data_6ESF
# 
_entry.id   6ESF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6ESF         
WWPDB D_1200007181 
EMDB  EMD-3947     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Nucleosome : Class 1' 
_pdbx_database_related.db_id          EMD-3947 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6ESF 
_pdbx_database_status.recvd_initial_deposition_date   2017-10-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bilokapic, S.' 1 ? 
'Halic, M.'     2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat. Struct. Mol. Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                101 
_citation.page_last                 108 
_citation.title                     'Histone octamer rearranges to adapt to DNA unwrapping.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41594-017-0005-5 
_citation.pdbx_database_id_PubMed   29323273 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bilokapic, S.' 1 ? 
primary 'Strauss, M.'   2 ? 
primary 'Halic, M.'     3 ? 
# 
_cell.angle_alpha                  90.0 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.0 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.0 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6ESF 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.0 
_cell.length_a_esd                 ? 
_cell.length_b                     1.0 
_cell.length_b_esd                 ? 
_cell.length_c                     1.0 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6ESF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Histone H3.2'    15303.930 2 ? ? ? ? 
2 polymer man 'Histone H4'      11263.231 2 ? ? ? ? 
3 polymer man 'Histone H2A'     13978.241 2 ? ? ? ? 
4 polymer man 'Histone H2B 1.1' 13524.752 2 ? ? ? ? 
5 polymer man 'DNA (147-MER)'   45604.047 1 ? ? ? ? 
6 polymer man 'DNA (147-MER)'   45145.754 1 ? ? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DC)(DA)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)
(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)
(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)
(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)
(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)
(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)
(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)
(DT)(DC)(DT)(DC)(DC)(DA)(DG)
;
;ACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTA
CGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAG
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)
(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)
(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)
(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)
(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)
(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)
(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)
(DA)(DT)(DC)(DC)(DT)(DG)(DT)
;
;CTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCC
CCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 ALA n 
3 127 LYS n 
3 128 SER n 
3 129 LYS n 
4 1   ALA n 
4 2   LYS n 
4 3   SER n 
4 4   ALA n 
4 5   PRO n 
4 6   ALA n 
4 7   PRO n 
4 8   LYS n 
4 9   LYS n 
4 10  GLY n 
4 11  SER n 
4 12  LYS n 
4 13  LYS n 
4 14  ALA n 
4 15  VAL n 
4 16  THR n 
4 17  LYS n 
4 18  THR n 
4 19  GLN n 
4 20  LYS n 
4 21  LYS n 
4 22  ASP n 
4 23  GLY n 
4 24  LYS n 
4 25  LYS n 
4 26  ARG n 
4 27  ARG n 
4 28  LYS n 
4 29  THR n 
4 30  ARG n 
4 31  LYS n 
4 32  GLU n 
4 33  SER n 
4 34  TYR n 
4 35  ALA n 
4 36  ILE n 
4 37  TYR n 
4 38  VAL n 
4 39  TYR n 
4 40  LYS n 
4 41  VAL n 
4 42  LEU n 
4 43  LYS n 
4 44  GLN n 
4 45  VAL n 
4 46  HIS n 
4 47  PRO n 
4 48  ASP n 
4 49  THR n 
4 50  GLY n 
4 51  ILE n 
4 52  SER n 
4 53  SER n 
4 54  LYS n 
4 55  ALA n 
4 56  MET n 
4 57  SER n 
4 58  ILE n 
4 59  MET n 
4 60  ASN n 
4 61  SER n 
4 62  PHE n 
4 63  VAL n 
4 64  ASN n 
4 65  ASP n 
4 66  VAL n 
4 67  PHE n 
4 68  GLU n 
4 69  ARG n 
4 70  ILE n 
4 71  ALA n 
4 72  GLY n 
4 73  GLU n 
4 74  ALA n 
4 75  SER n 
4 76  ARG n 
4 77  LEU n 
4 78  ALA n 
4 79  HIS n 
4 80  TYR n 
4 81  ASN n 
4 82  LYS n 
4 83  ARG n 
4 84  SER n 
4 85  THR n 
4 86  ILE n 
4 87  THR n 
4 88  SER n 
4 89  ARG n 
4 90  GLU n 
4 91  ILE n 
4 92  GLN n 
4 93  THR n 
4 94  ALA n 
4 95  VAL n 
4 96  ARG n 
4 97  LEU n 
4 98  LEU n 
4 99  LEU n 
4 100 PRO n 
4 101 GLY n 
4 102 GLU n 
4 103 LEU n 
4 104 ALA n 
4 105 LYS n 
4 106 HIS n 
4 107 ALA n 
4 108 VAL n 
4 109 SER n 
4 110 GLU n 
4 111 GLY n 
4 112 THR n 
4 113 LYS n 
4 114 ALA n 
4 115 VAL n 
4 116 THR n 
4 117 LYS n 
4 118 TYR n 
4 119 THR n 
4 120 SER n 
4 121 ALA n 
4 122 LYS n 
5 1   DA  n 
5 2   DC  n 
5 3   DA  n 
5 4   DG  n 
5 5   DG  n 
5 6   DA  n 
5 7   DT  n 
5 8   DG  n 
5 9   DT  n 
5 10  DA  n 
5 11  DT  n 
5 12  DA  n 
5 13  DT  n 
5 14  DA  n 
5 15  DT  n 
5 16  DC  n 
5 17  DT  n 
5 18  DG  n 
5 19  DA  n 
5 20  DC  n 
5 21  DA  n 
5 22  DC  n 
5 23  DG  n 
5 24  DT  n 
5 25  DG  n 
5 26  DC  n 
5 27  DC  n 
5 28  DT  n 
5 29  DG  n 
5 30  DG  n 
5 31  DA  n 
5 32  DG  n 
5 33  DA  n 
5 34  DC  n 
5 35  DT  n 
5 36  DA  n 
5 37  DG  n 
5 38  DG  n 
5 39  DG  n 
5 40  DA  n 
5 41  DG  n 
5 42  DT  n 
5 43  DA  n 
5 44  DA  n 
5 45  DT  n 
5 46  DC  n 
5 47  DC  n 
5 48  DC  n 
5 49  DC  n 
5 50  DT  n 
5 51  DT  n 
5 52  DG  n 
5 53  DG  n 
5 54  DC  n 
5 55  DG  n 
5 56  DG  n 
5 57  DT  n 
5 58  DT  n 
5 59  DA  n 
5 60  DA  n 
5 61  DA  n 
5 62  DA  n 
5 63  DC  n 
5 64  DG  n 
5 65  DC  n 
5 66  DG  n 
5 67  DG  n 
5 68  DG  n 
5 69  DG  n 
5 70  DG  n 
5 71  DA  n 
5 72  DC  n 
5 73  DA  n 
5 74  DG  n 
5 75  DC  n 
5 76  DG  n 
5 77  DC  n 
5 78  DG  n 
5 79  DT  n 
5 80  DA  n 
5 81  DC  n 
5 82  DG  n 
5 83  DT  n 
5 84  DG  n 
5 85  DC  n 
5 86  DG  n 
5 87  DT  n 
5 88  DT  n 
5 89  DT  n 
5 90  DA  n 
5 91  DA  n 
5 92  DG  n 
5 93  DC  n 
5 94  DG  n 
5 95  DG  n 
5 96  DT  n 
5 97  DG  n 
5 98  DC  n 
5 99  DT  n 
5 100 DA  n 
5 101 DG  n 
5 102 DA  n 
5 103 DG  n 
5 104 DC  n 
5 105 DT  n 
5 106 DG  n 
5 107 DT  n 
5 108 DC  n 
5 109 DT  n 
5 110 DA  n 
5 111 DC  n 
5 112 DG  n 
5 113 DA  n 
5 114 DC  n 
5 115 DC  n 
5 116 DA  n 
5 117 DA  n 
5 118 DT  n 
5 119 DT  n 
5 120 DG  n 
5 121 DA  n 
5 122 DG  n 
5 123 DC  n 
5 124 DG  n 
5 125 DG  n 
5 126 DC  n 
5 127 DC  n 
5 128 DT  n 
5 129 DC  n 
5 130 DG  n 
5 131 DG  n 
5 132 DC  n 
5 133 DA  n 
5 134 DC  n 
5 135 DC  n 
5 136 DG  n 
5 137 DG  n 
5 138 DG  n 
5 139 DA  n 
5 140 DT  n 
5 141 DT  n 
5 142 DC  n 
5 143 DT  n 
5 144 DC  n 
5 145 DC  n 
5 146 DA  n 
5 147 DG  n 
6 1   DC  n 
6 2   DT  n 
6 3   DG  n 
6 4   DG  n 
6 5   DA  n 
6 6   DG  n 
6 7   DA  n 
6 8   DA  n 
6 9   DT  n 
6 10  DC  n 
6 11  DC  n 
6 12  DC  n 
6 13  DG  n 
6 14  DG  n 
6 15  DT  n 
6 16  DG  n 
6 17  DC  n 
6 18  DC  n 
6 19  DG  n 
6 20  DA  n 
6 21  DG  n 
6 22  DG  n 
6 23  DC  n 
6 24  DC  n 
6 25  DG  n 
6 26  DC  n 
6 27  DT  n 
6 28  DC  n 
6 29  DA  n 
6 30  DA  n 
6 31  DT  n 
6 32  DT  n 
6 33  DG  n 
6 34  DG  n 
6 35  DT  n 
6 36  DC  n 
6 37  DG  n 
6 38  DT  n 
6 39  DA  n 
6 40  DG  n 
6 41  DA  n 
6 42  DC  n 
6 43  DA  n 
6 44  DG  n 
6 45  DC  n 
6 46  DT  n 
6 47  DC  n 
6 48  DT  n 
6 49  DA  n 
6 50  DG  n 
6 51  DC  n 
6 52  DA  n 
6 53  DC  n 
6 54  DC  n 
6 55  DG  n 
6 56  DC  n 
6 57  DT  n 
6 58  DT  n 
6 59  DA  n 
6 60  DA  n 
6 61  DA  n 
6 62  DC  n 
6 63  DG  n 
6 64  DC  n 
6 65  DA  n 
6 66  DC  n 
6 67  DG  n 
6 68  DT  n 
6 69  DA  n 
6 70  DC  n 
6 71  DG  n 
6 72  DC  n 
6 73  DG  n 
6 74  DC  n 
6 75  DT  n 
6 76  DG  n 
6 77  DT  n 
6 78  DC  n 
6 79  DC  n 
6 80  DC  n 
6 81  DC  n 
6 82  DC  n 
6 83  DG  n 
6 84  DC  n 
6 85  DG  n 
6 86  DT  n 
6 87  DT  n 
6 88  DT  n 
6 89  DT  n 
6 90  DA  n 
6 91  DA  n 
6 92  DC  n 
6 93  DC  n 
6 94  DG  n 
6 95  DC  n 
6 96  DC  n 
6 97  DA  n 
6 98  DA  n 
6 99  DG  n 
6 100 DG  n 
6 101 DG  n 
6 102 DG  n 
6 103 DA  n 
6 104 DT  n 
6 105 DT  n 
6 106 DA  n 
6 107 DC  n 
6 108 DT  n 
6 109 DC  n 
6 110 DC  n 
6 111 DC  n 
6 112 DT  n 
6 113 DA  n 
6 114 DG  n 
6 115 DT  n 
6 116 DC  n 
6 117 DT  n 
6 118 DC  n 
6 119 DC  n 
6 120 DA  n 
6 121 DG  n 
6 122 DG  n 
6 123 DC  n 
6 124 DA  n 
6 125 DC  n 
6 126 DG  n 
6 127 DT  n 
6 128 DG  n 
6 129 DT  n 
6 130 DC  n 
6 131 DA  n 
6 132 DG  n 
6 133 DA  n 
6 134 DT  n 
6 135 DA  n 
6 136 DT  n 
6 137 DA  n 
6 138 DT  n 
6 139 DA  n 
6 140 DC  n 
6 141 DA  n 
6 142 DT  n 
6 143 DC  n 
6 144 DC  n 
6 145 DT  n 
6 146 DG  n 
6 147 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 135 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis'      8355  ? ? 
? ? ? ? ? ? 'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 102 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis'      8355  ? ? 
? ? ? ? ? ? 'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 129 'African clawed frog' ? 'hist1h2aj, LOC494591' ? ? ? ? ? ? 'Xenopus laevis'      8355  ? ? 
? ? ? ? ? ? 'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 122 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis'      8355  ? ? 
? ? ? ? ? ? 'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 147 ?                     ? ?                      ? ? ? ? ? ? 'synthetic construct' 32630 ? ? 
? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 147 ?                     ? ?                      ? ? ? ? ? ? 'synthetic construct' 32630 ? ? 
? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H32_XENLA    P84233 ? 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 
2 UNP H4_XENLA     P62799 ? 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 
3 UNP Q6AZJ8_XENLA Q6AZJ8 ? 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2 
4 UNP H2B11_XENLA  P02281 ? 4 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5 
5 PDB 6ESF         6ESF   ? 5 ? 1 
6 PDB 6ESF         6ESF   ? 6 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6ESF A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 6ESF B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 6ESF C 1 ? 129 ? Q6AZJ8 2   ? 130 ? 1   129 
4  4 6ESF D 1 ? 122 ? P02281 5   ? 126 ? 1   122 
5  1 6ESF E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 6ESF F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 6ESF G 1 ? 129 ? Q6AZJ8 2   ? 130 ? 1   129 
8  4 6ESF H 1 ? 122 ? P02281 5   ? 126 ? 1   122 
9  5 6ESF I 1 ? 147 ? 6ESF   -73 ? 73  ? -73 73  
10 6 6ESF J 1 ? 147 ? 6ESF   -73 ? 73  ? -73 73  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6ESF ALA A 102 ? UNP P84233 GLY 103 variant 102 1 
4 6ESF THR D 29  ? UNP P02281 SER 33  variant 29  2 
5 6ESF ALA E 102 ? UNP P84233 GLY 103 variant 102 3 
8 6ESF THR H 29  ? UNP P02281 SER 33  variant 29  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6ESF 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 6ESF 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            . 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.008  ? 12906 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.961  ? 18692 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 24.975 ? 6752  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.052  ? 2130  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.007  ? 1345  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6ESF 
_struct.title                        'Nucleosome : Class 1' 
_struct.pdbx_descriptor              'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6ESF 
_struct_keywords.text            'nucleosome, nucleosome breathing, hexasome, GENE REGULATION' 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  AA2 ARG A 63  ? LYS A 79  ? ARG A 63  LYS A 79  1 ? 17 
HELX_P HELX_P3  AA3 GLN A 85  ? HIS A 113 ? GLN A 85  HIS A 113 1 ? 29 
HELX_P HELX_P4  AA4 MET A 120 ? ARG A 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  AA5 ASN B 25  ? ILE B 29  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  AA6 THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  AA9 PRO C 26  ? LYS C 36  ? PRO C 26  LYS C 36  1 ? 11 
HELX_P HELX_P10 AB1 GLY C 46  ? ASP C 72  ? GLY C 46  ASP C 72  1 ? 27 
HELX_P HELX_P11 AB2 ILE C 79  ? ASP C 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P12 AB3 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P13 AB4 TYR D 34  ? HIS D 46  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P14 AB5 SER D 52  ? HIS D 79  ? SER D 52  HIS D 79  1 ? 28 
HELX_P HELX_P15 AB6 THR D 87  ? LEU D 99  ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P16 AB7 GLY D 101 ? SER D 120 ? GLY D 101 SER D 120 1 ? 20 
HELX_P HELX_P17 AB8 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P18 AB9 ARG E 63  ? GLN E 76  ? ARG E 63  GLN E 76  1 ? 14 
HELX_P HELX_P19 AC1 GLN E 85  ? HIS E 113 ? GLN E 85  HIS E 113 1 ? 29 
HELX_P HELX_P20 AC2 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P21 AC3 ASN F 25  ? ILE F 29  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P22 AC4 THR F 30  ? GLY F 42  ? THR F 30  GLY F 42  1 ? 13 
HELX_P HELX_P23 AC5 LEU F 49  ? HIS F 75  ? LEU F 49  HIS F 75  1 ? 27 
HELX_P HELX_P24 AC6 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P25 AC7 ARG G 17  ? GLY G 22  ? ARG G 17  GLY G 22  1 ? 6  
HELX_P HELX_P26 AC8 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P27 AC9 GLY G 46  ? ASP G 72  ? GLY G 46  ASP G 72  1 ? 27 
HELX_P HELX_P28 AD1 ILE G 79  ? ARG G 88  ? ILE G 79  ARG G 88  1 ? 10 
HELX_P HELX_P29 AD2 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P30 AD3 TYR H 34  ? HIS H 46  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P31 AD4 SER H 52  ? ASN H 81  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P32 AD5 THR H 87  ? LEU H 99  ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P33 AD6 GLY H 101 ? SER H 120 ? GLY H 101 SER H 120 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? I DA 1   N1 ? ? ? 1_555 J DT 147 N3 ? ? I DA -73 J DT 73  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2   hydrog ? ? I DA 1   N6 ? ? ? 1_555 J DT 147 O4 ? ? I DA -73 J DT 73  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3   hydrog ? ? I DC 2   N3 ? ? ? 1_555 J DG 146 N1 ? ? I DC -72 J DG 72  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4   hydrog ? ? I DC 2   N4 ? ? ? 1_555 J DG 146 O6 ? ? I DC -72 J DG 72  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5   hydrog ? ? I DC 2   O2 ? ? ? 1_555 J DG 146 N2 ? ? I DC -72 J DG 72  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6   hydrog ? ? I DA 3   N1 ? ? ? 1_555 J DT 145 N3 ? ? I DA -71 J DT 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7   hydrog ? ? I DA 3   N6 ? ? ? 1_555 J DT 145 O4 ? ? I DA -71 J DT 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8   hydrog ? ? I DG 4   N1 ? ? ? 1_555 J DC 144 N3 ? ? I DG -70 J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9   hydrog ? ? I DG 4   N2 ? ? ? 1_555 J DC 144 O2 ? ? I DG -70 J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10  hydrog ? ? I DG 4   O6 ? ? ? 1_555 J DC 144 N4 ? ? I DG -70 J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11  hydrog ? ? I DG 5   N1 ? ? ? 1_555 J DC 143 N3 ? ? I DG -69 J DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12  hydrog ? ? I DG 5   N2 ? ? ? 1_555 J DC 143 O2 ? ? I DG -69 J DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13  hydrog ? ? I DG 5   O6 ? ? ? 1_555 J DC 143 N4 ? ? I DG -69 J DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14  hydrog ? ? I DA 6   N1 ? ? ? 1_555 J DT 142 N3 ? ? I DA -68 J DT 68  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog15  hydrog ? ? I DA 6   N1 ? ? ? 1_555 J DC 143 N4 ? ? I DA -68 J DC 69  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ? ? 
hydrog16  hydrog ? ? I DT 7   N3 ? ? ? 1_555 J DA 141 N1 ? ? I DT -67 J DA 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17  hydrog ? ? I DT 7   O4 ? ? ? 1_555 J DA 141 N6 ? ? I DT -67 J DA 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18  hydrog ? ? I DG 8   N2 ? ? ? 1_555 J DC 140 O2 ? ? I DG -66 J DC 66  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog19  hydrog ? ? I DT 9   N3 ? ? ? 1_555 J DA 139 N1 ? ? I DT -65 J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20  hydrog ? ? I DT 9   O4 ? ? ? 1_555 J DA 139 N6 ? ? I DT -65 J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21  hydrog ? ? I DA 10  N1 ? ? ? 1_555 J DT 138 N3 ? ? I DA -64 J DT 64  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22  hydrog ? ? I DA 10  N6 ? ? ? 1_555 J DT 138 O4 ? ? I DA -64 J DT 64  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23  hydrog ? ? I DT 11  N3 ? ? ? 1_555 J DA 137 N1 ? ? I DT -63 J DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24  hydrog ? ? I DT 11  O4 ? ? ? 1_555 J DA 137 N6 ? ? I DT -63 J DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25  hydrog ? ? I DA 12  N1 ? ? ? 1_555 J DT 136 N3 ? ? I DA -62 J DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26  hydrog ? ? I DA 12  N6 ? ? ? 1_555 J DT 136 O4 ? ? I DA -62 J DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27  hydrog ? ? I DT 13  N3 ? ? ? 1_555 J DA 135 N1 ? ? I DT -61 J DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28  hydrog ? ? I DT 13  O4 ? ? ? 1_555 J DA 135 N6 ? ? I DT -61 J DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29  hydrog ? ? I DA 14  N1 ? ? ? 1_555 J DT 134 N3 ? ? I DA -60 J DT 60  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30  hydrog ? ? I DA 14  N6 ? ? ? 1_555 J DT 134 O4 ? ? I DA -60 J DT 60  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31  hydrog ? ? I DT 15  N3 ? ? ? 1_555 J DA 133 N1 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32  hydrog ? ? I DT 15  O4 ? ? ? 1_555 J DA 133 N6 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33  hydrog ? ? I DC 16  N3 ? ? ? 1_555 J DG 132 N1 ? ? I DC -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34  hydrog ? ? I DC 16  N4 ? ? ? 1_555 J DG 132 O6 ? ? I DC -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35  hydrog ? ? I DC 16  O2 ? ? ? 1_555 J DG 132 N2 ? ? I DC -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36  hydrog ? ? I DT 17  N3 ? ? ? 1_555 J DA 131 N1 ? ? I DT -57 J DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37  hydrog ? ? I DT 17  O4 ? ? ? 1_555 J DA 131 N6 ? ? I DT -57 J DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38  hydrog ? ? I DG 18  N1 ? ? ? 1_555 J DC 130 N3 ? ? I DG -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39  hydrog ? ? I DG 18  N2 ? ? ? 1_555 J DC 130 O2 ? ? I DG -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40  hydrog ? ? I DG 18  O6 ? ? ? 1_555 J DC 130 N4 ? ? I DG -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41  hydrog ? ? I DA 19  N1 ? ? ? 1_555 J DT 129 N3 ? ? I DA -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42  hydrog ? ? I DA 19  N6 ? ? ? 1_555 J DT 129 O4 ? ? I DA -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43  hydrog ? ? I DC 20  N3 ? ? ? 1_555 J DG 128 N1 ? ? I DC -54 J DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44  hydrog ? ? I DC 20  N4 ? ? ? 1_555 J DG 128 O6 ? ? I DC -54 J DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45  hydrog ? ? I DC 20  O2 ? ? ? 1_555 J DG 128 N2 ? ? I DC -54 J DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog46  hydrog ? ? I DA 21  N1 ? ? ? 1_555 J DT 127 N3 ? ? I DA -53 J DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog47  hydrog ? ? I DA 21  N6 ? ? ? 1_555 J DT 127 O4 ? ? I DA -53 J DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48  hydrog ? ? I DC 22  N3 ? ? ? 1_555 J DG 126 N1 ? ? I DC -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49  hydrog ? ? I DC 22  N4 ? ? ? 1_555 J DG 126 O6 ? ? I DC -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50  hydrog ? ? I DC 22  O2 ? ? ? 1_555 J DG 126 N2 ? ? I DC -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51  hydrog ? ? I DG 23  N1 ? ? ? 1_555 J DC 125 N3 ? ? I DG -51 J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52  hydrog ? ? I DG 23  N2 ? ? ? 1_555 J DC 125 O2 ? ? I DG -51 J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53  hydrog ? ? I DG 23  O6 ? ? ? 1_555 J DC 125 N4 ? ? I DG -51 J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54  hydrog ? ? I DT 24  N3 ? ? ? 1_555 J DA 124 N1 ? ? I DT -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55  hydrog ? ? I DT 24  O4 ? ? ? 1_555 J DA 124 N6 ? ? I DT -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56  hydrog ? ? I DG 25  N1 ? ? ? 1_555 J DC 123 N3 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57  hydrog ? ? I DG 25  N2 ? ? ? 1_555 J DC 123 O2 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58  hydrog ? ? I DG 25  O6 ? ? ? 1_555 J DC 123 N4 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59  hydrog ? ? I DC 26  N3 ? ? ? 1_555 J DG 122 N1 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60  hydrog ? ? I DC 26  N4 ? ? ? 1_555 J DG 122 O6 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61  hydrog ? ? I DC 26  O2 ? ? ? 1_555 J DG 122 N2 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62  hydrog ? ? I DC 27  N3 ? ? ? 1_555 J DG 121 N1 ? ? I DC -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog63  hydrog ? ? I DC 27  N4 ? ? ? 1_555 J DG 121 O6 ? ? I DC -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64  hydrog ? ? I DC 27  O2 ? ? ? 1_555 J DG 121 N2 ? ? I DC -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog65  hydrog ? ? I DT 28  N3 ? ? ? 1_555 J DA 120 N1 ? ? I DT -46 J DA 46  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66  hydrog ? ? I DT 28  O4 ? ? ? 1_555 J DA 120 N6 ? ? I DT -46 J DA 46  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67  hydrog ? ? I DG 29  N1 ? ? ? 1_555 J DC 119 N3 ? ? I DG -45 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68  hydrog ? ? I DG 29  N2 ? ? ? 1_555 J DC 119 O2 ? ? I DG -45 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69  hydrog ? ? I DG 29  O6 ? ? ? 1_555 J DC 119 N4 ? ? I DG -45 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70  hydrog ? ? I DG 30  N1 ? ? ? 1_555 J DC 118 N3 ? ? I DG -44 J DC 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog71  hydrog ? ? I DG 30  N2 ? ? ? 1_555 J DC 118 O2 ? ? I DG -44 J DC 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72  hydrog ? ? I DG 30  O6 ? ? ? 1_555 J DC 118 N4 ? ? I DG -44 J DC 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73  hydrog ? ? I DA 31  N1 ? ? ? 1_555 J DT 117 N3 ? ? I DA -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog74  hydrog ? ? I DA 31  N6 ? ? ? 1_555 J DT 117 O4 ? ? I DA -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog75  hydrog ? ? I DG 32  N1 ? ? ? 1_555 J DC 116 N3 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76  hydrog ? ? I DG 32  N2 ? ? ? 1_555 J DC 116 O2 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog77  hydrog ? ? I DG 32  O6 ? ? ? 1_555 J DC 116 N4 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog78  hydrog ? ? I DA 33  N1 ? ? ? 1_555 J DG 114 N1 ? ? I DA -41 J DG 40  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog79  hydrog ? ? I DA 33  N6 ? ? ? 1_555 J DG 114 O6 ? ? I DA -41 J DG 40  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog80  hydrog ? ? I DA 33  N1 ? ? ? 1_555 J DT 115 N3 ? ? I DA -41 J DT 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog81  hydrog ? ? I DA 33  N6 ? ? ? 1_555 J DT 115 O4 ? ? I DA -41 J DT 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog82  hydrog ? ? I DC 34  N3 ? ? ? 1_555 J DG 114 N1 ? ? I DC -40 J DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog83  hydrog ? ? I DC 34  N4 ? ? ? 1_555 J DG 114 O6 ? ? I DC -40 J DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog84  hydrog ? ? I DC 34  O2 ? ? ? 1_555 J DG 114 N2 ? ? I DC -40 J DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog85  hydrog ? ? I DT 35  N3 ? ? ? 1_555 J DA 113 N1 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog86  hydrog ? ? I DT 35  O4 ? ? ? 1_555 J DA 113 N6 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog87  hydrog ? ? I DA 36  N1 ? ? ? 1_555 J DT 112 N3 ? ? I DA -38 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog88  hydrog ? ? I DA 36  N6 ? ? ? 1_555 J DT 112 O4 ? ? I DA -38 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog89  hydrog ? ? I DG 37  N1 ? ? ? 1_555 J DC 111 N3 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog90  hydrog ? ? I DG 37  N2 ? ? ? 1_555 J DC 111 O2 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog91  hydrog ? ? I DG 37  O6 ? ? ? 1_555 J DC 111 N4 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92  hydrog ? ? I DG 38  N1 ? ? ? 1_555 J DC 110 N3 ? ? I DG -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93  hydrog ? ? I DG 38  N2 ? ? ? 1_555 J DC 110 O2 ? ? I DG -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog94  hydrog ? ? I DG 38  O6 ? ? ? 1_555 J DC 110 N4 ? ? I DG -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog95  hydrog ? ? I DG 39  N1 ? ? ? 1_555 J DC 109 N3 ? ? I DG -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog96  hydrog ? ? I DG 39  N2 ? ? ? 1_555 J DC 109 O2 ? ? I DG -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog97  hydrog ? ? I DG 39  O6 ? ? ? 1_555 J DC 109 N4 ? ? I DG -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog98  hydrog ? ? I DA 40  N1 ? ? ? 1_555 J DT 108 N3 ? ? I DA -34 J DT 34  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog99  hydrog ? ? I DA 40  N6 ? ? ? 1_555 J DT 108 O4 ? ? I DA -34 J DT 34  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog100 hydrog ? ? I DG 41  N1 ? ? ? 1_555 J DC 107 N3 ? ? I DG -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog101 hydrog ? ? I DG 41  N2 ? ? ? 1_555 J DC 107 O2 ? ? I DG -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog102 hydrog ? ? I DG 41  O6 ? ? ? 1_555 J DC 107 N4 ? ? I DG -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog103 hydrog ? ? I DT 42  N3 ? ? ? 1_555 J DA 106 N1 ? ? I DT -32 J DA 32  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog104 hydrog ? ? I DT 42  O4 ? ? ? 1_555 J DA 106 N6 ? ? I DT -32 J DA 32  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog105 hydrog ? ? I DA 43  N1 ? ? ? 1_555 J DT 105 N3 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog106 hydrog ? ? I DA 43  N6 ? ? ? 1_555 J DT 105 O4 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog107 hydrog ? ? I DA 44  N1 ? ? ? 1_555 J DT 104 N3 ? ? I DA -30 J DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog108 hydrog ? ? I DA 44  N6 ? ? ? 1_555 J DT 104 O4 ? ? I DA -30 J DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog109 hydrog ? ? I DT 45  N3 ? ? ? 1_555 J DA 103 N1 ? ? I DT -29 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog110 hydrog ? ? I DT 45  O4 ? ? ? 1_555 J DA 103 N6 ? ? I DT -29 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog111 hydrog ? ? I DC 46  N3 ? ? ? 1_555 J DG 102 N1 ? ? I DC -28 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog112 hydrog ? ? I DC 46  N4 ? ? ? 1_555 J DG 102 O6 ? ? I DC -28 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog113 hydrog ? ? I DC 46  O2 ? ? ? 1_555 J DG 102 N2 ? ? I DC -28 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog114 hydrog ? ? I DC 47  N3 ? ? ? 1_555 J DG 101 N1 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog115 hydrog ? ? I DC 47  N4 ? ? ? 1_555 J DG 101 O6 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog116 hydrog ? ? I DC 47  O2 ? ? ? 1_555 J DG 101 N2 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog117 hydrog ? ? I DC 48  N3 ? ? ? 1_555 J DG 100 N1 ? ? I DC -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog118 hydrog ? ? I DC 48  N4 ? ? ? 1_555 J DG 100 O6 ? ? I DC -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog119 hydrog ? ? I DC 48  O2 ? ? ? 1_555 J DG 100 N2 ? ? I DC -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog120 hydrog ? ? I DC 49  N3 ? ? ? 1_555 J DG 99  N1 ? ? I DC -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog121 hydrog ? ? I DC 49  N4 ? ? ? 1_555 J DG 99  O6 ? ? I DC -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog122 hydrog ? ? I DC 49  O2 ? ? ? 1_555 J DG 99  N2 ? ? I DC -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog123 hydrog ? ? I DT 50  N3 ? ? ? 1_555 J DA 98  N1 ? ? I DT -24 J DA 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog124 hydrog ? ? I DT 50  O4 ? ? ? 1_555 J DA 98  N6 ? ? I DT -24 J DA 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog125 hydrog ? ? I DT 51  N3 ? ? ? 1_555 J DA 97  N1 ? ? I DT -23 J DA 23  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog126 hydrog ? ? I DT 51  O4 ? ? ? 1_555 J DA 97  N6 ? ? I DT -23 J DA 23  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog127 hydrog ? ? I DG 52  N1 ? ? ? 1_555 J DC 96  N3 ? ? I DG -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog128 hydrog ? ? I DG 52  N2 ? ? ? 1_555 J DC 96  O2 ? ? I DG -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog129 hydrog ? ? I DG 52  O6 ? ? ? 1_555 J DC 96  N4 ? ? I DG -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog130 hydrog ? ? I DG 53  N1 ? ? ? 1_555 J DC 95  N3 ? ? I DG -21 J DC 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog131 hydrog ? ? I DG 53  N2 ? ? ? 1_555 J DC 95  O2 ? ? I DG -21 J DC 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog132 hydrog ? ? I DG 53  O6 ? ? ? 1_555 J DC 95  N4 ? ? I DG -21 J DC 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog133 hydrog ? ? I DG 53  N1 ? ? ? 1_555 J DC 96  N3 ? ? I DG -21 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog134 hydrog ? ? I DG 53  N2 ? ? ? 1_555 J DC 96  O2 ? ? I DG -21 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog135 hydrog ? ? I DG 53  O6 ? ? ? 1_555 J DC 96  N4 ? ? I DG -21 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog136 hydrog ? ? I DC 54  N3 ? ? ? 1_555 J DG 94  N1 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog137 hydrog ? ? I DC 54  N4 ? ? ? 1_555 J DG 94  O6 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog138 hydrog ? ? I DC 54  O2 ? ? ? 1_555 J DG 94  N2 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog139 hydrog ? ? I DG 55  N1 ? ? ? 1_555 J DC 93  N3 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog140 hydrog ? ? I DG 55  N2 ? ? ? 1_555 J DC 93  O2 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog141 hydrog ? ? I DG 55  O6 ? ? ? 1_555 J DC 93  N4 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog142 hydrog ? ? I DG 56  N1 ? ? ? 1_555 J DC 92  N3 ? ? I DG -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog143 hydrog ? ? I DG 56  N2 ? ? ? 1_555 J DC 92  O2 ? ? I DG -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog144 hydrog ? ? I DG 56  O6 ? ? ? 1_555 J DC 92  N4 ? ? I DG -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog145 hydrog ? ? I DT 57  N3 ? ? ? 1_555 J DA 91  N1 ? ? I DT -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog146 hydrog ? ? I DT 57  O4 ? ? ? 1_555 J DA 91  N6 ? ? I DT -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog147 hydrog ? ? I DT 58  N3 ? ? ? 1_555 J DA 90  N1 ? ? I DT -16 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog148 hydrog ? ? I DT 58  O4 ? ? ? 1_555 J DA 90  N6 ? ? I DT -16 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog149 hydrog ? ? I DA 59  N1 ? ? ? 1_555 J DT 89  N3 ? ? I DA -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog150 hydrog ? ? I DA 59  N6 ? ? ? 1_555 J DT 89  O4 ? ? I DA -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog151 hydrog ? ? I DA 60  N1 ? ? ? 1_555 J DT 88  N3 ? ? I DA -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog152 hydrog ? ? I DA 60  N6 ? ? ? 1_555 J DT 88  O4 ? ? I DA -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog153 hydrog ? ? I DA 61  N1 ? ? ? 1_555 J DT 87  N3 ? ? I DA -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog154 hydrog ? ? I DA 61  N6 ? ? ? 1_555 J DT 87  O4 ? ? I DA -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog155 hydrog ? ? I DA 62  N1 ? ? ? 1_555 J DT 86  N3 ? ? I DA -12 J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog156 hydrog ? ? I DA 62  N6 ? ? ? 1_555 J DT 86  O4 ? ? I DA -12 J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog157 hydrog ? ? I DC 63  N3 ? ? ? 1_555 J DG 85  N1 ? ? I DC -11 J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog158 hydrog ? ? I DC 63  N4 ? ? ? 1_555 J DG 85  O6 ? ? I DC -11 J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog159 hydrog ? ? I DC 63  O2 ? ? ? 1_555 J DG 85  N2 ? ? I DC -11 J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog160 hydrog ? ? I DG 64  N1 ? ? ? 1_555 J DC 84  N3 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog161 hydrog ? ? I DG 64  N2 ? ? ? 1_555 J DC 84  O2 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog162 hydrog ? ? I DG 64  O6 ? ? ? 1_555 J DC 84  N4 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog163 hydrog ? ? I DC 65  N3 ? ? ? 1_555 J DG 83  N1 ? ? I DC -9  J DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog164 hydrog ? ? I DC 65  N4 ? ? ? 1_555 J DG 83  O6 ? ? I DC -9  J DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog165 hydrog ? ? I DC 65  O2 ? ? ? 1_555 J DG 83  N2 ? ? I DC -9  J DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog166 hydrog ? ? I DG 66  N1 ? ? ? 1_555 J DC 82  N3 ? ? I DG -8  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog167 hydrog ? ? I DG 66  N2 ? ? ? 1_555 J DC 82  O2 ? ? I DG -8  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog168 hydrog ? ? I DG 66  O6 ? ? ? 1_555 J DC 82  N4 ? ? I DG -8  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog169 hydrog ? ? I DG 67  N1 ? ? ? 1_555 J DC 81  N3 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog170 hydrog ? ? I DG 67  N2 ? ? ? 1_555 J DC 81  O2 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog171 hydrog ? ? I DG 67  O6 ? ? ? 1_555 J DC 81  N4 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog172 hydrog ? ? I DG 68  N1 ? ? ? 1_555 J DC 80  N3 ? ? I DG -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog173 hydrog ? ? I DG 68  N2 ? ? ? 1_555 J DC 80  O2 ? ? I DG -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog174 hydrog ? ? I DG 68  O6 ? ? ? 1_555 J DC 80  N4 ? ? I DG -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog175 hydrog ? ? I DG 69  N1 ? ? ? 1_555 J DC 79  N3 ? ? I DG -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog176 hydrog ? ? I DG 69  N2 ? ? ? 1_555 J DC 79  O2 ? ? I DG -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog177 hydrog ? ? I DG 69  O6 ? ? ? 1_555 J DC 79  N4 ? ? I DG -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog178 hydrog ? ? I DG 70  N1 ? ? ? 1_555 J DC 78  N3 ? ? I DG -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog179 hydrog ? ? I DG 70  N2 ? ? ? 1_555 J DC 78  O2 ? ? I DG -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog180 hydrog ? ? I DG 70  O6 ? ? ? 1_555 J DC 78  N4 ? ? I DG -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog181 hydrog ? ? I DA 71  N1 ? ? ? 1_555 J DT 77  N3 ? ? I DA -3  J DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog182 hydrog ? ? I DA 71  N6 ? ? ? 1_555 J DT 77  O4 ? ? I DA -3  J DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog183 hydrog ? ? I DC 72  N3 ? ? ? 1_555 J DG 76  N1 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog184 hydrog ? ? I DC 72  N4 ? ? ? 1_555 J DG 76  O6 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog185 hydrog ? ? I DC 72  O2 ? ? ? 1_555 J DG 76  N2 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog186 hydrog ? ? I DA 73  N1 ? ? ? 1_555 J DT 75  N3 ? ? I DA -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog187 hydrog ? ? I DA 73  N6 ? ? ? 1_555 J DT 75  O4 ? ? I DA -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog188 hydrog ? ? I DG 74  N1 ? ? ? 1_555 J DC 74  N3 ? ? I DG 0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog189 hydrog ? ? I DG 74  N2 ? ? ? 1_555 J DC 74  O2 ? ? I DG 0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog190 hydrog ? ? I DG 74  O6 ? ? ? 1_555 J DC 74  N4 ? ? I DG 0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog191 hydrog ? ? I DC 75  N3 ? ? ? 1_555 J DG 73  N1 ? ? I DC 1   J DG -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog192 hydrog ? ? I DC 75  N4 ? ? ? 1_555 J DG 73  O6 ? ? I DC 1   J DG -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog193 hydrog ? ? I DC 75  O2 ? ? ? 1_555 J DG 73  N2 ? ? I DC 1   J DG -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog194 hydrog ? ? I DG 76  N1 ? ? ? 1_555 J DC 72  N3 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog195 hydrog ? ? I DG 76  N2 ? ? ? 1_555 J DC 72  O2 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog196 hydrog ? ? I DG 76  O6 ? ? ? 1_555 J DC 72  N4 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog197 hydrog ? ? I DC 77  N3 ? ? ? 1_555 J DG 71  N1 ? ? I DC 3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog198 hydrog ? ? I DC 77  N4 ? ? ? 1_555 J DG 71  O6 ? ? I DC 3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog199 hydrog ? ? I DC 77  O2 ? ? ? 1_555 J DG 71  N2 ? ? I DC 3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog200 hydrog ? ? I DG 78  N1 ? ? ? 1_555 J DC 70  N3 ? ? I DG 4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog201 hydrog ? ? I DG 78  N2 ? ? ? 1_555 J DC 70  O2 ? ? I DG 4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog202 hydrog ? ? I DG 78  O6 ? ? ? 1_555 J DC 70  N4 ? ? I DG 4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog203 hydrog ? ? I DT 79  N3 ? ? ? 1_555 J DA 69  N1 ? ? I DT 5   J DA -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog204 hydrog ? ? I DT 79  O4 ? ? ? 1_555 J DA 69  N6 ? ? I DT 5   J DA -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog205 hydrog ? ? I DA 80  N1 ? ? ? 1_555 J DT 68  N3 ? ? I DA 6   J DT -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog206 hydrog ? ? I DA 80  N6 ? ? ? 1_555 J DT 68  O4 ? ? I DA 6   J DT -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog207 hydrog ? ? I DC 81  N3 ? ? ? 1_555 J DG 67  N1 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog208 hydrog ? ? I DC 81  N4 ? ? ? 1_555 J DG 67  O6 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog209 hydrog ? ? I DC 81  O2 ? ? ? 1_555 J DG 67  N2 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog210 hydrog ? ? I DG 82  N1 ? ? ? 1_555 J DC 66  N3 ? ? I DG 8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog211 hydrog ? ? I DG 82  N2 ? ? ? 1_555 J DC 66  O2 ? ? I DG 8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog212 hydrog ? ? I DG 82  O6 ? ? ? 1_555 J DC 66  N4 ? ? I DG 8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog213 hydrog ? ? I DT 83  N3 ? ? ? 1_555 J DA 65  N1 ? ? I DT 9   J DA -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog214 hydrog ? ? I DT 83  O4 ? ? ? 1_555 J DA 65  N6 ? ? I DT 9   J DA -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog215 hydrog ? ? I DG 84  N1 ? ? ? 1_555 J DC 64  N3 ? ? I DG 10  J DC -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog216 hydrog ? ? I DG 84  N2 ? ? ? 1_555 J DC 64  O2 ? ? I DG 10  J DC -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog217 hydrog ? ? I DG 84  O6 ? ? ? 1_555 J DC 64  N4 ? ? I DG 10  J DC -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog218 hydrog ? ? I DC 85  N3 ? ? ? 1_555 J DG 63  N1 ? ? I DC 11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog219 hydrog ? ? I DC 85  N4 ? ? ? 1_555 J DG 63  O6 ? ? I DC 11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog220 hydrog ? ? I DC 85  O2 ? ? ? 1_555 J DG 63  N2 ? ? I DC 11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog221 hydrog ? ? I DG 86  N1 ? ? ? 1_555 J DC 62  N3 ? ? I DG 12  J DC -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog222 hydrog ? ? I DG 86  N2 ? ? ? 1_555 J DC 62  O2 ? ? I DG 12  J DC -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog223 hydrog ? ? I DG 86  O6 ? ? ? 1_555 J DC 62  N4 ? ? I DG 12  J DC -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog224 hydrog ? ? I DT 87  N3 ? ? ? 1_555 J DA 61  N1 ? ? I DT 13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog225 hydrog ? ? I DT 87  O4 ? ? ? 1_555 J DA 61  N6 ? ? I DT 13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog226 hydrog ? ? I DT 88  N3 ? ? ? 1_555 J DA 60  N1 ? ? I DT 14  J DA -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog227 hydrog ? ? I DT 88  O4 ? ? ? 1_555 J DA 60  N6 ? ? I DT 14  J DA -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog228 hydrog ? ? I DT 89  N3 ? ? ? 1_555 J DA 59  N1 ? ? I DT 15  J DA -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog229 hydrog ? ? I DT 89  O4 ? ? ? 1_555 J DA 59  N6 ? ? I DT 15  J DA -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog230 hydrog ? ? I DA 90  N1 ? ? ? 1_555 J DT 58  N3 ? ? I DA 16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog231 hydrog ? ? I DA 90  N6 ? ? ? 1_555 J DT 58  O4 ? ? I DA 16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog232 hydrog ? ? I DA 91  N1 ? ? ? 1_555 J DT 57  N3 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog233 hydrog ? ? I DA 91  N6 ? ? ? 1_555 J DT 57  O4 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog234 hydrog ? ? I DG 92  N1 ? ? ? 1_555 J DC 56  N3 ? ? I DG 18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog235 hydrog ? ? I DG 92  N2 ? ? ? 1_555 J DC 56  O2 ? ? I DG 18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog236 hydrog ? ? I DG 92  O6 ? ? ? 1_555 J DC 56  N4 ? ? I DG 18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog237 hydrog ? ? I DC 93  N3 ? ? ? 1_555 J DG 55  N1 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog238 hydrog ? ? I DC 93  N4 ? ? ? 1_555 J DG 55  O6 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog239 hydrog ? ? I DC 93  O2 ? ? ? 1_555 J DG 55  N2 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog240 hydrog ? ? I DG 94  N1 ? ? ? 1_555 J DC 54  N3 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog241 hydrog ? ? I DG 94  N2 ? ? ? 1_555 J DC 54  O2 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog242 hydrog ? ? I DG 94  O6 ? ? ? 1_555 J DC 54  N4 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog243 hydrog ? ? I DG 95  N1 ? ? ? 1_555 J DC 53  N3 ? ? I DG 21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog244 hydrog ? ? I DG 95  N2 ? ? ? 1_555 J DC 53  O2 ? ? I DG 21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog245 hydrog ? ? I DG 95  O6 ? ? ? 1_555 J DC 53  N4 ? ? I DG 21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog246 hydrog ? ? I DT 96  N3 ? ? ? 1_555 J DA 52  N1 ? ? I DT 22  J DA -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog247 hydrog ? ? I DT 96  O4 ? ? ? 1_555 J DA 52  N6 ? ? I DT 22  J DA -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog248 hydrog ? ? I DG 97  N1 ? ? ? 1_555 J DC 51  N3 ? ? I DG 23  J DC -23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog249 hydrog ? ? I DG 97  N2 ? ? ? 1_555 J DC 51  O2 ? ? I DG 23  J DC -23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog250 hydrog ? ? I DG 97  O6 ? ? ? 1_555 J DC 51  N4 ? ? I DG 23  J DC -23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog251 hydrog ? ? I DC 98  N3 ? ? ? 1_555 J DG 50  N1 ? ? I DC 24  J DG -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog252 hydrog ? ? I DC 98  N4 ? ? ? 1_555 J DG 50  O6 ? ? I DC 24  J DG -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog253 hydrog ? ? I DC 98  O2 ? ? ? 1_555 J DG 50  N2 ? ? I DC 24  J DG -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog254 hydrog ? ? I DT 99  N3 ? ? ? 1_555 J DA 49  N1 ? ? I DT 25  J DA -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog255 hydrog ? ? I DT 99  O4 ? ? ? 1_555 J DA 49  N6 ? ? I DT 25  J DA -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog256 hydrog ? ? I DA 100 N1 ? ? ? 1_555 J DT 48  N3 ? ? I DA 26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog257 hydrog ? ? I DA 100 N6 ? ? ? 1_555 J DT 48  O4 ? ? I DA 26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog258 hydrog ? ? I DG 101 N1 ? ? ? 1_555 J DC 47  N3 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog259 hydrog ? ? I DG 101 N2 ? ? ? 1_555 J DC 47  O2 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog260 hydrog ? ? I DG 101 O6 ? ? ? 1_555 J DC 47  N4 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog261 hydrog ? ? I DA 102 N1 ? ? ? 1_555 J DT 46  N3 ? ? I DA 28  J DT -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog262 hydrog ? ? I DA 102 N6 ? ? ? 1_555 J DT 46  O4 ? ? I DA 28  J DT -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog263 hydrog ? ? I DG 103 N1 ? ? ? 1_555 J DC 45  N3 ? ? I DG 29  J DC -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog264 hydrog ? ? I DG 103 N2 ? ? ? 1_555 J DC 45  O2 ? ? I DG 29  J DC -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog265 hydrog ? ? I DG 103 O6 ? ? ? 1_555 J DC 45  N4 ? ? I DG 29  J DC -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog266 hydrog ? ? I DC 104 N3 ? ? ? 1_555 J DG 44  N1 ? ? I DC 30  J DG -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog267 hydrog ? ? I DC 104 N4 ? ? ? 1_555 J DG 44  O6 ? ? I DC 30  J DG -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog268 hydrog ? ? I DC 104 O2 ? ? ? 1_555 J DG 44  N2 ? ? I DC 30  J DG -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog269 hydrog ? ? I DT 105 N3 ? ? ? 1_555 J DA 43  N1 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog270 hydrog ? ? I DT 105 O4 ? ? ? 1_555 J DA 43  N6 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog271 hydrog ? ? I DG 106 N1 ? ? ? 1_555 J DC 42  N3 ? ? I DG 32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog272 hydrog ? ? I DG 106 N2 ? ? ? 1_555 J DC 42  O2 ? ? I DG 32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog273 hydrog ? ? I DG 106 O6 ? ? ? 1_555 J DC 42  N4 ? ? I DG 32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog274 hydrog ? ? I DT 107 N3 ? ? ? 1_555 J DA 41  N1 ? ? I DT 33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog275 hydrog ? ? I DT 107 O4 ? ? ? 1_555 J DA 41  N6 ? ? I DT 33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog276 hydrog ? ? I DC 108 N3 ? ? ? 1_555 J DG 40  N1 ? ? I DC 34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog277 hydrog ? ? I DC 108 N4 ? ? ? 1_555 J DG 40  O6 ? ? I DC 34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog278 hydrog ? ? I DC 108 O2 ? ? ? 1_555 J DG 40  N2 ? ? I DC 34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog279 hydrog ? ? I DT 109 N3 ? ? ? 1_555 J DA 39  N1 ? ? I DT 35  J DA -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog280 hydrog ? ? I DT 109 O4 ? ? ? 1_555 J DA 39  N6 ? ? I DT 35  J DA -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog281 hydrog ? ? I DA 110 N1 ? ? ? 1_555 J DG 37  N1 ? ? I DA 36  J DG -37 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog282 hydrog ? ? I DA 110 N6 ? ? ? 1_555 J DG 37  O6 ? ? I DA 36  J DG -37 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog283 hydrog ? ? I DA 110 N1 ? ? ? 1_555 J DT 38  N3 ? ? I DA 36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog284 hydrog ? ? I DA 110 N6 ? ? ? 1_555 J DT 38  O4 ? ? I DA 36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog285 hydrog ? ? I DC 111 N3 ? ? ? 1_555 J DG 37  N1 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog286 hydrog ? ? I DC 111 N4 ? ? ? 1_555 J DG 37  O6 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog287 hydrog ? ? I DC 111 O2 ? ? ? 1_555 J DG 37  N2 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog288 hydrog ? ? I DG 112 N1 ? ? ? 1_555 J DC 36  N3 ? ? I DG 38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog289 hydrog ? ? I DG 112 N2 ? ? ? 1_555 J DC 36  O2 ? ? I DG 38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog290 hydrog ? ? I DG 112 O6 ? ? ? 1_555 J DC 36  N4 ? ? I DG 38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog291 hydrog ? ? I DA 113 N1 ? ? ? 1_555 J DG 34  N1 ? ? I DA 39  J DG -40 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog292 hydrog ? ? I DA 113 N6 ? ? ? 1_555 J DG 34  O6 ? ? I DA 39  J DG -40 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog293 hydrog ? ? I DA 113 N1 ? ? ? 1_555 J DT 35  N3 ? ? I DA 39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog294 hydrog ? ? I DA 113 N6 ? ? ? 1_555 J DT 35  O4 ? ? I DA 39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog295 hydrog ? ? I DC 114 N3 ? ? ? 1_555 J DG 34  N1 ? ? I DC 40  J DG -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog296 hydrog ? ? I DC 114 N4 ? ? ? 1_555 J DG 34  O6 ? ? I DC 40  J DG -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog297 hydrog ? ? I DC 114 O2 ? ? ? 1_555 J DG 34  N2 ? ? I DC 40  J DG -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog298 hydrog ? ? I DC 115 N3 ? ? ? 1_555 J DG 33  N1 ? ? I DC 41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog299 hydrog ? ? I DC 115 N4 ? ? ? 1_555 J DG 33  O6 ? ? I DC 41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog300 hydrog ? ? I DC 115 O2 ? ? ? 1_555 J DG 33  N2 ? ? I DC 41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog301 hydrog ? ? I DA 116 N1 ? ? ? 1_555 J DT 31  N3 ? ? I DA 42  J DT -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog302 hydrog ? ? I DA 116 N6 ? ? ? 1_555 J DT 31  O4 ? ? I DA 42  J DT -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog303 hydrog ? ? I DA 116 N1 ? ? ? 1_555 J DT 32  N3 ? ? I DA 42  J DT -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog304 hydrog ? ? I DA 116 N6 ? ? ? 1_555 J DT 32  O4 ? ? I DA 42  J DT -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog305 hydrog ? ? I DA 117 N1 ? ? ? 1_555 J DT 31  N3 ? ? I DA 43  J DT -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog306 hydrog ? ? I DA 117 N6 ? ? ? 1_555 J DT 31  O4 ? ? I DA 43  J DT -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog307 hydrog ? ? I DT 118 N3 ? ? ? 1_555 J DA 29  N1 ? ? I DT 44  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog308 hydrog ? ? I DT 118 O4 ? ? ? 1_555 J DA 29  N6 ? ? I DT 44  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog309 hydrog ? ? I DT 118 N3 ? ? ? 1_555 J DA 30  N1 ? ? I DT 44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog310 hydrog ? ? I DT 118 O4 ? ? ? 1_555 J DA 30  N6 ? ? I DT 44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog311 hydrog ? ? I DT 119 N3 ? ? ? 1_555 J DA 29  N1 ? ? I DT 45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog312 hydrog ? ? I DT 119 O4 ? ? ? 1_555 J DA 29  N6 ? ? I DT 45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog313 hydrog ? ? I DG 120 N1 ? ? ? 1_555 J DC 28  N3 ? ? I DG 46  J DC -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog314 hydrog ? ? I DG 120 N2 ? ? ? 1_555 J DC 28  O2 ? ? I DG 46  J DC -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog315 hydrog ? ? I DG 120 O6 ? ? ? 1_555 J DC 28  N4 ? ? I DG 46  J DC -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog316 hydrog ? ? I DA 121 N1 ? ? ? 1_555 J DT 27  N3 ? ? I DA 47  J DT -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog317 hydrog ? ? I DA 121 N6 ? ? ? 1_555 J DT 27  O4 ? ? I DA 47  J DT -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog318 hydrog ? ? I DG 122 N1 ? ? ? 1_555 J DC 26  N3 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog319 hydrog ? ? I DG 122 N2 ? ? ? 1_555 J DC 26  O2 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog320 hydrog ? ? I DG 122 O6 ? ? ? 1_555 J DC 26  N4 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog321 hydrog ? ? I DC 123 N3 ? ? ? 1_555 J DG 25  N1 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog322 hydrog ? ? I DC 123 N4 ? ? ? 1_555 J DG 25  O6 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog323 hydrog ? ? I DC 123 O2 ? ? ? 1_555 J DG 25  N2 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog324 hydrog ? ? I DG 124 N1 ? ? ? 1_555 J DC 24  N3 ? ? I DG 50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog325 hydrog ? ? I DG 124 N2 ? ? ? 1_555 J DC 24  O2 ? ? I DG 50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog326 hydrog ? ? I DG 124 O6 ? ? ? 1_555 J DC 24  N4 ? ? I DG 50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog327 hydrog ? ? I DG 125 N1 ? ? ? 1_555 J DC 23  N3 ? ? I DG 51  J DC -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog328 hydrog ? ? I DG 125 N2 ? ? ? 1_555 J DC 23  O2 ? ? I DG 51  J DC -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog329 hydrog ? ? I DG 125 O6 ? ? ? 1_555 J DC 23  N4 ? ? I DG 51  J DC -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog330 hydrog ? ? I DC 126 N3 ? ? ? 1_555 J DG 22  N1 ? ? I DC 52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog331 hydrog ? ? I DC 126 N4 ? ? ? 1_555 J DG 22  O6 ? ? I DC 52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog332 hydrog ? ? I DC 126 O2 ? ? ? 1_555 J DG 22  N2 ? ? I DC 52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog333 hydrog ? ? I DC 127 N3 ? ? ? 1_555 J DG 21  N1 ? ? I DC 53  J DG -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog334 hydrog ? ? I DC 127 N4 ? ? ? 1_555 J DG 21  O6 ? ? I DC 53  J DG -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog335 hydrog ? ? I DC 127 O2 ? ? ? 1_555 J DG 21  N2 ? ? I DC 53  J DG -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog336 hydrog ? ? I DT 128 N3 ? ? ? 1_555 J DA 20  N1 ? ? I DT 54  J DA -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog337 hydrog ? ? I DT 128 O4 ? ? ? 1_555 J DA 20  N6 ? ? I DT 54  J DA -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog338 hydrog ? ? I DC 129 N3 ? ? ? 1_555 J DG 19  N1 ? ? I DC 55  J DG -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog339 hydrog ? ? I DC 129 N4 ? ? ? 1_555 J DG 19  O6 ? ? I DC 55  J DG -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog340 hydrog ? ? I DC 129 O2 ? ? ? 1_555 J DG 19  N2 ? ? I DC 55  J DG -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog341 hydrog ? ? I DG 130 N1 ? ? ? 1_555 J DC 18  N3 ? ? I DG 56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog342 hydrog ? ? I DG 130 N2 ? ? ? 1_555 J DC 18  O2 ? ? I DG 56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog343 hydrog ? ? I DG 130 O6 ? ? ? 1_555 J DC 18  N4 ? ? I DG 56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog344 hydrog ? ? I DG 131 N1 ? ? ? 1_555 J DC 17  N3 ? ? I DG 57  J DC -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog345 hydrog ? ? I DG 131 N2 ? ? ? 1_555 J DC 17  O2 ? ? I DG 57  J DC -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog346 hydrog ? ? I DG 131 O6 ? ? ? 1_555 J DC 17  N4 ? ? I DG 57  J DC -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog347 hydrog ? ? I DC 132 N3 ? ? ? 1_555 J DG 16  N1 ? ? I DC 58  J DG -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog348 hydrog ? ? I DC 132 N4 ? ? ? 1_555 J DG 16  O6 ? ? I DC 58  J DG -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog349 hydrog ? ? I DC 132 O2 ? ? ? 1_555 J DG 16  N2 ? ? I DC 58  J DG -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog350 hydrog ? ? I DA 133 N1 ? ? ? 1_555 J DT 15  N3 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog351 hydrog ? ? I DA 133 N6 ? ? ? 1_555 J DT 15  O4 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog352 hydrog ? ? I DC 134 N3 ? ? ? 1_555 J DG 14  N1 ? ? I DC 60  J DG -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog353 hydrog ? ? I DC 134 N4 ? ? ? 1_555 J DG 14  O6 ? ? I DC 60  J DG -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog354 hydrog ? ? I DC 134 O2 ? ? ? 1_555 J DG 14  N2 ? ? I DC 60  J DG -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog355 hydrog ? ? I DC 135 N3 ? ? ? 1_555 J DG 13  N1 ? ? I DC 61  J DG -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog356 hydrog ? ? I DC 135 N4 ? ? ? 1_555 J DG 13  O6 ? ? I DC 61  J DG -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog357 hydrog ? ? I DC 135 O2 ? ? ? 1_555 J DG 13  N2 ? ? I DC 61  J DG -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog358 hydrog ? ? I DG 136 N1 ? ? ? 1_555 J DC 12  N3 ? ? I DG 62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog359 hydrog ? ? I DG 136 N2 ? ? ? 1_555 J DC 12  O2 ? ? I DG 62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog360 hydrog ? ? I DG 136 O6 ? ? ? 1_555 J DC 12  N4 ? ? I DG 62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog361 hydrog ? ? I DG 137 N1 ? ? ? 1_555 J DC 11  N3 ? ? I DG 63  J DC -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog362 hydrog ? ? I DG 137 N2 ? ? ? 1_555 J DC 11  O2 ? ? I DG 63  J DC -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog363 hydrog ? ? I DG 137 O6 ? ? ? 1_555 J DC 11  N4 ? ? I DG 63  J DC -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog364 hydrog ? ? I DG 138 N1 ? ? ? 1_555 J DC 10  N3 ? ? I DG 64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog365 hydrog ? ? I DG 138 N2 ? ? ? 1_555 J DC 10  O2 ? ? I DG 64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog366 hydrog ? ? I DG 138 O6 ? ? ? 1_555 J DC 10  N4 ? ? I DG 64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog367 hydrog ? ? I DA 139 N1 ? ? ? 1_555 J DT 9   N3 ? ? I DA 65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog368 hydrog ? ? I DA 139 N6 ? ? ? 1_555 J DT 9   O4 ? ? I DA 65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog369 hydrog ? ? I DT 140 N3 ? ? ? 1_555 J DA 8   N1 ? ? I DT 66  J DA -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog370 hydrog ? ? I DT 140 O4 ? ? ? 1_555 J DA 8   N6 ? ? I DT 66  J DA -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog371 hydrog ? ? I DT 141 N3 ? ? ? 1_555 J DA 7   N1 ? ? I DT 67  J DA -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog372 hydrog ? ? I DT 141 O4 ? ? ? 1_555 J DA 7   N6 ? ? I DT 67  J DA -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog373 hydrog ? ? I DC 142 N3 ? ? ? 1_555 J DG 6   N1 ? ? I DC 68  J DG -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog374 hydrog ? ? I DC 142 N4 ? ? ? 1_555 J DG 6   O6 ? ? I DC 68  J DG -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog375 hydrog ? ? I DC 142 O2 ? ? ? 1_555 J DG 6   N2 ? ? I DC 68  J DG -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog376 hydrog ? ? I DT 143 N3 ? ? ? 1_555 J DA 5   N1 ? ? I DT 69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog377 hydrog ? ? I DT 143 O4 ? ? ? 1_555 J DA 5   N6 ? ? I DT 69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog378 hydrog ? ? I DC 144 N3 ? ? ? 1_555 J DG 4   N1 ? ? I DC 70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog379 hydrog ? ? I DC 144 N4 ? ? ? 1_555 J DG 4   O6 ? ? I DC 70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog380 hydrog ? ? I DC 144 O2 ? ? ? 1_555 J DG 4   N2 ? ? I DC 70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog381 hydrog ? ? I DC 145 N3 ? ? ? 1_555 J DG 3   N1 ? ? I DC 71  J DG -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog382 hydrog ? ? I DC 145 N4 ? ? ? 1_555 J DG 3   O6 ? ? I DC 71  J DG -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog383 hydrog ? ? I DC 145 O2 ? ? ? 1_555 J DG 3   N2 ? ? I DC 71  J DG -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog384 hydrog ? ? I DA 146 N1 ? ? ? 1_555 J DT 2   N3 ? ? I DA 72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog385 hydrog ? ? I DA 146 N6 ? ? ? 1_555 J DT 2   O4 ? ? I DA 72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog386 hydrog ? ? I DG 147 N1 ? ? ? 1_555 J DC 1   N3 ? ? I DG 73  J DC -73 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog387 hydrog ? ? I DG 147 N2 ? ? ? 1_555 J DC 1   O2 ? ? I DG 73  J DC -73 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog388 hydrog ? ? I DG 147 O6 ? ? ? 1_555 J DC 1   N4 ? ? I DG 73  J DC -73 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
AA1 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
AA2 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
AA2 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
AA3 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
AA3 2 THR D 85  ? ILE D 86  ? THR D 85  ILE D 86  
AA4 1 VAL C 100 ? THR C 101 ? VAL C 100 THR C 101 
AA4 2 THR F 96  ? LEU F 97  ? THR F 96  LEU F 97  
AA5 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
AA5 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
AA6 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
AA6 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
AA7 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
AA7 2 THR H 85  ? ILE H 86  ? THR H 85  ILE H 86  
AA8 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
AA8 2 GLY H 50  ? ILE H 51  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
AA2 1 2 N THR B 96  ? N THR B 96  O THR G 101 ? O THR G 101 
AA3 1 2 N ARG C 42  ? N ARG C 42  O ILE D 86  ? O ILE D 86  
AA4 1 2 N THR C 101 ? N THR C 101 O THR F 96  ? O THR F 96  
AA5 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
AA6 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
AA7 1 2 N ARG G 42  ? N ARG G 42  O ILE H 86  ? O ILE H 86  
AA8 1 2 N ILE G 78  ? N ILE G 78  O GLY H 50  ? O GLY H 50  
# 
_atom_sites.entry_id                    6ESF 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . LYS A 1 37  ? 111.179 75.458  66.562  1.00 119.19 ? 37  LYS A N     1 
ATOM 2     C CA    . LYS A 1 37  ? 111.120 76.894  66.801  1.00 119.19 ? 37  LYS A CA    1 
ATOM 3     C C     . LYS A 1 37  ? 111.701 77.238  68.159  1.00 119.19 ? 37  LYS A C     1 
ATOM 4     O O     . LYS A 1 37  ? 111.237 76.726  69.177  1.00 119.19 ? 37  LYS A O     1 
ATOM 5     C CB    . LYS A 1 37  ? 109.681 77.403  66.717  1.00 119.19 ? 37  LYS A CB    1 
ATOM 6     C CG    . LYS A 1 37  ? 109.075 77.370  65.327  1.00 119.19 ? 37  LYS A CG    1 
ATOM 7     C CD    . LYS A 1 37  ? 107.654 77.906  65.347  1.00 119.19 ? 37  LYS A CD    1 
ATOM 8     C CE    . LYS A 1 37  ? 107.022 77.843  63.974  1.00 119.19 ? 37  LYS A CE    1 
ATOM 9     N NZ    . LYS A 1 37  ? 105.616 78.327  64.000  1.00 119.19 ? 37  LYS A NZ    1 
ATOM 10    N N     . PRO A 1 38  ? 112.732 78.084  68.176  1.00 120.46 ? 38  PRO A N     1 
ATOM 11    C CA    . PRO A 1 38  ? 113.245 78.605  69.453  1.00 120.46 ? 38  PRO A CA    1 
ATOM 12    C C     . PRO A 1 38  ? 112.203 79.488  70.127  1.00 120.46 ? 38  PRO A C     1 
ATOM 13    O O     . PRO A 1 38  ? 111.696 80.440  69.531  1.00 120.46 ? 38  PRO A O     1 
ATOM 14    C CB    . PRO A 1 38  ? 114.488 79.402  69.038  1.00 120.46 ? 38  PRO A CB    1 
ATOM 15    C CG    . PRO A 1 38  ? 114.901 78.797  67.728  1.00 120.46 ? 38  PRO A CG    1 
ATOM 16    C CD    . PRO A 1 38  ? 113.613 78.429  67.048  1.00 120.46 ? 38  PRO A CD    1 
ATOM 17    N N     . HIS A 1 39  ? 111.882 79.159  71.372  1.00 109.74 ? 39  HIS A N     1 
ATOM 18    C CA    . HIS A 1 39  ? 110.817 79.819  72.110  1.00 109.74 ? 39  HIS A CA    1 
ATOM 19    C C     . HIS A 1 39  ? 111.403 80.802  73.112  1.00 109.74 ? 39  HIS A C     1 
ATOM 20    O O     . HIS A 1 39  ? 112.346 80.469  73.834  1.00 109.74 ? 39  HIS A O     1 
ATOM 21    C CB    . HIS A 1 39  ? 109.951 78.796  72.834  1.00 109.74 ? 39  HIS A CB    1 
ATOM 22    C CG    . HIS A 1 39  ? 108.747 79.395  73.475  1.00 109.74 ? 39  HIS A CG    1 
ATOM 23    N ND1   . HIS A 1 39  ? 108.759 79.893  74.758  1.00 109.74 ? 39  HIS A ND1   1 
ATOM 24    C CD2   . HIS A 1 39  ? 107.501 79.617  72.996  1.00 109.74 ? 39  HIS A CD2   1 
ATOM 25    C CE1   . HIS A 1 39  ? 107.563 80.372  75.050  1.00 109.74 ? 39  HIS A CE1   1 
ATOM 26    N NE2   . HIS A 1 39  ? 106.783 80.219  73.997  1.00 109.74 ? 39  HIS A NE2   1 
ATOM 27    N N     . ARG A 1 40  ? 110.837 82.005  73.161  1.00 103.42 ? 40  ARG A N     1 
ATOM 28    C CA    . ARG A 1 40  ? 111.351 83.070  74.008  1.00 103.42 ? 40  ARG A CA    1 
ATOM 29    C C     . ARG A 1 40  ? 110.209 83.928  74.521  1.00 103.42 ? 40  ARG A C     1 
ATOM 30    O O     . ARG A 1 40  ? 109.077 83.857  74.040  1.00 103.42 ? 40  ARG A O     1 
ATOM 31    C CB    . ARG A 1 40  ? 112.335 83.967  73.264  1.00 103.42 ? 40  ARG A CB    1 
ATOM 32    C CG    . ARG A 1 40  ? 113.708 83.405  73.074  1.00 103.42 ? 40  ARG A CG    1 
ATOM 33    C CD    . ARG A 1 40  ? 114.436 84.285  72.113  1.00 103.42 ? 40  ARG A CD    1 
ATOM 34    N NE    . ARG A 1 40  ? 114.469 85.661  72.581  1.00 103.42 ? 40  ARG A NE    1 
ATOM 35    C CZ    . ARG A 1 40  ? 115.415 86.149  73.365  1.00 103.42 ? 40  ARG A CZ    1 
ATOM 36    N NH1   . ARG A 1 40  ? 116.405 85.371  73.766  1.00 103.42 ? 40  ARG A NH1   1 
ATOM 37    N NH2   . ARG A 1 40  ? 115.377 87.416  73.737  1.00 103.42 ? 40  ARG A NH2   1 
ATOM 38    N N     . TYR A 1 41  ? 110.536 84.760  75.500  1.00 102.03 ? 41  TYR A N     1 
ATOM 39    C CA    . TYR A 1 41  ? 109.654 85.808  75.972  1.00 102.03 ? 41  TYR A CA    1 
ATOM 40    C C     . TYR A 1 41  ? 110.312 87.160  75.773  1.00 102.03 ? 41  TYR A C     1 
ATOM 41    O O     . TYR A 1 41  ? 111.534 87.295  75.861  1.00 102.03 ? 41  TYR A O     1 
ATOM 42    C CB    . TYR A 1 41  ? 109.289 85.594  77.421  1.00 102.03 ? 41  TYR A CB    1 
ATOM 43    C CG    . TYR A 1 41  ? 108.309 84.479  77.558  1.00 102.03 ? 41  TYR A CG    1 
ATOM 44    C CD1   . TYR A 1 41  ? 106.958 84.721  77.395  1.00 102.03 ? 41  TYR A CD1   1 
ATOM 45    C CD2   . TYR A 1 41  ? 108.725 83.180  77.796  1.00 102.03 ? 41  TYR A CD2   1 
ATOM 46    C CE1   . TYR A 1 41  ? 106.036 83.716  77.496  1.00 102.03 ? 41  TYR A CE1   1 
ATOM 47    C CE2   . TYR A 1 41  ? 107.805 82.158  77.908  1.00 102.03 ? 41  TYR A CE2   1 
ATOM 48    C CZ    . TYR A 1 41  ? 106.456 82.439  77.748  1.00 102.03 ? 41  TYR A CZ    1 
ATOM 49    O OH    . TYR A 1 41  ? 105.506 81.455  77.841  1.00 102.03 ? 41  TYR A OH    1 
ATOM 50    N N     . ARG A 1 42  ? 109.477 88.157  75.512  1.00 93.65  ? 42  ARG A N     1 
ATOM 51    C CA    . ARG A 1 42  ? 109.898 89.467  75.058  1.00 93.65  ? 42  ARG A CA    1 
ATOM 52    C C     . ARG A 1 42  ? 110.678 90.216  76.141  1.00 93.65  ? 42  ARG A C     1 
ATOM 53    O O     . ARG A 1 42  ? 110.701 89.813  77.304  1.00 93.65  ? 42  ARG A O     1 
ATOM 54    C CB    . ARG A 1 42  ? 108.660 90.251  74.631  1.00 93.65  ? 42  ARG A CB    1 
ATOM 55    C CG    . ARG A 1 42  ? 107.976 89.674  73.419  1.00 93.65  ? 42  ARG A CG    1 
ATOM 56    C CD    . ARG A 1 42  ? 106.728 90.453  73.104  1.00 93.65  ? 42  ARG A CD    1 
ATOM 57    N NE    . ARG A 1 42  ? 107.050 91.844  72.820  1.00 93.65  ? 42  ARG A NE    1 
ATOM 58    C CZ    . ARG A 1 42  ? 107.378 92.303  71.619  1.00 93.65  ? 42  ARG A CZ    1 
ATOM 59    N NH1   . ARG A 1 42  ? 107.422 91.480  70.582  1.00 93.65  ? 42  ARG A NH1   1 
ATOM 60    N NH2   . ARG A 1 42  ? 107.659 93.587  71.456  1.00 93.65  ? 42  ARG A NH2   1 
ATOM 61    N N     . PRO A 1 43  ? 111.349 91.306  75.783  1.00 91.09  ? 43  PRO A N     1 
ATOM 62    C CA    . PRO A 1 43  ? 111.923 92.172  76.815  1.00 91.09  ? 43  PRO A CA    1 
ATOM 63    C C     . PRO A 1 43  ? 110.864 92.966  77.550  1.00 91.09  ? 43  PRO A C     1 
ATOM 64    O O     . PRO A 1 43  ? 110.528 94.081  77.150  1.00 91.09  ? 43  PRO A O     1 
ATOM 65    C CB    . PRO A 1 43  ? 112.857 93.093  76.027  1.00 91.09  ? 43  PRO A CB    1 
ATOM 66    C CG    . PRO A 1 43  ? 113.192 92.332  74.822  1.00 91.09  ? 43  PRO A CG    1 
ATOM 67    C CD    . PRO A 1 43  ? 111.964 91.568  74.471  1.00 91.09  ? 43  PRO A CD    1 
ATOM 68    N N     . GLY A 1 44  ? 110.328 92.402  78.621  1.00 87.14  ? 44  GLY A N     1 
ATOM 69    C CA    . GLY A 1 44  ? 109.293 93.079  79.368  1.00 87.14  ? 44  GLY A CA    1 
ATOM 70    C C     . GLY A 1 44  ? 108.286 92.149  80.004  1.00 87.14  ? 44  GLY A C     1 
ATOM 71    O O     . GLY A 1 44  ? 107.689 92.495  81.024  1.00 87.14  ? 44  GLY A O     1 
ATOM 72    N N     . THR A 1 45  ? 108.105 90.958  79.449  1.00 86.83  ? 45  THR A N     1 
ATOM 73    C CA    . THR A 1 45  ? 107.223 90.010  80.112  1.00 86.83  ? 45  THR A CA    1 
ATOM 74    C C     . THR A 1 45  ? 107.905 89.374  81.310  1.00 86.83  ? 45  THR A C     1 
ATOM 75    O O     . THR A 1 45  ? 107.301 89.280  82.386  1.00 86.83  ? 45  THR A O     1 
ATOM 76    C CB    . THR A 1 45  ? 106.757 88.955  79.126  1.00 86.83  ? 45  THR A CB    1 
ATOM 77    O OG1   . THR A 1 45  ? 106.037 89.602  78.074  1.00 86.83  ? 45  THR A OG1   1 
ATOM 78    C CG2   . THR A 1 45  ? 105.843 87.961  79.812  1.00 86.83  ? 45  THR A CG2   1 
ATOM 79    N N     . VAL A 1 46  ? 109.164 88.954  81.150  1.00 84.78  ? 46  VAL A N     1 
ATOM 80    C CA    . VAL A 1 46  ? 109.970 88.529  82.293  1.00 84.78  ? 46  VAL A CA    1 
ATOM 81    C C     . VAL A 1 46  ? 110.147 89.685  83.270  1.00 84.78  ? 46  VAL A C     1 
ATOM 82    O O     . VAL A 1 46  ? 110.095 89.504  84.496  1.00 84.78  ? 46  VAL A O     1 
ATOM 83    C CB    . VAL A 1 46  ? 111.318 87.969  81.801  1.00 84.78  ? 46  VAL A CB    1 
ATOM 84    C CG1   . VAL A 1 46  ? 112.268 87.700  82.952  1.00 84.78  ? 46  VAL A CG1   1 
ATOM 85    C CG2   . VAL A 1 46  ? 111.083 86.695  81.032  1.00 84.78  ? 46  VAL A CG2   1 
ATOM 86    N N     . ALA A 1 47  ? 110.275 90.899  82.735  1.00 84.63  ? 47  ALA A N     1 
ATOM 87    C CA    . ALA A 1 47  ? 110.437 92.081  83.567  1.00 84.63  ? 47  ALA A CA    1 
ATOM 88    C C     . ALA A 1 47  ? 109.184 92.364  84.380  1.00 84.63  ? 47  ALA A C     1 
ATOM 89    O O     . ALA A 1 47  ? 109.235 92.367  85.606  1.00 84.63  ? 47  ALA A O     1 
ATOM 90    C CB    . ALA A 1 47  ? 110.807 93.283  82.704  1.00 84.63  ? 47  ALA A CB    1 
ATOM 91    N N     . LEU A 1 48  ? 108.043 92.569  83.720  1.00 83.74  ? 48  LEU A N     1 
ATOM 92    C CA    . LEU A 1 48  ? 106.845 92.987  84.449  1.00 83.74  ? 48  LEU A CA    1 
ATOM 93    C C     . LEU A 1 48  ? 106.243 91.855  85.273  1.00 83.74  ? 48  LEU A C     1 
ATOM 94    O O     . LEU A 1 48  ? 105.726 92.095  86.373  1.00 83.74  ? 48  LEU A O     1 
ATOM 95    C CB    . LEU A 1 48  ? 105.798 93.544  83.494  1.00 83.74  ? 48  LEU A CB    1 
ATOM 96    C CG    . LEU A 1 48  ? 105.792 95.031  83.174  1.00 83.74  ? 48  LEU A CG    1 
ATOM 97    C CD1   . LEU A 1 48  ? 106.967 95.457  82.328  1.00 83.74  ? 48  LEU A CD1   1 
ATOM 98    C CD2   . LEU A 1 48  ? 104.493 95.313  82.474  1.00 83.74  ? 48  LEU A CD2   1 
ATOM 99    N N     . ARG A 1 49  ? 106.277 90.625  84.753  1.00 83.03  ? 49  ARG A N     1 
ATOM 100   C CA    . ARG A 1 49  ? 105.832 89.486  85.546  1.00 83.03  ? 49  ARG A CA    1 
ATOM 101   C C     . ARG A 1 49  ? 106.728 89.292  86.757  1.00 83.03  ? 49  ARG A C     1 
ATOM 102   O O     . ARG A 1 49  ? 106.250 89.052  87.876  1.00 83.03  ? 49  ARG A O     1 
ATOM 103   C CB    . ARG A 1 49  ? 105.817 88.223  84.693  1.00 83.03  ? 49  ARG A CB    1 
ATOM 104   C CG    . ARG A 1 49  ? 105.204 87.047  85.410  1.00 83.03  ? 49  ARG A CG    1 
ATOM 105   C CD    . ARG A 1 49  ? 105.117 85.800  84.541  1.00 83.03  ? 49  ARG A CD    1 
ATOM 106   N NE    . ARG A 1 49  ? 106.405 85.163  84.268  1.00 83.03  ? 49  ARG A NE    1 
ATOM 107   C CZ    . ARG A 1 49  ? 106.908 84.969  83.053  1.00 83.03  ? 49  ARG A CZ    1 
ATOM 108   N NH1   . ARG A 1 49  ? 106.237 85.354  81.979  1.00 83.03  ? 49  ARG A NH1   1 
ATOM 109   N NH2   . ARG A 1 49  ? 108.078 84.373  82.910  1.00 83.03  ? 49  ARG A NH2   1 
ATOM 110   N N     . GLU A 1 50  ? 108.032 89.454  86.563  1.00 85.00  ? 50  GLU A N     1 
ATOM 111   C CA    . GLU A 1 50  ? 108.959 89.276  87.663  1.00 85.00  ? 50  GLU A CA    1 
ATOM 112   C C     . GLU A 1 50  ? 108.926 90.451  88.636  1.00 85.00  ? 50  GLU A C     1 
ATOM 113   O O     . GLU A 1 50  ? 109.238 90.270  89.817  1.00 85.00  ? 50  GLU A O     1 
ATOM 114   C CB    . GLU A 1 50  ? 110.328 88.991  87.053  1.00 85.00  ? 50  GLU A CB    1 
ATOM 115   C CG    . GLU A 1 50  ? 111.451 88.699  87.997  1.00 85.00  ? 50  GLU A CG    1 
ATOM 116   C CD    . GLU A 1 50  ? 112.405 89.859  88.074  1.00 85.00  ? 50  GLU A CD    1 
ATOM 117   O OE1   . GLU A 1 50  ? 112.550 90.536  87.038  1.00 85.00  ? 50  GLU A OE1   1 
ATOM 118   O OE2   . GLU A 1 50  ? 113.015 90.092  89.136  1.00 85.00  ? 50  GLU A OE2   1 
ATOM 119   N N     . ILE A 1 51  ? 108.495 91.628  88.179  1.00 80.86  ? 51  ILE A N     1 
ATOM 120   C CA    . ILE A 1 51  ? 108.161 92.730  89.075  1.00 80.86  ? 51  ILE A CA    1 
ATOM 121   C C     . ILE A 1 51  ? 106.940 92.383  89.907  1.00 80.86  ? 51  ILE A C     1 
ATOM 122   O O     . ILE A 1 51  ? 106.877 92.712  91.098  1.00 80.86  ? 51  ILE A O     1 
ATOM 123   C CB    . ILE A 1 51  ? 107.964 94.035  88.274  1.00 80.86  ? 51  ILE A CB    1 
ATOM 124   C CG1   . ILE A 1 51  ? 109.306 94.642  87.891  1.00 80.86  ? 51  ILE A CG1   1 
ATOM 125   C CG2   . ILE A 1 51  ? 107.167 95.084  89.015  1.00 80.86  ? 51  ILE A CG2   1 
ATOM 126   C CD1   . ILE A 1 51  ? 109.181 95.813  86.948  1.00 80.86  ? 51  ILE A CD1   1 
ATOM 127   N N     . ARG A 1 52  ? 105.960 91.696  89.312  1.00 83.92  ? 52  ARG A N     1 
ATOM 128   C CA    . ARG A 1 52  ? 104.803 91.279  90.100  1.00 83.92  ? 52  ARG A CA    1 
ATOM 129   C C     . ARG A 1 52  ? 105.196 90.272  91.170  1.00 83.92  ? 52  ARG A C     1 
ATOM 130   O O     . ARG A 1 52  ? 104.704 90.346  92.305  1.00 83.92  ? 52  ARG A O     1 
ATOM 131   C CB    . ARG A 1 52  ? 103.711 90.699  89.210  1.00 83.92  ? 52  ARG A CB    1 
ATOM 132   C CG    . ARG A 1 52  ? 103.000 91.708  88.332  1.00 83.92  ? 52  ARG A CG    1 
ATOM 133   C CD    . ARG A 1 52  ? 101.909 91.022  87.533  1.00 83.92  ? 52  ARG A CD    1 
ATOM 134   N NE    . ARG A 1 52  ? 101.250 91.922  86.594  1.00 83.92  ? 52  ARG A NE    1 
ATOM 135   C CZ    . ARG A 1 52  ? 101.638 92.092  85.336  1.00 83.92  ? 52  ARG A CZ    1 
ATOM 136   N NH1   . ARG A 1 52  ? 102.681 91.423  84.868  1.00 83.92  ? 52  ARG A NH1   1 
ATOM 137   N NH2   . ARG A 1 52  ? 100.983 92.927  84.544  1.00 83.92  ? 52  ARG A NH2   1 
ATOM 138   N N     . ARG A 1 53  ? 106.124 89.368  90.850  1.00 82.07  ? 53  ARG A N     1 
ATOM 139   C CA    . ARG A 1 53  ? 106.578 88.426  91.868  1.00 82.07  ? 53  ARG A CA    1 
ATOM 140   C C     . ARG A 1 53  ? 107.392 89.115  92.954  1.00 82.07  ? 53  ARG A C     1 
ATOM 141   O O     . ARG A 1 53  ? 107.057 89.031  94.138  1.00 82.07  ? 53  ARG A O     1 
ATOM 142   C CB    . ARG A 1 53  ? 107.398 87.296  91.262  1.00 82.07  ? 53  ARG A CB    1 
ATOM 143   C CG    . ARG A 1 53  ? 107.837 86.384  92.370  1.00 82.07  ? 53  ARG A CG    1 
ATOM 144   C CD    . ARG A 1 53  ? 108.604 85.192  91.925  1.00 82.07  ? 53  ARG A CD    1 
ATOM 145   N NE    . ARG A 1 53  ? 109.023 84.462  93.110  1.00 82.07  ? 53  ARG A NE    1 
ATOM 146   C CZ    . ARG A 1 53  ? 109.699 83.324  93.087  1.00 82.07  ? 53  ARG A CZ    1 
ATOM 147   N NH1   . ARG A 1 53  ? 110.029 82.774  91.927  1.00 82.07  ? 53  ARG A NH1   1 
ATOM 148   N NH2   . ARG A 1 53  ? 110.041 82.738  94.223  1.00 82.07  ? 53  ARG A NH2   1 
ATOM 149   N N     . TYR A 1 54  ? 108.469 89.797  92.577  1.00 82.73  ? 54  TYR A N     1 
ATOM 150   C CA    . TYR A 1 54  ? 109.344 90.348  93.600  1.00 82.73  ? 54  TYR A CA    1 
ATOM 151   C C     . TYR A 1 54  ? 108.803 91.605  94.262  1.00 82.73  ? 54  TYR A C     1 
ATOM 152   O O     . TYR A 1 54  ? 109.388 92.050  95.254  1.00 82.73  ? 54  TYR A O     1 
ATOM 153   C CB    . TYR A 1 54  ? 110.731 90.619  93.034  1.00 82.73  ? 54  TYR A CB    1 
ATOM 154   C CG    . TYR A 1 54  ? 111.541 89.364  92.880  1.00 82.73  ? 54  TYR A CG    1 
ATOM 155   C CD1   . TYR A 1 54  ? 112.132 88.764  93.981  1.00 82.73  ? 54  TYR A CD1   1 
ATOM 156   C CD2   . TYR A 1 54  ? 111.713 88.775  91.647  1.00 82.73  ? 54  TYR A CD2   1 
ATOM 157   C CE1   . TYR A 1 54  ? 112.875 87.612  93.850  1.00 82.73  ? 54  TYR A CE1   1 
ATOM 158   C CE2   . TYR A 1 54  ? 112.462 87.628  91.504  1.00 82.73  ? 54  TYR A CE2   1 
ATOM 159   C CZ    . TYR A 1 54  ? 113.032 87.050  92.607  1.00 82.73  ? 54  TYR A CZ    1 
ATOM 160   O OH    . TYR A 1 54  ? 113.772 85.905  92.467  1.00 82.73  ? 54  TYR A OH    1 
ATOM 161   N N     . GLN A 1 55  ? 107.720 92.192  93.760  1.00 81.47  ? 55  GLN A N     1 
ATOM 162   C CA    . GLN A 1 55  ? 106.956 93.077  94.626  1.00 81.47  ? 55  GLN A CA    1 
ATOM 163   C C     . GLN A 1 55  ? 106.047 92.279  95.535  1.00 81.47  ? 55  GLN A C     1 
ATOM 164   O O     . GLN A 1 55  ? 105.845 92.656  96.692  1.00 81.47  ? 55  GLN A O     1 
ATOM 165   C CB    . GLN A 1 55  ? 106.126 94.090  93.830  1.00 81.47  ? 55  GLN A CB    1 
ATOM 166   C CG    . GLN A 1 55  ? 106.922 95.252  93.266  1.00 81.47  ? 55  GLN A CG    1 
ATOM 167   C CD    . GLN A 1 55  ? 106.053 96.349  92.679  1.00 81.47  ? 55  GLN A CD    1 
ATOM 168   O OE1   . GLN A 1 55  ? 104.838 96.213  92.586  1.00 81.47  ? 55  GLN A OE1   1 
ATOM 169   N NE2   . GLN A 1 55  ? 106.672 97.459  92.317  1.00 81.47  ? 55  GLN A NE2   1 
ATOM 170   N N     . LYS A 1 56  ? 105.522 91.161  95.043  1.00 81.09  ? 56  LYS A N     1 
ATOM 171   C CA    . LYS A 1 56  ? 104.525 90.436  95.812  1.00 81.09  ? 56  LYS A CA    1 
ATOM 172   C C     . LYS A 1 56  ? 105.142 89.669  96.978  1.00 81.09  ? 56  LYS A C     1 
ATOM 173   O O     . LYS A 1 56  ? 104.498 89.521  98.018  1.00 81.09  ? 56  LYS A O     1 
ATOM 174   C CB    . LYS A 1 56  ? 103.754 89.508  94.873  1.00 81.09  ? 56  LYS A CB    1 
ATOM 175   C CG    . LYS A 1 56  ? 102.454 88.978  95.426  1.00 81.09  ? 56  LYS A CG    1 
ATOM 176   C CD    . LYS A 1 56  ? 101.675 88.281  94.335  1.00 81.09  ? 56  LYS A CD    1 
ATOM 177   C CE    . LYS A 1 56  ? 100.334 87.815  94.840  1.00 81.09  ? 56  LYS A CE    1 
ATOM 178   N NZ    . LYS A 1 56  ? 99.559  87.151  93.758  1.00 81.09  ? 56  LYS A NZ    1 
ATOM 179   N N     . SER A 1 57  ? 106.384 89.209  96.849  1.00 78.67  ? 57  SER A N     1 
ATOM 180   C CA    . SER A 1 57  ? 106.980 88.419  97.914  1.00 78.67  ? 57  SER A CA    1 
ATOM 181   C C     . SER A 1 57  ? 107.509 89.320  99.015  1.00 78.67  ? 57  SER A C     1 
ATOM 182   O O     . SER A 1 57  ? 107.511 90.546  98.908  1.00 78.67  ? 57  SER A O     1 
ATOM 183   C CB    . SER A 1 57  ? 108.129 87.565  97.408  1.00 78.67  ? 57  SER A CB    1 
ATOM 184   O OG    . SER A 1 57  ? 109.274 88.371  97.233  1.00 78.67  ? 57  SER A OG    1 
ATOM 185   N N     . THR A 1 58  ? 108.000 88.681  100.080 1.00 79.25  ? 58  THR A N     1 
ATOM 186   C CA    . THR A 1 58  ? 108.331 89.364  101.321 1.00 79.25  ? 58  THR A CA    1 
ATOM 187   C C     . THR A 1 58  ? 109.751 89.142  101.811 1.00 79.25  ? 58  THR A C     1 
ATOM 188   O O     . THR A 1 58  ? 110.217 89.919  102.648 1.00 79.25  ? 58  THR A O     1 
ATOM 189   C CB    . THR A 1 58  ? 107.393 88.912  102.453 1.00 79.25  ? 58  THR A CB    1 
ATOM 190   O OG1   . THR A 1 58  ? 107.566 87.511  102.675 1.00 79.25  ? 58  THR A OG1   1 
ATOM 191   C CG2   . THR A 1 58  ? 105.945 89.171  102.113 1.00 79.25  ? 58  THR A CG2   1 
ATOM 192   N N     . GLU A 1 59  ? 110.442 88.108  101.346 1.00 82.42  ? 59  GLU A N     1 
ATOM 193   C CA    . GLU A 1 59  ? 111.627 87.655  102.055 1.00 82.42  ? 59  GLU A CA    1 
ATOM 194   C C     . GLU A 1 59  ? 112.840 88.494  101.671 1.00 82.42  ? 59  GLU A C     1 
ATOM 195   O O     . GLU A 1 59  ? 112.766 89.425  100.868 1.00 82.42  ? 59  GLU A O     1 
ATOM 196   C CB    . GLU A 1 59  ? 111.871 86.170  101.792 1.00 82.42  ? 59  GLU A CB    1 
ATOM 197   C CG    . GLU A 1 59  ? 112.430 85.837  100.424 1.00 82.42  ? 59  GLU A CG    1 
ATOM 198   C CD    . GLU A 1 59  ? 111.371 85.666  99.360  1.00 82.42  ? 59  GLU A CD    1 
ATOM 199   O OE1   . GLU A 1 59  ? 110.224 86.117  99.551  1.00 82.42  ? 59  GLU A OE1   1 
ATOM 200   O OE2   . GLU A 1 59  ? 111.689 85.062  98.319  1.00 82.42  ? 59  GLU A OE2   1 
ATOM 201   N N     . LEU A 1 60  ? 113.976 88.146  102.256 1.00 81.28  ? 60  LEU A N     1 
ATOM 202   C CA    . LEU A 1 60  ? 115.189 88.941  102.172 1.00 81.28  ? 60  LEU A CA    1 
ATOM 203   C C     . LEU A 1 60  ? 116.087 88.376  101.086 1.00 81.28  ? 60  LEU A C     1 
ATOM 204   O O     . LEU A 1 60  ? 116.266 87.160  100.988 1.00 81.28  ? 60  LEU A O     1 
ATOM 205   C CB    . LEU A 1 60  ? 115.921 88.950  103.508 1.00 81.28  ? 60  LEU A CB    1 
ATOM 206   C CG    . LEU A 1 60  ? 115.346 89.855  104.597 1.00 81.28  ? 60  LEU A CG    1 
ATOM 207   C CD1   . LEU A 1 60  ? 114.119 89.291  105.303 1.00 81.28  ? 60  LEU A CD1   1 
ATOM 208   C CD2   . LEU A 1 60  ? 116.411 90.135  105.602 1.00 81.28  ? 60  LEU A CD2   1 
ATOM 209   N N     . LEU A 1 61  ? 116.664 89.261  100.280 1.00 79.49  ? 61  LEU A N     1 
ATOM 210   C CA    . LEU A 1 61  ? 117.163 88.806  98.991  1.00 79.49  ? 61  LEU A CA    1 
ATOM 211   C C     . LEU A 1 61  ? 118.634 88.419  99.026  1.00 79.49  ? 61  LEU A C     1 
ATOM 212   O O     . LEU A 1 61  ? 118.978 87.269  98.740  1.00 79.49  ? 61  LEU A O     1 
ATOM 213   C CB    . LEU A 1 61  ? 116.937 89.871  97.917  1.00 79.49  ? 61  LEU A CB    1 
ATOM 214   C CG    . LEU A 1 61  ? 115.563 89.870  97.249  1.00 79.49  ? 61  LEU A CG    1 
ATOM 215   C CD1   . LEU A 1 61  ? 115.234 88.479  96.757  1.00 79.49  ? 61  LEU A CD1   1 
ATOM 216   C CD2   . LEU A 1 61  ? 114.461 90.413  98.128  1.00 79.49  ? 61  LEU A CD2   1 
ATOM 217   N N     . ILE A 1 62  ? 119.507 89.358  99.355  1.00 75.65  ? 62  ILE A N     1 
ATOM 218   C CA    . ILE A 1 62  ? 120.932 89.137  99.159  1.00 75.65  ? 62  ILE A CA    1 
ATOM 219   C C     . ILE A 1 62  ? 121.449 88.196  100.238 1.00 75.65  ? 62  ILE A C     1 
ATOM 220   O O     . ILE A 1 62  ? 120.994 88.225  101.386 1.00 75.65  ? 62  ILE A O     1 
ATOM 221   C CB    . ILE A 1 62  ? 121.681 90.477  99.105  1.00 75.65  ? 62  ILE A CB    1 
ATOM 222   C CG1   . ILE A 1 62  ? 121.631 91.232  100.416 1.00 75.65  ? 62  ILE A CG1   1 
ATOM 223   C CG2   . ILE A 1 62  ? 121.026 91.354  98.082  1.00 75.65  ? 62  ILE A CG2   1 
ATOM 224   C CD1   . ILE A 1 62  ? 122.455 92.484  100.370 1.00 75.65  ? 62  ILE A CD1   1 
ATOM 225   N N     . ARG A 1 63  ? 122.360 87.312  99.839  1.00 78.13  ? 63  ARG A N     1 
ATOM 226   C CA    . ARG A 1 63  ? 122.582 86.061  100.545 1.00 78.13  ? 63  ARG A CA    1 
ATOM 227   C C     . ARG A 1 63  ? 123.306 86.292  101.865 1.00 78.13  ? 63  ARG A C     1 
ATOM 228   O O     . ARG A 1 63  ? 123.978 87.303  102.067 1.00 78.13  ? 63  ARG A O     1 
ATOM 229   C CB    . ARG A 1 63  ? 123.365 85.092  99.662  1.00 78.13  ? 63  ARG A CB    1 
ATOM 230   C CG    . ARG A 1 63  ? 122.667 84.697  98.355  1.00 78.13  ? 63  ARG A CG    1 
ATOM 231   C CD    . ARG A 1 63  ? 121.433 83.834  98.559  1.00 78.13  ? 63  ARG A CD    1 
ATOM 232   N NE    . ARG A 1 63  ? 120.209 84.617  98.700  1.00 78.13  ? 63  ARG A NE    1 
ATOM 233   C CZ    . ARG A 1 63  ? 119.049 84.128  99.125  1.00 78.13  ? 63  ARG A CZ    1 
ATOM 234   N NH1   . ARG A 1 63  ? 118.942 82.848  99.446  1.00 78.13  ? 63  ARG A NH1   1 
ATOM 235   N NH2   . ARG A 1 63  ? 117.992 84.919  99.226  1.00 78.13  ? 63  ARG A NH2   1 
ATOM 236   N N     . LYS A 1 64  ? 123.168 85.314  102.761 1.00 79.00  ? 64  LYS A N     1 
ATOM 237   C CA    . LYS A 1 64  ? 123.465 85.525  104.174 1.00 79.00  ? 64  LYS A CA    1 
ATOM 238   C C     . LYS A 1 64  ? 124.963 85.631  104.430 1.00 79.00  ? 64  LYS A C     1 
ATOM 239   O O     . LYS A 1 64  ? 125.424 86.568  105.093 1.00 79.00  ? 64  LYS A O     1 
ATOM 240   C CB    . LYS A 1 64  ? 122.866 84.388  104.993 1.00 79.00  ? 64  LYS A CB    1 
ATOM 241   C CG    . LYS A 1 64  ? 121.372 84.210  104.801 1.00 79.00  ? 64  LYS A CG    1 
ATOM 242   C CD    . LYS A 1 64  ? 120.587 85.358  105.400 1.00 79.00  ? 64  LYS A CD    1 
ATOM 243   C CE    . LYS A 1 64  ? 119.090 85.148  105.232 1.00 79.00  ? 64  LYS A CE    1 
ATOM 244   N NZ    . LYS A 1 64  ? 118.587 84.018  106.058 1.00 79.00  ? 64  LYS A NZ    1 
ATOM 245   N N     . LEU A 1 65  ? 125.737 84.676  103.931 1.00 78.24  ? 65  LEU A N     1 
ATOM 246   C CA    . LEU A 1 65  ? 127.177 84.690  104.173 1.00 78.24  ? 65  LEU A CA    1 
ATOM 247   C C     . LEU A 1 65  ? 127.974 85.770  103.431 1.00 78.24  ? 65  LEU A C     1 
ATOM 248   O O     . LEU A 1 65  ? 128.904 86.314  104.043 1.00 78.24  ? 65  LEU A O     1 
ATOM 249   C CB    . LEU A 1 65  ? 127.778 83.315  103.884 1.00 78.24  ? 65  LEU A CB    1 
ATOM 250   C CG    . LEU A 1 65  ? 127.371 82.258  104.901 1.00 78.24  ? 65  LEU A CG    1 
ATOM 251   C CD1   . LEU A 1 65  ? 127.969 80.923  104.531 1.00 78.24  ? 65  LEU A CD1   1 
ATOM 252   C CD2   . LEU A 1 65  ? 127.803 82.674  106.291 1.00 78.24  ? 65  LEU A CD2   1 
ATOM 253   N N     . PRO A 1 66  ? 127.706 86.115  102.156 1.00 75.32  ? 66  PRO A N     1 
ATOM 254   C CA    . PRO A 1 66  ? 128.445 87.256  101.588 1.00 75.32  ? 66  PRO A CA    1 
ATOM 255   C C     . PRO A 1 66  ? 128.098 88.577  102.237 1.00 75.32  ? 66  PRO A C     1 
ATOM 256   O O     . PRO A 1 66  ? 128.985 89.422  102.421 1.00 75.32  ? 66  PRO A O     1 
ATOM 257   C CB    . PRO A 1 66  ? 128.046 87.237  100.109 1.00 75.32  ? 66  PRO A CB    1 
ATOM 258   C CG    . PRO A 1 66  ? 127.656 85.873  99.850  1.00 75.32  ? 66  PRO A CG    1 
ATOM 259   C CD    . PRO A 1 66  ? 126.970 85.419  101.081 1.00 75.32  ? 66  PRO A CD    1 
ATOM 260   N N     . PHE A 1 67  ? 126.837 88.769  102.614 1.00 74.07  ? 67  PHE A N     1 
ATOM 261   C CA    . PHE A 1 67  ? 126.469 89.992  103.310 1.00 74.07  ? 67  PHE A CA    1 
ATOM 262   C C     . PHE A 1 67  ? 127.092 90.037  104.695 1.00 74.07  ? 67  PHE A C     1 
ATOM 263   O O     . PHE A 1 67  ? 127.543 91.098  105.145 1.00 74.07  ? 67  PHE A O     1 
ATOM 264   C CB    . PHE A 1 67  ? 124.955 90.103  103.408 1.00 74.07  ? 67  PHE A CB    1 
ATOM 265   C CG    . PHE A 1 67  ? 124.496 91.383  104.001 1.00 74.07  ? 67  PHE A CG    1 
ATOM 266   C CD1   . PHE A 1 67  ? 124.503 92.535  103.250 1.00 74.07  ? 67  PHE A CD1   1 
ATOM 267   C CD2   . PHE A 1 67  ? 124.084 91.447  105.313 1.00 74.07  ? 67  PHE A CD2   1 
ATOM 268   C CE1   . PHE A 1 67  ? 124.089 93.723  103.780 1.00 74.07  ? 67  PHE A CE1   1 
ATOM 269   C CE2   . PHE A 1 67  ? 123.694 92.635  105.855 1.00 74.07  ? 67  PHE A CE2   1 
ATOM 270   C CZ    . PHE A 1 67  ? 123.691 93.777  105.083 1.00 74.07  ? 67  PHE A CZ    1 
ATOM 271   N N     . GLN A 1 68  ? 127.123 88.892  105.375 1.00 77.94  ? 68  GLN A N     1 
ATOM 272   C CA    . GLN A 1 68  ? 127.699 88.820  106.711 1.00 77.94  ? 68  GLN A CA    1 
ATOM 273   C C     . GLN A 1 68  ? 129.192 89.114  106.677 1.00 77.94  ? 68  GLN A C     1 
ATOM 274   O O     . GLN A 1 68  ? 129.702 89.890  107.499 1.00 77.94  ? 68  GLN A O     1 
ATOM 275   C CB    . GLN A 1 68  ? 127.409 87.443  107.301 1.00 77.94  ? 68  GLN A CB    1 
ATOM 276   C CG    . GLN A 1 68  ? 127.838 87.233  108.732 1.00 77.94  ? 68  GLN A CG    1 
ATOM 277   C CD    . GLN A 1 68  ? 127.336 85.909  109.276 1.00 77.94  ? 68  GLN A CD    1 
ATOM 278   O OE1   . GLN A 1 68  ? 126.667 85.154  108.576 1.00 77.94  ? 68  GLN A OE1   1 
ATOM 279   N NE2   . GLN A 1 68  ? 127.655 85.622  110.524 1.00 77.94  ? 68  GLN A NE2   1 
ATOM 280   N N     . ARG A 1 69  ? 129.894 88.549  105.692 1.00 75.39  ? 69  ARG A N     1 
ATOM 281   C CA    . ARG A 1 69  ? 131.301 88.877  105.491 1.00 75.39  ? 69  ARG A CA    1 
ATOM 282   C C     . ARG A 1 69  ? 131.497 90.341  105.120 1.00 75.39  ? 69  ARG A C     1 
ATOM 283   O O     . ARG A 1 69  ? 132.527 90.931  105.465 1.00 75.39  ? 69  ARG A O     1 
ATOM 284   C CB    . ARG A 1 69  ? 131.895 87.981  104.407 1.00 75.39  ? 69  ARG A CB    1 
ATOM 285   C CG    . ARG A 1 69  ? 132.071 86.539  104.800 1.00 75.39  ? 69  ARG A CG    1 
ATOM 286   C CD    . ARG A 1 69  ? 132.902 85.801  103.768 1.00 75.39  ? 69  ARG A CD    1 
ATOM 287   N NE    . ARG A 1 69  ? 132.261 85.752  102.461 1.00 75.39  ? 69  ARG A NE    1 
ATOM 288   C CZ    . ARG A 1 69  ? 131.380 84.827  102.104 1.00 75.39  ? 69  ARG A CZ    1 
ATOM 289   N NH1   . ARG A 1 69  ? 131.022 83.884  102.963 1.00 75.39  ? 69  ARG A NH1   1 
ATOM 290   N NH2   . ARG A 1 69  ? 130.848 84.846  100.893 1.00 75.39  ? 69  ARG A NH2   1 
ATOM 291   N N     . LEU A 1 70  ? 130.523 90.943  104.432 1.00 73.04  ? 70  LEU A N     1 
ATOM 292   C CA    . LEU A 1 70  ? 130.621 92.360  104.097 1.00 73.04  ? 70  LEU A CA    1 
ATOM 293   C C     . LEU A 1 70  ? 130.561 93.226  105.342 1.00 73.04  ? 70  LEU A C     1 
ATOM 294   O O     . LEU A 1 70  ? 131.390 94.128  105.523 1.00 73.04  ? 70  LEU A O     1 
ATOM 295   C CB    . LEU A 1 70  ? 129.502 92.756  103.146 1.00 73.04  ? 70  LEU A CB    1 
ATOM 296   C CG    . LEU A 1 70  ? 129.510 94.253  102.853 1.00 73.04  ? 70  LEU A CG    1 
ATOM 297   C CD1   . LEU A 1 70  ? 130.719 94.635  102.035 1.00 73.04  ? 70  LEU A CD1   1 
ATOM 298   C CD2   . LEU A 1 70  ? 128.242 94.682  102.181 1.00 73.04  ? 70  LEU A CD2   1 
ATOM 299   N N     . VAL A 1 71  ? 129.583 92.958  106.209 1.00 75.66  ? 71  VAL A N     1 
ATOM 300   C CA    . VAL A 1 71  ? 129.417 93.742  107.429 1.00 75.66  ? 71  VAL A CA    1 
ATOM 301   C C     . VAL A 1 71  ? 130.619 93.563  108.349 1.00 75.66  ? 71  VAL A C     1 
ATOM 302   O O     . VAL A 1 71  ? 131.086 94.523  108.974 1.00 75.66  ? 71  VAL A O     1 
ATOM 303   C CB    . VAL A 1 71  ? 128.092 93.362  108.119 1.00 75.66  ? 71  VAL A CB    1 
ATOM 304   C CG1   . VAL A 1 71  ? 127.949 94.040  109.455 1.00 75.66  ? 71  VAL A CG1   1 
ATOM 305   C CG2   . VAL A 1 71  ? 126.930 93.743  107.241 1.00 75.66  ? 71  VAL A CG2   1 
ATOM 306   N N     . ARG A 1 72  ? 131.180 92.351  108.397 1.00 75.94  ? 72  ARG A N     1 
ATOM 307   C CA    . ARG A 1 72  ? 132.379 92.150  109.207 1.00 75.94  ? 72  ARG A CA    1 
ATOM 308   C C     . ARG A 1 72  ? 133.581 92.876  108.614 1.00 75.94  ? 72  ARG A C     1 
ATOM 309   O O     . ARG A 1 72  ? 134.410 93.418  109.356 1.00 75.94  ? 72  ARG A O     1 
ATOM 310   C CB    . ARG A 1 72  ? 132.671 90.659  109.355 1.00 75.94  ? 72  ARG A CB    1 
ATOM 311   C CG    . ARG A 1 72  ? 131.622 89.921  110.159 1.00 75.94  ? 72  ARG A CG    1 
ATOM 312   C CD    . ARG A 1 72  ? 131.869 88.426  110.188 1.00 75.94  ? 72  ARG A CD    1 
ATOM 313   N NE    . ARG A 1 72  ? 130.735 87.704  110.756 1.00 75.94  ? 72  ARG A NE    1 
ATOM 314   C CZ    . ARG A 1 72  ? 130.593 87.448  112.048 1.00 75.94  ? 72  ARG A CZ    1 
ATOM 315   N NH1   . ARG A 1 72  ? 131.511 87.852  112.908 1.00 75.94  ? 72  ARG A NH1   1 
ATOM 316   N NH2   . ARG A 1 72  ? 129.535 86.794  112.489 1.00 75.94  ? 72  ARG A NH2   1 
ATOM 317   N N     . GLU A 1 73  ? 133.671 92.931  107.281 1.00 79.76  ? 73  GLU A N     1 
ATOM 318   C CA    . GLU A 1 73  ? 134.811 93.586  106.645 1.00 79.76  ? 73  GLU A CA    1 
ATOM 319   C C     . GLU A 1 73  ? 134.779 95.091  106.855 1.00 79.76  ? 73  GLU A C     1 
ATOM 320   O O     . GLU A 1 73  ? 135.801 95.699  107.191 1.00 79.76  ? 73  GLU A O     1 
ATOM 321   C CB    . GLU A 1 73  ? 134.850 93.284  105.156 1.00 79.76  ? 73  GLU A CB    1 
ATOM 322   C CG    . GLU A 1 73  ? 136.053 93.915  104.508 1.00 79.76  ? 73  GLU A CG    1 
ATOM 323   C CD    . GLU A 1 73  ? 136.079 93.730  103.021 1.00 79.76  ? 73  GLU A CD    1 
ATOM 324   O OE1   . GLU A 1 73  ? 135.139 93.115  102.489 1.00 79.76  ? 73  GLU A OE1   1 
ATOM 325   O OE2   . GLU A 1 73  ? 137.033 94.210  102.378 1.00 79.76  ? 73  GLU A OE2   1 
ATOM 326   N N     . ILE A 1 74  ? 133.611 95.710  106.664 1.00 79.41  ? 74  ILE A N     1 
ATOM 327   C CA    . ILE A 1 74  ? 133.490 97.137  106.942 1.00 79.41  ? 74  ILE A CA    1 
ATOM 328   C C     . ILE A 1 74  ? 133.631 97.386  108.438 1.00 79.41  ? 74  ILE A C     1 
ATOM 329   O O     . ILE A 1 74  ? 134.154 98.423  108.863 1.00 79.41  ? 74  ILE A O     1 
ATOM 330   C CB    . ILE A 1 74  ? 132.158 97.666  106.380 1.00 79.41  ? 74  ILE A CB    1 
ATOM 331   C CG1   . ILE A 1 74  ? 132.069 97.378  104.884 1.00 79.41  ? 74  ILE A CG1   1 
ATOM 332   C CG2   . ILE A 1 74  ? 132.045 99.152  106.549 1.00 79.41  ? 74  ILE A CG2   1 
ATOM 333   C CD1   . ILE A 1 74  ? 130.701 97.644  104.289 1.00 79.41  ? 74  ILE A CD1   1 
ATOM 334   N N     . ALA A 1 75  ? 133.254 96.405  109.253 1.00 83.51  ? 75  ALA A N     1 
ATOM 335   C CA    . ALA A 1 75  ? 133.368 96.523  110.697 1.00 83.51  ? 75  ALA A CA    1 
ATOM 336   C C     . ALA A 1 75  ? 134.804 96.465  111.191 1.00 83.51  ? 75  ALA A C     1 
ATOM 337   O O     . ALA A 1 75  ? 135.085 96.984  112.276 1.00 83.51  ? 75  ALA A O     1 
ATOM 338   C CB    . ALA A 1 75  ? 132.553 95.423  111.366 1.00 83.51  ? 75  ALA A CB    1 
ATOM 339   N N     . GLN A 1 76  ? 135.716 95.842  110.435 1.00 85.96  ? 76  GLN A N     1 
ATOM 340   C CA    . GLN A 1 76  ? 137.099 95.749  110.899 1.00 85.96  ? 76  GLN A CA    1 
ATOM 341   C C     . GLN A 1 76  ? 137.821 97.086  110.897 1.00 85.96  ? 76  GLN A C     1 
ATOM 342   O O     . GLN A 1 76  ? 138.837 97.220  111.584 1.00 85.96  ? 76  GLN A O     1 
ATOM 343   C CB    . GLN A 1 76  ? 137.902 94.770  110.051 1.00 85.96  ? 76  GLN A CB    1 
ATOM 344   C CG    . GLN A 1 76  ? 137.569 93.326  110.277 1.00 85.96  ? 76  GLN A CG    1 
ATOM 345   C CD    . GLN A 1 76  ? 138.502 92.417  109.520 1.00 85.96  ? 76  GLN A CD    1 
ATOM 346   O OE1   . GLN A 1 76  ? 139.352 92.880  108.760 1.00 85.96  ? 76  GLN A OE1   1 
ATOM 347   N NE2   . GLN A 1 76  ? 138.365 91.117  109.737 1.00 85.96  ? 76  GLN A NE2   1 
ATOM 348   N N     . ASP A 1 77  ? 137.325 98.070  110.151 1.00 86.14  ? 77  ASP A N     1 
ATOM 349   C CA    . ASP A 1 77  ? 138.065 99.314  110.004 1.00 86.14  ? 77  ASP A CA    1 
ATOM 350   C C     . ASP A 1 77  ? 137.988 100.166 111.261 1.00 86.14  ? 77  ASP A C     1 
ATOM 351   O O     . ASP A 1 77  ? 138.996 100.729 111.696 1.00 86.14  ? 77  ASP A O     1 
ATOM 352   C CB    . ASP A 1 77  ? 137.541 100.090 108.803 1.00 86.14  ? 77  ASP A CB    1 
ATOM 353   C CG    . ASP A 1 77  ? 137.822 99.389  107.501 1.00 86.14  ? 77  ASP A CG    1 
ATOM 354   O OD1   . ASP A 1 77  ? 138.776 98.587  107.457 1.00 86.14  ? 77  ASP A OD1   1 
ATOM 355   O OD2   . ASP A 1 77  ? 137.108 99.653  106.514 1.00 86.14  ? 77  ASP A OD2   1 
ATOM 356   N N     . PHE A 1 78  ? 136.807 100.273 111.858 1.00 86.42  ? 78  PHE A N     1 
ATOM 357   C CA    . PHE A 1 78  ? 136.659 101.156 113.002 1.00 86.42  ? 78  PHE A CA    1 
ATOM 358   C C     . PHE A 1 78  ? 137.135 100.509 114.289 1.00 86.42  ? 78  PHE A C     1 
ATOM 359   O O     . PHE A 1 78  ? 137.459 101.221 115.242 1.00 86.42  ? 78  PHE A O     1 
ATOM 360   C CB    . PHE A 1 78  ? 135.204 101.585 113.145 1.00 86.42  ? 78  PHE A CB    1 
ATOM 361   C CG    . PHE A 1 78  ? 134.627 102.152 111.890 1.00 86.42  ? 78  PHE A CG    1 
ATOM 362   C CD1   . PHE A 1 78  ? 135.011 103.396 111.432 1.00 86.42  ? 78  PHE A CD1   1 
ATOM 363   C CD2   . PHE A 1 78  ? 133.686 101.442 111.171 1.00 86.42  ? 78  PHE A CD2   1 
ATOM 364   C CE1   . PHE A 1 78  ? 134.477 103.912 110.266 1.00 86.42  ? 78  PHE A CE1   1 
ATOM 365   C CE2   . PHE A 1 78  ? 133.148 101.954 110.013 1.00 86.42  ? 78  PHE A CE2   1 
ATOM 366   C CZ    . PHE A 1 78  ? 133.544 103.188 109.561 1.00 86.42  ? 78  PHE A CZ    1 
ATOM 367   N N     . LYS A 1 79  ? 137.190 99.183  114.330 1.00 86.08  ? 79  LYS A N     1 
ATOM 368   C CA    . LYS A 1 79  ? 137.631 98.451  115.505 1.00 86.08  ? 79  LYS A CA    1 
ATOM 369   C C     . LYS A 1 79  ? 138.013 97.051  115.052 1.00 86.08  ? 79  LYS A C     1 
ATOM 370   O O     . LYS A 1 79  ? 137.397 96.508  114.134 1.00 86.08  ? 79  LYS A O     1 
ATOM 371   C CB    . LYS A 1 79  ? 136.532 98.402  116.573 1.00 86.08  ? 79  LYS A CB    1 
ATOM 372   C CG    . LYS A 1 79  ? 136.947 97.795  117.887 1.00 86.08  ? 79  LYS A CG    1 
ATOM 373   C CD    . LYS A 1 79  ? 135.800 97.836  118.863 1.00 86.08  ? 79  LYS A CD    1 
ATOM 374   C CE    . LYS A 1 79  ? 136.205 97.284  120.217 1.00 86.08  ? 79  LYS A CE    1 
ATOM 375   N NZ    . LYS A 1 79  ? 136.501 95.827  120.148 1.00 86.08  ? 79  LYS A NZ    1 
ATOM 376   N N     . THR A 1 80  ? 139.037 96.485  115.675 1.00 86.99  ? 80  THR A N     1 
ATOM 377   C CA    . THR A 1 80  ? 139.456 95.132  115.355 1.00 86.99  ? 80  THR A CA    1 
ATOM 378   C C     . THR A 1 80  ? 138.708 94.109  116.204 1.00 86.99  ? 80  THR A C     1 
ATOM 379   O O     . THR A 1 80  ? 138.309 94.388  117.339 1.00 86.99  ? 80  THR A O     1 
ATOM 380   C CB    . THR A 1 80  ? 140.969 94.976  115.540 1.00 86.99  ? 80  THR A CB    1 
ATOM 381   O OG1   . THR A 1 80  ? 141.352 93.623  115.264 1.00 86.99  ? 80  THR A OG1   1 
ATOM 382   C CG2   . THR A 1 80  ? 141.405 95.361  116.944 1.00 86.99  ? 80  THR A CG2   1 
ATOM 383   N N     . ASP A 1 81  ? 138.484 92.934  115.605 1.00 86.17  ? 81  ASP A N     1 
ATOM 384   C CA    . ASP A 1 81  ? 138.030 91.712  116.275 1.00 86.17  ? 81  ASP A CA    1 
ATOM 385   C C     . ASP A 1 81  ? 136.671 91.884  116.956 1.00 86.17  ? 81  ASP A C     1 
ATOM 386   O O     . ASP A 1 81  ? 136.536 91.766  118.173 1.00 86.17  ? 81  ASP A O     1 
ATOM 387   C CB    . ASP A 1 81  ? 139.082 91.233  117.272 1.00 86.17  ? 81  ASP A CB    1 
ATOM 388   C CG    . ASP A 1 81  ? 140.380 90.886  116.602 1.00 86.17  ? 81  ASP A CG    1 
ATOM 389   O OD1   . ASP A 1 81  ? 140.343 90.533  115.406 1.00 86.17  ? 81  ASP A OD1   1 
ATOM 390   O OD2   . ASP A 1 81  ? 141.434 90.967  117.262 1.00 86.17  ? 81  ASP A OD2   1 
ATOM 391   N N     . LEU A 1 82  ? 135.660 92.156  116.143 1.00 83.23  ? 82  LEU A N     1 
ATOM 392   C CA    . LEU A 1 82  ? 134.310 92.324  116.650 1.00 83.23  ? 82  LEU A CA    1 
ATOM 393   C C     . LEU A 1 82  ? 133.577 90.991  116.712 1.00 83.23  ? 82  LEU A C     1 
ATOM 394   O O     . LEU A 1 82  ? 134.107 89.935  116.360 1.00 83.23  ? 82  LEU A O     1 
ATOM 395   C CB    . LEU A 1 82  ? 133.538 93.314  115.788 1.00 83.23  ? 82  LEU A CB    1 
ATOM 396   C CG    . LEU A 1 82  ? 134.018 94.741  115.985 1.00 83.23  ? 82  LEU A CG    1 
ATOM 397   C CD1   . LEU A 1 82  ? 133.357 95.666  114.988 1.00 83.23  ? 82  LEU A CD1   1 
ATOM 398   C CD2   . LEU A 1 82  ? 133.694 95.158  117.403 1.00 83.23  ? 82  LEU A CD2   1 
ATOM 399   N N     . ARG A 1 83  ? 132.331 91.052  117.170 1.00 81.72  ? 83  ARG A N     1 
ATOM 400   C CA    . ARG A 1 83  ? 131.418 89.922  117.188 1.00 81.72  ? 83  ARG A CA    1 
ATOM 401   C C     . ARG A 1 83  ? 130.019 90.436  116.904 1.00 81.72  ? 83  ARG A C     1 
ATOM 402   O O     . ARG A 1 83  ? 129.661 91.534  117.333 1.00 81.72  ? 83  ARG A O     1 
ATOM 403   C CB    . ARG A 1 83  ? 131.429 89.190  118.533 1.00 81.72  ? 83  ARG A CB    1 
ATOM 404   C CG    . ARG A 1 83  ? 132.654 88.336  118.804 1.00 81.72  ? 83  ARG A CG    1 
ATOM 405   C CD    . ARG A 1 83  ? 132.564 87.663  120.166 1.00 81.72  ? 83  ARG A CD    1 
ATOM 406   N NE    . ARG A 1 83  ? 133.774 86.914  120.476 1.00 81.72  ? 83  ARG A NE    1 
ATOM 407   C CZ    . ARG A 1 83  ? 133.946 85.628  120.202 1.00 81.72  ? 83  ARG A CZ    1 
ATOM 408   N NH1   . ARG A 1 83  ? 132.979 84.940  119.622 1.00 81.72  ? 83  ARG A NH1   1 
ATOM 409   N NH2   . ARG A 1 83  ? 135.084 85.029  120.518 1.00 81.72  ? 83  ARG A NH2   1 
ATOM 410   N N     . PHE A 1 84  ? 129.227 89.643  116.193 1.00 77.95  ? 84  PHE A N     1 
ATOM 411   C CA    . PHE A 1 84  ? 127.867 90.020  115.841 1.00 77.95  ? 84  PHE A CA    1 
ATOM 412   C C     . PHE A 1 84  ? 126.869 88.985  116.322 1.00 77.95  ? 84  PHE A C     1 
ATOM 413   O O     . PHE A 1 84  ? 127.090 87.784  116.170 1.00 77.95  ? 84  PHE A O     1 
ATOM 414   C CB    . PHE A 1 84  ? 127.711 90.180  114.341 1.00 77.95  ? 84  PHE A CB    1 
ATOM 415   C CG    . PHE A 1 84  ? 128.354 91.402  113.807 1.00 77.95  ? 84  PHE A CG    1 
ATOM 416   C CD1   . PHE A 1 84  ? 127.742 92.630  113.957 1.00 77.95  ? 84  PHE A CD1   1 
ATOM 417   C CD2   . PHE A 1 84  ? 129.562 91.333  113.145 1.00 77.95  ? 84  PHE A CD2   1 
ATOM 418   C CE1   . PHE A 1 84  ? 128.324 93.775  113.465 1.00 77.95  ? 84  PHE A CE1   1 
ATOM 419   C CE2   . PHE A 1 84  ? 130.152 92.475  112.648 1.00 77.95  ? 84  PHE A CE2   1 
ATOM 420   C CZ    . PHE A 1 84  ? 129.528 93.698  112.808 1.00 77.95  ? 84  PHE A CZ    1 
ATOM 421   N N     . GLN A 1 85  ? 125.763 89.452  116.889 1.00 78.41  ? 85  GLN A N     1 
ATOM 422   C CA    . GLN A 1 85  ? 124.589 88.600  116.949 1.00 78.41  ? 85  GLN A CA    1 
ATOM 423   C C     . GLN A 1 85  ? 124.058 88.406  115.538 1.00 78.41  ? 85  GLN A C     1 
ATOM 424   O O     . GLN A 1 85  ? 124.233 89.261  114.669 1.00 78.41  ? 85  GLN A O     1 
ATOM 425   C CB    . GLN A 1 85  ? 123.512 89.212  117.835 1.00 78.41  ? 85  GLN A CB    1 
ATOM 426   C CG    . GLN A 1 85  ? 123.860 89.267  119.304 1.00 78.41  ? 85  GLN A CG    1 
ATOM 427   C CD    . GLN A 1 85  ? 122.728 89.832  120.136 1.00 78.41  ? 85  GLN A CD    1 
ATOM 428   O OE1   . GLN A 1 85  ? 121.703 90.232  119.598 1.00 78.41  ? 85  GLN A OE1   1 
ATOM 429   N NE2   . GLN A 1 85  ? 122.905 89.864  121.450 1.00 78.41  ? 85  GLN A NE2   1 
ATOM 430   N N     . SER A 1 86  ? 123.423 87.259  115.304 1.00 77.25  ? 86  SER A N     1 
ATOM 431   C CA    . SER A 1 86  ? 122.964 86.939  113.956 1.00 77.25  ? 86  SER A CA    1 
ATOM 432   C C     . SER A 1 86  ? 121.794 87.823  113.542 1.00 77.25  ? 86  SER A C     1 
ATOM 433   O O     . SER A 1 86  ? 121.711 88.267  112.385 1.00 77.25  ? 86  SER A O     1 
ATOM 434   C CB    . SER A 1 86  ? 122.574 85.468  113.881 1.00 77.25  ? 86  SER A CB    1 
ATOM 435   O OG    . SER A 1 86  ? 121.442 85.214  114.685 1.00 77.25  ? 86  SER A OG    1 
ATOM 436   N N     . SER A 1 87  ? 120.895 88.106  114.486 1.00 79.19  ? 87  SER A N     1 
ATOM 437   C CA    . SER A 1 87  ? 119.724 88.916  114.189 1.00 79.19  ? 87  SER A CA    1 
ATOM 438   C C     . SER A 1 87  ? 120.100 90.353  113.865 1.00 79.19  ? 87  SER A C     1 
ATOM 439   O O     . SER A 1 87  ? 119.378 91.024  113.124 1.00 79.19  ? 87  SER A O     1 
ATOM 440   C CB    . SER A 1 87  ? 118.754 88.876  115.365 1.00 79.19  ? 87  SER A CB    1 
ATOM 441   O OG    . SER A 1 87  ? 119.312 89.521  116.493 1.00 79.19  ? 87  SER A OG    1 
ATOM 442   N N     . ALA A 1 88  ? 121.221 90.837  114.397 1.00 76.81  ? 88  ALA A N     1 
ATOM 443   C CA    . ALA A 1 88  ? 121.698 92.162  114.028 1.00 76.81  ? 88  ALA A CA    1 
ATOM 444   C C     . ALA A 1 88  ? 122.185 92.192  112.592 1.00 76.81  ? 88  ALA A C     1 
ATOM 445   O O     . ALA A 1 88  ? 122.034 93.210  111.907 1.00 76.81  ? 88  ALA A O     1 
ATOM 446   C CB    . ALA A 1 88  ? 122.814 92.599  114.964 1.00 76.81  ? 88  ALA A CB    1 
ATOM 447   N N     . VAL A 1 89  ? 122.762 91.091  112.120 1.00 77.00  ? 89  VAL A N     1 
ATOM 448   C CA    . VAL A 1 89  ? 123.122 91.000  110.714 1.00 77.00  ? 89  VAL A CA    1 
ATOM 449   C C     . VAL A 1 89  ? 121.865 90.982  109.860 1.00 77.00  ? 89  VAL A C     1 
ATOM 450   O O     . VAL A 1 89  ? 121.815 91.603  108.788 1.00 77.00  ? 89  VAL A O     1 
ATOM 451   C CB    . VAL A 1 89  ? 124.002 89.761  110.480 1.00 77.00  ? 89  VAL A CB    1 
ATOM 452   C CG1   . VAL A 1 89  ? 124.380 89.620  109.026 1.00 77.00  ? 89  VAL A CG1   1 
ATOM 453   C CG2   . VAL A 1 89  ? 125.239 89.858  111.328 1.00 77.00  ? 89  VAL A CG2   1 
ATOM 454   N N     . MET A 1 90  ? 120.808 90.323  110.351 1.00 79.44  ? 90  MET A N     1 
ATOM 455   C CA    . MET A 1 90  ? 119.524 90.400  109.661 1.00 79.44  ? 90  MET A CA    1 
ATOM 456   C C     . MET A 1 90  ? 118.961 91.814  109.684 1.00 79.44  ? 90  MET A C     1 
ATOM 457   O O     . MET A 1 90  ? 118.274 92.226  108.743 1.00 79.44  ? 90  MET A O     1 
ATOM 458   C CB    . MET A 1 90  ? 118.525 89.435  110.292 1.00 79.44  ? 90  MET A CB    1 
ATOM 459   C CG    . MET A 1 90  ? 118.965 87.996  110.241 1.00 79.44  ? 90  MET A CG    1 
ATOM 460   S SD    . MET A 1 90  ? 119.238 87.430  108.560 1.00 79.44  ? 90  MET A SD    1 
ATOM 461   C CE    . MET A 1 90  ? 117.552 87.380  107.966 1.00 79.44  ? 90  MET A CE    1 
ATOM 462   N N     . ALA A 1 91  ? 119.276 92.579  110.729 1.00 77.87  ? 91  ALA A N     1 
ATOM 463   C CA    . ALA A 1 91  ? 118.755 93.933  110.852 1.00 77.87  ? 91  ALA A CA    1 
ATOM 464   C C     . ALA A 1 91  ? 119.437 94.874  109.876 1.00 77.87  ? 91  ALA A C     1 
ATOM 465   O O     . ALA A 1 91  ? 118.768 95.674  109.209 1.00 77.87  ? 91  ALA A O     1 
ATOM 466   C CB    . ALA A 1 91  ? 118.927 94.433  112.282 1.00 77.87  ? 91  ALA A CB    1 
ATOM 467   N N     . LEU A 1 92  ? 120.762 94.784  109.774 1.00 74.04  ? 92  LEU A N     1 
ATOM 468   C CA    . LEU A 1 92  ? 121.472 95.566  108.773 1.00 74.04  ? 92  LEU A CA    1 
ATOM 469   C C     . LEU A 1 92  ? 121.088 95.145  107.368 1.00 74.04  ? 92  LEU A C     1 
ATOM 470   O O     . LEU A 1 92  ? 121.061 95.981  106.452 1.00 74.04  ? 92  LEU A O     1 
ATOM 471   C CB    . LEU A 1 92  ? 122.970 95.426  108.981 1.00 74.04  ? 92  LEU A CB    1 
ATOM 472   C CG    . LEU A 1 92  ? 123.384 95.987  110.336 1.00 74.04  ? 92  LEU A CG    1 
ATOM 473   C CD1   . LEU A 1 92  ? 124.847 95.787  110.574 1.00 74.04  ? 92  LEU A CD1   1 
ATOM 474   C CD2   . LEU A 1 92  ? 123.044 97.438  110.417 1.00 74.04  ? 92  LEU A CD2   1 
ATOM 475   N N     . GLN A 1 93  ? 120.759 93.864  107.191 1.00 76.98  ? 93  GLN A N     1 
ATOM 476   C CA    . GLN A 1 93  ? 120.256 93.394  105.909 1.00 76.98  ? 93  GLN A CA    1 
ATOM 477   C C     . GLN A 1 93  ? 118.922 94.031  105.579 1.00 76.98  ? 93  GLN A C     1 
ATOM 478   O O     . GLN A 1 93  ? 118.691 94.448  104.438 1.00 76.98  ? 93  GLN A O     1 
ATOM 479   C CB    . GLN A 1 93  ? 120.145 91.875  105.941 1.00 76.98  ? 93  GLN A CB    1 
ATOM 480   C CG    . GLN A 1 93  ? 119.785 91.235  104.638 1.00 76.98  ? 93  GLN A CG    1 
ATOM 481   C CD    . GLN A 1 93  ? 119.794 89.732  104.751 1.00 76.98  ? 93  GLN A CD    1 
ATOM 482   O OE1   . GLN A 1 93  ? 120.087 89.183  105.810 1.00 76.98  ? 93  GLN A OE1   1 
ATOM 483   N NE2   . GLN A 1 93  ? 119.448 89.054  103.669 1.00 76.98  ? 93  GLN A NE2   1 
ATOM 484   N N     . GLU A 1 94  ? 118.060 94.173  106.582 1.00 73.48  ? 94  GLU A N     1 
ATOM 485   C CA    . GLU A 1 94  ? 116.717 94.666  106.327 1.00 73.48  ? 94  GLU A CA    1 
ATOM 486   C C     . GLU A 1 94  ? 116.721 96.162  106.055 1.00 73.48  ? 94  GLU A C     1 
ATOM 487   O O     . GLU A 1 94  ? 116.051 96.634  105.127 1.00 73.48  ? 94  GLU A O     1 
ATOM 488   C CB    . GLU A 1 94  ? 115.819 94.336  107.512 1.00 73.48  ? 94  GLU A CB    1 
ATOM 489   C CG    . GLU A 1 94  ? 114.357 94.598  107.266 1.00 73.48  ? 94  GLU A CG    1 
ATOM 490   C CD    . GLU A 1 94  ? 113.732 93.586  106.324 1.00 73.48  ? 94  GLU A CD    1 
ATOM 491   O OE1   . GLU A 1 94  ? 114.237 92.459  106.262 1.00 73.48  ? 94  GLU A OE1   1 
ATOM 492   O OE2   . GLU A 1 94  ? 112.723 93.900  105.660 1.00 73.48  ? 94  GLU A OE2   1 
ATOM 493   N N     . ALA A 1 95  ? 117.461 96.927  106.851 1.00 71.34  ? 95  ALA A N     1 
ATOM 494   C CA    . ALA A 1 95  ? 117.517 98.357  106.585 1.00 71.34  ? 95  ALA A CA    1 
ATOM 495   C C     . ALA A 1 95  ? 118.281 98.658  105.315 1.00 71.34  ? 95  ALA A C     1 
ATOM 496   O O     . ALA A 1 95  ? 117.973 99.639  104.628 1.00 71.34  ? 95  ALA A O     1 
ATOM 497   C CB    . ALA A 1 95  ? 118.161 99.095  107.742 1.00 71.34  ? 95  ALA A CB    1 
ATOM 498   N N     . SER A 1 96  ? 119.258 97.821  104.975 1.00 72.12  ? 96  SER A N     1 
ATOM 499   C CA    . SER A 1 96  ? 120.035 98.070  103.770 1.00 72.12  ? 96  SER A CA    1 
ATOM 500   C C     . SER A 1 96  ? 119.226 97.777  102.516 1.00 72.12  ? 96  SER A C     1 
ATOM 501   O O     . SER A 1 96  ? 119.282 98.543  101.541 1.00 72.12  ? 96  SER A O     1 
ATOM 502   C CB    . SER A 1 96  ? 121.303 97.240  103.813 1.00 72.12  ? 96  SER A CB    1 
ATOM 503   O OG    . SER A 1 96  ? 122.036 97.597  104.966 1.00 72.12  ? 96  SER A OG    1 
ATOM 504   N N     . GLU A 1 97  ? 118.443 96.692  102.532 1.00 70.46  ? 97  GLU A N     1 
ATOM 505   C CA    . GLU A 1 97  ? 117.562 96.453  101.400 1.00 70.46  ? 97  GLU A CA    1 
ATOM 506   C C     . GLU A 1 97  ? 116.467 97.502  101.316 1.00 70.46  ? 97  GLU A C     1 
ATOM 507   O O     . GLU A 1 97  ? 116.092 97.892  100.213 1.00 70.46  ? 97  GLU A O     1 
ATOM 508   C CB    . GLU A 1 97  ? 116.958 95.043  101.438 1.00 70.46  ? 97  GLU A CB    1 
ATOM 509   C CG    . GLU A 1 97  ? 116.053 94.690  102.607 1.00 70.46  ? 97  GLU A CG    1 
ATOM 510   C CD    . GLU A 1 97  ? 114.607 95.113  102.417 1.00 70.46  ? 97  GLU A CD    1 
ATOM 511   O OE1   . GLU A 1 97  ? 114.188 95.301  101.261 1.00 70.46  ? 97  GLU A OE1   1 
ATOM 512   O OE2   . GLU A 1 97  ? 113.904 95.303  103.426 1.00 70.46  ? 97  GLU A OE2   1 
ATOM 513   N N     . ALA A 1 98  ? 115.954 97.984  102.449 1.00 68.78  ? 98  ALA A N     1 
ATOM 514   C CA    . ALA A 1 98  ? 114.866 98.952  102.366 1.00 68.78  ? 98  ALA A CA    1 
ATOM 515   C C     . ALA A 1 98  ? 115.360 100.310 101.891 1.00 68.78  ? 98  ALA A C     1 
ATOM 516   O O     . ALA A 1 98  ? 114.644 101.017 101.168 1.00 68.78  ? 98  ALA A O     1 
ATOM 517   C CB    . ALA A 1 98  ? 114.174 99.084  103.713 1.00 68.78  ? 98  ALA A CB    1 
ATOM 518   N N     . TYR A 1 99  ? 116.589 100.666 102.247 1.00 67.74  ? 99  TYR A N     1 
ATOM 519   C CA    . TYR A 1 99  ? 117.146 101.911 101.751 1.00 67.74  ? 99  TYR A CA    1 
ATOM 520   C C     . TYR A 1 99  ? 117.481 101.820 100.269 1.00 67.74  ? 99  TYR A C     1 
ATOM 521   O O     . TYR A 1 99  ? 117.246 102.783 99.525  1.00 67.74  ? 99  TYR A O     1 
ATOM 522   C CB    . TYR A 1 99  ? 118.376 102.292 102.554 1.00 67.74  ? 99  TYR A CB    1 
ATOM 523   C CG    . TYR A 1 99  ? 119.069 103.492 102.000 1.00 67.74  ? 99  TYR A CG    1 
ATOM 524   C CD1   . TYR A 1 99  ? 118.500 104.744 102.090 1.00 67.74  ? 99  TYR A CD1   1 
ATOM 525   C CD2   . TYR A 1 99  ? 120.303 103.372 101.389 1.00 67.74  ? 99  TYR A CD2   1 
ATOM 526   C CE1   . TYR A 1 99  ? 119.141 105.851 101.583 1.00 67.74  ? 99  TYR A CE1   1 
ATOM 527   C CE2   . TYR A 1 99  ? 120.950 104.468 100.871 1.00 67.74  ? 99  TYR A CE2   1 
ATOM 528   C CZ    . TYR A 1 99  ? 120.366 105.706 100.973 1.00 67.74  ? 99  TYR A CZ    1 
ATOM 529   O OH    . TYR A 1 99  ? 121.025 106.791 100.459 1.00 67.74  ? 99  TYR A OH    1 
ATOM 530   N N     . LEU A 1 100 ? 118.031 100.684 99.813  1.00 65.86  ? 100 LEU A N     1 
ATOM 531   C CA    . LEU A 1 100 ? 118.286 100.557 98.378  1.00 65.86  ? 100 LEU A CA    1 
ATOM 532   C C     . LEU A 1 100 ? 116.991 100.512 97.579  1.00 65.86  ? 100 LEU A C     1 
ATOM 533   O O     . LEU A 1 100 ? 116.893 101.155 96.529  1.00 65.86  ? 100 LEU A O     1 
ATOM 534   C CB    . LEU A 1 100 ? 119.121 99.321  98.058  1.00 65.86  ? 100 LEU A CB    1 
ATOM 535   C CG    . LEU A 1 100 ? 120.595 99.309  98.428  1.00 65.86  ? 100 LEU A CG    1 
ATOM 536   C CD1   . LEU A 1 100 ? 121.212 97.995  98.008  1.00 65.86  ? 100 LEU A CD1   1 
ATOM 537   C CD2   . LEU A 1 100 ? 121.316 100.468 97.791  1.00 65.86  ? 100 LEU A CD2   1 
ATOM 538   N N     . VAL A 1 101 ? 115.997 99.760  98.064  1.00 63.69  ? 101 VAL A N     1 
ATOM 539   C CA    . VAL A 1 101 ? 114.706 99.640  97.392  1.00 63.69  ? 101 VAL A CA    1 
ATOM 540   C C     . VAL A 1 101 ? 114.036 100.998 97.251  1.00 63.69  ? 101 VAL A C     1 
ATOM 541   O O     . VAL A 1 101 ? 113.565 101.358 96.164  1.00 63.69  ? 101 VAL A O     1 
ATOM 542   C CB    . VAL A 1 101 ? 113.818 98.627  98.137  1.00 63.69  ? 101 VAL A CB    1 
ATOM 543   C CG1   . VAL A 1 101 ? 112.359 98.826  97.806  1.00 63.69  ? 101 VAL A CG1   1 
ATOM 544   C CG2   . VAL A 1 101 ? 114.195 97.233  97.721  1.00 63.69  ? 101 VAL A CG2   1 
ATOM 545   N N     . ALA A 1 102 ? 114.036 101.794 98.324  1.00 64.48  ? 102 ALA A N     1 
ATOM 546   C CA    . ALA A 1 102 ? 113.469 103.134 98.230  1.00 64.48  ? 102 ALA A CA    1 
ATOM 547   C C     . ALA A 1 102 ? 114.273 104.013 97.287  1.00 64.48  ? 102 ALA A C     1 
ATOM 548   O O     . ALA A 1 102 ? 113.695 104.844 96.569  1.00 64.48  ? 102 ALA A O     1 
ATOM 549   C CB    . ALA A 1 102 ? 113.387 103.768 99.615  1.00 64.48  ? 102 ALA A CB    1 
ATOM 550   N N     . LEU A 1 103 ? 115.589 103.804 97.234  1.00 65.17  ? 103 LEU A N     1 
ATOM 551   C CA    . LEU A 1 103 ? 116.395 104.526 96.261  1.00 65.17  ? 103 LEU A CA    1 
ATOM 552   C C     . LEU A 1 103 ? 116.034 104.151 94.821  1.00 65.17  ? 103 LEU A C     1 
ATOM 553   O O     . LEU A 1 103 ? 116.041 105.022 93.943  1.00 65.17  ? 103 LEU A O     1 
ATOM 554   C CB    . LEU A 1 103 ? 117.874 104.283 96.535  1.00 65.17  ? 103 LEU A CB    1 
ATOM 555   C CG    . LEU A 1 103 ? 118.848 105.024 95.633  1.00 65.17  ? 103 LEU A CG    1 
ATOM 556   C CD1   . LEU A 1 103 ? 118.656 106.503 95.812  1.00 65.17  ? 103 LEU A CD1   1 
ATOM 557   C CD2   . LEU A 1 103 ? 120.265 104.642 95.953  1.00 65.17  ? 103 LEU A CD2   1 
ATOM 558   N N     . PHE A 1 104 ? 115.658 102.892 94.559  1.00 65.87  ? 104 PHE A N     1 
ATOM 559   C CA    . PHE A 1 104 ? 115.261 102.552 93.194  1.00 65.87  ? 104 PHE A CA    1 
ATOM 560   C C     . PHE A 1 104 ? 113.854 103.021 92.861  1.00 65.87  ? 104 PHE A C     1 
ATOM 561   O O     . PHE A 1 104 ? 113.563 103.267 91.683  1.00 65.87  ? 104 PHE A O     1 
ATOM 562   C CB    . PHE A 1 104 ? 115.353 101.054 92.929  1.00 65.87  ? 104 PHE A CB    1 
ATOM 563   C CG    . PHE A 1 104 ? 116.733 100.522 92.990  1.00 65.87  ? 104 PHE A CG    1 
ATOM 564   C CD1   . PHE A 1 104 ? 117.679 100.942 92.090  1.00 65.87  ? 104 PHE A CD1   1 
ATOM 565   C CD2   . PHE A 1 104 ? 117.062 99.533  93.890  1.00 65.87  ? 104 PHE A CD2   1 
ATOM 566   C CE1   . PHE A 1 104 ? 118.953 100.444 92.136  1.00 65.87  ? 104 PHE A CE1   1 
ATOM 567   C CE2   . PHE A 1 104 ? 118.331 99.027  93.942  1.00 65.87  ? 104 PHE A CE2   1 
ATOM 568   C CZ    . PHE A 1 104 ? 119.278 99.477  93.059  1.00 65.87  ? 104 PHE A CZ    1 
ATOM 569   N N     . GLU A 1 105 ? 112.971 103.095 93.865  1.00 66.62  ? 105 GLU A N     1 
ATOM 570   C CA    . GLU A 1 105 ? 111.685 103.768 93.699  1.00 66.62  ? 105 GLU A CA    1 
ATOM 571   C C     . GLU A 1 105 ? 111.899 105.178 93.184  1.00 66.62  ? 105 GLU A C     1 
ATOM 572   O O     . GLU A 1 105 ? 111.359 105.582 92.140  1.00 66.62  ? 105 GLU A O     1 
ATOM 573   C CB    . GLU A 1 105 ? 110.951 103.834 95.041  1.00 66.62  ? 105 GLU A CB    1 
ATOM 574   C CG    . GLU A 1 105 ? 110.577 102.523 95.697  1.00 66.62  ? 105 GLU A CG    1 
ATOM 575   C CD    . GLU A 1 105 ? 109.388 101.841 95.071  1.00 66.62  ? 105 GLU A CD    1 
ATOM 576   O OE1   . GLU A 1 105 ? 108.498 102.541 94.549  1.00 66.62  ? 105 GLU A OE1   1 
ATOM 577   O OE2   . GLU A 1 105 ? 109.329 100.599 95.132  1.00 66.62  ? 105 GLU A OE2   1 
ATOM 578   N N     . ASP A 1 106 ? 112.770 105.911 93.867  1.00 67.05  ? 106 ASP A N     1 
ATOM 579   C CA    . ASP A 1 106 ? 112.878 107.320 93.556  1.00 67.05  ? 106 ASP A CA    1 
ATOM 580   C C     . ASP A 1 106 ? 113.672 107.564 92.281  1.00 67.05  ? 106 ASP A C     1 
ATOM 581   O O     . ASP A 1 106 ? 113.332 108.466 91.506  1.00 67.05  ? 106 ASP A O     1 
ATOM 582   C CB    . ASP A 1 106 ? 113.522 108.059 94.704  1.00 67.05  ? 106 ASP A CB    1 
ATOM 583   C CG    . ASP A 1 106 ? 113.202 109.501 94.667  1.00 67.05  ? 106 ASP A CG    1 
ATOM 584   O OD1   . ASP A 1 106 ? 112.138 109.847 95.220  1.00 67.05  ? 106 ASP A OD1   1 
ATOM 585   O OD2   . ASP A 1 106 ? 113.949 110.257 94.014  1.00 67.05  ? 106 ASP A OD2   1 
ATOM 586   N N     . THR A 1 107 ? 114.723 106.773 92.032  1.00 64.23  ? 107 THR A N     1 
ATOM 587   C CA    . THR A 1 107 ? 115.445 106.942 90.775  1.00 64.23  ? 107 THR A CA    1 
ATOM 588   C C     . THR A 1 107 ? 114.625 106.440 89.595  1.00 64.23  ? 107 THR A C     1 
ATOM 589   O O     . THR A 1 107 ? 114.860 106.874 88.459  1.00 64.23  ? 107 THR A O     1 
ATOM 590   C CB    . THR A 1 107 ? 116.817 106.252 90.822  1.00 64.23  ? 107 THR A CB    1 
ATOM 591   O OG1   . THR A 1 107 ? 117.625 106.732 89.745  1.00 64.23  ? 107 THR A OG1   1 
ATOM 592   C CG2   . THR A 1 107 ? 116.708 104.765 90.664  1.00 64.23  ? 107 THR A CG2   1 
ATOM 593   N N     . ASN A 1 108 ? 113.631 105.581 89.851  1.00 65.27  ? 108 ASN A N     1 
ATOM 594   C CA    . ASN A 1 108 ? 112.701 105.202 88.801  1.00 65.27  ? 108 ASN A CA    1 
ATOM 595   C C     . ASN A 1 108 ? 111.794 106.362 88.444  1.00 65.27  ? 108 ASN A C     1 
ATOM 596   O O     . ASN A 1 108 ? 111.524 106.599 87.262  1.00 65.27  ? 108 ASN A O     1 
ATOM 597   C CB    . ASN A 1 108 ? 111.872 104.007 89.238  1.00 65.27  ? 108 ASN A CB    1 
ATOM 598   C CG    . ASN A 1 108 ? 111.198 103.342 88.089  1.00 65.27  ? 108 ASN A CG    1 
ATOM 599   O OD1   . ASN A 1 108 ? 111.437 103.689 86.937  1.00 65.27  ? 108 ASN A OD1   1 
ATOM 600   N ND2   . ASN A 1 108 ? 110.319 102.404 88.385  1.00 65.27  ? 108 ASN A ND2   1 
ATOM 601   N N     . LEU A 1 109 ? 111.323 107.102 89.452  1.00 62.48  ? 109 LEU A N     1 
ATOM 602   C CA    . LEU A 1 109 ? 110.567 108.313 89.153  1.00 62.48  ? 109 LEU A CA    1 
ATOM 603   C C     . LEU A 1 109 ? 111.426 109.357 88.462  1.00 62.48  ? 109 LEU A C     1 
ATOM 604   O O     . LEU A 1 109 ? 110.921 110.123 87.630  1.00 62.48  ? 109 LEU A O     1 
ATOM 605   C CB    . LEU A 1 109 ? 109.982 108.880 90.429  1.00 62.48  ? 109 LEU A CB    1 
ATOM 606   C CG    . LEU A 1 109 ? 108.888 108.013 91.020  1.00 62.48  ? 109 LEU A CG    1 
ATOM 607   C CD1   . LEU A 1 109 ? 108.580 108.512 92.392  1.00 62.48  ? 109 LEU A CD1   1 
ATOM 608   C CD2   . LEU A 1 109 ? 107.672 108.107 90.136  1.00 62.48  ? 109 LEU A CD2   1 
ATOM 609   N N     . CYS A 1 110 ? 112.720 109.381 88.779  1.00 67.50  ? 110 CYS A N     1 
ATOM 610   C CA    . CYS A 1 110 ? 113.640 110.290 88.108  1.00 67.50  ? 110 CYS A CA    1 
ATOM 611   C C     . CYS A 1 110 ? 113.756 109.985 86.620  1.00 67.50  ? 110 CYS A C     1 
ATOM 612   O O     . CYS A 1 110 ? 113.561 110.869 85.779  1.00 67.50  ? 110 CYS A O     1 
ATOM 613   C CB    . CYS A 1 110 ? 115.012 110.216 88.760  1.00 67.50  ? 110 CYS A CB    1 
ATOM 614   S SG    . CYS A 1 110 ? 116.231 111.179 87.876  1.00 67.50  ? 110 CYS A SG    1 
ATOM 615   N N     . ALA A 1 111 ? 114.076 108.737 86.274  1.00 66.41  ? 111 ALA A N     1 
ATOM 616   C CA    . ALA A 1 111 ? 114.293 108.415 84.868  1.00 66.41  ? 111 ALA A CA    1 
ATOM 617   C C     . ALA A 1 111 ? 112.993 108.381 84.073  1.00 66.41  ? 111 ALA A C     1 
ATOM 618   O O     . ALA A 1 111 ? 113.011 108.650 82.869  1.00 66.41  ? 111 ALA A O     1 
ATOM 619   C CB    . ALA A 1 111 ? 115.021 107.084 84.743  1.00 66.41  ? 111 ALA A CB    1 
ATOM 620   N N     . ILE A 1 112 ? 111.867 108.043 84.708  1.00 65.75  ? 112 ILE A N     1 
ATOM 621   C CA    . ILE A 1 112 ? 110.579 108.190 84.033  1.00 65.75  ? 112 ILE A CA    1 
ATOM 622   C C     . ILE A 1 112 ? 110.281 109.658 83.788  1.00 65.75  ? 112 ILE A C     1 
ATOM 623   O O     . ILE A 1 112 ? 109.716 110.026 82.751  1.00 65.75  ? 112 ILE A O     1 
ATOM 624   C CB    . ILE A 1 112 ? 109.470 107.491 84.842  1.00 65.75  ? 112 ILE A CB    1 
ATOM 625   C CG1   . ILE A 1 112 ? 109.640 105.981 84.753  1.00 65.75  ? 112 ILE A CG1   1 
ATOM 626   C CG2   . ILE A 1 112 ? 108.072 107.853 84.363  1.00 65.75  ? 112 ILE A CG2   1 
ATOM 627   C CD1   . ILE A 1 112 ? 108.790 105.238 85.724  1.00 65.75  ? 112 ILE A CD1   1 
ATOM 628   N N     . HIS A 1 113 ? 110.757 110.531 84.665  1.00 66.07  ? 113 HIS A N     1 
ATOM 629   C CA    . HIS A 1 113 ? 110.552 111.945 84.406  1.00 66.07  ? 113 HIS A CA    1 
ATOM 630   C C     . HIS A 1 113 ? 111.474 112.493 83.308  1.00 66.07  ? 113 HIS A C     1 
ATOM 631   O O     . HIS A 1 113 ? 111.381 113.677 82.976  1.00 66.07  ? 113 HIS A O     1 
ATOM 632   C CB    . HIS A 1 113 ? 110.740 112.717 85.705  1.00 66.07  ? 113 HIS A CB    1 
ATOM 633   C CG    . HIS A 1 113 ? 110.080 114.052 85.703  1.00 66.07  ? 113 HIS A CG    1 
ATOM 634   N ND1   . HIS A 1 113 ? 108.717 114.197 85.822  1.00 66.07  ? 113 HIS A ND1   1 
ATOM 635   C CD2   . HIS A 1 113 ? 110.583 115.298 85.568  1.00 66.07  ? 113 HIS A CD2   1 
ATOM 636   C CE1   . HIS A 1 113 ? 108.410 115.479 85.781  1.00 66.07  ? 113 HIS A CE1   1 
ATOM 637   N NE2   . HIS A 1 113 ? 109.523 116.168 85.624  1.00 66.07  ? 113 HIS A NE2   1 
ATOM 638   N N     . ALA A 1 114 ? 112.349 111.672 82.728  1.00 67.04  ? 114 ALA A N     1 
ATOM 639   C CA    . ALA A 1 114 ? 113.118 112.039 81.548  1.00 67.04  ? 114 ALA A CA    1 
ATOM 640   C C     . ALA A 1 114 ? 112.563 111.415 80.276  1.00 67.04  ? 114 ALA A C     1 
ATOM 641   O O     . ALA A 1 114 ? 113.220 111.486 79.232  1.00 67.04  ? 114 ALA A O     1 
ATOM 642   C CB    . ALA A 1 114 ? 114.581 111.631 81.719  1.00 67.04  ? 114 ALA A CB    1 
ATOM 643   N N     . LYS A 1 115 ? 111.361 110.833 80.348  1.00 67.93  ? 115 LYS A N     1 
ATOM 644   C CA    . LYS A 1 115 ? 110.785 109.962 79.314  1.00 67.93  ? 115 LYS A CA    1 
ATOM 645   C C     . LYS A 1 115 ? 111.761 108.863 78.897  1.00 67.93  ? 115 LYS A C     1 
ATOM 646   O O     . LYS A 1 115 ? 112.018 108.632 77.716  1.00 67.93  ? 115 LYS A O     1 
ATOM 647   C CB    . LYS A 1 115 ? 110.287 110.768 78.117  1.00 67.93  ? 115 LYS A CB    1 
ATOM 648   C CG    . LYS A 1 115 ? 109.003 111.527 78.415  1.00 67.93  ? 115 LYS A CG    1 
ATOM 649   C CD    . LYS A 1 115 ? 108.507 112.278 77.190  1.00 67.93  ? 115 LYS A CD    1 
ATOM 650   C CE    . LYS A 1 115 ? 107.217 113.030 77.460  1.00 67.93  ? 115 LYS A CE    1 
ATOM 651   N NZ    . LYS A 1 115 ? 106.070 112.098 77.612  1.00 67.93  ? 115 LYS A NZ    1 
ATOM 652   N N     . ARG A 1 116 ? 112.324 108.201 79.906  1.00 69.42  ? 116 ARG A N     1 
ATOM 653   C CA    . ARG A 1 116 ? 113.128 106.999 79.761  1.00 69.42  ? 116 ARG A CA    1 
ATOM 654   C C     . ARG A 1 116 ? 112.562 105.918 80.667  1.00 69.42  ? 116 ARG A C     1 
ATOM 655   O O     . ARG A 1 116 ? 111.900 106.202 81.666  1.00 69.42  ? 116 ARG A O     1 
ATOM 656   C CB    . ARG A 1 116 ? 114.605 107.239 80.110  1.00 69.42  ? 116 ARG A CB    1 
ATOM 657   C CG    . ARG A 1 116 ? 115.361 108.029 79.069  1.00 69.42  ? 116 ARG A CG    1 
ATOM 658   C CD    . ARG A 1 116 ? 116.870 108.063 79.328  1.00 69.42  ? 116 ARG A CD    1 
ATOM 659   N NE    . ARG A 1 116 ? 117.296 108.963 80.398  1.00 69.42  ? 116 ARG A NE    1 
ATOM 660   C CZ    . ARG A 1 116 ? 117.922 108.575 81.502  1.00 69.42  ? 116 ARG A CZ    1 
ATOM 661   N NH1   . ARG A 1 116 ? 118.189 107.298 81.691  1.00 69.42  ? 116 ARG A NH1   1 
ATOM 662   N NH2   . ARG A 1 116 ? 118.283 109.462 82.414  1.00 69.42  ? 116 ARG A NH2   1 
ATOM 663   N N     . VAL A 1 117 ? 112.821 104.665 80.307  1.00 66.83  ? 117 VAL A N     1 
ATOM 664   C CA    . VAL A 1 117 ? 112.375 103.542 81.121  1.00 66.83  ? 117 VAL A CA    1 
ATOM 665   C C     . VAL A 1 117 ? 113.588 102.733 81.545  1.00 66.83  ? 117 VAL A C     1 
ATOM 666   O O     . VAL A 1 117 ? 113.505 101.517 81.738  1.00 66.83  ? 117 VAL A O     1 
ATOM 667   C CB    . VAL A 1 117 ? 111.344 102.670 80.377  1.00 66.83  ? 117 VAL A CB    1 
ATOM 668   C CG1   . VAL A 1 117 ? 110.057 103.433 80.176  1.00 66.83  ? 117 VAL A CG1   1 
ATOM 669   C CG2   . VAL A 1 117 ? 111.874 102.227 79.031  1.00 66.83  ? 117 VAL A CG2   1 
ATOM 670   N N     . THR A 1 118 ? 114.724 103.398 81.704  1.00 67.08  ? 118 THR A N     1 
ATOM 671   C CA    . THR A 1 118 ? 115.935 102.700 82.103  1.00 67.08  ? 118 THR A CA    1 
ATOM 672   C C     . THR A 1 118 ? 116.713 103.537 83.103  1.00 67.08  ? 118 THR A C     1 
ATOM 673   O O     . THR A 1 118 ? 116.972 104.719 82.866  1.00 67.08  ? 118 THR A O     1 
ATOM 674   C CB    . THR A 1 118 ? 116.795 102.369 80.885  1.00 67.08  ? 118 THR A CB    1 
ATOM 675   O OG1   . THR A 1 118 ? 116.044 101.526 80.008  1.00 67.08  ? 118 THR A OG1   1 
ATOM 676   C CG2   . THR A 1 118 ? 118.066 101.656 81.295  1.00 67.08  ? 118 THR A CG2   1 
ATOM 677   N N     . ILE A 1 119 ? 117.065 102.918 84.224  1.00 65.35  ? 119 ILE A N     1 
ATOM 678   C CA    . ILE A 1 119 ? 117.859 103.579 85.243  1.00 65.35  ? 119 ILE A CA    1 
ATOM 679   C C     . ILE A 1 119 ? 119.282 103.751 84.739  1.00 65.35  ? 119 ILE A C     1 
ATOM 680   O O     . ILE A 1 119 ? 119.912 102.794 84.283  1.00 65.35  ? 119 ILE A O     1 
ATOM 681   C CB    . ILE A 1 119 ? 117.830 102.761 86.536  1.00 65.35  ? 119 ILE A CB    1 
ATOM 682   C CG1   . ILE A 1 119 ? 116.389 102.510 86.936  1.00 65.35  ? 119 ILE A CG1   1 
ATOM 683   C CG2   . ILE A 1 119 ? 118.568 103.468 87.639  1.00 65.35  ? 119 ILE A CG2   1 
ATOM 684   C CD1   . ILE A 1 119 ? 115.604 103.744 87.127  1.00 65.35  ? 119 ILE A CD1   1 
ATOM 685   N N     . MET A 1 120 ? 119.793 104.969 84.821  1.00 74.01  ? 120 MET A N     1 
ATOM 686   C CA    . MET A 1 120 ? 121.162 105.302 84.469  1.00 74.01  ? 120 MET A CA    1 
ATOM 687   C C     . MET A 1 120 ? 121.808 106.000 85.657  1.00 74.01  ? 120 MET A C     1 
ATOM 688   O O     . MET A 1 120 ? 121.089 106.557 86.486  1.00 74.01  ? 120 MET A O     1 
ATOM 689   C CB    . MET A 1 120 ? 121.182 106.178 83.209  1.00 74.01  ? 120 MET A CB    1 
ATOM 690   C CG    . MET A 1 120 ? 120.901 105.384 81.950  1.00 74.01  ? 120 MET A CG    1 
ATOM 691   S SD    . MET A 1 120 ? 120.879 106.403 80.473  1.00 74.01  ? 120 MET A SD    1 
ATOM 692   C CE    . MET A 1 120 ? 122.615 106.804 80.347  1.00 74.01  ? 120 MET A CE    1 
ATOM 693   N N     . PRO A 1 121 ? 123.146 105.952 85.800  1.00 73.40  ? 121 PRO A N     1 
ATOM 694   C CA    . PRO A 1 121 ? 123.748 106.317 87.096  1.00 73.40  ? 121 PRO A CA    1 
ATOM 695   C C     . PRO A 1 121 ? 123.596 107.776 87.483  1.00 73.40  ? 121 PRO A C     1 
ATOM 696   O O     . PRO A 1 121 ? 123.560 108.083 88.683  1.00 73.40  ? 121 PRO A O     1 
ATOM 697   C CB    . PRO A 1 121 ? 125.225 105.955 86.911  1.00 73.40  ? 121 PRO A CB    1 
ATOM 698   C CG    . PRO A 1 121 ? 125.238 104.964 85.842  1.00 73.40  ? 121 PRO A CG    1 
ATOM 699   C CD    . PRO A 1 121 ? 124.171 105.385 84.907  1.00 73.40  ? 121 PRO A CD    1 
ATOM 700   N N     . LYS A 1 122 ? 123.468 108.681 86.514  1.00 75.17  ? 122 LYS A N     1 
ATOM 701   C CA    . LYS A 1 122 ? 123.225 110.076 86.857  1.00 75.17  ? 122 LYS A CA    1 
ATOM 702   C C     . LYS A 1 122 ? 121.841 110.293 87.452  1.00 75.17  ? 122 LYS A C     1 
ATOM 703   O O     . LYS A 1 122 ? 121.642 111.277 88.170  1.00 75.17  ? 122 LYS A O     1 
ATOM 704   C CB    . LYS A 1 122 ? 123.438 110.965 85.633  1.00 75.17  ? 122 LYS A CB    1 
ATOM 705   C CG    . LYS A 1 122 ? 122.527 110.690 84.456  1.00 75.17  ? 122 LYS A CG    1 
ATOM 706   C CD    . LYS A 1 122 ? 122.881 111.612 83.296  1.00 75.17  ? 122 LYS A CD    1 
ATOM 707   C CE    . LYS A 1 122 ? 122.076 111.309 82.048  1.00 75.17  ? 122 LYS A CE    1 
ATOM 708   N NZ    . LYS A 1 122 ? 120.630 111.609 82.223  1.00 75.17  ? 122 LYS A NZ    1 
ATOM 709   N N     . ASP A 1 123 ? 120.898 109.381 87.208  1.00 74.11  ? 123 ASP A N     1 
ATOM 710   C CA    . ASP A 1 123 ? 119.607 109.457 87.881  1.00 74.11  ? 123 ASP A CA    1 
ATOM 711   C C     . ASP A 1 123 ? 119.741 109.099 89.356  1.00 74.11  ? 123 ASP A C     1 
ATOM 712   O O     . ASP A 1 123 ? 119.127 109.745 90.219  1.00 74.11  ? 123 ASP A O     1 
ATOM 713   C CB    . ASP A 1 123 ? 118.617 108.527 87.194  1.00 74.11  ? 123 ASP A CB    1 
ATOM 714   C CG    . ASP A 1 123 ? 118.402 108.880 85.744  1.00 74.11  ? 123 ASP A CG    1 
ATOM 715   O OD1   . ASP A 1 123 ? 118.496 110.069 85.408  1.00 74.11  ? 123 ASP A OD1   1 
ATOM 716   O OD2   . ASP A 1 123 ? 118.173 107.963 84.928  1.00 74.11  ? 123 ASP A OD2   1 
ATOM 717   N N     . ILE A 1 124 ? 120.533 108.063 89.648  1.00 73.12  ? 124 ILE A N     1 
ATOM 718   C CA    . ILE A 1 124 ? 120.883 107.705 91.020  1.00 73.12  ? 124 ILE A CA    1 
ATOM 719   C C     . ILE A 1 124 ? 121.527 108.885 91.729  1.00 73.12  ? 124 ILE A C     1 
ATOM 720   O O     . ILE A 1 124 ? 121.165 109.227 92.866  1.00 73.12  ? 124 ILE A O     1 
ATOM 721   C CB    . ILE A 1 124 ? 121.822 106.488 91.009  1.00 73.12  ? 124 ILE A CB    1 
ATOM 722   C CG1   . ILE A 1 124 ? 121.146 105.306 90.323  1.00 73.12  ? 124 ILE A CG1   1 
ATOM 723   C CG2   . ILE A 1 124 ? 122.259 106.130 92.409  1.00 73.12  ? 124 ILE A CG2   1 
ATOM 724   C CD1   . ILE A 1 124 ? 122.100 104.187 89.992  1.00 73.12  ? 124 ILE A CD1   1 
ATOM 725   N N     . GLN A 1 125 ? 122.460 109.551 91.041  1.00 73.17  ? 125 GLN A N     1 
ATOM 726   C CA    . GLN A 1 125 ? 123.108 110.738 91.585  1.00 73.17  ? 125 GLN A CA    1 
ATOM 727   C C     . GLN A 1 125 ? 122.116 111.871 91.810  1.00 73.17  ? 125 GLN A C     1 
ATOM 728   O O     . GLN A 1 125 ? 122.255 112.629 92.783  1.00 73.17  ? 125 GLN A O     1 
ATOM 729   C CB    . GLN A 1 125 ? 124.230 111.161 90.644  1.00 73.17  ? 125 GLN A CB    1 
ATOM 730   C CG    . GLN A 1 125 ? 125.315 110.102 90.555  1.00 73.17  ? 125 GLN A CG    1 
ATOM 731   C CD    . GLN A 1 125 ? 126.331 110.359 89.466  1.00 73.17  ? 125 GLN A CD    1 
ATOM 732   O OE1   . GLN A 1 125 ? 126.237 111.333 88.725  1.00 73.17  ? 125 GLN A OE1   1 
ATOM 733   N NE2   . GLN A 1 125 ? 127.297 109.464 89.344  1.00 73.17  ? 125 GLN A NE2   1 
ATOM 734   N N     . LEU A 1 126 ? 121.084 111.966 90.964  1.00 69.27  ? 126 LEU A N     1 
ATOM 735   C CA    . LEU A 1 126 ? 120.077 113.002 91.157  1.00 69.27  ? 126 LEU A CA    1 
ATOM 736   C C     . LEU A 1 126 ? 119.272 112.758 92.419  1.00 69.27  ? 126 LEU A C     1 
ATOM 737   O O     . LEU A 1 126 ? 119.166 113.649 93.267  1.00 69.27  ? 126 LEU A O     1 
ATOM 738   C CB    . LEU A 1 126 ? 119.130 113.096 89.967  1.00 69.27  ? 126 LEU A CB    1 
ATOM 739   C CG    . LEU A 1 126 ? 118.211 114.299 90.200  1.00 69.27  ? 126 LEU A CG    1 
ATOM 740   C CD1   . LEU A 1 126 ? 119.028 115.580 90.176  1.00 69.27  ? 126 LEU A CD1   1 
ATOM 741   C CD2   . LEU A 1 126 ? 117.068 114.394 89.228  1.00 69.27  ? 126 LEU A CD2   1 
ATOM 742   N N     . ALA A 1 127 ? 118.711 111.553 92.567  1.00 69.37  ? 127 ALA A N     1 
ATOM 743   C CA    . ALA A 1 127 ? 117.872 111.273 93.730  1.00 69.37  ? 127 ALA A CA    1 
ATOM 744   C C     . ALA A 1 127 ? 118.655 111.330 95.033  1.00 69.37  ? 127 ALA A C     1 
ATOM 745   O O     . ALA A 1 127 ? 118.113 111.752 96.066  1.00 69.37  ? 127 ALA A O     1 
ATOM 746   C CB    . ALA A 1 127 ? 117.217 109.909 93.584  1.00 69.37  ? 127 ALA A CB    1 
ATOM 747   N N     . ARG A 1 128 ? 119.932 110.948 94.996  1.00 74.63  ? 128 ARG A N     1 
ATOM 748   C CA    . ARG A 1 128 ? 120.768 111.137 96.173  1.00 74.63  ? 128 ARG A CA    1 
ATOM 749   C C     . ARG A 1 128 ? 121.017 112.610 96.457  1.00 74.63  ? 128 ARG A C     1 
ATOM 750   O O     . ARG A 1 128 ? 121.160 112.989 97.623  1.00 74.63  ? 128 ARG A O     1 
ATOM 751   C CB    . ARG A 1 128 ? 122.087 110.391 96.012  1.00 74.63  ? 128 ARG A CB    1 
ATOM 752   C CG    . ARG A 1 128 ? 121.909 108.898 96.015  1.00 74.63  ? 128 ARG A CG    1 
ATOM 753   C CD    . ARG A 1 128 ? 123.212 108.161 95.817  1.00 74.63  ? 128 ARG A CD    1 
ATOM 754   N NE    . ARG A 1 128 ? 124.124 108.284 96.950  1.00 74.63  ? 128 ARG A NE    1 
ATOM 755   C CZ    . ARG A 1 128 ? 125.326 108.842 96.882  1.00 74.63  ? 128 ARG A CZ    1 
ATOM 756   N NH1   . ARG A 1 128 ? 125.770 109.317 95.729  1.00 74.63  ? 128 ARG A NH1   1 
ATOM 757   N NH2   . ARG A 1 128 ? 126.091 108.905 97.962  1.00 74.63  ? 128 ARG A NH2   1 
ATOM 758   N N     . ARG A 1 129 ? 121.060 113.460 95.431  1.00 72.78  ? 129 ARG A N     1 
ATOM 759   C CA    . ARG A 1 129 ? 121.219 114.874 95.752  1.00 72.78  ? 129 ARG A CA    1 
ATOM 760   C C     . ARG A 1 129 ? 119.927 115.480 96.290  1.00 72.78  ? 129 ARG A C     1 
ATOM 761   O O     . ARG A 1 129 ? 119.971 116.313 97.200  1.00 72.78  ? 129 ARG A O     1 
ATOM 762   C CB    . ARG A 1 129 ? 121.700 115.657 94.538  1.00 72.78  ? 129 ARG A CB    1 
ATOM 763   C CG    . ARG A 1 129 ? 122.109 117.088 94.854  1.00 72.78  ? 129 ARG A CG    1 
ATOM 764   C CD    . ARG A 1 129 ? 122.460 117.837 93.581  1.00 72.78  ? 129 ARG A CD    1 
ATOM 765   N NE    . ARG A 1 129 ? 123.672 117.362 92.920  1.00 72.78  ? 129 ARG A NE    1 
ATOM 766   C CZ    . ARG A 1 129 ? 124.874 117.903 93.084  1.00 72.78  ? 129 ARG A CZ    1 
ATOM 767   N NH1   . ARG A 1 129 ? 125.029 118.965 93.864  1.00 72.78  ? 129 ARG A NH1   1 
ATOM 768   N NH2   . ARG A 1 129 ? 125.916 117.398 92.443  1.00 72.78  ? 129 ARG A NH2   1 
ATOM 769   N N     . ILE A 1 130 ? 118.773 115.071 95.754  1.00 68.84  ? 130 ILE A N     1 
ATOM 770   C CA    . ILE A 1 130 ? 117.511 115.675 96.178  1.00 68.84  ? 130 ILE A CA    1 
ATOM 771   C C     . ILE A 1 130 ? 117.148 115.222 97.587  1.00 68.84  ? 130 ILE A C     1 
ATOM 772   O O     . ILE A 1 130 ? 116.598 115.998 98.377  1.00 68.84  ? 130 ILE A O     1 
ATOM 773   C CB    . ILE A 1 130 ? 116.390 115.363 95.168  1.00 68.84  ? 130 ILE A CB    1 
ATOM 774   C CG1   . ILE A 1 130 ? 116.809 115.778 93.770  1.00 68.84  ? 130 ILE A CG1   1 
ATOM 775   C CG2   . ILE A 1 130 ? 115.143 116.141 95.484  1.00 68.84  ? 130 ILE A CG2   1 
ATOM 776   C CD1   . ILE A 1 130 ? 117.146 117.228 93.659  1.00 68.84  ? 130 ILE A CD1   1 
ATOM 777   N N     . ARG A 1 131 ? 117.505 113.994 97.956  1.00 70.85  ? 131 ARG A N     1 
ATOM 778   C CA    . ARG A 1 131 ? 117.329 113.628 99.357  1.00 70.85  ? 131 ARG A CA    1 
ATOM 779   C C     . ARG A 1 131 ? 118.343 114.281 100.285 1.00 70.85  ? 131 ARG A C     1 
ATOM 780   O O     . ARG A 1 131 ? 118.237 114.092 101.499 1.00 70.85  ? 131 ARG A O     1 
ATOM 781   C CB    . ARG A 1 131 ? 117.421 112.116 99.543  1.00 70.85  ? 131 ARG A CB    1 
ATOM 782   C CG    . ARG A 1 131 ? 116.252 111.315 99.040  1.00 70.85  ? 131 ARG A CG    1 
ATOM 783   C CD    . ARG A 1 131 ? 116.502 109.859 99.328  1.00 70.85  ? 131 ARG A CD    1 
ATOM 784   N NE    . ARG A 1 131 ? 115.401 109.018 98.895  1.00 70.85  ? 131 ARG A NE    1 
ATOM 785   C CZ    . ARG A 1 131 ? 115.422 107.695 98.945  1.00 70.85  ? 131 ARG A CZ    1 
ATOM 786   N NH1   . ARG A 1 131 ? 116.491 107.068 99.402  1.00 70.85  ? 131 ARG A NH1   1 
ATOM 787   N NH2   . ARG A 1 131 ? 114.378 106.999 98.529  1.00 70.85  ? 131 ARG A NH2   1 
ATOM 788   N N     . GLY A 1 132 ? 119.323 115.015 99.772  1.00 76.00  ? 132 GLY A N     1 
ATOM 789   C CA    . GLY A 1 132 ? 120.301 115.638 100.635 1.00 76.00  ? 132 GLY A CA    1 
ATOM 790   C C     . GLY A 1 132 ? 121.373 114.683 101.112 1.00 76.00  ? 132 GLY A C     1 
ATOM 791   O O     . GLY A 1 132 ? 121.490 114.414 102.309 1.00 76.00  ? 132 GLY A O     1 
ATOM 792   N N     . GLU A 1 133 ? 122.146 114.143 100.177 1.00 79.44  ? 133 GLU A N     1 
ATOM 793   C CA    . GLU A 1 133 ? 123.341 113.378 100.504 1.00 79.44  ? 133 GLU A CA    1 
ATOM 794   C C     . GLU A 1 133 ? 124.597 114.027 99.948  1.00 79.44  ? 133 GLU A C     1 
ATOM 795   O O     . GLU A 1 133 ? 125.541 114.291 100.700 1.00 79.44  ? 133 GLU A O     1 
ATOM 796   C CB    . GLU A 1 133 ? 123.201 111.943 99.980  1.00 79.44  ? 133 GLU A CB    1 
ATOM 797   C CG    . GLU A 1 133 ? 122.049 111.192 100.619 1.00 79.44  ? 133 GLU A CG    1 
ATOM 798   C CD    . GLU A 1 133 ? 121.891 109.790 100.083 1.00 79.44  ? 133 GLU A CD    1 
ATOM 799   O OE1   . GLU A 1 133 ? 122.637 109.416 99.160  1.00 79.44  ? 133 GLU A OE1   1 
ATOM 800   O OE2   . GLU A 1 133 ? 121.006 109.063 100.577 1.00 79.44  ? 133 GLU A OE2   1 
ATOM 801   N N     . ARG A 1 134 ? 124.629 114.303 98.649  1.00 80.12  ? 134 ARG A N     1 
ATOM 802   C CA    . ARG A 1 134 ? 125.702 115.078 98.038  1.00 80.12  ? 134 ARG A CA    1 
ATOM 803   C C     . ARG A 1 134 ? 125.131 116.079 97.038  1.00 80.12  ? 134 ARG A C     1 
ATOM 804   O O     . ARG A 1 134 ? 124.261 116.886 97.373  1.00 80.12  ? 134 ARG A O     1 
ATOM 805   C CB    . ARG A 1 134 ? 126.716 114.165 97.347  1.00 80.12  ? 134 ARG A CB    1 
ATOM 806   C CG    . ARG A 1 134 ? 127.597 113.381 98.302  1.00 80.12  ? 134 ARG A CG    1 
ATOM 807   C CD    . ARG A 1 134 ? 128.582 112.482 97.580  1.00 80.12  ? 134 ARG A CD    1 
ATOM 808   N NE    . ARG A 1 134 ? 129.422 111.750 98.521  1.00 80.12  ? 134 ARG A NE    1 
ATOM 809   C CZ    . ARG A 1 134 ? 130.335 110.854 98.169  1.00 80.12  ? 134 ARG A CZ    1 
ATOM 810   N NH1   . ARG A 1 134 ? 130.527 110.571 96.891  1.00 80.12  ? 134 ARG A NH1   1 
ATOM 811   N NH2   . ARG A 1 134 ? 131.054 110.240 99.095  1.00 80.12  ? 134 ARG A NH2   1 
ATOM 812   N N     . HIS B 2 18  ? 142.699 84.275  116.972 1.00 173.83 ? 18  HIS B N     1 
ATOM 813   C CA    . HIS B 2 18  ? 142.328 85.667  117.199 1.00 173.83 ? 18  HIS B CA    1 
ATOM 814   C C     . HIS B 2 18  ? 142.954 86.570  116.143 1.00 173.83 ? 18  HIS B C     1 
ATOM 815   O O     . HIS B 2 18  ? 143.233 87.741  116.401 1.00 173.83 ? 18  HIS B O     1 
ATOM 816   C CB    . HIS B 2 18  ? 142.757 86.117  118.596 1.00 173.83 ? 18  HIS B CB    1 
ATOM 817   C CG    . HIS B 2 18  ? 142.079 85.377  119.707 1.00 173.83 ? 18  HIS B CG    1 
ATOM 818   N ND1   . HIS B 2 18  ? 140.772 85.617  120.074 1.00 173.83 ? 18  HIS B ND1   1 
ATOM 819   C CD2   . HIS B 2 18  ? 142.527 84.402  120.532 1.00 173.83 ? 18  HIS B CD2   1 
ATOM 820   C CE1   . HIS B 2 18  ? 140.444 84.821  121.077 1.00 173.83 ? 18  HIS B CE1   1 
ATOM 821   N NE2   . HIS B 2 18  ? 141.492 84.075  121.376 1.00 173.83 ? 18  HIS B NE2   1 
ATOM 822   N N     . ARG B 2 19  ? 143.176 86.014  114.954 1.00 173.16 ? 19  ARG B N     1 
ATOM 823   C CA    . ARG B 2 19  ? 143.834 86.702  113.845 1.00 173.16 ? 19  ARG B CA    1 
ATOM 824   C C     . ARG B 2 19  ? 143.000 86.578  112.576 1.00 173.16 ? 19  ARG B C     1 
ATOM 825   O O     . ARG B 2 19  ? 143.493 86.227  111.502 1.00 173.16 ? 19  ARG B O     1 
ATOM 826   C CB    . ARG B 2 19  ? 145.239 86.151  113.625 1.00 173.16 ? 19  ARG B CB    1 
ATOM 827   C CG    . ARG B 2 19  ? 146.197 86.450  114.762 1.00 173.16 ? 19  ARG B CG    1 
ATOM 828   C CD    . ARG B 2 19  ? 147.577 85.877  114.509 1.00 173.16 ? 19  ARG B CD    1 
ATOM 829   N NE    . ARG B 2 19  ? 148.474 86.160  115.624 1.00 173.16 ? 19  ARG B NE    1 
ATOM 830   C CZ    . ARG B 2 19  ? 149.737 85.755  115.691 1.00 173.16 ? 19  ARG B CZ    1 
ATOM 831   N NH1   . ARG B 2 19  ? 150.261 85.047  114.701 1.00 173.16 ? 19  ARG B NH1   1 
ATOM 832   N NH2   . ARG B 2 19  ? 150.478 86.062  116.747 1.00 173.16 ? 19  ARG B NH2   1 
ATOM 833   N N     . LYS B 2 20  ? 141.709 86.862  112.696 1.00 163.31 ? 20  LYS B N     1 
ATOM 834   C CA    . LYS B 2 20  ? 140.782 86.729  111.581 1.00 163.31 ? 20  LYS B CA    1 
ATOM 835   C C     . LYS B 2 20  ? 140.963 87.903  110.623 1.00 163.31 ? 20  LYS B C     1 
ATOM 836   O O     . LYS B 2 20  ? 140.735 89.057  111.001 1.00 163.31 ? 20  LYS B O     1 
ATOM 837   C CB    . LYS B 2 20  ? 139.354 86.664  112.114 1.00 163.31 ? 20  LYS B CB    1 
ATOM 838   C CG    . LYS B 2 20  ? 138.288 86.370  111.082 1.00 163.31 ? 20  LYS B CG    1 
ATOM 839   C CD    . LYS B 2 20  ? 136.936 86.220  111.758 1.00 163.31 ? 20  LYS B CD    1 
ATOM 840   C CE    . LYS B 2 20  ? 135.831 85.944  110.763 1.00 163.31 ? 20  LYS B CE    1 
ATOM 841   N NZ    . LYS B 2 20  ? 134.521 85.780  111.453 1.00 163.31 ? 20  LYS B NZ    1 
ATOM 842   N N     . VAL B 2 21  ? 141.371 87.612  109.386 1.00 153.01 ? 21  VAL B N     1 
ATOM 843   C CA    . VAL B 2 21  ? 141.632 88.633  108.377 1.00 153.01 ? 21  VAL B CA    1 
ATOM 844   C C     . VAL B 2 21  ? 140.625 88.454  107.245 1.00 153.01 ? 21  VAL B C     1 
ATOM 845   O O     . VAL B 2 21  ? 140.118 87.351  107.013 1.00 153.01 ? 21  VAL B O     1 
ATOM 846   C CB    . VAL B 2 21  ? 143.101 88.561  107.882 1.00 153.01 ? 21  VAL B CB    1 
ATOM 847   C CG1   . VAL B 2 21  ? 143.360 87.315  107.041 1.00 153.01 ? 21  VAL B CG1   1 
ATOM 848   C CG2   . VAL B 2 21  ? 143.530 89.840  107.162 1.00 153.01 ? 21  VAL B CG2   1 
ATOM 849   N N     . LEU B 2 22  ? 140.307 89.553  106.557 1.00 142.69 ? 22  LEU B N     1 
ATOM 850   C CA    . LEU B 2 22  ? 139.187 89.557  105.628 1.00 142.69 ? 22  LEU B CA    1 
ATOM 851   C C     . LEU B 2 22  ? 139.317 90.730  104.664 1.00 142.69 ? 22  LEU B C     1 
ATOM 852   O O     . LEU B 2 22  ? 139.684 91.832  105.080 1.00 142.69 ? 22  LEU B O     1 
ATOM 853   C CB    . LEU B 2 22  ? 137.869 89.642  106.400 1.00 142.69 ? 22  LEU B CB    1 
ATOM 854   C CG    . LEU B 2 22  ? 136.588 89.502  105.603 1.00 142.69 ? 22  LEU B CG    1 
ATOM 855   C CD1   . LEU B 2 22  ? 136.573 88.147  104.927 1.00 142.69 ? 22  LEU B CD1   1 
ATOM 856   C CD2   . LEU B 2 22  ? 135.399 89.657  106.528 1.00 142.69 ? 22  LEU B CD2   1 
ATOM 857   N N     . ARG B 2 23  ? 138.990 90.492  103.389 1.00 132.12 ? 23  ARG B N     1 
ATOM 858   C CA    . ARG B 2 23  ? 139.145 91.503  102.347 1.00 132.12 ? 23  ARG B CA    1 
ATOM 859   C C     . ARG B 2 23  ? 138.345 91.100  101.110 1.00 132.12 ? 23  ARG B C     1 
ATOM 860   O O     . ARG B 2 23  ? 138.193 89.911  100.818 1.00 132.12 ? 23  ARG B O     1 
ATOM 861   C CB    . ARG B 2 23  ? 140.629 91.697  101.999 1.00 132.12 ? 23  ARG B CB    1 
ATOM 862   C CG    . ARG B 2 23  ? 140.955 92.869  101.091 1.00 132.12 ? 23  ARG B CG    1 
ATOM 863   C CD    . ARG B 2 23  ? 142.456 93.037  100.952 1.00 132.12 ? 23  ARG B CD    1 
ATOM 864   N NE    . ARG B 2 23  ? 143.078 91.877  100.323 1.00 132.12 ? 23  ARG B NE    1 
ATOM 865   C CZ    . ARG B 2 23  ? 144.390 91.687  100.243 1.00 132.12 ? 23  ARG B CZ    1 
ATOM 866   N NH1   . ARG B 2 23  ? 145.222 92.586  100.749 1.00 132.12 ? 23  ARG B NH1   1 
ATOM 867   N NH2   . ARG B 2 23  ? 144.870 90.600  99.657  1.00 132.12 ? 23  ARG B NH2   1 
ATOM 868   N N     . ASP B 2 24  ? 137.835 92.117  100.400 1.00 122.92 ? 24  ASP B N     1 
ATOM 869   C CA    . ASP B 2 24  ? 137.148 92.008  99.106  1.00 122.92 ? 24  ASP B CA    1 
ATOM 870   C C     . ASP B 2 24  ? 135.889 91.140  99.192  1.00 122.92 ? 24  ASP B C     1 
ATOM 871   O O     . ASP B 2 24  ? 135.807 90.043  98.642  1.00 122.92 ? 24  ASP B O     1 
ATOM 872   C CB    . ASP B 2 24  ? 138.086 91.498  98.006  1.00 122.92 ? 24  ASP B CB    1 
ATOM 873   C CG    . ASP B 2 24  ? 139.037 92.564  97.517  1.00 122.92 ? 24  ASP B CG    1 
ATOM 874   O OD1   . ASP B 2 24  ? 138.672 93.756  97.589  1.00 122.92 ? 24  ASP B OD1   1 
ATOM 875   O OD2   . ASP B 2 24  ? 140.140 92.216  97.048  1.00 122.92 ? 24  ASP B OD2   1 
ATOM 876   N N     . ASN B 2 25  ? 134.908 91.668  99.917  1.00 111.92 ? 25  ASN B N     1 
ATOM 877   C CA    . ASN B 2 25  ? 133.565 91.110  99.915  1.00 111.92 ? 25  ASN B CA    1 
ATOM 878   C C     . ASN B 2 25  ? 132.561 91.983  99.184  1.00 111.92 ? 25  ASN B C     1 
ATOM 879   O O     . ASN B 2 25  ? 131.391 91.602  99.094  1.00 111.92 ? 25  ASN B O     1 
ATOM 880   C CB    . ASN B 2 25  ? 133.071 90.885  101.343 1.00 111.92 ? 25  ASN B CB    1 
ATOM 881   C CG    . ASN B 2 25  ? 133.794 89.769  102.035 1.00 111.92 ? 25  ASN B CG    1 
ATOM 882   O OD1   . ASN B 2 25  ? 133.987 88.690  101.480 1.00 111.92 ? 25  ASN B OD1   1 
ATOM 883   N ND2   . ASN B 2 25  ? 134.227 90.030  103.254 1.00 111.92 ? 25  ASN B ND2   1 
ATOM 884   N N     . ILE B 2 26  ? 132.973 93.142  98.669  1.00 96.56  ? 26  ILE B N     1 
ATOM 885   C CA    . ILE B 2 26  ? 132.008 94.043  98.060  1.00 96.56  ? 26  ILE B CA    1 
ATOM 886   C C     . ILE B 2 26  ? 131.523 93.512  96.720  1.00 96.56  ? 26  ILE B C     1 
ATOM 887   O O     . ILE B 2 26  ? 130.393 93.796  96.318  1.00 96.56  ? 26  ILE B O     1 
ATOM 888   C CB    . ILE B 2 26  ? 132.614 95.458  97.956  1.00 96.56  ? 26  ILE B CB    1 
ATOM 889   C CG1   . ILE B 2 26  ? 131.554 96.494  97.582  1.00 96.56  ? 26  ILE B CG1   1 
ATOM 890   C CG2   . ILE B 2 26  ? 133.782 95.495  96.990  1.00 96.56  ? 26  ILE B CG2   1 
ATOM 891   C CD1   . ILE B 2 26  ? 132.030 97.908  97.705  1.00 96.56  ? 26  ILE B CD1   1 
ATOM 892   N N     . GLN B 2 27  ? 132.304 92.667  96.056  1.00 94.83  ? 27  GLN B N     1 
ATOM 893   C CA    . GLN B 2 27  ? 131.816 92.033  94.843  1.00 94.83  ? 27  GLN B CA    1 
ATOM 894   C C     . GLN B 2 27  ? 130.882 90.869  95.133  1.00 94.83  ? 27  GLN B C     1 
ATOM 895   O O     . GLN B 2 27  ? 130.306 90.312  94.194  1.00 94.83  ? 27  GLN B O     1 
ATOM 896   C CB    . GLN B 2 27  ? 132.982 91.550  93.979  1.00 94.83  ? 27  GLN B CB    1 
ATOM 897   C CG    . GLN B 2 27  ? 133.877 92.657  93.436  1.00 94.83  ? 27  GLN B CG    1 
ATOM 898   C CD    . GLN B 2 27  ? 133.130 93.659  92.573  1.00 94.83  ? 27  GLN B CD    1 
ATOM 899   O OE1   . GLN B 2 27  ? 132.995 94.824  92.939  1.00 94.83  ? 27  GLN B OE1   1 
ATOM 900   N NE2   . GLN B 2 27  ? 132.627 93.207  91.432  1.00 94.83  ? 27  GLN B NE2   1 
ATOM 901   N N     . GLY B 2 28  ? 130.724 90.488  96.403  1.00 95.80  ? 28  GLY B N     1 
ATOM 902   C CA    . GLY B 2 28  ? 129.821 89.411  96.764  1.00 95.80  ? 28  GLY B CA    1 
ATOM 903   C C     . GLY B 2 28  ? 128.358 89.744  96.578  1.00 95.80  ? 28  GLY B C     1 
ATOM 904   O O     . GLY B 2 28  ? 127.536 88.832  96.450  1.00 95.80  ? 28  GLY B O     1 
ATOM 905   N N     . ILE B 2 29  ? 128.010 91.026  96.575  1.00 88.82  ? 29  ILE B N     1 
ATOM 906   C CA    . ILE B 2 29  ? 126.666 91.448  96.202  1.00 88.82  ? 29  ILE B CA    1 
ATOM 907   C C     . ILE B 2 29  ? 126.573 91.298  94.692  1.00 88.82  ? 29  ILE B C     1 
ATOM 908   O O     . ILE B 2 29  ? 127.204 92.046  93.943  1.00 88.82  ? 29  ILE B O     1 
ATOM 909   C CB    . ILE B 2 29  ? 126.367 92.883  96.643  1.00 88.82  ? 29  ILE B CB    1 
ATOM 910   C CG1   . ILE B 2 29  ? 126.310 92.982  98.169  1.00 88.82  ? 29  ILE B CG1   1 
ATOM 911   C CG2   . ILE B 2 29  ? 125.059 93.356  96.053  1.00 88.82  ? 29  ILE B CG2   1 
ATOM 912   C CD1   . ILE B 2 29  ? 127.594 93.410  98.817  1.00 88.82  ? 29  ILE B CD1   1 
ATOM 913   N N     . THR B 2 30  ? 125.810 90.315  94.243  1.00 88.47  ? 30  THR B N     1 
ATOM 914   C CA    . THR B 2 30  ? 125.872 89.932  92.849  1.00 88.47  ? 30  THR B CA    1 
ATOM 915   C C     . THR B 2 30  ? 125.031 90.864  91.994  1.00 88.47  ? 30  THR B C     1 
ATOM 916   O O     . THR B 2 30  ? 124.149 91.572  92.482  1.00 88.47  ? 30  THR B O     1 
ATOM 917   C CB    . THR B 2 30  ? 125.376 88.510  92.665  1.00 88.47  ? 30  THR B CB    1 
ATOM 918   O OG1   . THR B 2 30  ? 123.961 88.480  92.871  1.00 88.47  ? 30  THR B OG1   1 
ATOM 919   C CG2   . THR B 2 30  ? 126.029 87.612  93.680  1.00 88.47  ? 30  THR B CG2   1 
ATOM 920   N N     . LYS B 2 31  ? 125.332 90.853  90.699  1.00 85.92  ? 31  LYS B N     1 
ATOM 921   C CA    . LYS B 2 31  ? 124.496 91.514  89.698  1.00 85.92  ? 31  LYS B CA    1 
ATOM 922   C C     . LYS B 2 31  ? 123.032 91.076  89.721  1.00 85.92  ? 31  LYS B C     1 
ATOM 923   O O     . LYS B 2 31  ? 122.161 91.966  89.725  1.00 85.92  ? 31  LYS B O     1 
ATOM 924   C CB    . LYS B 2 31  ? 125.156 91.325  88.323  1.00 85.92  ? 31  LYS B CB    1 
ATOM 925   C CG    . LYS B 2 31  ? 124.407 91.935  87.161  1.00 85.92  ? 31  LYS B CG    1 
ATOM 926   C CD    . LYS B 2 31  ? 125.117 91.655  85.843  1.00 85.92  ? 31  LYS B CD    1 
ATOM 927   C CE    . LYS B 2 31  ? 124.429 92.336  84.666  1.00 85.92  ? 31  LYS B CE    1 
ATOM 928   N NZ    . LYS B 2 31  ? 123.069 91.795  84.391  1.00 85.92  ? 31  LYS B NZ    1 
ATOM 929   N N     . PRO B 2 32  ? 122.666 89.778  89.778  1.00 86.64  ? 32  PRO B N     1 
ATOM 930   C CA    . PRO B 2 32  ? 121.239 89.461  89.910  1.00 86.64  ? 32  PRO B CA    1 
ATOM 931   C C     . PRO B 2 32  ? 120.643 89.833  91.248  1.00 86.64  ? 32  PRO B C     1 
ATOM 932   O O     . PRO B 2 32  ? 119.422 89.978  91.320  1.00 86.64  ? 32  PRO B O     1 
ATOM 933   C CB    . PRO B 2 32  ? 121.180 87.945  89.693  1.00 86.64  ? 32  PRO B CB    1 
ATOM 934   C CG    . PRO B 2 32  ? 122.476 87.475  90.041  1.00 86.64  ? 32  PRO B CG    1 
ATOM 935   C CD    . PRO B 2 32  ? 123.418 88.521  89.577  1.00 86.64  ? 32  PRO B CD    1 
ATOM 936   N N     . ALA B 2 33  ? 121.443 90.001  92.302  1.00 85.54  ? 33  ALA B N     1 
ATOM 937   C CA    . ALA B 2 33  ? 120.873 90.424  93.578  1.00 85.54  ? 33  ALA B CA    1 
ATOM 938   C C     . ALA B 2 33  ? 120.423 91.877  93.526  1.00 85.54  ? 33  ALA B C     1 
ATOM 939   O O     . ALA B 2 33  ? 119.332 92.215  94.001  1.00 85.54  ? 33  ALA B O     1 
ATOM 940   C CB    . ALA B 2 33  ? 121.883 90.213  94.695  1.00 85.54  ? 33  ALA B CB    1 
ATOM 941   N N     . ILE B 2 34  ? 121.242 92.744  92.931  1.00 83.14  ? 34  ILE B N     1 
ATOM 942   C CA    . ILE B 2 34  ? 120.836 94.119  92.678  1.00 83.14  ? 34  ILE B CA    1 
ATOM 943   C C     . ILE B 2 34  ? 119.674 94.161  91.692  1.00 83.14  ? 34  ILE B C     1 
ATOM 944   O O     . ILE B 2 34  ? 118.781 95.014  91.813  1.00 83.14  ? 34  ILE B O     1 
ATOM 945   C CB    . ILE B 2 34  ? 122.061 94.925  92.205  1.00 83.14  ? 34  ILE B CB    1 
ATOM 946   C CG1   . ILE B 2 34  ? 123.063 95.023  93.343  1.00 83.14  ? 34  ILE B CG1   1 
ATOM 947   C CG2   . ILE B 2 34  ? 121.703 96.318  91.748  1.00 83.14  ? 34  ILE B CG2   1 
ATOM 948   C CD1   . ILE B 2 34  ? 124.383 95.571  92.915  1.00 83.14  ? 34  ILE B CD1   1 
ATOM 949   N N     . ARG B 2 35  ? 119.631 93.220  90.738  1.00 82.07  ? 35  ARG B N     1 
ATOM 950   C CA    . ARG B 2 35  ? 118.443 93.089  89.899  1.00 82.07  ? 35  ARG B CA    1 
ATOM 951   C C     . ARG B 2 35  ? 117.211 92.745  90.724  1.00 82.07  ? 35  ARG B C     1 
ATOM 952   O O     . ARG B 2 35  ? 116.137 93.301  90.490  1.00 82.07  ? 35  ARG B O     1 
ATOM 953   C CB    . ARG B 2 35  ? 118.660 92.039  88.814  1.00 82.07  ? 35  ARG B CB    1 
ATOM 954   C CG    . ARG B 2 35  ? 119.629 92.463  87.738  1.00 82.07  ? 35  ARG B CG    1 
ATOM 955   C CD    . ARG B 2 35  ? 119.879 91.369  86.709  1.00 82.07  ? 35  ARG B CD    1 
ATOM 956   N NE    . ARG B 2 35  ? 118.712 91.091  85.882  1.00 82.07  ? 35  ARG B NE    1 
ATOM 957   C CZ    . ARG B 2 35  ? 118.024 89.958  85.932  1.00 82.07  ? 35  ARG B CZ    1 
ATOM 958   N NH1   . ARG B 2 35  ? 118.384 89.005  86.773  1.00 82.07  ? 35  ARG B NH1   1 
ATOM 959   N NH2   . ARG B 2 35  ? 116.974 89.779  85.149  1.00 82.07  ? 35  ARG B NH2   1 
ATOM 960   N N     . ARG B 2 36  ? 117.356 91.880  91.725  1.00 81.36  ? 36  ARG B N     1 
ATOM 961   C CA    . ARG B 2 36  ? 116.189 91.464  92.493  1.00 81.36  ? 36  ARG B CA    1 
ATOM 962   C C     . ARG B 2 36  ? 115.690 92.585  93.390  1.00 81.36  ? 36  ARG B C     1 
ATOM 963   O O     . ARG B 2 36  ? 114.478 92.765  93.543  1.00 81.36  ? 36  ARG B O     1 
ATOM 964   C CB    . ARG B 2 36  ? 116.499 90.217  93.319  1.00 81.36  ? 36  ARG B CB    1 
ATOM 965   C CG    . ARG B 2 36  ? 116.654 88.927  92.517  1.00 81.36  ? 36  ARG B CG    1 
ATOM 966   C CD    . ARG B 2 36  ? 116.633 87.727  93.437  1.00 81.36  ? 36  ARG B CD    1 
ATOM 967   N NE    . ARG B 2 36  ? 117.657 87.844  94.461  1.00 81.36  ? 36  ARG B NE    1 
ATOM 968   C CZ    . ARG B 2 36  ? 118.886 87.370  94.337  1.00 81.36  ? 36  ARG B CZ    1 
ATOM 969   N NH1   . ARG B 2 36  ? 119.236 86.728  93.234  1.00 81.36  ? 36  ARG B NH1   1 
ATOM 970   N NH2   . ARG B 2 36  ? 119.760 87.529  95.319  1.00 81.36  ? 36  ARG B NH2   1 
ATOM 971   N N     . LEU B 2 37  ? 116.603 93.369  93.965  1.00 78.97  ? 37  LEU B N     1 
ATOM 972   C CA    . LEU B 2 37  ? 116.168 94.509  94.762  1.00 78.97  ? 37  LEU B CA    1 
ATOM 973   C C     . LEU B 2 37  ? 115.536 95.589  93.899  1.00 78.97  ? 37  LEU B C     1 
ATOM 974   O O     . LEU B 2 37  ? 114.554 96.220  94.314  1.00 78.97  ? 37  LEU B O     1 
ATOM 975   C CB    . LEU B 2 37  ? 117.340 95.098  95.532  1.00 78.97  ? 37  LEU B CB    1 
ATOM 976   C CG    . LEU B 2 37  ? 117.982 94.178  96.556  1.00 78.97  ? 37  LEU B CG    1 
ATOM 977   C CD1   . LEU B 2 37  ? 119.135 94.895  97.220  1.00 78.97  ? 37  LEU B CD1   1 
ATOM 978   C CD2   . LEU B 2 37  ? 116.958 93.738  97.566  1.00 78.97  ? 37  LEU B CD2   1 
ATOM 979   N N     . ALA B 2 38  ? 116.078 95.812  92.702  1.00 79.05  ? 38  ALA B N     1 
ATOM 980   C CA    . ALA B 2 38  ? 115.497 96.809  91.815  1.00 79.05  ? 38  ALA B CA    1 
ATOM 981   C C     . ALA B 2 38  ? 114.125 96.375  91.331  1.00 79.05  ? 38  ALA B C     1 
ATOM 982   O O     . ALA B 2 38  ? 113.211 97.197  91.219  1.00 79.05  ? 38  ALA B O     1 
ATOM 983   C CB    . ALA B 2 38  ? 116.422 97.066  90.631  1.00 79.05  ? 38  ALA B CB    1 
ATOM 984   N N     . ARG B 2 39  ? 113.949 95.083  91.072  1.00 77.08  ? 39  ARG B N     1 
ATOM 985   C CA    . ARG B 2 39  ? 112.637 94.615  90.658  1.00 77.08  ? 39  ARG B CA    1 
ATOM 986   C C     . ARG B 2 39  ? 111.650 94.536  91.806  1.00 77.08  ? 39  ARG B C     1 
ATOM 987   O O     . ARG B 2 39  ? 110.442 94.538  91.557  1.00 77.08  ? 39  ARG B O     1 
ATOM 988   C CB    . ARG B 2 39  ? 112.736 93.269  89.961  1.00 77.08  ? 39  ARG B CB    1 
ATOM 989   C CG    . ARG B 2 39  ? 112.819 93.392  88.468  1.00 77.08  ? 39  ARG B CG    1 
ATOM 990   C CD    . ARG B 2 39  ? 114.173 93.768  87.967  1.00 77.08  ? 39  ARG B CD    1 
ATOM 991   N NE    . ARG B 2 39  ? 114.214 93.747  86.515  1.00 77.08  ? 39  ARG B NE    1 
ATOM 992   C CZ    . ARG B 2 39  ? 114.462 92.660  85.800  1.00 77.08  ? 39  ARG B CZ    1 
ATOM 993   N NH1   . ARG B 2 39  ? 114.696 91.505  86.405  1.00 77.08  ? 39  ARG B NH1   1 
ATOM 994   N NH2   . ARG B 2 39  ? 114.474 92.731  84.480  1.00 77.08  ? 39  ARG B NH2   1 
ATOM 995   N N     . ARG B 2 40  ? 112.118 94.456  93.050  1.00 77.39  ? 40  ARG B N     1 
ATOM 996   C CA    . ARG B 2 40  ? 111.196 94.745  94.139  1.00 77.39  ? 40  ARG B CA    1 
ATOM 997   C C     . ARG B 2 40  ? 110.829 96.216  94.135  1.00 77.39  ? 40  ARG B C     1 
ATOM 998   O O     . ARG B 2 40  ? 109.675 96.571  94.385  1.00 77.39  ? 40  ARG B O     1 
ATOM 999   C CB    . ARG B 2 40  ? 111.783 94.331  95.489  1.00 77.39  ? 40  ARG B CB    1 
ATOM 1000  C CG    . ARG B 2 40  ? 110.880 94.662  96.656  1.00 77.39  ? 40  ARG B CG    1 
ATOM 1001  C CD    . ARG B 2 40  ? 111.410 94.208  97.991  1.00 77.39  ? 40  ARG B CD    1 
ATOM 1002  N NE    . ARG B 2 40  ? 111.202 92.794  98.244  1.00 77.39  ? 40  ARG B NE    1 
ATOM 1003  C CZ    . ARG B 2 40  ? 111.640 92.174  99.331  1.00 77.39  ? 40  ARG B CZ    1 
ATOM 1004  N NH1   . ARG B 2 40  ? 112.316 92.847  100.251 1.00 77.39  ? 40  ARG B NH1   1 
ATOM 1005  N NH2   . ARG B 2 40  ? 111.401 90.880  99.504  1.00 77.39  ? 40  ARG B NH2   1 
ATOM 1006  N N     . GLY B 2 41  ? 111.770 97.077  93.781  1.00 75.41  ? 41  GLY B N     1 
ATOM 1007  C CA    . GLY B 2 41  ? 111.433 98.480  93.689  1.00 75.41  ? 41  GLY B CA    1 
ATOM 1008  C C     . GLY B 2 41  ? 110.577 98.865  92.506  1.00 75.41  ? 41  GLY B C     1 
ATOM 1009  O O     . GLY B 2 41  ? 110.143 100.014 92.427  1.00 75.41  ? 41  GLY B O     1 
ATOM 1010  N N     . GLY B 2 42  ? 110.314 97.949  91.588  1.00 74.13  ? 42  GLY B N     1 
ATOM 1011  C CA    . GLY B 2 42  ? 109.574 98.318  90.402  1.00 74.13  ? 42  GLY B CA    1 
ATOM 1012  C C     . GLY B 2 42  ? 110.443 99.025  89.388  1.00 74.13  ? 42  GLY B C     1 
ATOM 1013  O O     . GLY B 2 42  ? 110.229 100.196 89.081  1.00 74.13  ? 42  GLY B O     1 
ATOM 1014  N N     . VAL B 2 43  ? 111.440 98.313  88.873  1.00 74.49  ? 43  VAL B N     1 
ATOM 1015  C CA    . VAL B 2 43  ? 112.394 98.835  87.906  1.00 74.49  ? 43  VAL B CA    1 
ATOM 1016  C C     . VAL B 2 43  ? 112.492 97.844  86.761  1.00 74.49  ? 43  VAL B C     1 
ATOM 1017  O O     . VAL B 2 43  ? 112.763 96.660  86.984  1.00 74.49  ? 43  VAL B O     1 
ATOM 1018  C CB    . VAL B 2 43  ? 113.774 99.059  88.541  1.00 74.49  ? 43  VAL B CB    1 
ATOM 1019  C CG1   . VAL B 2 43  ? 114.817 99.275  87.482  1.00 74.49  ? 43  VAL B CG1   1 
ATOM 1020  C CG2   . VAL B 2 43  ? 113.730 100.243 89.472  1.00 74.49  ? 43  VAL B CG2   1 
ATOM 1021  N N     . LYS B 2 44  ? 112.279 98.322  85.540  1.00 78.96  ? 44  LYS B N     1 
ATOM 1022  C CA    . LYS B 2 44  ? 112.204 97.423  84.398  1.00 78.96  ? 44  LYS B CA    1 
ATOM 1023  C C     . LYS B 2 44  ? 113.581 97.103  83.831  1.00 78.96  ? 44  LYS B C     1 
ATOM 1024  O O     . LYS B 2 44  ? 113.993 95.941  83.813  1.00 78.96  ? 44  LYS B O     1 
ATOM 1025  C CB    . LYS B 2 44  ? 111.309 98.038  83.326  1.00 78.96  ? 44  LYS B CB    1 
ATOM 1026  C CG    . LYS B 2 44  ? 111.041 97.163  82.139  1.00 78.96  ? 44  LYS B CG    1 
ATOM 1027  C CD    . LYS B 2 44  ? 110.078 97.876  81.228  1.00 78.96  ? 44  LYS B CD    1 
ATOM 1028  C CE    . LYS B 2 44  ? 109.799 97.097  79.977  1.00 78.96  ? 44  LYS B CE    1 
ATOM 1029  N NZ    . LYS B 2 44  ? 108.868 97.862  79.110  1.00 78.96  ? 44  LYS B NZ    1 
ATOM 1030  N N     . ARG B 2 45  ? 114.309 98.119  83.383  1.00 85.56  ? 45  ARG B N     1 
ATOM 1031  C CA    . ARG B 2 45  ? 115.554 97.928  82.655  1.00 85.56  ? 45  ARG B CA    1 
ATOM 1032  C C     . ARG B 2 45  ? 116.690 98.641  83.374  1.00 85.56  ? 45  ARG B C     1 
ATOM 1033  O O     . ARG B 2 45  ? 116.559 99.808  83.747  1.00 85.56  ? 45  ARG B O     1 
ATOM 1034  C CB    . ARG B 2 45  ? 115.407 98.431  81.219  1.00 85.56  ? 45  ARG B CB    1 
ATOM 1035  C CG    . ARG B 2 45  ? 116.586 98.149  80.313  1.00 85.56  ? 45  ARG B CG    1 
ATOM 1036  C CD    . ARG B 2 45  ? 116.231 98.470  78.868  1.00 85.56  ? 45  ARG B CD    1 
ATOM 1037  N NE    . ARG B 2 45  ? 117.333 98.261  77.931  1.00 85.56  ? 45  ARG B NE    1 
ATOM 1038  C CZ    . ARG B 2 45  ? 118.199 99.206  77.580  1.00 85.56  ? 45  ARG B CZ    1 
ATOM 1039  N NH1   . ARG B 2 45  ? 118.096 100.421 78.094  1.00 85.56  ? 45  ARG B NH1   1 
ATOM 1040  N NH2   . ARG B 2 45  ? 119.165 98.941  76.717  1.00 85.56  ? 45  ARG B NH2   1 
ATOM 1041  N N     . ILE B 2 46  ? 117.803 97.939  83.557  1.00 82.43  ? 46  ILE B N     1 
ATOM 1042  C CA    . ILE B 2 46  ? 118.930 98.407  84.353  1.00 82.43  ? 46  ILE B CA    1 
ATOM 1043  C C     . ILE B 2 46  ? 120.132 98.579  83.439  1.00 82.43  ? 46  ILE B C     1 
ATOM 1044  O O     . ILE B 2 46  ? 120.493 97.649  82.715  1.00 82.43  ? 46  ILE B O     1 
ATOM 1045  C CB    . ILE B 2 46  ? 119.254 97.405  85.472  1.00 82.43  ? 46  ILE B CB    1 
ATOM 1046  C CG1   . ILE B 2 46  ? 118.081 97.289  86.430  1.00 82.43  ? 46  ILE B CG1   1 
ATOM 1047  C CG2   . ILE B 2 46  ? 120.504 97.796  86.206  1.00 82.43  ? 46  ILE B CG2   1 
ATOM 1048  C CD1   . ILE B 2 46  ? 118.215 96.128  87.375  1.00 82.43  ? 46  ILE B CD1   1 
ATOM 1049  N N     . SER B 2 47  ? 120.785 99.736  83.506  1.00 85.03  ? 47  SER B N     1 
ATOM 1050  C CA    . SER B 2 47  ? 121.958 99.952  82.672  1.00 85.03  ? 47  SER B CA    1 
ATOM 1051  C C     . SER B 2 47  ? 123.167 99.198  83.218  1.00 85.03  ? 47  SER B C     1 
ATOM 1052  O O     . SER B 2 47  ? 123.085 98.418  84.169  1.00 85.03  ? 47  SER B O     1 
ATOM 1053  C CB    . SER B 2 47  ? 122.287 101.432 82.550  1.00 85.03  ? 47  SER B CB    1 
ATOM 1054  O OG    . SER B 2 47  ? 123.458 101.607 81.774  1.00 85.03  ? 47  SER B OG    1 
ATOM 1055  N N     . GLY B 2 48  ? 124.319 99.458  82.612  1.00 91.18  ? 48  GLY B N     1 
ATOM 1056  C CA    . GLY B 2 48  ? 125.491 98.639  82.836  1.00 91.18  ? 48  GLY B CA    1 
ATOM 1057  C C     . GLY B 2 48  ? 126.304 99.031  84.046  1.00 91.18  ? 48  GLY B C     1 
ATOM 1058  O O     . GLY B 2 48  ? 126.700 98.172  84.835  1.00 91.18  ? 48  GLY B O     1 
ATOM 1059  N N     . LEU B 2 49  ? 126.551 100.322 84.216  1.00 89.58  ? 49  LEU B N     1 
ATOM 1060  C CA    . LEU B 2 49  ? 127.370 100.778 85.326  1.00 89.58  ? 49  LEU B CA    1 
ATOM 1061  C C     . LEU B 2 49  ? 126.582 100.957 86.612  1.00 89.58  ? 49  LEU B C     1 
ATOM 1062  O O     . LEU B 2 49  ? 127.132 101.496 87.577  1.00 89.58  ? 49  LEU B O     1 
ATOM 1063  C CB    . LEU B 2 49  ? 128.057 102.090 84.956  1.00 89.58  ? 49  LEU B CB    1 
ATOM 1064  C CG    . LEU B 2 49  ? 129.083 101.997 83.830  1.00 89.58  ? 49  LEU B CG    1 
ATOM 1065  C CD1   . LEU B 2 49  ? 129.588 103.376 83.460  1.00 89.58  ? 49  LEU B CD1   1 
ATOM 1066  C CD2   . LEU B 2 49  ? 130.236 101.101 84.237  1.00 89.58  ? 49  LEU B CD2   1 
ATOM 1067  N N     . ILE B 2 50  ? 125.316 100.530 86.640  1.00 86.75  ? 50  ILE B N     1 
ATOM 1068  C CA    . ILE B 2 50  ? 124.468 100.683 87.816  1.00 86.75  ? 50  ILE B CA    1 
ATOM 1069  C C     . ILE B 2 50  ? 125.008 99.871  88.977  1.00 86.75  ? 50  ILE B C     1 
ATOM 1070  O O     . ILE B 2 50  ? 124.899 100.283 90.137  1.00 86.75  ? 50  ILE B O     1 
ATOM 1071  C CB    . ILE B 2 50  ? 123.030 100.257 87.477  1.00 86.75  ? 50  ILE B CB    1 
ATOM 1072  C CG1   . ILE B 2 50  ? 122.555 100.970 86.228  1.00 86.75  ? 50  ILE B CG1   1 
ATOM 1073  C CG2   . ILE B 2 50  ? 122.075 100.584 88.606  1.00 86.75  ? 50  ILE B CG2   1 
ATOM 1074  C CD1   . ILE B 2 50  ? 122.519 102.447 86.380  1.00 86.75  ? 50  ILE B CD1   1 
ATOM 1075  N N     . TYR B 2 51  ? 125.630 98.732  88.683  1.00 88.32  ? 51  TYR B N     1 
ATOM 1076  C CA    . TYR B 2 51  ? 125.946 97.771  89.728  1.00 88.32  ? 51  TYR B CA    1 
ATOM 1077  C C     . TYR B 2 51  ? 127.101 98.251  90.591  1.00 88.32  ? 51  TYR B C     1 
ATOM 1078  O O     . TYR B 2 51  ? 127.046 98.141  91.822  1.00 88.32  ? 51  TYR B O     1 
ATOM 1079  C CB    . TYR B 2 51  ? 126.261 96.425  89.095  1.00 88.32  ? 51  TYR B CB    1 
ATOM 1080  C CG    . TYR B 2 51  ? 125.149 95.976  88.194  1.00 88.32  ? 51  TYR B CG    1 
ATOM 1081  C CD1   . TYR B 2 51  ? 123.964 95.477  88.712  1.00 88.32  ? 51  TYR B CD1   1 
ATOM 1082  C CD2   . TYR B 2 51  ? 125.280 96.064  86.819  1.00 88.32  ? 51  TYR B CD2   1 
ATOM 1083  C CE1   . TYR B 2 51  ? 122.944 95.084  87.882  1.00 88.32  ? 51  TYR B CE1   1 
ATOM 1084  C CE2   . TYR B 2 51  ? 124.270 95.670  85.982  1.00 88.32  ? 51  TYR B CE2   1 
ATOM 1085  C CZ    . TYR B 2 51  ? 123.107 95.178  86.515  1.00 88.32  ? 51  TYR B CZ    1 
ATOM 1086  O OH    . TYR B 2 51  ? 122.099 94.784  85.670  1.00 88.32  ? 51  TYR B OH    1 
ATOM 1087  N N     . GLU B 2 52  ? 128.137 98.813  89.965  1.00 91.70  ? 52  GLU B N     1 
ATOM 1088  C CA    . GLU B 2 52  ? 129.289 99.305  90.713  1.00 91.70  ? 52  GLU B CA    1 
ATOM 1089  C C     . GLU B 2 52  ? 128.917 100.498 91.586  1.00 91.70  ? 52  GLU B C     1 
ATOM 1090  O O     . GLU B 2 52  ? 129.333 100.581 92.752  1.00 91.70  ? 52  GLU B O     1 
ATOM 1091  C CB    . GLU B 2 52  ? 130.410 99.665  89.742  1.00 91.70  ? 52  GLU B CB    1 
ATOM 1092  C CG    . GLU B 2 52  ? 131.661 100.180 90.408  1.00 91.70  ? 52  GLU B CG    1 
ATOM 1093  C CD    . GLU B 2 52  ? 132.356 99.129  91.247  1.00 91.70  ? 52  GLU B CD    1 
ATOM 1094  O OE1   . GLU B 2 52  ? 132.243 97.925  90.934  1.00 91.70  ? 52  GLU B OE1   1 
ATOM 1095  O OE2   . GLU B 2 52  ? 133.018 99.508  92.233  1.00 91.70  ? 52  GLU B OE2   1 
ATOM 1096  N N     . GLU B 2 53  ? 128.100 101.407 91.050  1.00 86.39  ? 53  GLU B N     1 
ATOM 1097  C CA    . GLU B 2 53  ? 127.597 102.519 91.842  1.00 86.39  ? 53  GLU B CA    1 
ATOM 1098  C C     . GLU B 2 53  ? 126.676 102.038 92.950  1.00 86.39  ? 53  GLU B C     1 
ATOM 1099  O O     . GLU B 2 53  ? 126.659 102.623 94.037  1.00 86.39  ? 53  GLU B O     1 
ATOM 1100  C CB    . GLU B 2 53  ? 126.877 103.517 90.937  1.00 86.39  ? 53  GLU B CB    1 
ATOM 1101  C CG    . GLU B 2 53  ? 126.345 104.749 91.644  1.00 86.39  ? 53  GLU B CG    1 
ATOM 1102  C CD    . GLU B 2 53  ? 127.442 105.614 92.231  1.00 86.39  ? 53  GLU B CD    1 
ATOM 1103  O OE1   . GLU B 2 53  ? 128.553 105.646 91.667  1.00 86.39  ? 53  GLU B OE1   1 
ATOM 1104  O OE2   . GLU B 2 53  ? 127.196 106.257 93.270  1.00 86.39  ? 53  GLU B OE2   1 
ATOM 1105  N N     . THR B 2 54  ? 125.943 100.953 92.713  1.00 82.88  ? 54  THR B N     1 
ATOM 1106  C CA    . THR B 2 54  ? 125.062 100.424 93.742  1.00 82.88  ? 54  THR B CA    1 
ATOM 1107  C C     . THR B 2 54  ? 125.867 99.839  94.889  1.00 82.88  ? 54  THR B C     1 
ATOM 1108  O O     . THR B 2 54  ? 125.519 100.031 96.063  1.00 82.88  ? 54  THR B O     1 
ATOM 1109  C CB    . THR B 2 54  ? 124.142 99.377  93.134  1.00 82.88  ? 54  THR B CB    1 
ATOM 1110  O OG1   . THR B 2 54  ? 123.463 99.956  92.018  1.00 82.88  ? 54  THR B OG1   1 
ATOM 1111  C CG2   . THR B 2 54  ? 123.111 98.943  94.130  1.00 82.88  ? 54  THR B CG2   1 
ATOM 1112  N N     . ARG B 2 55  ? 126.974 99.169  94.563  1.00 87.41  ? 55  ARG B N     1 
ATOM 1113  C CA    . ARG B 2 55  ? 127.899 98.705  95.591  1.00 87.41  ? 55  ARG B CA    1 
ATOM 1114  C C     . ARG B 2 55  ? 128.499 99.877  96.353  1.00 87.41  ? 55  ARG B C     1 
ATOM 1115  O O     . ARG B 2 55  ? 128.716 99.791  97.568  1.00 87.41  ? 55  ARG B O     1 
ATOM 1116  C CB    . ARG B 2 55  ? 129.012 97.877  94.961  1.00 87.41  ? 55  ARG B CB    1 
ATOM 1117  C CG    . ARG B 2 55  ? 128.559 96.613  94.271  1.00 87.41  ? 55  ARG B CG    1 
ATOM 1118  C CD    . ARG B 2 55  ? 129.755 95.931  93.650  1.00 87.41  ? 55  ARG B CD    1 
ATOM 1119  N NE    . ARG B 2 55  ? 129.405 94.749  92.875  1.00 87.41  ? 55  ARG B NE    1 
ATOM 1120  C CZ    . ARG B 2 55  ? 129.201 94.759  91.564  1.00 87.41  ? 55  ARG B CZ    1 
ATOM 1121  N NH1   . ARG B 2 55  ? 129.315 95.888  90.888  1.00 87.41  ? 55  ARG B NH1   1 
ATOM 1122  N NH2   . ARG B 2 55  ? 128.894 93.640  90.931  1.00 87.41  ? 55  ARG B NH2   1 
ATOM 1123  N N     . GLY B 2 56  ? 128.760 100.985 95.656  1.00 82.12  ? 56  GLY B N     1 
ATOM 1124  C CA    . GLY B 2 56  ? 129.290 102.159 96.331  1.00 82.12  ? 56  GLY B CA    1 
ATOM 1125  C C     . GLY B 2 56  ? 128.302 102.792 97.293  1.00 82.12  ? 56  GLY B C     1 
ATOM 1126  O O     . GLY B 2 56  ? 128.665 103.150 98.416  1.00 82.12  ? 56  GLY B O     1 
ATOM 1127  N N     . VAL B 2 57  ? 127.043 102.925 96.872  1.00 77.80  ? 57  VAL B N     1 
ATOM 1128  C CA    . VAL B 2 57  ? 126.028 103.549 97.713  1.00 77.80  ? 57  VAL B CA    1 
ATOM 1129  C C     . VAL B 2 57  ? 125.732 102.684 98.926  1.00 77.80  ? 57  VAL B C     1 
ATOM 1130  O O     . VAL B 2 57  ? 125.652 103.186 100.059 1.00 77.80  ? 57  VAL B O     1 
ATOM 1131  C CB    . VAL B 2 57  ? 124.762 103.826 96.889  1.00 77.80  ? 57  VAL B CB    1 
ATOM 1132  C CG1   . VAL B 2 57  ? 123.647 104.328 97.777  1.00 77.80  ? 57  VAL B CG1   1 
ATOM 1133  C CG2   . VAL B 2 57  ? 125.061 104.855 95.846  1.00 77.80  ? 57  VAL B CG2   1 
ATOM 1134  N N     . LEU B 2 58  ? 125.598 101.371 98.711  1.00 75.66  ? 58  LEU B N     1 
ATOM 1135  C CA    . LEU B 2 58  ? 125.420 100.444 99.822  1.00 75.66  ? 58  LEU B CA    1 
ATOM 1136  C C     . LEU B 2 58  ? 126.613 100.477 100.764 1.00 75.66  ? 58  LEU B C     1 
ATOM 1137  O O     . LEU B 2 58  ? 126.448 100.396 101.989 1.00 75.66  ? 58  LEU B O     1 
ATOM 1138  C CB    . LEU B 2 58  ? 125.203 99.033  99.289  1.00 75.66  ? 58  LEU B CB    1 
ATOM 1139  C CG    . LEU B 2 58  ? 125.048 97.932  100.331 1.00 75.66  ? 58  LEU B CG    1 
ATOM 1140  C CD1   . LEU B 2 58  ? 123.809 98.161  101.143 1.00 75.66  ? 58  LEU B CD1   1 
ATOM 1141  C CD2   . LEU B 2 58  ? 125.007 96.582  99.659  1.00 75.66  ? 58  LEU B CD2   1 
ATOM 1142  N N     . LYS B 2 59  ? 127.816 100.648 100.212 1.00 77.02  ? 59  LYS B N     1 
ATOM 1143  C CA    . LYS B 2 59  ? 129.002 100.732 101.050 1.00 77.02  ? 59  LYS B CA    1 
ATOM 1144  C C     . LYS B 2 59  ? 128.987 101.991 101.904 1.00 77.02  ? 59  LYS B C     1 
ATOM 1145  O O     . LYS B 2 59  ? 129.339 101.937 103.083 1.00 77.02  ? 59  LYS B O     1 
ATOM 1146  C CB    . LYS B 2 59  ? 130.266 100.681 100.199 1.00 77.02  ? 59  LYS B CB    1 
ATOM 1147  C CG    . LYS B 2 59  ? 131.543 100.704 101.023 1.00 77.02  ? 59  LYS B CG    1 
ATOM 1148  C CD    . LYS B 2 59  ? 132.788 100.554 100.180 1.00 77.02  ? 59  LYS B CD    1 
ATOM 1149  C CE    . LYS B 2 59  ? 133.091 101.818 99.407  1.00 77.02  ? 59  LYS B CE    1 
ATOM 1150  N NZ    . LYS B 2 59  ? 134.374 101.691 98.669  1.00 77.02  ? 59  LYS B NZ    1 
ATOM 1151  N N     . VAL B 2 60  ? 128.546 103.121 101.342 1.00 78.86  ? 60  VAL B N     1 
ATOM 1152  C CA    . VAL B 2 60  ? 128.504 104.363 102.114 1.00 78.86  ? 60  VAL B CA    1 
ATOM 1153  C C     . VAL B 2 60  ? 127.468 104.268 103.220 1.00 78.86  ? 60  VAL B C     1 
ATOM 1154  O O     . VAL B 2 60  ? 127.731 104.652 104.372 1.00 78.86  ? 60  VAL B O     1 
ATOM 1155  C CB    . VAL B 2 60  ? 128.236 105.564 101.190 1.00 78.86  ? 60  VAL B CB    1 
ATOM 1156  C CG1   . VAL B 2 60  ? 127.973 106.819 101.996 1.00 78.86  ? 60  VAL B CG1   1 
ATOM 1157  C CG2   . VAL B 2 60  ? 129.423 105.793 100.275 1.00 78.86  ? 60  VAL B CG2   1 
ATOM 1158  N N     . PHE B 2 61  ? 126.299 103.704 102.899 1.00 76.28  ? 61  PHE B N     1 
ATOM 1159  C CA    . PHE B 2 61  ? 125.237 103.567 103.887 1.00 76.28  ? 61  PHE B CA    1 
ATOM 1160  C C     . PHE B 2 61  ? 125.649 102.654 105.031 1.00 76.28  ? 61  PHE B C     1 
ATOM 1161  O O     . PHE B 2 61  ? 125.467 103.002 106.204 1.00 76.28  ? 61  PHE B O     1 
ATOM 1162  C CB    . PHE B 2 61  ? 123.970 103.051 103.222 1.00 76.28  ? 61  PHE B CB    1 
ATOM 1163  C CG    . PHE B 2 61  ? 122.859 102.799 104.176 1.00 76.28  ? 61  PHE B CG    1 
ATOM 1164  C CD1   . PHE B 2 61  ? 122.205 103.847 104.782 1.00 76.28  ? 61  PHE B CD1   1 
ATOM 1165  C CD2   . PHE B 2 61  ? 122.458 101.514 104.458 1.00 76.28  ? 61  PHE B CD2   1 
ATOM 1166  C CE1   . PHE B 2 61  ? 121.174 103.618 105.666 1.00 76.28  ? 61  PHE B CE1   1 
ATOM 1167  C CE2   . PHE B 2 61  ? 121.426 101.277 105.335 1.00 76.28  ? 61  PHE B CE2   1 
ATOM 1168  C CZ    . PHE B 2 61  ? 120.784 102.334 105.942 1.00 76.28  ? 61  PHE B CZ    1 
ATOM 1169  N N     . LEU B 2 62  ? 126.259 101.513 104.714 1.00 74.74  ? 62  LEU B N     1 
ATOM 1170  C CA    . LEU B 2 62  ? 126.712 100.622 105.775 1.00 74.74  ? 62  LEU B CA    1 
ATOM 1171  C C     . LEU B 2 62  ? 127.877 101.202 106.561 1.00 74.74  ? 62  LEU B C     1 
ATOM 1172  O O     . LEU B 2 62  ? 127.972 100.952 107.765 1.00 74.74  ? 62  LEU B O     1 
ATOM 1173  C CB    . LEU B 2 62  ? 127.087 99.266  105.198 1.00 74.74  ? 62  LEU B CB    1 
ATOM 1174  C CG    . LEU B 2 62  ? 125.864 98.472  104.780 1.00 74.74  ? 62  LEU B CG    1 
ATOM 1175  C CD1   . LEU B 2 62  ? 126.262 97.214  104.065 1.00 74.74  ? 62  LEU B CD1   1 
ATOM 1176  C CD2   . LEU B 2 62  ? 125.102 98.145  106.031 1.00 74.74  ? 62  LEU B CD2   1 
ATOM 1177  N N     . GLU B 2 63  ? 128.757 101.974 105.911 1.00 79.75  ? 63  GLU B N     1 
ATOM 1178  C CA    . GLU B 2 63  ? 129.848 102.626 106.632 1.00 79.75  ? 63  GLU B CA    1 
ATOM 1179  C C     . GLU B 2 63  ? 129.324 103.605 107.663 1.00 79.75  ? 63  GLU B C     1 
ATOM 1180  O O     . GLU B 2 63  ? 129.829 103.652 108.792 1.00 79.75  ? 63  GLU B O     1 
ATOM 1181  C CB    . GLU B 2 63  ? 130.792 103.349 105.673 1.00 79.75  ? 63  GLU B CB    1 
ATOM 1182  C CG    . GLU B 2 63  ? 131.834 102.474 105.008 1.00 79.75  ? 63  GLU B CG    1 
ATOM 1183  C CD    . GLU B 2 63  ? 132.687 103.232 104.013 1.00 79.75  ? 63  GLU B CD    1 
ATOM 1184  O OE1   . GLU B 2 63  ? 132.388 104.416 103.755 1.00 79.75  ? 63  GLU B OE1   1 
ATOM 1185  O OE2   . GLU B 2 63  ? 133.651 102.640 103.482 1.00 79.75  ? 63  GLU B OE2   1 
ATOM 1186  N N     . ASN B 2 64  ? 128.299 104.380 107.310 1.00 78.68  ? 64  ASN B N     1 
ATOM 1187  C CA    . ASN B 2 64  ? 127.745 105.285 108.304 1.00 78.68  ? 64  ASN B CA    1 
ATOM 1188  C C     . ASN B 2 64  ? 127.002 104.529 109.393 1.00 78.68  ? 64  ASN B C     1 
ATOM 1189  O O     . ASN B 2 64  ? 127.185 104.824 110.581 1.00 78.68  ? 64  ASN B O     1 
ATOM 1190  C CB    . ASN B 2 64  ? 126.842 106.316 107.644 1.00 78.68  ? 64  ASN B CB    1 
ATOM 1191  C CG    . ASN B 2 64  ? 127.626 107.422 106.995 1.00 78.68  ? 64  ASN B CG    1 
ATOM 1192  O OD1   . ASN B 2 64  ? 128.620 107.890 107.545 1.00 78.68  ? 64  ASN B OD1   1 
ATOM 1193  N ND2   . ASN B 2 64  ? 127.186 107.856 105.821 1.00 78.68  ? 64  ASN B ND2   1 
ATOM 1194  N N     . VAL B 2 65  ? 126.215 103.516 109.018 1.00 75.94  ? 65  VAL B N     1 
ATOM 1195  C CA    . VAL B 2 65  ? 125.352 102.855 109.995 1.00 75.94  ? 65  VAL B CA    1 
ATOM 1196  C C     . VAL B 2 65  ? 126.170 102.049 110.997 1.00 75.94  ? 65  VAL B C     1 
ATOM 1197  O O     . VAL B 2 65  ? 125.934 102.130 112.207 1.00 75.94  ? 65  VAL B O     1 
ATOM 1198  C CB    . VAL B 2 65  ? 124.297 101.994 109.283 1.00 75.94  ? 65  VAL B CB    1 
ATOM 1199  C CG1   . VAL B 2 65  ? 123.580 101.117 110.258 1.00 75.94  ? 65  VAL B CG1   1 
ATOM 1200  C CG2   . VAL B 2 65  ? 123.283 102.892 108.628 1.00 75.94  ? 65  VAL B CG2   1 
ATOM 1201  N N     . ILE B 2 66  ? 127.178 101.315 110.541 1.00 75.78  ? 66  ILE B N     1 
ATOM 1202  C CA    . ILE B 2 66  ? 127.927 100.545 111.521 1.00 75.78  ? 66  ILE B CA    1 
ATOM 1203  C C     . ILE B 2 66  ? 129.096 101.322 112.106 1.00 75.78  ? 66  ILE B C     1 
ATOM 1204  O O     . ILE B 2 66  ? 129.638 100.896 113.134 1.00 75.78  ? 66  ILE B O     1 
ATOM 1205  C CB    . ILE B 2 66  ? 128.426 99.206  110.961 1.00 75.78  ? 66  ILE B CB    1 
ATOM 1206  C CG1   . ILE B 2 66  ? 129.624 99.402  110.061 1.00 75.78  ? 66  ILE B CG1   1 
ATOM 1207  C CG2   . ILE B 2 66  ? 127.339 98.560  110.154 1.00 75.78  ? 66  ILE B CG2   1 
ATOM 1208  C CD1   . ILE B 2 66  ? 130.215 98.110  109.626 1.00 75.78  ? 66  ILE B CD1   1 
ATOM 1209  N N     . ARG B 2 67  ? 129.504 102.443 111.488 1.00 79.09  ? 67  ARG B N     1 
ATOM 1210  C CA    . ARG B 2 67  ? 130.347 103.391 112.215 1.00 79.09  ? 67  ARG B CA    1 
ATOM 1211  C C     . ARG B 2 67  ? 129.609 103.923 113.430 1.00 79.09  ? 67  ARG B C     1 
ATOM 1212  O O     . ARG B 2 67  ? 130.184 104.050 114.517 1.00 79.09  ? 67  ARG B O     1 
ATOM 1213  C CB    . ARG B 2 67  ? 130.772 104.574 111.340 1.00 79.09  ? 67  ARG B CB    1 
ATOM 1214  C CG    . ARG B 2 67  ? 131.730 105.519 112.086 1.00 79.09  ? 67  ARG B CG    1 
ATOM 1215  C CD    . ARG B 2 67  ? 131.963 106.873 111.429 1.00 79.09  ? 67  ARG B CD    1 
ATOM 1216  N NE    . ARG B 2 67  ? 132.732 106.852 110.191 1.00 79.09  ? 67  ARG B NE    1 
ATOM 1217  C CZ    . ARG B 2 67  ? 132.245 107.201 109.005 1.00 79.09  ? 67  ARG B CZ    1 
ATOM 1218  N NH1   . ARG B 2 67  ? 130.983 107.583 108.890 1.00 79.09  ? 67  ARG B NH1   1 
ATOM 1219  N NH2   . ARG B 2 67  ? 133.022 107.164 107.933 1.00 79.09  ? 67  ARG B NH2   1 
ATOM 1220  N N     . ASP B 2 68  ? 128.325 104.219 113.271 1.00 81.08  ? 68  ASP B N     1 
ATOM 1221  C CA    . ASP B 2 68  ? 127.581 104.696 114.421 1.00 81.08  ? 68  ASP B CA    1 
ATOM 1222  C C     . ASP B 2 68  ? 127.214 103.564 115.364 1.00 81.08  ? 68  ASP B C     1 
ATOM 1223  O O     . ASP B 2 68  ? 127.099 103.787 116.570 1.00 81.08  ? 68  ASP B O     1 
ATOM 1224  C CB    . ASP B 2 68  ? 126.335 105.424 113.954 1.00 81.08  ? 68  ASP B CB    1 
ATOM 1225  C CG    . ASP B 2 68  ? 126.668 106.569 113.038 1.00 81.08  ? 68  ASP B CG    1 
ATOM 1226  O OD1   . ASP B 2 68  ? 127.808 107.071 113.123 1.00 81.08  ? 68  ASP B OD1   1 
ATOM 1227  O OD2   . ASP B 2 68  ? 125.810 106.955 112.219 1.00 81.08  ? 68  ASP B OD2   1 
ATOM 1228  N N     . ALA B 2 69  ? 127.050 102.347 114.843 1.00 76.45  ? 69  ALA B N     1 
ATOM 1229  C CA    . ALA B 2 69  ? 126.644 101.232 115.689 1.00 76.45  ? 69  ALA B CA    1 
ATOM 1230  C C     . ALA B 2 69  ? 127.801 100.733 116.537 1.00 76.45  ? 69  ALA B C     1 
ATOM 1231  O O     . ALA B 2 69  ? 127.609 100.362 117.706 1.00 76.45  ? 69  ALA B O     1 
ATOM 1232  C CB    . ALA B 2 69  ? 126.088 100.105 114.833 1.00 76.45  ? 69  ALA B CB    1 
ATOM 1233  N N     . VAL B 2 70  ? 129.015 100.741 115.977 1.00 74.52  ? 70  VAL B N     1 
ATOM 1234  C CA    . VAL B 2 70  ? 130.174 100.259 116.713 1.00 74.52  ? 70  VAL B CA    1 
ATOM 1235  C C     . VAL B 2 70  ? 130.503 101.178 117.875 1.00 74.52  ? 70  VAL B C     1 
ATOM 1236  O O     . VAL B 2 70  ? 131.087 100.732 118.861 1.00 74.52  ? 70  VAL B O     1 
ATOM 1237  C CB    . VAL B 2 70  ? 131.384 100.083 115.771 1.00 74.52  ? 70  VAL B CB    1 
ATOM 1238  C CG1   . VAL B 2 70  ? 131.990 101.413 115.360 1.00 74.52  ? 70  VAL B CG1   1 
ATOM 1239  C CG2   . VAL B 2 70  ? 132.434 99.169  116.386 1.00 74.52  ? 70  VAL B CG2   1 
ATOM 1240  N N     . THR B 2 71  ? 130.078 102.438 117.819 1.00 77.60  ? 71  THR B N     1 
ATOM 1241  C CA    . THR B 2 71  ? 130.324 103.336 118.932 1.00 77.60  ? 71  THR B CA    1 
ATOM 1242  C C     . THR B 2 71  ? 129.392 103.019 120.088 1.00 77.60  ? 71  THR B C     1 
ATOM 1243  O O     . THR B 2 71  ? 129.794 103.094 121.255 1.00 77.60  ? 71  THR B O     1 
ATOM 1244  C CB    . THR B 2 71  ? 130.144 104.771 118.473 1.00 77.60  ? 71  THR B CB    1 
ATOM 1245  O OG1   . THR B 2 71  ? 130.856 104.952 117.247 1.00 77.60  ? 71  THR B OG1   1 
ATOM 1246  C CG2   . THR B 2 71  ? 130.741 105.695 119.483 1.00 77.60  ? 71  THR B CG2   1 
ATOM 1247  N N     . TYR B 2 72  ? 128.149 102.643 119.778 1.00 77.63  ? 72  TYR B N     1 
ATOM 1248  C CA    . TYR B 2 72  ? 127.251 102.127 120.805 1.00 77.63  ? 72  TYR B CA    1 
ATOM 1249  C C     . TYR B 2 72  ? 127.778 100.838 121.400 1.00 77.63  ? 72  TYR B C     1 
ATOM 1250  O O     . TYR B 2 72  ? 127.596 100.578 122.594 1.00 77.63  ? 72  TYR B O     1 
ATOM 1251  C CB    . TYR B 2 72  ? 125.861 101.883 120.239 1.00 77.63  ? 72  TYR B CB    1 
ATOM 1252  C CG    . TYR B 2 72  ? 125.053 103.117 120.043 1.00 77.63  ? 72  TYR B CG    1 
ATOM 1253  C CD1   . TYR B 2 72  ? 124.479 103.748 121.124 1.00 77.63  ? 72  TYR B CD1   1 
ATOM 1254  C CD2   . TYR B 2 72  ? 124.817 103.619 118.781 1.00 77.63  ? 72  TYR B CD2   1 
ATOM 1255  C CE1   . TYR B 2 72  ? 123.720 104.872 120.960 1.00 77.63  ? 72  TYR B CE1   1 
ATOM 1256  C CE2   . TYR B 2 72  ? 124.055 104.745 118.600 1.00 77.63  ? 72  TYR B CE2   1 
ATOM 1257  C CZ    . TYR B 2 72  ? 123.513 105.369 119.697 1.00 77.63  ? 72  TYR B CZ    1 
ATOM 1258  O OH    . TYR B 2 72  ? 122.749 106.496 119.535 1.00 77.63  ? 72  TYR B OH    1 
ATOM 1259  N N     . THR B 2 73  ? 128.424 100.009 120.587 1.00 76.08  ? 73  THR B N     1 
ATOM 1260  C CA    . THR B 2 73  ? 128.989 98.799  121.157 1.00 76.08  ? 73  THR B CA    1 
ATOM 1261  C C     . THR B 2 73  ? 130.247 99.112  121.965 1.00 76.08  ? 73  THR B C     1 
ATOM 1262  O O     . THR B 2 73  ? 130.549 98.418  122.940 1.00 76.08  ? 73  THR B O     1 
ATOM 1263  C CB    . THR B 2 73  ? 129.237 97.790  120.038 1.00 76.08  ? 73  THR B CB    1 
ATOM 1264  O OG1   . THR B 2 73  ? 128.018 97.611  119.313 1.00 76.08  ? 73  THR B OG1   1 
ATOM 1265  C CG2   . THR B 2 73  ? 129.624 96.433  120.588 1.00 76.08  ? 73  THR B CG2   1 
ATOM 1266  N N     . GLU B 2 74  ? 130.945 100.193 121.634 1.00 79.50  ? 74  GLU B N     1 
ATOM 1267  C CA    . GLU B 2 74  ? 132.133 100.540 122.400 1.00 79.50  ? 74  GLU B CA    1 
ATOM 1268  C C     . GLU B 2 74  ? 131.800 101.235 123.707 1.00 79.50  ? 74  GLU B C     1 
ATOM 1269  O O     . GLU B 2 74  ? 132.592 101.153 124.650 1.00 79.50  ? 74  GLU B O     1 
ATOM 1270  C CB    . GLU B 2 74  ? 133.075 101.429 121.589 1.00 79.50  ? 74  GLU B CB    1 
ATOM 1271  C CG    . GLU B 2 74  ? 133.908 100.706 120.539 1.00 79.50  ? 74  GLU B CG    1 
ATOM 1272  C CD    . GLU B 2 74  ? 134.828 101.643 119.768 1.00 79.50  ? 74  GLU B CD    1 
ATOM 1273  O OE1   . GLU B 2 74  ? 134.710 102.876 119.935 1.00 79.50  ? 74  GLU B OE1   1 
ATOM 1274  O OE2   . GLU B 2 74  ? 135.677 101.143 118.999 1.00 79.50  ? 74  GLU B OE2   1 
ATOM 1275  N N     . HIS B 2 75  ? 130.660 101.928 123.786 1.00 80.98  ? 75  HIS B N     1 
ATOM 1276  C CA    . HIS B 2 75  ? 130.376 102.695 124.994 1.00 80.98  ? 75  HIS B CA    1 
ATOM 1277  C C     . HIS B 2 75  ? 130.024 101.799 126.164 1.00 80.98  ? 75  HIS B C     1 
ATOM 1278  O O     . HIS B 2 75  ? 130.365 102.115 127.306 1.00 80.98  ? 75  HIS B O     1 
ATOM 1279  C CB    . HIS B 2 75  ? 129.236 103.672 124.782 1.00 80.98  ? 75  HIS B CB    1 
ATOM 1280  C CG    . HIS B 2 75  ? 129.008 104.558 125.960 1.00 80.98  ? 75  HIS B CG    1 
ATOM 1281  N ND1   . HIS B 2 75  ? 129.757 105.688 126.195 1.00 80.98  ? 75  HIS B ND1   1 
ATOM 1282  C CD2   . HIS B 2 75  ? 128.175 104.433 127.018 1.00 80.98  ? 75  HIS B CD2   1 
ATOM 1283  C CE1   . HIS B 2 75  ? 129.353 106.257 127.315 1.00 80.98  ? 75  HIS B CE1   1 
ATOM 1284  N NE2   . HIS B 2 75  ? 128.398 105.511 127.839 1.00 80.98  ? 75  HIS B NE2   1 
ATOM 1285  N N     . ALA B 2 76  ? 129.362 100.680 125.907 1.00 76.55  ? 76  ALA B N     1 
ATOM 1286  C CA    . ALA B 2 76  ? 129.138 99.692  126.949 1.00 76.55  ? 76  ALA B CA    1 
ATOM 1287  C C     . ALA B 2 76  ? 130.366 98.840  127.231 1.00 76.55  ? 76  ALA B C     1 
ATOM 1288  O O     . ALA B 2 76  ? 130.267 97.920  128.049 1.00 76.55  ? 76  ALA B O     1 
ATOM 1289  C CB    . ALA B 2 76  ? 127.966 98.790  126.571 1.00 76.55  ? 76  ALA B CB    1 
ATOM 1290  N N     . LYS B 2 77  ? 131.489 99.113  126.550 1.00 77.43  ? 77  LYS B N     1 
ATOM 1291  C CA    . LYS B 2 77  ? 132.766 98.406  126.687 1.00 77.43  ? 77  LYS B CA    1 
ATOM 1292  C C     . LYS B 2 77  ? 132.624 96.927  126.354 1.00 77.43  ? 77  LYS B C     1 
ATOM 1293  O O     . LYS B 2 77  ? 133.335 96.083  126.898 1.00 77.43  ? 77  LYS B O     1 
ATOM 1294  C CB    . LYS B 2 77  ? 133.365 98.592  128.080 1.00 77.43  ? 77  LYS B CB    1 
ATOM 1295  C CG    . LYS B 2 77  ? 133.646 100.033 128.424 1.00 77.43  ? 77  LYS B CG    1 
ATOM 1296  C CD    . LYS B 2 77  ? 134.138 100.152 129.851 1.00 77.43  ? 77  LYS B CD    1 
ATOM 1297  C CE    . LYS B 2 77  ? 134.309 101.599 130.264 1.00 77.43  ? 77  LYS B CE    1 
ATOM 1298  N NZ    . LYS B 2 77  ? 134.720 101.710 131.687 1.00 77.43  ? 77  LYS B NZ    1 
ATOM 1299  N N     . ARG B 2 78  ? 131.706 96.617  125.449 1.00 75.76  ? 78  ARG B N     1 
ATOM 1300  C CA    . ARG B 2 78  ? 131.408 95.255  125.054 1.00 75.76  ? 78  ARG B CA    1 
ATOM 1301  C C     . ARG B 2 78  ? 131.964 95.004  123.664 1.00 75.76  ? 78  ARG B C     1 
ATOM 1302  O O     . ARG B 2 78  ? 132.063 95.915  122.841 1.00 75.76  ? 78  ARG B O     1 
ATOM 1303  C CB    . ARG B 2 78  ? 129.903 95.009  125.067 1.00 75.76  ? 78  ARG B CB    1 
ATOM 1304  C CG    . ARG B 2 78  ? 129.277 95.223  126.421 1.00 75.76  ? 78  ARG B CG    1 
ATOM 1305  C CD    . ARG B 2 78  ? 127.831 94.793  126.442 1.00 75.76  ? 78  ARG B CD    1 
ATOM 1306  N NE    . ARG B 2 78  ? 126.977 95.610  125.595 1.00 75.76  ? 78  ARG B NE    1 
ATOM 1307  C CZ    . ARG B 2 78  ? 126.373 95.158  124.505 1.00 75.76  ? 78  ARG B CZ    1 
ATOM 1308  N NH1   . ARG B 2 78  ? 126.539 93.900  124.132 1.00 75.76  ? 78  ARG B NH1   1 
ATOM 1309  N NH2   . ARG B 2 78  ? 125.603 95.960  123.787 1.00 75.76  ? 78  ARG B NH2   1 
ATOM 1310  N N     . LYS B 2 79  ? 132.324 93.756  123.405 1.00 75.77  ? 79  LYS B N     1 
ATOM 1311  C CA    . LYS B 2 79  ? 132.996 93.396  122.170 1.00 75.77  ? 79  LYS B CA    1 
ATOM 1312  C C     . LYS B 2 79  ? 132.060 92.719  121.183 1.00 75.77  ? 79  LYS B C     1 
ATOM 1313  O O     . LYS B 2 79  ? 132.516 92.232  120.145 1.00 75.77  ? 79  LYS B O     1 
ATOM 1314  C CB    . LYS B 2 79  ? 134.190 92.496  122.484 1.00 75.77  ? 79  LYS B CB    1 
ATOM 1315  C CG    . LYS B 2 79  ? 135.236 93.192  123.337 1.00 75.77  ? 79  LYS B CG    1 
ATOM 1316  C CD    . LYS B 2 79  ? 136.398 92.286  123.708 1.00 75.77  ? 79  LYS B CD    1 
ATOM 1317  C CE    . LYS B 2 79  ? 137.369 93.017  124.630 1.00 75.77  ? 79  LYS B CE    1 
ATOM 1318  N NZ    . LYS B 2 79  ? 138.529 92.189  125.053 1.00 75.77  ? 79  LYS B NZ    1 
ATOM 1319  N N     . THR B 2 80  ? 130.764 92.687  121.474 1.00 76.94  ? 80  THR B N     1 
ATOM 1320  C CA    . THR B 2 80  ? 129.791 92.010  120.629 1.00 76.94  ? 80  THR B CA    1 
ATOM 1321  C C     . THR B 2 80  ? 128.686 92.982  120.251 1.00 76.94  ? 80  THR B C     1 
ATOM 1322  O O     . THR B 2 80  ? 127.988 93.502  121.126 1.00 76.94  ? 80  THR B O     1 
ATOM 1323  C CB    . THR B 2 80  ? 129.204 90.794  121.341 1.00 76.94  ? 80  THR B CB    1 
ATOM 1324  O OG1   . THR B 2 80  ? 130.258 89.886  121.674 1.00 76.94  ? 80  THR B OG1   1 
ATOM 1325  C CG2   . THR B 2 80  ? 128.206 90.094  120.450 1.00 76.94  ? 80  THR B CG2   1 
ATOM 1326  N N     . VAL B 2 81  ? 128.527 93.224  118.953 1.00 74.71  ? 81  VAL B N     1 
ATOM 1327  C CA    . VAL B 2 81  ? 127.450 94.075  118.474 1.00 74.71  ? 81  VAL B CA    1 
ATOM 1328  C C     . VAL B 2 81  ? 126.141 93.306  118.556 1.00 74.71  ? 81  VAL B C     1 
ATOM 1329  O O     . VAL B 2 81  ? 126.072 92.135  118.163 1.00 74.71  ? 81  VAL B O     1 
ATOM 1330  C CB    . VAL B 2 81  ? 127.749 94.536  117.043 1.00 74.71  ? 81  VAL B CB    1 
ATOM 1331  C CG1   . VAL B 2 81  ? 126.589 95.305  116.464 1.00 74.71  ? 81  VAL B CG1   1 
ATOM 1332  C CG2   . VAL B 2 81  ? 129.003 95.374  117.029 1.00 74.71  ? 81  VAL B CG2   1 
ATOM 1333  N N     . THR B 2 82  ? 125.107 93.939  119.103 1.00 73.44  ? 82  THR B N     1 
ATOM 1334  C CA    . THR B 2 82  ? 123.804 93.308  119.247 1.00 73.44  ? 82  THR B CA    1 
ATOM 1335  C C     . THR B 2 82  ? 122.806 93.935  118.286 1.00 73.44  ? 82  THR B C     1 
ATOM 1336  O O     . THR B 2 82  ? 123.135 94.809  117.485 1.00 73.44  ? 82  THR B O     1 
ATOM 1337  C CB    . THR B 2 82  ? 123.284 93.429  120.674 1.00 73.44  ? 82  THR B CB    1 
ATOM 1338  O OG1   . THR B 2 82  ? 122.939 94.791  120.932 1.00 73.44  ? 82  THR B OG1   1 
ATOM 1339  C CG2   . THR B 2 82  ? 124.344 92.999  121.656 1.00 73.44  ? 82  THR B CG2   1 
ATOM 1340  N N     . ALA B 2 83  ? 121.559 93.484  118.394 1.00 75.43  ? 83  ALA B N     1 
ATOM 1341  C CA    . ALA B 2 83  ? 120.501 93.969  117.520 1.00 75.43  ? 83  ALA B CA    1 
ATOM 1342  C C     . ALA B 2 83  ? 119.966 95.311  117.989 1.00 75.43  ? 83  ALA B C     1 
ATOM 1343  O O     . ALA B 2 83  ? 119.655 96.180  117.163 1.00 75.43  ? 83  ALA B O     1 
ATOM 1344  C CB    . ALA B 2 83  ? 119.374 92.943  117.446 1.00 75.43  ? 83  ALA B CB    1 
ATOM 1345  N N     . MET B 2 84  ? 119.859 95.491  119.311 1.00 73.77  ? 84  MET B N     1 
ATOM 1346  C CA    . MET B 2 84  ? 119.464 96.776  119.876 1.00 73.77  ? 84  MET B CA    1 
ATOM 1347  C C     . MET B 2 84  ? 120.434 97.882  119.496 1.00 73.77  ? 84  MET B C     1 
ATOM 1348  O O     . MET B 2 84  ? 120.012 99.030  119.313 1.00 73.77  ? 84  MET B O     1 
ATOM 1349  C CB    . MET B 2 84  ? 119.389 96.684  121.392 1.00 73.77  ? 84  MET B CB    1 
ATOM 1350  C CG    . MET B 2 84  ? 118.291 95.814  121.944 1.00 73.77  ? 84  MET B CG    1 
ATOM 1351  S SD    . MET B 2 84  ? 116.632 96.457  121.680 1.00 73.77  ? 84  MET B SD    1 
ATOM 1352  C CE    . MET B 2 84  ? 115.671 95.160  122.466 1.00 73.77  ? 84  MET B CE    1 
ATOM 1353  N N     . ASP B 2 85  ? 121.723 97.544  119.370 1.00 77.57  ? 85  ASP B N     1 
ATOM 1354  C CA    . ASP B 2 85  ? 122.747 98.467  118.894 1.00 77.57  ? 85  ASP B CA    1 
ATOM 1355  C C     . ASP B 2 85  ? 122.364 99.082  117.560 1.00 77.57  ? 85  ASP B C     1 
ATOM 1356  O O     . ASP B 2 85  ? 122.199 100.300 117.442 1.00 77.57  ? 85  ASP B O     1 
ATOM 1357  C CB    . ASP B 2 85  ? 124.074 97.731  118.737 1.00 77.57  ? 85  ASP B CB    1 
ATOM 1358  C CG    . ASP B 2 85  ? 124.608 97.198  120.039 1.00 77.57  ? 85  ASP B CG    1 
ATOM 1359  O OD1   . ASP B 2 85  ? 124.311 97.791  121.096 1.00 77.57  ? 85  ASP B OD1   1 
ATOM 1360  O OD2   . ASP B 2 85  ? 125.325 96.173  120.009 1.00 77.57  ? 85  ASP B OD2   1 
ATOM 1361  N N     . VAL B 2 86  ? 122.165 98.235  116.553 1.00 72.44  ? 86  VAL B N     1 
ATOM 1362  C CA    . VAL B 2 86  ? 121.912 98.767  115.229 1.00 72.44  ? 86  VAL B CA    1 
ATOM 1363  C C     . VAL B 2 86  ? 120.507 99.305  115.065 1.00 72.44  ? 86  VAL B C     1 
ATOM 1364  O O     . VAL B 2 86  ? 120.314 100.183 114.230 1.00 72.44  ? 86  VAL B O     1 
ATOM 1365  C CB    . VAL B 2 86  ? 122.183 97.732  114.133 1.00 72.44  ? 86  VAL B CB    1 
ATOM 1366  C CG1   . VAL B 2 86  ? 123.643 97.373  114.118 1.00 72.44  ? 86  VAL B CG1   1 
ATOM 1367  C CG2   . VAL B 2 86  ? 121.344 96.501  114.351 1.00 72.44  ? 86  VAL B CG2   1 
ATOM 1368  N N     . VAL B 2 87  ? 119.517 98.832  115.825 1.00 70.95  ? 87  VAL B N     1 
ATOM 1369  C CA    . VAL B 2 87  ? 118.196 99.448  115.710 1.00 70.95  ? 87  VAL B CA    1 
ATOM 1370  C C     . VAL B 2 87  ? 118.211 100.845 116.311 1.00 70.95  ? 87  VAL B C     1 
ATOM 1371  O O     . VAL B 2 87  ? 117.615 101.777 115.758 1.00 70.95  ? 87  VAL B O     1 
ATOM 1372  C CB    . VAL B 2 87  ? 117.123 98.554  116.349 1.00 70.95  ? 87  VAL B CB    1 
ATOM 1373  C CG1   . VAL B 2 87  ? 115.765 99.232  116.342 1.00 70.95  ? 87  VAL B CG1   1 
ATOM 1374  C CG2   . VAL B 2 87  ? 117.031 97.288  115.578 1.00 70.95  ? 87  VAL B CG2   1 
ATOM 1375  N N     . TYR B 2 88  ? 118.938 101.027 117.416 1.00 73.27  ? 88  TYR B N     1 
ATOM 1376  C CA    . TYR B 2 88  ? 119.097 102.359 117.992 1.00 73.27  ? 88  TYR B CA    1 
ATOM 1377  C C     . TYR B 2 88  ? 119.872 103.290 117.064 1.00 73.27  ? 88  TYR B C     1 
ATOM 1378  O O     . TYR B 2 88  ? 119.466 104.443 116.849 1.00 73.27  ? 88  TYR B O     1 
ATOM 1379  C CB    . TYR B 2 88  ? 119.775 102.245 119.348 1.00 73.27  ? 88  TYR B CB    1 
ATOM 1380  C CG    . TYR B 2 88  ? 118.848 101.749 120.420 1.00 73.27  ? 88  TYR B CG    1 
ATOM 1381  C CD1   . TYR B 2 88  ? 117.482 101.928 120.308 1.00 73.27  ? 88  TYR B CD1   1 
ATOM 1382  C CD2   . TYR B 2 88  ? 119.334 101.062 121.529 1.00 73.27  ? 88  TYR B CD2   1 
ATOM 1383  C CE1   . TYR B 2 88  ? 116.623 101.469 121.287 1.00 73.27  ? 88  TYR B CE1   1 
ATOM 1384  C CE2   . TYR B 2 88  ? 118.487 100.586 122.503 1.00 73.27  ? 88  TYR B CE2   1 
ATOM 1385  C CZ    . TYR B 2 88  ? 117.131 100.796 122.381 1.00 73.27  ? 88  TYR B CZ    1 
ATOM 1386  O OH    . TYR B 2 88  ? 116.280 100.330 123.357 1.00 73.27  ? 88  TYR B OH    1 
ATOM 1387  N N     . ALA B 2 89  ? 120.960 102.798 116.468 1.00 71.02  ? 89  ALA B N     1 
ATOM 1388  C CA    . ALA B 2 89  ? 121.726 103.638 115.554 1.00 71.02  ? 89  ALA B CA    1 
ATOM 1389  C C     . ALA B 2 89  ? 120.979 103.903 114.256 1.00 71.02  ? 89  ALA B C     1 
ATOM 1390  O O     . ALA B 2 89  ? 121.226 104.920 113.603 1.00 71.02  ? 89  ALA B O     1 
ATOM 1391  C CB    . ALA B 2 89  ? 123.079 103.007 115.254 1.00 71.02  ? 89  ALA B CB    1 
ATOM 1392  N N     . LEU B 2 90  ? 120.062 103.024 113.866 1.00 70.18  ? 90  LEU B N     1 
ATOM 1393  C CA    . LEU B 2 90  ? 119.215 103.338 112.724 1.00 70.18  ? 90  LEU B CA    1 
ATOM 1394  C C     . LEU B 2 90  ? 118.167 104.369 113.087 1.00 70.18  ? 90  LEU B C     1 
ATOM 1395  O O     . LEU B 2 90  ? 117.818 105.218 112.260 1.00 70.18  ? 90  LEU B O     1 
ATOM 1396  C CB    . LEU B 2 90  ? 118.538 102.087 112.194 1.00 70.18  ? 90  LEU B CB    1 
ATOM 1397  C CG    . LEU B 2 90  ? 119.393 101.178 111.342 1.00 70.18  ? 90  LEU B CG    1 
ATOM 1398  C CD1   . LEU B 2 90  ? 118.643 99.892  111.252 1.00 70.18  ? 90  LEU B CD1   1 
ATOM 1399  C CD2   . LEU B 2 90  ? 119.599 101.790 109.987 1.00 70.18  ? 90  LEU B CD2   1 
ATOM 1400  N N     . LYS B 2 91  ? 117.626 104.274 114.304 1.00 67.99  ? 91  LYS B N     1 
ATOM 1401  C CA    . LYS B 2 91  ? 116.647 105.242 114.783 1.00 67.99  ? 91  LYS B CA    1 
ATOM 1402  C C     . LYS B 2 91  ? 117.217 106.642 114.790 1.00 67.99  ? 91  LYS B C     1 
ATOM 1403  O O     . LYS B 2 91  ? 116.547 107.595 114.381 1.00 67.99  ? 91  LYS B O     1 
ATOM 1404  C CB    . LYS B 2 91  ? 116.202 104.870 116.188 1.00 67.99  ? 91  LYS B CB    1 
ATOM 1405  C CG    . LYS B 2 91  ? 115.287 105.878 116.842 1.00 67.99  ? 91  LYS B CG    1 
ATOM 1406  C CD    . LYS B 2 91  ? 115.023 105.468 118.268 1.00 67.99  ? 91  LYS B CD    1 
ATOM 1407  C CE    . LYS B 2 91  ? 114.223 106.506 119.007 1.00 67.99  ? 91  LYS B CE    1 
ATOM 1408  N NZ    . LYS B 2 91  ? 114.091 106.125 120.435 1.00 67.99  ? 91  LYS B NZ    1 
ATOM 1409  N N     . ARG B 2 92  ? 118.472 106.773 115.215 1.00 69.48  ? 92  ARG B N     1 
ATOM 1410  C CA    . ARG B 2 92  ? 119.086 108.088 115.323 1.00 69.48  ? 92  ARG B CA    1 
ATOM 1411  C C     . ARG B 2 92  ? 119.279 108.725 113.952 1.00 69.48  ? 92  ARG B C     1 
ATOM 1412  O O     . ARG B 2 92  ? 119.163 109.945 113.817 1.00 69.48  ? 92  ARG B O     1 
ATOM 1413  C CB    . ARG B 2 92  ? 120.416 107.952 116.061 1.00 69.48  ? 92  ARG B CB    1 
ATOM 1414  C CG    . ARG B 2 92  ? 120.937 109.167 116.811 1.00 69.48  ? 92  ARG B CG    1 
ATOM 1415  C CD    . ARG B 2 92  ? 121.645 110.181 115.932 1.00 69.48  ? 92  ARG B CD    1 
ATOM 1416  N NE    . ARG B 2 92  ? 122.416 109.553 114.867 1.00 69.48  ? 92  ARG B NE    1 
ATOM 1417  C CZ    . ARG B 2 92  ? 123.607 108.994 115.014 1.00 69.48  ? 92  ARG B CZ    1 
ATOM 1418  N NH1   . ARG B 2 92  ? 124.189 108.947 116.197 1.00 69.48  ? 92  ARG B NH1   1 
ATOM 1419  N NH2   . ARG B 2 92  ? 124.206 108.469 113.966 1.00 69.48  ? 92  ARG B NH2   1 
ATOM 1420  N N     . GLN B 2 93  ? 119.525 107.927 112.922 1.00 72.62  ? 93  GLN B N     1 
ATOM 1421  C CA    . GLN B 2 93  ? 119.656 108.480 111.584 1.00 72.62  ? 93  GLN B CA    1 
ATOM 1422  C C     . GLN B 2 93  ? 118.326 108.687 110.891 1.00 72.62  ? 93  GLN B C     1 
ATOM 1423  O O     . GLN B 2 93  ? 118.318 108.918 109.681 1.00 72.62  ? 93  GLN B O     1 
ATOM 1424  C CB    . GLN B 2 93  ? 120.540 107.585 110.718 1.00 72.62  ? 93  GLN B CB    1 
ATOM 1425  C CG    . GLN B 2 93  ? 121.999 107.640 111.095 1.00 72.62  ? 93  GLN B CG    1 
ATOM 1426  C CD    . GLN B 2 93  ? 122.868 106.819 110.178 1.00 72.62  ? 93  GLN B CD    1 
ATOM 1427  O OE1   . GLN B 2 93  ? 122.372 106.097 109.320 1.00 72.62  ? 93  GLN B OE1   1 
ATOM 1428  N NE2   . GLN B 2 93  ? 124.175 106.946 110.334 1.00 72.62  ? 93  GLN B NE2   1 
ATOM 1429  N N     . GLY B 2 94  ? 117.212 108.609 111.611 1.00 74.29  ? 94  GLY B N     1 
ATOM 1430  C CA    . GLY B 2 94  ? 115.912 108.832 111.005 1.00 74.29  ? 94  GLY B CA    1 
ATOM 1431  C C     . GLY B 2 94  ? 115.467 107.743 110.060 1.00 74.29  ? 94  GLY B C     1 
ATOM 1432  O O     . GLY B 2 94  ? 114.820 108.037 109.053 1.00 74.29  ? 94  GLY B O     1 
ATOM 1433  N N     . ARG B 2 95  ? 115.831 106.495 110.335 1.00 70.86  ? 95  ARG B N     1 
ATOM 1434  C CA    . ARG B 2 95  ? 115.495 105.353 109.496 1.00 70.86  ? 95  ARG B CA    1 
ATOM 1435  C C     . ARG B 2 95  ? 115.022 104.205 110.367 1.00 70.86  ? 95  ARG B C     1 
ATOM 1436  O O     . ARG B 2 95  ? 115.542 103.094 110.287 1.00 70.86  ? 95  ARG B O     1 
ATOM 1437  C CB    . ARG B 2 95  ? 116.680 104.909 108.648 1.00 70.86  ? 95  ARG B CB    1 
ATOM 1438  C CG    . ARG B 2 95  ? 117.131 105.942 107.664 1.00 70.86  ? 95  ARG B CG    1 
ATOM 1439  C CD    . ARG B 2 95  ? 118.169 105.412 106.717 1.00 70.86  ? 95  ARG B CD    1 
ATOM 1440  N NE    . ARG B 2 95  ? 118.710 106.487 105.900 1.00 70.86  ? 95  ARG B NE    1 
ATOM 1441  C CZ    . ARG B 2 95  ? 118.135 106.957 104.800 1.00 70.86  ? 95  ARG B CZ    1 
ATOM 1442  N NH1   . ARG B 2 95  ? 116.978 106.463 104.377 1.00 70.86  ? 95  ARG B NH1   1 
ATOM 1443  N NH2   . ARG B 2 95  ? 118.713 107.938 104.129 1.00 70.86  ? 95  ARG B NH2   1 
ATOM 1444  N N     . THR B 2 96  ? 114.058 104.481 111.245 1.00 63.59  ? 96  THR B N     1 
ATOM 1445  C CA    . THR B 2 96  ? 113.695 103.551 112.309 1.00 63.59  ? 96  THR B CA    1 
ATOM 1446  C C     . THR B 2 96  ? 113.058 102.280 111.757 1.00 63.59  ? 96  THR B C     1 
ATOM 1447  O O     . THR B 2 96  ? 112.282 102.310 110.800 1.00 63.59  ? 96  THR B O     1 
ATOM 1448  C CB    . THR B 2 96  ? 112.741 104.231 113.283 1.00 63.59  ? 96  THR B CB    1 
ATOM 1449  O OG1   . THR B 2 96  ? 113.252 105.528 113.595 1.00 63.59  ? 96  THR B OG1   1 
ATOM 1450  C CG2   . THR B 2 96  ? 112.649 103.456 114.594 1.00 63.59  ? 96  THR B CG2   1 
ATOM 1451  N N     . LEU B 2 97  ? 113.400 101.160 112.381 1.00 56.94  ? 97  LEU B N     1 
ATOM 1452  C CA    . LEU B 2 97  ? 113.159 99.826  111.851 1.00 56.94  ? 97  LEU B CA    1 
ATOM 1453  C C     . LEU B 2 97  ? 112.639 98.963  112.983 1.00 56.94  ? 97  LEU B C     1 
ATOM 1454  O O     . LEU B 2 97  ? 113.395 98.628  113.895 1.00 56.94  ? 97  LEU B O     1 
ATOM 1455  C CB    . LEU B 2 97  ? 114.450 99.249  111.292 1.00 56.94  ? 97  LEU B CB    1 
ATOM 1456  C CG    . LEU B 2 97  ? 114.474 97.819  110.788 1.00 56.94  ? 97  LEU B CG    1 
ATOM 1457  C CD1   . LEU B 2 97  ? 113.514 97.636  109.652 1.00 56.94  ? 97  LEU B CD1   1 
ATOM 1458  C CD2   . LEU B 2 97  ? 115.872 97.536  110.325 1.00 56.94  ? 97  LEU B CD2   1 
ATOM 1459  N N     . TYR B 2 98  ? 111.369 98.589  112.929 1.00 49.90  ? 98  TYR B N     1 
ATOM 1460  C CA    . TYR B 2 98  ? 110.809 97.810  114.018 1.00 49.90  ? 98  TYR B CA    1 
ATOM 1461  C C     . TYR B 2 98  ? 111.168 96.345  113.817 1.00 49.90  ? 98  TYR B C     1 
ATOM 1462  O O     . TYR B 2 98  ? 111.851 95.972  112.865 1.00 49.90  ? 98  TYR B O     1 
ATOM 1463  C CB    . TYR B 2 98  ? 109.294 97.949  114.082 1.00 49.90  ? 98  TYR B CB    1 
ATOM 1464  C CG    . TYR B 2 98  ? 108.731 99.332  114.287 1.00 49.90  ? 98  TYR B CG    1 
ATOM 1465  C CD1   . TYR B 2 98  ? 109.504 100.374 114.756 1.00 49.90  ? 98  TYR B CD1   1 
ATOM 1466  C CD2   . TYR B 2 98  ? 107.404 99.588  113.996 1.00 49.90  ? 98  TYR B CD2   1 
ATOM 1467  C CE1   . TYR B 2 98  ? 108.972 101.627 114.918 1.00 49.90  ? 98  TYR B CE1   1 
ATOM 1468  C CE2   . TYR B 2 98  ? 106.867 100.829 114.155 1.00 49.90  ? 98  TYR B CE2   1 
ATOM 1469  C CZ    . TYR B 2 98  ? 107.653 101.845 114.620 1.00 49.90  ? 98  TYR B CZ    1 
ATOM 1470  O OH    . TYR B 2 98  ? 107.136 103.097 114.778 1.00 49.90  ? 98  TYR B OH    1 
ATOM 1471  N N     . GLY B 2 99  ? 110.663 95.490  114.693 1.00 53.29  ? 99  GLY B N     1 
ATOM 1472  C CA    . GLY B 2 99  ? 110.853 94.069  114.526 1.00 53.29  ? 99  GLY B CA    1 
ATOM 1473  C C     . GLY B 2 99  ? 112.117 93.511  115.124 1.00 53.29  ? 99  GLY B C     1 
ATOM 1474  O O     . GLY B 2 99  ? 112.440 92.348  114.865 1.00 53.29  ? 99  GLY B O     1 
ATOM 1475  N N     . PHE B 2 100 ? 112.860 94.302  115.887 1.00 53.05  ? 100 PHE B N     1 
ATOM 1476  C CA    . PHE B 2 100 ? 113.971 93.762  116.657 1.00 53.05  ? 100 PHE B CA    1 
ATOM 1477  C C     . PHE B 2 100 ? 114.023 94.286  118.073 1.00 53.05  ? 100 PHE B C     1 
ATOM 1478  O O     . PHE B 2 100 ? 114.722 93.694  118.898 1.00 53.05  ? 100 PHE B O     1 
ATOM 1479  C CB    . PHE B 2 100 ? 115.302 94.066  115.974 1.00 53.05  ? 100 PHE B CB    1 
ATOM 1480  C CG    . PHE B 2 100 ? 115.408 93.524  114.578 1.00 53.05  ? 100 PHE B CG    1 
ATOM 1481  C CD1   . PHE B 2 100 ? 115.630 92.185  114.355 1.00 53.05  ? 100 PHE B CD1   1 
ATOM 1482  C CD2   . PHE B 2 100 ? 115.305 94.362  113.494 1.00 53.05  ? 100 PHE B CD2   1 
ATOM 1483  C CE1   . PHE B 2 100 ? 115.728 91.699  113.080 1.00 53.05  ? 100 PHE B CE1   1 
ATOM 1484  C CE2   . PHE B 2 100 ? 115.400 93.875  112.229 1.00 53.05  ? 100 PHE B CE2   1 
ATOM 1485  C CZ    . PHE B 2 100 ? 115.616 92.544  112.024 1.00 53.05  ? 100 PHE B CZ    1 
ATOM 1486  N N     . GLY B 2 101 ? 113.306 95.352  118.396 1.00 58.27  ? 101 GLY B N     1 
ATOM 1487  C CA    . GLY B 2 101 ? 113.299 95.897  119.737 1.00 58.27  ? 101 GLY B CA    1 
ATOM 1488  C C     . GLY B 2 101 ? 112.937 97.367  119.781 1.00 58.27  ? 101 GLY B C     1 
ATOM 1489  O O     . GLY B 2 101 ? 111.769 97.725  119.920 1.00 58.27  ? 101 GLY B O     1 
ATOM 1490  N N     . THR C 3 16  ? 134.929 131.199 138.956 1.00 82.66  ? 16  THR C N     1 
ATOM 1491  C CA    . THR C 3 16  ? 135.414 131.043 137.594 1.00 82.66  ? 16  THR C CA    1 
ATOM 1492  C C     . THR C 3 16  ? 136.044 129.677 137.416 1.00 82.66  ? 16  THR C C     1 
ATOM 1493  O O     . THR C 3 16  ? 137.264 129.553 137.346 1.00 82.66  ? 16  THR C O     1 
ATOM 1494  C CB    . THR C 3 16  ? 136.446 132.112 137.226 1.00 82.66  ? 16  THR C CB    1 
ATOM 1495  O OG1   . THR C 3 16  ? 137.625 131.930 138.016 1.00 82.66  ? 16  THR C OG1   1 
ATOM 1496  C CG2   . THR C 3 16  ? 135.884 133.497 137.485 1.00 82.66  ? 16  THR C CG2   1 
ATOM 1497  N N     . ARG C 3 17  ? 135.203 128.644 137.333 1.00 74.64  ? 17  ARG C N     1 
ATOM 1498  C CA    . ARG C 3 17  ? 135.698 127.299 137.072 1.00 74.64  ? 17  ARG C CA    1 
ATOM 1499  C C     . ARG C 3 17  ? 136.200 127.133 135.649 1.00 74.64  ? 17  ARG C C     1 
ATOM 1500  O O     . ARG C 3 17  ? 136.883 126.142 135.360 1.00 74.64  ? 17  ARG C O     1 
ATOM 1501  C CB    . ARG C 3 17  ? 134.616 126.267 137.370 1.00 74.64  ? 17  ARG C CB    1 
ATOM 1502  C CG    . ARG C 3 17  ? 134.273 126.176 138.840 1.00 74.64  ? 17  ARG C CG    1 
ATOM 1503  C CD    . ARG C 3 17  ? 133.409 124.972 139.134 1.00 74.64  ? 17  ARG C CD    1 
ATOM 1504  N NE    . ARG C 3 17  ? 132.030 125.100 138.689 1.00 74.64  ? 17  ARG C NE    1 
ATOM 1505  C CZ    . ARG C 3 17  ? 131.184 124.078 138.615 1.00 74.64  ? 17  ARG C CZ    1 
ATOM 1506  N NH1   . ARG C 3 17  ? 131.588 122.855 138.920 1.00 74.64  ? 17  ARG C NH1   1 
ATOM 1507  N NH2   . ARG C 3 17  ? 129.941 124.277 138.213 1.00 74.64  ? 17  ARG C NH2   1 
ATOM 1508  N N     . SER C 3 18  ? 135.859 128.068 134.764 1.00 76.37  ? 18  SER C N     1 
ATOM 1509  C CA    . SER C 3 18  ? 136.579 128.224 133.512 1.00 76.37  ? 18  SER C CA    1 
ATOM 1510  C C     . SER C 3 18  ? 138.069 128.418 133.761 1.00 76.37  ? 18  SER C C     1 
ATOM 1511  O O     . SER C 3 18  ? 138.902 127.804 133.088 1.00 76.37  ? 18  SER C O     1 
ATOM 1512  C CB    . SER C 3 18  ? 136.012 129.413 132.749 1.00 76.37  ? 18  SER C CB    1 
ATOM 1513  O OG    . SER C 3 18  ? 134.625 129.252 132.526 1.00 76.37  ? 18  SER C OG    1 
ATOM 1514  N N     . SER C 3 19  ? 138.424 129.258 134.738 1.00 79.97  ? 19  SER C N     1 
ATOM 1515  C CA    . SER C 3 19  ? 139.827 129.420 135.102 1.00 79.97  ? 19  SER C CA    1 
ATOM 1516  C C     . SER C 3 19  ? 140.369 128.209 135.843 1.00 79.97  ? 19  SER C C     1 
ATOM 1517  O O     . SER C 3 19  ? 141.576 127.958 135.797 1.00 79.97  ? 19  SER C O     1 
ATOM 1518  C CB    . SER C 3 19  ? 140.016 130.669 135.960 1.00 79.97  ? 19  SER C CB    1 
ATOM 1519  O OG    . SER C 3 19  ? 139.384 130.516 137.218 1.00 79.97  ? 19  SER C OG    1 
ATOM 1520  N N     . ARG C 3 20  ? 139.507 127.449 136.517 1.00 82.41  ? 20  ARG C N     1 
ATOM 1521  C CA    . ARG C 3 20  ? 139.916 126.162 137.059 1.00 82.41  ? 20  ARG C CA    1 
ATOM 1522  C C     . ARG C 3 20  ? 140.117 125.115 135.977 1.00 82.41  ? 20  ARG C C     1 
ATOM 1523  O O     . ARG C 3 20  ? 140.662 124.047 136.270 1.00 82.41  ? 20  ARG C O     1 
ATOM 1524  C CB    . ARG C 3 20  ? 138.882 125.642 138.055 1.00 82.41  ? 20  ARG C CB    1 
ATOM 1525  C CG    . ARG C 3 20  ? 138.791 126.387 139.373 1.00 82.41  ? 20  ARG C CG    1 
ATOM 1526  C CD    . ARG C 3 20  ? 137.697 125.754 140.227 1.00 82.41  ? 20  ARG C CD    1 
ATOM 1527  N NE    . ARG C 3 20  ? 137.508 126.407 141.518 1.00 82.41  ? 20  ARG C NE    1 
ATOM 1528  C CZ    . ARG C 3 20  ? 138.127 126.034 142.631 1.00 82.41  ? 20  ARG C CZ    1 
ATOM 1529  N NH1   . ARG C 3 20  ? 138.975 125.015 142.610 1.00 82.41  ? 20  ARG C NH1   1 
ATOM 1530  N NH2   . ARG C 3 20  ? 137.900 126.675 143.765 1.00 82.41  ? 20  ARG C NH2   1 
ATOM 1531  N N     . ALA C 3 21  ? 139.673 125.376 134.749 1.00 77.96  ? 21  ALA C N     1 
ATOM 1532  C CA    . ALA C 3 21  ? 139.921 124.466 133.647 1.00 77.96  ? 21  ALA C CA    1 
ATOM 1533  C C     . ALA C 3 21  ? 140.626 125.100 132.458 1.00 77.96  ? 21  ALA C C     1 
ATOM 1534  O O     . ALA C 3 21  ? 141.028 124.367 131.549 1.00 77.96  ? 21  ALA C O     1 
ATOM 1535  C CB    . ALA C 3 21  ? 138.607 123.842 133.164 1.00 77.96  ? 21  ALA C CB    1 
ATOM 1536  N N     . GLY C 3 22  ? 140.803 126.415 132.431 1.00 79.53  ? 22  GLY C N     1 
ATOM 1537  C CA    . GLY C 3 22  ? 141.493 127.038 131.317 1.00 79.53  ? 22  GLY C CA    1 
ATOM 1538  C C     . GLY C 3 22  ? 140.622 127.304 130.112 1.00 79.53  ? 22  GLY C C     1 
ATOM 1539  O O     . GLY C 3 22  ? 141.090 127.180 128.975 1.00 79.53  ? 22  GLY C O     1 
ATOM 1540  N N     . LEU C 3 23  ? 139.360 127.668 130.325 1.00 73.20  ? 23  LEU C N     1 
ATOM 1541  C CA    . LEU C 3 23  ? 138.470 127.934 129.205 1.00 73.20  ? 23  LEU C CA    1 
ATOM 1542  C C     . LEU C 3 23  ? 137.833 129.300 129.374 1.00 73.20  ? 23  LEU C C     1 
ATOM 1543  O O     . LEU C 3 23  ? 138.238 130.071 130.247 1.00 73.20  ? 23  LEU C O     1 
ATOM 1544  C CB    . LEU C 3 23  ? 137.377 126.876 129.083 1.00 73.20  ? 23  LEU C CB    1 
ATOM 1545  C CG    . LEU C 3 23  ? 137.761 125.513 128.505 1.00 73.20  ? 23  LEU C CG    1 
ATOM 1546  C CD1   . LEU C 3 23  ? 138.612 125.644 127.251 1.00 73.20  ? 23  LEU C CD1   1 
ATOM 1547  C CD2   . LEU C 3 23  ? 138.407 124.591 129.518 1.00 73.20  ? 23  LEU C CD2   1 
ATOM 1548  N N     . GLN C 3 24  ? 136.847 129.619 128.534 1.00 72.11  ? 24  GLN C N     1 
ATOM 1549  C CA    . GLN C 3 24  ? 136.116 130.876 128.647 1.00 72.11  ? 24  GLN C CA    1 
ATOM 1550  C C     . GLN C 3 24  ? 134.614 130.668 128.496 1.00 72.11  ? 24  GLN C C     1 
ATOM 1551  O O     . GLN C 3 24  ? 133.926 131.526 127.935 1.00 72.11  ? 24  GLN C O     1 
ATOM 1552  C CB    . GLN C 3 24  ? 136.584 131.894 127.605 1.00 72.11  ? 24  GLN C CB    1 
ATOM 1553  C CG    . GLN C 3 24  ? 138.055 132.284 127.683 1.00 72.11  ? 24  GLN C CG    1 
ATOM 1554  C CD    . GLN C 3 24  ? 138.413 133.060 128.937 1.00 72.11  ? 24  GLN C CD    1 
ATOM 1555  O OE1   . GLN C 3 24  ? 137.682 133.954 129.359 1.00 72.11  ? 24  GLN C OE1   1 
ATOM 1556  N NE2   . GLN C 3 24  ? 139.541 132.715 129.543 1.00 72.11  ? 24  GLN C NE2   1 
ATOM 1557  N N     . PHE C 3 25  ? 134.089 129.539 128.977 1.00 71.49  ? 25  PHE C N     1 
ATOM 1558  C CA    . PHE C 3 25  ? 132.668 129.222 128.954 1.00 71.49  ? 25  PHE C CA    1 
ATOM 1559  C C     . PHE C 3 25  ? 132.127 128.974 130.355 1.00 71.49  ? 25  PHE C C     1 
ATOM 1560  O O     . PHE C 3 25  ? 132.855 128.488 131.222 1.00 71.49  ? 25  PHE C O     1 
ATOM 1561  C CB    . PHE C 3 25  ? 132.368 128.000 128.072 1.00 71.49  ? 25  PHE C CB    1 
ATOM 1562  C CG    . PHE C 3 25  ? 132.045 128.348 126.659 1.00 71.49  ? 25  PHE C CG    1 
ATOM 1563  C CD1   . PHE C 3 25  ? 131.966 129.662 126.266 1.00 71.49  ? 25  PHE C CD1   1 
ATOM 1564  C CD2   . PHE C 3 25  ? 131.703 127.368 125.756 1.00 71.49  ? 25  PHE C CD2   1 
ATOM 1565  C CE1   . PHE C 3 25  ? 131.638 129.988 124.979 1.00 71.49  ? 25  PHE C CE1   1 
ATOM 1566  C CE2   . PHE C 3 25  ? 131.358 127.692 124.470 1.00 71.49  ? 25  PHE C CE2   1 
ATOM 1567  C CZ    . PHE C 3 25  ? 131.328 129.005 124.082 1.00 71.49  ? 25  PHE C CZ    1 
ATOM 1568  N N     . PRO C 3 26  ? 130.852 129.290 130.612 1.00 68.33  ? 26  PRO C N     1 
ATOM 1569  C CA    . PRO C 3 26  ? 130.317 129.147 131.971 1.00 68.33  ? 26  PRO C CA    1 
ATOM 1570  C C     . PRO C 3 26  ? 130.059 127.695 132.323 1.00 68.33  ? 26  PRO C C     1 
ATOM 1571  O O     . PRO C 3 26  ? 129.102 127.079 131.842 1.00 68.33  ? 26  PRO C O     1 
ATOM 1572  C CB    . PRO C 3 26  ? 129.020 129.964 131.917 1.00 68.33  ? 26  PRO C CB    1 
ATOM 1573  C CG    . PRO C 3 26  ? 128.618 129.936 130.500 1.00 68.33  ? 26  PRO C CG    1 
ATOM 1574  C CD    . PRO C 3 26  ? 129.870 129.918 129.708 1.00 68.33  ? 26  PRO C CD    1 
ATOM 1575  N N     . VAL C 3 27  ? 130.906 127.141 133.183 1.00 62.77  ? 27  VAL C N     1 
ATOM 1576  C CA    . VAL C 3 27  ? 130.715 125.767 133.616 1.00 62.77  ? 27  VAL C CA    1 
ATOM 1577  C C     . VAL C 3 27  ? 129.491 125.668 134.509 1.00 62.77  ? 27  VAL C C     1 
ATOM 1578  O O     . VAL C 3 27  ? 128.724 124.705 134.436 1.00 62.77  ? 27  VAL C O     1 
ATOM 1579  C CB    . VAL C 3 27  ? 131.985 125.265 134.321 1.00 62.77  ? 27  VAL C CB    1 
ATOM 1580  C CG1   . VAL C 3 27  ? 131.813 123.857 134.831 1.00 62.77  ? 27  VAL C CG1   1 
ATOM 1581  C CG2   . VAL C 3 27  ? 133.147 125.329 133.367 1.00 62.77  ? 27  VAL C CG2   1 
ATOM 1582  N N     . GLY C 3 28  ? 129.255 126.687 135.325 1.00 67.03  ? 28  GLY C N     1 
ATOM 1583  C CA    . GLY C 3 28  ? 128.142 126.624 136.249 1.00 67.03  ? 28  GLY C CA    1 
ATOM 1584  C C     . GLY C 3 28  ? 126.804 126.824 135.573 1.00 67.03  ? 28  GLY C C     1 
ATOM 1585  O O     . GLY C 3 28  ? 125.825 126.168 135.927 1.00 67.03  ? 28  GLY C O     1 
ATOM 1586  N N     . ARG C 3 29  ? 126.740 127.735 134.600 1.00 73.40  ? 29  ARG C N     1 
ATOM 1587  C CA    . ARG C 3 29  ? 125.479 127.979 133.907 1.00 73.40  ? 29  ARG C CA    1 
ATOM 1588  C C     . ARG C 3 29  ? 125.098 126.784 133.035 1.00 73.40  ? 29  ARG C C     1 
ATOM 1589  O O     . ARG C 3 29  ? 123.937 126.350 133.031 1.00 73.40  ? 29  ARG C O     1 
ATOM 1590  C CB    . ARG C 3 29  ? 125.576 129.255 133.068 1.00 73.40  ? 29  ARG C CB    1 
ATOM 1591  C CG    . ARG C 3 29  ? 124.258 129.676 132.442 1.00 73.40  ? 29  ARG C CG    1 
ATOM 1592  C CD    . ARG C 3 29  ? 124.400 130.831 131.451 1.00 73.40  ? 29  ARG C CD    1 
ATOM 1593  N NE    . ARG C 3 29  ? 124.772 132.098 132.069 1.00 73.40  ? 29  ARG C NE    1 
ATOM 1594  C CZ    . ARG C 3 29  ? 125.039 133.202 131.382 1.00 73.40  ? 29  ARG C CZ    1 
ATOM 1595  N NH1   . ARG C 3 29  ? 124.967 133.191 130.064 1.00 73.40  ? 29  ARG C NH1   1 
ATOM 1596  N NH2   . ARG C 3 29  ? 125.372 134.319 132.010 1.00 73.40  ? 29  ARG C NH2   1 
ATOM 1597  N N     . VAL C 3 30  ? 126.075 126.225 132.316 1.00 67.81  ? 30  VAL C N     1 
ATOM 1598  C CA    . VAL C 3 30  ? 125.846 125.010 131.542 1.00 67.81  ? 30  VAL C CA    1 
ATOM 1599  C C     . VAL C 3 30  ? 125.505 123.850 132.468 1.00 67.81  ? 30  VAL C C     1 
ATOM 1600  O O     . VAL C 3 30  ? 124.621 123.044 132.170 1.00 67.81  ? 30  VAL C O     1 
ATOM 1601  C CB    . VAL C 3 30  ? 127.075 124.718 130.659 1.00 67.81  ? 30  VAL C CB    1 
ATOM 1602  C CG1   . VAL C 3 30  ? 127.017 123.350 130.061 1.00 67.81  ? 30  VAL C CG1   1 
ATOM 1603  C CG2   . VAL C 3 30  ? 127.150 125.721 129.538 1.00 67.81  ? 30  VAL C CG2   1 
ATOM 1604  N N     . HIS C 3 31  ? 126.143 123.801 133.636 1.00 65.60  ? 31  HIS C N     1 
ATOM 1605  C CA    . HIS C 3 31  ? 125.886 122.751 134.617 1.00 65.60  ? 31  HIS C CA    1 
ATOM 1606  C C     . HIS C 3 31  ? 124.466 122.820 135.159 1.00 65.60  ? 31  HIS C C     1 
ATOM 1607  O O     . HIS C 3 31  ? 123.819 121.782 135.365 1.00 65.60  ? 31  HIS C O     1 
ATOM 1608  C CB    . HIS C 3 31  ? 126.883 122.876 135.755 1.00 65.60  ? 31  HIS C CB    1 
ATOM 1609  C CG    . HIS C 3 31  ? 126.673 121.884 136.841 1.00 65.60  ? 31  HIS C CG    1 
ATOM 1610  N ND1   . HIS C 3 31  ? 127.007 120.558 136.707 1.00 65.60  ? 31  HIS C ND1   1 
ATOM 1611  C CD2   . HIS C 3 31  ? 126.168 122.024 138.086 1.00 65.60  ? 31  HIS C CD2   1 
ATOM 1612  C CE1   . HIS C 3 31  ? 126.715 119.920 137.825 1.00 65.60  ? 31  HIS C CE1   1 
ATOM 1613  N NE2   . HIS C 3 31  ? 126.205 120.788 138.678 1.00 65.60  ? 31  HIS C NE2   1 
ATOM 1614  N N     . ARG C 3 32  ? 123.986 124.039 135.416 1.00 71.62  ? 32  ARG C N     1 
ATOM 1615  C CA    . ARG C 3 32  ? 122.577 124.266 135.709 1.00 71.62  ? 32  ARG C CA    1 
ATOM 1616  C C     . ARG C 3 32  ? 121.710 123.736 134.581 1.00 71.62  ? 32  ARG C C     1 
ATOM 1617  O O     . ARG C 3 32  ? 120.724 123.029 134.822 1.00 71.62  ? 32  ARG C O     1 
ATOM 1618  C CB    . ARG C 3 32  ? 122.340 125.767 135.920 1.00 71.62  ? 32  ARG C CB    1 
ATOM 1619  C CG    . ARG C 3 32  ? 120.974 126.225 136.473 1.00 71.62  ? 32  ARG C CG    1 
ATOM 1620  C CD    . ARG C 3 32  ? 119.902 126.467 135.393 1.00 71.62  ? 32  ARG C CD    1 
ATOM 1621  N NE    . ARG C 3 32  ? 120.343 127.334 134.307 1.00 71.62  ? 32  ARG C NE    1 
ATOM 1622  C CZ    . ARG C 3 32  ? 120.182 128.650 134.283 1.00 71.62  ? 32  ARG C CZ    1 
ATOM 1623  N NH1   . ARG C 3 32  ? 119.564 129.260 135.280 1.00 71.62  ? 32  ARG C NH1   1 
ATOM 1624  N NH2   . ARG C 3 32  ? 120.621 129.352 133.251 1.00 71.62  ? 32  ARG C NH2   1 
ATOM 1625  N N     . LEU C 3 33  ? 122.077 124.049 133.339 1.00 71.97  ? 33  LEU C N     1 
ATOM 1626  C CA    . LEU C 3 33  ? 121.209 123.702 132.223 1.00 71.97  ? 33  LEU C CA    1 
ATOM 1627  C C     . LEU C 3 33  ? 121.222 122.207 131.936 1.00 71.97  ? 33  LEU C C     1 
ATOM 1628  O O     . LEU C 3 33  ? 120.285 121.686 131.326 1.00 71.97  ? 33  LEU C O     1 
ATOM 1629  C CB    . LEU C 3 33  ? 121.606 124.505 130.995 1.00 71.97  ? 33  LEU C CB    1 
ATOM 1630  C CG    . LEU C 3 33  ? 121.246 125.975 131.149 1.00 71.97  ? 33  LEU C CG    1 
ATOM 1631  C CD1   . LEU C 3 33  ? 121.845 126.788 130.019 1.00 71.97  ? 33  LEU C CD1   1 
ATOM 1632  C CD2   . LEU C 3 33  ? 119.737 126.112 131.171 1.00 71.97  ? 33  LEU C CD2   1 
ATOM 1633  N N     . LEU C 3 34  ? 122.269 121.497 132.357 1.00 67.24  ? 34  LEU C N     1 
ATOM 1634  C CA    . LEU C 3 34  ? 122.196 120.045 132.312 1.00 67.24  ? 34  LEU C CA    1 
ATOM 1635  C C     . LEU C 3 34  ? 121.368 119.501 133.457 1.00 67.24  ? 34  LEU C C     1 
ATOM 1636  O O     . LEU C 3 34  ? 120.702 118.475 133.296 1.00 67.24  ? 34  LEU C O     1 
ATOM 1637  C CB    . LEU C 3 34  ? 123.576 119.397 132.350 1.00 67.24  ? 34  LEU C CB    1 
ATOM 1638  C CG    . LEU C 3 34  ? 124.298 119.095 131.039 1.00 67.24  ? 34  LEU C CG    1 
ATOM 1639  C CD1   . LEU C 3 34  ? 123.379 118.355 130.084 1.00 67.24  ? 34  LEU C CD1   1 
ATOM 1640  C CD2   . LEU C 3 34  ? 124.895 120.296 130.405 1.00 67.24  ? 34  LEU C CD2   1 
ATOM 1641  N N     . ARG C 3 35  ? 121.413 120.141 134.625 1.00 67.67  ? 35  ARG C N     1 
ATOM 1642  C CA    . ARG C 3 35  ? 120.643 119.585 135.727 1.00 67.67  ? 35  ARG C CA    1 
ATOM 1643  C C     . ARG C 3 35  ? 119.170 119.923 135.625 1.00 67.67  ? 35  ARG C C     1 
ATOM 1644  O O     . ARG C 3 35  ? 118.340 119.206 136.187 1.00 67.67  ? 35  ARG C O     1 
ATOM 1645  C CB    . ARG C 3 35  ? 121.161 120.070 137.075 1.00 67.67  ? 35  ARG C CB    1 
ATOM 1646  C CG    . ARG C 3 35  ? 122.480 119.490 137.509 1.00 67.67  ? 35  ARG C CG    1 
ATOM 1647  C CD    . ARG C 3 35  ? 122.786 119.917 138.932 1.00 67.67  ? 35  ARG C CD    1 
ATOM 1648  N NE    . ARG C 3 35  ? 123.029 121.354 139.031 1.00 67.67  ? 35  ARG C NE    1 
ATOM 1649  C CZ    . ARG C 3 35  ? 122.219 122.209 139.649 1.00 67.67  ? 35  ARG C CZ    1 
ATOM 1650  N NH1   . ARG C 3 35  ? 121.103 121.775 140.217 1.00 67.67  ? 35  ARG C NH1   1 
ATOM 1651  N NH2   . ARG C 3 35  ? 122.517 123.499 139.689 1.00 67.67  ? 35  ARG C NH2   1 
ATOM 1652  N N     . LYS C 3 36  ? 118.816 120.989 134.928 1.00 71.73  ? 36  LYS C N     1 
ATOM 1653  C CA    . LYS C 3 36  ? 117.446 121.473 134.959 1.00 71.73  ? 36  LYS C CA    1 
ATOM 1654  C C     . LYS C 3 36  ? 116.776 121.347 133.603 1.00 71.73  ? 36  LYS C C     1 
ATOM 1655  O O     . LYS C 3 36  ? 116.084 122.252 133.141 1.00 71.73  ? 36  LYS C O     1 
ATOM 1656  C CB    . LYS C 3 36  ? 117.391 122.907 135.469 1.00 71.73  ? 36  LYS C CB    1 
ATOM 1657  C CG    . LYS C 3 36  ? 117.747 123.001 136.941 1.00 71.73  ? 36  LYS C CG    1 
ATOM 1658  C CD    . LYS C 3 36  ? 117.646 124.412 137.459 1.00 71.73  ? 36  LYS C CD    1 
ATOM 1659  C CE    . LYS C 3 36  ? 118.119 124.482 138.896 1.00 71.73  ? 36  LYS C CE    1 
ATOM 1660  N NZ    . LYS C 3 36  ? 118.093 125.871 139.437 1.00 71.73  ? 36  LYS C NZ    1 
ATOM 1661  N N     . GLY C 3 37  ? 116.976 120.210 132.960 1.00 73.83  ? 37  GLY C N     1 
ATOM 1662  C CA    . GLY C 3 37  ? 116.279 119.925 131.733 1.00 73.83  ? 37  GLY C CA    1 
ATOM 1663  C C     . GLY C 3 37  ? 115.723 118.525 131.757 1.00 73.83  ? 37  GLY C C     1 
ATOM 1664  O O     . GLY C 3 37  ? 115.156 118.075 130.759 1.00 73.83  ? 37  GLY C O     1 
ATOM 1665  N N     . ASN C 3 38  ? 115.879 117.851 132.899 1.00 77.12  ? 38  ASN C N     1 
ATOM 1666  C CA    . ASN C 3 38  ? 115.464 116.465 133.119 1.00 77.12  ? 38  ASN C CA    1 
ATOM 1667  C C     . ASN C 3 38  ? 116.046 115.537 132.049 1.00 77.12  ? 38  ASN C C     1 
ATOM 1668  O O     . ASN C 3 38  ? 115.351 115.026 131.183 1.00 77.12  ? 38  ASN C O     1 
ATOM 1669  C CB    . ASN C 3 38  ? 113.937 116.336 133.183 1.00 77.12  ? 38  ASN C CB    1 
ATOM 1670  C CG    . ASN C 3 38  ? 113.356 116.889 134.464 1.00 77.12  ? 38  ASN C CG    1 
ATOM 1671  O OD1   . ASN C 3 38  ? 113.961 116.776 135.523 1.00 77.12  ? 38  ASN C OD1   1 
ATOM 1672  N ND2   . ASN C 3 38  ? 112.157 117.447 134.383 1.00 77.12  ? 38  ASN C ND2   1 
ATOM 1673  N N     . TYR C 3 39  ? 117.362 115.388 132.081 1.00 71.31  ? 39  TYR C N     1 
ATOM 1674  C CA    . TYR C 3 39  ? 118.029 114.473 131.163 1.00 71.31  ? 39  TYR C CA    1 
ATOM 1675  C C     . TYR C 3 39  ? 118.361 113.149 131.835 1.00 71.31  ? 39  TYR C C     1 
ATOM 1676  O O     . TYR C 3 39  ? 117.918 112.091 131.384 1.00 71.31  ? 39  TYR C O     1 
ATOM 1677  C CB    . TYR C 3 39  ? 119.276 115.141 130.600 1.00 71.31  ? 39  TYR C CB    1 
ATOM 1678  C CG    . TYR C 3 39  ? 118.922 116.233 129.643 1.00 71.31  ? 39  TYR C CG    1 
ATOM 1679  C CD1   . TYR C 3 39  ? 118.710 115.953 128.308 1.00 71.31  ? 39  TYR C CD1   1 
ATOM 1680  C CD2   . TYR C 3 39  ? 118.744 117.533 130.082 1.00 71.31  ? 39  TYR C CD2   1 
ATOM 1681  C CE1   . TYR C 3 39  ? 118.381 116.940 127.428 1.00 71.31  ? 39  TYR C CE1   1 
ATOM 1682  C CE2   . TYR C 3 39  ? 118.408 118.526 129.211 1.00 71.31  ? 39  TYR C CE2   1 
ATOM 1683  C CZ    . TYR C 3 39  ? 118.228 118.223 127.887 1.00 71.31  ? 39  TYR C CZ    1 
ATOM 1684  O OH    . TYR C 3 39  ? 117.888 119.213 127.009 1.00 71.31  ? 39  TYR C OH    1 
ATOM 1685  N N     . ALA C 3 40  ? 119.127 113.193 132.911 1.00 74.94  ? 40  ALA C N     1 
ATOM 1686  C CA    . ALA C 3 40  ? 119.301 112.070 133.814 1.00 74.94  ? 40  ALA C CA    1 
ATOM 1687  C C     . ALA C 3 40  ? 118.660 112.424 135.143 1.00 74.94  ? 40  ALA C C     1 
ATOM 1688  O O     . ALA C 3 40  ? 118.077 113.492 135.305 1.00 74.94  ? 40  ALA C O     1 
ATOM 1689  C CB    . ALA C 3 40  ? 120.781 111.734 133.996 1.00 74.94  ? 40  ALA C CB    1 
ATOM 1690  N N     . GLU C 3 41  ? 118.762 111.516 136.107 1.00 75.96  ? 41  GLU C N     1 
ATOM 1691  C CA    . GLU C 3 41  ? 118.415 111.916 137.461 1.00 75.96  ? 41  GLU C CA    1 
ATOM 1692  C C     . GLU C 3 41  ? 119.563 112.682 138.103 1.00 75.96  ? 41  GLU C C     1 
ATOM 1693  O O     . GLU C 3 41  ? 119.338 113.519 138.985 1.00 75.96  ? 41  GLU C O     1 
ATOM 1694  C CB    . GLU C 3 41  ? 118.024 110.699 138.303 1.00 75.96  ? 41  GLU C CB    1 
ATOM 1695  C CG    . GLU C 3 41  ? 117.416 111.065 139.663 1.00 75.96  ? 41  GLU C CG    1 
ATOM 1696  C CD    . GLU C 3 41  ? 116.973 109.872 140.461 1.00 75.96  ? 41  GLU C CD    1 
ATOM 1697  O OE1   . GLU C 3 41  ? 117.117 108.738 139.965 1.00 75.96  ? 41  GLU C OE1   1 
ATOM 1698  O OE2   . GLU C 3 41  ? 116.492 110.070 141.593 1.00 75.96  ? 41  GLU C OE2   1 
ATOM 1699  N N     . ARG C 3 42  ? 120.788 112.456 137.637 1.00 74.26  ? 42  ARG C N     1 
ATOM 1700  C CA    . ARG C 3 42  ? 121.946 113.066 138.265 1.00 74.26  ? 42  ARG C CA    1 
ATOM 1701  C C     . ARG C 3 42  ? 123.057 113.231 137.240 1.00 74.26  ? 42  ARG C C     1 
ATOM 1702  O O     . ARG C 3 42  ? 123.152 112.464 136.284 1.00 74.26  ? 42  ARG C O     1 
ATOM 1703  C CB    . ARG C 3 42  ? 122.381 112.230 139.462 1.00 74.26  ? 42  ARG C CB    1 
ATOM 1704  C CG    . ARG C 3 42  ? 122.776 110.824 139.125 1.00 74.26  ? 42  ARG C CG    1 
ATOM 1705  C CD    . ARG C 3 42  ? 122.759 109.992 140.383 1.00 74.26  ? 42  ARG C CD    1 
ATOM 1706  N NE    . ARG C 3 42  ? 123.728 110.450 141.366 1.00 74.26  ? 42  ARG C NE    1 
ATOM 1707  C CZ    . ARG C 3 42  ? 123.625 110.193 142.661 1.00 74.26  ? 42  ARG C CZ    1 
ATOM 1708  N NH1   . ARG C 3 42  ? 122.586 109.502 143.105 1.00 74.26  ? 42  ARG C NH1   1 
ATOM 1709  N NH2   . ARG C 3 42  ? 124.541 110.638 143.507 1.00 74.26  ? 42  ARG C NH2   1 
ATOM 1710  N N     . VAL C 3 43  ? 123.873 114.266 137.426 1.00 70.57  ? 43  VAL C N     1 
ATOM 1711  C CA    . VAL C 3 43  ? 124.882 114.676 136.455 1.00 70.57  ? 43  VAL C CA    1 
ATOM 1712  C C     . VAL C 3 43  ? 126.232 114.716 137.148 1.00 70.57  ? 43  VAL C C     1 
ATOM 1713  O O     . VAL C 3 43  ? 126.395 115.415 138.152 1.00 70.57  ? 43  VAL C O     1 
ATOM 1714  C CB    . VAL C 3 43  ? 124.560 116.054 135.855 1.00 70.57  ? 43  VAL C CB    1 
ATOM 1715  C CG1   . VAL C 3 43  ? 125.642 116.487 134.888 1.00 70.57  ? 43  VAL C CG1   1 
ATOM 1716  C CG2   . VAL C 3 43  ? 123.217 116.036 135.172 1.00 70.57  ? 43  VAL C CG2   1 
ATOM 1717  N N     . GLY C 3 44  ? 127.213 114.021 136.578 1.00 79.43  ? 44  GLY C N     1 
ATOM 1718  C CA    . GLY C 3 44  ? 128.541 113.927 137.159 1.00 79.43  ? 44  GLY C CA    1 
ATOM 1719  C C     . GLY C 3 44  ? 129.338 115.215 137.239 1.00 79.43  ? 44  GLY C C     1 
ATOM 1720  O O     . GLY C 3 44  ? 128.837 116.298 136.924 1.00 79.43  ? 44  GLY C O     1 
ATOM 1721  N N     . ALA C 3 45  ? 130.595 115.113 137.652 1.00 73.06  ? 45  ALA C N     1 
ATOM 1722  C CA    . ALA C 3 45  ? 131.369 116.320 137.902 1.00 73.06  ? 45  ALA C CA    1 
ATOM 1723  C C     . ALA C 3 45  ? 131.982 116.871 136.621 1.00 73.06  ? 45  ALA C C     1 
ATOM 1724  O O     . ALA C 3 45  ? 131.854 118.062 136.324 1.00 73.06  ? 45  ALA C O     1 
ATOM 1725  C CB    . ALA C 3 45  ? 132.454 116.037 138.939 1.00 73.06  ? 45  ALA C CB    1 
ATOM 1726  N N     . GLY C 3 46  ? 132.649 116.014 135.846 1.00 67.33  ? 46  GLY C N     1 
ATOM 1727  C CA    . GLY C 3 46  ? 133.468 116.493 134.748 1.00 67.33  ? 46  GLY C CA    1 
ATOM 1728  C C     . GLY C 3 46  ? 132.709 116.895 133.508 1.00 67.33  ? 46  GLY C C     1 
ATOM 1729  O O     . GLY C 3 46  ? 133.296 117.520 132.621 1.00 67.33  ? 46  GLY C O     1 
ATOM 1730  N N     . ALA C 3 47  ? 131.420 116.572 133.440 1.00 64.62  ? 47  ALA C N     1 
ATOM 1731  C CA    . ALA C 3 47  ? 130.677 116.680 132.183 1.00 64.62  ? 47  ALA C CA    1 
ATOM 1732  C C     . ALA C 3 47  ? 130.490 118.102 131.651 1.00 64.62  ? 47  ALA C C     1 
ATOM 1733  O O     . ALA C 3 47  ? 130.688 118.295 130.433 1.00 64.62  ? 47  ALA C O     1 
ATOM 1734  C CB    . ALA C 3 47  ? 129.338 115.946 132.332 1.00 64.62  ? 47  ALA C CB    1 
ATOM 1735  N N     . PRO C 3 48  ? 130.115 119.129 132.442 1.00 65.87  ? 48  PRO C N     1 
ATOM 1736  C CA    . PRO C 3 48  ? 129.958 120.455 131.822 1.00 65.87  ? 48  PRO C CA    1 
ATOM 1737  C C     . PRO C 3 48  ? 131.270 121.081 131.393 1.00 65.87  ? 48  PRO C C     1 
ATOM 1738  O O     . PRO C 3 48  ? 131.279 121.940 130.500 1.00 65.87  ? 48  PRO C O     1 
ATOM 1739  C CB    . PRO C 3 48  ? 129.272 121.278 132.917 1.00 65.87  ? 48  PRO C CB    1 
ATOM 1740  C CG    . PRO C 3 48  ? 128.662 120.304 133.791 1.00 65.87  ? 48  PRO C CG    1 
ATOM 1741  C CD    . PRO C 3 48  ? 129.607 119.178 133.828 1.00 65.87  ? 48  PRO C CD    1 
ATOM 1742  N N     . VAL C 3 49  ? 132.378 120.664 132.008 1.00 65.15  ? 49  VAL C N     1 
ATOM 1743  C CA    . VAL C 3 49  ? 133.700 121.033 131.514 1.00 65.15  ? 49  VAL C CA    1 
ATOM 1744  C C     . VAL C 3 49  ? 133.898 120.485 130.109 1.00 65.15  ? 49  VAL C C     1 
ATOM 1745  O O     . VAL C 3 49  ? 134.390 121.182 129.207 1.00 65.15  ? 49  VAL C O     1 
ATOM 1746  C CB    . VAL C 3 49  ? 134.782 120.511 132.474 1.00 65.15  ? 49  VAL C CB    1 
ATOM 1747  C CG1   . VAL C 3 49  ? 136.171 120.853 131.969 1.00 65.15  ? 49  VAL C CG1   1 
ATOM 1748  C CG2   . VAL C 3 49  ? 134.561 121.058 133.859 1.00 65.15  ? 49  VAL C CG2   1 
ATOM 1749  N N     . TYR C 3 50  ? 133.474 119.239 129.899 1.00 63.15  ? 50  TYR C N     1 
ATOM 1750  C CA    . TYR C 3 50  ? 133.664 118.587 128.615 1.00 63.15  ? 50  TYR C CA    1 
ATOM 1751  C C     . TYR C 3 50  ? 132.820 119.260 127.546 1.00 63.15  ? 50  TYR C C     1 
ATOM 1752  O O     . TYR C 3 50  ? 133.331 119.664 126.490 1.00 63.15  ? 50  TYR C O     1 
ATOM 1753  C CB    . TYR C 3 50  ? 133.298 117.113 128.729 1.00 63.15  ? 50  TYR C CB    1 
ATOM 1754  C CG    . TYR C 3 50  ? 133.804 116.293 127.577 1.00 63.15  ? 50  TYR C CG    1 
ATOM 1755  C CD1   . TYR C 3 50  ? 135.077 115.757 127.601 1.00 63.15  ? 50  TYR C CD1   1 
ATOM 1756  C CD2   . TYR C 3 50  ? 133.040 116.102 126.442 1.00 63.15  ? 50  TYR C CD2   1 
ATOM 1757  C CE1   . TYR C 3 50  ? 135.553 115.011 126.547 1.00 63.15  ? 50  TYR C CE1   1 
ATOM 1758  C CE2   . TYR C 3 50  ? 133.513 115.377 125.378 1.00 63.15  ? 50  TYR C CE2   1 
ATOM 1759  C CZ    . TYR C 3 50  ? 134.769 114.834 125.438 1.00 63.15  ? 50  TYR C CZ    1 
ATOM 1760  O OH    . TYR C 3 50  ? 135.252 114.108 124.387 1.00 63.15  ? 50  TYR C OH    1 
ATOM 1761  N N     . LEU C 3 51  ? 131.527 119.420 127.826 1.00 59.38  ? 51  LEU C N     1 
ATOM 1762  C CA    . LEU C 3 51  ? 130.605 119.986 126.847 1.00 59.38  ? 51  LEU C CA    1 
ATOM 1763  C C     . LEU C 3 51  ? 130.927 121.445 126.556 1.00 59.38  ? 51  LEU C C     1 
ATOM 1764  O O     . LEU C 3 51  ? 130.802 121.909 125.414 1.00 59.38  ? 51  LEU C O     1 
ATOM 1765  C CB    . LEU C 3 51  ? 129.179 119.830 127.358 1.00 59.38  ? 51  LEU C CB    1 
ATOM 1766  C CG    . LEU C 3 51  ? 128.058 120.376 126.497 1.00 59.38  ? 51  LEU C CG    1 
ATOM 1767  C CD1   . LEU C 3 51  ? 128.112 119.743 125.160 1.00 59.38  ? 51  LEU C CD1   1 
ATOM 1768  C CD2   . LEU C 3 51  ? 126.776 120.022 127.162 1.00 59.38  ? 51  LEU C CD2   1 
ATOM 1769  N N     . ALA C 3 52  ? 131.388 122.170 127.577 1.00 62.13  ? 52  ALA C N     1 
ATOM 1770  C CA    . ALA C 3 52  ? 131.821 123.544 127.366 1.00 62.13  ? 52  ALA C CA    1 
ATOM 1771  C C     . ALA C 3 52  ? 133.051 123.606 126.472 1.00 62.13  ? 52  ALA C C     1 
ATOM 1772  O O     . ALA C 3 52  ? 133.173 124.514 125.639 1.00 62.13  ? 52  ALA C O     1 
ATOM 1773  C CB    . ALA C 3 52  ? 132.098 124.209 128.706 1.00 62.13  ? 52  ALA C CB    1 
ATOM 1774  N N     . ALA C 3 53  ? 133.960 122.638 126.615 1.00 65.10  ? 53  ALA C N     1 
ATOM 1775  C CA    . ALA C 3 53  ? 135.134 122.611 125.748 1.00 65.10  ? 53  ALA C CA    1 
ATOM 1776  C C     . ALA C 3 53  ? 134.750 122.354 124.297 1.00 65.10  ? 53  ALA C C     1 
ATOM 1777  O O     . ALA C 3 53  ? 135.287 122.996 123.378 1.00 65.10  ? 53  ALA C O     1 
ATOM 1778  C CB    . ALA C 3 53  ? 136.116 121.551 126.229 1.00 65.10  ? 53  ALA C CB    1 
ATOM 1779  N N     . VAL C 3 54  ? 133.804 121.433 124.080 1.00 61.94  ? 54  VAL C N     1 
ATOM 1780  C CA    . VAL C 3 54  ? 133.370 121.106 122.724 1.00 61.94  ? 54  VAL C CA    1 
ATOM 1781  C C     . VAL C 3 54  ? 132.704 122.310 122.075 1.00 61.94  ? 54  VAL C C     1 
ATOM 1782  O O     . VAL C 3 54  ? 133.008 122.677 120.930 1.00 61.94  ? 54  VAL C O     1 
ATOM 1783  C CB    . VAL C 3 54  ? 132.436 119.888 122.756 1.00 61.94  ? 54  VAL C CB    1 
ATOM 1784  C CG1   . VAL C 3 54  ? 131.884 119.614 121.394 1.00 61.94  ? 54  VAL C CG1   1 
ATOM 1785  C CG2   . VAL C 3 54  ? 133.189 118.692 123.269 1.00 61.94  ? 54  VAL C CG2   1 
ATOM 1786  N N     . LEU C 3 55  ? 131.838 122.983 122.824 1.00 65.06  ? 55  LEU C N     1 
ATOM 1787  C CA    . LEU C 3 55  ? 131.133 124.130 122.266 1.00 65.06  ? 55  LEU C CA    1 
ATOM 1788  C C     . LEU C 3 55  ? 132.060 125.319 122.037 1.00 65.06  ? 55  LEU C C     1 
ATOM 1789  O O     . LEU C 3 55  ? 131.834 126.109 121.111 1.00 65.06  ? 55  LEU C O     1 
ATOM 1790  C CB    . LEU C 3 55  ? 129.963 124.491 123.174 1.00 65.06  ? 55  LEU C CB    1 
ATOM 1791  C CG    . LEU C 3 55  ? 128.600 123.902 122.797 1.00 65.06  ? 55  LEU C CG    1 
ATOM 1792  C CD1   . LEU C 3 55  ? 128.602 122.417 122.612 1.00 65.06  ? 55  LEU C CD1   1 
ATOM 1793  C CD2   . LEU C 3 55  ? 127.683 124.200 123.933 1.00 65.06  ? 55  LEU C CD2   1 
ATOM 1794  N N     . GLU C 3 56  ? 133.131 125.440 122.826 1.00 71.03  ? 56  GLU C N     1 
ATOM 1795  C CA    . GLU C 3 56  ? 134.094 126.499 122.546 1.00 71.03  ? 56  GLU C CA    1 
ATOM 1796  C C     . GLU C 3 56  ? 134.891 126.192 121.288 1.00 71.03  ? 56  GLU C C     1 
ATOM 1797  O O     . GLU C 3 56  ? 135.236 127.109 120.532 1.00 71.03  ? 56  GLU C O     1 
ATOM 1798  C CB    . GLU C 3 56  ? 135.021 126.729 123.742 1.00 71.03  ? 56  GLU C CB    1 
ATOM 1799  C CG    . GLU C 3 56  ? 135.971 127.911 123.535 1.00 71.03  ? 56  GLU C CG    1 
ATOM 1800  C CD    . GLU C 3 56  ? 136.737 128.292 124.766 1.00 71.03  ? 56  GLU C CD    1 
ATOM 1801  O OE1   . GLU C 3 56  ? 136.514 127.654 125.806 1.00 71.03  ? 56  GLU C OE1   1 
ATOM 1802  O OE2   . GLU C 3 56  ? 137.555 129.232 124.697 1.00 71.03  ? 56  GLU C OE2   1 
ATOM 1803  N N     . TYR C 3 57  ? 135.176 124.911 121.041 1.00 71.20  ? 57  TYR C N     1 
ATOM 1804  C CA    . TYR C 3 57  ? 135.820 124.530 119.788 1.00 71.20  ? 57  TYR C CA    1 
ATOM 1805  C C     . TYR C 3 57  ? 134.958 124.895 118.588 1.00 71.20  ? 57  TYR C C     1 
ATOM 1806  O O     . TYR C 3 57  ? 135.403 125.623 117.689 1.00 71.20  ? 57  TYR C O     1 
ATOM 1807  C CB    . TYR C 3 57  ? 136.119 123.039 119.781 1.00 71.20  ? 57  TYR C CB    1 
ATOM 1808  C CG    . TYR C 3 57  ? 136.690 122.577 118.471 1.00 71.20  ? 57  TYR C CG    1 
ATOM 1809  C CD1   . TYR C 3 57  ? 137.983 122.904 118.111 1.00 71.20  ? 57  TYR C CD1   1 
ATOM 1810  C CD2   . TYR C 3 57  ? 135.939 121.813 117.594 1.00 71.20  ? 57  TYR C CD2   1 
ATOM 1811  C CE1   . TYR C 3 57  ? 138.516 122.481 116.913 1.00 71.20  ? 57  TYR C CE1   1 
ATOM 1812  C CE2   . TYR C 3 57  ? 136.464 121.385 116.395 1.00 71.20  ? 57  TYR C CE2   1 
ATOM 1813  C CZ    . TYR C 3 57  ? 137.747 121.729 116.056 1.00 71.20  ? 57  TYR C CZ    1 
ATOM 1814  O OH    . TYR C 3 57  ? 138.272 121.309 114.859 1.00 71.20  ? 57  TYR C OH    1 
ATOM 1815  N N     . LEU C 3 58  ? 133.704 124.427 118.588 1.00 71.31  ? 58  LEU C N     1 
ATOM 1816  C CA    . LEU C 3 58  ? 132.794 124.632 117.462 1.00 71.31  ? 58  LEU C CA    1 
ATOM 1817  C C     . LEU C 3 58  ? 132.552 126.114 117.207 1.00 71.31  ? 58  LEU C C     1 
ATOM 1818  O O     . LEU C 3 58  ? 132.682 126.597 116.070 1.00 71.31  ? 58  LEU C O     1 
ATOM 1819  C CB    . LEU C 3 58  ? 131.473 123.920 117.745 1.00 71.31  ? 58  LEU C CB    1 
ATOM 1820  C CG    . LEU C 3 58  ? 131.637 122.419 117.947 1.00 71.31  ? 58  LEU C CG    1 
ATOM 1821  C CD1   . LEU C 3 58  ? 130.349 121.791 118.403 1.00 71.31  ? 58  LEU C CD1   1 
ATOM 1822  C CD2   . LEU C 3 58  ? 132.087 121.796 116.678 1.00 71.31  ? 58  LEU C CD2   1 
ATOM 1823  N N     . THR C 3 59  ? 132.263 126.847 118.291 1.00 71.32  ? 59  THR C N     1 
ATOM 1824  C CA    . THR C 3 59  ? 132.139 128.300 118.265 1.00 71.32  ? 59  THR C CA    1 
ATOM 1825  C C     . THR C 3 59  ? 133.385 128.965 117.689 1.00 71.32  ? 59  THR C C     1 
ATOM 1826  O O     . THR C 3 59  ? 133.292 129.921 116.904 1.00 71.32  ? 59  THR C O     1 
ATOM 1827  C CB    . THR C 3 59  ? 131.898 128.798 119.686 1.00 71.32  ? 59  THR C CB    1 
ATOM 1828  O OG1   . THR C 3 59  ? 130.771 128.117 120.246 1.00 71.32  ? 59  THR C OG1   1 
ATOM 1829  C CG2   . THR C 3 59  ? 131.633 130.283 119.698 1.00 71.32  ? 59  THR C CG2   1 
ATOM 1830  N N     . ALA C 3 60  ? 134.557 128.426 118.029 1.00 76.38  ? 60  ALA C N     1 
ATOM 1831  C CA    . ALA C 3 60  ? 135.818 129.048 117.651 1.00 76.38  ? 60  ALA C CA    1 
ATOM 1832  C C     . ALA C 3 60  ? 136.052 128.965 116.150 1.00 76.38  ? 60  ALA C C     1 
ATOM 1833  O O     . ALA C 3 60  ? 136.342 129.980 115.507 1.00 76.38  ? 60  ALA C O     1 
ATOM 1834  C CB    . ALA C 3 60  ? 136.974 128.407 118.418 1.00 76.38  ? 60  ALA C CB    1 
ATOM 1835  N N     . GLU C 3 61  ? 135.920 127.771 115.558 1.00 78.25  ? 61  GLU C N     1 
ATOM 1836  C CA    . GLU C 3 61  ? 136.196 127.744 114.122 1.00 78.25  ? 61  GLU C CA    1 
ATOM 1837  C C     . GLU C 3 61  ? 135.042 128.295 113.298 1.00 78.25  ? 61  GLU C C     1 
ATOM 1838  O O     . GLU C 3 61  ? 135.268 128.733 112.161 1.00 78.25  ? 61  GLU C O     1 
ATOM 1839  C CB    . GLU C 3 61  ? 136.539 126.355 113.599 1.00 78.25  ? 61  GLU C CB    1 
ATOM 1840  C CG    . GLU C 3 61  ? 135.414 125.383 113.654 1.00 78.25  ? 61  GLU C CG    1 
ATOM 1841  C CD    . GLU C 3 61  ? 135.608 124.409 114.764 1.00 78.25  ? 61  GLU C CD    1 
ATOM 1842  O OE1   . GLU C 3 61  ? 136.635 124.533 115.454 1.00 78.25  ? 61  GLU C OE1   1 
ATOM 1843  O OE2   . GLU C 3 61  ? 134.733 123.546 114.964 1.00 78.25  ? 61  GLU C OE2   1 
ATOM 1844  N N     . ILE C 3 62  ? 133.812 128.294 113.825 1.00 75.23  ? 62  ILE C N     1 
ATOM 1845  C CA    . ILE C 3 62  ? 132.746 128.897 113.031 1.00 75.23  ? 62  ILE C CA    1 
ATOM 1846  C C     . ILE C 3 62  ? 132.912 130.413 113.004 1.00 75.23  ? 62  ILE C C     1 
ATOM 1847  O O     . ILE C 3 62  ? 132.761 131.047 111.951 1.00 75.23  ? 62  ILE C O     1 
ATOM 1848  C CB    . ILE C 3 62  ? 131.358 128.431 113.525 1.00 75.23  ? 62  ILE C CB    1 
ATOM 1849  C CG1   . ILE C 3 62  ? 130.275 128.770 112.526 1.00 75.23  ? 62  ILE C CG1   1 
ATOM 1850  C CG2   . ILE C 3 62  ? 130.920 129.034 114.841 1.00 75.23  ? 62  ILE C CG2   1 
ATOM 1851  C CD1   . ILE C 3 62  ? 129.002 128.067 112.864 1.00 75.23  ? 62  ILE C CD1   1 
ATOM 1852  N N     . LEU C 3 63  ? 133.356 131.001 114.119 1.00 78.14  ? 63  LEU C N     1 
ATOM 1853  C CA    . LEU C 3 63  ? 133.664 132.417 114.112 1.00 78.14  ? 63  LEU C CA    1 
ATOM 1854  C C     . LEU C 3 63  ? 134.961 132.713 113.383 1.00 78.14  ? 63  LEU C C     1 
ATOM 1855  O O     . LEU C 3 63  ? 135.161 133.846 112.942 1.00 78.14  ? 63  LEU C O     1 
ATOM 1856  C CB    . LEU C 3 63  ? 133.721 132.941 115.539 1.00 78.14  ? 63  LEU C CB    1 
ATOM 1857  C CG    . LEU C 3 63  ? 132.343 133.059 116.163 1.00 78.14  ? 63  LEU C CG    1 
ATOM 1858  C CD1   . LEU C 3 63  ? 132.453 133.354 117.625 1.00 78.14  ? 63  LEU C CD1   1 
ATOM 1859  C CD2   . LEU C 3 63  ? 131.628 134.179 115.467 1.00 78.14  ? 63  LEU C CD2   1 
ATOM 1860  N N     . GLU C 3 64  ? 135.843 131.727 113.238 1.00 83.61  ? 64  GLU C N     1 
ATOM 1861  C CA    . GLU C 3 64  ? 137.062 131.963 112.478 1.00 83.61  ? 64  GLU C CA    1 
ATOM 1862  C C     . GLU C 3 64  ? 136.766 132.017 110.989 1.00 83.61  ? 64  GLU C C     1 
ATOM 1863  O O     . GLU C 3 64  ? 137.260 132.904 110.281 1.00 83.61  ? 64  GLU C O     1 
ATOM 1864  C CB    . GLU C 3 64  ? 138.099 130.888 112.779 1.00 83.61  ? 64  GLU C CB    1 
ATOM 1865  C CG    . GLU C 3 64  ? 139.429 131.150 112.094 1.00 83.61  ? 64  GLU C CG    1 
ATOM 1866  C CD    . GLU C 3 64  ? 140.530 130.250 112.602 1.00 83.61  ? 64  GLU C CD    1 
ATOM 1867  O OE1   . GLU C 3 64  ? 140.243 129.398 113.467 1.00 83.61  ? 64  GLU C OE1   1 
ATOM 1868  O OE2   . GLU C 3 64  ? 141.685 130.406 112.155 1.00 83.61  ? 64  GLU C OE2   1 
ATOM 1869  N N     . LEU C 3 65  ? 135.953 131.079 110.498 1.00 78.82  ? 65  LEU C N     1 
ATOM 1870  C CA    . LEU C 3 65  ? 135.590 131.093 109.086 1.00 78.82  ? 65  LEU C CA    1 
ATOM 1871  C C     . LEU C 3 65  ? 134.702 132.282 108.764 1.00 78.82  ? 65  LEU C C     1 
ATOM 1872  O O     . LEU C 3 65  ? 134.759 132.830 107.657 1.00 78.82  ? 65  LEU C O     1 
ATOM 1873  C CB    . LEU C 3 65  ? 134.909 129.785 108.707 1.00 78.82  ? 65  LEU C CB    1 
ATOM 1874  C CG    . LEU C 3 65  ? 135.871 128.602 108.762 1.00 78.82  ? 65  LEU C CG    1 
ATOM 1875  C CD1   . LEU C 3 65  ? 135.137 127.310 108.489 1.00 78.82  ? 65  LEU C CD1   1 
ATOM 1876  C CD2   . LEU C 3 65  ? 137.010 128.800 107.773 1.00 78.82  ? 65  LEU C CD2   1 
ATOM 1877  N N     . ALA C 3 66  ? 133.908 132.729 109.738 1.00 80.00  ? 66  ALA C N     1 
ATOM 1878  C CA    . ALA C 3 66  ? 133.263 134.025 109.582 1.00 80.00  ? 66  ALA C CA    1 
ATOM 1879  C C     . ALA C 3 66  ? 134.265 135.160 109.714 1.00 80.00  ? 66  ALA C C     1 
ATOM 1880  O O     . ALA C 3 66  ? 133.972 136.287 109.312 1.00 80.00  ? 66  ALA C O     1 
ATOM 1881  C CB    . ALA C 3 66  ? 132.143 134.187 110.604 1.00 80.00  ? 66  ALA C CB    1 
ATOM 1882  N N     . GLY C 3 67  ? 135.439 134.891 110.286 1.00 83.04  ? 67  GLY C N     1 
ATOM 1883  C CA    . GLY C 3 67  ? 136.451 135.928 110.401 1.00 83.04  ? 67  GLY C CA    1 
ATOM 1884  C C     . GLY C 3 67  ? 137.161 136.194 109.088 1.00 83.04  ? 67  GLY C C     1 
ATOM 1885  O O     . GLY C 3 67  ? 137.229 137.339 108.631 1.00 83.04  ? 67  GLY C O     1 
ATOM 1886  N N     . ASN C 3 68  ? 137.702 135.143 108.468 1.00 84.87  ? 68  ASN C N     1 
ATOM 1887  C CA    . ASN C 3 68  ? 138.315 135.293 107.153 1.00 84.87  ? 68  ASN C CA    1 
ATOM 1888  C C     . ASN C 3 68  ? 137.273 135.642 106.107 1.00 84.87  ? 68  ASN C C     1 
ATOM 1889  O O     . ASN C 3 68  ? 137.450 136.581 105.323 1.00 84.87  ? 68  ASN C O     1 
ATOM 1890  C CB    . ASN C 3 68  ? 139.055 134.019 106.768 1.00 84.87  ? 68  ASN C CB    1 
ATOM 1891  C CG    . ASN C 3 68  ? 140.364 133.872 107.503 1.00 84.87  ? 68  ASN C CG    1 
ATOM 1892  O OD1   . ASN C 3 68  ? 141.107 134.839 107.663 1.00 84.87  ? 68  ASN C OD1   1 
ATOM 1893  N ND2   . ASN C 3 68  ? 140.658 132.660 107.954 1.00 84.87  ? 68  ASN C ND2   1 
ATOM 1894  N N     . ALA C 3 69  ? 136.142 134.936 106.122 1.00 81.23  ? 69  ALA C N     1 
ATOM 1895  C CA    . ALA C 3 69  ? 135.078 135.251 105.179 1.00 81.23  ? 69  ALA C CA    1 
ATOM 1896  C C     . ALA C 3 69  ? 134.320 136.512 105.563 1.00 81.23  ? 69  ALA C C     1 
ATOM 1897  O O     . ALA C 3 69  ? 133.389 136.898 104.850 1.00 81.23  ? 69  ALA C O     1 
ATOM 1898  C CB    . ALA C 3 69  ? 134.118 134.074 105.054 1.00 81.23  ? 69  ALA C CB    1 
ATOM 1899  N N     . ALA C 3 70  ? 134.671 137.141 106.685 1.00 84.86  ? 70  ALA C N     1 
ATOM 1900  C CA    . ALA C 3 70  ? 134.232 138.504 106.944 1.00 84.86  ? 70  ALA C CA    1 
ATOM 1901  C C     . ALA C 3 70  ? 135.235 139.504 106.391 1.00 84.86  ? 70  ALA C C     1 
ATOM 1902  O O     . ALA C 3 70  ? 134.857 140.570 105.891 1.00 84.86  ? 70  ALA C O     1 
ATOM 1903  C CB    . ALA C 3 70  ? 134.026 138.718 108.438 1.00 84.86  ? 70  ALA C CB    1 
ATOM 1904  N N     . ARG C 3 71  ? 136.523 139.174 106.474 1.00 87.11  ? 71  ARG C N     1 
ATOM 1905  C CA    . ARG C 3 71  ? 137.540 140.066 105.937 1.00 87.11  ? 71  ARG C CA    1 
ATOM 1906  C C     . ARG C 3 71  ? 137.495 140.094 104.420 1.00 87.11  ? 71  ARG C C     1 
ATOM 1907  O O     . ARG C 3 71  ? 137.900 141.086 103.808 1.00 87.11  ? 71  ARG C O     1 
ATOM 1908  C CB    . ARG C 3 71  ? 138.919 139.635 106.436 1.00 87.11  ? 71  ARG C CB    1 
ATOM 1909  C CG    . ARG C 3 71  ? 140.072 140.550 106.093 1.00 87.11  ? 71  ARG C CG    1 
ATOM 1910  C CD    . ARG C 3 71  ? 141.331 139.975 106.655 1.00 87.11  ? 71  ARG C CD    1 
ATOM 1911  N NE    . ARG C 3 71  ? 141.568 138.656 106.090 1.00 87.11  ? 71  ARG C NE    1 
ATOM 1912  C CZ    . ARG C 3 71  ? 142.476 137.809 106.552 1.00 87.11  ? 71  ARG C CZ    1 
ATOM 1913  N NH1   . ARG C 3 71  ? 143.226 138.154 107.584 1.00 87.11  ? 71  ARG C NH1   1 
ATOM 1914  N NH2   . ARG C 3 71  ? 142.633 136.619 105.994 1.00 87.11  ? 71  ARG C NH2   1 
ATOM 1915  N N     . ASP C 3 72  ? 136.979 139.035 103.791 1.00 93.96  ? 72  ASP C N     1 
ATOM 1916  C CA    . ASP C 3 72  ? 136.836 139.050 102.339 1.00 93.96  ? 72  ASP C CA    1 
ATOM 1917  C C     . ASP C 3 72  ? 135.781 140.039 101.863 1.00 93.96  ? 72  ASP C C     1 
ATOM 1918  O O     . ASP C 3 72  ? 135.863 140.504 100.722 1.00 93.96  ? 72  ASP C O     1 
ATOM 1919  C CB    . ASP C 3 72  ? 136.515 137.655 101.817 1.00 93.96  ? 72  ASP C CB    1 
ATOM 1920  C CG    . ASP C 3 72  ? 137.695 136.718 101.923 1.00 93.96  ? 72  ASP C CG    1 
ATOM 1921  O OD1   . ASP C 3 72  ? 138.841 137.217 101.960 1.00 93.96  ? 72  ASP C OD1   1 
ATOM 1922  O OD2   . ASP C 3 72  ? 137.484 135.487 101.944 1.00 93.96  ? 72  ASP C OD2   1 
ATOM 1923  N N     . ASN C 3 73  ? 134.804 140.383 102.700 1.00 94.52  ? 73  ASN C N     1 
ATOM 1924  C CA    . ASN C 3 73  ? 133.918 141.505 102.416 1.00 94.52  ? 73  ASN C CA    1 
ATOM 1925  C C     . ASN C 3 73  ? 134.450 142.826 102.938 1.00 94.52  ? 73  ASN C C     1 
ATOM 1926  O O     . ASN C 3 73  ? 133.714 143.820 102.920 1.00 94.52  ? 73  ASN C O     1 
ATOM 1927  C CB    . ASN C 3 73  ? 132.522 141.259 102.982 1.00 94.52  ? 73  ASN C CB    1 
ATOM 1928  C CG    . ASN C 3 73  ? 131.680 140.393 102.077 1.00 94.52  ? 73  ASN C CG    1 
ATOM 1929  O OD1   . ASN C 3 73  ? 131.742 140.518 100.854 1.00 94.52  ? 73  ASN C OD1   1 
ATOM 1930  N ND2   . ASN C 3 73  ? 130.867 139.531 102.665 1.00 94.52  ? 73  ASN C ND2   1 
ATOM 1931  N N     . LYS C 3 74  ? 135.690 142.840 103.433 1.00 97.27  ? 74  LYS C N     1 
ATOM 1932  C CA    . LYS C 3 74  ? 136.446 144.035 103.814 1.00 97.27  ? 74  LYS C CA    1 
ATOM 1933  C C     . LYS C 3 74  ? 135.779 144.822 104.942 1.00 97.27  ? 74  LYS C C     1 
ATOM 1934  O O     . LYS C 3 74  ? 136.029 146.020 105.102 1.00 97.27  ? 74  LYS C O     1 
ATOM 1935  C CB    . LYS C 3 74  ? 136.695 144.932 102.595 1.00 97.27  ? 74  LYS C CB    1 
ATOM 1936  C CG    . LYS C 3 74  ? 137.495 144.261 101.486 1.00 97.27  ? 74  LYS C CG    1 
ATOM 1937  C CD    . LYS C 3 74  ? 137.697 145.224 100.326 1.00 97.27  ? 74  LYS C CD    1 
ATOM 1938  C CE    . LYS C 3 74  ? 138.460 144.602 99.168  1.00 97.27  ? 74  LYS C CE    1 
ATOM 1939  N NZ    . LYS C 3 74  ? 138.653 145.573 98.048  1.00 97.27  ? 74  LYS C NZ    1 
ATOM 1940  N N     . LYS C 3 75  ? 134.948 144.161 105.739 1.00 91.87  ? 75  LYS C N     1 
ATOM 1941  C CA    . LYS C 3 75  ? 134.215 144.783 106.823 1.00 91.87  ? 75  LYS C CA    1 
ATOM 1942  C C     . LYS C 3 75  ? 134.977 144.620 108.129 1.00 91.87  ? 75  LYS C C     1 
ATOM 1943  O O     . LYS C 3 75  ? 136.100 144.116 108.171 1.00 91.87  ? 75  LYS C O     1 
ATOM 1944  C CB    . LYS C 3 75  ? 132.832 144.153 106.946 1.00 91.87  ? 75  LYS C CB    1 
ATOM 1945  C CG    . LYS C 3 75  ? 131.962 144.271 105.724 1.00 91.87  ? 75  LYS C CG    1 
ATOM 1946  C CD    . LYS C 3 75  ? 131.506 145.690 105.513 1.00 91.87  ? 75  LYS C CD    1 
ATOM 1947  C CE    . LYS C 3 75  ? 130.469 145.757 104.421 1.00 91.87  ? 75  LYS C CE    1 
ATOM 1948  N NZ    . LYS C 3 75  ? 131.075 145.492 103.095 1.00 91.87  ? 75  LYS C NZ    1 
ATOM 1949  N N     . THR C 3 76  ? 134.352 145.061 109.215 1.00 94.32  ? 76  THR C N     1 
ATOM 1950  C CA    . THR C 3 76  ? 134.767 144.666 110.552 1.00 94.32  ? 76  THR C CA    1 
ATOM 1951  C C     . THR C 3 76  ? 133.677 143.975 111.349 1.00 94.32  ? 76  THR C C     1 
ATOM 1952  O O     . THR C 3 76  ? 134.000 143.249 112.292 1.00 94.32  ? 76  THR C O     1 
ATOM 1953  C CB    . THR C 3 76  ? 135.255 145.874 111.359 1.00 94.32  ? 76  THR C CB    1 
ATOM 1954  O OG1   . THR C 3 76  ? 134.196 146.827 111.473 1.00 94.32  ? 76  THR C OG1   1 
ATOM 1955  C CG2   . THR C 3 76  ? 136.457 146.520 110.693 1.00 94.32  ? 76  THR C CG2   1 
ATOM 1956  N N     . ARG C 3 77  ? 132.412 144.164 111.014 1.00 94.18  ? 77  ARG C N     1 
ATOM 1957  C CA    . ARG C 3 77  ? 131.320 143.533 111.735 1.00 94.18  ? 77  ARG C CA    1 
ATOM 1958  C C     . ARG C 3 77  ? 130.804 142.347 110.934 1.00 94.18  ? 77  ARG C C     1 
ATOM 1959  O O     . ARG C 3 77  ? 130.453 142.489 109.759 1.00 94.18  ? 77  ARG C O     1 
ATOM 1960  C CB    . ARG C 3 77  ? 130.209 144.541 112.021 1.00 94.18  ? 77  ARG C CB    1 
ATOM 1961  C CG    . ARG C 3 77  ? 130.568 145.505 113.141 1.00 94.18  ? 77  ARG C CG    1 
ATOM 1962  C CD    . ARG C 3 77  ? 129.485 146.540 113.426 1.00 94.18  ? 77  ARG C CD    1 
ATOM 1963  N NE    . ARG C 3 77  ? 129.415 147.582 112.405 1.00 94.18  ? 77  ARG C NE    1 
ATOM 1964  C CZ    . ARG C 3 77  ? 128.494 148.544 112.384 1.00 94.18  ? 77  ARG C CZ    1 
ATOM 1965  N NH1   . ARG C 3 77  ? 127.566 148.597 113.324 1.00 94.18  ? 77  ARG C NH1   1 
ATOM 1966  N NH2   . ARG C 3 77  ? 128.501 149.459 111.427 1.00 94.18  ? 77  ARG C NH2   1 
ATOM 1967  N N     . ILE C 3 78  ? 130.781 141.178 111.571 1.00 82.50  ? 78  ILE C N     1 
ATOM 1968  C CA    . ILE C 3 78  ? 130.193 139.993 110.965 1.00 82.50  ? 78  ILE C CA    1 
ATOM 1969  C C     . ILE C 3 78  ? 128.680 140.127 110.975 1.00 82.50  ? 78  ILE C C     1 
ATOM 1970  O O     . ILE C 3 78  ? 128.073 140.346 112.028 1.00 82.50  ? 78  ILE C O     1 
ATOM 1971  C CB    . ILE C 3 78  ? 130.634 138.740 111.727 1.00 82.50  ? 78  ILE C CB    1 
ATOM 1972  C CG1   . ILE C 3 78  ? 132.141 138.563 111.632 1.00 82.50  ? 78  ILE C CG1   1 
ATOM 1973  C CG2   . ILE C 3 78  ? 129.916 137.526 111.234 1.00 82.50  ? 78  ILE C CG2   1 
ATOM 1974  C CD1   . ILE C 3 78  ? 132.673 137.516 112.577 1.00 82.50  ? 78  ILE C CD1   1 
ATOM 1975  N N     . ILE C 3 79  ? 128.062 140.002 109.805 1.00 80.42  ? 79  ILE C N     1 
ATOM 1976  C CA    . ILE C 3 79  ? 126.606 140.003 109.706 1.00 80.42  ? 79  ILE C CA    1 
ATOM 1977  C C     . ILE C 3 79  ? 126.205 138.554 109.445 1.00 80.42  ? 79  ILE C C     1 
ATOM 1978  O O     . ILE C 3 79  ? 127.090 137.739 109.148 1.00 80.42  ? 79  ILE C O     1 
ATOM 1979  C CB    . ILE C 3 79  ? 126.115 140.967 108.612 1.00 80.42  ? 79  ILE C CB    1 
ATOM 1980  C CG1   . ILE C 3 79  ? 126.249 140.344 107.230 1.00 80.42  ? 79  ILE C CG1   1 
ATOM 1981  C CG2   . ILE C 3 79  ? 126.887 142.261 108.681 1.00 80.42  ? 79  ILE C CG2   1 
ATOM 1982  C CD1   . ILE C 3 79  ? 125.503 141.111 106.172 1.00 80.42  ? 79  ILE C CD1   1 
ATOM 1983  N N     . PRO C 3 80  ? 124.924 138.171 109.567 1.00 77.53  ? 80  PRO C N     1 
ATOM 1984  C CA    . PRO C 3 80  ? 124.537 136.778 109.278 1.00 77.53  ? 80  PRO C CA    1 
ATOM 1985  C C     . PRO C 3 80  ? 124.827 136.264 107.872 1.00 77.53  ? 80  PRO C C     1 
ATOM 1986  O O     . PRO C 3 80  ? 124.767 135.043 107.693 1.00 77.53  ? 80  PRO C O     1 
ATOM 1987  C CB    . PRO C 3 80  ? 123.029 136.784 109.534 1.00 77.53  ? 80  PRO C CB    1 
ATOM 1988  C CG    . PRO C 3 80  ? 122.852 137.777 110.546 1.00 77.53  ? 80  PRO C CG    1 
ATOM 1989  C CD    . PRO C 3 80  ? 123.829 138.857 110.280 1.00 77.53  ? 80  PRO C CD    1 
ATOM 1990  N N     . ARG C 3 81  ? 125.100 137.123 106.879 1.00 76.90  ? 81  ARG C N     1 
ATOM 1991  C CA    . ARG C 3 81  ? 125.575 136.631 105.586 1.00 76.90  ? 81  ARG C CA    1 
ATOM 1992  C C     . ARG C 3 81  ? 126.893 135.901 105.741 1.00 76.90  ? 81  ARG C C     1 
ATOM 1993  O O     . ARG C 3 81  ? 127.122 134.852 105.120 1.00 76.90  ? 81  ARG C O     1 
ATOM 1994  C CB    . ARG C 3 81  ? 125.745 137.788 104.606 1.00 76.90  ? 81  ARG C CB    1 
ATOM 1995  C CG    . ARG C 3 81  ? 126.276 137.392 103.240 1.00 76.90  ? 81  ARG C CG    1 
ATOM 1996  C CD    . ARG C 3 81  ? 125.259 136.536 102.540 1.00 76.90  ? 81  ARG C CD    1 
ATOM 1997  N NE    . ARG C 3 81  ? 125.621 136.192 101.174 1.00 76.90  ? 81  ARG C NE    1 
ATOM 1998  C CZ    . ARG C 3 81  ? 124.913 135.366 100.417 1.00 76.90  ? 81  ARG C CZ    1 
ATOM 1999  N NH1   . ARG C 3 81  ? 123.809 134.816 100.895 1.00 76.90  ? 81  ARG C NH1   1 
ATOM 2000  N NH2   . ARG C 3 81  ? 125.299 135.091 99.181  1.00 76.90  ? 81  ARG C NH2   1 
ATOM 2001  N N     . HIS C 3 82  ? 127.759 136.433 106.592 1.00 82.08  ? 82  HIS C N     1 
ATOM 2002  C CA    . HIS C 3 82  ? 129.044 135.811 106.813 1.00 82.08  ? 82  HIS C CA    1 
ATOM 2003  C C     . HIS C 3 82  ? 128.895 134.496 107.558 1.00 82.08  ? 82  HIS C C     1 
ATOM 2004  O O     . HIS C 3 82  ? 129.695 133.582 107.347 1.00 82.08  ? 82  HIS C O     1 
ATOM 2005  C CB    . HIS C 3 82  ? 129.954 136.771 107.563 1.00 82.08  ? 82  HIS C CB    1 
ATOM 2006  C CG    . HIS C 3 82  ? 130.114 138.096 106.886 1.00 82.08  ? 82  HIS C CG    1 
ATOM 2007  N ND1   . HIS C 3 82  ? 129.356 139.193 107.224 1.00 82.08  ? 82  HIS C ND1   1 
ATOM 2008  C CD2   . HIS C 3 82  ? 130.916 138.492 105.872 1.00 82.08  ? 82  HIS C CD2   1 
ATOM 2009  C CE1   . HIS C 3 82  ? 129.702 140.217 106.467 1.00 82.08  ? 82  HIS C CE1   1 
ATOM 2010  N NE2   . HIS C 3 82  ? 130.649 139.818 105.639 1.00 82.08  ? 82  HIS C NE2   1 
ATOM 2011  N N     . LEU C 3 83  ? 127.862 134.361 108.396 1.00 77.16  ? 83  LEU C N     1 
ATOM 2012  C CA    . LEU C 3 83  ? 127.595 133.061 109.001 1.00 77.16  ? 83  LEU C CA    1 
ATOM 2013  C C     . LEU C 3 83  ? 126.970 132.100 108.007 1.00 77.16  ? 83  LEU C C     1 
ATOM 2014  O O     . LEU C 3 83  ? 127.196 130.889 108.102 1.00 77.16  ? 83  LEU C O     1 
ATOM 2015  C CB    . LEU C 3 83  ? 126.699 133.192 110.227 1.00 77.16  ? 83  LEU C CB    1 
ATOM 2016  C CG    . LEU C 3 83  ? 127.377 133.826 111.436 1.00 77.16  ? 83  LEU C CG    1 
ATOM 2017  C CD1   . LEU C 3 83  ? 126.455 133.811 112.638 1.00 77.16  ? 83  LEU C CD1   1 
ATOM 2018  C CD2   . LEU C 3 83  ? 128.679 133.139 111.751 1.00 77.16  ? 83  LEU C CD2   1 
ATOM 2019  N N     . GLN C 3 84  ? 126.206 132.624 107.048 1.00 76.61  ? 84  GLN C N     1 
ATOM 2020  C CA    . GLN C 3 84  ? 125.633 131.797 105.992 1.00 76.61  ? 84  GLN C CA    1 
ATOM 2021  C C     . GLN C 3 84  ? 126.722 131.132 105.164 1.00 76.61  ? 84  GLN C C     1 
ATOM 2022  O O     . GLN C 3 84  ? 126.826 129.900 105.136 1.00 76.61  ? 84  GLN C O     1 
ATOM 2023  C CB    . GLN C 3 84  ? 124.726 132.637 105.097 1.00 76.61  ? 84  GLN C CB    1 
ATOM 2024  C CG    . GLN C 3 84  ? 124.114 131.869 103.965 1.00 76.61  ? 84  GLN C CG    1 
ATOM 2025  C CD    . GLN C 3 84  ? 123.115 130.862 104.441 1.00 76.61  ? 84  GLN C CD    1 
ATOM 2026  O OE1   . GLN C 3 84  ? 122.312 131.146 105.321 1.00 76.61  ? 84  GLN C OE1   1 
ATOM 2027  N NE2   . GLN C 3 84  ? 123.150 129.674 103.861 1.00 76.61  ? 84  GLN C NE2   1 
ATOM 2028  N N     . LEU C 3 85  ? 127.577 131.925 104.512 1.00 75.29  ? 85  LEU C N     1 
ATOM 2029  C CA    . LEU C 3 85  ? 128.557 131.242 103.677 1.00 75.29  ? 85  LEU C CA    1 
ATOM 2030  C C     . LEU C 3 85  ? 129.713 130.693 104.493 1.00 75.29  ? 85  LEU C C     1 
ATOM 2031  O O     . LEU C 3 85  ? 130.409 129.784 104.020 1.00 75.29  ? 85  LEU C O     1 
ATOM 2032  C CB    . LEU C 3 85  ? 129.100 132.139 102.570 1.00 75.29  ? 85  LEU C CB    1 
ATOM 2033  C CG    . LEU C 3 85  ? 130.330 132.990 102.833 1.00 75.29  ? 85  LEU C CG    1 
ATOM 2034  C CD1   . LEU C 3 85  ? 130.916 133.437 101.511 1.00 75.29  ? 85  LEU C CD1   1 
ATOM 2035  C CD2   . LEU C 3 85  ? 129.990 134.167 103.682 1.00 75.29  ? 85  LEU C CD2   1 
ATOM 2036  N N     . ALA C 3 86  ? 129.910 131.203 105.708 1.00 74.33  ? 86  ALA C N     1 
ATOM 2037  C CA    . ALA C 3 86  ? 130.928 130.645 106.583 1.00 74.33  ? 86  ALA C CA    1 
ATOM 2038  C C     . ALA C 3 86  ? 130.575 129.229 106.994 1.00 74.33  ? 86  ALA C C     1 
ATOM 2039  O O     . ALA C 3 86  ? 131.458 128.372 107.095 1.00 74.33  ? 86  ALA C O     1 
ATOM 2040  C CB    . ALA C 3 86  ? 131.109 131.518 107.817 1.00 74.33  ? 86  ALA C CB    1 
ATOM 2041  N N     . VAL C 3 87  ? 129.292 128.956 107.223 1.00 74.61  ? 87  VAL C N     1 
ATOM 2042  C CA    . VAL C 3 87  ? 128.893 127.573 107.448 1.00 74.61  ? 87  VAL C CA    1 
ATOM 2043  C C     . VAL C 3 87  ? 128.917 126.793 106.144 1.00 74.61  ? 87  VAL C C     1 
ATOM 2044  O O     . VAL C 3 87  ? 129.556 125.740 106.048 1.00 74.61  ? 87  VAL C O     1 
ATOM 2045  C CB    . VAL C 3 87  ? 127.512 127.498 108.110 1.00 74.61  ? 87  VAL C CB    1 
ATOM 2046  C CG1   . VAL C 3 87  ? 127.052 126.074 108.131 1.00 74.61  ? 87  VAL C CG1   1 
ATOM 2047  C CG2   . VAL C 3 87  ? 127.596 127.984 109.511 1.00 74.61  ? 87  VAL C CG2   1 
ATOM 2048  N N     . ARG C 3 88  ? 128.246 127.310 105.110 1.00 69.91  ? 88  ARG C N     1 
ATOM 2049  C CA    . ARG C 3 88  ? 128.001 126.498 103.923 1.00 69.91  ? 88  ARG C CA    1 
ATOM 2050  C C     . ARG C 3 88  ? 129.238 126.263 103.067 1.00 69.91  ? 88  ARG C C     1 
ATOM 2051  O O     . ARG C 3 88  ? 129.152 125.495 102.106 1.00 69.91  ? 88  ARG C O     1 
ATOM 2052  C CB    . ARG C 3 88  ? 126.917 127.126 103.054 1.00 69.91  ? 88  ARG C CB    1 
ATOM 2053  C CG    . ARG C 3 88  ? 125.568 127.261 103.726 1.00 69.91  ? 88  ARG C CG    1 
ATOM 2054  C CD    . ARG C 3 88  ? 124.954 125.929 104.080 1.00 69.91  ? 88  ARG C CD    1 
ATOM 2055  N NE    . ARG C 3 88  ? 123.563 126.094 104.486 1.00 69.91  ? 88  ARG C NE    1 
ATOM 2056  C CZ    . ARG C 3 88  ? 123.168 126.354 105.723 1.00 69.91  ? 88  ARG C CZ    1 
ATOM 2057  N NH1   . ARG C 3 88  ? 124.059 126.485 106.681 1.00 69.91  ? 88  ARG C NH1   1 
ATOM 2058  N NH2   . ARG C 3 88  ? 121.883 126.489 105.996 1.00 69.91  ? 88  ARG C NH2   1 
ATOM 2059  N N     . ASN C 3 89  ? 130.379 126.878 103.380 1.00 79.05  ? 89  ASN C N     1 
ATOM 2060  C CA    . ASN C 3 89  ? 131.574 126.589 102.593 1.00 79.05  ? 89  ASN C CA    1 
ATOM 2061  C C     . ASN C 3 89  ? 132.303 125.338 103.070 1.00 79.05  ? 89  ASN C C     1 
ATOM 2062  O O     . ASN C 3 89  ? 132.746 124.535 102.244 1.00 79.05  ? 89  ASN C O     1 
ATOM 2063  C CB    . ASN C 3 89  ? 132.511 127.791 102.594 1.00 79.05  ? 89  ASN C CB    1 
ATOM 2064  C CG    . ASN C 3 89  ? 132.094 128.832 101.593 1.00 79.05  ? 89  ASN C CG    1 
ATOM 2065  O OD1   . ASN C 3 89  ? 131.764 128.503 100.460 1.00 79.05  ? 89  ASN C OD1   1 
ATOM 2066  N ND2   . ASN C 3 89  ? 132.085 130.092 102.006 1.00 79.05  ? 89  ASN C ND2   1 
ATOM 2067  N N     . ASP C 3 90  ? 132.466 125.155 104.374 1.00 79.03  ? 90  ASP C N     1 
ATOM 2068  C CA    . ASP C 3 90  ? 133.067 123.917 104.845 1.00 79.03  ? 90  ASP C CA    1 
ATOM 2069  C C     . ASP C 3 90  ? 132.059 122.784 104.739 1.00 79.03  ? 90  ASP C C     1 
ATOM 2070  O O     . ASP C 3 90  ? 130.849 122.993 104.842 1.00 79.03  ? 90  ASP C O     1 
ATOM 2071  C CB    . ASP C 3 90  ? 133.545 124.054 106.287 1.00 79.03  ? 90  ASP C CB    1 
ATOM 2072  C CG    . ASP C 3 90  ? 134.253 122.808 106.785 1.00 79.03  ? 90  ASP C CG    1 
ATOM 2073  O OD1   . ASP C 3 90  ? 135.418 122.593 106.398 1.00 79.03  ? 90  ASP C OD1   1 
ATOM 2074  O OD2   . ASP C 3 90  ? 133.621 122.024 107.525 1.00 79.03  ? 90  ASP C OD2   1 
ATOM 2075  N N     . GLU C 3 91  ? 132.568 121.574 104.511 1.00 79.21  ? 91  GLU C N     1 
ATOM 2076  C CA    . GLU C 3 91  ? 131.690 120.416 104.409 1.00 79.21  ? 91  GLU C CA    1 
ATOM 2077  C C     . GLU C 3 91  ? 131.117 120.038 105.767 1.00 79.21  ? 91  GLU C C     1 
ATOM 2078  O O     . GLU C 3 91  ? 129.916 119.779 105.888 1.00 79.21  ? 91  GLU C O     1 
ATOM 2079  C CB    . GLU C 3 91  ? 132.449 119.241 103.794 1.00 79.21  ? 91  GLU C CB    1 
ATOM 2080  C CG    . GLU C 3 91  ? 131.579 118.057 103.380 1.00 79.21  ? 91  GLU C CG    1 
ATOM 2081  C CD    . GLU C 3 91  ? 131.369 117.053 104.495 1.00 79.21  ? 91  GLU C CD    1 
ATOM 2082  O OE1   . GLU C 3 91  ? 132.244 116.965 105.377 1.00 79.21  ? 91  GLU C OE1   1 
ATOM 2083  O OE2   . GLU C 3 91  ? 130.336 116.355 104.490 1.00 79.21  ? 91  GLU C OE2   1 
ATOM 2084  N N     . GLU C 3 92  ? 131.960 120.000 106.796 1.00 77.39  ? 92  GLU C N     1 
ATOM 2085  C CA    . GLU C 3 92  ? 131.559 119.375 108.050 1.00 77.39  ? 92  GLU C CA    1 
ATOM 2086  C C     . GLU C 3 92  ? 130.587 120.246 108.830 1.00 77.39  ? 92  GLU C C     1 
ATOM 2087  O O     . GLU C 3 92  ? 129.632 119.738 109.432 1.00 77.39  ? 92  GLU C O     1 
ATOM 2088  C CB    . GLU C 3 92  ? 132.798 119.057 108.872 1.00 77.39  ? 92  GLU C CB    1 
ATOM 2089  C CG    . GLU C 3 92  ? 133.634 118.004 108.203 1.00 77.39  ? 92  GLU C CG    1 
ATOM 2090  C CD    . GLU C 3 92  ? 134.896 117.682 108.948 1.00 77.39  ? 92  GLU C CD    1 
ATOM 2091  O OE1   . GLU C 3 92  ? 135.210 118.371 109.941 1.00 77.39  ? 92  GLU C OE1   1 
ATOM 2092  O OE2   . GLU C 3 92  ? 135.577 116.726 108.529 1.00 77.39  ? 92  GLU C OE2   1 
ATOM 2093  N N     . LEU C 3 93  ? 130.806 121.557 108.813 1.00 74.15  ? 93  LEU C N     1 
ATOM 2094  C CA    . LEU C 3 93  ? 129.868 122.474 109.442 1.00 74.15  ? 93  LEU C CA    1 
ATOM 2095  C C     . LEU C 3 93  ? 128.542 122.494 108.704 1.00 74.15  ? 93  LEU C C     1 
ATOM 2096  O O     . LEU C 3 93  ? 127.493 122.693 109.325 1.00 74.15  ? 93  LEU C O     1 
ATOM 2097  C CB    . LEU C 3 93  ? 130.473 123.869 109.485 1.00 74.15  ? 93  LEU C CB    1 
ATOM 2098  C CG    . LEU C 3 93  ? 131.775 123.893 110.273 1.00 74.15  ? 93  LEU C CG    1 
ATOM 2099  C CD1   . LEU C 3 93  ? 132.456 125.224 110.119 1.00 74.15  ? 93  LEU C CD1   1 
ATOM 2100  C CD2   . LEU C 3 93  ? 131.486 123.614 111.723 1.00 74.15  ? 93  LEU C CD2   1 
ATOM 2101  N N     . ASN C 3 94  ? 128.570 122.282 107.388 1.00 73.37  ? 94  ASN C N     1 
ATOM 2102  C CA    . ASN C 3 94  ? 127.332 122.182 106.629 1.00 73.37  ? 94  ASN C CA    1 
ATOM 2103  C C     . ASN C 3 94  ? 126.586 120.905 106.978 1.00 73.37  ? 94  ASN C C     1 
ATOM 2104  O O     . ASN C 3 94  ? 125.362 120.919 107.121 1.00 73.37  ? 94  ASN C O     1 
ATOM 2105  C CB    . ASN C 3 94  ? 127.627 122.231 105.136 1.00 73.37  ? 94  ASN C CB    1 
ATOM 2106  C CG    . ASN C 3 94  ? 126.390 122.486 104.303 1.00 73.37  ? 94  ASN C CG    1 
ATOM 2107  O OD1   . ASN C 3 94  ? 125.292 122.667 104.825 1.00 73.37  ? 94  ASN C OD1   1 
ATOM 2108  N ND2   . ASN C 3 94  ? 126.565 122.511 102.990 1.00 73.37  ? 94  ASN C ND2   1 
ATOM 2109  N N     . LYS C 3 95  ? 127.307 119.796 107.135 1.00 74.14  ? 95  LYS C N     1 
ATOM 2110  C CA    . LYS C 3 95  ? 126.662 118.536 107.475 1.00 74.14  ? 95  LYS C CA    1 
ATOM 2111  C C     . LYS C 3 95  ? 126.158 118.536 108.911 1.00 74.14  ? 95  LYS C C     1 
ATOM 2112  O O     . LYS C 3 95  ? 125.201 117.824 109.228 1.00 74.14  ? 95  LYS C O     1 
ATOM 2113  C CB    . LYS C 3 95  ? 127.634 117.380 107.243 1.00 74.14  ? 95  LYS C CB    1 
ATOM 2114  C CG    . LYS C 3 95  ? 126.983 116.023 107.244 1.00 74.14  ? 95  LYS C CG    1 
ATOM 2115  C CD    . LYS C 3 95  ? 126.029 115.931 106.066 1.00 74.14  ? 95  LYS C CD    1 
ATOM 2116  C CE    . LYS C 3 95  ? 125.421 114.547 105.941 1.00 74.14  ? 95  LYS C CE    1 
ATOM 2117  N NZ    . LYS C 3 95  ? 124.438 114.455 104.824 1.00 74.14  ? 95  LYS C NZ    1 
ATOM 2118  N N     . LEU C 3 96  ? 126.743 119.352 109.780 1.00 70.63  ? 96  LEU C N     1 
ATOM 2119  C CA    . LEU C 3 96  ? 126.150 119.502 111.098 1.00 70.63  ? 96  LEU C CA    1 
ATOM 2120  C C     . LEU C 3 96  ? 124.891 120.350 111.037 1.00 70.63  ? 96  LEU C C     1 
ATOM 2121  O O     . LEU C 3 96  ? 123.998 120.181 111.869 1.00 70.63  ? 96  LEU C O     1 
ATOM 2122  C CB    . LEU C 3 96  ? 127.179 120.094 112.060 1.00 70.63  ? 96  LEU C CB    1 
ATOM 2123  C CG    . LEU C 3 96  ? 126.955 120.115 113.578 1.00 70.63  ? 96  LEU C CG    1 
ATOM 2124  C CD1   . LEU C 3 96  ? 126.216 121.329 114.092 1.00 70.63  ? 96  LEU C CD1   1 
ATOM 2125  C CD2   . LEU C 3 96  ? 126.213 118.866 113.984 1.00 70.63  ? 96  LEU C CD2   1 
ATOM 2126  N N     . LEU C 3 97  ? 124.786 121.241 110.055 1.00 66.98  ? 97  LEU C N     1 
ATOM 2127  C CA    . LEU C 3 97  ? 123.720 122.234 110.021 1.00 66.98  ? 97  LEU C CA    1 
ATOM 2128  C C     . LEU C 3 97  ? 122.894 122.163 108.744 1.00 66.98  ? 97  LEU C C     1 
ATOM 2129  O O     . LEU C 3 97  ? 122.340 123.169 108.306 1.00 66.98  ? 97  LEU C O     1 
ATOM 2130  C CB    . LEU C 3 97  ? 124.297 123.634 110.178 1.00 66.98  ? 97  LEU C CB    1 
ATOM 2131  C CG    . LEU C 3 97  ? 124.975 123.876 111.510 1.00 66.98  ? 97  LEU C CG    1 
ATOM 2132  C CD1   . LEU C 3 97  ? 125.591 125.230 111.476 1.00 66.98  ? 97  LEU C CD1   1 
ATOM 2133  C CD2   . LEU C 3 97  ? 123.930 123.805 112.570 1.00 66.98  ? 97  LEU C CD2   1 
ATOM 2134  N N     . GLY C 3 98  ? 122.788 120.982 108.147 1.00 68.56  ? 98  GLY C N     1 
ATOM 2135  C CA    . GLY C 3 98  ? 122.141 120.857 106.857 1.00 68.56  ? 98  GLY C CA    1 
ATOM 2136  C C     . GLY C 3 98  ? 120.641 120.966 106.862 1.00 68.56  ? 98  GLY C C     1 
ATOM 2137  O O     . GLY C 3 98  ? 120.042 121.076 105.791 1.00 68.56  ? 98  GLY C O     1 
ATOM 2138  N N     . ARG C 3 99  ? 120.018 120.928 108.032 1.00 72.21  ? 99  ARG C N     1 
ATOM 2139  C CA    . ARG C 3 99  ? 118.578 121.076 108.158 1.00 72.21  ? 99  ARG C CA    1 
ATOM 2140  C C     . ARG C 3 99  ? 118.201 122.401 108.793 1.00 72.21  ? 99  ARG C C     1 
ATOM 2141  O O     . ARG C 3 99  ? 117.051 122.574 109.199 1.00 72.21  ? 99  ARG C O     1 
ATOM 2142  C CB    . ARG C 3 99  ? 118.002 119.927 108.987 1.00 72.21  ? 99  ARG C CB    1 
ATOM 2143  C CG    . ARG C 3 99  ? 118.142 118.551 108.365 1.00 72.21  ? 99  ARG C CG    1 
ATOM 2144  C CD    . ARG C 3 99  ? 117.118 118.303 107.267 1.00 72.21  ? 99  ARG C CD    1 
ATOM 2145  N NE    . ARG C 3 99  ? 117.295 116.983 106.661 1.00 72.21  ? 99  ARG C NE    1 
ATOM 2146  C CZ    . ARG C 3 99  ? 117.971 116.755 105.536 1.00 72.21  ? 99  ARG C CZ    1 
ATOM 2147  N NH1   . ARG C 3 99  ? 118.513 117.761 104.867 1.00 72.21  ? 99  ARG C NH1   1 
ATOM 2148  N NH2   . ARG C 3 99  ? 118.091 115.523 105.063 1.00 72.21  ? 99  ARG C NH2   1 
ATOM 2149  N N     . VAL C 3 100 ? 119.139 123.331 108.906 1.00 67.89  ? 100 VAL C N     1 
ATOM 2150  C CA    . VAL C 3 100 ? 118.936 124.559 109.661 1.00 67.89  ? 100 VAL C CA    1 
ATOM 2151  C C     . VAL C 3 100 ? 118.941 125.735 108.706 1.00 67.89  ? 100 VAL C C     1 
ATOM 2152  O O     . VAL C 3 100 ? 119.934 125.980 108.013 1.00 67.89  ? 100 VAL C O     1 
ATOM 2153  C CB    . VAL C 3 100 ? 120.004 124.745 110.741 1.00 67.89  ? 100 VAL C CB    1 
ATOM 2154  C CG1   . VAL C 3 100 ? 119.922 126.134 111.284 1.00 67.89  ? 100 VAL C CG1   1 
ATOM 2155  C CG2   . VAL C 3 100 ? 119.791 123.744 111.863 1.00 67.89  ? 100 VAL C CG2   1 
ATOM 2156  N N     . THR C 3 101 ? 117.841 126.468 108.680 1.00 66.43  ? 101 THR C N     1 
ATOM 2157  C CA    . THR C 3 101 ? 117.800 127.725 107.961 1.00 66.43  ? 101 THR C CA    1 
ATOM 2158  C C     . THR C 3 101 ? 118.412 128.801 108.844 1.00 66.43  ? 101 THR C C     1 
ATOM 2159  O O     . THR C 3 101 ? 118.253 128.780 110.065 1.00 66.43  ? 101 THR C O     1 
ATOM 2160  C CB    . THR C 3 101 ? 116.357 128.073 107.587 1.00 66.43  ? 101 THR C CB    1 
ATOM 2161  O OG1   . THR C 3 101 ? 115.784 126.986 106.851 1.00 66.43  ? 101 THR C OG1   1 
ATOM 2162  C CG2   . THR C 3 101 ? 116.290 129.319 106.719 1.00 66.43  ? 101 THR C CG2   1 
ATOM 2163  N N     . ILE C 3 102 ? 119.154 129.712 108.226 1.00 62.18  ? 102 ILE C N     1 
ATOM 2164  C CA    . ILE C 3 102 ? 119.666 130.903 108.880 1.00 62.18  ? 102 ILE C CA    1 
ATOM 2165  C C     . ILE C 3 102 ? 118.887 132.093 108.350 1.00 62.18  ? 102 ILE C C     1 
ATOM 2166  O O     . ILE C 3 102 ? 118.810 132.290 107.134 1.00 62.18  ? 102 ILE C O     1 
ATOM 2167  C CB    . ILE C 3 102 ? 121.160 131.080 108.605 1.00 62.18  ? 102 ILE C CB    1 
ATOM 2168  C CG1   . ILE C 3 102 ? 121.906 129.809 108.953 1.00 62.18  ? 102 ILE C CG1   1 
ATOM 2169  C CG2   . ILE C 3 102 ? 121.679 132.217 109.393 1.00 62.18  ? 102 ILE C CG2   1 
ATOM 2170  C CD1   . ILE C 3 102 ? 121.774 129.428 110.381 1.00 62.18  ? 102 ILE C CD1   1 
ATOM 2171  N N     . ALA C 3 103 ? 118.306 132.878 109.246 1.00 66.38  ? 103 ALA C N     1 
ATOM 2172  C CA    . ALA C 3 103 ? 117.572 134.061 108.823 1.00 66.38  ? 103 ALA C CA    1 
ATOM 2173  C C     . ALA C 3 103 ? 118.541 135.121 108.332 1.00 66.38  ? 103 ALA C C     1 
ATOM 2174  O O     . ALA C 3 103 ? 119.638 135.261 108.875 1.00 66.38  ? 103 ALA C O     1 
ATOM 2175  C CB    . ALA C 3 103 ? 116.738 134.609 109.974 1.00 66.38  ? 103 ALA C CB    1 
ATOM 2176  N N     . GLN C 3 104 ? 118.122 135.864 107.302 1.00 67.95  ? 104 GLN C N     1 
ATOM 2177  C CA    . GLN C 3 104 ? 118.959 136.831 106.580 1.00 67.95  ? 104 GLN C CA    1 
ATOM 2178  C C     . GLN C 3 104 ? 120.262 136.203 106.085 1.00 67.95  ? 104 GLN C C     1 
ATOM 2179  O O     . GLN C 3 104 ? 121.330 136.816 106.131 1.00 67.95  ? 104 GLN C O     1 
ATOM 2180  C CB    . GLN C 3 104 ? 119.256 138.076 107.421 1.00 67.95  ? 104 GLN C CB    1 
ATOM 2181  C CG    . GLN C 3 104 ? 118.105 139.043 107.606 1.00 67.95  ? 104 GLN C CG    1 
ATOM 2182  C CD    . GLN C 3 104 ? 117.192 138.664 108.747 1.00 67.95  ? 104 GLN C CD    1 
ATOM 2183  O OE1   . GLN C 3 104 ? 117.538 137.833 109.576 1.00 67.95  ? 104 GLN C OE1   1 
ATOM 2184  N NE2   . GLN C 3 104 ? 116.025 139.289 108.808 1.00 67.95  ? 104 GLN C NE2   1 
ATOM 2185  N N     . GLY C 3 105 ? 120.181 134.963 105.620 1.00 70.66  ? 105 GLY C N     1 
ATOM 2186  C CA    . GLY C 3 105 ? 121.366 134.304 105.116 1.00 70.66  ? 105 GLY C CA    1 
ATOM 2187  C C     . GLY C 3 105 ? 121.514 134.351 103.611 1.00 70.66  ? 105 GLY C C     1 
ATOM 2188  O O     . GLY C 3 105 ? 122.570 134.724 103.097 1.00 70.66  ? 105 GLY C O     1 
ATOM 2189  N N     . GLY C 3 106 ? 120.461 133.986 102.888 1.00 73.18  ? 106 GLY C N     1 
ATOM 2190  C CA    . GLY C 3 106 ? 120.576 133.857 101.450 1.00 73.18  ? 106 GLY C CA    1 
ATOM 2191  C C     . GLY C 3 106 ? 121.194 132.525 101.056 1.00 73.18  ? 106 GLY C C     1 
ATOM 2192  O O     . GLY C 3 106 ? 121.042 131.512 101.739 1.00 73.18  ? 106 GLY C O     1 
ATOM 2193  N N     . VAL C 3 107 ? 121.901 132.532 99.925  1.00 71.68  ? 107 VAL C N     1 
ATOM 2194  C CA    . VAL C 3 107 ? 122.503 131.331 99.365  1.00 71.68  ? 107 VAL C CA    1 
ATOM 2195  C C     . VAL C 3 107 ? 123.950 131.606 98.978  1.00 71.68  ? 107 VAL C C     1 
ATOM 2196  O O     . VAL C 3 107 ? 124.376 132.751 98.822  1.00 71.68  ? 107 VAL C O     1 
ATOM 2197  C CB    . VAL C 3 107 ? 121.736 130.813 98.133  1.00 71.68  ? 107 VAL C CB    1 
ATOM 2198  C CG1   . VAL C 3 107 ? 120.352 130.350 98.504  1.00 71.68  ? 107 VAL C CG1   1 
ATOM 2199  C CG2   . VAL C 3 107 ? 121.642 131.906 97.112  1.00 71.68  ? 107 VAL C CG2   1 
ATOM 2200  N N     . LEU C 3 108 ? 124.704 130.524 98.827  1.00 76.43  ? 108 LEU C N     1 
ATOM 2201  C CA    . LEU C 3 108 ? 125.970 130.588 98.124  1.00 76.43  ? 108 LEU C CA    1 
ATOM 2202  C C     . LEU C 3 108 ? 125.695 130.801 96.637  1.00 76.43  ? 108 LEU C C     1 
ATOM 2203  O O     . LEU C 3 108 ? 124.666 130.357 96.127  1.00 76.43  ? 108 LEU C O     1 
ATOM 2204  C CB    . LEU C 3 108 ? 126.755 129.294 98.342  1.00 76.43  ? 108 LEU C CB    1 
ATOM 2205  C CG    . LEU C 3 108 ? 128.226 129.126 97.926  1.00 76.43  ? 108 LEU C CG    1 
ATOM 2206  C CD1   . LEU C 3 108 ? 128.922 128.162 98.856  1.00 76.43  ? 108 LEU C CD1   1 
ATOM 2207  C CD2   . LEU C 3 108 ? 128.380 128.624 96.499  1.00 76.43  ? 108 LEU C CD2   1 
ATOM 2208  N N     . PRO C 3 109 ? 126.597 131.481 95.914  1.00 75.14  ? 109 PRO C N     1 
ATOM 2209  C CA    . PRO C 3 109 ? 126.435 131.589 94.458  1.00 75.14  ? 109 PRO C CA    1 
ATOM 2210  C C     . PRO C 3 109 ? 126.654 130.272 93.732  1.00 75.14  ? 109 PRO C C     1 
ATOM 2211  O O     . PRO C 3 109 ? 127.703 130.050 93.123  1.00 75.14  ? 109 PRO C O     1 
ATOM 2212  C CB    . PRO C 3 109 ? 127.499 132.618 94.060  1.00 75.14  ? 109 PRO C CB    1 
ATOM 2213  C CG    . PRO C 3 109 ? 127.740 133.392 95.277  1.00 75.14  ? 109 PRO C CG    1 
ATOM 2214  C CD    . PRO C 3 109 ? 127.607 132.425 96.410  1.00 75.14  ? 109 PRO C CD    1 
ATOM 2215  N N     . ASN C 3 110 ? 125.671 129.388 93.804  1.00 84.43  ? 110 ASN C N     1 
ATOM 2216  C CA    . ASN C 3 110 ? 125.645 128.188 92.991  1.00 84.43  ? 110 ASN C CA    1 
ATOM 2217  C C     . ASN C 3 110 ? 124.964 128.529 91.676  1.00 84.43  ? 110 ASN C C     1 
ATOM 2218  O O     . ASN C 3 110 ? 123.880 129.119 91.666  1.00 84.43  ? 110 ASN C O     1 
ATOM 2219  C CB    . ASN C 3 110 ? 124.896 127.072 93.720  1.00 84.43  ? 110 ASN C CB    1 
ATOM 2220  C CG    . ASN C 3 110 ? 125.051 125.716 93.059  1.00 84.43  ? 110 ASN C CG    1 
ATOM 2221  O OD1   . ASN C 3 110 ? 125.729 125.571 92.047  1.00 84.43  ? 110 ASN C OD1   1 
ATOM 2222  N ND2   . ASN C 3 110 ? 124.411 124.711 93.637  1.00 84.43  ? 110 ASN C ND2   1 
ATOM 2223  N N     . ILE C 3 111 ? 125.619 128.192 90.570  1.00 92.24  ? 111 ILE C N     1 
ATOM 2224  C CA    . ILE C 3 111 ? 125.063 128.346 89.232  1.00 92.24  ? 111 ILE C CA    1 
ATOM 2225  C C     . ILE C 3 111 ? 125.298 127.035 88.504  1.00 92.24  ? 111 ILE C C     1 
ATOM 2226  O O     . ILE C 3 111 ? 126.443 126.579 88.406  1.00 92.24  ? 111 ILE C O     1 
ATOM 2227  C CB    . ILE C 3 111 ? 125.704 129.509 88.456  1.00 92.24  ? 111 ILE C CB    1 
ATOM 2228  C CG1   . ILE C 3 111 ? 125.460 130.847 89.153  1.00 92.24  ? 111 ILE C CG1   1 
ATOM 2229  C CG2   . ILE C 3 111 ? 125.142 129.574 87.054  1.00 92.24  ? 111 ILE C CG2   1 
ATOM 2230  C CD1   . ILE C 3 111 ? 126.310 131.969 88.613  1.00 92.24  ? 111 ILE C CD1   1 
ATOM 2231  N N     . GLN C 3 112 ? 124.227 126.418 88.020  1.00 104.17 ? 112 GLN C N     1 
ATOM 2232  C CA    . GLN C 3 112 ? 124.376 125.203 87.233  1.00 104.17 ? 112 GLN C CA    1 
ATOM 2233  C C     . GLN C 3 112 ? 125.013 125.515 85.889  1.00 104.17 ? 112 GLN C C     1 
ATOM 2234  O O     . GLN C 3 112 ? 124.719 126.536 85.262  1.00 104.17 ? 112 GLN C O     1 
ATOM 2235  C CB    . GLN C 3 112 ? 123.030 124.517 87.044  1.00 104.17 ? 112 GLN C CB    1 
ATOM 2236  C CG    . GLN C 3 112 ? 122.527 123.874 88.313  1.00 104.17 ? 112 GLN C CG    1 
ATOM 2237  C CD    . GLN C 3 112 ? 123.465 122.789 88.807  1.00 104.17 ? 112 GLN C CD    1 
ATOM 2238  O OE1   . GLN C 3 112 ? 124.175 122.971 89.795  1.00 104.17 ? 112 GLN C OE1   1 
ATOM 2239  N NE2   . GLN C 3 112 ? 123.469 121.651 88.124  1.00 104.17 ? 112 GLN C NE2   1 
ATOM 2240  N N     . SER C 3 113 ? 125.893 124.617 85.450  1.00 111.62 ? 113 SER C N     1 
ATOM 2241  C CA    . SER C 3 113 ? 126.800 124.916 84.351  1.00 111.62 ? 113 SER C CA    1 
ATOM 2242  C C     . SER C 3 113 ? 126.095 124.986 83.007  1.00 111.62 ? 113 SER C C     1 
ATOM 2243  O O     . SER C 3 113 ? 126.640 125.571 82.067  1.00 111.62 ? 113 SER C O     1 
ATOM 2244  C CB    . SER C 3 113 ? 127.911 123.868 84.307  1.00 111.62 ? 113 SER C CB    1 
ATOM 2245  O OG    . SER C 3 113 ? 128.686 123.895 85.497  1.00 111.62 ? 113 SER C OG    1 
ATOM 2246  N N     . VAL C 3 114 ? 124.897 124.416 82.894  1.00 109.22 ? 114 VAL C N     1 
ATOM 2247  C CA    . VAL C 3 114 ? 124.163 124.527 81.643  1.00 109.22 ? 114 VAL C CA    1 
ATOM 2248  C C     . VAL C 3 114 ? 123.572 125.921 81.488  1.00 109.22 ? 114 VAL C C     1 
ATOM 2249  O O     . VAL C 3 114 ? 123.283 126.345 80.363  1.00 109.22 ? 114 VAL C O     1 
ATOM 2250  C CB    . VAL C 3 114 ? 123.093 123.421 81.560  1.00 109.22 ? 114 VAL C CB    1 
ATOM 2251  C CG1   . VAL C 3 114 ? 121.916 123.712 82.463  1.00 109.22 ? 114 VAL C CG1   1 
ATOM 2252  C CG2   . VAL C 3 114 ? 122.646 123.170 80.133  1.00 109.22 ? 114 VAL C CG2   1 
ATOM 2253  N N     . LEU C 3 115 ? 123.430 126.674 82.580  1.00 111.39 ? 115 LEU C N     1 
ATOM 2254  C CA    . LEU C 3 115 ? 122.890 128.021 82.477  1.00 111.39 ? 115 LEU C CA    1 
ATOM 2255  C C     . LEU C 3 115 ? 123.935 129.036 82.051  1.00 111.39 ? 115 LEU C C     1 
ATOM 2256  O O     . LEU C 3 115 ? 123.566 130.130 81.612  1.00 111.39 ? 115 LEU C O     1 
ATOM 2257  C CB    . LEU C 3 115 ? 122.276 128.459 83.806  1.00 111.39 ? 115 LEU C CB    1 
ATOM 2258  C CG    . LEU C 3 115 ? 121.042 127.707 84.297  1.00 111.39 ? 115 LEU C CG    1 
ATOM 2259  C CD1   . LEU C 3 115 ? 120.644 128.225 85.653  1.00 111.39 ? 115 LEU C CD1   1 
ATOM 2260  C CD2   . LEU C 3 115 ? 119.897 127.837 83.332  1.00 111.39 ? 115 LEU C CD2   1 
ATOM 2261  N N     . LEU C 3 116 ? 125.216 128.700 82.168  1.00 116.63 ? 116 LEU C N     1 
ATOM 2262  C CA    . LEU C 3 116 ? 126.277 129.653 81.858  1.00 116.63 ? 116 LEU C CA    1 
ATOM 2263  C C     . LEU C 3 116 ? 126.330 129.919 80.361  1.00 116.63 ? 116 LEU C C     1 
ATOM 2264  O O     . LEU C 3 116 ? 126.285 128.973 79.570  1.00 116.63 ? 116 LEU C O     1 
ATOM 2265  C CB    . LEU C 3 116 ? 127.626 129.138 82.343  1.00 116.63 ? 116 LEU C CB    1 
ATOM 2266  C CG    . LEU C 3 116 ? 127.806 129.142 83.854  1.00 116.63 ? 116 LEU C CG    1 
ATOM 2267  C CD1   . LEU C 3 116 ? 129.107 128.462 84.222  1.00 116.63 ? 116 LEU C CD1   1 
ATOM 2268  C CD2   . LEU C 3 116 ? 127.782 130.571 84.351  1.00 116.63 ? 116 LEU C CD2   1 
ATOM 2269  N N     . PRO C 3 117 ? 126.419 131.175 79.940  1.00 120.24 ? 117 PRO C N     1 
ATOM 2270  C CA    . PRO C 3 117 ? 126.387 131.479 78.508  1.00 120.24 ? 117 PRO C CA    1 
ATOM 2271  C C     . PRO C 3 117 ? 127.665 131.057 77.803  1.00 120.24 ? 117 PRO C C     1 
ATOM 2272  O O     . PRO C 3 117 ? 128.718 131.688 77.931  1.00 120.24 ? 117 PRO C O     1 
ATOM 2273  C CB    . PRO C 3 117 ? 126.186 132.998 78.482  1.00 120.24 ? 117 PRO C CB    1 
ATOM 2274  C CG    . PRO C 3 117 ? 126.738 133.472 79.775  1.00 120.24 ? 117 PRO C CG    1 
ATOM 2275  C CD    . PRO C 3 117 ? 126.497 132.388 80.768  1.00 120.24 ? 117 PRO C CD    1 
ATOM 2276  N N     . LYS C 3 118 ? 127.564 129.975 77.043  1.00 123.98 ? 118 LYS C N     1 
ATOM 2277  C CA    . LYS C 3 118 ? 128.710 129.321 76.427  1.00 123.98 ? 118 LYS C CA    1 
ATOM 2278  C C     . LYS C 3 118 ? 128.595 129.471 74.913  1.00 123.98 ? 118 LYS C C     1 
ATOM 2279  O O     . LYS C 3 118 ? 128.008 128.627 74.233  1.00 123.98 ? 118 LYS C O     1 
ATOM 2280  C CB    . LYS C 3 118 ? 128.773 127.854 76.837  1.00 123.98 ? 118 LYS C CB    1 
ATOM 2281  C CG    . LYS C 3 118 ? 129.070 127.623 78.305  1.00 123.98 ? 118 LYS C CG    1 
ATOM 2282  C CD    . LYS C 3 118 ? 129.118 126.133 78.607  1.00 123.98 ? 118 LYS C CD    1 
ATOM 2283  C CE    . LYS C 3 118 ? 129.378 125.848 80.080  1.00 123.98 ? 118 LYS C CE    1 
ATOM 2284  N NZ    . LYS C 3 118 ? 129.392 124.383 80.361  1.00 123.98 ? 118 LYS C NZ    1 
ATOM 2285  N N     . LYS C 3 119 ? 129.155 130.552 74.388  1.00 121.47 ? 119 LYS C N     1 
ATOM 2286  C CA    . LYS C 3 119 ? 129.296 130.687 72.950  1.00 121.47 ? 119 LYS C CA    1 
ATOM 2287  C C     . LYS C 3 119 ? 130.624 130.084 72.521  1.00 121.47 ? 119 LYS C C     1 
ATOM 2288  O O     . LYS C 3 119 ? 131.516 129.887 73.344  1.00 121.47 ? 119 LYS C O     1 
ATOM 2289  C CB    . LYS C 3 119 ? 129.213 132.150 72.520  1.00 121.47 ? 119 LYS C CB    1 
ATOM 2290  C CG    . LYS C 3 119 ? 127.826 132.764 72.613  1.00 121.47 ? 119 LYS C CG    1 
ATOM 2291  C CD    . LYS C 3 119 ? 127.836 134.219 72.152  1.00 121.47 ? 119 LYS C CD    1 
ATOM 2292  C CE    . LYS C 3 119 ? 126.457 134.848 72.259  1.00 121.47 ? 119 LYS C CE    1 
ATOM 2293  N NZ    . LYS C 3 119 ? 126.471 136.292 71.909  1.00 121.47 ? 119 LYS C NZ    1 
ATOM 2294  N N     . LYS D 4 28  ? 114.825 144.889 133.755 1.00 106.37 ? 28  LYS D N     1 
ATOM 2295  C CA    . LYS D 4 28  ? 113.595 144.122 133.583 1.00 106.37 ? 28  LYS D CA    1 
ATOM 2296  C C     . LYS D 4 28  ? 113.789 142.651 133.946 1.00 106.37 ? 28  LYS D C     1 
ATOM 2297  O O     . LYS D 4 28  ? 114.638 142.310 134.769 1.00 106.37 ? 28  LYS D O     1 
ATOM 2298  C CB    . LYS D 4 28  ? 113.091 144.246 132.148 1.00 106.37 ? 28  LYS D CB    1 
ATOM 2299  C CG    . LYS D 4 28  ? 112.628 145.636 131.795 1.00 106.37 ? 28  LYS D CG    1 
ATOM 2300  C CD    . LYS D 4 28  ? 112.045 145.662 130.400 1.00 106.37 ? 28  LYS D CD    1 
ATOM 2301  C CE    . LYS D 4 28  ? 111.518 147.038 130.030 1.00 106.37 ? 28  LYS D CE    1 
ATOM 2302  N NZ    . LYS D 4 28  ? 110.900 147.041 128.668 1.00 106.37 ? 28  LYS D NZ    1 
ATOM 2303  N N     . THR D 4 29  ? 112.995 141.780 133.328 1.00 105.05 ? 29  THR D N     1 
ATOM 2304  C CA    . THR D 4 29  ? 113.092 140.348 133.591 1.00 105.05 ? 29  THR D CA    1 
ATOM 2305  C C     . THR D 4 29  ? 114.334 139.794 132.908 1.00 105.05 ? 29  THR D C     1 
ATOM 2306  O O     . THR D 4 29  ? 114.383 139.705 131.676 1.00 105.05 ? 29  THR D O     1 
ATOM 2307  C CB    . THR D 4 29  ? 111.854 139.628 133.084 1.00 105.05 ? 29  THR D CB    1 
ATOM 2308  O OG1   . THR D 4 29  ? 110.683 140.209 133.665 1.00 105.05 ? 29  THR D OG1   1 
ATOM 2309  C CG2   . THR D 4 29  ? 111.922 138.163 133.471 1.00 105.05 ? 29  THR D CG2   1 
ATOM 2310  N N     . ARG D 4 30  ? 115.330 139.407 133.701 1.00 101.76 ? 30  ARG D N     1 
ATOM 2311  C CA    . ARG D 4 30  ? 116.602 138.989 133.133 1.00 101.76 ? 30  ARG D CA    1 
ATOM 2312  C C     . ARG D 4 30  ? 116.480 137.616 132.480 1.00 101.76 ? 30  ARG D C     1 
ATOM 2313  O O     . ARG D 4 30  ? 115.802 136.719 132.984 1.00 101.76 ? 30  ARG D O     1 
ATOM 2314  C CB    . ARG D 4 30  ? 117.695 139.010 134.206 1.00 101.76 ? 30  ARG D CB    1 
ATOM 2315  C CG    . ARG D 4 30  ? 117.564 138.000 135.325 1.00 101.76 ? 30  ARG D CG    1 
ATOM 2316  C CD    . ARG D 4 30  ? 118.597 138.260 136.393 1.00 101.76 ? 30  ARG D CD    1 
ATOM 2317  N NE    . ARG D 4 30  ? 118.263 139.445 137.175 1.00 101.76 ? 30  ARG D NE    1 
ATOM 2318  C CZ    . ARG D 4 30  ? 119.085 140.027 138.041 1.00 101.76 ? 30  ARG D CZ    1 
ATOM 2319  N NH1   . ARG D 4 30  ? 120.306 139.545 138.222 1.00 101.76 ? 30  ARG D NH1   1 
ATOM 2320  N NH2   . ARG D 4 30  ? 118.691 141.100 138.716 1.00 101.76 ? 30  ARG D NH2   1 
ATOM 2321  N N     . LYS D 4 31  ? 117.068 137.499 131.296 1.00 96.81  ? 31  LYS D N     1 
ATOM 2322  C CA    . LYS D 4 31  ? 117.122 136.251 130.549 1.00 96.81  ? 31  LYS D CA    1 
ATOM 2323  C C     . LYS D 4 31  ? 118.513 136.159 129.952 1.00 96.81  ? 31  LYS D C     1 
ATOM 2324  O O     . LYS D 4 31  ? 118.902 137.025 129.166 1.00 96.81  ? 31  LYS D O     1 
ATOM 2325  C CB    . LYS D 4 31  ? 116.064 136.203 129.444 1.00 96.81  ? 31  LYS D CB    1 
ATOM 2326  C CG    . LYS D 4 31  ? 114.622 136.108 129.923 1.00 96.81  ? 31  LYS D CG    1 
ATOM 2327  C CD    . LYS D 4 31  ? 113.672 136.054 128.738 1.00 96.81  ? 31  LYS D CD    1 
ATOM 2328  C CE    . LYS D 4 31  ? 112.219 135.968 129.164 1.00 96.81  ? 31  LYS D CE    1 
ATOM 2329  N NZ    . LYS D 4 31  ? 111.301 135.987 127.988 1.00 96.81  ? 31  LYS D NZ    1 
ATOM 2330  N N     . GLU D 4 32  ? 119.249 135.114 130.312 1.00 95.56  ? 32  GLU D N     1 
ATOM 2331  C CA    . GLU D 4 32  ? 120.658 135.014 129.976 1.00 95.56  ? 32  GLU D CA    1 
ATOM 2332  C C     . GLU D 4 32  ? 120.849 134.776 128.477 1.00 95.56  ? 32  GLU D C     1 
ATOM 2333  O O     . GLU D 4 32  ? 119.898 134.586 127.717 1.00 95.56  ? 32  GLU D O     1 
ATOM 2334  C CB    . GLU D 4 32  ? 121.287 133.877 130.770 1.00 95.56  ? 32  GLU D CB    1 
ATOM 2335  C CG    . GLU D 4 32  ? 120.986 132.485 130.203 1.00 95.56  ? 32  GLU D CG    1 
ATOM 2336  C CD    . GLU D 4 32  ? 119.623 131.911 130.575 1.00 95.56  ? 32  GLU D CD    1 
ATOM 2337  O OE1   . GLU D 4 32  ? 118.726 132.653 131.026 1.00 95.56  ? 32  GLU D OE1   1 
ATOM 2338  O OE2   . GLU D 4 32  ? 119.450 130.688 130.396 1.00 95.56  ? 32  GLU D OE2   1 
ATOM 2339  N N     . SER D 4 33  ? 122.106 134.793 128.051 1.00 75.14  ? 33  SER D N     1 
ATOM 2340  C CA    . SER D 4 33  ? 122.464 134.488 126.676 1.00 75.14  ? 33  SER D CA    1 
ATOM 2341  C C     . SER D 4 33  ? 123.857 133.881 126.687 1.00 75.14  ? 33  SER D C     1 
ATOM 2342  O O     . SER D 4 33  ? 124.378 133.507 127.740 1.00 75.14  ? 33  SER D O     1 
ATOM 2343  C CB    . SER D 4 33  ? 122.405 135.748 125.812 1.00 75.14  ? 33  SER D CB    1 
ATOM 2344  O OG    . SER D 4 33  ? 123.415 136.655 126.210 1.00 75.14  ? 33  SER D OG    1 
ATOM 2345  N N     . TYR D 4 34  ? 124.468 133.793 125.514 1.00 67.80  ? 34  TYR D N     1 
ATOM 2346  C CA    . TYR D 4 34  ? 125.868 133.420 125.394 1.00 67.80  ? 34  TYR D CA    1 
ATOM 2347  C C     . TYR D 4 34  ? 126.692 134.548 124.806 1.00 67.80  ? 34  TYR D C     1 
ATOM 2348  O O     . TYR D 4 34  ? 127.865 134.335 124.479 1.00 67.80  ? 34  TYR D O     1 
ATOM 2349  C CB    . TYR D 4 34  ? 126.019 132.169 124.530 1.00 67.80  ? 34  TYR D CB    1 
ATOM 2350  C CG    . TYR D 4 34  ? 125.517 130.905 125.168 1.00 67.80  ? 34  TYR D CG    1 
ATOM 2351  C CD1   . TYR D 4 34  ? 125.404 130.791 126.541 1.00 67.80  ? 34  TYR D CD1   1 
ATOM 2352  C CD2   . TYR D 4 34  ? 125.127 129.833 124.393 1.00 67.80  ? 34  TYR D CD2   1 
ATOM 2353  C CE1   . TYR D 4 34  ? 124.939 129.635 127.122 1.00 67.80  ? 34  TYR D CE1   1 
ATOM 2354  C CE2   . TYR D 4 34  ? 124.659 128.675 124.965 1.00 67.80  ? 34  TYR D CE2   1 
ATOM 2355  C CZ    . TYR D 4 34  ? 124.568 128.582 126.325 1.00 67.80  ? 34  TYR D CZ    1 
ATOM 2356  O OH    . TYR D 4 34  ? 124.096 127.425 126.884 1.00 67.80  ? 34  TYR D OH    1 
ATOM 2357  N N     . ALA D 4 35  ? 126.107 135.742 124.682 1.00 63.70  ? 35  ALA D N     1 
ATOM 2358  C CA    . ALA D 4 35  ? 126.637 136.773 123.799 1.00 63.70  ? 35  ALA D CA    1 
ATOM 2359  C C     . ALA D 4 35  ? 127.970 137.320 124.282 1.00 63.70  ? 35  ALA D C     1 
ATOM 2360  O O     . ALA D 4 35  ? 128.836 137.646 123.462 1.00 63.70  ? 35  ALA D O     1 
ATOM 2361  C CB    . ALA D 4 35  ? 125.623 137.902 123.666 1.00 63.70  ? 35  ALA D CB    1 
ATOM 2362  N N     . ILE D 4 36  ? 128.160 137.402 125.599 1.00 65.78  ? 36  ILE D N     1 
ATOM 2363  C CA    . ILE D 4 36  ? 129.450 137.819 126.131 1.00 65.78  ? 36  ILE D CA    1 
ATOM 2364  C C     . ILE D 4 36  ? 130.491 136.745 125.867 1.00 65.78  ? 36  ILE D C     1 
ATOM 2365  O O     . ILE D 4 36  ? 131.634 137.044 125.501 1.00 65.78  ? 36  ILE D O     1 
ATOM 2366  C CB    . ILE D 4 36  ? 129.336 138.176 127.627 1.00 65.78  ? 36  ILE D CB    1 
ATOM 2367  C CG1   . ILE D 4 36  ? 128.612 139.507 127.808 1.00 65.78  ? 36  ILE D CG1   1 
ATOM 2368  C CG2   . ILE D 4 36  ? 130.692 138.326 128.263 1.00 65.78  ? 36  ILE D CG2   1 
ATOM 2369  C CD1   . ILE D 4 36  ? 127.136 139.416 128.007 1.00 65.78  ? 36  ILE D CD1   1 
ATOM 2370  N N     . TYR D 4 37  ? 130.090 135.482 125.951 1.00 67.60  ? 37  TYR D N     1 
ATOM 2371  C CA    . TYR D 4 37  ? 131.043 134.405 125.737 1.00 67.60  ? 37  TYR D CA    1 
ATOM 2372  C C     . TYR D 4 37  ? 131.418 134.270 124.266 1.00 67.60  ? 37  TYR D C     1 
ATOM 2373  O O     . TYR D 4 37  ? 132.598 134.084 123.941 1.00 67.60  ? 37  TYR D O     1 
ATOM 2374  C CB    . TYR D 4 37  ? 130.468 133.107 126.272 1.00 67.60  ? 37  TYR D CB    1 
ATOM 2375  C CG    . TYR D 4 37  ? 130.113 133.202 127.725 1.00 67.60  ? 37  TYR D CG    1 
ATOM 2376  C CD1   . TYR D 4 37  ? 131.090 133.203 128.698 1.00 67.60  ? 37  TYR D CD1   1 
ATOM 2377  C CD2   . TYR D 4 37  ? 128.797 133.283 128.122 1.00 67.60  ? 37  TYR D CD2   1 
ATOM 2378  C CE1   . TYR D 4 37  ? 130.761 133.297 130.027 1.00 67.60  ? 37  TYR D CE1   1 
ATOM 2379  C CE2   . TYR D 4 37  ? 128.460 133.366 129.443 1.00 67.60  ? 37  TYR D CE2   1 
ATOM 2380  C CZ    . TYR D 4 37  ? 129.444 133.368 130.390 1.00 67.60  ? 37  TYR D CZ    1 
ATOM 2381  O OH    . TYR D 4 37  ? 129.118 133.453 131.714 1.00 67.60  ? 37  TYR D OH    1 
ATOM 2382  N N     . VAL D 4 38  ? 130.427 134.366 123.369 1.00 69.50  ? 38  VAL D N     1 
ATOM 2383  C CA    . VAL D 4 38  ? 130.685 134.391 121.929 1.00 69.50  ? 38  VAL D CA    1 
ATOM 2384  C C     . VAL D 4 38  ? 131.576 135.568 121.581 1.00 69.50  ? 38  VAL D C     1 
ATOM 2385  O O     . VAL D 4 38  ? 132.505 135.452 120.765 1.00 69.50  ? 38  VAL D O     1 
ATOM 2386  C CB    . VAL D 4 38  ? 129.354 134.441 121.153 1.00 69.50  ? 38  VAL D CB    1 
ATOM 2387  C CG1   . VAL D 4 38  ? 129.577 134.614 119.666 1.00 69.50  ? 38  VAL D CG1   1 
ATOM 2388  C CG2   . VAL D 4 38  ? 128.576 133.184 121.397 1.00 69.50  ? 38  VAL D CG2   1 
ATOM 2389  N N     . TYR D 4 39  ? 131.347 136.697 122.248 1.00 69.91  ? 39  TYR D N     1 
ATOM 2390  C CA    . TYR D 4 39  ? 132.206 137.848 122.059 1.00 69.91  ? 39  TYR D CA    1 
ATOM 2391  C C     . TYR D 4 39  ? 133.625 137.562 122.534 1.00 69.91  ? 39  TYR D C     1 
ATOM 2392  O O     . TYR D 4 39  ? 134.590 138.033 121.923 1.00 69.91  ? 39  TYR D O     1 
ATOM 2393  C CB    . TYR D 4 39  ? 131.612 139.044 122.791 1.00 69.91  ? 39  TYR D CB    1 
ATOM 2394  C CG    . TYR D 4 39  ? 132.268 140.333 122.429 1.00 69.91  ? 39  TYR D CG    1 
ATOM 2395  C CD1   . TYR D 4 39  ? 131.942 140.980 121.250 1.00 69.91  ? 39  TYR D CD1   1 
ATOM 2396  C CD2   . TYR D 4 39  ? 133.238 140.889 123.245 1.00 69.91  ? 39  TYR D CD2   1 
ATOM 2397  C CE1   . TYR D 4 39  ? 132.544 142.150 120.904 1.00 69.91  ? 39  TYR D CE1   1 
ATOM 2398  C CE2   . TYR D 4 39  ? 133.851 142.057 122.906 1.00 69.91  ? 39  TYR D CE2   1 
ATOM 2399  C CZ    . TYR D 4 39  ? 133.500 142.682 121.732 1.00 69.91  ? 39  TYR D CZ    1 
ATOM 2400  O OH    . TYR D 4 39  ? 134.111 143.855 121.381 1.00 69.91  ? 39  TYR D OH    1 
ATOM 2401  N N     . LYS D 4 40  ? 133.775 136.741 123.575 1.00 67.76  ? 40  LYS D N     1 
ATOM 2402  C CA    . LYS D 4 40  ? 135.109 136.444 124.082 1.00 67.76  ? 40  LYS D CA    1 
ATOM 2403  C C     . LYS D 4 40  ? 135.868 135.501 123.163 1.00 67.76  ? 40  LYS D C     1 
ATOM 2404  O O     . LYS D 4 40  ? 137.084 135.646 122.997 1.00 67.76  ? 40  LYS D O     1 
ATOM 2405  C CB    . LYS D 4 40  ? 135.033 135.862 125.488 1.00 67.76  ? 40  LYS D CB    1 
ATOM 2406  C CG    . LYS D 4 40  ? 134.767 136.883 126.575 1.00 67.76  ? 40  LYS D CG    1 
ATOM 2407  C CD    . LYS D 4 40  ? 134.851 136.225 127.938 1.00 67.76  ? 40  LYS D CD    1 
ATOM 2408  C CE    . LYS D 4 40  ? 134.691 137.227 129.055 1.00 67.76  ? 40  LYS D CE    1 
ATOM 2409  N NZ    . LYS D 4 40  ? 134.844 136.559 130.368 1.00 67.76  ? 40  LYS D NZ    1 
ATOM 2410  N N     . VAL D 4 41  ? 135.182 134.527 122.564 1.00 70.23  ? 41  VAL D N     1 
ATOM 2411  C CA    . VAL D 4 41  ? 135.893 133.641 121.648 1.00 70.23  ? 41  VAL D CA    1 
ATOM 2412  C C     . VAL D 4 41  ? 136.246 134.393 120.376 1.00 70.23  ? 41  VAL D C     1 
ATOM 2413  O O     . VAL D 4 41  ? 137.319 134.172 119.787 1.00 70.23  ? 41  VAL D O     1 
ATOM 2414  C CB    . VAL D 4 41  ? 135.059 132.385 121.347 1.00 70.23  ? 41  VAL D CB    1 
ATOM 2415  C CG1   . VAL D 4 41  ? 135.874 131.381 120.571 1.00 70.23  ? 41  VAL D CG1   1 
ATOM 2416  C CG2   . VAL D 4 41  ? 134.561 131.776 122.616 1.00 70.23  ? 41  VAL D CG2   1 
ATOM 2417  N N     . LEU D 4 42  ? 135.372 135.316 119.956 1.00 73.16  ? 42  LEU D N     1 
ATOM 2418  C CA    . LEU D 4 42  ? 135.696 136.203 118.844 1.00 73.16  ? 42  LEU D CA    1 
ATOM 2419  C C     . LEU D 4 42  ? 136.922 137.050 119.154 1.00 73.16  ? 42  LEU D C     1 
ATOM 2420  O O     . LEU D 4 42  ? 137.777 137.263 118.285 1.00 73.16  ? 42  LEU D O     1 
ATOM 2421  C CB    . LEU D 4 42  ? 134.506 137.100 118.528 1.00 73.16  ? 42  LEU D CB    1 
ATOM 2422  C CG    . LEU D 4 42  ? 134.742 138.053 117.364 1.00 73.16  ? 42  LEU D CG    1 
ATOM 2423  C CD1   . LEU D 4 42  ? 134.940 137.269 116.100 1.00 73.16  ? 42  LEU D CD1   1 
ATOM 2424  C CD2   . LEU D 4 42  ? 133.608 139.015 117.218 1.00 73.16  ? 42  LEU D CD2   1 
ATOM 2425  N N     . LYS D 4 43  ? 137.048 137.504 120.402 1.00 75.30  ? 43  LYS D N     1 
ATOM 2426  C CA    . LYS D 4 43  ? 138.276 138.169 120.812 1.00 75.30  ? 43  LYS D CA    1 
ATOM 2427  C C     . LYS D 4 43  ? 139.465 137.224 120.887 1.00 75.30  ? 43  LYS D C     1 
ATOM 2428  O O     . LYS D 4 43  ? 140.603 137.688 120.798 1.00 75.30  ? 43  LYS D O     1 
ATOM 2429  C CB    . LYS D 4 43  ? 138.077 138.869 122.149 1.00 75.30  ? 43  LYS D CB    1 
ATOM 2430  C CG    . LYS D 4 43  ? 137.151 140.043 122.040 1.00 75.30  ? 43  LYS D CG    1 
ATOM 2431  C CD    . LYS D 4 43  ? 137.775 141.055 121.119 1.00 75.30  ? 43  LYS D CD    1 
ATOM 2432  C CE    . LYS D 4 43  ? 136.949 142.307 120.996 1.00 75.30  ? 43  LYS D CE    1 
ATOM 2433  N NZ    . LYS D 4 43  ? 137.574 143.276 120.056 1.00 75.30  ? 43  LYS D NZ    1 
ATOM 2434  N N     . GLN D 4 44  ? 139.248 135.921 121.042 1.00 73.80  ? 44  GLN D N     1 
ATOM 2435  C CA    . GLN D 4 44  ? 140.400 135.033 120.975 1.00 73.80  ? 44  GLN D CA    1 
ATOM 2436  C C     . GLN D 4 44  ? 140.889 134.835 119.549 1.00 73.80  ? 44  GLN D C     1 
ATOM 2437  O O     . GLN D 4 44  ? 142.096 134.718 119.325 1.00 73.80  ? 44  GLN D O     1 
ATOM 2438  C CB    . GLN D 4 44  ? 140.099 133.674 121.595 1.00 73.80  ? 44  GLN D CB    1 
ATOM 2439  C CG    . GLN D 4 44  ? 140.063 133.667 123.098 1.00 73.80  ? 44  GLN D CG    1 
ATOM 2440  C CD    . GLN D 4 44  ? 140.010 132.260 123.651 1.00 73.80  ? 44  GLN D CD    1 
ATOM 2441  O OE1   . GLN D 4 44  ? 139.936 131.291 122.900 1.00 73.80  ? 44  GLN D OE1   1 
ATOM 2442  N NE2   . GLN D 4 44  ? 140.067 132.140 124.968 1.00 73.80  ? 44  GLN D NE2   1 
ATOM 2443  N N     . VAL D 4 45  ? 139.984 134.793 118.574 1.00 78.31  ? 45  VAL D N     1 
ATOM 2444  C CA    . VAL D 4 45  ? 140.383 134.346 117.240 1.00 78.31  ? 45  VAL D CA    1 
ATOM 2445  C C     . VAL D 4 45  ? 140.855 135.491 116.348 1.00 78.31  ? 45  VAL D C     1 
ATOM 2446  O O     . VAL D 4 45  ? 142.003 135.499 115.890 1.00 78.31  ? 45  VAL D O     1 
ATOM 2447  C CB    . VAL D 4 45  ? 139.239 133.579 116.565 1.00 78.31  ? 45  VAL D CB    1 
ATOM 2448  C CG1   . VAL D 4 45  ? 139.659 133.179 115.192 1.00 78.31  ? 45  VAL D CG1   1 
ATOM 2449  C CG2   . VAL D 4 45  ? 138.904 132.354 117.363 1.00 78.31  ? 45  VAL D CG2   1 
ATOM 2450  N N     . HIS D 4 46  ? 139.973 136.447 116.064 1.00 79.83  ? 46  HIS D N     1 
ATOM 2451  C CA    . HIS D 4 46  ? 140.319 137.646 115.302 1.00 79.83  ? 46  HIS D CA    1 
ATOM 2452  C C     . HIS D 4 46  ? 139.957 138.852 116.154 1.00 79.83  ? 46  HIS D C     1 
ATOM 2453  O O     . HIS D 4 46  ? 138.834 139.368 116.061 1.00 79.83  ? 46  HIS D O     1 
ATOM 2454  C CB    . HIS D 4 46  ? 139.596 137.683 113.962 1.00 79.83  ? 46  HIS D CB    1 
ATOM 2455  C CG    . HIS D 4 46  ? 140.011 136.599 113.017 1.00 79.83  ? 46  HIS D CG    1 
ATOM 2456  N ND1   . HIS D 4 46  ? 141.234 136.594 112.381 1.00 79.83  ? 46  HIS D ND1   1 
ATOM 2457  C CD2   . HIS D 4 46  ? 139.349 135.510 112.564 1.00 79.83  ? 46  HIS D CD2   1 
ATOM 2458  C CE1   . HIS D 4 46  ? 141.318 135.535 111.598 1.00 79.83  ? 46  HIS D CE1   1 
ATOM 2459  N NE2   . HIS D 4 46  ? 140.187 134.859 111.692 1.00 79.83  ? 46  HIS D NE2   1 
ATOM 2460  N N     . PRO D 4 47  ? 140.884 139.346 116.981 1.00 82.14  ? 47  PRO D N     1 
ATOM 2461  C CA    . PRO D 4 47  ? 140.488 140.195 118.119 1.00 82.14  ? 47  PRO D CA    1 
ATOM 2462  C C     . PRO D 4 47  ? 140.079 141.606 117.744 1.00 82.14  ? 47  PRO D C     1 
ATOM 2463  O O     . PRO D 4 47  ? 139.331 142.236 118.498 1.00 82.14  ? 47  PRO D O     1 
ATOM 2464  C CB    . PRO D 4 47  ? 141.750 140.213 118.991 1.00 82.14  ? 47  PRO D CB    1 
ATOM 2465  C CG    . PRO D 4 47  ? 142.572 139.049 118.523 1.00 82.14  ? 47  PRO D CG    1 
ATOM 2466  C CD    . PRO D 4 47  ? 142.298 138.954 117.059 1.00 82.14  ? 47  PRO D CD    1 
ATOM 2467  N N     . ASP D 4 48  ? 140.540 142.131 116.617 1.00 83.15  ? 48  ASP D N     1 
ATOM 2468  C CA    . ASP D 4 48  ? 140.262 143.512 116.236 1.00 83.15  ? 48  ASP D CA    1 
ATOM 2469  C C     . ASP D 4 48  ? 139.145 143.594 115.208 1.00 83.15  ? 48  ASP D C     1 
ATOM 2470  O O     . ASP D 4 48  ? 139.166 144.444 114.315 1.00 83.15  ? 48  ASP D O     1 
ATOM 2471  C CB    . ASP D 4 48  ? 141.533 144.159 115.707 1.00 83.15  ? 48  ASP D CB    1 
ATOM 2472  C CG    . ASP D 4 48  ? 142.644 144.154 116.728 1.00 83.15  ? 48  ASP D CG    1 
ATOM 2473  O OD1   . ASP D 4 48  ? 142.341 144.163 117.936 1.00 83.15  ? 48  ASP D OD1   1 
ATOM 2474  O OD2   . ASP D 4 48  ? 143.822 144.128 116.324 1.00 83.15  ? 48  ASP D OD2   1 
ATOM 2475  N N     . THR D 4 49  ? 138.158 142.708 115.313 1.00 79.72  ? 49  THR D N     1 
ATOM 2476  C CA    . THR D 4 49  ? 137.148 142.524 114.279 1.00 79.72  ? 49  THR D CA    1 
ATOM 2477  C C     . THR D 4 49  ? 135.829 142.220 114.970 1.00 79.72  ? 49  THR D C     1 
ATOM 2478  O O     . THR D 4 49  ? 135.708 141.194 115.643 1.00 79.72  ? 49  THR D O     1 
ATOM 2479  C CB    . THR D 4 49  ? 137.543 141.379 113.342 1.00 79.72  ? 49  THR D CB    1 
ATOM 2480  O OG1   . THR D 4 49  ? 138.865 141.598 112.840 1.00 79.72  ? 49  THR D OG1   1 
ATOM 2481  C CG2   . THR D 4 49  ? 136.605 141.298 112.175 1.00 79.72  ? 49  THR D CG2   1 
ATOM 2482  N N     . GLY D 4 50  ? 134.842 143.092 114.800 1.00 75.50  ? 50  GLY D N     1 
ATOM 2483  C CA    . GLY D 4 50  ? 133.619 143.029 115.577 1.00 75.50  ? 50  GLY D CA    1 
ATOM 2484  C C     . GLY D 4 50  ? 132.535 142.133 115.008 1.00 75.50  ? 50  GLY D C     1 
ATOM 2485  O O     . GLY D 4 50  ? 132.750 141.336 114.093 1.00 75.50  ? 50  GLY D O     1 
ATOM 2486  N N     . ILE D 4 51  ? 131.335 142.298 115.561 1.00 71.81  ? 51  ILE D N     1 
ATOM 2487  C CA    . ILE D 4 51  ? 130.210 141.391 115.359 1.00 71.81  ? 51  ILE D CA    1 
ATOM 2488  C C     . ILE D 4 51  ? 128.923 142.205 115.409 1.00 71.81  ? 51  ILE D C     1 
ATOM 2489  O O     . ILE D 4 51  ? 128.821 143.170 116.171 1.00 71.81  ? 51  ILE D O     1 
ATOM 2490  C CB    . ILE D 4 51  ? 130.241 140.264 116.418 1.00 71.81  ? 51  ILE D CB    1 
ATOM 2491  C CG1   . ILE D 4 51  ? 129.072 139.292 116.279 1.00 71.81  ? 51  ILE D CG1   1 
ATOM 2492  C CG2   . ILE D 4 51  ? 130.355 140.822 117.818 1.00 71.81  ? 51  ILE D CG2   1 
ATOM 2493  C CD1   . ILE D 4 51  ? 129.132 138.438 115.077 1.00 71.81  ? 51  ILE D CD1   1 
ATOM 2494  N N     . SER D 4 52  ? 127.956 141.857 114.564 1.00 70.23  ? 52  SER D N     1 
ATOM 2495  C CA    . SER D 4 52  ? 126.671 142.542 114.555 1.00 70.23  ? 52  SER D CA    1 
ATOM 2496  C C     . SER D 4 52  ? 125.630 141.734 115.323 1.00 70.23  ? 52  SER D C     1 
ATOM 2497  O O     . SER D 4 52  ? 125.824 140.556 115.622 1.00 70.23  ? 52  SER D O     1 
ATOM 2498  C CB    . SER D 4 52  ? 126.207 142.783 113.130 1.00 70.23  ? 52  SER D CB    1 
ATOM 2499  O OG    . SER D 4 52  ? 125.998 141.538 112.514 1.00 70.23  ? 52  SER D OG    1 
ATOM 2500  N N     . SER D 4 53  ? 124.505 142.388 115.634 1.00 72.92  ? 53  SER D N     1 
ATOM 2501  C CA    . SER D 4 53  ? 123.590 141.879 116.656 1.00 72.92  ? 53  SER D CA    1 
ATOM 2502  C C     . SER D 4 53  ? 122.742 140.718 116.163 1.00 72.92  ? 53  SER D C     1 
ATOM 2503  O O     . SER D 4 53  ? 122.457 139.796 116.938 1.00 72.92  ? 53  SER D O     1 
ATOM 2504  C CB    . SER D 4 53  ? 122.658 142.979 117.139 1.00 72.92  ? 53  SER D CB    1 
ATOM 2505  O OG    . SER D 4 53  ? 121.726 143.292 116.124 1.00 72.92  ? 53  SER D OG    1 
ATOM 2506  N N     . LYS D 4 54  ? 122.278 140.776 114.910 1.00 68.89  ? 54  LYS D N     1 
ATOM 2507  C CA    . LYS D 4 54  ? 121.537 139.652 114.348 1.00 68.89  ? 54  LYS D CA    1 
ATOM 2508  C C     . LYS D 4 54  ? 122.404 138.410 114.304 1.00 68.89  ? 54  LYS D C     1 
ATOM 2509  O O     . LYS D 4 54  ? 121.944 137.311 114.629 1.00 68.89  ? 54  LYS D O     1 
ATOM 2510  C CB    . LYS D 4 54  ? 121.034 139.983 112.948 1.00 68.89  ? 54  LYS D CB    1 
ATOM 2511  C CG    . LYS D 4 54  ? 119.935 141.011 112.893 1.00 68.89  ? 54  LYS D CG    1 
ATOM 2512  C CD    . LYS D 4 54  ? 119.568 141.310 111.447 1.00 68.89  ? 54  LYS D CD    1 
ATOM 2513  C CE    . LYS D 4 54  ? 118.519 142.406 111.350 1.00 68.89  ? 54  LYS D CE    1 
ATOM 2514  N NZ    . LYS D 4 54  ? 118.222 142.768 109.939 1.00 68.89  ? 54  LYS D NZ    1 
ATOM 2515  N N     . ALA D 4 55  ? 123.679 138.577 113.961 1.00 67.45  ? 55  ALA D N     1 
ATOM 2516  C CA    . ALA D 4 55  ? 124.585 137.441 113.961 1.00 67.45  ? 55  ALA D CA    1 
ATOM 2517  C C     . ALA D 4 55  ? 124.883 136.979 115.370 1.00 67.45  ? 55  ALA D C     1 
ATOM 2518  O O     . ALA D 4 55  ? 125.150 135.794 115.589 1.00 67.45  ? 55  ALA D O     1 
ATOM 2519  C CB    . ALA D 4 55  ? 125.876 137.797 113.240 1.00 67.45  ? 55  ALA D CB    1 
ATOM 2520  N N     . MET D 4 56  ? 124.823 137.893 116.330 1.00 71.34  ? 56  MET D N     1 
ATOM 2521  C CA    . MET D 4 56  ? 125.001 137.516 117.722 1.00 71.34  ? 56  MET D CA    1 
ATOM 2522  C C     . MET D 4 56  ? 123.848 136.654 118.212 1.00 71.34  ? 56  MET D C     1 
ATOM 2523  O O     . MET D 4 56  ? 124.068 135.630 118.871 1.00 71.34  ? 56  MET D O     1 
ATOM 2524  C CB    . MET D 4 56  ? 125.146 138.769 118.569 1.00 71.34  ? 56  MET D CB    1 
ATOM 2525  C CG    . MET D 4 56  ? 125.367 138.449 119.994 1.00 71.34  ? 56  MET D CG    1 
ATOM 2526  S SD    . MET D 4 56  ? 126.800 137.380 120.132 1.00 71.34  ? 56  MET D SD    1 
ATOM 2527  C CE    . MET D 4 56  ? 128.110 138.542 119.795 1.00 71.34  ? 56  MET D CE    1 
ATOM 2528  N N     . SER D 4 57  ? 122.614 137.027 117.869 1.00 64.74  ? 57  SER D N     1 
ATOM 2529  C CA    . SER D 4 57  ? 121.483 136.199 118.268 1.00 64.74  ? 57  SER D CA    1 
ATOM 2530  C C     . SER D 4 57  ? 121.428 134.898 117.477 1.00 64.74  ? 57  SER D C     1 
ATOM 2531  O O     . SER D 4 57  ? 120.928 133.886 117.991 1.00 64.74  ? 57  SER D O     1 
ATOM 2532  C CB    . SER D 4 57  ? 120.181 136.973 118.119 1.00 64.74  ? 57  SER D CB    1 
ATOM 2533  O OG    . SER D 4 57  ? 119.090 136.148 118.463 1.00 64.74  ? 57  SER D OG    1 
ATOM 2534  N N     . ILE D 4 58  ? 121.963 134.887 116.253 1.00 62.02  ? 58  ILE D N     1 
ATOM 2535  C CA    . ILE D 4 58  ? 122.022 133.638 115.503 1.00 62.02  ? 58  ILE D CA    1 
ATOM 2536  C C     . ILE D 4 58  ? 123.030 132.689 116.121 1.00 62.02  ? 58  ILE D C     1 
ATOM 2537  O O     . ILE D 4 58  ? 122.751 131.495 116.274 1.00 62.02  ? 58  ILE D O     1 
ATOM 2538  C CB    . ILE D 4 58  ? 122.302 133.910 114.017 1.00 62.02  ? 58  ILE D CB    1 
ATOM 2539  C CG1   . ILE D 4 58  ? 121.027 134.433 113.376 1.00 62.02  ? 58  ILE D CG1   1 
ATOM 2540  C CG2   . ILE D 4 58  ? 122.758 132.678 113.285 1.00 62.02  ? 58  ILE D CG2   1 
ATOM 2541  C CD1   . ILE D 4 58  ? 121.152 134.806 111.958 1.00 62.02  ? 58  ILE D CD1   1 
ATOM 2542  N N     . MET D 4 59  ? 124.193 133.205 116.526 1.00 63.51  ? 59  MET D N     1 
ATOM 2543  C CA    . MET D 4 59  ? 125.154 132.380 117.250 1.00 63.51  ? 59  MET D CA    1 
ATOM 2544  C C     . MET D 4 59  ? 124.579 131.889 118.564 1.00 63.51  ? 59  MET D C     1 
ATOM 2545  O O     . MET D 4 59  ? 124.835 130.749 118.967 1.00 63.51  ? 59  MET D O     1 
ATOM 2546  C CB    . MET D 4 59  ? 126.438 133.154 117.515 1.00 63.51  ? 59  MET D CB    1 
ATOM 2547  C CG    . MET D 4 59  ? 127.298 133.360 116.307 1.00 63.51  ? 59  MET D CG    1 
ATOM 2548  S SD    . MET D 4 59  ? 127.773 131.780 115.619 1.00 63.51  ? 59  MET D SD    1 
ATOM 2549  C CE    . MET D 4 59  ? 128.697 131.110 116.988 1.00 63.51  ? 59  MET D CE    1 
ATOM 2550  N N     . ASN D 4 60  ? 123.769 132.726 119.220 1.00 62.20  ? 60  ASN D N     1 
ATOM 2551  C CA    . ASN D 4 60  ? 123.142 132.354 120.484 1.00 62.20  ? 60  ASN D CA    1 
ATOM 2552  C C     . ASN D 4 60  ? 122.218 131.154 120.316 1.00 62.20  ? 60  ASN D C     1 
ATOM 2553  O O     . ASN D 4 60  ? 122.358 130.139 121.017 1.00 62.20  ? 60  ASN D O     1 
ATOM 2554  C CB    . ASN D 4 60  ? 122.370 133.546 121.025 1.00 62.20  ? 60  ASN D CB    1 
ATOM 2555  C CG    . ASN D 4 60  ? 121.967 133.375 122.453 1.00 62.20  ? 60  ASN D CG    1 
ATOM 2556  O OD1   . ASN D 4 60  ? 122.325 132.395 123.096 1.00 62.20  ? 60  ASN D OD1   1 
ATOM 2557  N ND2   . ASN D 4 60  ? 121.193 134.324 122.964 1.00 62.20  ? 60  ASN D ND2   1 
ATOM 2558  N N     . SER D 4 61  ? 121.287 131.236 119.363 1.00 58.42  ? 61  SER D N     1 
ATOM 2559  C CA    . SER D 4 61  ? 120.404 130.100 119.134 1.00 58.42  ? 61  SER D CA    1 
ATOM 2560  C C     . SER D 4 61  ? 121.124 128.923 118.499 1.00 58.42  ? 61  SER D C     1 
ATOM 2561  O O     . SER D 4 61  ? 120.640 127.790 118.599 1.00 58.42  ? 61  SER D O     1 
ATOM 2562  C CB    . SER D 4 61  ? 119.224 130.512 118.266 1.00 58.42  ? 61  SER D CB    1 
ATOM 2563  O OG    . SER D 4 61  ? 118.395 131.426 118.955 1.00 58.42  ? 61  SER D OG    1 
ATOM 2564  N N     . PHE D 4 62  ? 122.273 129.162 117.871 1.00 57.40  ? 62  PHE D N     1 
ATOM 2565  C CA    . PHE D 4 62  ? 123.088 128.066 117.365 1.00 57.40  ? 62  PHE D CA    1 
ATOM 2566  C C     . PHE D 4 62  ? 123.648 127.229 118.498 1.00 57.40  ? 62  PHE D C     1 
ATOM 2567  O O     . PHE D 4 62  ? 123.578 125.992 118.471 1.00 57.40  ? 62  PHE D O     1 
ATOM 2568  C CB    . PHE D 4 62  ? 124.225 128.609 116.512 1.00 57.40  ? 62  PHE D CB    1 
ATOM 2569  C CG    . PHE D 4 62  ? 125.257 127.589 116.190 1.00 57.40  ? 62  PHE D CG    1 
ATOM 2570  C CD1   . PHE D 4 62  ? 124.985 126.572 115.310 1.00 57.40  ? 62  PHE D CD1   1 
ATOM 2571  C CD2   . PHE D 4 62  ? 126.507 127.642 116.777 1.00 57.40  ? 62  PHE D CD2   1 
ATOM 2572  C CE1   . PHE D 4 62  ? 125.937 125.622 115.020 1.00 57.40  ? 62  PHE D CE1   1 
ATOM 2573  C CE2   . PHE D 4 62  ? 127.464 126.689 116.489 1.00 57.40  ? 62  PHE D CE2   1 
ATOM 2574  C CZ    . PHE D 4 62  ? 127.178 125.684 115.606 1.00 57.40  ? 62  PHE D CZ    1 
ATOM 2575  N N     . VAL D 4 63  ? 124.220 127.888 119.499 1.00 57.12  ? 63  VAL D N     1 
ATOM 2576  C CA    . VAL D 4 63  ? 124.835 127.132 120.572 1.00 57.12  ? 63  VAL D CA    1 
ATOM 2577  C C     . VAL D 4 63  ? 123.761 126.545 121.489 1.00 57.12  ? 63  VAL D C     1 
ATOM 2578  O O     . VAL D 4 63  ? 123.975 125.491 122.105 1.00 57.12  ? 63  VAL D O     1 
ATOM 2579  C CB    . VAL D 4 63  ? 125.851 128.033 121.290 1.00 57.12  ? 63  VAL D CB    1 
ATOM 2580  C CG1   . VAL D 4 63  ? 126.613 127.286 122.319 1.00 57.12  ? 63  VAL D CG1   1 
ATOM 2581  C CG2   . VAL D 4 63  ? 126.831 128.573 120.300 1.00 57.12  ? 63  VAL D CG2   1 
ATOM 2582  N N     . ASN D 4 64  ? 122.566 127.155 121.548 1.00 60.23  ? 64  ASN D N     1 
ATOM 2583  C CA    . ASN D 4 64  ? 121.461 126.439 122.192 1.00 60.23  ? 64  ASN D CA    1 
ATOM 2584  C C     . ASN D 4 64  ? 121.037 125.205 121.407 1.00 60.23  ? 64  ASN D C     1 
ATOM 2585  O O     . ASN D 4 64  ? 120.685 124.187 122.016 1.00 60.23  ? 64  ASN D O     1 
ATOM 2586  C CB    . ASN D 4 64  ? 120.247 127.333 122.411 1.00 60.23  ? 64  ASN D CB    1 
ATOM 2587  C CG    . ASN D 4 64  ? 120.347 128.146 123.673 1.00 60.23  ? 64  ASN D CG    1 
ATOM 2588  O OD1   . ASN D 4 64  ? 120.898 127.683 124.666 1.00 60.23  ? 64  ASN D OD1   1 
ATOM 2589  N ND2   . ASN D 4 64  ? 119.763 129.336 123.668 1.00 60.23  ? 64  ASN D ND2   1 
ATOM 2590  N N     . ASP D 4 65  ? 121.082 125.264 120.071 1.00 64.17  ? 65  ASP D N     1 
ATOM 2591  C CA    . ASP D 4 65  ? 120.711 124.105 119.258 1.00 64.17  ? 65  ASP D CA    1 
ATOM 2592  C C     . ASP D 4 65  ? 121.690 122.952 119.450 1.00 64.17  ? 65  ASP D C     1 
ATOM 2593  O O     . ASP D 4 65  ? 121.274 121.805 119.665 1.00 64.17  ? 65  ASP D O     1 
ATOM 2594  C CB    . ASP D 4 65  ? 120.650 124.502 117.786 1.00 64.17  ? 65  ASP D CB    1 
ATOM 2595  C CG    . ASP D 4 65  ? 119.984 123.446 116.902 1.00 64.17  ? 65  ASP D CG    1 
ATOM 2596  O OD1   . ASP D 4 65  ? 119.524 122.404 117.411 1.00 64.17  ? 65  ASP D OD1   1 
ATOM 2597  O OD2   . ASP D 4 65  ? 119.923 123.668 115.673 1.00 64.17  ? 65  ASP D OD2   1 
ATOM 2598  N N     . VAL D 4 66  ? 122.990 123.235 119.357 1.00 59.64  ? 66  VAL D N     1 
ATOM 2599  C CA    . VAL D 4 66  ? 123.988 122.187 119.543 1.00 59.64  ? 66  VAL D CA    1 
ATOM 2600  C C     . VAL D 4 66  ? 123.970 121.673 120.974 1.00 59.64  ? 66  VAL D C     1 
ATOM 2601  O O     . VAL D 4 66  ? 124.133 120.468 121.213 1.00 59.64  ? 66  VAL D O     1 
ATOM 2602  C CB    . VAL D 4 66  ? 125.368 122.719 119.128 1.00 59.64  ? 66  VAL D CB    1 
ATOM 2603  C CG1   . VAL D 4 66  ? 126.477 121.745 119.455 1.00 59.64  ? 66  VAL D CG1   1 
ATOM 2604  C CG2   . VAL D 4 66  ? 125.359 123.003 117.655 1.00 59.64  ? 66  VAL D CG2   1 
ATOM 2605  N N     . PHE D 4 67  ? 123.705 122.561 121.932 1.00 60.97  ? 67  PHE D N     1 
ATOM 2606  C CA    . PHE D 4 67  ? 123.595 122.159 123.325 1.00 60.97  ? 67  PHE D CA    1 
ATOM 2607  C C     . PHE D 4 67  ? 122.445 121.186 123.539 1.00 60.97  ? 67  PHE D C     1 
ATOM 2608  O O     . PHE D 4 67  ? 122.574 120.218 124.297 1.00 60.97  ? 67  PHE D O     1 
ATOM 2609  C CB    . PHE D 4 67  ? 123.412 123.395 124.184 1.00 60.97  ? 67  PHE D CB    1 
ATOM 2610  C CG    . PHE D 4 67  ? 123.288 123.106 125.633 1.00 60.97  ? 67  PHE D CG    1 
ATOM 2611  C CD1   . PHE D 4 67  ? 124.395 122.766 126.371 1.00 60.97  ? 67  PHE D CD1   1 
ATOM 2612  C CD2   . PHE D 4 67  ? 122.062 123.200 126.265 1.00 60.97  ? 67  PHE D CD2   1 
ATOM 2613  C CE1   . PHE D 4 67  ? 124.283 122.523 127.702 1.00 60.97  ? 67  PHE D CE1   1 
ATOM 2614  C CE2   . PHE D 4 67  ? 121.946 122.948 127.604 1.00 60.97  ? 67  PHE D CE2   1 
ATOM 2615  C CZ    . PHE D 4 67  ? 123.059 122.604 128.318 1.00 60.97  ? 67  PHE D CZ    1 
ATOM 2616  N N     . GLU D 4 68  ? 121.329 121.394 122.843 1.00 67.01  ? 68  GLU D N     1 
ATOM 2617  C CA    . GLU D 4 68  ? 120.217 120.467 123.024 1.00 67.01  ? 68  GLU D CA    1 
ATOM 2618  C C     . GLU D 4 68  ? 120.379 119.193 122.212 1.00 67.01  ? 68  GLU D C     1 
ATOM 2619  O O     . GLU D 4 68  ? 119.817 118.158 122.588 1.00 67.01  ? 68  GLU D O     1 
ATOM 2620  C CB    . GLU D 4 68  ? 118.884 121.130 122.682 1.00 67.01  ? 68  GLU D CB    1 
ATOM 2621  C CG    . GLU D 4 68  ? 118.548 122.266 123.613 1.00 67.01  ? 68  GLU D CG    1 
ATOM 2622  C CD    . GLU D 4 68  ? 118.430 121.817 125.045 1.00 67.01  ? 68  GLU D CD    1 
ATOM 2623  O OE1   . GLU D 4 68  ? 117.910 120.714 125.290 1.00 67.01  ? 68  GLU D OE1   1 
ATOM 2624  O OE2   . GLU D 4 68  ? 118.893 122.556 125.931 1.00 67.01  ? 68  GLU D OE2   1 
ATOM 2625  N N     . ARG D 4 69  ? 121.114 119.242 121.099 1.00 65.11  ? 69  ARG D N     1 
ATOM 2626  C CA    . ARG D 4 69  ? 121.429 118.004 120.399 1.00 65.11  ? 69  ARG D CA    1 
ATOM 2627  C C     . ARG D 4 69  ? 122.340 117.119 121.235 1.00 65.11  ? 69  ARG D C     1 
ATOM 2628  O O     . ARG D 4 69  ? 122.097 115.916 121.362 1.00 65.11  ? 69  ARG D O     1 
ATOM 2629  C CB    . ARG D 4 69  ? 122.077 118.290 119.052 1.00 65.11  ? 69  ARG D CB    1 
ATOM 2630  C CG    . ARG D 4 69  ? 121.133 118.725 117.961 1.00 65.11  ? 69  ARG D CG    1 
ATOM 2631  C CD    . ARG D 4 69  ? 121.922 118.962 116.679 1.00 65.11  ? 69  ARG D CD    1 
ATOM 2632  N NE    . ARG D 4 69  ? 121.092 119.424 115.572 1.00 65.11  ? 69  ARG D NE    1 
ATOM 2633  C CZ    . ARG D 4 69  ? 121.574 119.768 114.385 1.00 65.11  ? 69  ARG D CZ    1 
ATOM 2634  N NH1   . ARG D 4 69  ? 122.875 119.707 114.165 1.00 65.11  ? 69  ARG D NH1   1 
ATOM 2635  N NH2   . ARG D 4 69  ? 120.763 120.176 113.421 1.00 65.11  ? 69  ARG D NH2   1 
ATOM 2636  N N     . ILE D 4 70  ? 123.383 117.698 121.836 1.00 63.26  ? 70  ILE D N     1 
ATOM 2637  C CA    . ILE D 4 70  ? 124.349 116.884 122.569 1.00 63.26  ? 70  ILE D CA    1 
ATOM 2638  C C     . ILE D 4 70  ? 123.771 116.426 123.902 1.00 63.26  ? 70  ILE D C     1 
ATOM 2639  O O     . ILE D 4 70  ? 123.947 115.268 124.302 1.00 63.26  ? 70  ILE D O     1 
ATOM 2640  C CB    . ILE D 4 70  ? 125.670 117.644 122.757 1.00 63.26  ? 70  ILE D CB    1 
ATOM 2641  C CG1   . ILE D 4 70  ? 126.300 117.950 121.409 1.00 63.26  ? 70  ILE D CG1   1 
ATOM 2642  C CG2   . ILE D 4 70  ? 126.644 116.819 123.537 1.00 63.26  ? 70  ILE D CG2   1 
ATOM 2643  C CD1   . ILE D 4 70  ? 127.495 118.831 121.501 1.00 63.26  ? 70  ILE D CD1   1 
ATOM 2644  N N     . ALA D 4 71  ? 123.058 117.310 124.604 1.00 67.51  ? 71  ALA D N     1 
ATOM 2645  C CA    . ALA D 4 71  ? 122.396 116.891 125.836 1.00 67.51  ? 71  ALA D CA    1 
ATOM 2646  C C     . ALA D 4 71  ? 121.295 115.874 125.562 1.00 67.51  ? 71  ALA D C     1 
ATOM 2647  O O     . ALA D 4 71  ? 121.105 114.935 126.349 1.00 67.51  ? 71  ALA D O     1 
ATOM 2648  C CB    . ALA D 4 71  ? 121.828 118.103 126.566 1.00 67.51  ? 71  ALA D CB    1 
ATOM 2649  N N     . GLY D 4 72  ? 120.590 116.021 124.440 1.00 69.53  ? 72  GLY D N     1 
ATOM 2650  C CA    . GLY D 4 72  ? 119.583 115.039 124.081 1.00 69.53  ? 72  GLY D CA    1 
ATOM 2651  C C     . GLY D 4 72  ? 120.179 113.685 123.755 1.00 69.53  ? 72  GLY D C     1 
ATOM 2652  O O     . GLY D 4 72  ? 119.661 112.650 124.186 1.00 69.53  ? 72  GLY D O     1 
ATOM 2653  N N     . GLU D 4 73  ? 121.276 113.673 122.996 1.00 69.65  ? 73  GLU D N     1 
ATOM 2654  C CA    . GLU D 4 73  ? 121.967 112.421 122.712 1.00 69.65  ? 73  GLU D CA    1 
ATOM 2655  C C     . GLU D 4 73  ? 122.555 111.802 123.969 1.00 69.65  ? 73  GLU D C     1 
ATOM 2656  O O     . GLU D 4 73  ? 122.661 110.574 124.062 1.00 69.65  ? 73  GLU D O     1 
ATOM 2657  C CB    . GLU D 4 73  ? 123.069 112.644 121.685 1.00 69.65  ? 73  GLU D CB    1 
ATOM 2658  C CG    . GLU D 4 73  ? 122.582 112.869 120.288 1.00 69.65  ? 73  GLU D CG    1 
ATOM 2659  C CD    . GLU D 4 73  ? 121.992 111.627 119.690 1.00 69.65  ? 73  GLU D CD    1 
ATOM 2660  O OE1   . GLU D 4 73  ? 122.428 110.521 120.071 1.00 69.65  ? 73  GLU D OE1   1 
ATOM 2661  O OE2   . GLU D 4 73  ? 121.097 111.757 118.831 1.00 69.65  ? 73  GLU D OE2   1 
ATOM 2662  N N     . ALA D 4 74  ? 122.946 112.628 124.938 1.00 70.38  ? 74  ALA D N     1 
ATOM 2663  C CA    . ALA D 4 74  ? 123.357 112.089 126.223 1.00 70.38  ? 74  ALA D CA    1 
ATOM 2664  C C     . ALA D 4 74  ? 122.188 111.447 126.941 1.00 70.38  ? 74  ALA D C     1 
ATOM 2665  O O     . ALA D 4 74  ? 122.372 110.454 127.653 1.00 70.38  ? 74  ALA D O     1 
ATOM 2666  C CB    . ALA D 4 74  ? 123.966 113.186 127.082 1.00 70.38  ? 74  ALA D CB    1 
ATOM 2667  N N     . SER D 4 75  ? 120.980 111.983 126.752 1.00 71.34  ? 75  SER D N     1 
ATOM 2668  C CA    . SER D 4 75  ? 119.816 111.362 127.372 1.00 71.34  ? 75  SER D CA    1 
ATOM 2669  C C     . SER D 4 75  ? 119.491 110.032 126.718 1.00 71.34  ? 75  SER D C     1 
ATOM 2670  O O     . SER D 4 75  ? 119.246 109.037 127.413 1.00 71.34  ? 75  SER D O     1 
ATOM 2671  C CB    . SER D 4 75  ? 118.607 112.286 127.301 1.00 71.34  ? 75  SER D CB    1 
ATOM 2672  O OG    . SER D 4 75  ? 117.474 111.648 127.864 1.00 71.34  ? 75  SER D OG    1 
ATOM 2673  N N     . ARG D 4 76  ? 119.505 109.991 125.383 1.00 72.78  ? 76  ARG D N     1 
ATOM 2674  C CA    . ARG D 4 76  ? 119.161 108.759 124.684 1.00 72.78  ? 76  ARG D CA    1 
ATOM 2675  C C     . ARG D 4 76  ? 120.251 107.718 124.849 1.00 72.78  ? 76  ARG D C     1 
ATOM 2676  O O     . ARG D 4 76  ? 119.989 106.518 124.735 1.00 72.78  ? 76  ARG D O     1 
ATOM 2677  C CB    . ARG D 4 76  ? 118.939 109.025 123.201 1.00 72.78  ? 76  ARG D CB    1 
ATOM 2678  C CG    . ARG D 4 76  ? 117.812 109.956 122.887 1.00 72.78  ? 76  ARG D CG    1 
ATOM 2679  C CD    . ARG D 4 76  ? 117.775 110.216 121.407 1.00 72.78  ? 76  ARG D CD    1 
ATOM 2680  N NE    . ARG D 4 76  ? 116.803 111.245 121.076 1.00 72.78  ? 76  ARG D NE    1 
ATOM 2681  C CZ    . ARG D 4 76  ? 117.089 112.539 121.038 1.00 72.78  ? 76  ARG D CZ    1 
ATOM 2682  N NH1   . ARG D 4 76  ? 118.315 112.949 121.303 1.00 72.78  ? 76  ARG D NH1   1 
ATOM 2683  N NH2   . ARG D 4 76  ? 116.155 113.422 120.730 1.00 72.78  ? 76  ARG D NH2   1 
ATOM 2684  N N     . LEU D 4 77  ? 121.479 108.156 125.118 1.00 73.94  ? 77  LEU D N     1 
ATOM 2685  C CA    . LEU D 4 77  ? 122.557 107.202 125.288 1.00 73.94  ? 77  LEU D CA    1 
ATOM 2686  C C     . LEU D 4 77  ? 122.621 106.679 126.707 1.00 73.94  ? 77  LEU D C     1 
ATOM 2687  O O     . LEU D 4 77  ? 122.954 105.511 126.914 1.00 73.94  ? 77  LEU D O     1 
ATOM 2688  C CB    . LEU D 4 77  ? 123.880 107.833 124.891 1.00 73.94  ? 77  LEU D CB    1 
ATOM 2689  C CG    . LEU D 4 77  ? 125.039 106.861 124.706 1.00 73.94  ? 77  LEU D CG    1 
ATOM 2690  C CD1   . LEU D 4 77  ? 125.823 107.330 123.523 1.00 73.94  ? 77  LEU D CD1   1 
ATOM 2691  C CD2   . LEU D 4 77  ? 125.949 106.838 125.901 1.00 73.94  ? 77  LEU D CD2   1 
ATOM 2692  N N     . ALA D 4 78  ? 122.340 107.524 127.695 1.00 73.56  ? 78  ALA D N     1 
ATOM 2693  C CA    . ALA D 4 78  ? 122.251 107.021 129.056 1.00 73.56  ? 78  ALA D CA    1 
ATOM 2694  C C     . ALA D 4 78  ? 121.020 106.150 129.244 1.00 73.56  ? 78  ALA D C     1 
ATOM 2695  O O     . ALA D 4 78  ? 121.023 105.245 130.085 1.00 73.56  ? 78  ALA D O     1 
ATOM 2696  C CB    . ALA D 4 78  ? 122.232 108.177 130.045 1.00 73.56  ? 78  ALA D CB    1 
ATOM 2697  N N     . HIS D 4 79  ? 119.984 106.364 128.438 1.00 76.98  ? 79  HIS D N     1 
ATOM 2698  C CA    . HIS D 4 79  ? 118.731 105.641 128.591 1.00 76.98  ? 79  HIS D CA    1 
ATOM 2699  C C     . HIS D 4 79  ? 118.783 104.240 127.973 1.00 76.98  ? 79  HIS D C     1 
ATOM 2700  O O     . HIS D 4 79  ? 117.755 103.570 127.863 1.00 76.98  ? 79  HIS D O     1 
ATOM 2701  C CB    . HIS D 4 79  ? 117.598 106.485 127.992 1.00 76.98  ? 79  HIS D CB    1 
ATOM 2702  C CG    . HIS D 4 79  ? 116.225 106.072 128.425 1.00 76.98  ? 79  HIS D CG    1 
ATOM 2703  N ND1   . HIS D 4 79  ? 115.790 106.191 129.727 1.00 76.98  ? 79  HIS D ND1   1 
ATOM 2704  C CD2   . HIS D 4 79  ? 115.181 105.573 127.725 1.00 76.98  ? 79  HIS D CD2   1 
ATOM 2705  C CE1   . HIS D 4 79  ? 114.545 105.762 129.814 1.00 76.98  ? 79  HIS D CE1   1 
ATOM 2706  N NE2   . HIS D 4 79  ? 114.151 105.383 128.612 1.00 76.98  ? 79  HIS D NE2   1 
ATOM 2707  N N     . TYR D 4 80  ? 119.961 103.762 127.593 1.00 79.50  ? 80  TYR D N     1 
ATOM 2708  C CA    . TYR D 4 80  ? 120.114 102.418 127.064 1.00 79.50  ? 80  TYR D CA    1 
ATOM 2709  C C     . TYR D 4 80  ? 120.907 101.509 127.975 1.00 79.50  ? 80  TYR D C     1 
ATOM 2710  O O     . TYR D 4 80  ? 120.598 100.323 128.059 1.00 79.50  ? 80  TYR D O     1 
ATOM 2711  C CB    . TYR D 4 80  ? 120.810 102.455 125.698 1.00 79.50  ? 80  TYR D CB    1 
ATOM 2712  C CG    . TYR D 4 80  ? 120.007 103.112 124.596 1.00 79.50  ? 80  TYR D CG    1 
ATOM 2713  C CD1   . TYR D 4 80  ? 118.625 103.236 124.688 1.00 79.50  ? 80  TYR D CD1   1 
ATOM 2714  C CD2   . TYR D 4 80  ? 120.642 103.651 123.480 1.00 79.50  ? 80  TYR D CD2   1 
ATOM 2715  C CE1   . TYR D 4 80  ? 117.900 103.843 123.692 1.00 79.50  ? 80  TYR D CE1   1 
ATOM 2716  C CE2   . TYR D 4 80  ? 119.920 104.277 122.481 1.00 79.50  ? 80  TYR D CE2   1 
ATOM 2717  C CZ    . TYR D 4 80  ? 118.550 104.357 122.591 1.00 79.50  ? 80  TYR D CZ    1 
ATOM 2718  O OH    . TYR D 4 80  ? 117.817 104.965 121.606 1.00 79.50  ? 80  TYR D OH    1 
ATOM 2719  N N     . ASN D 4 81  ? 121.910 102.031 128.668 1.00 79.71  ? 81  ASN D N     1 
ATOM 2720  C CA    . ASN D 4 81  ? 122.827 101.206 129.432 1.00 79.71  ? 81  ASN D CA    1 
ATOM 2721  C C     . ASN D 4 81  ? 122.376 100.985 130.866 1.00 79.71  ? 81  ASN D C     1 
ATOM 2722  O O     . ASN D 4 81  ? 123.207 100.611 131.701 1.00 79.71  ? 81  ASN D O     1 
ATOM 2723  C CB    . ASN D 4 81  ? 124.215 101.835 129.425 1.00 79.71  ? 81  ASN D CB    1 
ATOM 2724  C CG    . ASN D 4 81  ? 124.820 101.859 128.062 1.00 79.71  ? 81  ASN D CG    1 
ATOM 2725  O OD1   . ASN D 4 81  ? 124.701 100.902 127.306 1.00 79.71  ? 81  ASN D OD1   1 
ATOM 2726  N ND2   . ASN D 4 81  ? 125.468 102.958 127.730 1.00 79.71  ? 81  ASN D ND2   1 
ATOM 2727  N N     . LYS D 4 82  ? 121.088 101.211 131.157 1.00 84.33  ? 82  LYS D N     1 
ATOM 2728  C CA    . LYS D 4 82  ? 120.507 101.142 132.506 1.00 84.33  ? 82  LYS D CA    1 
ATOM 2729  C C     . LYS D 4 82  ? 121.250 102.050 133.481 1.00 84.33  ? 82  LYS D C     1 
ATOM 2730  O O     . LYS D 4 82  ? 121.449 101.714 134.649 1.00 84.33  ? 82  LYS D O     1 
ATOM 2731  C CB    . LYS D 4 82  ? 120.465 99.709  133.040 1.00 84.33  ? 82  LYS D CB    1 
ATOM 2732  C CG    . LYS D 4 82  ? 119.632 98.741  132.234 1.00 84.33  ? 82  LYS D CG    1 
ATOM 2733  C CD    . LYS D 4 82  ? 119.510 97.433  132.994 1.00 84.33  ? 82  LYS D CD    1 
ATOM 2734  C CE    . LYS D 4 82  ? 120.844 96.709  133.063 1.00 84.33  ? 82  LYS D CE    1 
ATOM 2735  N NZ    . LYS D 4 82  ? 120.742 95.376  133.714 1.00 84.33  ? 82  LYS D NZ    1 
ATOM 2736  N N     . ARG D 4 83  ? 121.680 103.207 132.995 1.00 87.79  ? 83  ARG D N     1 
ATOM 2737  C CA    . ARG D 4 83  ? 122.409 104.160 133.809 1.00 87.79  ? 83  ARG D CA    1 
ATOM 2738  C C     . ARG D 4 83  ? 121.670 105.487 133.843 1.00 87.79  ? 83  ARG D C     1 
ATOM 2739  O O     . ARG D 4 83  ? 121.008 105.875 132.878 1.00 87.79  ? 83  ARG D O     1 
ATOM 2740  C CB    . ARG D 4 83  ? 123.827 104.347 133.296 1.00 87.79  ? 83  ARG D CB    1 
ATOM 2741  C CG    . ARG D 4 83  ? 124.676 103.155 133.616 1.00 87.79  ? 83  ARG D CG    1 
ATOM 2742  C CD    . ARG D 4 83  ? 126.082 103.287 133.108 1.00 87.79  ? 83  ARG D CD    1 
ATOM 2743  N NE    . ARG D 4 83  ? 126.905 102.187 133.597 1.00 87.79  ? 83  ARG D NE    1 
ATOM 2744  C CZ    . ARG D 4 83  ? 127.023 101.011 132.995 1.00 87.79  ? 83  ARG D CZ    1 
ATOM 2745  N NH1   . ARG D 4 83  ? 126.370 100.769 131.871 1.00 87.79  ? 83  ARG D NH1   1 
ATOM 2746  N NH2   . ARG D 4 83  ? 127.796 100.077 133.519 1.00 87.79  ? 83  ARG D NH2   1 
ATOM 2747  N N     . SER D 4 84  ? 121.786 106.171 134.972 1.00 87.58  ? 84  SER D N     1 
ATOM 2748  C CA    . SER D 4 84  ? 121.062 107.404 135.229 1.00 87.58  ? 84  SER D CA    1 
ATOM 2749  C C     . SER D 4 84  ? 122.012 108.532 135.602 1.00 87.58  ? 84  SER D C     1 
ATOM 2750  O O     . SER D 4 84  ? 121.701 109.371 136.444 1.00 87.58  ? 84  SER D O     1 
ATOM 2751  C CB    . SER D 4 84  ? 120.031 107.187 136.325 1.00 87.58  ? 84  SER D CB    1 
ATOM 2752  O OG    . SER D 4 84  ? 120.678 106.824 137.525 1.00 87.58  ? 84  SER D OG    1 
ATOM 2753  N N     . THR D 4 85  ? 123.178 108.570 134.961 1.00 86.10  ? 85  THR D N     1 
ATOM 2754  C CA    . THR D 4 85  ? 124.217 109.538 135.280 1.00 86.10  ? 85  THR D CA    1 
ATOM 2755  C C     . THR D 4 85  ? 124.903 109.960 133.992 1.00 86.10  ? 85  THR D C     1 
ATOM 2756  O O     . THR D 4 85  ? 125.252 109.111 133.171 1.00 86.10  ? 85  THR D O     1 
ATOM 2757  C CB    . THR D 4 85  ? 125.236 108.948 136.264 1.00 86.10  ? 85  THR D CB    1 
ATOM 2758  O OG1   . THR D 4 85  ? 124.559 108.513 137.448 1.00 86.10  ? 85  THR D OG1   1 
ATOM 2759  C CG2   . THR D 4 85  ? 126.277 109.976 136.656 1.00 86.10  ? 85  THR D CG2   1 
ATOM 2760  N N     . ILE D 4 86  ? 125.074 111.258 133.805 1.00 76.06  ? 86  ILE D N     1 
ATOM 2761  C CA    . ILE D 4 86  ? 125.732 111.796 132.629 1.00 76.06  ? 86  ILE D CA    1 
ATOM 2762  C C     . ILE D 4 86  ? 127.099 112.291 133.077 1.00 76.06  ? 86  ILE D C     1 
ATOM 2763  O O     . ILE D 4 86  ? 127.234 113.412 133.578 1.00 76.06  ? 86  ILE D O     1 
ATOM 2764  C CB    . ILE D 4 86  ? 124.910 112.910 131.979 1.00 76.06  ? 86  ILE D CB    1 
ATOM 2765  C CG1   . ILE D 4 86  ? 123.544 112.372 131.582 1.00 76.06  ? 86  ILE D CG1   1 
ATOM 2766  C CG2   . ILE D 4 86  ? 125.582 113.417 130.740 1.00 76.06  ? 86  ILE D CG2   1 
ATOM 2767  C CD1   . ILE D 4 86  ? 122.595 113.421 131.095 1.00 76.06  ? 86  ILE D CD1   1 
ATOM 2768  N N     . THR D 4 87  ? 128.116 111.451 132.916 1.00 82.11  ? 87  THR D N     1 
ATOM 2769  C CA    . THR D 4 87  ? 129.495 111.852 133.141 1.00 82.11  ? 87  THR D CA    1 
ATOM 2770  C C     . THR D 4 87  ? 130.062 112.390 131.831 1.00 82.11  ? 87  THR D C     1 
ATOM 2771  O O     . THR D 4 87  ? 129.353 112.503 130.830 1.00 82.11  ? 87  THR D O     1 
ATOM 2772  C CB    . THR D 4 87  ? 130.315 110.679 133.664 1.00 82.11  ? 87  THR D CB    1 
ATOM 2773  O OG1   . THR D 4 87  ? 130.398 109.673 132.649 1.00 82.11  ? 87  THR D OG1   1 
ATOM 2774  C CG2   . THR D 4 87  ? 129.649 110.091 134.892 1.00 82.11  ? 87  THR D CG2   1 
ATOM 2775  N N     . SER D 4 88  ? 131.354 112.713 131.812 1.00 84.57  ? 88  SER D N     1 
ATOM 2776  C CA    . SER D 4 88  ? 131.941 113.297 130.614 1.00 84.57  ? 88  SER D CA    1 
ATOM 2777  C C     . SER D 4 88  ? 132.113 112.286 129.498 1.00 84.57  ? 88  SER D C     1 
ATOM 2778  O O     . SER D 4 88  ? 132.160 112.677 128.328 1.00 84.57  ? 88  SER D O     1 
ATOM 2779  C CB    . SER D 4 88  ? 133.302 113.901 130.925 1.00 84.57  ? 88  SER D CB    1 
ATOM 2780  O OG    . SER D 4 88  ? 134.239 112.872 131.165 1.00 84.57  ? 88  SER D OG    1 
ATOM 2781  N N     . ARG D 4 89  ? 132.224 111.006 129.836 1.00 80.54  ? 89  ARG D N     1 
ATOM 2782  C CA    . ARG D 4 89  ? 132.484 109.987 128.830 1.00 80.54  ? 89  ARG D CA    1 
ATOM 2783  C C     . ARG D 4 89  ? 131.299 109.815 127.892 1.00 80.54  ? 89  ARG D C     1 
ATOM 2784  O O     . ARG D 4 89  ? 131.480 109.567 126.693 1.00 80.54  ? 89  ARG D O     1 
ATOM 2785  C CB    . ARG D 4 89  ? 132.819 108.683 129.536 1.00 80.54  ? 89  ARG D CB    1 
ATOM 2786  C CG    . ARG D 4 89  ? 133.201 107.556 128.650 1.00 80.54  ? 89  ARG D CG    1 
ATOM 2787  C CD    . ARG D 4 89  ? 133.476 106.356 129.504 1.00 80.54  ? 89  ARG D CD    1 
ATOM 2788  N NE    . ARG D 4 89  ? 133.889 105.222 128.698 1.00 80.54  ? 89  ARG D NE    1 
ATOM 2789  C CZ    . ARG D 4 89  ? 133.048 104.338 128.185 1.00 80.54  ? 89  ARG D CZ    1 
ATOM 2790  N NH1   . ARG D 4 89  ? 131.746 104.460 128.403 1.00 80.54  ? 89  ARG D NH1   1 
ATOM 2791  N NH2   . ARG D 4 89  ? 133.512 103.334 127.457 1.00 80.54  ? 89  ARG D NH2   1 
ATOM 2792  N N     . GLU D 4 90  ? 130.085 109.978 128.417 1.00 81.90  ? 90  GLU D N     1 
ATOM 2793  C CA    . GLU D 4 90  ? 128.899 109.950 127.577 1.00 81.90  ? 90  GLU D CA    1 
ATOM 2794  C C     . GLU D 4 90  ? 128.861 111.139 126.643 1.00 81.90  ? 90  GLU D C     1 
ATOM 2795  O O     . GLU D 4 90  ? 128.373 111.025 125.515 1.00 81.90  ? 90  GLU D O     1 
ATOM 2796  C CB    . GLU D 4 90  ? 127.643 109.931 128.438 1.00 81.90  ? 90  GLU D CB    1 
ATOM 2797  C CG    . GLU D 4 90  ? 127.432 108.642 129.196 1.00 81.90  ? 90  GLU D CG    1 
ATOM 2798  C CD    . GLU D 4 90  ? 128.194 108.593 130.500 1.00 81.90  ? 90  GLU D CD    1 
ATOM 2799  O OE1   . GLU D 4 90  ? 128.831 109.603 130.855 1.00 81.90  ? 90  GLU D OE1   1 
ATOM 2800  O OE2   . GLU D 4 90  ? 128.176 107.538 131.164 1.00 81.90  ? 90  GLU D OE2   1 
ATOM 2801  N N     . ILE D 4 91  ? 129.375 112.280 127.091 1.00 78.73  ? 91  ILE D N     1 
ATOM 2802  C CA    . ILE D 4 91  ? 129.459 113.418 126.198 1.00 78.73  ? 91  ILE D CA    1 
ATOM 2803  C C     . ILE D 4 91  ? 130.525 113.164 125.141 1.00 78.73  ? 91  ILE D C     1 
ATOM 2804  O O     . ILE D 4 91  ? 130.396 113.628 124.004 1.00 78.73  ? 91  ILE D O     1 
ATOM 2805  C CB    . ILE D 4 91  ? 129.738 114.700 126.992 1.00 78.73  ? 91  ILE D CB    1 
ATOM 2806  C CG1   . ILE D 4 91  ? 128.810 114.796 128.192 1.00 78.73  ? 91  ILE D CG1   1 
ATOM 2807  C CG2   . ILE D 4 91  ? 129.484 115.915 126.134 1.00 78.73  ? 91  ILE D CG2   1 
ATOM 2808  C CD1   . ILE D 4 91  ? 127.363 114.919 127.839 1.00 78.73  ? 91  ILE D CD1   1 
ATOM 2809  N N     . GLN D 4 92  ? 131.571 112.399 125.478 1.00 84.27  ? 92  GLN D N     1 
ATOM 2810  C CA    . GLN D 4 92  ? 132.579 112.030 124.484 1.00 84.27  ? 92  GLN D CA    1 
ATOM 2811  C C     . GLN D 4 92  ? 131.988 111.146 123.397 1.00 84.27  ? 92  GLN D C     1 
ATOM 2812  O O     . GLN D 4 92  ? 132.218 111.373 122.200 1.00 84.27  ? 92  GLN D O     1 
ATOM 2813  C CB    . GLN D 4 92  ? 133.758 111.319 125.145 1.00 84.27  ? 92  GLN D CB    1 
ATOM 2814  C CG    . GLN D 4 92  ? 134.794 110.849 124.138 1.00 84.27  ? 92  GLN D CG    1 
ATOM 2815  C CD    . GLN D 4 92  ? 135.976 110.173 124.775 1.00 84.27  ? 92  GLN D CD    1 
ATOM 2816  O OE1   . GLN D 4 92  ? 136.046 110.038 125.992 1.00 84.27  ? 92  GLN D OE1   1 
ATOM 2817  N NE2   . GLN D 4 92  ? 136.912 109.728 123.951 1.00 84.27  ? 92  GLN D NE2   1 
ATOM 2818  N N     . THR D 4 93  ? 131.217 110.140 123.798 1.00 82.34  ? 93  THR D N     1 
ATOM 2819  C CA    . THR D 4 93  ? 130.590 109.263 122.821 1.00 82.34  ? 93  THR D CA    1 
ATOM 2820  C C     . THR D 4 93  ? 129.564 110.011 121.981 1.00 82.34  ? 93  THR D C     1 
ATOM 2821  O O     . THR D 4 93  ? 129.549 109.877 120.752 1.00 82.34  ? 93  THR D O     1 
ATOM 2822  C CB    . THR D 4 93  ? 129.948 108.087 123.540 1.00 82.34  ? 93  THR D CB    1 
ATOM 2823  O OG1   . THR D 4 93  ? 130.951 107.395 124.290 1.00 82.34  ? 93  THR D OG1   1 
ATOM 2824  C CG2   . THR D 4 93  ? 129.349 107.142 122.550 1.00 82.34  ? 93  THR D CG2   1 
ATOM 2825  N N     . ALA D 4 94  ? 128.738 110.844 122.621 1.00 79.42  ? 94  ALA D N     1 
ATOM 2826  C CA    . ALA D 4 94  ? 127.681 111.542 121.901 1.00 79.42  ? 94  ALA D CA    1 
ATOM 2827  C C     . ALA D 4 94  ? 128.237 112.591 120.951 1.00 79.42  ? 94  ALA D C     1 
ATOM 2828  O O     . ALA D 4 94  ? 127.659 112.822 119.882 1.00 79.42  ? 94  ALA D O     1 
ATOM 2829  C CB    . ALA D 4 94  ? 126.709 112.182 122.885 1.00 79.42  ? 94  ALA D CB    1 
ATOM 2830  N N     . VAL D 4 95  ? 129.359 113.214 121.306 1.00 79.48  ? 95  VAL D N     1 
ATOM 2831  C CA    . VAL D 4 95  ? 130.045 114.063 120.344 1.00 79.48  ? 95  VAL D CA    1 
ATOM 2832  C C     . VAL D 4 95  ? 130.612 113.220 119.213 1.00 79.48  ? 95  VAL D C     1 
ATOM 2833  O O     . VAL D 4 95  ? 130.483 113.575 118.034 1.00 79.48  ? 95  VAL D O     1 
ATOM 2834  C CB    . VAL D 4 95  ? 131.118 114.908 121.046 1.00 79.48  ? 95  VAL D CB    1 
ATOM 2835  C CG1   . VAL D 4 95  ? 132.059 115.527 120.045 1.00 79.48  ? 95  VAL D CG1   1 
ATOM 2836  C CG2   . VAL D 4 95  ? 130.451 116.021 121.797 1.00 79.48  ? 95  VAL D CG2   1 
ATOM 2837  N N     . ARG D 4 96  ? 131.142 112.036 119.533 1.00 82.45  ? 96  ARG D N     1 
ATOM 2838  C CA    . ARG D 4 96  ? 131.611 111.143 118.473 1.00 82.45  ? 96  ARG D CA    1 
ATOM 2839  C C     . ARG D 4 96  ? 130.487 110.497 117.678 1.00 82.45  ? 96  ARG D C     1 
ATOM 2840  O O     . ARG D 4 96  ? 130.781 109.731 116.761 1.00 82.45  ? 96  ARG D O     1 
ATOM 2841  C CB    . ARG D 4 96  ? 132.523 110.062 119.050 1.00 82.45  ? 96  ARG D CB    1 
ATOM 2842  C CG    . ARG D 4 96  ? 133.887 110.592 119.409 1.00 82.45  ? 96  ARG D CG    1 
ATOM 2843  C CD    . ARG D 4 96  ? 134.741 109.598 120.164 1.00 82.45  ? 96  ARG D CD    1 
ATOM 2844  N NE    . ARG D 4 96  ? 135.129 108.438 119.376 1.00 82.45  ? 96  ARG D NE    1 
ATOM 2845  C CZ    . ARG D 4 96  ? 135.795 107.403 119.876 1.00 82.45  ? 96  ARG D CZ    1 
ATOM 2846  N NH1   . ARG D 4 96  ? 136.151 107.395 121.153 1.00 82.45  ? 96  ARG D NH1   1 
ATOM 2847  N NH2   . ARG D 4 96  ? 136.113 106.378 119.104 1.00 82.45  ? 96  ARG D NH2   1 
ATOM 2848  N N     . LEU D 4 97  ? 129.226 110.774 117.989 1.00 78.42  ? 97  LEU D N     1 
ATOM 2849  C CA    . LEU D 4 97  ? 128.142 110.433 117.087 1.00 78.42  ? 97  LEU D CA    1 
ATOM 2850  C C     . LEU D 4 97  ? 127.579 111.626 116.340 1.00 78.42  ? 97  LEU D C     1 
ATOM 2851  O O     . LEU D 4 97  ? 127.117 111.460 115.207 1.00 78.42  ? 97  LEU D O     1 
ATOM 2852  C CB    . LEU D 4 97  ? 127.008 109.752 117.845 1.00 78.42  ? 97  LEU D CB    1 
ATOM 2853  C CG    . LEU D 4 97  ? 127.358 108.351 118.308 1.00 78.42  ? 97  LEU D CG    1 
ATOM 2854  C CD1   . LEU D 4 97  ? 126.199 107.767 119.078 1.00 78.42  ? 97  LEU D CD1   1 
ATOM 2855  C CD2   . LEU D 4 97  ? 127.715 107.489 117.113 1.00 78.42  ? 97  LEU D CD2   1 
ATOM 2856  N N     . LEU D 4 98  ? 127.585 112.824 116.923 1.00 78.09  ? 98  LEU D N     1 
ATOM 2857  C CA    . LEU D 4 98  ? 126.993 113.942 116.194 1.00 78.09  ? 98  LEU D CA    1 
ATOM 2858  C C     . LEU D 4 98  ? 127.962 114.543 115.189 1.00 78.09  ? 98  LEU D C     1 
ATOM 2859  O O     . LEU D 4 98  ? 127.681 114.576 113.987 1.00 78.09  ? 98  LEU D O     1 
ATOM 2860  C CB    . LEU D 4 98  ? 126.498 115.016 117.152 1.00 78.09  ? 98  LEU D CB    1 
ATOM 2861  C CG    . LEU D 4 98  ? 125.247 114.609 117.913 1.00 78.09  ? 98  LEU D CG    1 
ATOM 2862  C CD1   . LEU D 4 98  ? 124.864 115.718 118.843 1.00 78.09  ? 98  LEU D CD1   1 
ATOM 2863  C CD2   . LEU D 4 98  ? 124.128 114.315 116.944 1.00 78.09  ? 98  LEU D CD2   1 
ATOM 2864  N N     . LEU D 4 99  ? 129.094 115.025 115.658 1.00 86.92  ? 99  LEU D N     1 
ATOM 2865  C CA    . LEU D 4 99  ? 129.975 115.813 114.812 1.00 86.92  ? 99  LEU D CA    1 
ATOM 2866  C C     . LEU D 4 99  ? 130.720 114.912 113.836 1.00 86.92  ? 99  LEU D C     1 
ATOM 2867  O O     . LEU D 4 99  ? 131.232 113.866 114.237 1.00 86.92  ? 99  LEU D O     1 
ATOM 2868  C CB    . LEU D 4 99  ? 130.953 116.585 115.669 1.00 86.92  ? 99  LEU D CB    1 
ATOM 2869  C CG    . LEU D 4 99  ? 130.243 117.515 116.644 1.00 86.92  ? 99  LEU D CG    1 
ATOM 2870  C CD1   . LEU D 4 99  ? 131.243 118.210 117.530 1.00 86.92  ? 99  LEU D CD1   1 
ATOM 2871  C CD2   . LEU D 4 99  ? 129.406 118.518 115.895 1.00 86.92  ? 99  LEU D CD2   1 
ATOM 2872  N N     . PRO D 4 100 ? 130.760 115.250 112.560 1.00 89.77  ? 100 PRO D N     1 
ATOM 2873  C CA    . PRO D 4 100 ? 131.341 114.344 111.560 1.00 89.77  ? 100 PRO D CA    1 
ATOM 2874  C C     . PRO D 4 100 ? 132.853 114.473 111.445 1.00 89.77  ? 100 PRO D C     1 
ATOM 2875  O O     . PRO D 4 100 ? 133.368 115.455 110.905 1.00 89.77  ? 100 PRO D O     1 
ATOM 2876  C CB    . PRO D 4 100 ? 130.638 114.775 110.263 1.00 89.77  ? 100 PRO D CB    1 
ATOM 2877  C CG    . PRO D 4 100 ? 129.441 115.549 110.702 1.00 89.77  ? 100 PRO D CG    1 
ATOM 2878  C CD    . PRO D 4 100 ? 129.883 116.248 111.936 1.00 89.77  ? 100 PRO D CD    1 
ATOM 2879  N N     . GLY D 4 101 ? 133.570 113.453 111.911 1.00 94.95  ? 101 GLY D N     1 
ATOM 2880  C CA    . GLY D 4 101 ? 134.945 113.262 111.482 1.00 94.95  ? 101 GLY D CA    1 
ATOM 2881  C C     . GLY D 4 101 ? 136.018 114.127 112.110 1.00 94.95  ? 101 GLY D C     1 
ATOM 2882  O O     . GLY D 4 101 ? 136.423 113.893 113.250 1.00 94.95  ? 101 GLY D O     1 
ATOM 2883  N N     . GLU D 4 102 ? 136.505 115.109 111.347 1.00 99.73  ? 102 GLU D N     1 
ATOM 2884  C CA    . GLU D 4 102 ? 137.694 115.868 111.729 1.00 99.73  ? 102 GLU D CA    1 
ATOM 2885  C C     . GLU D 4 102 ? 137.435 116.742 112.950 1.00 99.73  ? 102 GLU D C     1 
ATOM 2886  O O     . GLU D 4 102 ? 138.207 116.731 113.922 1.00 99.73  ? 102 GLU D O     1 
ATOM 2887  C CB    . GLU D 4 102 ? 138.143 116.731 110.551 1.00 99.73  ? 102 GLU D CB    1 
ATOM 2888  C CG    . GLU D 4 102 ? 139.426 117.500 110.759 1.00 99.73  ? 102 GLU D CG    1 
ATOM 2889  C CD    . GLU D 4 102 ? 140.645 116.609 110.720 1.00 99.73  ? 102 GLU D CD    1 
ATOM 2890  O OE1   . GLU D 4 102 ? 140.589 115.554 110.057 1.00 99.73  ? 102 GLU D OE1   1 
ATOM 2891  O OE2   . GLU D 4 102 ? 141.663 116.966 111.347 1.00 99.73  ? 102 GLU D OE2   1 
ATOM 2892  N N     . LEU D 4 103 ? 136.341 117.499 112.924 1.00 97.36  ? 103 LEU D N     1 
ATOM 2893  C CA    . LEU D 4 103 ? 136.024 118.342 114.064 1.00 97.36  ? 103 LEU D CA    1 
ATOM 2894  C C     . LEU D 4 103 ? 135.505 117.520 115.232 1.00 97.36  ? 103 LEU D C     1 
ATOM 2895  O O     . LEU D 4 103 ? 135.487 118.013 116.363 1.00 97.36  ? 103 LEU D O     1 
ATOM 2896  C CB    . LEU D 4 103 ? 135.018 119.421 113.662 1.00 97.36  ? 103 LEU D CB    1 
ATOM 2897  C CG    . LEU D 4 103 ? 133.511 119.183 113.660 1.00 97.36  ? 103 LEU D CG    1 
ATOM 2898  C CD1   . LEU D 4 103 ? 132.831 120.489 113.344 1.00 97.36  ? 103 LEU D CD1   1 
ATOM 2899  C CD2   . LEU D 4 103 ? 133.074 118.131 112.688 1.00 97.36  ? 103 LEU D CD2   1 
ATOM 2900  N N     . ALA D 4 104 ? 135.096 116.275 114.988 1.00 95.89  ? 104 ALA D N     1 
ATOM 2901  C CA    . ALA D 4 104 ? 134.894 115.358 116.098 1.00 95.89  ? 104 ALA D CA    1 
ATOM 2902  C C     . ALA D 4 104 ? 136.218 115.004 116.758 1.00 95.89  ? 104 ALA D C     1 
ATOM 2903  O O     . ALA D 4 104 ? 136.290 114.900 117.987 1.00 95.89  ? 104 ALA D O     1 
ATOM 2904  C CB    . ALA D 4 104 ? 134.187 114.096 115.624 1.00 95.89  ? 104 ALA D CB    1 
ATOM 2905  N N     . LYS D 4 105 ? 137.273 114.812 115.955 1.00 94.41  ? 105 LYS D N     1 
ATOM 2906  C CA    . LYS D 4 105 ? 138.581 114.475 116.509 1.00 94.41  ? 105 LYS D CA    1 
ATOM 2907  C C     . LYS D 4 105 ? 139.125 115.617 117.346 1.00 94.41  ? 105 LYS D C     1 
ATOM 2908  O O     . LYS D 4 105 ? 139.529 115.415 118.497 1.00 94.41  ? 105 LYS D O     1 
ATOM 2909  C CB    . LYS D 4 105 ? 139.579 114.138 115.402 1.00 94.41  ? 105 LYS D CB    1 
ATOM 2910  C CG    . LYS D 4 105 ? 139.311 112.864 114.639 1.00 94.41  ? 105 LYS D CG    1 
ATOM 2911  C CD    . LYS D 4 105 ? 140.445 112.596 113.672 1.00 94.41  ? 105 LYS D CD    1 
ATOM 2912  C CE    . LYS D 4 105 ? 140.140 111.415 112.777 1.00 94.41  ? 105 LYS D CE    1 
ATOM 2913  N NZ    . LYS D 4 105 ? 140.066 110.138 113.520 1.00 94.41  ? 105 LYS D NZ    1 
ATOM 2914  N N     . HIS D 4 106 ? 139.131 116.829 116.791 1.00 97.89  ? 106 HIS D N     1 
ATOM 2915  C CA    . HIS D 4 106 ? 139.689 117.940 117.553 1.00 97.89  ? 106 HIS D CA    1 
ATOM 2916  C C     . HIS D 4 106 ? 138.754 118.379 118.667 1.00 97.89  ? 106 HIS D C     1 
ATOM 2917  O O     . HIS D 4 106 ? 139.214 118.907 119.686 1.00 97.89  ? 106 HIS D O     1 
ATOM 2918  C CB    . HIS D 4 106 ? 140.017 119.100 116.626 1.00 97.89  ? 106 HIS D CB    1 
ATOM 2919  C CG    . HIS D 4 106 ? 141.122 118.797 115.669 1.00 97.89  ? 106 HIS D CG    1 
ATOM 2920  N ND1   . HIS D 4 106 ? 142.442 118.731 116.058 1.00 97.89  ? 106 HIS D ND1   1 
ATOM 2921  C CD2   . HIS D 4 106 ? 141.106 118.526 114.344 1.00 97.89  ? 106 HIS D CD2   1 
ATOM 2922  C CE1   . HIS D 4 106 ? 143.193 118.440 115.012 1.00 97.89  ? 106 HIS D CE1   1 
ATOM 2923  N NE2   . HIS D 4 106 ? 142.407 118.311 113.959 1.00 97.89  ? 106 HIS D NE2   1 
ATOM 2924  N N     . ALA D 4 107 ? 137.454 118.152 118.499 1.00 99.44  ? 107 ALA D N     1 
ATOM 2925  C CA    . ALA D 4 107 ? 136.503 118.449 119.561 1.00 99.44  ? 107 ALA D CA    1 
ATOM 2926  C C     . ALA D 4 107 ? 136.736 117.553 120.766 1.00 99.44  ? 107 ALA D C     1 
ATOM 2927  O O     . ALA D 4 107 ? 136.864 118.037 121.897 1.00 99.44  ? 107 ALA D O     1 
ATOM 2928  C CB    . ALA D 4 107 ? 135.080 118.285 119.040 1.00 99.44  ? 107 ALA D CB    1 
ATOM 2929  N N     . VAL D 4 108 ? 136.813 116.243 120.534 1.00 101.63 ? 108 VAL D N     1 
ATOM 2930  C CA    . VAL D 4 108 ? 137.046 115.295 121.617 1.00 101.63 ? 108 VAL D CA    1 
ATOM 2931  C C     . VAL D 4 108 ? 138.449 115.464 122.198 1.00 101.63 ? 108 VAL D C     1 
ATOM 2932  O O     . VAL D 4 108 ? 138.650 115.313 123.414 1.00 101.63 ? 108 VAL D O     1 
ATOM 2933  C CB    . VAL D 4 108 ? 136.761 113.872 121.093 1.00 101.63 ? 108 VAL D CB    1 
ATOM 2934  C CG1   . VAL D 4 108 ? 137.217 112.795 122.056 1.00 101.63 ? 108 VAL D CG1   1 
ATOM 2935  C CG2   . VAL D 4 108 ? 135.278 113.717 120.862 1.00 101.63 ? 108 VAL D CG2   1 
ATOM 2936  N N     . SER D 4 109 ? 139.420 115.851 121.366 1.00 104.50 ? 109 SER D N     1 
ATOM 2937  C CA    . SER D 4 109 ? 140.774 116.071 121.861 1.00 104.50 ? 109 SER D CA    1 
ATOM 2938  C C     . SER D 4 109 ? 140.843 117.295 122.770 1.00 104.50 ? 109 SER D C     1 
ATOM 2939  O O     . SER D 4 109 ? 141.512 117.264 123.812 1.00 104.50 ? 109 SER D O     1 
ATOM 2940  C CB    . SER D 4 109 ? 141.737 116.210 120.686 1.00 104.50 ? 109 SER D CB    1 
ATOM 2941  O OG    . SER D 4 109 ? 143.061 116.407 121.139 1.00 104.50 ? 109 SER D OG    1 
ATOM 2942  N N     . GLU D 4 110 ? 140.133 118.369 122.411 1.00 107.16 ? 110 GLU D N     1 
ATOM 2943  C CA    . GLU D 4 110 ? 140.004 119.501 123.324 1.00 107.16 ? 110 GLU D CA    1 
ATOM 2944  C C     . GLU D 4 110 ? 139.217 119.138 124.572 1.00 107.16 ? 110 GLU D C     1 
ATOM 2945  O O     . GLU D 4 110 ? 139.452 119.717 125.639 1.00 107.16 ? 110 GLU D O     1 
ATOM 2946  C CB    . GLU D 4 110 ? 139.337 120.679 122.624 1.00 107.16 ? 110 GLU D CB    1 
ATOM 2947  C CG    . GLU D 4 110 ? 140.237 121.404 121.665 1.00 107.16 ? 110 GLU D CG    1 
ATOM 2948  C CD    . GLU D 4 110 ? 141.342 122.154 122.380 1.00 107.16 ? 110 GLU D CD    1 
ATOM 2949  O OE1   . GLU D 4 110 ? 141.108 122.634 123.509 1.00 107.16 ? 110 GLU D OE1   1 
ATOM 2950  O OE2   . GLU D 4 110 ? 142.448 122.266 121.817 1.00 107.16 ? 110 GLU D OE2   1 
ATOM 2951  N N     . GLY D 4 111 ? 138.286 118.193 124.461 1.00 105.15 ? 111 GLY D N     1 
ATOM 2952  C CA    . GLY D 4 111 ? 137.562 117.754 125.638 1.00 105.15 ? 111 GLY D CA    1 
ATOM 2953  C C     . GLY D 4 111 ? 138.450 117.029 126.629 1.00 105.15 ? 111 GLY D C     1 
ATOM 2954  O O     . GLY D 4 111 ? 138.360 117.256 127.839 1.00 105.15 ? 111 GLY D O     1 
ATOM 2955  N N     . THR D 4 112 ? 139.329 116.161 126.133 1.00 107.68 ? 112 THR D N     1 
ATOM 2956  C CA    . THR D 4 112 ? 140.304 115.525 127.009 1.00 107.68 ? 112 THR D CA    1 
ATOM 2957  C C     . THR D 4 112 ? 141.290 116.548 127.558 1.00 107.68 ? 112 THR D C     1 
ATOM 2958  O O     . THR D 4 112 ? 141.722 116.435 128.714 1.00 107.68 ? 112 THR D O     1 
ATOM 2959  C CB    . THR D 4 112 ? 141.034 114.417 126.247 1.00 107.68 ? 112 THR D CB    1 
ATOM 2960  O OG1   . THR D 4 112 ? 140.071 113.521 125.677 1.00 107.68 ? 112 THR D OG1   1 
ATOM 2961  C CG2   . THR D 4 112 ? 141.940 113.614 127.172 1.00 107.68 ? 112 THR D CG2   1 
ATOM 2962  N N     . LYS D 4 113 ? 141.614 117.573 126.759 1.00 106.23 ? 113 LYS D N     1 
ATOM 2963  C CA    . LYS D 4 113 ? 142.444 118.670 127.247 1.00 106.23 ? 113 LYS D CA    1 
ATOM 2964  C C     . LYS D 4 113 ? 141.787 119.429 128.390 1.00 106.23 ? 113 LYS D C     1 
ATOM 2965  O O     . LYS D 4 113 ? 142.484 119.916 129.283 1.00 106.23 ? 113 LYS D O     1 
ATOM 2966  C CB    . LYS D 4 113 ? 142.757 119.646 126.118 1.00 106.23 ? 113 LYS D CB    1 
ATOM 2967  C CG    . LYS D 4 113 ? 143.797 119.190 125.124 1.00 106.23 ? 113 LYS D CG    1 
ATOM 2968  C CD    . LYS D 4 113 ? 143.868 120.199 123.997 1.00 106.23 ? 113 LYS D CD    1 
ATOM 2969  C CE    . LYS D 4 113 ? 144.395 121.532 124.516 1.00 106.23 ? 113 LYS D CE    1 
ATOM 2970  N NZ    . LYS D 4 113 ? 144.529 122.569 123.456 1.00 106.23 ? 113 LYS D NZ    1 
ATOM 2971  N N     . ALA D 4 114 ? 140.463 119.533 128.395 1.00 105.57 ? 114 ALA D N     1 
ATOM 2972  C CA    . ALA D 4 114 ? 139.805 120.299 129.443 1.00 105.57 ? 114 ALA D CA    1 
ATOM 2973  C C     . ALA D 4 114 ? 139.465 119.473 130.669 1.00 105.57 ? 114 ALA D C     1 
ATOM 2974  O O     . ALA D 4 114 ? 139.434 120.015 131.778 1.00 105.57 ? 114 ALA D O     1 
ATOM 2975  C CB    . ALA D 4 114 ? 138.528 120.933 128.914 1.00 105.57 ? 114 ALA D CB    1 
ATOM 2976  N N     . VAL D 4 115 ? 139.170 118.187 130.496 1.00 107.49 ? 115 VAL D N     1 
ATOM 2977  C CA    . VAL D 4 115 ? 139.034 117.305 131.650 1.00 107.49 ? 115 VAL D CA    1 
ATOM 2978  C C     . VAL D 4 115 ? 140.370 117.165 132.365 1.00 107.49 ? 115 VAL D C     1 
ATOM 2979  O O     . VAL D 4 115 ? 140.472 117.369 133.582 1.00 107.49 ? 115 VAL D O     1 
ATOM 2980  C CB    . VAL D 4 115 ? 138.494 115.935 131.212 1.00 107.49 ? 115 VAL D CB    1 
ATOM 2981  C CG1   . VAL D 4 115 ? 138.508 114.962 132.380 1.00 107.49 ? 115 VAL D CG1   1 
ATOM 2982  C CG2   . VAL D 4 115 ? 137.102 116.077 130.656 1.00 107.49 ? 115 VAL D CG2   1 
ATOM 2983  N N     . THR D 4 116 ? 141.416 116.820 131.612 1.00 109.51 ? 116 THR D N     1 
ATOM 2984  C CA    . THR D 4 116 ? 142.721 116.590 132.212 1.00 109.51 ? 116 THR D CA    1 
ATOM 2985  C C     . THR D 4 116 ? 143.337 117.894 132.693 1.00 109.51 ? 116 THR D C     1 
ATOM 2986  O O     . THR D 4 116 ? 143.925 117.943 133.777 1.00 109.51 ? 116 THR D O     1 
ATOM 2987  C CB    . THR D 4 116 ? 143.628 115.892 131.208 1.00 109.51 ? 116 THR D CB    1 
ATOM 2988  O OG1   . THR D 4 116 ? 142.986 114.693 130.762 1.00 109.51 ? 116 THR D OG1   1 
ATOM 2989  C CG2   . THR D 4 116 ? 144.946 115.525 131.849 1.00 109.51 ? 116 THR D CG2   1 
ATOM 2990  N N     . LYS D 4 117 ? 143.164 118.971 131.923 1.00 109.82 ? 117 LYS D N     1 
ATOM 2991  C CA    . LYS D 4 117 ? 143.619 120.287 132.361 1.00 109.82 ? 117 LYS D CA    1 
ATOM 2992  C C     . LYS D 4 117 ? 142.820 120.775 133.561 1.00 109.82 ? 117 LYS D C     1 
ATOM 2993  O O     . LYS D 4 117 ? 143.328 121.561 134.367 1.00 109.82 ? 117 LYS D O     1 
ATOM 2994  C CB    . LYS D 4 117 ? 143.513 121.278 131.202 1.00 109.82 ? 117 LYS D CB    1 
ATOM 2995  C CG    . LYS D 4 117 ? 144.105 122.666 131.421 1.00 109.82 ? 117 LYS D CG    1 
ATOM 2996  C CD    . LYS D 4 117 ? 143.948 123.491 130.142 1.00 109.82 ? 117 LYS D CD    1 
ATOM 2997  C CE    . LYS D 4 117 ? 144.393 124.938 130.302 1.00 109.82 ? 117 LYS D CE    1 
ATOM 2998  N NZ    . LYS D 4 117 ? 145.866 125.068 130.463 1.00 109.82 ? 117 LYS D NZ    1 
ATOM 2999  N N     . TYR D 4 118 ? 141.584 120.301 133.712 1.00 108.69 ? 118 TYR D N     1 
ATOM 3000  C CA    . TYR D 4 118 ? 140.816 120.620 134.907 1.00 108.69 ? 118 TYR D CA    1 
ATOM 3001  C C     . TYR D 4 118 ? 141.374 119.893 136.119 1.00 108.69 ? 118 TYR D C     1 
ATOM 3002  O O     . TYR D 4 118 ? 141.801 120.520 137.094 1.00 108.69 ? 118 TYR D O     1 
ATOM 3003  C CB    . TYR D 4 118 ? 139.344 120.259 134.702 1.00 108.69 ? 118 TYR D CB    1 
ATOM 3004  C CG    . TYR D 4 118 ? 138.463 120.571 135.896 1.00 108.69 ? 118 TYR D CG    1 
ATOM 3005  C CD1   . TYR D 4 118 ? 138.060 121.872 136.164 1.00 108.69 ? 118 TYR D CD1   1 
ATOM 3006  C CD2   . TYR D 4 118 ? 138.044 119.564 136.757 1.00 108.69 ? 118 TYR D CD2   1 
ATOM 3007  C CE1   . TYR D 4 118 ? 137.265 122.160 137.249 1.00 108.69 ? 118 TYR D CE1   1 
ATOM 3008  C CE2   . TYR D 4 118 ? 137.253 119.843 137.842 1.00 108.69 ? 118 TYR D CE2   1 
ATOM 3009  C CZ    . TYR D 4 118 ? 136.865 121.142 138.084 1.00 108.69 ? 118 TYR D CZ    1 
ATOM 3010  O OH    . TYR D 4 118 ? 136.072 121.429 139.172 1.00 108.69 ? 118 TYR D OH    1 
ATOM 3011  N N     . THR D 4 119 ? 141.389 118.563 136.069 1.00 109.93 ? 119 THR D N     1 
ATOM 3012  C CA    . THR D 4 119 ? 141.648 117.780 137.268 1.00 109.93 ? 119 THR D CA    1 
ATOM 3013  C C     . THR D 4 119 ? 143.111 117.778 137.688 1.00 109.93 ? 119 THR D C     1 
ATOM 3014  O O     . THR D 4 119 ? 143.396 117.514 138.860 1.00 109.93 ? 119 THR D O     1 
ATOM 3015  C CB    . THR D 4 119 ? 141.170 116.351 137.063 1.00 109.93 ? 119 THR D CB    1 
ATOM 3016  O OG1   . THR D 4 119 ? 141.767 115.822 135.875 1.00 109.93 ? 119 THR D OG1   1 
ATOM 3017  C CG2   . THR D 4 119 ? 139.668 116.324 136.930 1.00 109.93 ? 119 THR D CG2   1 
ATOM 3018  N N     . SER D 4 120 ? 144.042 118.075 136.779 1.00 113.71 ? 120 SER D N     1 
ATOM 3019  C CA    . SER D 4 120 ? 145.444 118.142 137.178 1.00 113.71 ? 120 SER D CA    1 
ATOM 3020  C C     . SER D 4 120 ? 145.735 119.367 138.030 1.00 113.71 ? 120 SER D C     1 
ATOM 3021  O O     . SER D 4 120 ? 146.751 119.393 138.731 1.00 113.71 ? 120 SER D O     1 
ATOM 3022  C CB    . SER D 4 120 ? 146.362 118.136 135.953 1.00 113.71 ? 120 SER D CB    1 
ATOM 3023  O OG    . SER D 4 120 ? 146.225 119.322 135.192 1.00 113.71 ? 120 SER D OG    1 
ATOM 3024  N N     . ALA D 4 121 ? 144.870 120.371 137.989 1.00 111.32 ? 121 ALA D N     1 
ATOM 3025  C CA    . ALA D 4 121 ? 144.991 121.517 138.866 1.00 111.32 ? 121 ALA D CA    1 
ATOM 3026  C C     . ALA D 4 121 ? 144.572 121.138 140.282 1.00 111.32 ? 121 ALA D C     1 
ATOM 3027  O O     . ALA D 4 121 ? 143.949 120.097 140.498 1.00 111.32 ? 121 ALA D O     1 
ATOM 3028  C CB    . ALA D 4 121 ? 144.152 122.665 138.348 1.00 111.32 ? 121 ALA D CB    1 
ATOM 3029  N N     . LYS E 1 37  ? 116.824 151.074 66.831  1.00 95.25  ? 37  LYS E N     1 
ATOM 3030  C CA    . LYS E 1 37  ? 117.684 150.916 67.996  1.00 95.25  ? 37  LYS E CA    1 
ATOM 3031  C C     . LYS E 1 37  ? 116.879 150.435 69.198  1.00 95.25  ? 37  LYS E C     1 
ATOM 3032  O O     . LYS E 1 37  ? 116.382 151.248 69.975  1.00 95.25  ? 37  LYS E O     1 
ATOM 3033  C CB    . LYS E 1 37  ? 118.387 152.221 68.313  1.00 95.25  ? 37  LYS E CB    1 
ATOM 3034  N N     . PRO E 1 38  ? 116.743 149.113 69.350  1.00 97.02  ? 38  PRO E N     1 
ATOM 3035  C CA    . PRO E 1 38  ? 115.893 148.588 70.428  1.00 97.02  ? 38  PRO E CA    1 
ATOM 3036  C C     . PRO E 1 38  ? 116.504 148.713 71.806  1.00 97.02  ? 38  PRO E C     1 
ATOM 3037  O O     . PRO E 1 38  ? 115.745 148.714 72.784  1.00 97.02  ? 38  PRO E O     1 
ATOM 3038  C CB    . PRO E 1 38  ? 115.710 147.111 70.047  1.00 97.02  ? 38  PRO E CB    1 
ATOM 3039  C CG    . PRO E 1 38  ? 116.039 147.040 68.608  1.00 97.02  ? 38  PRO E CG    1 
ATOM 3040  C CD    . PRO E 1 38  ? 117.124 148.054 68.406  1.00 97.02  ? 38  PRO E CD    1 
ATOM 3041  N N     . HIS E 1 39  ? 117.839 148.780 71.904  1.00 96.78  ? 39  HIS E N     1 
ATOM 3042  C CA    . HIS E 1 39  ? 118.598 148.786 73.163  1.00 96.78  ? 39  HIS E CA    1 
ATOM 3043  C C     . HIS E 1 39  ? 118.293 147.559 74.016  1.00 96.78  ? 39  HIS E C     1 
ATOM 3044  O O     . HIS E 1 39  ? 118.388 147.606 75.244  1.00 96.78  ? 39  HIS E O     1 
ATOM 3045  C CB    . HIS E 1 39  ? 118.350 150.060 73.972  1.00 96.78  ? 39  HIS E CB    1 
ATOM 3046  C CG    . HIS E 1 39  ? 118.606 151.315 73.209  1.00 96.78  ? 39  HIS E CG    1 
ATOM 3047  N ND1   . HIS E 1 39  ? 119.875 151.767 72.921  1.00 96.78  ? 39  HIS E ND1   1 
ATOM 3048  C CD2   . HIS E 1 39  ? 117.753 152.216 72.667  1.00 96.78  ? 39  HIS E CD2   1 
ATOM 3049  C CE1   . HIS E 1 39  ? 119.794 152.893 72.236  1.00 96.78  ? 39  HIS E CE1   1 
ATOM 3050  N NE2   . HIS E 1 39  ? 118.517 153.188 72.069  1.00 96.78  ? 39  HIS E NE2   1 
ATOM 3051  N N     . ARG E 1 40  ? 117.926 146.455 73.375  1.00 93.21  ? 40  ARG E N     1 
ATOM 3052  C CA    . ARG E 1 40  ? 117.436 145.283 74.072  1.00 93.21  ? 40  ARG E CA    1 
ATOM 3053  C C     . ARG E 1 40  ? 118.564 144.316 74.378  1.00 93.21  ? 40  ARG E C     1 
ATOM 3054  O O     . ARG E 1 40  ? 119.733 144.541 74.060  1.00 93.21  ? 40  ARG E O     1 
ATOM 3055  C CB    . ARG E 1 40  ? 116.370 144.571 73.251  1.00 93.21  ? 40  ARG E CB    1 
ATOM 3056  C CG    . ARG E 1 40  ? 115.032 145.236 73.233  1.00 93.21  ? 40  ARG E CG    1 
ATOM 3057  C CD    . ARG E 1 40  ? 114.171 144.515 72.241  1.00 93.21  ? 40  ARG E CD    1 
ATOM 3058  N NE    . ARG E 1 40  ? 114.101 143.093 72.545  1.00 93.21  ? 40  ARG E NE    1 
ATOM 3059  C CZ    . ARG E 1 40  ? 113.197 142.550 73.344  1.00 93.21  ? 40  ARG E CZ    1 
ATOM 3060  N NH1   . ARG E 1 40  ? 112.280 143.311 73.915  1.00 93.21  ? 40  ARG E NH1   1 
ATOM 3061  N NH2   . ARG E 1 40  ? 113.204 141.246 73.558  1.00 93.21  ? 40  ARG E NH2   1 
ATOM 3062  N N     . TYR E 1 41  ? 118.193 143.211 75.000  1.00 91.67  ? 41  TYR E N     1 
ATOM 3063  C CA    . TYR E 1 41  ? 119.117 142.161 75.358  1.00 91.67  ? 41  TYR E CA    1 
ATOM 3064  C C     . TYR E 1 41  ? 118.510 140.827 74.965  1.00 91.67  ? 41  TYR E C     1 
ATOM 3065  O O     . TYR E 1 41  ? 117.341 140.739 74.588  1.00 91.67  ? 41  TYR E O     1 
ATOM 3066  C CB    . TYR E 1 41  ? 119.435 142.218 76.850  1.00 91.67  ? 41  TYR E CB    1 
ATOM 3067  C CG    . TYR E 1 41  ? 120.290 143.402 77.194  1.00 91.67  ? 41  TYR E CG    1 
ATOM 3068  C CD1   . TYR E 1 41  ? 121.665 143.324 77.101  1.00 91.67  ? 41  TYR E CD1   1 
ATOM 3069  C CD2   . TYR E 1 41  ? 119.727 144.610 77.565  1.00 91.67  ? 41  TYR E CD2   1 
ATOM 3070  C CE1   . TYR E 1 41  ? 122.465 144.408 77.395  1.00 91.67  ? 41  TYR E CE1   1 
ATOM 3071  C CE2   . TYR E 1 41  ? 120.511 145.704 77.858  1.00 91.67  ? 41  TYR E CE2   1 
ATOM 3072  C CZ    . TYR E 1 41  ? 121.885 145.595 77.771  1.00 91.67  ? 41  TYR E CZ    1 
ATOM 3073  O OH    . TYR E 1 41  ? 122.685 146.675 78.061  1.00 91.67  ? 41  TYR E OH    1 
ATOM 3074  N N     . ARG E 1 42  ? 119.334 139.790 75.029  1.00 85.01  ? 42  ARG E N     1 
ATOM 3075  C CA    . ARG E 1 42  ? 118.839 138.441 74.853  1.00 85.01  ? 42  ARG E CA    1 
ATOM 3076  C C     . ARG E 1 42  ? 117.858 138.079 75.967  1.00 85.01  ? 42  ARG E C     1 
ATOM 3077  O O     . ARG E 1 42  ? 117.892 138.654 77.057  1.00 85.01  ? 42  ARG E O     1 
ATOM 3078  C CB    . ARG E 1 42  ? 119.993 137.444 74.855  1.00 85.01  ? 42  ARG E CB    1 
ATOM 3079  C CG    . ARG E 1 42  ? 120.510 137.040 73.499  1.00 85.01  ? 42  ARG E CG    1 
ATOM 3080  C CD    . ARG E 1 42  ? 121.240 138.143 72.793  1.00 85.01  ? 42  ARG E CD    1 
ATOM 3081  N NE    . ARG E 1 42  ? 121.928 137.604 71.631  1.00 85.01  ? 42  ARG E NE    1 
ATOM 3082  C CZ    . ARG E 1 42  ? 122.523 138.341 70.706  1.00 85.01  ? 42  ARG E CZ    1 
ATOM 3083  N NH1   . ARG E 1 42  ? 122.504 139.656 70.795  1.00 85.01  ? 42  ARG E NH1   1 
ATOM 3084  N NH2   . ARG E 1 42  ? 123.128 137.759 69.683  1.00 85.01  ? 42  ARG E NH2   1 
ATOM 3085  N N     . PRO E 1 43  ? 116.973 137.151 75.718  1.00 81.90  ? 43  PRO E N     1 
ATOM 3086  C CA    . PRO E 1 43  ? 116.203 136.571 76.815  1.00 81.90  ? 43  PRO E CA    1 
ATOM 3087  C C     . PRO E 1 43  ? 117.068 135.638 77.635  1.00 81.90  ? 43  PRO E C     1 
ATOM 3088  O O     . PRO E 1 43  ? 117.140 134.437 77.369  1.00 81.90  ? 43  PRO E O     1 
ATOM 3089  C CB    . PRO E 1 43  ? 115.067 135.835 76.103  1.00 81.90  ? 43  PRO E CB    1 
ATOM 3090  C CG    . PRO E 1 43  ? 115.574 135.587 74.748  1.00 81.90  ? 43  PRO E CG    1 
ATOM 3091  C CD    . PRO E 1 43  ? 116.457 136.732 74.406  1.00 81.90  ? 43  PRO E CD    1 
ATOM 3092  N N     . GLY E 1 44  ? 117.736 136.190 78.636  1.00 80.93  ? 44  GLY E N     1 
ATOM 3093  C CA    . GLY E 1 44  ? 118.637 135.412 79.454  1.00 80.93  ? 44  GLY E CA    1 
ATOM 3094  C C     . GLY E 1 44  ? 119.789 136.209 80.022  1.00 80.93  ? 44  GLY E C     1 
ATOM 3095  O O     . GLY E 1 44  ? 120.373 135.809 81.029  1.00 80.93  ? 44  GLY E O     1 
ATOM 3096  N N     . THR E 1 45  ? 120.106 137.356 79.427  1.00 80.50  ? 45  THR E N     1 
ATOM 3097  C CA    . THR E 1 45  ? 121.090 138.234 80.045  1.00 80.50  ? 45  THR E CA    1 
ATOM 3098  C C     . THR E 1 45  ? 120.509 138.917 81.269  1.00 80.50  ? 45  THR E C     1 
ATOM 3099  O O     . THR E 1 45  ? 121.140 138.944 82.332  1.00 80.50  ? 45  THR E O     1 
ATOM 3100  C CB    . THR E 1 45  ? 121.588 139.261 79.042  1.00 80.50  ? 45  THR E CB    1 
ATOM 3101  O OG1   . THR E 1 45  ? 122.291 138.586 77.995  1.00 80.50  ? 45  THR E OG1   1 
ATOM 3102  C CG2   . THR E 1 45  ? 122.521 140.253 79.716  1.00 80.50  ? 45  THR E CG2   1 
ATOM 3103  N N     . VAL E 1 46  ? 119.292 139.456 81.145  1.00 77.58  ? 46  VAL E N     1 
ATOM 3104  C CA    . VAL E 1 46  ? 118.580 139.992 82.304  1.00 77.58  ? 46  VAL E CA    1 
ATOM 3105  C C     . VAL E 1 46  ? 118.296 138.881 83.309  1.00 77.58  ? 46  VAL E C     1 
ATOM 3106  O O     . VAL E 1 46  ? 118.332 139.102 84.528  1.00 77.58  ? 46  VAL E O     1 
ATOM 3107  C CB    . VAL E 1 46  ? 117.301 140.713 81.829  1.00 77.58  ? 46  VAL E CB    1 
ATOM 3108  C CG1   . VAL E 1 46  ? 116.438 141.173 82.987  1.00 77.58  ? 46  VAL E CG1   1 
ATOM 3109  C CG2   . VAL E 1 46  ? 117.681 141.899 80.981  1.00 77.58  ? 46  VAL E CG2   1 
ATOM 3110  N N     . ALA E 1 47  ? 118.097 137.659 82.818  1.00 76.55  ? 47  ALA E N     1 
ATOM 3111  C CA    . ALA E 1 47  ? 117.900 136.524 83.706  1.00 76.55  ? 47  ALA E CA    1 
ATOM 3112  C C     . ALA E 1 47  ? 119.169 136.190 84.475  1.00 76.55  ? 47  ALA E C     1 
ATOM 3113  O O     . ALA E 1 47  ? 119.138 136.104 85.700  1.00 76.55  ? 47  ALA E O     1 
ATOM 3114  C CB    . ALA E 1 47  ? 117.413 135.316 82.913  1.00 76.55  ? 47  ALA E CB    1 
ATOM 3115  N N     . LEU E 1 48  ? 120.299 136.018 83.783  1.00 76.49  ? 48  LEU E N     1 
ATOM 3116  C CA    . LEU E 1 48  ? 121.505 135.547 84.466  1.00 76.49  ? 48  LEU E CA    1 
ATOM 3117  C C     . LEU E 1 48  ? 122.148 136.638 85.313  1.00 76.49  ? 48  LEU E C     1 
ATOM 3118  O O     . LEU E 1 48  ? 122.654 136.362 86.411  1.00 76.49  ? 48  LEU E O     1 
ATOM 3119  C CB    . LEU E 1 48  ? 122.510 135.006 83.460  1.00 76.49  ? 48  LEU E CB    1 
ATOM 3120  C CG    . LEU E 1 48  ? 122.115 133.689 82.821  1.00 76.49  ? 48  LEU E CG    1 
ATOM 3121  C CD1   . LEU E 1 48  ? 123.087 133.368 81.724  1.00 76.49  ? 48  LEU E CD1   1 
ATOM 3122  C CD2   . LEU E 1 48  ? 122.115 132.614 83.866  1.00 76.49  ? 48  LEU E CD2   1 
ATOM 3123  N N     . ARG E 1 49  ? 122.153 137.877 84.815  1.00 75.96  ? 49  ARG E N     1 
ATOM 3124  C CA    . ARG E 1 49  ? 122.566 138.999 85.645  1.00 75.96  ? 49  ARG E CA    1 
ATOM 3125  C C     . ARG E 1 49  ? 121.620 139.167 86.824  1.00 75.96  ? 49  ARG E C     1 
ATOM 3126  O O     . ARG E 1 49  ? 122.046 139.500 87.941  1.00 75.96  ? 49  ARG E O     1 
ATOM 3127  C CB    . ARG E 1 49  ? 122.619 140.274 84.810  1.00 75.96  ? 49  ARG E CB    1 
ATOM 3128  C CG    . ARG E 1 49  ? 123.236 141.440 85.539  1.00 75.96  ? 49  ARG E CG    1 
ATOM 3129  C CD    . ARG E 1 49  ? 123.367 142.672 84.654  1.00 75.96  ? 49  ARG E CD    1 
ATOM 3130  N NE    . ARG E 1 49  ? 122.096 143.313 84.321  1.00 75.96  ? 49  ARG E NE    1 
ATOM 3131  C CZ    . ARG E 1 49  ? 121.618 143.453 83.087  1.00 75.96  ? 49  ARG E CZ    1 
ATOM 3132  N NH1   . ARG E 1 49  ? 122.299 142.997 82.045  1.00 75.96  ? 49  ARG E NH1   1 
ATOM 3133  N NH2   . ARG E 1 49  ? 120.461 144.062 82.894  1.00 75.96  ? 49  ARG E NH2   1 
ATOM 3134  N N     . GLU E 1 50  ? 120.334 138.885 86.603  1.00 77.76  ? 50  GLU E N     1 
ATOM 3135  C CA    . GLU E 1 50  ? 119.368 138.933 87.688  1.00 77.76  ? 50  GLU E CA    1 
ATOM 3136  C C     . GLU E 1 50  ? 119.613 137.824 88.704  1.00 77.76  ? 50  GLU E C     1 
ATOM 3137  O O     . GLU E 1 50  ? 119.356 138.014 89.896  1.00 77.76  ? 50  GLU E O     1 
ATOM 3138  C CB    . GLU E 1 50  ? 117.957 138.853 87.111  1.00 77.76  ? 50  GLU E CB    1 
ATOM 3139  C CG    . GLU E 1 50  ? 116.867 139.161 88.114  1.00 77.76  ? 50  GLU E CG    1 
ATOM 3140  C CD    . GLU E 1 50  ? 115.464 139.116 87.535  1.00 77.76  ? 50  GLU E CD    1 
ATOM 3141  O OE1   . GLU E 1 50  ? 115.313 138.803 86.336  1.00 77.76  ? 50  GLU E OE1   1 
ATOM 3142  O OE2   . GLU E 1 50  ? 114.503 139.373 88.292  1.00 77.76  ? 50  GLU E OE2   1 
ATOM 3143  N N     . ILE E 1 51  ? 120.132 136.678 88.262  1.00 73.48  ? 51  ILE E N     1 
ATOM 3144  C CA    . ILE E 1 51  ? 120.518 135.614 89.182  1.00 73.48  ? 51  ILE E CA    1 
ATOM 3145  C C     . ILE E 1 51  ? 121.738 136.031 89.984  1.00 73.48  ? 51  ILE E C     1 
ATOM 3146  O O     . ILE E 1 51  ? 121.853 135.705 91.173  1.00 73.48  ? 51  ILE E O     1 
ATOM 3147  C CB    . ILE E 1 51  ? 120.751 134.298 88.413  1.00 73.48  ? 51  ILE E CB    1 
ATOM 3148  C CG1   . ILE E 1 51  ? 119.430 133.750 87.901  1.00 73.48  ? 51  ILE E CG1   1 
ATOM 3149  C CG2   . ILE E 1 51  ? 121.359 133.218 89.271  1.00 73.48  ? 51  ILE E CG2   1 
ATOM 3150  C CD1   . ILE E 1 51  ? 119.585 132.580 86.959  1.00 73.48  ? 51  ILE E CD1   1 
ATOM 3151  N N     . ARG E 1 52  ? 122.651 136.786 89.370  1.00 74.84  ? 52  ARG E N     1 
ATOM 3152  C CA    . ARG E 1 52  ? 123.783 137.282 90.145  1.00 74.84  ? 52  ARG E CA    1 
ATOM 3153  C C     . ARG E 1 52  ? 123.334 138.284 91.197  1.00 74.84  ? 52  ARG E C     1 
ATOM 3154  O O     . ARG E 1 52  ? 123.840 138.268 92.326  1.00 74.84  ? 52  ARG E O     1 
ATOM 3155  C CB    . ARG E 1 52  ? 124.838 137.899 89.239  1.00 74.84  ? 52  ARG E CB    1 
ATOM 3156  C CG    . ARG E 1 52  ? 125.590 136.891 88.394  1.00 74.84  ? 52  ARG E CG    1 
ATOM 3157  C CD    . ARG E 1 52  ? 126.675 137.575 87.595  1.00 74.84  ? 52  ARG E CD    1 
ATOM 3158  N NE    . ARG E 1 52  ? 127.341 136.657 86.679  1.00 74.84  ? 52  ARG E NE    1 
ATOM 3159  C CZ    . ARG E 1 52  ? 126.960 136.465 85.422  1.00 74.84  ? 52  ARG E CZ    1 
ATOM 3160  N NH1   . ARG E 1 52  ? 125.924 137.131 84.936  1.00 74.84  ? 52  ARG E NH1   1 
ATOM 3161  N NH2   . ARG E 1 52  ? 127.617 135.614 84.650  1.00 74.84  ? 52  ARG E NH2   1 
ATOM 3162  N N     . ARG E 1 53  ? 122.342 139.116 90.875  1.00 74.75  ? 53  ARG E N     1 
ATOM 3163  C CA    . ARG E 1 53  ? 121.873 140.066 91.877  1.00 74.75  ? 53  ARG E CA    1 
ATOM 3164  C C     . ARG E 1 53  ? 121.071 139.381 92.976  1.00 74.75  ? 53  ARG E C     1 
ATOM 3165  O O     . ARG E 1 53  ? 121.366 139.551 94.162  1.00 74.75  ? 53  ARG E O     1 
ATOM 3166  C CB    . ARG E 1 53  ? 121.036 141.172 91.253  1.00 74.75  ? 53  ARG E CB    1 
ATOM 3167  C CG    . ARG E 1 53  ? 120.642 142.140 92.328  1.00 74.75  ? 53  ARG E CG    1 
ATOM 3168  C CD    . ARG E 1 53  ? 119.809 143.274 91.858  1.00 74.75  ? 53  ARG E CD    1 
ATOM 3169  N NE    . ARG E 1 53  ? 119.444 144.078 93.013  1.00 74.75  ? 53  ARG E NE    1 
ATOM 3170  C CZ    . ARG E 1 53  ? 118.683 145.159 92.960  1.00 74.75  ? 53  ARG E CZ    1 
ATOM 3171  N NH1   . ARG E 1 53  ? 118.199 145.571 91.797  1.00 74.75  ? 53  ARG E NH1   1 
ATOM 3172  N NH2   . ARG E 1 53  ? 118.402 145.823 94.070  1.00 74.75  ? 53  ARG E NH2   1 
ATOM 3173  N N     . TYR E 1 54  ? 120.049 138.615 92.614  1.00 74.36  ? 54  TYR E N     1 
ATOM 3174  C CA    . TYR E 1 54  ? 119.198 138.059 93.655  1.00 74.36  ? 54  TYR E CA    1 
ATOM 3175  C C     . TYR E 1 54  ? 119.783 136.838 94.340  1.00 74.36  ? 54  TYR E C     1 
ATOM 3176  O O     . TYR E 1 54  ? 119.280 136.458 95.402  1.00 74.36  ? 54  TYR E O     1 
ATOM 3177  C CB    . TYR E 1 54  ? 117.815 137.723 93.113  1.00 74.36  ? 54  TYR E CB    1 
ATOM 3178  C CG    . TYR E 1 54  ? 116.975 138.945 92.893  1.00 74.36  ? 54  TYR E CG    1 
ATOM 3179  C CD1   . TYR E 1 54  ? 116.456 139.652 93.968  1.00 74.36  ? 54  TYR E CD1   1 
ATOM 3180  C CD2   . TYR E 1 54  ? 116.678 139.382 91.621  1.00 74.36  ? 54  TYR E CD2   1 
ATOM 3181  C CE1   . TYR E 1 54  ? 115.684 140.775 93.776  1.00 74.36  ? 54  TYR E CE1   1 
ATOM 3182  C CE2   . TYR E 1 54  ? 115.899 140.500 91.415  1.00 74.36  ? 54  TYR E CE2   1 
ATOM 3183  C CZ    . TYR E 1 54  ? 115.411 141.194 92.497  1.00 74.36  ? 54  TYR E CZ    1 
ATOM 3184  O OH    . TYR E 1 54  ? 114.637 142.310 92.296  1.00 74.36  ? 54  TYR E OH    1 
ATOM 3185  N N     . GLN E 1 55  ? 120.810 136.203 93.783  1.00 73.58  ? 55  GLN E N     1 
ATOM 3186  C CA    . GLN E 1 55  ? 121.609 135.339 94.636  1.00 73.58  ? 55  GLN E CA    1 
ATOM 3187  C C     . GLN E 1 55  ? 122.550 136.162 95.489  1.00 73.58  ? 55  GLN E C     1 
ATOM 3188  O O     . GLN E 1 55  ? 122.884 135.760 96.608  1.00 73.58  ? 55  GLN E O     1 
ATOM 3189  C CB    . GLN E 1 55  ? 122.406 134.309 93.828  1.00 73.58  ? 55  GLN E CB    1 
ATOM 3190  C CG    . GLN E 1 55  ? 121.588 133.140 93.311  1.00 73.58  ? 55  GLN E CG    1 
ATOM 3191  C CD    . GLN E 1 55  ? 122.435 132.039 92.700  1.00 73.58  ? 55  GLN E CD    1 
ATOM 3192  O OE1   . GLN E 1 55  ? 123.644 132.178 92.556  1.00 73.58  ? 55  GLN E OE1   1 
ATOM 3193  N NE2   . GLN E 1 55  ? 121.805 130.923 92.377  1.00 73.58  ? 55  GLN E NE2   1 
ATOM 3194  N N     . LYS E 1 56  ? 122.957 137.327 94.992  1.00 71.74  ? 56  LYS E N     1 
ATOM 3195  C CA    . LYS E 1 56  ? 123.962 138.105 95.698  1.00 71.74  ? 56  LYS E CA    1 
ATOM 3196  C C     . LYS E 1 56  ? 123.377 138.779 96.935  1.00 71.74  ? 56  LYS E C     1 
ATOM 3197  O O     . LYS E 1 56  ? 123.991 138.754 98.005  1.00 71.74  ? 56  LYS E O     1 
ATOM 3198  C CB    . LYS E 1 56  ? 124.574 139.119 94.733  1.00 71.74  ? 56  LYS E CB    1 
ATOM 3199  C CG    . LYS E 1 56  ? 125.832 139.774 95.222  1.00 71.74  ? 56  LYS E CG    1 
ATOM 3200  C CD    . LYS E 1 56  ? 126.492 140.547 94.103  1.00 71.74  ? 56  LYS E CD    1 
ATOM 3201  C CE    . LYS E 1 56  ? 127.747 141.203 94.611  1.00 71.74  ? 56  LYS E CE    1 
ATOM 3202  N NZ    . LYS E 1 56  ? 128.709 140.155 95.031  1.00 71.74  ? 56  LYS E NZ    1 
ATOM 3203  N N     . SER E 1 57  ? 122.182 139.352 96.827  1.00 70.79  ? 57  SER E N     1 
ATOM 3204  C CA    . SER E 1 57  ? 121.599 140.066 97.951  1.00 70.79  ? 57  SER E CA    1 
ATOM 3205  C C     . SER E 1 57  ? 120.879 139.097 98.875  1.00 70.79  ? 57  SER E C     1 
ATOM 3206  O O     . SER E 1 57  ? 120.804 137.895 98.620  1.00 70.79  ? 57  SER E O     1 
ATOM 3207  C CB    . SER E 1 57  ? 120.621 141.132 97.486  1.00 70.79  ? 57  SER E CB    1 
ATOM 3208  O OG    . SER E 1 57  ? 119.413 140.523 97.086  1.00 70.79  ? 57  SER E OG    1 
ATOM 3209  N N     . THR E 1 58  ? 120.323 139.640 99.964  1.00 70.92  ? 58  THR E N     1 
ATOM 3210  C CA    . THR E 1 58  ? 119.803 138.840 101.068 1.00 70.92  ? 58  THR E CA    1 
ATOM 3211  C C     . THR E 1 58  ? 118.446 139.261 101.599 1.00 70.92  ? 58  THR E C     1 
ATOM 3212  O O     . THR E 1 58  ? 117.896 138.542 102.438 1.00 70.92  ? 58  THR E O     1 
ATOM 3213  C CB    . THR E 1 58  ? 120.765 138.872 102.267 1.00 70.92  ? 58  THR E CB    1 
ATOM 3214  O OG1   . THR E 1 58  ? 121.024 140.231 102.634 1.00 70.92  ? 58  THR E OG1   1 
ATOM 3215  C CG2   . THR E 1 58  ? 122.056 138.166 101.980 1.00 70.92  ? 58  THR E CG2   1 
ATOM 3216  N N     . GLU E 1 59  ? 117.900 140.395 101.180 1.00 73.45  ? 59  GLU E N     1 
ATOM 3217  C CA    . GLU E 1 59  ? 116.818 140.989 101.946 1.00 73.45  ? 59  GLU E CA    1 
ATOM 3218  C C     . GLU E 1 59  ? 115.494 140.300 101.635 1.00 73.45  ? 59  GLU E C     1 
ATOM 3219  O O     . GLU E 1 59  ? 115.400 139.411 100.786 1.00 73.45  ? 59  GLU E O     1 
ATOM 3220  C CB    . GLU E 1 59  ? 116.730 142.490 101.675 1.00 73.45  ? 59  GLU E CB    1 
ATOM 3221  C CG    . GLU E 1 59  ? 116.097 142.859 100.353 1.00 73.45  ? 59  GLU E CG    1 
ATOM 3222  C CD    . GLU E 1 59  ? 117.076 142.904 99.208  1.00 73.45  ? 59  GLU E CD    1 
ATOM 3223  O OE1   . GLU E 1 59  ? 118.187 142.350 99.328  1.00 73.45  ? 59  GLU E OE1   1 
ATOM 3224  O OE2   . GLU E 1 59  ? 116.733 143.512 98.176  1.00 73.45  ? 59  GLU E OE2   1 
ATOM 3225  N N     . LEU E 1 60  ? 114.455 140.731 102.333 1.00 71.52  ? 60  LEU E N     1 
ATOM 3226  C CA    . LEU E 1 60  ? 113.162 140.074 102.285 1.00 71.52  ? 60  LEU E CA    1 
ATOM 3227  C C     . LEU E 1 60  ? 112.321 140.734 101.207 1.00 71.52  ? 60  LEU E C     1 
ATOM 3228  O O     . LEU E 1 60  ? 112.255 141.963 101.126 1.00 71.52  ? 60  LEU E O     1 
ATOM 3229  C CB    . LEU E 1 60  ? 112.462 140.150 103.637 1.00 71.52  ? 60  LEU E CB    1 
ATOM 3230  C CG    . LEU E 1 60  ? 112.861 139.104 104.680 1.00 71.52  ? 60  LEU E CG    1 
ATOM 3231  C CD1   . LEU E 1 60  ? 112.678 137.708 104.112 1.00 71.52  ? 60  LEU E CD1   1 
ATOM 3232  C CD2   . LEU E 1 60  ? 114.264 139.308 105.248 1.00 71.52  ? 60  LEU E CD2   1 
ATOM 3233  N N     . LEU E 1 61  ? 111.676 139.917 100.388 1.00 70.72  ? 61  LEU E N     1 
ATOM 3234  C CA    . LEU E 1 61  ? 111.298 140.381 99.063  1.00 70.72  ? 61  LEU E CA    1 
ATOM 3235  C C     . LEU E 1 61  ? 109.916 139.924 98.618  1.00 70.72  ? 61  LEU E C     1 
ATOM 3236  O O     . LEU E 1 61  ? 109.597 140.043 97.430  1.00 70.72  ? 61  LEU E O     1 
ATOM 3237  C CB    . LEU E 1 61  ? 112.373 139.960 98.054  1.00 70.72  ? 61  LEU E CB    1 
ATOM 3238  C CG    . LEU E 1 61  ? 112.585 138.520 97.598  1.00 70.72  ? 61  LEU E CG    1 
ATOM 3239  C CD1   . LEU E 1 61  ? 113.511 138.566 96.420  1.00 70.72  ? 61  LEU E CD1   1 
ATOM 3240  C CD2   . LEU E 1 61  ? 113.168 137.607 98.667  1.00 70.72  ? 61  LEU E CD2   1 
ATOM 3241  N N     . ILE E 1 62  ? 109.099 139.400 99.516  1.00 68.50  ? 62  ILE E N     1 
ATOM 3242  C CA    . ILE E 1 62  ? 107.654 139.392 99.355  1.00 68.50  ? 62  ILE E CA    1 
ATOM 3243  C C     . ILE E 1 62  ? 107.113 140.478 100.269 1.00 68.50  ? 62  ILE E C     1 
ATOM 3244  O O     . ILE E 1 62  ? 107.534 140.578 101.427 1.00 68.50  ? 62  ILE E O     1 
ATOM 3245  C CB    . ILE E 1 62  ? 107.057 138.021 99.697  1.00 68.50  ? 62  ILE E CB    1 
ATOM 3246  C CG1   . ILE E 1 62  ? 107.623 136.956 98.784  1.00 68.50  ? 62  ILE E CG1   1 
ATOM 3247  C CG2   . ILE E 1 62  ? 105.574 138.030 99.524  1.00 68.50  ? 62  ILE E CG2   1 
ATOM 3248  C CD1   . ILE E 1 62  ? 107.226 135.578 99.203  1.00 68.50  ? 62  ILE E CD1   1 
ATOM 3249  N N     . ARG E 1 63  ? 106.204 141.301 99.748  1.00 71.18  ? 63  ARG E N     1 
ATOM 3250  C CA    . ARG E 1 63  ? 105.835 142.549 100.404 1.00 71.18  ? 63  ARG E CA    1 
ATOM 3251  C C     . ARG E 1 63  ? 105.074 142.287 101.698 1.00 71.18  ? 63  ARG E C     1 
ATOM 3252  O O     . ARG E 1 63  ? 104.285 141.345 101.794 1.00 71.18  ? 63  ARG E O     1 
ATOM 3253  C CB    . ARG E 1 63  ? 105.006 143.404 99.450  1.00 71.18  ? 63  ARG E CB    1 
ATOM 3254  C CG    . ARG E 1 63  ? 105.710 143.753 98.131  1.00 71.18  ? 63  ARG E CG    1 
ATOM 3255  C CD    . ARG E 1 63  ? 106.902 144.682 98.302  1.00 71.18  ? 63  ARG E CD    1 
ATOM 3256  N NE    . ARG E 1 63  ? 108.156 143.967 98.517  1.00 71.18  ? 63  ARG E NE    1 
ATOM 3257  C CZ    . ARG E 1 63  ? 109.270 144.533 98.964  1.00 71.18  ? 63  ARG E CZ    1 
ATOM 3258  N NH1   . ARG E 1 63  ? 109.291 145.829 99.236  1.00 71.18  ? 63  ARG E NH1   1 
ATOM 3259  N NH2   . ARG E 1 63  ? 110.366 143.808 99.139  1.00 71.18  ? 63  ARG E NH2   1 
ATOM 3260  N N     . LYS E 1 64  ? 105.320 143.138 102.696 1.00 73.52  ? 64  LYS E N     1 
ATOM 3261  C CA    . LYS E 1 64  ? 105.046 142.759 104.078 1.00 73.52  ? 64  LYS E CA    1 
ATOM 3262  C C     . LYS E 1 64  ? 103.560 142.825 104.415 1.00 73.52  ? 64  LYS E C     1 
ATOM 3263  O O     . LYS E 1 64  ? 103.064 142.000 105.193 1.00 73.52  ? 64  LYS E O     1 
ATOM 3264  C CB    . LYS E 1 64  ? 105.871 143.631 105.022 1.00 73.52  ? 64  LYS E CB    1 
ATOM 3265  C CG    . LYS E 1 64  ? 107.362 143.307 104.961 1.00 73.52  ? 64  LYS E CG    1 
ATOM 3266  C CD    . LYS E 1 64  ? 108.182 144.023 106.032 1.00 73.52  ? 64  LYS E CD    1 
ATOM 3267  C CE    . LYS E 1 64  ? 108.919 145.230 105.483 1.00 73.52  ? 64  LYS E CE    1 
ATOM 3268  N NZ    . LYS E 1 64  ? 108.017 146.376 105.238 1.00 73.52  ? 64  LYS E NZ    1 
ATOM 3269  N N     . LEU E 1 65  ? 102.829 143.779 103.850 1.00 72.88  ? 65  LEU E N     1 
ATOM 3270  C CA    . LEU E 1 65  ? 101.390 143.794 104.110 1.00 72.88  ? 65  LEU E CA    1 
ATOM 3271  C C     . LEU E 1 65  ? 100.569 142.740 103.358 1.00 72.88  ? 65  LEU E C     1 
ATOM 3272  O O     . LEU E 1 65  ? 99.639  142.194 103.969 1.00 72.88  ? 65  LEU E O     1 
ATOM 3273  C CB    . LEU E 1 65  ? 100.801 145.183 103.857 1.00 72.88  ? 65  LEU E CB    1 
ATOM 3274  C CG    . LEU E 1 65  ? 101.155 146.195 104.938 1.00 72.88  ? 65  LEU E CG    1 
ATOM 3275  C CD1   . LEU E 1 65  ? 100.572 147.544 104.598 1.00 72.88  ? 65  LEU E CD1   1 
ATOM 3276  C CD2   . LEU E 1 65  ? 100.649 145.716 106.281 1.00 72.88  ? 65  LEU E CD2   1 
ATOM 3277  N N     . PRO E 1 66  ? 100.821 142.417 102.074 1.00 70.54  ? 66  PRO E N     1 
ATOM 3278  C CA    . PRO E 1 66  ? 100.085 141.277 101.501 1.00 70.54  ? 66  PRO E CA    1 
ATOM 3279  C C     . PRO E 1 66  ? 100.453 139.952 102.128 1.00 70.54  ? 66  PRO E C     1 
ATOM 3280  O O     . PRO E 1 66  ? 99.582  139.086 102.291 1.00 70.54  ? 66  PRO E O     1 
ATOM 3281  C CB    . PRO E 1 66  ? 100.467 141.318 100.018 1.00 70.54  ? 66  PRO E CB    1 
ATOM 3282  C CG    . PRO E 1 66  ? 100.833 142.693 99.771  1.00 70.54  ? 66  PRO E CG    1 
ATOM 3283  C CD    . PRO E 1 66  ? 101.528 143.141 100.999 1.00 70.54  ? 66  PRO E CD    1 
ATOM 3284  N N     . PHE E 1 67  ? 101.719 139.774 102.498 1.00 68.33  ? 67  PHE E N     1 
ATOM 3285  C CA    . PHE E 1 67  ? 102.114 138.552 103.179 1.00 68.33  ? 67  PHE E CA    1 
ATOM 3286  C C     . PHE E 1 67  ? 101.476 138.472 104.554 1.00 68.33  ? 67  PHE E C     1 
ATOM 3287  O O     . PHE E 1 67  ? 101.013 137.403 104.968 1.00 68.33  ? 67  PHE E O     1 
ATOM 3288  C CB    . PHE E 1 67  ? 103.631 138.486 103.293 1.00 68.33  ? 67  PHE E CB    1 
ATOM 3289  C CG    . PHE E 1 67  ? 104.129 137.186 103.813 1.00 68.33  ? 67  PHE E CG    1 
ATOM 3290  C CD1   . PHE E 1 67  ? 104.199 136.087 102.985 1.00 68.33  ? 67  PHE E CD1   1 
ATOM 3291  C CD2   . PHE E 1 67  ? 104.509 137.051 105.130 1.00 68.33  ? 67  PHE E CD2   1 
ATOM 3292  C CE1   . PHE E 1 67  ? 104.645 134.884 103.455 1.00 68.33  ? 67  PHE E CE1   1 
ATOM 3293  C CE2   . PHE E 1 67  ? 104.944 135.848 105.606 1.00 68.33  ? 67  PHE E CE2   1 
ATOM 3294  C CZ    . PHE E 1 67  ? 105.013 134.762 104.766 1.00 68.33  ? 67  PHE E CZ    1 
ATOM 3295  N N     . GLN E 1 68  ? 101.423 139.605 105.254 1.00 72.38  ? 68  GLN E N     1 
ATOM 3296  C CA    . GLN E 1 68  ? 100.841 139.652 106.588 1.00 72.38  ? 68  GLN E CA    1 
ATOM 3297  C C     . GLN E 1 68  ? 99.350  139.346 106.550 1.00 72.38  ? 68  GLN E C     1 
ATOM 3298  O O     . GLN E 1 68  ? 98.852  138.549 107.358 1.00 72.38  ? 68  GLN E O     1 
ATOM 3299  C CB    . GLN E 1 68  ? 101.122 141.023 107.196 1.00 72.38  ? 68  GLN E CB    1 
ATOM 3300  C CG    . GLN E 1 68  ? 100.696 141.211 108.628 1.00 72.38  ? 68  GLN E CG    1 
ATOM 3301  C CD    . GLN E 1 68  ? 101.176 142.538 109.184 1.00 72.38  ? 68  GLN E CD    1 
ATOM 3302  O OE1   . GLN E 1 68  ? 101.831 143.312 108.487 1.00 72.38  ? 68  GLN E OE1   1 
ATOM 3303  N NE2   . GLN E 1 68  ? 100.854 142.809 110.437 1.00 72.38  ? 68  GLN E NE2   1 
ATOM 3304  N N     . ARG E 1 69  ? 98.635  139.930 105.584 1.00 71.84  ? 69  ARG E N     1 
ATOM 3305  C CA    . ARG E 1 69  ? 97.226  139.602 105.394 1.00 71.84  ? 69  ARG E CA    1 
ATOM 3306  C C     . ARG E 1 69  ? 97.031  138.146 104.998 1.00 71.84  ? 69  ARG E C     1 
ATOM 3307  O O     . ARG E 1 69  ? 96.018  137.536 105.361 1.00 71.84  ? 69  ARG E O     1 
ATOM 3308  C CB    . ARG E 1 69  ? 96.615  140.512 104.332 1.00 71.84  ? 69  ARG E CB    1 
ATOM 3309  C CG    . ARG E 1 69  ? 96.463  141.949 104.745 1.00 71.84  ? 69  ARG E CG    1 
ATOM 3310  C CD    . ARG E 1 69  ? 95.632  142.710 103.734 1.00 71.84  ? 69  ARG E CD    1 
ATOM 3311  N NE    . ARG E 1 69  ? 96.258  142.761 102.420 1.00 71.84  ? 69  ARG E NE    1 
ATOM 3312  C CZ    . ARG E 1 69  ? 97.157  143.669 102.063 1.00 71.84  ? 69  ARG E CZ    1 
ATOM 3313  N NH1   . ARG E 1 69  ? 97.551  144.591 102.928 1.00 71.84  ? 69  ARG E NH1   1 
ATOM 3314  N NH2   . ARG E 1 69  ? 97.671  143.653 100.844 1.00 71.84  ? 69  ARG E NH2   1 
ATOM 3315  N N     . LEU E 1 70  ? 97.990  137.575 104.267 1.00 69.43  ? 70  LEU E N     1 
ATOM 3316  C CA    . LEU E 1 70  ? 97.897  136.172 103.881 1.00 69.43  ? 70  LEU E CA    1 
ATOM 3317  C C     . LEU E 1 70  ? 98.015  135.258 105.085 1.00 69.43  ? 70  LEU E C     1 
ATOM 3318  O O     . LEU E 1 70  ? 97.253  134.292 105.217 1.00 69.43  ? 70  LEU E O     1 
ATOM 3319  C CB    . LEU E 1 70  ? 98.983  135.848 102.866 1.00 69.43  ? 70  LEU E CB    1 
ATOM 3320  C CG    . LEU E 1 70  ? 99.063  134.406 102.385 1.00 69.43  ? 70  LEU E CG    1 
ATOM 3321  C CD1   . LEU E 1 70  ? 97.772  134.005 101.718 1.00 69.43  ? 70  LEU E CD1   1 
ATOM 3322  C CD2   . LEU E 1 70  ? 100.217 134.268 101.416 1.00 69.43  ? 70  LEU E CD2   1 
ATOM 3323  N N     . VAL E 1 71  ? 98.960  135.558 105.975 1.00 73.21  ? 71  VAL E N     1 
ATOM 3324  C CA    . VAL E 1 71  ? 99.143  134.756 107.179 1.00 73.21  ? 71  VAL E CA    1 
ATOM 3325  C C     . VAL E 1 71  ? 97.934  134.888 108.099 1.00 73.21  ? 71  VAL E C     1 
ATOM 3326  O O     . VAL E 1 71  ? 97.492  133.905 108.707 1.00 73.21  ? 71  VAL E O     1 
ATOM 3327  C CB    . VAL E 1 71  ? 100.457 135.164 107.872 1.00 73.21  ? 71  VAL E CB    1 
ATOM 3328  C CG1   . VAL E 1 71  ? 100.608 134.507 109.205 1.00 73.21  ? 71  VAL E CG1   1 
ATOM 3329  C CG2   . VAL E 1 71  ? 101.629 134.784 107.006 1.00 73.21  ? 71  VAL E CG2   1 
ATOM 3330  N N     . ARG E 1 72  ? 97.345  136.085 108.173 1.00 73.15  ? 72  ARG E N     1 
ATOM 3331  C CA    . ARG E 1 72  ? 96.162  136.255 109.012 1.00 73.15  ? 72  ARG E CA    1 
ATOM 3332  C C     . ARG E 1 72  ? 94.958  135.516 108.441 1.00 73.15  ? 72  ARG E C     1 
ATOM 3333  O O     . ARG E 1 72  ? 94.200  134.889 109.189 1.00 73.15  ? 72  ARG E O     1 
ATOM 3334  C CB    . ARG E 1 72  ? 95.848  137.739 109.183 1.00 73.15  ? 72  ARG E CB    1 
ATOM 3335  C CG    . ARG E 1 72  ? 96.887  138.485 109.991 1.00 73.15  ? 72  ARG E CG    1 
ATOM 3336  C CD    . ARG E 1 72  ? 96.617  139.976 110.019 1.00 73.15  ? 72  ARG E CD    1 
ATOM 3337  N NE    . ARG E 1 72  ? 97.729  140.717 110.603 1.00 73.15  ? 72  ARG E NE    1 
ATOM 3338  C CZ    . ARG E 1 72  ? 97.841  140.979 111.897 1.00 73.15  ? 72  ARG E CZ    1 
ATOM 3339  N NH1   . ARG E 1 72  ? 96.908  140.563 112.735 1.00 73.15  ? 72  ARG E NH1   1 
ATOM 3340  N NH2   . ARG E 1 72  ? 98.878  141.653 112.358 1.00 73.15  ? 72  ARG E NH2   1 
ATOM 3341  N N     . GLU E 1 73  ? 94.785  135.545 107.116 1.00 77.93  ? 73  GLU E N     1 
ATOM 3342  C CA    . GLU E 1 73  ? 93.617  134.902 106.522 1.00 77.93  ? 73  GLU E CA    1 
ATOM 3343  C C     . GLU E 1 73  ? 93.728  133.385 106.574 1.00 77.93  ? 73  GLU E C     1 
ATOM 3344  O O     . GLU E 1 73  ? 92.726  132.694 106.794 1.00 77.93  ? 73  GLU E O     1 
ATOM 3345  C CB    . GLU E 1 73  ? 93.411  135.381 105.088 1.00 77.93  ? 73  GLU E CB    1 
ATOM 3346  C CG    . GLU E 1 73  ? 92.170  134.796 104.449 1.00 77.93  ? 73  GLU E CG    1 
ATOM 3347  C CD    . GLU E 1 73  ? 91.855  135.384 103.098 1.00 77.93  ? 73  GLU E CD    1 
ATOM 3348  O OE1   . GLU E 1 73  ? 92.575  136.304 102.664 1.00 77.93  ? 73  GLU E OE1   1 
ATOM 3349  O OE2   . GLU E 1 73  ? 90.887  134.918 102.462 1.00 77.93  ? 73  GLU E OE2   1 
ATOM 3350  N N     . ILE E 1 74  ? 94.937  132.846 106.402 1.00 75.70  ? 74  ILE E N     1 
ATOM 3351  C CA    . ILE E 1 74  ? 95.122  131.419 106.648 1.00 75.70  ? 74  ILE E CA    1 
ATOM 3352  C C     . ILE E 1 74  ? 94.932  131.114 108.129 1.00 75.70  ? 74  ILE E C     1 
ATOM 3353  O O     . ILE E 1 74  ? 94.382  130.068 108.494 1.00 75.70  ? 74  ILE E O     1 
ATOM 3354  C CB    . ILE E 1 74  ? 96.501  130.975 106.121 1.00 75.70  ? 74  ILE E CB    1 
ATOM 3355  C CG1   . ILE E 1 74  ? 96.560  131.145 104.604 1.00 75.70  ? 74  ILE E CG1   1 
ATOM 3356  C CG2   . ILE E 1 74  ? 96.793  129.532 106.452 1.00 75.70  ? 74  ILE E CG2   1 
ATOM 3357  C CD1   . ILE E 1 74  ? 97.947  131.003 104.020 1.00 75.70  ? 74  ILE E CD1   1 
ATOM 3358  N N     . ALA E 1 75  ? 95.280  132.061 108.997 1.00 79.07  ? 75  ALA E N     1 
ATOM 3359  C CA    . ALA E 1 75  ? 95.182  131.836 110.431 1.00 79.07  ? 75  ALA E CA    1 
ATOM 3360  C C     . ALA E 1 75  ? 93.753  131.885 110.951 1.00 79.07  ? 75  ALA E C     1 
ATOM 3361  O O     . ALA E 1 75  ? 93.492  131.354 112.036 1.00 79.07  ? 75  ALA E O     1 
ATOM 3362  C CB    . ALA E 1 75  ? 96.026  132.863 111.177 1.00 79.07  ? 75  ALA E CB    1 
ATOM 3363  N N     . GLN E 1 76  ? 92.825  132.508 110.219 1.00 81.34  ? 76  GLN E N     1 
ATOM 3364  C CA    . GLN E 1 76  ? 91.457  132.620 110.719 1.00 81.34  ? 76  GLN E CA    1 
ATOM 3365  C C     . GLN E 1 76  ? 90.712  131.297 110.718 1.00 81.34  ? 76  GLN E C     1 
ATOM 3366  O O     . GLN E 1 76  ? 89.702  131.175 111.417 1.00 81.34  ? 76  GLN E O     1 
ATOM 3367  C CB    . GLN E 1 76  ? 90.651  133.623 109.902 1.00 81.34  ? 76  GLN E CB    1 
ATOM 3368  C CG    . GLN E 1 76  ? 91.035  135.062 110.100 1.00 81.34  ? 76  GLN E CG    1 
ATOM 3369  C CD    . GLN E 1 76  ? 90.127  135.988 109.328 1.00 81.34  ? 76  GLN E CD    1 
ATOM 3370  O OE1   . GLN E 1 76  ? 89.243  135.538 108.599 1.00 81.34  ? 76  GLN E OE1   1 
ATOM 3371  N NE2   . GLN E 1 76  ? 90.331  137.288 109.489 1.00 81.34  ? 76  GLN E NE2   1 
ATOM 3372  N N     . ASP E 1 77  ? 91.178  130.312 109.954 1.00 80.82  ? 77  ASP E N     1 
ATOM 3373  C CA    . ASP E 1 77  ? 90.414  129.081 109.801 1.00 80.82  ? 77  ASP E CA    1 
ATOM 3374  C C     . ASP E 1 77  ? 90.479  128.222 111.053 1.00 80.82  ? 77  ASP E C     1 
ATOM 3375  O O     . ASP E 1 77  ? 89.467  127.648 111.470 1.00 80.82  ? 77  ASP E O     1 
ATOM 3376  C CB    . ASP E 1 77  ? 90.924  128.298 108.596 1.00 80.82  ? 77  ASP E CB    1 
ATOM 3377  C CG    . ASP E 1 77  ? 90.641  129.000 107.291 1.00 80.82  ? 77  ASP E CG    1 
ATOM 3378  O OD1   . ASP E 1 77  ? 89.680  129.794 107.239 1.00 80.82  ? 77  ASP E OD1   1 
ATOM 3379  O OD2   . ASP E 1 77  ? 91.366  128.746 106.309 1.00 80.82  ? 77  ASP E OD2   1 
ATOM 3380  N N     . PHE E 1 78  ? 91.652  128.120 111.668 1.00 79.82  ? 78  PHE E N     1 
ATOM 3381  C CA    . PHE E 1 78  ? 91.788  127.225 112.804 1.00 79.82  ? 78  PHE E CA    1 
ATOM 3382  C C     . PHE E 1 78  ? 91.203  127.833 114.063 1.00 79.82  ? 78  PHE E C     1 
ATOM 3383  O O     . PHE E 1 78  ? 90.647  127.110 114.895 1.00 79.82  ? 78  PHE E O     1 
ATOM 3384  C CB    . PHE E 1 78  ? 93.253  126.876 113.019 1.00 79.82  ? 78  PHE E CB    1 
ATOM 3385  C CG    . PHE E 1 78  ? 93.912  126.339 111.797 1.00 79.82  ? 78  PHE E CG    1 
ATOM 3386  C CD1   . PHE E 1 78  ? 93.598  125.082 111.324 1.00 79.82  ? 78  PHE E CD1   1 
ATOM 3387  C CD2   . PHE E 1 78  ? 94.851  127.090 111.118 1.00 79.82  ? 78  PHE E CD2   1 
ATOM 3388  C CE1   . PHE E 1 78  ? 94.198  124.594 110.188 1.00 79.82  ? 78  PHE E CE1   1 
ATOM 3389  C CE2   . PHE E 1 78  ? 95.458  126.600 109.988 1.00 79.82  ? 78  PHE E CE2   1 
ATOM 3390  C CZ    . PHE E 1 78  ? 95.134  125.350 109.526 1.00 79.82  ? 78  PHE E CZ    1 
ATOM 3391  N N     . LYS E 1 79  ? 91.301  129.149 114.204 1.00 79.99  ? 79  LYS E N     1 
ATOM 3392  C CA    . LYS E 1 79  ? 90.755  129.848 115.353 1.00 79.99  ? 79  LYS E CA    1 
ATOM 3393  C C     . LYS E 1 79  ? 90.578  131.296 114.919 1.00 79.99  ? 79  LYS E C     1 
ATOM 3394  O O     . LYS E 1 79  ? 91.214  131.750 113.966 1.00 79.99  ? 79  LYS E O     1 
ATOM 3395  C CB    . LYS E 1 79  ? 91.674  129.686 116.571 1.00 79.99  ? 79  LYS E CB    1 
ATOM 3396  C CG    . LYS E 1 79  ? 91.065  130.044 117.901 1.00 79.99  ? 79  LYS E CG    1 
ATOM 3397  C CD    . LYS E 1 79  ? 91.521  131.388 118.366 1.00 79.99  ? 79  LYS E CD    1 
ATOM 3398  C CE    . LYS E 1 79  ? 92.974  131.339 118.762 1.00 79.99  ? 79  LYS E CE    1 
ATOM 3399  N NZ    . LYS E 1 79  ? 93.434  132.667 119.239 1.00 79.99  ? 79  LYS E NZ    1 
ATOM 3400  N N     . THR E 1 80  ? 89.675  132.004 115.587 1.00 81.37  ? 80  THR E N     1 
ATOM 3401  C CA    . THR E 1 80  ? 89.268  133.331 115.153 1.00 81.37  ? 80  THR E CA    1 
ATOM 3402  C C     . THR E 1 80  ? 89.791  134.398 116.106 1.00 81.37  ? 80  THR E C     1 
ATOM 3403  O O     . THR E 1 80  ? 90.185  134.102 117.237 1.00 81.37  ? 80  THR E O     1 
ATOM 3404  C CB    . THR E 1 80  ? 87.744  133.422 115.061 1.00 81.37  ? 80  THR E CB    1 
ATOM 3405  O OG1   . THR E 1 80  ? 87.177  133.261 116.366 1.00 81.37  ? 80  THR E OG1   1 
ATOM 3406  C CG2   . THR E 1 80  ? 87.214  132.321 114.165 1.00 81.37  ? 80  THR E CG2   1 
ATOM 3407  N N     . ASP E 1 81  ? 89.791  135.644 115.616 1.00 82.93  ? 81  ASP E N     1 
ATOM 3408  C CA    . ASP E 1 81  ? 90.083  136.854 116.393 1.00 82.93  ? 81  ASP E CA    1 
ATOM 3409  C C     . ASP E 1 81  ? 91.492  136.798 116.999 1.00 82.93  ? 81  ASP E C     1 
ATOM 3410  O O     . ASP E 1 81  ? 91.686  136.703 118.209 1.00 82.93  ? 81  ASP E O     1 
ATOM 3411  C CB    . ASP E 1 81  ? 89.003  137.067 117.462 1.00 82.93  ? 81  ASP E CB    1 
ATOM 3412  C CG    . ASP E 1 81  ? 89.112  138.403 118.148 1.00 82.93  ? 81  ASP E CG    1 
ATOM 3413  O OD1   . ASP E 1 81  ? 88.754  139.419 117.520 1.00 82.93  ? 81  ASP E OD1   1 
ATOM 3414  O OD2   . ASP E 1 81  ? 89.549  138.437 119.317 1.00 82.93  ? 81  ASP E OD2   1 
ATOM 3415  N N     . LEU E 1 82  ? 92.475  136.825 116.108 1.00 79.76  ? 82  LEU E N     1 
ATOM 3416  C CA    . LEU E 1 82  ? 93.865  136.587 116.474 1.00 79.76  ? 82  LEU E CA    1 
ATOM 3417  C C     . LEU E 1 82  ? 94.649  137.879 116.630 1.00 79.76  ? 82  LEU E C     1 
ATOM 3418  O O     . LEU E 1 82  ? 94.181  138.971 116.304 1.00 79.76  ? 82  LEU E O     1 
ATOM 3419  C CB    . LEU E 1 82  ? 94.564  135.713 115.434 1.00 79.76  ? 82  LEU E CB    1 
ATOM 3420  C CG    . LEU E 1 82  ? 94.642  134.220 115.707 1.00 79.76  ? 82  LEU E CG    1 
ATOM 3421  C CD1   . LEU E 1 82  ? 95.473  134.010 116.952 1.00 79.76  ? 82  LEU E CD1   1 
ATOM 3422  C CD2   . LEU E 1 82  ? 93.272  133.603 115.860 1.00 79.76  ? 82  LEU E CD2   1 
ATOM 3423  N N     . ARG E 1 83  ? 95.883  137.719 117.109 1.00 78.32  ? 83  ARG E N     1 
ATOM 3424  C CA    . ARG E 1 83  ? 96.857  138.792 117.243 1.00 78.32  ? 83  ARG E CA    1 
ATOM 3425  C C     . ARG E 1 83  ? 98.249  138.218 117.023 1.00 78.32  ? 83  ARG E C     1 
ATOM 3426  O O     . ARG E 1 83  ? 98.576  137.156 117.556 1.00 78.32  ? 83  ARG E O     1 
ATOM 3427  C CB    . ARG E 1 83  ? 96.777  139.472 118.617 1.00 78.32  ? 83  ARG E CB    1 
ATOM 3428  C CG    . ARG E 1 83  ? 95.604  140.433 118.784 1.00 78.32  ? 83  ARG E CG    1 
ATOM 3429  C CD    . ARG E 1 83  ? 95.487  141.027 120.175 1.00 78.32  ? 83  ARG E CD    1 
ATOM 3430  N NE    . ARG E 1 83  ? 94.333  141.916 120.251 1.00 78.32  ? 83  ARG E NE    1 
ATOM 3431  C CZ    . ARG E 1 83  ? 93.098  141.513 120.534 1.00 78.32  ? 83  ARG E CZ    1 
ATOM 3432  N NH1   . ARG E 1 83  ? 92.844  140.234 120.768 1.00 78.32  ? 83  ARG E NH1   1 
ATOM 3433  N NH2   . ARG E 1 83  ? 92.107  142.390 120.575 1.00 78.32  ? 83  ARG E NH2   1 
ATOM 3434  N N     . PHE E 1 84  ? 99.065  138.931 116.248 1.00 72.86  ? 84  PHE E N     1 
ATOM 3435  C CA    . PHE E 1 84  ? 100.405 138.501 115.862 1.00 72.86  ? 84  PHE E CA    1 
ATOM 3436  C C     . PHE E 1 84  ? 101.462 139.481 116.335 1.00 72.86  ? 84  PHE E C     1 
ATOM 3437  O O     . PHE E 1 84  ? 101.288 140.691 116.208 1.00 72.86  ? 84  PHE E O     1 
ATOM 3438  C CB    . PHE E 1 84  ? 100.518 138.384 114.351 1.00 72.86  ? 84  PHE E CB    1 
ATOM 3439  C CG    . PHE E 1 84  ? 99.956  137.128 113.802 1.00 72.86  ? 84  PHE E CG    1 
ATOM 3440  C CD1   . PHE E 1 84  ? 99.910  135.985 114.569 1.00 72.86  ? 84  PHE E CD1   1 
ATOM 3441  C CD2   . PHE E 1 84  ? 99.438  137.093 112.527 1.00 72.86  ? 84  PHE E CD2   1 
ATOM 3442  C CE1   . PHE E 1 84  ? 99.392  134.815 114.063 1.00 72.86  ? 84  PHE E CE1   1 
ATOM 3443  C CE2   . PHE E 1 84  ? 98.907  135.931 112.018 1.00 72.86  ? 84  PHE E CE2   1 
ATOM 3444  C CZ    . PHE E 1 84  ? 98.889  134.788 112.787 1.00 72.86  ? 84  PHE E CZ    1 
ATOM 3445  N N     . GLN E 1 85  ? 102.578 138.966 116.839 1.00 69.76  ? 85  GLN E N     1 
ATOM 3446  C CA    . GLN E 1 85  ? 103.768 139.799 116.894 1.00 69.76  ? 85  GLN E CA    1 
ATOM 3447  C C     . GLN E 1 85  ? 104.293 140.011 115.483 1.00 69.76  ? 85  GLN E C     1 
ATOM 3448  O O     . GLN E 1 85  ? 104.044 139.209 114.582 1.00 69.76  ? 85  GLN E O     1 
ATOM 3449  C CB    . GLN E 1 85  ? 104.852 139.167 117.760 1.00 69.76  ? 85  GLN E CB    1 
ATOM 3450  C CG    . GLN E 1 85  ? 104.566 139.178 119.242 1.00 69.76  ? 85  GLN E CG    1 
ATOM 3451  C CD    . GLN E 1 85  ? 105.718 138.609 120.043 1.00 69.76  ? 85  GLN E CD    1 
ATOM 3452  O OE1   . GLN E 1 85  ? 106.698 138.147 119.473 1.00 69.76  ? 85  GLN E OE1   1 
ATOM 3453  N NE2   . GLN E 1 85  ? 105.610 138.644 121.366 1.00 69.76  ? 85  GLN E NE2   1 
ATOM 3454  N N     . SER E 1 86  ? 105.018 141.111 115.286 1.00 67.31  ? 86  SER E N     1 
ATOM 3455  C CA    . SER E 1 86  ? 105.499 141.436 113.947 1.00 67.31  ? 86  SER E CA    1 
ATOM 3456  C C     . SER E 1 86  ? 106.635 140.511 113.524 1.00 67.31  ? 86  SER E C     1 
ATOM 3457  O O     . SER E 1 86  ? 106.673 140.033 112.378 1.00 67.31  ? 86  SER E O     1 
ATOM 3458  C CB    . SER E 1 86  ? 105.949 142.891 113.901 1.00 67.31  ? 86  SER E CB    1 
ATOM 3459  O OG    . SER E 1 86  ? 107.088 143.082 114.713 1.00 67.31  ? 86  SER E OG    1 
ATOM 3460  N N     . SER E 1 87  ? 107.559 140.232 114.445 1.00 69.79  ? 87  SER E N     1 
ATOM 3461  C CA    . SER E 1 87  ? 108.703 139.387 114.139 1.00 69.79  ? 87  SER E CA    1 
ATOM 3462  C C     . SER E 1 87  ? 108.302 137.948 113.855 1.00 69.79  ? 87  SER E C     1 
ATOM 3463  O O     . SER E 1 87  ? 109.051 137.233 113.186 1.00 69.79  ? 87  SER E O     1 
ATOM 3464  C CB    . SER E 1 87  ? 109.704 139.432 115.289 1.00 69.79  ? 87  SER E CB    1 
ATOM 3465  O OG    . SER E 1 87  ? 109.159 138.842 116.451 1.00 69.79  ? 87  SER E OG    1 
ATOM 3466  N N     . ALA E 1 88  ? 107.143 137.510 114.344 1.00 67.53  ? 88  ALA E N     1 
ATOM 3467  C CA    . ALA E 1 88  ? 106.636 136.202 113.957 1.00 67.53  ? 88  ALA E CA    1 
ATOM 3468  C C     . ALA E 1 88  ? 106.225 136.192 112.495 1.00 67.53  ? 88  ALA E C     1 
ATOM 3469  O O     . ALA E 1 88  ? 106.406 135.187 111.801 1.00 67.53  ? 88  ALA E O     1 
ATOM 3470  C CB    . ALA E 1 88  ? 105.462 135.812 114.845 1.00 67.53  ? 88  ALA E CB    1 
ATOM 3471  N N     . VAL E 1 89  ? 105.688 137.308 112.005 1.00 67.86  ? 89  VAL E N     1 
ATOM 3472  C CA    . VAL E 1 89  ? 105.374 137.401 110.588 1.00 67.86  ? 89  VAL E CA    1 
ATOM 3473  C C     . VAL E 1 89  ? 106.660 137.430 109.778 1.00 67.86  ? 89  VAL E C     1 
ATOM 3474  O O     . VAL E 1 89  ? 106.730 136.848 108.682 1.00 67.86  ? 89  VAL E O     1 
ATOM 3475  C CB    . VAL E 1 89  ? 104.485 138.631 110.338 1.00 67.86  ? 89  VAL E CB    1 
ATOM 3476  C CG1   . VAL E 1 89  ? 104.137 138.781 108.875 1.00 67.86  ? 89  VAL E CG1   1 
ATOM 3477  C CG2   . VAL E 1 89  ? 103.229 138.517 111.156 1.00 67.86  ? 89  VAL E CG2   1 
ATOM 3478  N N     . MET E 1 90  ? 107.711 138.055 110.324 1.00 67.74  ? 90  MET E N     1 
ATOM 3479  C CA    . MET E 1 90  ? 109.038 137.931 109.723 1.00 67.74  ? 90  MET E CA    1 
ATOM 3480  C C     . MET E 1 90  ? 109.509 136.482 109.693 1.00 67.74  ? 90  MET E C     1 
ATOM 3481  O O     . MET E 1 90  ? 110.135 136.044 108.720 1.00 67.74  ? 90  MET E O     1 
ATOM 3482  C CB    . MET E 1 90  ? 110.042 138.785 110.487 1.00 67.74  ? 90  MET E CB    1 
ATOM 3483  C CG    . MET E 1 90  ? 109.927 140.258 110.253 1.00 67.74  ? 90  MET E CG    1 
ATOM 3484  S SD    . MET E 1 90  ? 110.409 140.611 108.569 1.00 67.74  ? 90  MET E SD    1 
ATOM 3485  C CE    . MET E 1 90  ? 112.151 140.201 108.674 1.00 67.74  ? 90  MET E CE    1 
ATOM 3486  N N     . ALA E 1 91  ? 109.191 135.718 110.737 1.00 67.90  ? 91  ALA E N     1 
ATOM 3487  C CA    . ALA E 1 91  ? 109.689 134.352 110.833 1.00 67.90  ? 91  ALA E CA    1 
ATOM 3488  C C     . ALA E 1 91  ? 108.993 133.440 109.839 1.00 67.90  ? 91  ALA E C     1 
ATOM 3489  O O     . ALA E 1 91  ? 109.645 132.619 109.179 1.00 67.90  ? 91  ALA E O     1 
ATOM 3490  C CB    . ALA E 1 91  ? 109.511 133.828 112.252 1.00 67.90  ? 91  ALA E CB    1 
ATOM 3491  N N     . LEU E 1 92  ? 107.678 133.585 109.700 1.00 66.36  ? 92  LEU E N     1 
ATOM 3492  C CA    . LEU E 1 92  ? 106.975 132.851 108.659 1.00 66.36  ? 92  LEU E CA    1 
ATOM 3493  C C     . LEU E 1 92  ? 107.400 133.296 107.271 1.00 66.36  ? 92  LEU E C     1 
ATOM 3494  O O     . LEU E 1 92  ? 107.356 132.496 106.327 1.00 66.36  ? 92  LEU E O     1 
ATOM 3495  C CB    . LEU E 1 92  ? 105.473 133.005 108.818 1.00 66.36  ? 92  LEU E CB    1 
ATOM 3496  C CG    . LEU E 1 92  ? 104.793 131.974 109.713 1.00 66.36  ? 92  LEU E CG    1 
ATOM 3497  C CD1   . LEU E 1 92  ? 105.025 132.212 111.160 1.00 66.36  ? 92  LEU E CD1   1 
ATOM 3498  C CD2   . LEU E 1 92  ? 103.337 132.005 109.427 1.00 66.36  ? 92  LEU E CD2   1 
ATOM 3499  N N     . GLN E 1 93  ? 107.822 134.553 107.130 1.00 67.71  ? 93  GLN E N     1 
ATOM 3500  C CA    . GLN E 1 93  ? 108.398 134.983 105.865 1.00 67.71  ? 93  GLN E CA    1 
ATOM 3501  C C     . GLN E 1 93  ? 109.708 134.266 105.583 1.00 67.71  ? 93  GLN E C     1 
ATOM 3502  O O     . GLN E 1 93  ? 109.992 133.919 104.425 1.00 67.71  ? 93  GLN E O     1 
ATOM 3503  C CB    . GLN E 1 93  ? 108.577 136.494 105.886 1.00 67.71  ? 93  GLN E CB    1 
ATOM 3504  C CG    . GLN E 1 93  ? 108.969 137.109 104.586 1.00 67.71  ? 93  GLN E CG    1 
ATOM 3505  C CD    . GLN E 1 93  ? 108.939 138.610 104.669 1.00 67.71  ? 93  GLN E CD    1 
ATOM 3506  O OE1   . GLN E 1 93  ? 108.651 139.177 105.720 1.00 67.71  ? 93  GLN E OE1   1 
ATOM 3507  N NE2   . GLN E 1 93  ? 109.228 139.267 103.560 1.00 67.71  ? 93  GLN E NE2   1 
ATOM 3508  N N     . GLU E 1 94  ? 110.483 133.981 106.630 1.00 62.73  ? 94  GLU E N     1 
ATOM 3509  C CA    . GLU E 1 94  ? 111.724 133.250 106.424 1.00 62.73  ? 94  GLU E CA    1 
ATOM 3510  C C     . GLU E 1 94  ? 111.463 131.797 106.071 1.00 62.73  ? 94  GLU E C     1 
ATOM 3511  O O     . GLU E 1 94  ? 112.186 131.212 105.259 1.00 62.73  ? 94  GLU E O     1 
ATOM 3512  C CB    . GLU E 1 94  ? 112.606 133.329 107.659 1.00 62.73  ? 94  GLU E CB    1 
ATOM 3513  C CG    . GLU E 1 94  ? 113.052 134.714 108.035 1.00 62.73  ? 94  GLU E CG    1 
ATOM 3514  C CD    . GLU E 1 94  ? 113.945 135.366 107.008 1.00 62.73  ? 94  GLU E CD    1 
ATOM 3515  O OE1   . GLU E 1 94  ? 114.655 134.668 106.258 1.00 62.73  ? 94  GLU E OE1   1 
ATOM 3516  O OE2   . GLU E 1 94  ? 113.963 136.602 106.977 1.00 62.73  ? 94  GLU E OE2   1 
ATOM 3517  N N     . ALA E 1 95  ? 110.445 131.190 106.677 1.00 63.25  ? 95  ALA E N     1 
ATOM 3518  C CA    . ALA E 1 95  ? 110.131 129.815 106.314 1.00 63.25  ? 95  ALA E CA    1 
ATOM 3519  C C     . ALA E 1 95  ? 109.579 129.728 104.907 1.00 63.25  ? 95  ALA E C     1 
ATOM 3520  O O     . ALA E 1 95  ? 109.833 128.743 104.201 1.00 63.25  ? 95  ALA E O     1 
ATOM 3521  C CB    . ALA E 1 95  ? 109.134 129.224 107.298 1.00 63.25  ? 95  ALA E CB    1 
ATOM 3522  N N     . SER E 1 96  ? 108.847 130.756 104.483 1.00 63.41  ? 96  SER E N     1 
ATOM 3523  C CA    . SER E 1 96  ? 108.328 130.801 103.123 1.00 63.41  ? 96  SER E CA    1 
ATOM 3524  C C     . SER E 1 96  ? 109.454 130.898 102.106 1.00 63.41  ? 96  SER E C     1 
ATOM 3525  O O     . SER E 1 96  ? 109.471 130.154 101.117 1.00 63.41  ? 96  SER E O     1 
ATOM 3526  C CB    . SER E 1 96  ? 107.385 131.985 102.983 1.00 63.41  ? 96  SER E CB    1 
ATOM 3527  O OG    . SER E 1 96  ? 106.318 131.861 103.901 1.00 63.41  ? 96  SER E OG    1 
ATOM 3528  N N     . GLU E 1 97  ? 110.413 131.797 102.343 1.00 61.38  ? 97  GLU E N     1 
ATOM 3529  C CA    . GLU E 1 97  ? 111.502 131.934 101.385 1.00 61.38  ? 97  GLU E CA    1 
ATOM 3530  C C     . GLU E 1 97  ? 112.420 130.716 101.397 1.00 61.38  ? 97  GLU E C     1 
ATOM 3531  O O     . GLU E 1 97  ? 112.902 130.298 100.342 1.00 61.38  ? 97  GLU E O     1 
ATOM 3532  C CB    . GLU E 1 97  ? 112.284 133.225 101.633 1.00 61.38  ? 97  GLU E CB    1 
ATOM 3533  C CG    . GLU E 1 97  ? 112.961 133.381 102.975 1.00 61.38  ? 97  GLU E CG    1 
ATOM 3534  C CD    . GLU E 1 97  ? 114.354 132.798 103.007 1.00 61.38  ? 97  GLU E CD    1 
ATOM 3535  O OE1   . GLU E 1 97  ? 114.926 132.584 101.923 1.00 61.38  ? 97  GLU E OE1   1 
ATOM 3536  O OE2   . GLU E 1 97  ? 114.871 132.543 104.108 1.00 61.38  ? 97  GLU E OE2   1 
ATOM 3537  N N     . ALA E 1 98  ? 112.649 130.114 102.565 1.00 58.75  ? 98  ALA E N     1 
ATOM 3538  C CA    . ALA E 1 98  ? 113.539 128.957 102.628 1.00 58.75  ? 98  ALA E CA    1 
ATOM 3539  C C     . ALA E 1 98  ? 112.925 127.751 101.945 1.00 58.75  ? 98  ALA E C     1 
ATOM 3540  O O     . ALA E 1 98  ? 113.590 127.061 101.162 1.00 58.75  ? 98  ALA E O     1 
ATOM 3541  C CB    . ALA E 1 98  ? 113.857 128.615 104.076 1.00 58.75  ? 98  ALA E CB    1 
ATOM 3542  N N     . TYR E 1 99  ? 111.646 127.509 102.205 1.00 60.03  ? 99  TYR E N     1 
ATOM 3543  C CA    . TYR E 1 99  ? 111.013 126.328 101.653 1.00 60.03  ? 99  TYR E CA    1 
ATOM 3544  C C     . TYR E 1 99  ? 110.739 126.484 100.164 1.00 60.03  ? 99  TYR E C     1 
ATOM 3545  O O     . TYR E 1 99  ? 110.951 125.536 99.394  1.00 60.03  ? 99  TYR E O     1 
ATOM 3546  C CB    . TYR E 1 99  ? 109.738 126.032 102.421 1.00 60.03  ? 99  TYR E CB    1 
ATOM 3547  C CG    . TYR E 1 99  ? 108.961 124.901 101.846 1.00 60.03  ? 99  TYR E CG    1 
ATOM 3548  C CD1   . TYR E 1 99  ? 109.409 123.599 101.951 1.00 60.03  ? 99  TYR E CD1   1 
ATOM 3549  C CD2   . TYR E 1 99  ? 107.766 125.136 101.199 1.00 60.03  ? 99  TYR E CD2   1 
ATOM 3550  C CE1   . TYR E 1 99  ? 108.682 122.557 101.417 1.00 60.03  ? 99  TYR E CE1   1 
ATOM 3551  C CE2   . TYR E 1 99  ? 107.037 124.110 100.663 1.00 60.03  ? 99  TYR E CE2   1 
ATOM 3552  C CZ    . TYR E 1 99  ? 107.494 122.825 100.772 1.00 60.03  ? 99  TYR E CZ    1 
ATOM 3553  O OH    . TYR E 1 99  ? 106.734 121.828 100.226 1.00 60.03  ? 99  TYR E OH    1 
ATOM 3554  N N     . LEU E 1 100 ? 110.293 127.670 99.726  1.00 56.85  ? 100 LEU E N     1 
ATOM 3555  C CA    . LEU E 1 100 ? 110.073 127.856 98.294  1.00 56.85  ? 100 LEU E CA    1 
ATOM 3556  C C     . LEU E 1 100 ? 111.388 127.855 97.529  1.00 56.85  ? 100 LEU E C     1 
ATOM 3557  O O     . LEU E 1 100 ? 111.509 127.171 96.507  1.00 56.85  ? 100 LEU E O     1 
ATOM 3558  C CB    . LEU E 1 100 ? 109.302 129.141 98.005  1.00 56.85  ? 100 LEU E CB    1 
ATOM 3559  C CG    . LEU E 1 100 ? 107.827 129.180 98.372  1.00 56.85  ? 100 LEU E CG    1 
ATOM 3560  C CD1   . LEU E 1 100 ? 107.234 130.515 97.991  1.00 56.85  ? 100 LEU E CD1   1 
ATOM 3561  C CD2   . LEU E 1 100 ? 107.079 128.050 97.717  1.00 56.85  ? 100 LEU E CD2   1 
ATOM 3562  N N     . VAL E 1 101 ? 112.385 128.598 98.025  1.00 53.81  ? 101 VAL E N     1 
ATOM 3563  C CA    . VAL E 1 101 ? 113.673 128.717 97.345  1.00 53.81  ? 101 VAL E CA    1 
ATOM 3564  C C     . VAL E 1 101 ? 114.364 127.363 97.231  1.00 53.81  ? 101 VAL E C     1 
ATOM 3565  O O     . VAL E 1 101 ? 114.856 126.996 96.155  1.00 53.81  ? 101 VAL E O     1 
ATOM 3566  C CB    . VAL E 1 101 ? 114.544 129.767 98.059  1.00 53.81  ? 101 VAL E CB    1 
ATOM 3567  C CG1   . VAL E 1 101 ? 116.010 129.551 97.781  1.00 53.81  ? 101 VAL E CG1   1 
ATOM 3568  C CG2   . VAL E 1 101 ? 114.182 131.139 97.541  1.00 53.81  ? 101 VAL E CG2   1 
ATOM 3569  N N     . ALA E 1 102 ? 114.349 126.575 98.307  1.00 53.60  ? 102 ALA E N     1 
ATOM 3570  C CA    . ALA E 1 102 ? 114.924 125.237 98.227  1.00 53.60  ? 102 ALA E CA    1 
ATOM 3571  C C     . ALA E 1 102 ? 114.122 124.343 97.295  1.00 53.60  ? 102 ALA E C     1 
ATOM 3572  O O     . ALA E 1 102 ? 114.698 123.498 96.590  1.00 53.60  ? 102 ALA E O     1 
ATOM 3573  C CB    . ALA E 1 102 ? 115.011 124.621 99.620  1.00 53.60  ? 102 ALA E CB    1 
ATOM 3574  N N     . LEU E 1 103 ? 112.807 124.553 97.234  1.00 55.18  ? 103 LEU E N     1 
ATOM 3575  C CA    . LEU E 1 103 ? 112.009 123.792 96.287  1.00 55.18  ? 103 LEU E CA    1 
ATOM 3576  C C     . LEU E 1 103 ? 112.328 124.172 94.839  1.00 55.18  ? 103 LEU E C     1 
ATOM 3577  O O     . LEU E 1 103 ? 112.203 123.328 93.944  1.00 55.18  ? 103 LEU E O     1 
ATOM 3578  C CB    . LEU E 1 103 ? 110.530 123.970 96.612  1.00 55.18  ? 103 LEU E CB    1 
ATOM 3579  C CG    . LEU E 1 103 ? 109.500 123.049 95.971  1.00 55.18  ? 103 LEU E CG    1 
ATOM 3580  C CD1   . LEU E 1 103 ? 108.412 122.786 96.981  1.00 55.18  ? 103 LEU E CD1   1 
ATOM 3581  C CD2   . LEU E 1 103 ? 108.889 123.670 94.732  1.00 55.18  ? 103 LEU E CD2   1 
ATOM 3582  N N     . PHE E 1 104 ? 112.781 125.407 94.582  1.00 54.56  ? 104 PHE E N     1 
ATOM 3583  C CA    . PHE E 1 104 ? 113.223 125.722 93.224  1.00 54.56  ? 104 PHE E CA    1 
ATOM 3584  C C     . PHE E 1 104 ? 114.637 125.238 92.951  1.00 54.56  ? 104 PHE E C     1 
ATOM 3585  O O     . PHE E 1 104 ? 115.005 125.074 91.783  1.00 54.56  ? 104 PHE E O     1 
ATOM 3586  C CB    . PHE E 1 104 ? 113.169 127.218 92.933  1.00 54.56  ? 104 PHE E CB    1 
ATOM 3587  C CG    . PHE E 1 104 ? 111.801 127.788 92.958  1.00 54.56  ? 104 PHE E CG    1 
ATOM 3588  C CD1   . PHE E 1 104 ? 110.870 127.404 92.027  1.00 54.56  ? 104 PHE E CD1   1 
ATOM 3589  C CD2   . PHE E 1 104 ? 111.475 128.780 93.857  1.00 54.56  ? 104 PHE E CD2   1 
ATOM 3590  C CE1   . PHE E 1 104 ? 109.609 127.942 92.040  1.00 54.56  ? 104 PHE E CE1   1 
ATOM 3591  C CE2   . PHE E 1 104 ? 110.219 129.324 93.877  1.00 54.56  ? 104 PHE E CE2   1 
ATOM 3592  C CZ    . PHE E 1 104 ? 109.286 128.910 92.962  1.00 54.56  ? 104 PHE E CZ    1 
ATOM 3593  N N     . GLU E 1 105 ? 115.455 125.069 93.995  1.00 53.80  ? 105 GLU E N     1 
ATOM 3594  C CA    . GLU E 1 105 ? 116.740 124.399 93.821  1.00 53.80  ? 105 GLU E CA    1 
ATOM 3595  C C     . GLU E 1 105 ? 116.530 122.994 93.282  1.00 53.80  ? 105 GLU E C     1 
ATOM 3596  O O     . GLU E 1 105 ? 117.039 122.634 92.209  1.00 53.80  ? 105 GLU E O     1 
ATOM 3597  C CB    . GLU E 1 105 ? 117.489 124.329 95.152  1.00 53.80  ? 105 GLU E CB    1 
ATOM 3598  C CG    . GLU E 1 105 ? 117.796 125.651 95.815  1.00 53.80  ? 105 GLU E CG    1 
ATOM 3599  C CD    . GLU E 1 105 ? 118.868 126.444 95.115  1.00 53.80  ? 105 GLU E CD    1 
ATOM 3600  O OE1   . GLU E 1 105 ? 119.787 125.830 94.537  1.00 53.80  ? 105 GLU E OE1   1 
ATOM 3601  O OE2   . GLU E 1 105 ? 118.795 127.687 95.154  1.00 53.80  ? 105 GLU E OE2   1 
ATOM 3602  N N     . ASP E 1 106 ? 115.718 122.208 93.989  1.00 56.70  ? 106 ASP E N     1 
ATOM 3603  C CA    . ASP E 1 106 ? 115.532 120.823 93.582  1.00 56.70  ? 106 ASP E CA    1 
ATOM 3604  C C     . ASP E 1 106 ? 114.683 120.708 92.322  1.00 56.70  ? 106 ASP E C     1 
ATOM 3605  O O     . ASP E 1 106 ? 114.892 119.787 91.522  1.00 56.70  ? 106 ASP E O     1 
ATOM 3606  C CB    . ASP E 1 106 ? 114.914 120.027 94.723  1.00 56.70  ? 106 ASP E CB    1 
ATOM 3607  C CG    . ASP E 1 106 ? 115.856 119.884 95.895  1.00 56.70  ? 106 ASP E CG    1 
ATOM 3608  O OD1   . ASP E 1 106 ? 117.080 119.930 95.662  1.00 56.70  ? 106 ASP E OD1   1 
ATOM 3609  O OD2   . ASP E 1 106 ? 115.387 119.724 97.045  1.00 56.70  ? 106 ASP E OD2   1 
ATOM 3610  N N     . THR E 1 107 ? 113.745 121.636 92.118  1.00 55.98  ? 107 THR E N     1 
ATOM 3611  C CA    . THR E 1 107 ? 112.960 121.634 90.886  1.00 55.98  ? 107 THR E CA    1 
ATOM 3612  C C     . THR E 1 107 ? 113.831 121.973 89.685  1.00 55.98  ? 107 THR E C     1 
ATOM 3613  O O     . THR E 1 107 ? 113.670 121.399 88.598  1.00 55.98  ? 107 THR E O     1 
ATOM 3614  C CB    . THR E 1 107 ? 111.812 122.627 91.009  1.00 55.98  ? 107 THR E CB    1 
ATOM 3615  O OG1   . THR E 1 107 ? 111.056 122.324 92.182  1.00 55.98  ? 107 THR E OG1   1 
ATOM 3616  C CG2   . THR E 1 107 ? 110.890 122.539 89.818  1.00 55.98  ? 107 THR E CG2   1 
ATOM 3617  N N     . ASN E 1 108 ? 114.787 122.879 89.883  1.00 54.03  ? 108 ASN E N     1 
ATOM 3618  C CA    . ASN E 1 108 ? 115.689 123.265 88.808  1.00 54.03  ? 108 ASN E CA    1 
ATOM 3619  C C     . ASN E 1 108 ? 116.624 122.124 88.444  1.00 54.03  ? 108 ASN E C     1 
ATOM 3620  O O     . ASN E 1 108 ? 116.899 121.898 87.261  1.00 54.03  ? 108 ASN E O     1 
ATOM 3621  C CB    . ASN E 1 108 ? 116.486 124.490 89.229  1.00 54.03  ? 108 ASN E CB    1 
ATOM 3622  C CG    . ASN E 1 108 ? 117.152 125.166 88.077  1.00 54.03  ? 108 ASN E CG    1 
ATOM 3623  O OD1   . ASN E 1 108 ? 116.996 124.764 86.929  1.00 54.03  ? 108 ASN E OD1   1 
ATOM 3624  N ND2   . ASN E 1 108 ? 117.915 126.201 88.372  1.00 54.03  ? 108 ASN E ND2   1 
ATOM 3625  N N     . LEU E 1 109 ? 117.108 121.384 89.445  1.00 53.39  ? 109 LEU E N     1 
ATOM 3626  C CA    . LEU E 1 109 ? 117.926 120.218 89.132  1.00 53.39  ? 109 LEU E CA    1 
ATOM 3627  C C     . LEU E 1 109 ? 117.104 119.130 88.465  1.00 53.39  ? 109 LEU E C     1 
ATOM 3628  O O     . LEU E 1 109 ? 117.627 118.381 87.628  1.00 53.39  ? 109 LEU E O     1 
ATOM 3629  C CB    . LEU E 1 109 ? 118.578 119.693 90.396  1.00 53.39  ? 109 LEU E CB    1 
ATOM 3630  C CG    . LEU E 1 109 ? 119.556 120.686 91.008  1.00 53.39  ? 109 LEU E CG    1 
ATOM 3631  C CD1   . LEU E 1 109 ? 119.968 120.200 92.362  1.00 53.39  ? 109 LEU E CD1   1 
ATOM 3632  C CD2   . LEU E 1 109 ? 120.765 120.855 90.115  1.00 53.39  ? 109 LEU E CD2   1 
ATOM 3633  N N     . CYS E 1 110 ? 115.818 119.051 88.806  1.00 57.47  ? 110 CYS E N     1 
ATOM 3634  C CA    . CYS E 1 110 ? 114.916 118.119 88.141  1.00 57.47  ? 110 CYS E CA    1 
ATOM 3635  C C     . CYS E 1 110 ? 114.779 118.428 86.654  1.00 57.47  ? 110 CYS E C     1 
ATOM 3636  O O     . CYS E 1 110 ? 114.939 117.542 85.807  1.00 57.47  ? 110 CYS E O     1 
ATOM 3637  C CB    . CYS E 1 110 ? 113.550 118.153 88.811  1.00 57.47  ? 110 CYS E CB    1 
ATOM 3638  S SG    . CYS E 1 110 ? 112.320 117.231 87.902  1.00 57.47  ? 110 CYS E SG    1 
ATOM 3639  N N     . ALA E 1 111 ? 114.483 119.685 86.315  1.00 55.52  ? 111 ALA E N     1 
ATOM 3640  C CA    . ALA E 1 111 ? 114.274 120.022 84.911  1.00 55.52  ? 111 ALA E CA    1 
ATOM 3641  C C     . ALA E 1 111 ? 115.572 120.026 84.114  1.00 55.52  ? 111 ALA E C     1 
ATOM 3642  O O     . ALA E 1 111 ? 115.553 119.711 82.921  1.00 55.52  ? 111 ALA E O     1 
ATOM 3643  C CB    . ALA E 1 111 ? 113.588 121.375 84.794  1.00 55.52  ? 111 ALA E CB    1 
ATOM 3644  N N     . ILE E 1 112 ? 116.698 120.393 84.738  1.00 54.37  ? 112 ILE E N     1 
ATOM 3645  C CA    . ILE E 1 112 ? 117.995 120.264 84.075  1.00 54.37  ? 112 ILE E CA    1 
ATOM 3646  C C     . ILE E 1 112 ? 118.303 118.800 83.805  1.00 54.37  ? 112 ILE E C     1 
ATOM 3647  O O     . ILE E 1 112 ? 118.866 118.445 82.762  1.00 54.37  ? 112 ILE E O     1 
ATOM 3648  C CB    . ILE E 1 112 ? 119.094 120.949 84.911  1.00 54.37  ? 112 ILE E CB    1 
ATOM 3649  C CG1   . ILE E 1 112 ? 118.929 122.463 84.848  1.00 54.37  ? 112 ILE E CG1   1 
ATOM 3650  C CG2   . ILE E 1 112 ? 120.498 120.581 84.447  1.00 54.37  ? 112 ILE E CG2   1 
ATOM 3651  C CD1   . ILE E 1 112 ? 119.765 123.201 85.852  1.00 54.37  ? 112 ILE E CD1   1 
ATOM 3652  N N     . HIS E 1 113 ? 117.834 117.917 84.674  1.00 55.26  ? 113 HIS E N     1 
ATOM 3653  C CA    . HIS E 1 113 ? 118.025 116.501 84.414  1.00 55.26  ? 113 HIS E CA    1 
ATOM 3654  C C     . HIS E 1 113 ? 117.081 115.958 83.336  1.00 55.26  ? 113 HIS E C     1 
ATOM 3655  O O     . HIS E 1 113 ? 117.113 114.758 83.050  1.00 55.26  ? 113 HIS E O     1 
ATOM 3656  C CB    . HIS E 1 113 ? 117.862 115.728 85.720  1.00 55.26  ? 113 HIS E CB    1 
ATOM 3657  C CG    . HIS E 1 113 ? 118.533 114.396 85.709  1.00 55.26  ? 113 HIS E CG    1 
ATOM 3658  N ND1   . HIS E 1 113 ? 119.901 114.263 85.787  1.00 55.26  ? 113 HIS E ND1   1 
ATOM 3659  C CD2   . HIS E 1 113 ? 118.037 113.144 85.607  1.00 55.26  ? 113 HIS E CD2   1 
ATOM 3660  C CE1   . HIS E 1 113 ? 120.219 112.983 85.745  1.00 55.26  ? 113 HIS E CE1   1 
ATOM 3661  N NE2   . HIS E 1 113 ? 119.106 112.283 85.637  1.00 55.26  ? 113 HIS E NE2   1 
ATOM 3662  N N     . ALA E 1 114 ? 116.246 116.799 82.726  1.00 55.97  ? 114 ALA E N     1 
ATOM 3663  C CA    . ALA E 1 114 ? 115.472 116.431 81.549  1.00 55.97  ? 114 ALA E CA    1 
ATOM 3664  C C     . ALA E 1 114 ? 116.030 117.040 80.272  1.00 55.97  ? 114 ALA E C     1 
ATOM 3665  O O     . ALA E 1 114 ? 115.364 116.977 79.233  1.00 55.97  ? 114 ALA E O     1 
ATOM 3666  C CB    . ALA E 1 114 ? 114.013 116.849 81.720  1.00 55.97  ? 114 ALA E CB    1 
ATOM 3667  N N     . LYS E 1 115 ? 117.242 117.603 80.333  1.00 56.47  ? 115 LYS E N     1 
ATOM 3668  C CA    . LYS E 1 115 ? 117.823 118.464 79.294  1.00 56.47  ? 115 LYS E CA    1 
ATOM 3669  C C     . LYS E 1 115 ? 116.859 119.580 78.891  1.00 56.47  ? 115 LYS E C     1 
ATOM 3670  O O     . LYS E 1 115 ? 116.590 119.819 77.714  1.00 56.47  ? 115 LYS E O     1 
ATOM 3671  C CB    . LYS E 1 115 ? 118.292 117.652 78.090  1.00 56.47  ? 115 LYS E CB    1 
ATOM 3672  C CG    . LYS E 1 115 ? 119.559 116.863 78.379  1.00 56.47  ? 115 LYS E CG    1 
ATOM 3673  C CD    . LYS E 1 115 ? 120.022 116.091 77.157  1.00 56.47  ? 115 LYS E CD    1 
ATOM 3674  C CE    . LYS E 1 115 ? 121.290 115.312 77.428  1.00 56.47  ? 115 LYS E CE    1 
ATOM 3675  N NZ    . LYS E 1 115 ? 122.449 116.229 77.574  1.00 56.47  ? 115 LYS E NZ    1 
ATOM 3676  N N     . ARG E 1 116 ? 116.323 120.247 79.911  1.00 56.18  ? 116 ARG E N     1 
ATOM 3677  C CA    . ARG E 1 116 ? 115.500 121.438 79.785  1.00 56.18  ? 116 ARG E CA    1 
ATOM 3678  C C     . ARG E 1 116 ? 116.050 122.519 80.701  1.00 56.18  ? 116 ARG E C     1 
ATOM 3679  O O     . ARG E 1 116 ? 116.508 122.236 81.808  1.00 56.18  ? 116 ARG E O     1 
ATOM 3680  C CB    . ARG E 1 116 ? 114.033 121.166 80.146  1.00 56.18  ? 116 ARG E CB    1 
ATOM 3681  C CG    . ARG E 1 116 ? 113.274 120.401 79.089  1.00 56.18  ? 116 ARG E CG    1 
ATOM 3682  C CD    . ARG E 1 116 ? 111.756 120.398 79.321  1.00 56.18  ? 116 ARG E CD    1 
ATOM 3683  N NE    . ARG E 1 116 ? 111.289 119.522 80.394  1.00 56.18  ? 116 ARG E NE    1 
ATOM 3684  C CZ    . ARG E 1 116 ? 110.617 119.933 81.465  1.00 56.18  ? 116 ARG E CZ    1 
ATOM 3685  N NH1   . ARG E 1 116 ? 110.330 121.211 81.614  1.00 56.18  ? 116 ARG E NH1   1 
ATOM 3686  N NH2   . ARG E 1 116 ? 110.223 119.064 82.380  1.00 56.18  ? 116 ARG E NH2   1 
ATOM 3687  N N     . VAL E 1 117 ? 116.010 123.761 80.235  1.00 54.95  ? 117 VAL E N     1 
ATOM 3688  C CA    . VAL E 1 117 ? 116.451 124.887 81.043  1.00 54.95  ? 117 VAL E CA    1 
ATOM 3689  C C     . VAL E 1 117 ? 115.264 125.696 81.548  1.00 54.95  ? 117 VAL E C     1 
ATOM 3690  O O     . VAL E 1 117 ? 115.427 126.827 81.984  1.00 54.95  ? 117 VAL E O     1 
ATOM 3691  C CB    . VAL E 1 117 ? 117.447 125.778 80.284  1.00 54.95  ? 117 VAL E CB    1 
ATOM 3692  C CG1   . VAL E 1 117 ? 118.691 124.997 79.930  1.00 54.95  ? 117 VAL E CG1   1 
ATOM 3693  C CG2   . VAL E 1 117 ? 116.816 126.359 79.039  1.00 54.95  ? 117 VAL E CG2   1 
ATOM 3694  N N     . THR E 1 118 ? 114.065 125.129 81.501  1.00 55.27  ? 118 THR E N     1 
ATOM 3695  C CA    . THR E 1 118 ? 112.872 125.839 81.935  1.00 55.27  ? 118 THR E CA    1 
ATOM 3696  C C     . THR E 1 118 ? 112.031 124.907 82.784  1.00 55.27  ? 118 THR E C     1 
ATOM 3697  O O     . THR E 1 118 ? 111.676 123.813 82.341  1.00 55.27  ? 118 THR E O     1 
ATOM 3698  C CB    . THR E 1 118 ? 112.072 126.350 80.742  1.00 55.27  ? 118 THR E CB    1 
ATOM 3699  O OG1   . THR E 1 118 ? 112.867 127.293 80.020  1.00 55.27  ? 118 THR E OG1   1 
ATOM 3700  C CG2   . THR E 1 118 ? 110.781 126.996 81.198  1.00 55.27  ? 118 THR E CG2   1 
ATOM 3701  N N     . ILE E 1 119 ? 111.720 125.332 83.990  1.00 54.53  ? 119 ILE E N     1 
ATOM 3702  C CA    . ILE E 1 119 ? 110.979 124.489 84.908  1.00 54.53  ? 119 ILE E CA    1 
ATOM 3703  C C     . ILE E 1 119 ? 109.502 124.520 84.544  1.00 54.53  ? 119 ILE E C     1 
ATOM 3704  O O     . ILE E 1 119 ? 109.005 125.475 83.944  1.00 54.53  ? 119 ILE E O     1 
ATOM 3705  C CB    . ILE E 1 119 ? 111.238 124.939 86.354  1.00 54.53  ? 119 ILE E CB    1 
ATOM 3706  C CG1   . ILE E 1 119 ? 110.628 126.301 86.628  1.00 54.53  ? 119 ILE E CG1   1 
ATOM 3707  C CG2   . ILE E 1 119 ? 112.719 125.048 86.587  1.00 54.53  ? 119 ILE E CG2   1 
ATOM 3708  C CD1   . ILE E 1 119 ? 110.613 126.633 88.090  1.00 54.53  ? 119 ILE E CD1   1 
ATOM 3709  N N     . MET E 1 120 ? 108.804 123.450 84.885  1.00 62.68  ? 120 MET E N     1 
ATOM 3710  C CA    . MET E 1 120 ? 107.421 123.186 84.515  1.00 62.68  ? 120 MET E CA    1 
ATOM 3711  C C     . MET E 1 120 ? 106.764 122.492 85.695  1.00 62.68  ? 120 MET E C     1 
ATOM 3712  O O     . MET E 1 120 ? 107.467 121.931 86.542  1.00 62.68  ? 120 MET E O     1 
ATOM 3713  C CB    . MET E 1 120 ? 107.368 122.339 83.233  1.00 62.68  ? 120 MET E CB    1 
ATOM 3714  C CG    . MET E 1 120 ? 107.614 123.139 81.967  1.00 62.68  ? 120 MET E CG    1 
ATOM 3715  S SD    . MET E 1 120 ? 107.586 122.135 80.482  1.00 62.68  ? 120 MET E SD    1 
ATOM 3716  C CE    . MET E 1 120 ? 105.847 121.728 80.417  1.00 62.68  ? 120 MET E CE    1 
ATOM 3717  N N     . PRO E 1 121 ? 105.420 122.544 85.818  1.00 62.99  ? 121 PRO E N     1 
ATOM 3718  C CA    . PRO E 1 121 ? 104.796 122.156 87.097  1.00 62.99  ? 121 PRO E CA    1 
ATOM 3719  C C     . PRO E 1 121 ? 104.950 120.692 87.465  1.00 62.99  ? 121 PRO E C     1 
ATOM 3720  O O     . PRO E 1 121 ? 104.952 120.368 88.663  1.00 62.99  ? 121 PRO E O     1 
ATOM 3721  C CB    . PRO E 1 121 ? 103.320 122.512 86.892  1.00 62.99  ? 121 PRO E CB    1 
ATOM 3722  C CG    . PRO E 1 121 ? 103.320 123.519 85.850  1.00 62.99  ? 121 PRO E CG    1 
ATOM 3723  C CD    . PRO E 1 121 ? 104.401 123.122 84.923  1.00 62.99  ? 121 PRO E CD    1 
ATOM 3724  N N     . LYS E 1 122 ? 105.118 119.805 86.483  1.00 64.70  ? 122 LYS E N     1 
ATOM 3725  C CA    . LYS E 1 122 ? 105.405 118.410 86.793  1.00 64.70  ? 122 LYS E CA    1 
ATOM 3726  C C     . LYS E 1 122 ? 106.748 118.233 87.488  1.00 64.70  ? 122 LYS E C     1 
ATOM 3727  O O     . LYS E 1 122 ? 106.918 117.261 88.227  1.00 64.70  ? 122 LYS E O     1 
ATOM 3728  C CB    . LYS E 1 122 ? 105.362 117.560 85.525  1.00 64.70  ? 122 LYS E CB    1 
ATOM 3729  C CG    . LYS E 1 122 ? 106.360 117.981 84.473  1.00 64.70  ? 122 LYS E CG    1 
ATOM 3730  C CD    . LYS E 1 122 ? 106.449 116.983 83.338  1.00 64.70  ? 122 LYS E CD    1 
ATOM 3731  C CE    . LYS E 1 122 ? 105.272 117.045 82.412  1.00 64.70  ? 122 LYS E CE    1 
ATOM 3732  N NZ    . LYS E 1 122 ? 105.523 116.115 81.287  1.00 64.70  ? 122 LYS E NZ    1 
ATOM 3733  N N     . ASP E 1 123 ? 107.688 119.160 87.297  1.00 63.59  ? 123 ASP E N     1 
ATOM 3734  C CA    . ASP E 1 123 ? 108.961 119.074 88.001  1.00 63.59  ? 123 ASP E CA    1 
ATOM 3735  C C     . ASP E 1 123 ? 108.797 119.444 89.467  1.00 63.59  ? 123 ASP E C     1 
ATOM 3736  O O     . ASP E 1 123 ? 109.412 118.819 90.346  1.00 63.59  ? 123 ASP E O     1 
ATOM 3737  C CB    . ASP E 1 123 ? 109.976 119.986 87.328  1.00 63.59  ? 123 ASP E CB    1 
ATOM 3738  C CG    . ASP E 1 123 ? 110.255 119.585 85.905  1.00 63.59  ? 123 ASP E CG    1 
ATOM 3739  O OD1   . ASP E 1 123 ? 110.219 118.379 85.618  1.00 63.59  ? 123 ASP E OD1   1 
ATOM 3740  O OD2   . ASP E 1 123 ? 110.466 120.475 85.058  1.00 63.59  ? 123 ASP E OD2   1 
ATOM 3741  N N     . ILE E 1 124 ? 107.983 120.469 89.734  1.00 62.79  ? 124 ILE E N     1 
ATOM 3742  C CA    . ILE E 1 124 ? 107.578 120.812 91.094  1.00 62.79  ? 124 ILE E CA    1 
ATOM 3743  C C     . ILE E 1 124 ? 106.950 119.607 91.775  1.00 62.79  ? 124 ILE E C     1 
ATOM 3744  O O     . ILE E 1 124 ? 107.307 119.247 92.907  1.00 62.79  ? 124 ILE E O     1 
ATOM 3745  C CB    . ILE E 1 124 ? 106.598 121.995 91.063  1.00 62.79  ? 124 ILE E CB    1 
ATOM 3746  C CG1   . ILE E 1 124 ? 107.240 123.198 90.387  1.00 62.79  ? 124 ILE E CG1   1 
ATOM 3747  C CG2   . ILE E 1 124 ? 106.138 122.344 92.454  1.00 62.79  ? 124 ILE E CG2   1 
ATOM 3748  C CD1   . ILE E 1 124 ? 106.251 124.281 90.052  1.00 62.79  ? 124 ILE E CD1   1 
ATOM 3749  N N     . GLN E 1 125 ? 106.040 118.938 91.062  1.00 64.45  ? 125 GLN E N     1 
ATOM 3750  C CA    . GLN E 1 125 ? 105.391 117.743 91.584  1.00 64.45  ? 125 GLN E CA    1 
ATOM 3751  C C     . GLN E 1 125 ? 106.384 116.612 91.814  1.00 64.45  ? 125 GLN E C     1 
ATOM 3752  O O     . GLN E 1 125 ? 106.235 115.844 92.779  1.00 64.45  ? 125 GLN E O     1 
ATOM 3753  C CB    . GLN E 1 125 ? 104.285 117.328 90.622  1.00 64.45  ? 125 GLN E CB    1 
ATOM 3754  C CG    . GLN E 1 125 ? 103.194 118.381 90.548  1.00 64.45  ? 125 GLN E CG    1 
ATOM 3755  C CD    . GLN E 1 125 ? 102.173 118.131 89.465  1.00 64.45  ? 125 GLN E CD    1 
ATOM 3756  O OE1   . GLN E 1 125 ? 102.267 117.165 88.713  1.00 64.45  ? 125 GLN E OE1   1 
ATOM 3757  N NE2   . GLN E 1 125 ? 101.200 119.020 89.362  1.00 64.45  ? 125 GLN E NE2   1 
ATOM 3758  N N     . LEU E 1 126 ? 107.434 116.537 90.992  1.00 61.58  ? 126 LEU E N     1 
ATOM 3759  C CA    . LEU E 1 126 ? 108.425 115.484 91.168  1.00 61.58  ? 126 LEU E CA    1 
ATOM 3760  C C     . LEU E 1 126 ? 109.234 115.699 92.431  1.00 61.58  ? 126 LEU E C     1 
ATOM 3761  O O     . LEU E 1 126 ? 109.338 114.793 93.263  1.00 61.58  ? 126 LEU E O     1 
ATOM 3762  C CB    . LEU E 1 126 ? 109.366 115.392 89.974  1.00 61.58  ? 126 LEU E CB    1 
ATOM 3763  C CG    . LEU E 1 126 ? 110.245 114.157 90.186  1.00 61.58  ? 126 LEU E CG    1 
ATOM 3764  C CD1   . LEU E 1 126 ? 109.388 112.902 90.137  1.00 61.58  ? 126 LEU E CD1   1 
ATOM 3765  C CD2   . LEU E 1 126 ? 111.395 114.036 89.223  1.00 61.58  ? 126 LEU E CD2   1 
ATOM 3766  N N     . ALA E 1 127 ? 109.809 116.894 92.597  1.00 61.95  ? 127 ALA E N     1 
ATOM 3767  C CA    . ALA E 1 127 ? 110.614 117.155 93.785  1.00 61.95  ? 127 ALA E CA    1 
ATOM 3768  C C     . ALA E 1 127 ? 109.799 117.108 95.068  1.00 61.95  ? 127 ALA E C     1 
ATOM 3769  O O     . ALA E 1 127 ? 110.332 116.720 96.116  1.00 61.95  ? 127 ALA E O     1 
ATOM 3770  C CB    . ALA E 1 127 ? 111.303 118.509 93.669  1.00 61.95  ? 127 ALA E CB    1 
ATOM 3771  N N     . ARG E 1 128 ? 108.513 117.451 94.999  1.00 66.17  ? 128 ARG E N     1 
ATOM 3772  C CA    . ARG E 1 128 ? 107.671 117.287 96.175  1.00 66.17  ? 128 ARG E CA    1 
ATOM 3773  C C     . ARG E 1 128 ? 107.420 115.817 96.486  1.00 66.17  ? 128 ARG E C     1 
ATOM 3774  O O     . ARG E 1 128 ? 107.340 115.445 97.660  1.00 66.17  ? 128 ARG E O     1 
ATOM 3775  C CB    . ARG E 1 128 ? 106.358 118.042 96.000  1.00 66.17  ? 128 ARG E CB    1 
ATOM 3776  C CG    . ARG E 1 128 ? 106.553 119.532 96.036  1.00 66.17  ? 128 ARG E CG    1 
ATOM 3777  C CD    . ARG E 1 128 ? 105.271 120.287 95.811  1.00 66.17  ? 128 ARG E CD    1 
ATOM 3778  N NE    . ARG E 1 128 ? 104.335 120.166 96.922  1.00 66.17  ? 128 ARG E NE    1 
ATOM 3779  C CZ    . ARG E 1 128 ? 103.125 119.634 96.823  1.00 66.17  ? 128 ARG E CZ    1 
ATOM 3780  N NH1   . ARG E 1 128 ? 102.693 119.184 95.655  1.00 66.17  ? 128 ARG E NH1   1 
ATOM 3781  N NH2   . ARG E 1 128 ? 102.338 119.571 97.888  1.00 66.17  ? 128 ARG E NH2   1 
ATOM 3782  N N     . ARG E 1 129 ? 107.301 114.956 95.469  1.00 64.60  ? 129 ARG E N     1 
ATOM 3783  C CA    . ARG E 1 129 ? 107.140 113.547 95.820  1.00 64.60  ? 129 ARG E CA    1 
ATOM 3784  C C     . ARG E 1 129 ? 108.447 112.943 96.318  1.00 64.60  ? 129 ARG E C     1 
ATOM 3785  O O     . ARG E 1 129 ? 108.429 112.084 97.205  1.00 64.60  ? 129 ARG E O     1 
ATOM 3786  C CB    . ARG E 1 129 ? 106.604 112.729 94.646  1.00 64.60  ? 129 ARG E CB    1 
ATOM 3787  C CG    . ARG E 1 129 ? 106.192 111.301 95.039  1.00 64.60  ? 129 ARG E CG    1 
ATOM 3788  C CD    . ARG E 1 129 ? 105.854 110.437 93.833  1.00 64.60  ? 129 ARG E CD    1 
ATOM 3789  N NE    . ARG E 1 129 ? 104.582 110.732 93.178  1.00 64.60  ? 129 ARG E NE    1 
ATOM 3790  C CZ    . ARG E 1 129 ? 103.455 110.065 93.405  1.00 64.60  ? 129 ARG E CZ    1 
ATOM 3791  N NH1   . ARG E 1 129 ? 103.442 109.043 94.250  1.00 64.60  ? 129 ARG E NH1   1 
ATOM 3792  N NH2   . ARG E 1 129 ? 102.346 110.394 92.760  1.00 64.60  ? 129 ARG E NH2   1 
ATOM 3793  N N     . ILE E 1 130 ? 109.584 113.399 95.788  1.00 61.31  ? 130 ILE E N     1 
ATOM 3794  C CA    . ILE E 1 130 ? 110.875 112.851 96.197  1.00 61.31  ? 130 ILE E CA    1 
ATOM 3795  C C     . ILE E 1 130 ? 111.196 113.243 97.634  1.00 61.31  ? 130 ILE E C     1 
ATOM 3796  O O     . ILE E 1 130 ? 111.661 112.419 98.431  1.00 61.31  ? 130 ILE E O     1 
ATOM 3797  C CB    . ILE E 1 130 ? 111.972 113.298 95.217  1.00 61.31  ? 130 ILE E CB    1 
ATOM 3798  C CG1   . ILE E 1 130 ? 111.724 112.693 93.842  1.00 61.31  ? 130 ILE E CG1   1 
ATOM 3799  C CG2   . ILE E 1 130 ? 113.338 112.934 95.724  1.00 61.31  ? 130 ILE E CG2   1 
ATOM 3800  C CD1   . ILE E 1 130 ? 112.707 113.110 92.822  1.00 61.31  ? 130 ILE E CD1   1 
ATOM 3801  N N     . ARG E 1 131 ? 110.881 114.478 98.014  1.00 60.46  ? 131 ARG E N     1 
ATOM 3802  C CA    . ARG E 1 131 ? 111.018 114.826 99.422  1.00 60.46  ? 131 ARG E CA    1 
ATOM 3803  C C     . ARG E 1 131 ? 109.952 114.193 100.305 1.00 60.46  ? 131 ARG E C     1 
ATOM 3804  O O     . ARG E 1 131 ? 110.045 114.316 101.529 1.00 60.46  ? 131 ARG E O     1 
ATOM 3805  C CB    . ARG E 1 131 ? 110.959 116.338 99.613  1.00 60.46  ? 131 ARG E CB    1 
ATOM 3806  C CG    . ARG E 1 131 ? 112.160 117.109 99.139  1.00 60.46  ? 131 ARG E CG    1 
ATOM 3807  C CD    . ARG E 1 131 ? 111.928 118.573 99.402  1.00 60.46  ? 131 ARG E CD    1 
ATOM 3808  N NE    . ARG E 1 131 ? 113.070 119.388 99.030  1.00 60.46  ? 131 ARG E NE    1 
ATOM 3809  C CZ    . ARG E 1 131 ? 113.073 120.711 99.068  1.00 60.46  ? 131 ARG E CZ    1 
ATOM 3810  N NH1   . ARG E 1 131 ? 111.990 121.364 99.453  1.00 60.46  ? 131 ARG E NH1   1 
ATOM 3811  N NH2   . ARG E 1 131 ? 114.155 121.382 98.712  1.00 60.46  ? 131 ARG E NH2   1 
ATOM 3812  N N     . GLY E 1 132 ? 108.947 113.539 99.733  1.00 63.63  ? 132 GLY E N     1 
ATOM 3813  C CA    . GLY E 1 132 ? 107.877 112.974 100.526 1.00 63.63  ? 132 GLY E CA    1 
ATOM 3814  C C     . GLY E 1 132 ? 106.930 114.035 101.039 1.00 63.63  ? 132 GLY E C     1 
ATOM 3815  O O     . GLY E 1 132 ? 106.834 114.257 102.247 1.00 63.63  ? 132 GLY E O     1 
ATOM 3816  N N     . GLU E 1 133 ? 106.233 114.707 100.131 1.00 69.37  ? 133 GLU E N     1 
ATOM 3817  C CA    . GLU E 1 133 ? 105.291 115.760 100.483 1.00 69.37  ? 133 GLU E CA    1 
ATOM 3818  C C     . GLU E 1 133 ? 103.911 115.466 99.914  1.00 69.37  ? 133 GLU E C     1 
ATOM 3819  O O     . GLU E 1 133 ? 103.190 116.365 99.480  1.00 69.37  ? 133 GLU E O     1 
ATOM 3820  C CB    . GLU E 1 133 ? 105.791 117.121 100.012 1.00 69.37  ? 133 GLU E CB    1 
ATOM 3821  C CG    . GLU E 1 133 ? 107.064 117.553 100.696 1.00 69.37  ? 133 GLU E CG    1 
ATOM 3822  C CD    . GLU E 1 133 ? 107.537 118.900 100.230 1.00 69.37  ? 133 GLU E CD    1 
ATOM 3823  O OE1   . GLU E 1 133 ? 106.915 119.467 99.310  1.00 69.37  ? 133 GLU E OE1   1 
ATOM 3824  O OE2   . GLU E 1 133 ? 108.533 119.402 100.780 1.00 69.37  ? 133 GLU E OE2   1 
ATOM 3825  N N     . ARG E 1 134 ? 103.540 114.191 99.903  1.00 72.76  ? 134 ARG E N     1 
ATOM 3826  C CA    . ARG E 1 134 ? 102.179 113.769 99.603  1.00 72.76  ? 134 ARG E CA    1 
ATOM 3827  C C     . ARG E 1 134 ? 101.737 112.699 100.595 1.00 72.76  ? 134 ARG E C     1 
ATOM 3828  O O     . ARG E 1 134 ? 102.357 111.643 100.709 1.00 72.76  ? 134 ARG E O     1 
ATOM 3829  C CB    . ARG E 1 134 ? 102.067 113.247 98.172  1.00 72.76  ? 134 ARG E CB    1 
ATOM 3830  C CG    . ARG E 1 134 ? 102.117 114.330 97.125  1.00 72.76  ? 134 ARG E CG    1 
ATOM 3831  C CD    . ARG E 1 134 ? 102.052 113.772 95.729  1.00 72.76  ? 134 ARG E CD    1 
ATOM 3832  N NE    . ARG E 1 134 ? 102.070 114.846 94.742  1.00 72.76  ? 134 ARG E NE    1 
ATOM 3833  C CZ    . ARG E 1 134 ? 102.099 114.660 93.428  1.00 72.76  ? 134 ARG E CZ    1 
ATOM 3834  N NH1   . ARG E 1 134 ? 102.122 113.435 92.928  1.00 72.76  ? 134 ARG E NH1   1 
ATOM 3835  N NH2   . ARG E 1 134 ? 102.108 115.704 92.614  1.00 72.76  ? 134 ARG E NH2   1 
ATOM 3836  N N     . HIS F 2 18  ? 85.673  144.858 117.661 1.00 162.80 ? 18  HIS F N     1 
ATOM 3837  C CA    . HIS F 2 18  ? 85.233  144.569 116.301 1.00 162.80 ? 18  HIS F CA    1 
ATOM 3838  C C     . HIS F 2 18  ? 85.500  143.133 115.884 1.00 162.80 ? 18  HIS F C     1 
ATOM 3839  O O     . HIS F 2 18  ? 85.936  142.305 116.683 1.00 162.80 ? 18  HIS F O     1 
ATOM 3840  C CB    . HIS F 2 18  ? 85.904  145.515 115.307 1.00 162.80 ? 18  HIS F CB    1 
ATOM 3841  C CG    . HIS F 2 18  ? 85.379  146.914 115.355 1.00 162.80 ? 18  HIS F CG    1 
ATOM 3842  N ND1   . HIS F 2 18  ? 84.181  147.276 114.778 1.00 162.80 ? 18  HIS F ND1   1 
ATOM 3843  C CD2   . HIS F 2 18  ? 85.881  148.038 115.917 1.00 162.80 ? 18  HIS F CD2   1 
ATOM 3844  C CE1   . HIS F 2 18  ? 83.971  148.565 114.977 1.00 162.80 ? 18  HIS F CE1   1 
ATOM 3845  N NE2   . HIS F 2 18  ? 84.987  149.051 115.667 1.00 162.80 ? 18  HIS F NE2   1 
ATOM 3846  N N     . ARG F 2 19  ? 85.213  142.854 114.610 1.00 152.67 ? 19  ARG F N     1 
ATOM 3847  C CA    . ARG F 2 19  ? 85.436  141.529 114.038 1.00 152.67 ? 19  ARG F CA    1 
ATOM 3848  C C     . ARG F 2 19  ? 85.613  141.724 112.532 1.00 152.67 ? 19  ARG F C     1 
ATOM 3849  O O     . ARG F 2 19  ? 84.625  141.869 111.809 1.00 152.67 ? 19  ARG F O     1 
ATOM 3850  C CB    . ARG F 2 19  ? 84.273  140.602 114.354 1.00 152.67 ? 19  ARG F CB    1 
ATOM 3851  C CG    . ARG F 2 19  ? 84.454  139.172 113.898 1.00 152.67 ? 19  ARG F CG    1 
ATOM 3852  C CD    . ARG F 2 19  ? 83.251  138.334 114.292 1.00 152.67 ? 19  ARG F CD    1 
ATOM 3853  N NE    . ARG F 2 19  ? 83.141  138.185 115.738 1.00 152.67 ? 19  ARG F NE    1 
ATOM 3854  C CZ    . ARG F 2 19  ? 82.080  137.674 116.353 1.00 152.67 ? 19  ARG F CZ    1 
ATOM 3855  N NH1   . ARG F 2 19  ? 81.035  137.270 115.646 1.00 152.67 ? 19  ARG F NH1   1 
ATOM 3856  N NH2   . ARG F 2 19  ? 82.061  137.572 117.675 1.00 152.67 ? 19  ARG F NH2   1 
ATOM 3857  N N     . LYS F 2 20  ? 86.862  141.725 112.077 1.00 145.91 ? 20  LYS F N     1 
ATOM 3858  C CA    . LYS F 2 20  ? 87.155  141.968 110.673 1.00 145.91 ? 20  LYS F CA    1 
ATOM 3859  C C     . LYS F 2 20  ? 87.201  140.659 109.897 1.00 145.91 ? 20  LYS F C     1 
ATOM 3860  O O     . LYS F 2 20  ? 87.505  139.597 110.446 1.00 145.91 ? 20  LYS F O     1 
ATOM 3861  C CB    . LYS F 2 20  ? 88.481  142.714 110.513 1.00 145.91 ? 20  LYS F CB    1 
ATOM 3862  C CG    . LYS F 2 20  ? 88.452  144.155 110.987 1.00 145.91 ? 20  LYS F CG    1 
ATOM 3863  C CD    . LYS F 2 20  ? 89.788  144.836 110.732 1.00 145.91 ? 20  LYS F CD    1 
ATOM 3864  C CE    . LYS F 2 20  ? 89.787  146.279 111.212 1.00 145.91 ? 20  LYS F CE    1 
ATOM 3865  N NZ    . LYS F 2 20  ? 91.100  146.938 110.971 1.00 145.91 ? 20  LYS F NZ    1 
ATOM 3866  N N     . VAL F 2 21  ? 86.888  140.745 108.606 1.00 144.96 ? 21  VAL F N     1 
ATOM 3867  C CA    . VAL F 2 21  ? 86.852  139.595 107.710 1.00 144.96 ? 21  VAL F CA    1 
ATOM 3868  C C     . VAL F 2 21  ? 87.798  139.867 106.550 1.00 144.96 ? 21  VAL F C     1 
ATOM 3869  O O     . VAL F 2 21  ? 87.726  140.930 105.923 1.00 144.96 ? 21  VAL F O     1 
ATOM 3870  C CB    . VAL F 2 21  ? 85.425  139.318 107.201 1.00 144.96 ? 21  VAL F CB    1 
ATOM 3871  C CG1   . VAL F 2 21  ? 85.420  138.168 106.203 1.00 144.96 ? 21  VAL F CG1   1 
ATOM 3872  C CG2   . VAL F 2 21  ? 84.486  139.024 108.363 1.00 144.96 ? 21  VAL F CG2   1 
ATOM 3873  N N     . LEU F 2 22  ? 88.683  138.915 106.269 1.00 141.73 ? 22  LEU F N     1 
ATOM 3874  C CA    . LEU F 2 22  ? 89.664  139.042 105.203 1.00 141.73 ? 22  LEU F CA    1 
ATOM 3875  C C     . LEU F 2 22  ? 89.388  138.004 104.123 1.00 141.73 ? 22  LEU F C     1 
ATOM 3876  O O     . LEU F 2 22  ? 89.104  136.841 104.426 1.00 141.73 ? 22  LEU F O     1 
ATOM 3877  C CB    . LEU F 2 22  ? 91.080  138.879 105.753 1.00 141.73 ? 22  LEU F CB    1 
ATOM 3878  C CG    . LEU F 2 22  ? 91.437  139.955 106.781 1.00 141.73 ? 22  LEU F CG    1 
ATOM 3879  C CD1   . LEU F 2 22  ? 92.812  139.713 107.386 1.00 141.73 ? 22  LEU F CD1   1 
ATOM 3880  C CD2   . LEU F 2 22  ? 91.346  141.342 106.163 1.00 141.73 ? 22  LEU F CD2   1 
ATOM 3881  N N     . ARG F 2 23  ? 89.465  138.431 102.862 1.00 136.43 ? 23  ARG F N     1 
ATOM 3882  C CA    . ARG F 2 23  ? 89.079  137.593 101.733 1.00 136.43 ? 23  ARG F CA    1 
ATOM 3883  C C     . ARG F 2 23  ? 90.124  137.682 100.634 1.00 136.43 ? 23  ARG F C     1 
ATOM 3884  O O     . ARG F 2 23  ? 90.503  138.787 100.234 1.00 136.43 ? 23  ARG F O     1 
ATOM 3885  C CB    . ARG F 2 23  ? 87.718  138.016 101.170 1.00 136.43 ? 23  ARG F CB    1 
ATOM 3886  C CG    . ARG F 2 23  ? 86.541  137.790 102.101 1.00 136.43 ? 23  ARG F CG    1 
ATOM 3887  C CD    . ARG F 2 23  ? 85.251  138.272 101.463 1.00 136.43 ? 23  ARG F CD    1 
ATOM 3888  N NE    . ARG F 2 23  ? 84.108  138.124 102.355 1.00 136.43 ? 23  ARG F NE    1 
ATOM 3889  C CZ    . ARG F 2 23  ? 82.878  138.524 102.056 1.00 136.43 ? 23  ARG F CZ    1 
ATOM 3890  N NH1   . ARG F 2 23  ? 82.633  139.094 100.886 1.00 136.43 ? 23  ARG F NH1   1 
ATOM 3891  N NH2   . ARG F 2 23  ? 81.892  138.354 102.926 1.00 136.43 ? 23  ARG F NH2   1 
ATOM 3892  N N     . ASP F 2 24  ? 90.575  136.515 100.160 1.00 123.01 ? 24  ASP F N     1 
ATOM 3893  C CA    . ASP F 2 24  ? 91.387  136.354 98.948  1.00 123.01 ? 24  ASP F CA    1 
ATOM 3894  C C     . ASP F 2 24  ? 92.698  137.139 99.008  1.00 123.01 ? 24  ASP F C     1 
ATOM 3895  O O     . ASP F 2 24  ? 92.927  138.078 98.246  1.00 123.01 ? 24  ASP F O     1 
ATOM 3896  C CB    . ASP F 2 24  ? 90.590  136.733 97.696  1.00 123.01 ? 24  ASP F CB    1 
ATOM 3897  C CG    . ASP F 2 24  ? 89.538  135.709 97.347  1.00 123.01 ? 24  ASP F CG    1 
ATOM 3898  O OD1   . ASP F 2 24  ? 89.738  134.522 97.679  1.00 123.01 ? 24  ASP F OD1   1 
ATOM 3899  O OD2   . ASP F 2 24  ? 88.518  136.085 96.733  1.00 123.01 ? 24  ASP F OD2   1 
ATOM 3900  N N     . ASN F 2 25  ? 93.558  136.741 99.934  1.00 110.89 ? 25  ASN F N     1 
ATOM 3901  C CA    . ASN F 2 25  ? 94.913  137.261 99.977  1.00 110.89 ? 25  ASN F CA    1 
ATOM 3902  C C     . ASN F 2 25  ? 95.909  136.346 99.290  1.00 110.89 ? 25  ASN F C     1 
ATOM 3903  O O     . ASN F 2 25  ? 97.103  136.651 99.284  1.00 110.89 ? 25  ASN F O     1 
ATOM 3904  C CB    . ASN F 2 25  ? 95.353  137.497 101.422 1.00 110.89 ? 25  ASN F CB    1 
ATOM 3905  C CG    . ASN F 2 25  ? 94.649  138.672 102.058 1.00 110.89 ? 25  ASN F CG    1 
ATOM 3906  O OD1   . ASN F 2 25  ? 94.515  139.734 101.454 1.00 110.89 ? 25  ASN F OD1   1 
ATOM 3907  N ND2   . ASN F 2 25  ? 94.180  138.482 103.282 1.00 110.89 ? 25  ASN F ND2   1 
ATOM 3908  N N     . ILE F 2 26  ? 95.455  135.234 98.712  1.00 93.35  ? 26  ILE F N     1 
ATOM 3909  C CA    . ILE F 2 26  ? 96.396  134.306 98.107  1.00 93.35  ? 26  ILE F CA    1 
ATOM 3910  C C     . ILE F 2 26  ? 96.921  134.841 96.785  1.00 93.35  ? 26  ILE F C     1 
ATOM 3911  O O     . ILE F 2 26  ? 98.036  134.500 96.383  1.00 93.35  ? 26  ILE F O     1 
ATOM 3912  C CB    . ILE F 2 26  ? 95.737  132.916 97.978  1.00 93.35  ? 26  ILE F CB    1 
ATOM 3913  C CG1   . ILE F 2 26  ? 96.774  131.835 97.672  1.00 93.35  ? 26  ILE F CG1   1 
ATOM 3914  C CG2   . ILE F 2 26  ? 94.625  132.920 96.945  1.00 93.35  ? 26  ILE F CG2   1 
ATOM 3915  C CD1   . ILE F 2 26  ? 97.774  131.632 98.776  1.00 93.35  ? 26  ILE F CD1   1 
ATOM 3916  N N     . GLN F 2 27  ? 96.192  135.737 96.132  1.00 90.17  ? 27  GLN F N     1 
ATOM 3917  C CA    . GLN F 2 27  ? 96.715  136.362 94.929  1.00 90.17  ? 27  GLN F CA    1 
ATOM 3918  C C     . GLN F 2 27  ? 97.633  137.533 95.237  1.00 90.17  ? 27  GLN F C     1 
ATOM 3919  O O     . GLN F 2 27  ? 98.165  138.145 94.306  1.00 90.17  ? 27  GLN F O     1 
ATOM 3920  C CB    . GLN F 2 27  ? 95.570  136.823 94.024  1.00 90.17  ? 27  GLN F CB    1 
ATOM 3921  C CG    . GLN F 2 27  ? 94.720  135.692 93.462  1.00 90.17  ? 27  GLN F CG    1 
ATOM 3922  C CD    . GLN F 2 27  ? 95.485  134.790 92.508  1.00 90.17  ? 27  GLN F CD    1 
ATOM 3923  O OE1   . GLN F 2 27  ? 96.326  135.250 91.736  1.00 90.17  ? 27  GLN F OE1   1 
ATOM 3924  N NE2   . GLN F 2 27  ? 95.186  133.500 92.551  1.00 90.17  ? 27  GLN F NE2   1 
ATOM 3925  N N     . GLY F 2 28  ? 97.824  137.861 96.516  1.00 92.27  ? 28  GLY F N     1 
ATOM 3926  C CA    . GLY F 2 28  ? 98.752  138.911 96.890  1.00 92.27  ? 28  GLY F CA    1 
ATOM 3927  C C     . GLY F 2 28  ? 100.205 138.533 96.710  1.00 92.27  ? 28  GLY F C     1 
ATOM 3928  O O     . GLY F 2 28  ? 101.061 139.420 96.628  1.00 92.27  ? 28  GLY F O     1 
ATOM 3929  N N     . ILE F 2 29  ? 100.504 137.238 96.664  1.00 84.96  ? 29  ILE F N     1 
ATOM 3930  C CA    . ILE F 2 29  ? 101.827 136.777 96.278  1.00 84.96  ? 29  ILE F CA    1 
ATOM 3931  C C     . ILE F 2 29  ? 101.957 137.051 94.793  1.00 84.96  ? 29  ILE F C     1 
ATOM 3932  O O     . ILE F 2 29  ? 101.377 136.334 93.971  1.00 84.96  ? 29  ILE F O     1 
ATOM 3933  C CB    . ILE F 2 29  ? 102.022 135.287 96.587  1.00 84.96  ? 29  ILE F CB    1 
ATOM 3934  C CG1   . ILE F 2 29  ? 101.759 135.017 98.067  1.00 84.96  ? 29  ILE F CG1   1 
ATOM 3935  C CG2   . ILE F 2 29  ? 103.408 134.843 96.187  1.00 84.96  ? 29  ILE F CG2   1 
ATOM 3936  C CD1   . ILE F 2 29  ? 102.631 135.800 98.990  1.00 84.96  ? 29  ILE F CD1   1 
ATOM 3937  N N     . THR F 2 30  ? 102.700 138.093 94.443  1.00 84.04  ? 30  THR F N     1 
ATOM 3938  C CA    . THR F 2 30  ? 102.697 138.577 93.075  1.00 84.04  ? 30  THR F CA    1 
ATOM 3939  C C     . THR F 2 30  ? 103.475 137.631 92.178  1.00 84.04  ? 30  THR F C     1 
ATOM 3940  O O     . THR F 2 30  ? 104.370 136.913 92.626  1.00 84.04  ? 30  THR F O     1 
ATOM 3941  C CB    . THR F 2 30  ? 103.332 139.955 92.984  1.00 84.04  ? 30  THR F CB    1 
ATOM 3942  O OG1   . THR F 2 30  ? 104.755 139.817 93.009  1.00 84.04  ? 30  THR F OG1   1 
ATOM 3943  C CG2   . THR F 2 30  ? 102.919 140.789 94.177  1.00 84.04  ? 30  THR F CG2   1 
ATOM 3944  N N     . LYS F 2 31  ? 103.100 137.627 90.904  1.00 81.79  ? 31  LYS F N     1 
ATOM 3945  C CA    . LYS F 2 31  ? 103.904 136.949 89.895  1.00 81.79  ? 31  LYS F CA    1 
ATOM 3946  C C     . LYS F 2 31  ? 105.351 137.443 89.827  1.00 81.79  ? 31  LYS F C     1 
ATOM 3947  O O     . LYS F 2 31  ? 106.245 136.586 89.700  1.00 81.79  ? 31  LYS F O     1 
ATOM 3948  C CB    . LYS F 2 31  ? 103.183 137.037 88.542  1.00 81.79  ? 31  LYS F CB    1 
ATOM 3949  C CG    . LYS F 2 31  ? 103.912 136.387 87.400  1.00 81.79  ? 31  LYS F CG    1 
ATOM 3950  C CD    . LYS F 2 31  ? 103.037 136.239 86.166  1.00 81.79  ? 31  LYS F CD    1 
ATOM 3951  C CE    . LYS F 2 31  ? 102.822 137.558 85.456  1.00 81.79  ? 31  LYS F CE    1 
ATOM 3952  N NZ    . LYS F 2 31  ? 102.083 137.379 84.178  1.00 81.79  ? 31  LYS F NZ    1 
ATOM 3953  N N     . PRO F 2 32  ? 105.673 138.745 89.953  1.00 81.02  ? 32  PRO F N     1 
ATOM 3954  C CA    . PRO F 2 32  ? 107.094 139.098 90.091  1.00 81.02  ? 32  PRO F CA    1 
ATOM 3955  C C     . PRO F 2 32  ? 107.748 138.616 91.372  1.00 81.02  ? 32  PRO F C     1 
ATOM 3956  O O     . PRO F 2 32  ? 108.968 138.438 91.368  1.00 81.02  ? 32  PRO F O     1 
ATOM 3957  C CB    . PRO F 2 32  ? 107.092 140.629 90.016  1.00 81.02  ? 32  PRO F CB    1 
ATOM 3958  C CG    . PRO F 2 32  ? 105.936 140.946 89.238  1.00 81.02  ? 32  PRO F CG    1 
ATOM 3959  C CD    . PRO F 2 32  ? 104.897 139.961 89.636  1.00 81.02  ? 32  PRO F CD    1 
ATOM 3960  N N     . ALA F 2 33  ? 107.004 138.396 92.460  1.00 80.40  ? 33  ALA F N     1 
ATOM 3961  C CA    . ALA F 2 33  ? 107.651 137.899 93.673  1.00 80.40  ? 33  ALA F CA    1 
ATOM 3962  C C     . ALA F 2 33  ? 108.063 136.442 93.522  1.00 80.40  ? 33  ALA F C     1 
ATOM 3963  O O     . ALA F 2 33  ? 109.158 136.053 93.947  1.00 80.40  ? 33  ALA F O     1 
ATOM 3964  C CB    . ALA F 2 33  ? 106.739 138.066 94.882  1.00 80.40  ? 33  ALA F CB    1 
ATOM 3965  N N     . ILE F 2 34  ? 107.205 135.629 92.909  1.00 78.92  ? 34  ILE F N     1 
ATOM 3966  C CA    . ILE F 2 34  ? 107.560 134.249 92.601  1.00 78.92  ? 34  ILE F CA    1 
ATOM 3967  C C     . ILE F 2 34  ? 108.692 134.209 91.582  1.00 78.92  ? 34  ILE F C     1 
ATOM 3968  O O     . ILE F 2 34  ? 109.589 133.352 91.663  1.00 78.92  ? 34  ILE F O     1 
ATOM 3969  C CB    . ILE F 2 34  ? 106.306 133.492 92.131  1.00 78.92  ? 34  ILE F CB    1 
ATOM 3970  C CG1   . ILE F 2 34  ? 105.330 133.384 93.290  1.00 78.92  ? 34  ILE F CG1   1 
ATOM 3971  C CG2   . ILE F 2 34  ? 106.624 132.115 91.607  1.00 78.92  ? 34  ILE F CG2   1 
ATOM 3972  C CD1   . ILE F 2 34  ? 103.977 132.919 92.874  1.00 78.92  ? 34  ILE F CD1   1 
ATOM 3973  N N     . ARG F 2 35  ? 108.697 135.163 90.639  1.00 76.83  ? 35  ARG F N     1 
ATOM 3974  C CA    . ARG F 2 35  ? 109.854 135.318 89.761  1.00 76.83  ? 35  ARG F CA    1 
ATOM 3975  C C     . ARG F 2 35  ? 111.115 135.611 90.550  1.00 76.83  ? 35  ARG F C     1 
ATOM 3976  O O     . ARG F 2 35  ? 112.147 134.987 90.306  1.00 76.83  ? 35  ARG F O     1 
ATOM 3977  C CB    . ARG F 2 35  ? 109.622 136.416 88.728  1.00 76.83  ? 35  ARG F CB    1 
ATOM 3978  C CG    . ARG F 2 35  ? 108.680 136.029 87.618  1.00 76.83  ? 35  ARG F CG    1 
ATOM 3979  C CD    . ARG F 2 35  ? 108.491 137.151 86.609  1.00 76.83  ? 35  ARG F CD    1 
ATOM 3980  N NE    . ARG F 2 35  ? 109.698 137.410 85.834  1.00 76.83  ? 35  ARG F NE    1 
ATOM 3981  C CZ    . ARG F 2 35  ? 110.425 138.513 85.944  1.00 76.83  ? 35  ARG F CZ    1 
ATOM 3982  N NH1   . ARG F 2 35  ? 110.070 139.455 86.801  1.00 76.83  ? 35  ARG F NH1   1 
ATOM 3983  N NH2   . ARG F 2 35  ? 111.511 138.674 85.207  1.00 76.83  ? 35  ARG F NH2   1 
ATOM 3984  N N     . ARG F 2 36  ? 111.029 136.492 91.546  1.00 75.08  ? 36  ARG F N     1 
ATOM 3985  C CA    . ARG F 2 36  ? 112.217 136.898 92.289  1.00 75.08  ? 36  ARG F CA    1 
ATOM 3986  C C     . ARG F 2 36  ? 112.768 135.762 93.134  1.00 75.08  ? 36  ARG F C     1 
ATOM 3987  O O     . ARG F 2 36  ? 113.987 135.572 93.200  1.00 75.08  ? 36  ARG F O     1 
ATOM 3988  C CB    . ARG F 2 36  ? 111.915 138.100 93.175  1.00 75.08  ? 36  ARG F CB    1 
ATOM 3989  C CG    . ARG F 2 36  ? 111.812 139.444 92.481  1.00 75.08  ? 36  ARG F CG    1 
ATOM 3990  C CD    . ARG F 2 36  ? 111.902 140.540 93.521  1.00 75.08  ? 36  ARG F CD    1 
ATOM 3991  N NE    . ARG F 2 36  ? 110.844 140.408 94.507  1.00 75.08  ? 36  ARG F NE    1 
ATOM 3992  C CZ    . ARG F 2 36  ? 109.665 141.002 94.404  1.00 75.08  ? 36  ARG F CZ    1 
ATOM 3993  N NH1   . ARG F 2 36  ? 109.412 141.784 93.367  1.00 75.08  ? 36  ARG F NH1   1 
ATOM 3994  N NH2   . ARG F 2 36  ? 108.747 140.826 95.340  1.00 75.08  ? 36  ARG F NH2   1 
ATOM 3995  N N     . LEU F 2 37  ? 111.888 134.988 93.769  1.00 71.38  ? 37  LEU F N     1 
ATOM 3996  C CA    . LEU F 2 37  ? 112.346 133.829 94.525  1.00 71.38  ? 37  LEU F CA    1 
ATOM 3997  C C     . LEU F 2 37  ? 112.945 132.773 93.612  1.00 71.38  ? 37  LEU F C     1 
ATOM 3998  O O     . LEU F 2 37  ? 113.900 132.088 93.998  1.00 71.38  ? 37  LEU F O     1 
ATOM 3999  C CB    . LEU F 2 37  ? 111.195 133.230 95.316  1.00 71.38  ? 37  LEU F CB    1 
ATOM 4000  C CG    . LEU F 2 37  ? 110.571 134.141 96.359  1.00 71.38  ? 37  LEU F CG    1 
ATOM 4001  C CD1   . LEU F 2 37  ? 109.410 133.434 97.002  1.00 71.38  ? 37  LEU F CD1   1 
ATOM 4002  C CD2   . LEU F 2 37  ? 111.599 134.518 97.374  1.00 71.38  ? 37  LEU F CD2   1 
ATOM 4003  N N     . ALA F 2 38  ? 112.409 132.635 92.399  1.00 73.69  ? 38  ALA F N     1 
ATOM 4004  C CA    . ALA F 2 38  ? 113.048 131.755 91.432  1.00 73.69  ? 38  ALA F CA    1 
ATOM 4005  C C     . ALA F 2 38  ? 114.402 132.292 90.999  1.00 73.69  ? 38  ALA F C     1 
ATOM 4006  O O     . ALA F 2 38  ? 115.311 131.507 90.711  1.00 73.69  ? 38  ALA F O     1 
ATOM 4007  C CB    . ALA F 2 38  ? 112.146 131.558 90.220  1.00 73.69  ? 38  ALA F CB    1 
ATOM 4008  N N     . ARG F 2 39  ? 114.560 133.617 90.954  1.00 71.03  ? 39  ARG F N     1 
ATOM 4009  C CA    . ARG F 2 39  ? 115.850 134.193 90.597  1.00 71.03  ? 39  ARG F CA    1 
ATOM 4010  C C     . ARG F 2 39  ? 116.880 133.966 91.686  1.00 71.03  ? 39  ARG F C     1 
ATOM 4011  O O     . ARG F 2 39  ? 118.062 133.776 91.386  1.00 71.03  ? 39  ARG F O     1 
ATOM 4012  C CB    . ARG F 2 39  ? 115.722 135.685 90.320  1.00 71.03  ? 39  ARG F CB    1 
ATOM 4013  C CG    . ARG F 2 39  ? 114.913 136.026 89.109  1.00 71.03  ? 39  ARG F CG    1 
ATOM 4014  C CD    . ARG F 2 39  ? 115.578 135.606 87.833  1.00 71.03  ? 39  ARG F CD    1 
ATOM 4015  N NE    . ARG F 2 39  ? 114.841 136.142 86.700  1.00 71.03  ? 39  ARG F NE    1 
ATOM 4016  C CZ    . ARG F 2 39  ? 113.881 135.491 86.064  1.00 71.03  ? 39  ARG F CZ    1 
ATOM 4017  N NH1   . ARG F 2 39  ? 113.558 134.270 86.440  1.00 71.03  ? 39  ARG F NH1   1 
ATOM 4018  N NH2   . ARG F 2 39  ? 113.251 136.057 85.050  1.00 71.03  ? 39  ARG F NH2   1 
ATOM 4019  N N     . ARG F 2 40  ? 116.460 133.992 92.950  1.00 70.02  ? 40  ARG F N     1 
ATOM 4020  C CA    . ARG F 2 40  ? 117.385 133.641 94.016  1.00 70.02  ? 40  ARG F CA    1 
ATOM 4021  C C     . ARG F 2 40  ? 117.688 132.157 93.997  1.00 70.02  ? 40  ARG F C     1 
ATOM 4022  O O     . ARG F 2 40  ? 118.812 131.748 94.294  1.00 70.02  ? 40  ARG F O     1 
ATOM 4023  C CB    . ARG F 2 40  ? 116.820 134.061 95.370  1.00 70.02  ? 40  ARG F CB    1 
ATOM 4024  C CG    . ARG F 2 40  ? 117.735 133.793 96.537  1.00 70.02  ? 40  ARG F CG    1 
ATOM 4025  C CD    . ARG F 2 40  ? 117.144 134.313 97.812  1.00 70.02  ? 40  ARG F CD    1 
ATOM 4026  N NE    . ARG F 2 40  ? 117.116 135.764 97.841  1.00 70.02  ? 40  ARG F NE    1 
ATOM 4027  C CZ    . ARG F 2 40  ? 116.532 136.466 98.800  1.00 70.02  ? 40  ARG F CZ    1 
ATOM 4028  N NH1   . ARG F 2 40  ? 115.926 135.845 99.801  1.00 70.02  ? 40  ARG F NH1   1 
ATOM 4029  N NH2   . ARG F 2 40  ? 116.552 137.791 98.759  1.00 70.02  ? 40  ARG F NH2   1 
ATOM 4030  N N     . GLY F 2 41  ? 116.719 131.341 93.605  1.00 69.57  ? 41  GLY F N     1 
ATOM 4031  C CA    . GLY F 2 41  ? 116.989 129.925 93.505  1.00 69.57  ? 41  GLY F CA    1 
ATOM 4032  C C     . GLY F 2 41  ? 117.893 129.538 92.359  1.00 69.57  ? 41  GLY F C     1 
ATOM 4033  O O     . GLY F 2 41  ? 118.385 128.408 92.341  1.00 69.57  ? 41  GLY F O     1 
ATOM 4034  N N     . GLY F 2 42  ? 118.131 130.436 91.416  1.00 67.41  ? 42  GLY F N     1 
ATOM 4035  C CA    . GLY F 2 42  ? 118.896 130.065 90.248  1.00 67.41  ? 42  GLY F CA    1 
ATOM 4036  C C     . GLY F 2 42  ? 118.064 129.429 89.164  1.00 67.41  ? 42  GLY F C     1 
ATOM 4037  O O     . GLY F 2 42  ? 118.502 128.462 88.537  1.00 67.41  ? 42  GLY F O     1 
ATOM 4038  N N     . VAL F 2 43  ? 116.869 129.950 88.923  1.00 68.06  ? 43  VAL F N     1 
ATOM 4039  C CA    . VAL F 2 43  ? 115.973 129.450 87.893  1.00 68.06  ? 43  VAL F CA    1 
ATOM 4040  C C     . VAL F 2 43  ? 115.918 130.485 86.786  1.00 68.06  ? 43  VAL F C     1 
ATOM 4041  O O     . VAL F 2 43  ? 115.649 131.663 87.043  1.00 68.06  ? 43  VAL F O     1 
ATOM 4042  C CB    . VAL F 2 43  ? 114.575 129.176 88.457  1.00 68.06  ? 43  VAL F CB    1 
ATOM 4043  C CG1   . VAL F 2 43  ? 113.623 128.784 87.350  1.00 68.06  ? 43  VAL F CG1   1 
ATOM 4044  C CG2   . VAL F 2 43  ? 114.657 128.099 89.502  1.00 68.06  ? 43  VAL F CG2   1 
ATOM 4045  N N     . LYS F 2 44  ? 116.178 130.051 85.559  1.00 70.23  ? 44  LYS F N     1 
ATOM 4046  C CA    . LYS F 2 44  ? 116.292 130.998 84.462  1.00 70.23  ? 44  LYS F CA    1 
ATOM 4047  C C     . LYS F 2 44  ? 114.925 131.398 83.935  1.00 70.23  ? 44  LYS F C     1 
ATOM 4048  O O     . LYS F 2 44  ? 114.556 132.575 83.970  1.00 70.23  ? 44  LYS F O     1 
ATOM 4049  C CB    . LYS F 2 44  ? 117.145 130.395 83.353  1.00 70.23  ? 44  LYS F CB    1 
ATOM 4050  C CG    . LYS F 2 44  ? 117.474 131.322 82.223  1.00 70.23  ? 44  LYS F CG    1 
ATOM 4051  C CD    . LYS F 2 44  ? 118.409 130.604 81.289  1.00 70.23  ? 44  LYS F CD    1 
ATOM 4052  C CE    . LYS F 2 44  ? 118.793 131.436 80.105  1.00 70.23  ? 44  LYS F CE    1 
ATOM 4053  N NZ    . LYS F 2 44  ? 119.709 130.651 79.239  1.00 70.23  ? 44  LYS F NZ    1 
ATOM 4054  N N     . ARG F 2 45  ? 114.151 130.429 83.464  1.00 81.20  ? 45  ARG F N     1 
ATOM 4055  C CA    . ARG F 2 45  ? 112.904 130.689 82.765  1.00 81.20  ? 45  ARG F CA    1 
ATOM 4056  C C     . ARG F 2 45  ? 111.749 129.949 83.431  1.00 81.20  ? 45  ARG F C     1 
ATOM 4057  O O     . ARG F 2 45  ? 111.885 128.789 83.820  1.00 81.20  ? 45  ARG F O     1 
ATOM 4058  C CB    . ARG F 2 45  ? 113.047 130.298 81.293  1.00 81.20  ? 45  ARG F CB    1 
ATOM 4059  C CG    . ARG F 2 45  ? 111.795 130.478 80.487  1.00 81.20  ? 45  ARG F CG    1 
ATOM 4060  C CD    . ARG F 2 45  ? 111.971 130.271 79.001  1.00 81.20  ? 45  ARG F CD    1 
ATOM 4061  N NE    . ARG F 2 45  ? 110.653 130.136 78.393  1.00 81.20  ? 45  ARG F NE    1 
ATOM 4062  C CZ    . ARG F 2 45  ? 110.413 130.090 77.091  1.00 81.20  ? 45  ARG F CZ    1 
ATOM 4063  N NH1   . ARG F 2 45  ? 111.407 130.204 76.229  1.00 81.20  ? 45  ARG F NH1   1 
ATOM 4064  N NH2   . ARG F 2 45  ? 109.173 129.952 76.649  1.00 81.20  ? 45  ARG F NH2   1 
ATOM 4065  N N     . ILE F 2 46  ? 110.613 130.630 83.559  1.00 78.87  ? 46  ILE F N     1 
ATOM 4066  C CA    . ILE F 2 46  ? 109.463 130.156 84.318  1.00 78.87  ? 46  ILE F CA    1 
ATOM 4067  C C     . ILE F 2 46  ? 108.295 129.938 83.366  1.00 78.87  ? 46  ILE F C     1 
ATOM 4068  O O     . ILE F 2 46  ? 107.934 130.843 82.606  1.00 78.87  ? 46  ILE F O     1 
ATOM 4069  C CB    . ILE F 2 46  ? 109.093 131.174 85.404  1.00 78.87  ? 46  ILE F CB    1 
ATOM 4070  C CG1   . ILE F 2 46  ? 110.263 131.351 86.357  1.00 78.87  ? 46  ILE F CG1   1 
ATOM 4071  C CG2   . ILE F 2 46  ? 107.864 130.747 86.142  1.00 78.87  ? 46  ILE F CG2   1 
ATOM 4072  C CD1   . ILE F 2 46  ? 110.127 132.558 87.223  1.00 78.87  ? 46  ILE F CD1   1 
ATOM 4073  N N     . SER F 2 47  ? 107.666 128.770 83.444  1.00 81.63  ? 47  SER F N     1 
ATOM 4074  C CA    . SER F 2 47  ? 106.572 128.432 82.542  1.00 81.63  ? 47  SER F CA    1 
ATOM 4075  C C     . SER F 2 47  ? 105.278 129.114 82.975  1.00 81.63  ? 47  SER F C     1 
ATOM 4076  O O     . SER F 2 47  ? 105.259 129.991 83.842  1.00 81.63  ? 47  SER F O     1 
ATOM 4077  C CB    . SER F 2 47  ? 106.379 126.926 82.470  1.00 81.63  ? 47  SER F CB    1 
ATOM 4078  O OG    . SER F 2 47  ? 105.260 126.618 81.662  1.00 81.63  ? 47  SER F OG    1 
ATOM 4079  N N     . GLY F 2 48  ? 104.169 128.696 82.374  1.00 87.48  ? 48  GLY F N     1 
ATOM 4080  C CA    . GLY F 2 48  ? 102.894 129.361 82.553  1.00 87.48  ? 48  GLY F CA    1 
ATOM 4081  C C     . GLY F 2 48  ? 102.202 129.158 83.879  1.00 87.48  ? 48  GLY F C     1 
ATOM 4082  O O     . GLY F 2 48  ? 102.021 130.110 84.640  1.00 87.48  ? 48  GLY F O     1 
ATOM 4083  N N     . LEU F 2 49  ? 101.815 127.922 84.175  1.00 87.10  ? 49  LEU F N     1 
ATOM 4084  C CA    . LEU F 2 49  ? 101.019 127.634 85.355  1.00 87.10  ? 49  LEU F CA    1 
ATOM 4085  C C     . LEU F 2 49  ? 101.868 127.388 86.590  1.00 87.10  ? 49  LEU F C     1 
ATOM 4086  O O     . LEU F 2 49  ? 101.411 126.709 87.514  1.00 87.10  ? 49  LEU F O     1 
ATOM 4087  C CB    . LEU F 2 49  ? 100.113 126.432 85.095  1.00 87.10  ? 49  LEU F CB    1 
ATOM 4088  C CG    . LEU F 2 49  ? 99.032  126.614 84.029  1.00 87.10  ? 49  LEU F CG    1 
ATOM 4089  C CD1   . LEU F 2 49  ? 98.258  125.326 83.831  1.00 87.10  ? 49  LEU F CD1   1 
ATOM 4090  C CD2   . LEU F 2 49  ? 98.098  127.751 84.394  1.00 87.10  ? 49  LEU F CD2   1 
ATOM 4091  N N     . ILE F 2 50  ? 103.095 127.909 86.618  1.00 84.57  ? 50  ILE F N     1 
ATOM 4092  C CA    . ILE F 2 50  ? 103.955 127.761 87.784  1.00 84.57  ? 50  ILE F CA    1 
ATOM 4093  C C     . ILE F 2 50  ? 103.377 128.518 88.962  1.00 84.57  ? 50  ILE F C     1 
ATOM 4094  O O     . ILE F 2 50  ? 103.498 128.084 90.112  1.00 84.57  ? 50  ILE F O     1 
ATOM 4095  C CB    . ILE F 2 50  ? 105.370 128.260 87.453  1.00 84.57  ? 50  ILE F CB    1 
ATOM 4096  C CG1   . ILE F 2 50  ? 105.859 127.634 86.159  1.00 84.57  ? 50  ILE F CG1   1 
ATOM 4097  C CG2   . ILE F 2 50  ? 106.341 127.914 88.560  1.00 84.57  ? 50  ILE F CG2   1 
ATOM 4098  C CD1   . ILE F 2 50  ? 105.984 126.156 86.229  1.00 84.57  ? 50  ILE F CD1   1 
ATOM 4099  N N     . TYR F 2 51  ? 102.707 129.635 88.695  1.00 86.92  ? 51  TYR F N     1 
ATOM 4100  C CA    . TYR F 2 51  ? 102.336 130.550 89.761  1.00 86.92  ? 51  TYR F CA    1 
ATOM 4101  C C     . TYR F 2 51  ? 101.153 130.026 90.560  1.00 86.92  ? 51  TYR F C     1 
ATOM 4102  O O     . TYR F 2 51  ? 101.103 130.211 91.782  1.00 86.92  ? 51  TYR F O     1 
ATOM 4103  C CB    . TYR F 2 51  ? 102.034 131.914 89.163  1.00 86.92  ? 51  TYR F CB    1 
ATOM 4104  C CG    . TYR F 2 51  ? 103.148 132.378 88.269  1.00 86.92  ? 51  TYR F CG    1 
ATOM 4105  C CD1   . TYR F 2 51  ? 104.350 132.825 88.793  1.00 86.92  ? 51  TYR F CD1   1 
ATOM 4106  C CD2   . TYR F 2 51  ? 102.997 132.361 86.891  1.00 86.92  ? 51  TYR F CD2   1 
ATOM 4107  C CE1   . TYR F 2 51  ? 105.370 133.233 87.968  1.00 86.92  ? 51  TYR F CE1   1 
ATOM 4108  C CE2   . TYR F 2 51  ? 104.005 132.774 86.060  1.00 86.92  ? 51  TYR F CE2   1 
ATOM 4109  C CZ    . TYR F 2 51  ? 105.186 133.212 86.600  1.00 86.92  ? 51  TYR F CZ    1 
ATOM 4110  O OH    . TYR F 2 51  ? 106.191 133.623 85.760  1.00 86.92  ? 51  TYR F OH    1 
ATOM 4111  N N     . GLU F 2 52  ? 100.208 129.367 89.881  1.00 91.67  ? 52  GLU F N     1 
ATOM 4112  C CA    . GLU F 2 52  ? 99.078  128.729 90.553  1.00 91.67  ? 52  GLU F CA    1 
ATOM 4113  C C     . GLU F 2 52  ? 99.551  127.672 91.541  1.00 91.67  ? 52  GLU F C     1 
ATOM 4114  O O     . GLU F 2 52  ? 99.175  127.688 92.723  1.00 91.67  ? 52  GLU F O     1 
ATOM 4115  C CB    . GLU F 2 52  ? 98.161  128.095 89.512  1.00 91.67  ? 52  GLU F CB    1 
ATOM 4116  C CG    . GLU F 2 52  ? 97.479  129.075 88.599  1.00 91.67  ? 52  GLU F CG    1 
ATOM 4117  C CD    . GLU F 2 52  ? 96.403  129.851 89.309  1.00 91.67  ? 52  GLU F CD    1 
ATOM 4118  O OE1   . GLU F 2 52  ? 95.794  129.292 90.244  1.00 91.67  ? 52  GLU F OE1   1 
ATOM 4119  O OE2   . GLU F 2 52  ? 96.158  131.014 88.928  1.00 91.67  ? 52  GLU F OE2   1 
ATOM 4120  N N     . GLU F 2 53  ? 100.400 126.757 91.070  1.00 83.08  ? 53  GLU F N     1 
ATOM 4121  C CA    . GLU F 2 53  ? 100.939 125.716 91.929  1.00 83.08  ? 53  GLU F CA    1 
ATOM 4122  C C     . GLU F 2 53  ? 101.855 126.294 92.995  1.00 83.08  ? 53  GLU F C     1 
ATOM 4123  O O     . GLU F 2 53  ? 101.936 125.747 94.097  1.00 83.08  ? 53  GLU F O     1 
ATOM 4124  C CB    . GLU F 2 53  ? 101.672 124.677 91.080  1.00 83.08  ? 53  GLU F CB    1 
ATOM 4125  C CG    . GLU F 2 53  ? 102.209 123.481 91.847  1.00 83.08  ? 53  GLU F CG    1 
ATOM 4126  C CD    . GLU F 2 53  ? 101.118 122.638 92.478  1.00 83.08  ? 53  GLU F CD    1 
ATOM 4127  O OE1   . GLU F 2 53  ? 100.003 122.576 91.925  1.00 83.08  ? 53  GLU F OE1   1 
ATOM 4128  O OE2   . GLU F 2 53  ? 101.373 122.043 93.544  1.00 83.08  ? 53  GLU F OE2   1 
ATOM 4129  N N     . THR F 2 54  ? 102.506 127.420 92.712  1.00 78.64  ? 54  THR F N     1 
ATOM 4130  C CA    . THR F 2 54  ? 103.385 128.018 93.705  1.00 78.64  ? 54  THR F CA    1 
ATOM 4131  C C     . THR F 2 54  ? 102.584 128.590 94.862  1.00 78.64  ? 54  THR F C     1 
ATOM 4132  O O     . THR F 2 54  ? 102.931 128.375 96.032  1.00 78.64  ? 54  THR F O     1 
ATOM 4133  C CB    . THR F 2 54  ? 104.236 129.098 93.061  1.00 78.64  ? 54  THR F CB    1 
ATOM 4134  O OG1   . THR F 2 54  ? 104.930 128.534 91.948  1.00 78.64  ? 54  THR F OG1   1 
ATOM 4135  C CG2   . THR F 2 54  ? 105.252 129.597 94.040  1.00 78.64  ? 54  THR F CG2   1 
ATOM 4136  N N     . ARG F 2 55  ? 101.484 129.279 94.550  1.00 82.47  ? 55  ARG F N     1 
ATOM 4137  C CA    . ARG F 2 55  ? 100.577 129.738 95.594  1.00 82.47  ? 55  ARG F CA    1 
ATOM 4138  C C     . ARG F 2 55  ? 99.953  128.570 96.342  1.00 82.47  ? 55  ARG F C     1 
ATOM 4139  O O     . ARG F 2 55  ? 99.696  128.673 97.546  1.00 82.47  ? 55  ARG F O     1 
ATOM 4140  C CB    . ARG F 2 55  ? 99.475  130.603 94.995  1.00 82.47  ? 55  ARG F CB    1 
ATOM 4141  C CG    . ARG F 2 55  ? 99.951  131.868 94.329  1.00 82.47  ? 55  ARG F CG    1 
ATOM 4142  C CD    . ARG F 2 55  ? 98.765  132.579 93.727  1.00 82.47  ? 55  ARG F CD    1 
ATOM 4143  N NE    . ARG F 2 55  ? 99.134  133.742 92.932  1.00 82.47  ? 55  ARG F NE    1 
ATOM 4144  C CZ    . ARG F 2 55  ? 99.326  133.704 91.621  1.00 82.47  ? 55  ARG F CZ    1 
ATOM 4145  N NH1   . ARG F 2 55  ? 99.185  132.564 90.968  1.00 82.47  ? 55  ARG F NH1   1 
ATOM 4146  N NH2   . ARG F 2 55  ? 99.651  134.804 90.963  1.00 82.47  ? 55  ARG F NH2   1 
ATOM 4147  N N     . GLY F 2 56  ? 99.714  127.454 95.650  1.00 76.15  ? 56  GLY F N     1 
ATOM 4148  C CA    . GLY F 2 56  ? 99.182  126.283 96.328  1.00 76.15  ? 56  GLY F CA    1 
ATOM 4149  C C     . GLY F 2 56  ? 100.162 125.665 97.306  1.00 76.15  ? 56  GLY F C     1 
ATOM 4150  O O     . GLY F 2 56  ? 99.790  125.313 98.427  1.00 76.15  ? 56  GLY F O     1 
ATOM 4151  N N     . VAL F 2 57  ? 101.426 125.539 96.902  1.00 72.05  ? 57  VAL F N     1 
ATOM 4152  C CA    . VAL F 2 57  ? 102.430 124.906 97.751  1.00 72.05  ? 57  VAL F CA    1 
ATOM 4153  C C     . VAL F 2 57  ? 102.736 125.779 98.955  1.00 72.05  ? 57  VAL F C     1 
ATOM 4154  O O     . VAL F 2 57  ? 102.790 125.294 100.097 1.00 72.05  ? 57  VAL F O     1 
ATOM 4155  C CB    . VAL F 2 57  ? 103.693 124.598 96.932  1.00 72.05  ? 57  VAL F CB    1 
ATOM 4156  C CG1   . VAL F 2 57  ? 104.811 124.148 97.829  1.00 72.05  ? 57  VAL F CG1   1 
ATOM 4157  C CG2   . VAL F 2 57  ? 103.395 123.507 95.960  1.00 72.05  ? 57  VAL F CG2   1 
ATOM 4158  N N     . LEU F 2 58  ? 102.913 127.084 98.717  1.00 66.72  ? 58  LEU F N     1 
ATOM 4159  C CA    . LEU F 2 58  ? 103.081 128.032 99.813  1.00 66.72  ? 58  LEU F CA    1 
ATOM 4160  C C     . LEU F 2 58  ? 101.875 128.023 100.738 1.00 66.72  ? 58  LEU F C     1 
ATOM 4161  O O     . LEU F 2 58  ? 102.021 128.111 101.965 1.00 66.72  ? 58  LEU F O     1 
ATOM 4162  C CB    . LEU F 2 58  ? 103.307 129.430 99.252  1.00 66.72  ? 58  LEU F CB    1 
ATOM 4163  C CG    . LEU F 2 58  ? 103.427 130.548 100.279 1.00 66.72  ? 58  LEU F CG    1 
ATOM 4164  C CD1   . LEU F 2 58  ? 104.630 130.315 101.136 1.00 66.72  ? 58  LEU F CD1   1 
ATOM 4165  C CD2   . LEU F 2 58  ? 103.509 131.887 99.588  1.00 66.72  ? 58  LEU F CD2   1 
ATOM 4166  N N     . LYS F 2 59  ? 100.684 127.860 100.163 1.00 69.61  ? 59  LYS F N     1 
ATOM 4167  C CA    . LYS F 2 59  ? 99.470  127.793 100.960 1.00 69.61  ? 59  LYS F CA    1 
ATOM 4168  C C     . LYS F 2 59  ? 99.461  126.565 101.858 1.00 69.61  ? 59  LYS F C     1 
ATOM 4169  O O     . LYS F 2 59  ? 99.090  126.659 103.030 1.00 69.61  ? 59  LYS F O     1 
ATOM 4170  C CB    . LYS F 2 59  ? 98.253  127.796 100.044 1.00 69.61  ? 59  LYS F CB    1 
ATOM 4171  C CG    . LYS F 2 59  ? 96.933  127.787 100.771 1.00 69.61  ? 59  LYS F CG    1 
ATOM 4172  C CD    . LYS F 2 59  ? 95.778  127.798 99.794  1.00 69.61  ? 59  LYS F CD    1 
ATOM 4173  C CE    . LYS F 2 59  ? 94.459  127.847 100.528 1.00 69.61  ? 59  LYS F CE    1 
ATOM 4174  N NZ    . LYS F 2 59  ? 94.229  126.592 101.290 1.00 69.61  ? 59  LYS F NZ    1 
ATOM 4175  N N     . VAL F 2 60  ? 99.902  125.416 101.338 1.00 72.17  ? 60  VAL F N     1 
ATOM 4176  C CA    . VAL F 2 60  ? 99.918  124.191 102.135 1.00 72.17  ? 60  VAL F CA    1 
ATOM 4177  C C     . VAL F 2 60  ? 100.927 124.302 103.263 1.00 72.17  ? 60  VAL F C     1 
ATOM 4178  O O     . VAL F 2 60  ? 100.627 123.968 104.420 1.00 72.17  ? 60  VAL F O     1 
ATOM 4179  C CB    . VAL F 2 60  ? 100.206 122.971 101.243 1.00 72.17  ? 60  VAL F CB    1 
ATOM 4180  C CG1   . VAL F 2 60  ? 100.470 121.740 102.082 1.00 72.17  ? 60  VAL F CG1   1 
ATOM 4181  C CG2   . VAL F 2 60  ? 99.031  122.708 100.319 1.00 72.17  ? 60  VAL F CG2   1 
ATOM 4182  N N     . PHE F 2 61  ? 102.118 124.820 102.951 1.00 69.35  ? 61  PHE F N     1 
ATOM 4183  C CA    . PHE F 2 61  ? 103.172 124.921 103.951 1.00 69.35  ? 61  PHE F CA    1 
ATOM 4184  C C     . PHE F 2 61  ? 102.798 125.885 105.067 1.00 69.35  ? 61  PHE F C     1 
ATOM 4185  O O     . PHE F 2 61  ? 102.959 125.562 106.254 1.00 69.35  ? 61  PHE F O     1 
ATOM 4186  C CB    . PHE F 2 61  ? 104.472 125.342 103.287 1.00 69.35  ? 61  PHE F CB    1 
ATOM 4187  C CG    . PHE F 2 61  ? 105.582 125.544 104.243 1.00 69.35  ? 61  PHE F CG    1 
ATOM 4188  C CD1   . PHE F 2 61  ? 106.131 124.476 104.912 1.00 69.35  ? 61  PHE F CD1   1 
ATOM 4189  C CD2   . PHE F 2 61  ? 106.093 126.799 104.461 1.00 69.35  ? 61  PHE F CD2   1 
ATOM 4190  C CE1   . PHE F 2 61  ? 107.163 124.658 105.801 1.00 69.35  ? 61  PHE F CE1   1 
ATOM 4191  C CE2   . PHE F 2 61  ? 107.128 126.988 105.339 1.00 69.35  ? 61  PHE F CE2   1 
ATOM 4192  C CZ    . PHE F 2 61  ? 107.665 125.913 106.013 1.00 69.35  ? 61  PHE F CZ    1 
ATOM 4193  N N     . LEU F 2 62  ? 102.242 127.042 104.711 1.00 66.65  ? 62  LEU F N     1 
ATOM 4194  C CA    . LEU F 2 62  ? 101.787 127.965 105.742 1.00 66.65  ? 62  LEU F CA    1 
ATOM 4195  C C     . LEU F 2 62  ? 100.582 127.428 106.501 1.00 66.65  ? 62  LEU F C     1 
ATOM 4196  O O     . LEU F 2 62  ? 100.405 127.770 107.671 1.00 66.65  ? 62  LEU F O     1 
ATOM 4197  C CB    . LEU F 2 62  ? 101.465 129.322 105.133 1.00 66.65  ? 62  LEU F CB    1 
ATOM 4198  C CG    . LEU F 2 62  ? 102.673 130.099 104.636 1.00 66.65  ? 62  LEU F CG    1 
ATOM 4199  C CD1   . LEU F 2 62  ? 102.240 131.378 103.957 1.00 66.65  ? 62  LEU F CD1   1 
ATOM 4200  C CD2   . LEU F 2 62  ? 103.564 130.391 105.809 1.00 66.65  ? 62  LEU F CD2   1 
ATOM 4201  N N     . GLU F 2 63  ? 99.753  126.586 105.873 1.00 74.49  ? 63  GLU F N     1 
ATOM 4202  C CA    . GLU F 2 63  ? 98.656  125.972 106.616 1.00 74.49  ? 63  GLU F CA    1 
ATOM 4203  C C     . GLU F 2 63  ? 99.168  125.027 107.688 1.00 74.49  ? 63  GLU F C     1 
ATOM 4204  O O     . GLU F 2 63  ? 98.648  125.024 108.813 1.00 74.49  ? 63  GLU F O     1 
ATOM 4205  C CB    . GLU F 2 63  ? 97.700  125.232 105.685 1.00 74.49  ? 63  GLU F CB    1 
ATOM 4206  C CG    . GLU F 2 63  ? 96.655  126.109 105.025 1.00 74.49  ? 63  GLU F CG    1 
ATOM 4207  C CD    . GLU F 2 63  ? 95.784  125.344 104.054 1.00 74.49  ? 63  GLU F CD    1 
ATOM 4208  O OE1   . GLU F 2 63  ? 96.081  124.158 103.802 1.00 74.49  ? 63  GLU F OE1   1 
ATOM 4209  O OE2   . GLU F 2 63  ? 94.808  125.928 103.539 1.00 74.49  ? 63  GLU F OE2   1 
ATOM 4210  N N     . ASN F 2 64  ? 100.192 124.233 107.378 1.00 74.78  ? 64  ASN F N     1 
ATOM 4211  C CA    . ASN F 2 64  ? 100.713 123.330 108.397 1.00 74.78  ? 64  ASN F CA    1 
ATOM 4212  C C     . ASN F 2 64  ? 101.433 124.093 109.498 1.00 74.78  ? 64  ASN F C     1 
ATOM 4213  O O     . ASN F 2 64  ? 101.194 123.845 110.690 1.00 74.78  ? 64  ASN F O     1 
ATOM 4214  C CB    . ASN F 2 64  ? 101.627 122.286 107.769 1.00 74.78  ? 64  ASN F CB    1 
ATOM 4215  C CG    . ASN F 2 64  ? 100.853 121.186 107.093 1.00 74.78  ? 64  ASN F CG    1 
ATOM 4216  O OD1   . ASN F 2 64  ? 99.831  120.734 107.603 1.00 74.78  ? 64  ASN F OD1   1 
ATOM 4217  N ND2   . ASN F 2 64  ? 101.338 120.737 105.944 1.00 74.78  ? 64  ASN F ND2   1 
ATOM 4218  N N     . VAL F 2 65  ? 102.279 125.057 109.119 1.00 72.23  ? 65  VAL F N     1 
ATOM 4219  C CA    . VAL F 2 65  ? 103.066 125.792 110.109 1.00 72.23  ? 65  VAL F CA    1 
ATOM 4220  C C     . VAL F 2 65  ? 102.166 126.638 111.002 1.00 72.23  ? 65  VAL F C     1 
ATOM 4221  O O     . VAL F 2 65  ? 102.343 126.671 112.226 1.00 72.23  ? 65  VAL F O     1 
ATOM 4222  C CB    . VAL F 2 65  ? 104.137 126.635 109.399 1.00 72.23  ? 65  VAL F CB    1 
ATOM 4223  C CG1   . VAL F 2 65  ? 104.832 127.553 110.357 1.00 72.23  ? 65  VAL F CG1   1 
ATOM 4224  C CG2   . VAL F 2 65  ? 105.151 125.728 108.756 1.00 72.23  ? 65  VAL F CG2   1 
ATOM 4225  N N     . ILE F 2 66  ? 101.151 127.277 110.421 1.00 73.03  ? 66  ILE F N     1 
ATOM 4226  C CA    . ILE F 2 66  ? 100.232 128.083 111.219 1.00 73.03  ? 66  ILE F CA    1 
ATOM 4227  C C     . ILE F 2 66  ? 99.372  127.204 112.114 1.00 73.03  ? 66  ILE F C     1 
ATOM 4228  O O     . ILE F 2 66  ? 99.133  127.555 113.273 1.00 73.03  ? 66  ILE F O     1 
ATOM 4229  C CB    . ILE F 2 66  ? 99.388  128.995 110.309 1.00 73.03  ? 66  ILE F CB    1 
ATOM 4230  C CG1   . ILE F 2 66  ? 100.235 130.155 109.822 1.00 73.03  ? 66  ILE F CG1   1 
ATOM 4231  C CG2   . ILE F 2 66  ? 98.181  129.566 111.012 1.00 73.03  ? 66  ILE F CG2   1 
ATOM 4232  C CD1   . ILE F 2 66  ? 99.571  130.963 108.752 1.00 73.03  ? 66  ILE F CD1   1 
ATOM 4233  N N     . ARG F 2 67  ? 98.930  126.039 111.613 1.00 78.25  ? 67  ARG F N     1 
ATOM 4234  C CA    . ARG F 2 67  ? 98.155  125.107 112.441 1.00 78.25  ? 67  ARG F CA    1 
ATOM 4235  C C     . ARG F 2 67  ? 98.939  124.657 113.668 1.00 78.25  ? 67  ARG F C     1 
ATOM 4236  O O     . ARG F 2 67  ? 98.411  124.643 114.792 1.00 78.25  ? 67  ARG F O     1 
ATOM 4237  C CB    . ARG F 2 67  ? 97.744  123.883 111.624 1.00 78.25  ? 67  ARG F CB    1 
ATOM 4238  C CG    . ARG F 2 67  ? 96.925  122.866 112.403 1.00 78.25  ? 67  ARG F CG    1 
ATOM 4239  C CD    . ARG F 2 67  ? 96.685  121.608 111.589 1.00 78.25  ? 67  ARG F CD    1 
ATOM 4240  N NE    . ARG F 2 67  ? 95.808  121.820 110.449 1.00 78.25  ? 67  ARG F NE    1 
ATOM 4241  C CZ    . ARG F 2 67  ? 95.605  120.934 109.480 1.00 78.25  ? 67  ARG F CZ    1 
ATOM 4242  N NH1   . ARG F 2 67  ? 96.228  119.769 109.506 1.00 78.25  ? 67  ARG F NH1   1 
ATOM 4243  N NH2   . ARG F 2 67  ? 94.782  121.214 108.480 1.00 78.25  ? 67  ARG F NH2   1 
ATOM 4244  N N     . ASP F 2 68  ? 100.221 124.352 113.481 1.00 79.20  ? 68  ASP F N     1 
ATOM 4245  C CA    . ASP F 2 68  ? 101.016 123.913 114.615 1.00 79.20  ? 68  ASP F CA    1 
ATOM 4246  C C     . ASP F 2 68  ? 101.372 125.075 115.530 1.00 79.20  ? 68  ASP F C     1 
ATOM 4247  O O     . ASP F 2 68  ? 101.528 124.884 116.742 1.00 79.20  ? 68  ASP F O     1 
ATOM 4248  C CB    . ASP F 2 68  ? 102.258 123.219 114.100 1.00 79.20  ? 68  ASP F CB    1 
ATOM 4249  C CG    . ASP F 2 68  ? 101.916 122.106 113.146 1.00 79.20  ? 68  ASP F CG    1 
ATOM 4250  O OD1   . ASP F 2 68  ? 100.785 121.588 113.242 1.00 79.20  ? 68  ASP F OD1   1 
ATOM 4251  O OD2   . ASP F 2 68  ? 102.755 121.766 112.287 1.00 79.20  ? 68  ASP F OD2   1 
ATOM 4252  N N     . ALA F 2 69  ? 101.478 126.284 114.978 1.00 76.38  ? 69  ALA F N     1 
ATOM 4253  C CA    . ALA F 2 69  ? 101.754 127.452 115.802 1.00 76.38  ? 69  ALA F CA    1 
ATOM 4254  C C     . ALA F 2 69  ? 100.551 127.829 116.653 1.00 76.38  ? 69  ALA F C     1 
ATOM 4255  O O     . ALA F 2 69  ? 100.702 128.202 117.823 1.00 76.38  ? 69  ALA F O     1 
ATOM 4256  C CB    . ALA F 2 69  ? 102.159 128.617 114.920 1.00 76.38  ? 69  ALA F CB    1 
ATOM 4257  N N     . VAL F 2 70  ? 99.353  127.758 116.070 1.00 76.54  ? 70  VAL F N     1 
ATOM 4258  C CA    . VAL F 2 70  ? 98.121  127.993 116.813 1.00 76.54  ? 70  VAL F CA    1 
ATOM 4259  C C     . VAL F 2 70  ? 97.963  126.955 117.904 1.00 76.54  ? 70  VAL F C     1 
ATOM 4260  O O     . VAL F 2 70  ? 97.566  127.278 119.028 1.00 76.54  ? 70  VAL F O     1 
ATOM 4261  C CB    . VAL F 2 70  ? 96.919  128.007 115.852 1.00 76.54  ? 70  VAL F CB    1 
ATOM 4262  C CG1   . VAL F 2 70  ? 95.610  127.985 116.608 1.00 76.54  ? 70  VAL F CG1   1 
ATOM 4263  C CG2   . VAL F 2 70  ? 96.963  129.255 115.017 1.00 76.54  ? 70  VAL F CG2   1 
ATOM 4264  N N     . THR F 2 71  ? 98.321  125.704 117.605 1.00 80.18  ? 71  THR F N     1 
ATOM 4265  C CA    . THR F 2 71  ? 98.306  124.671 118.634 1.00 80.18  ? 71  THR F CA    1 
ATOM 4266  C C     . THR F 2 71  ? 99.295  124.988 119.750 1.00 80.18  ? 71  THR F C     1 
ATOM 4267  O O     . THR F 2 71  ? 98.999  124.779 120.930 1.00 80.18  ? 71  THR F O     1 
ATOM 4268  C CB    . THR F 2 71  ? 98.624  123.323 118.011 1.00 80.18  ? 71  THR F CB    1 
ATOM 4269  O OG1   . THR F 2 71  ? 97.772  123.123 116.880 1.00 80.18  ? 71  THR F OG1   1 
ATOM 4270  C CG2   . THR F 2 71  ? 98.352  122.224 119.010 1.00 80.18  ? 71  THR F CG2   1 
ATOM 4271  N N     . TYR F 2 72  ? 100.453 125.549 119.400 1.00 78.15  ? 72  TYR F N     1 
ATOM 4272  C CA    . TYR F 2 72  ? 101.382 126.040 120.411 1.00 78.15  ? 72  TYR F CA    1 
ATOM 4273  C C     . TYR F 2 72  ? 100.868 127.249 121.168 1.00 78.15  ? 72  TYR F C     1 
ATOM 4274  O O     . TYR F 2 72  ? 101.380 127.540 122.252 1.00 78.15  ? 72  TYR F O     1 
ATOM 4275  C CB    . TYR F 2 72  ? 102.719 126.396 119.777 1.00 78.15  ? 72  TYR F CB    1 
ATOM 4276  C CG    . TYR F 2 72  ? 103.650 125.236 119.631 1.00 78.15  ? 72  TYR F CG    1 
ATOM 4277  C CD1   . TYR F 2 72  ? 103.554 124.145 120.466 1.00 78.15  ? 72  TYR F CD1   1 
ATOM 4278  C CD2   . TYR F 2 72  ? 104.620 125.225 118.642 1.00 78.15  ? 72  TYR F CD2   1 
ATOM 4279  C CE1   . TYR F 2 72  ? 104.412 123.085 120.336 1.00 78.15  ? 72  TYR F CE1   1 
ATOM 4280  C CE2   . TYR F 2 72  ? 105.475 124.163 118.501 1.00 78.15  ? 72  TYR F CE2   1 
ATOM 4281  C CZ    . TYR F 2 72  ? 105.364 123.093 119.352 1.00 78.15  ? 72  TYR F CZ    1 
ATOM 4282  O OH    . TYR F 2 72  ? 106.214 122.026 119.221 1.00 78.15  ? 72  TYR F OH    1 
ATOM 4283  N N     . THR F 2 73  ? 99.886  127.968 120.640 1.00 78.78  ? 73  THR F N     1 
ATOM 4284  C CA    . THR F 2 73  ? 99.482  129.204 121.288 1.00 78.78  ? 73  THR F CA    1 
ATOM 4285  C C     . THR F 2 73  ? 98.207  129.055 122.105 1.00 78.78  ? 73  THR F C     1 
ATOM 4286  O O     . THR F 2 73  ? 98.061  129.709 123.142 1.00 78.78  ? 73  THR F O     1 
ATOM 4287  C CB    . THR F 2 73  ? 99.328  130.297 120.234 1.00 78.78  ? 73  THR F CB    1 
ATOM 4288  O OG1   . THR F 2 73  ? 100.509 130.314 119.430 1.00 78.78  ? 73  THR F OG1   1 
ATOM 4289  C CG2   . THR F 2 73  ? 99.218  131.653 120.879 1.00 78.78  ? 73  THR F CG2   1 
ATOM 4290  N N     . GLU F 2 74  ? 97.309  128.166 121.696 1.00 83.97  ? 74  GLU F N     1 
ATOM 4291  C CA    . GLU F 2 74  ? 96.137  127.866 122.501 1.00 83.97  ? 74  GLU F CA    1 
ATOM 4292  C C     . GLU F 2 74  ? 96.496  127.130 123.778 1.00 83.97  ? 74  GLU F C     1 
ATOM 4293  O O     . GLU F 2 74  ? 95.736  127.195 124.748 1.00 83.97  ? 74  GLU F O     1 
ATOM 4294  C CB    . GLU F 2 74  ? 95.146  127.026 121.698 1.00 83.97  ? 74  GLU F CB    1 
ATOM 4295  C CG    . GLU F 2 74  ? 94.486  127.758 120.543 1.00 83.97  ? 74  GLU F CG    1 
ATOM 4296  C CD    . GLU F 2 74  ? 93.591  126.855 119.711 1.00 83.97  ? 74  GLU F CD    1 
ATOM 4297  O OE1   . GLU F 2 74  ? 93.619  125.622 119.919 1.00 83.97  ? 74  GLU F OE1   1 
ATOM 4298  O OE2   . GLU F 2 74  ? 92.853  127.384 118.851 1.00 83.97  ? 74  GLU F OE2   1 
ATOM 4299  N N     . HIS F 2 75  ? 97.637  126.439 123.801 1.00 84.06  ? 75  HIS F N     1 
ATOM 4300  C CA    . HIS F 2 75  ? 97.994  125.651 124.972 1.00 84.06  ? 75  HIS F CA    1 
ATOM 4301  C C     . HIS F 2 75  ? 98.462  126.525 126.119 1.00 84.06  ? 75  HIS F C     1 
ATOM 4302  O O     . HIS F 2 75  ? 98.253  126.176 127.284 1.00 84.06  ? 75  HIS F O     1 
ATOM 4303  C CB    . HIS F 2 75  ? 99.073  124.643 124.624 1.00 84.06  ? 75  HIS F CB    1 
ATOM 4304  C CG    . HIS F 2 75  ? 99.440  123.763 125.768 1.00 84.06  ? 75  HIS F CG    1 
ATOM 4305  N ND1   . HIS F 2 75  ? 98.596  122.790 126.255 1.00 84.06  ? 75  HIS F ND1   1 
ATOM 4306  C CD2   . HIS F 2 75  ? 100.549 123.721 126.538 1.00 84.06  ? 75  HIS F CD2   1 
ATOM 4307  C CE1   . HIS F 2 75  ? 99.177  122.177 127.270 1.00 84.06  ? 75  HIS F CE1   1 
ATOM 4308  N NE2   . HIS F 2 75  ? 100.364 122.723 127.462 1.00 84.06  ? 75  HIS F NE2   1 
ATOM 4309  N N     . ALA F 2 76  ? 99.085  127.656 125.818 1.00 79.73  ? 76  ALA F N     1 
ATOM 4310  C CA    . ALA F 2 76  ? 99.360  128.648 126.843 1.00 79.73  ? 76  ALA F CA    1 
ATOM 4311  C C     . ALA F 2 76  ? 98.158  129.530 127.140 1.00 79.73  ? 76  ALA F C     1 
ATOM 4312  O O     . ALA F 2 76  ? 98.272  130.415 127.995 1.00 79.73  ? 76  ALA F O     1 
ATOM 4313  C CB    . ALA F 2 76  ? 100.545 129.518 126.431 1.00 79.73  ? 76  ALA F CB    1 
ATOM 4314  N N     . LYS F 2 77  ? 97.039  129.310 126.434 1.00 80.40  ? 77  LYS F N     1 
ATOM 4315  C CA    . LYS F 2 77  ? 95.770  130.021 126.617 1.00 80.40  ? 77  LYS F CA    1 
ATOM 4316  C C     . LYS F 2 77  ? 95.929  131.519 126.380 1.00 80.40  ? 77  LYS F C     1 
ATOM 4317  O O     . LYS F 2 77  ? 95.307  132.343 127.050 1.00 80.40  ? 77  LYS F O     1 
ATOM 4318  C CB    . LYS F 2 77  ? 95.171  129.744 127.994 1.00 80.40  ? 77  LYS F CB    1 
ATOM 4319  C CG    . LYS F 2 77  ? 94.843  128.294 128.220 1.00 80.40  ? 77  LYS F CG    1 
ATOM 4320  C CD    . LYS F 2 77  ? 94.325  128.082 129.625 1.00 80.40  ? 77  LYS F CD    1 
ATOM 4321  C CE    . LYS F 2 77  ? 94.064  126.618 129.902 1.00 80.40  ? 77  LYS F CE    1 
ATOM 4322  N NZ    . LYS F 2 77  ? 93.619  126.411 131.301 1.00 80.40  ? 77  LYS F NZ    1 
ATOM 4323  N N     . ARG F 2 78  ? 96.760  131.869 125.407 1.00 79.01  ? 78  ARG F N     1 
ATOM 4324  C CA    . ARG F 2 78  ? 97.082  133.252 125.105 1.00 79.01  ? 78  ARG F CA    1 
ATOM 4325  C C     . ARG F 2 78  ? 96.517  133.620 123.744 1.00 79.01  ? 78  ARG F C     1 
ATOM 4326  O O     . ARG F 2 78  ? 96.552  132.819 122.807 1.00 79.01  ? 78  ARG F O     1 
ATOM 4327  C CB    . ARG F 2 78  ? 98.592  133.471 125.117 1.00 79.01  ? 78  ARG F CB    1 
ATOM 4328  C CG    . ARG F 2 78  ? 99.226  133.159 126.448 1.00 79.01  ? 78  ARG F CG    1 
ATOM 4329  C CD    . ARG F 2 78  ? 100.678 133.566 126.488 1.00 79.01  ? 78  ARG F CD    1 
ATOM 4330  N NE    . ARG F 2 78  ? 101.520 132.801 125.582 1.00 79.01  ? 78  ARG F NE    1 
ATOM 4331  C CZ    . ARG F 2 78  ? 102.119 133.321 124.521 1.00 79.01  ? 78  ARG F CZ    1 
ATOM 4332  N NH1   . ARG F 2 78  ? 101.957 134.602 124.234 1.00 79.01  ? 78  ARG F NH1   1 
ATOM 4333  N NH2   . ARG F 2 78  ? 102.879 132.566 123.745 1.00 79.01  ? 78  ARG F NH2   1 
ATOM 4334  N N     . LYS F 2 79  ? 96.003  134.840 123.637 1.00 79.89  ? 79  LYS F N     1 
ATOM 4335  C CA    . LYS F 2 79  ? 95.377  135.289 122.404 1.00 79.89  ? 79  LYS F CA    1 
ATOM 4336  C C     . LYS F 2 79  ? 96.389  135.739 121.363 1.00 79.89  ? 79  LYS F C     1 
ATOM 4337  O O     . LYS F 2 79  ? 96.018  135.915 120.199 1.00 79.89  ? 79  LYS F O     1 
ATOM 4338  C CB    . LYS F 2 79  ? 94.411  136.444 122.685 1.00 79.89  ? 79  LYS F CB    1 
ATOM 4339  C CG    . LYS F 2 79  ? 92.950  136.071 122.943 1.00 79.89  ? 79  LYS F CG    1 
ATOM 4340  C CD    . LYS F 2 79  ? 92.761  135.274 124.223 1.00 79.89  ? 79  LYS F CD    1 
ATOM 4341  C CE    . LYS F 2 79  ? 91.310  134.872 124.435 1.00 79.89  ? 79  LYS F CE    1 
ATOM 4342  N NZ    . LYS F 2 79  ? 90.422  136.054 124.614 1.00 79.89  ? 79  LYS F NZ    1 
ATOM 4343  N N     . THR F 2 80  ? 97.645  135.931 121.745 1.00 81.48  ? 80  THR F N     1 
ATOM 4344  C CA    . THR F 2 80  ? 98.647  136.519 120.871 1.00 81.48  ? 80  THR F CA    1 
ATOM 4345  C C     . THR F 2 80  ? 99.705  135.482 120.525 1.00 81.48  ? 80  THR F C     1 
ATOM 4346  O O     . THR F 2 80  ? 100.288 134.861 121.419 1.00 81.48  ? 80  THR F O     1 
ATOM 4347  C CB    . THR F 2 80  ? 99.297  137.729 121.540 1.00 81.48  ? 80  THR F CB    1 
ATOM 4348  O OG1   . THR F 2 80  ? 98.286  138.683 121.878 1.00 81.48  ? 80  THR F OG1   1 
ATOM 4349  C CG2   . THR F 2 80  ? 100.294 138.381 120.609 1.00 81.48  ? 80  THR F CG2   1 
ATOM 4350  N N     . VAL F 2 81  ? 99.948  135.299 119.235 1.00 78.47  ? 81  VAL F N     1 
ATOM 4351  C CA    . VAL F 2 81  ? 100.991 134.398 118.769 1.00 78.47  ? 81  VAL F CA    1 
ATOM 4352  C C     . VAL F 2 81  ? 102.313 135.144 118.768 1.00 78.47  ? 81  VAL F C     1 
ATOM 4353  O O     . VAL F 2 81  ? 102.406 136.255 118.237 1.00 78.47  ? 81  VAL F O     1 
ATOM 4354  C CB    . VAL F 2 81  ? 100.652 133.868 117.373 1.00 78.47  ? 81  VAL F CB    1 
ATOM 4355  C CG1   . VAL F 2 81  ? 101.804 133.089 116.800 1.00 78.47  ? 81  VAL F CG1   1 
ATOM 4356  C CG2   . VAL F 2 81  ? 99.405  133.024 117.428 1.00 78.47  ? 81  VAL F CG2   1 
ATOM 4357  N N     . THR F 2 82  ? 103.335 134.555 119.382 1.00 78.13  ? 82  THR F N     1 
ATOM 4358  C CA    . THR F 2 82  ? 104.651 135.164 119.412 1.00 78.13  ? 82  THR F CA    1 
ATOM 4359  C C     . THR F 2 82  ? 105.550 134.515 118.372 1.00 78.13  ? 82  THR F C     1 
ATOM 4360  O O     . THR F 2 82  ? 105.140 133.640 117.611 1.00 78.13  ? 82  THR F O     1 
ATOM 4361  C CB    . THR F 2 82  ? 105.286 135.038 120.790 1.00 78.13  ? 82  THR F CB    1 
ATOM 4362  O OG1   . THR F 2 82  ? 105.607 133.667 121.033 1.00 78.13  ? 82  THR F OG1   1 
ATOM 4363  C CG2   . THR F 2 82  ? 104.323 135.510 121.853 1.00 78.13  ? 82  THR F CG2   1 
ATOM 4364  N N     . ALA F 2 83  ? 106.808 134.939 118.362 1.00 78.28  ? 83  ALA F N     1 
ATOM 4365  C CA    . ALA F 2 83  ? 107.788 134.417 117.424 1.00 78.28  ? 83  ALA F CA    1 
ATOM 4366  C C     . ALA F 2 83  ? 108.439 133.138 117.917 1.00 78.28  ? 83  ALA F C     1 
ATOM 4367  O O     . ALA F 2 83  ? 108.803 132.284 117.097 1.00 78.28  ? 83  ALA F O     1 
ATOM 4368  C CB    . ALA F 2 83  ? 108.865 135.466 117.151 1.00 78.28  ? 83  ALA F CB    1 
ATOM 4369  N N     . MET F 2 84  ? 108.589 132.987 119.238 1.00 79.24  ? 84  MET F N     1 
ATOM 4370  C CA    . MET F 2 84  ? 109.088 131.733 119.790 1.00 79.24  ? 84  MET F CA    1 
ATOM 4371  C C     . MET F 2 84  ? 108.143 130.580 119.511 1.00 79.24  ? 84  MET F C     1 
ATOM 4372  O O     . MET F 2 84  ? 108.597 129.437 119.359 1.00 79.24  ? 84  MET F O     1 
ATOM 4373  C CB    . MET F 2 84  ? 109.298 131.858 121.289 1.00 79.24  ? 84  MET F CB    1 
ATOM 4374  C CG    . MET F 2 84  ? 110.445 132.733 121.656 1.00 79.24  ? 84  MET F CG    1 
ATOM 4375  S SD    . MET F 2 84  ? 111.930 132.094 120.884 1.00 79.24  ? 84  MET F SD    1 
ATOM 4376  C CE    . MET F 2 84  ? 112.104 130.528 121.717 1.00 79.24  ? 84  MET F CE    1 
ATOM 4377  N N     . ASP F 2 85  ? 106.837 130.872 119.457 1.00 80.88  ? 85  ASP F N     1 
ATOM 4378  C CA    . ASP F 2 85  ? 105.826 129.918 119.019 1.00 80.88  ? 85  ASP F CA    1 
ATOM 4379  C C     . ASP F 2 85  ? 106.196 129.293 117.690 1.00 80.88  ? 85  ASP F C     1 
ATOM 4380  O O     . ASP F 2 85  ? 106.306 128.069 117.569 1.00 80.88  ? 85  ASP F O     1 
ATOM 4381  C CB    . ASP F 2 85  ? 104.481 130.623 118.874 1.00 80.88  ? 85  ASP F CB    1 
ATOM 4382  C CG    . ASP F 2 85  ? 103.977 131.208 120.170 1.00 80.88  ? 85  ASP F CG    1 
ATOM 4383  O OD1   . ASP F 2 85  ? 104.307 130.669 121.246 1.00 80.88  ? 85  ASP F OD1   1 
ATOM 4384  O OD2   . ASP F 2 85  ? 103.248 132.223 120.111 1.00 80.88  ? 85  ASP F OD2   1 
ATOM 4385  N N     . VAL F 2 86  ? 106.461 130.128 116.694 1.00 75.25  ? 86  VAL F N     1 
ATOM 4386  C CA    . VAL F 2 86  ? 106.649 129.603 115.357 1.00 75.25  ? 86  VAL F CA    1 
ATOM 4387  C C     . VAL F 2 86  ? 108.071 129.153 115.082 1.00 75.25  ? 86  VAL F C     1 
ATOM 4388  O O     . VAL F 2 86  ? 108.281 128.379 114.144 1.00 75.25  ? 86  VAL F O     1 
ATOM 4389  C CB    . VAL F 2 86  ? 106.217 130.635 114.313 1.00 75.25  ? 86  VAL F CB    1 
ATOM 4390  C CG1   . VAL F 2 86  ? 104.830 131.087 114.629 1.00 75.25  ? 86  VAL F CG1   1 
ATOM 4391  C CG2   . VAL F 2 86  ? 107.155 131.801 114.298 1.00 75.25  ? 86  VAL F CG2   1 
ATOM 4392  N N     . VAL F 2 87  ? 109.056 129.606 115.856 1.00 73.51  ? 87  VAL F N     1 
ATOM 4393  C CA    . VAL F 2 87  ? 110.370 128.986 115.738 1.00 73.51  ? 87  VAL F CA    1 
ATOM 4394  C C     . VAL F 2 87  ? 110.331 127.585 116.324 1.00 73.51  ? 87  VAL F C     1 
ATOM 4395  O O     . VAL F 2 87  ? 110.957 126.658 115.795 1.00 73.51  ? 87  VAL F O     1 
ATOM 4396  C CB    . VAL F 2 87  ? 111.442 129.867 116.396 1.00 73.51  ? 87  VAL F CB    1 
ATOM 4397  C CG1   . VAL F 2 87  ? 112.806 129.204 116.365 1.00 73.51  ? 87  VAL F CG1   1 
ATOM 4398  C CG2   . VAL F 2 87  ? 111.515 131.154 115.659 1.00 73.51  ? 87  VAL F CG2   1 
ATOM 4399  N N     . TYR F 2 88  ? 109.553 127.396 117.393 1.00 74.16  ? 88  TYR F N     1 
ATOM 4400  C CA    . TYR F 2 88  ? 109.308 126.052 117.907 1.00 74.16  ? 88  TYR F CA    1 
ATOM 4401  C C     . TYR F 2 88  ? 108.574 125.183 116.888 1.00 74.16  ? 88  TYR F C     1 
ATOM 4402  O O     . TYR F 2 88  ? 108.955 124.028 116.649 1.00 74.16  ? 88  TYR F O     1 
ATOM 4403  C CB    . TYR F 2 88  ? 108.526 126.146 119.206 1.00 74.16  ? 88  TYR F CB    1 
ATOM 4404  C CG    . TYR F 2 88  ? 109.371 126.543 120.379 1.00 74.16  ? 88  TYR F CG    1 
ATOM 4405  C CD1   . TYR F 2 88  ? 110.734 126.316 120.378 1.00 74.16  ? 88  TYR F CD1   1 
ATOM 4406  C CD2   . TYR F 2 88  ? 108.808 127.172 121.482 1.00 74.16  ? 88  TYR F CD2   1 
ATOM 4407  C CE1   . TYR F 2 88  ? 111.514 126.678 121.456 1.00 74.16  ? 88  TYR F CE1   1 
ATOM 4408  C CE2   . TYR F 2 88  ? 109.575 127.552 122.556 1.00 74.16  ? 88  TYR F CE2   1 
ATOM 4409  C CZ    . TYR F 2 88  ? 110.929 127.299 122.542 1.00 74.16  ? 88  TYR F CZ    1 
ATOM 4410  O OH    . TYR F 2 88  ? 111.697 127.670 123.622 1.00 74.16  ? 88  TYR F OH    1 
ATOM 4411  N N     . ALA F 2 89  ? 107.536 125.738 116.254 1.00 70.83  ? 89  ALA F N     1 
ATOM 4412  C CA    . ALA F 2 89  ? 106.786 124.985 115.255 1.00 70.83  ? 89  ALA F CA    1 
ATOM 4413  C C     . ALA F 2 89  ? 107.620 124.677 114.026 1.00 70.83  ? 89  ALA F C     1 
ATOM 4414  O O     . ALA F 2 89  ? 107.419 123.639 113.391 1.00 70.83  ? 89  ALA F O     1 
ATOM 4415  C CB    . ALA F 2 89  ? 105.532 125.745 114.843 1.00 70.83  ? 89  ALA F CB    1 
ATOM 4416  N N     . LEU F 2 90  ? 108.561 125.544 113.679 1.00 69.40  ? 90  LEU F N     1 
ATOM 4417  C CA    . LEU F 2 90  ? 109.450 125.200 112.585 1.00 69.40  ? 90  LEU F CA    1 
ATOM 4418  C C     . LEU F 2 90  ? 110.505 124.201 113.009 1.00 69.40  ? 90  LEU F C     1 
ATOM 4419  O O     . LEU F 2 90  ? 110.994 123.440 112.167 1.00 69.40  ? 90  LEU F O     1 
ATOM 4420  C CB    . LEU F 2 90  ? 110.122 126.441 112.022 1.00 69.40  ? 90  LEU F CB    1 
ATOM 4421  C CG    . LEU F 2 90  ? 109.202 127.326 111.210 1.00 69.40  ? 90  LEU F CG    1 
ATOM 4422  C CD1   . LEU F 2 90  ? 109.967 128.554 110.825 1.00 69.40  ? 90  LEU F CD1   1 
ATOM 4423  C CD2   . LEU F 2 90  ? 108.735 126.575 110.000 1.00 69.40  ? 90  LEU F CD2   1 
ATOM 4424  N N     . LYS F 2 91  ? 110.882 124.198 114.287 1.00 68.15  ? 91  LYS F N     1 
ATOM 4425  C CA    . LYS F 2 91  ? 111.848 123.215 114.754 1.00 68.15  ? 91  LYS F CA    1 
ATOM 4426  C C     . LYS F 2 91  ? 111.267 121.820 114.697 1.00 68.15  ? 91  LYS F C     1 
ATOM 4427  O O     . LYS F 2 91  ? 111.942 120.876 114.278 1.00 68.15  ? 91  LYS F O     1 
ATOM 4428  C CB    . LYS F 2 91  ? 112.285 123.518 116.181 1.00 68.15  ? 91  LYS F CB    1 
ATOM 4429  C CG    . LYS F 2 91  ? 113.389 122.594 116.672 1.00 68.15  ? 91  LYS F CG    1 
ATOM 4430  C CD    . LYS F 2 91  ? 113.678 122.785 118.147 1.00 68.15  ? 91  LYS F CD    1 
ATOM 4431  C CE    . LYS F 2 91  ? 114.262 124.151 118.428 1.00 68.15  ? 91  LYS F CE    1 
ATOM 4432  N NZ    . LYS F 2 91  ? 115.598 124.342 117.818 1.00 68.15  ? 91  LYS F NZ    1 
ATOM 4433  N N     . ARG F 2 92  ? 110.003 121.683 115.087 1.00 69.85  ? 92  ARG F N     1 
ATOM 4434  C CA    . ARG F 2 92  ? 109.412 120.359 115.212 1.00 69.85  ? 92  ARG F CA    1 
ATOM 4435  C C     . ARG F 2 92  ? 109.191 119.724 113.845 1.00 69.85  ? 92  ARG F C     1 
ATOM 4436  O O     . ARG F 2 92  ? 109.276 118.502 113.711 1.00 69.85  ? 92  ARG F O     1 
ATOM 4437  C CB    . ARG F 2 92  ? 108.105 120.471 115.993 1.00 69.85  ? 92  ARG F CB    1 
ATOM 4438  C CG    . ARG F 2 92  ? 107.610 119.239 116.739 1.00 69.85  ? 92  ARG F CG    1 
ATOM 4439  C CD    . ARG F 2 92  ? 106.858 118.251 115.867 1.00 69.85  ? 92  ARG F CD    1 
ATOM 4440  N NE    . ARG F 2 92  ? 106.063 118.912 114.840 1.00 69.85  ? 92  ARG F NE    1 
ATOM 4441  C CZ    . ARG F 2 92  ? 104.891 119.494 115.037 1.00 69.85  ? 92  ARG F CZ    1 
ATOM 4442  N NH1   . ARG F 2 92  ? 104.355 119.536 116.240 1.00 69.85  ? 92  ARG F NH1   1 
ATOM 4443  N NH2   . ARG F 2 92  ? 104.267 120.049 114.020 1.00 69.85  ? 92  ARG F NH2   1 
ATOM 4444  N N     . GLN F 2 93  ? 108.952 120.526 112.817 1.00 73.14  ? 93  GLN F N     1 
ATOM 4445  C CA    . GLN F 2 93  ? 108.819 119.981 111.476 1.00 73.14  ? 93  GLN F CA    1 
ATOM 4446  C C     . GLN F 2 93  ? 110.148 119.788 110.781 1.00 73.14  ? 93  GLN F C     1 
ATOM 4447  O O     . GLN F 2 93  ? 110.159 119.597 109.563 1.00 73.14  ? 93  GLN F O     1 
ATOM 4448  C CB    . GLN F 2 93  ? 107.922 120.875 110.622 1.00 73.14  ? 93  GLN F CB    1 
ATOM 4449  C CG    . GLN F 2 93  ? 106.470 120.822 111.025 1.00 73.14  ? 93  GLN F CG    1 
ATOM 4450  C CD    . GLN F 2 93  ? 105.583 121.639 110.122 1.00 73.14  ? 93  GLN F CD    1 
ATOM 4451  O OE1   . GLN F 2 93  ? 106.060 122.357 109.250 1.00 73.14  ? 93  GLN F OE1   1 
ATOM 4452  N NE2   . GLN F 2 93  ? 104.278 121.515 110.310 1.00 73.14  ? 93  GLN F NE2   1 
ATOM 4453  N N     . GLY F 2 94  ? 111.258 119.834 111.510 1.00 76.05  ? 94  GLY F N     1 
ATOM 4454  C CA    . GLY F 2 94  ? 112.564 119.621 110.915 1.00 76.05  ? 94  GLY F CA    1 
ATOM 4455  C C     . GLY F 2 94  ? 113.019 120.724 109.992 1.00 76.05  ? 94  GLY F C     1 
ATOM 4456  O O     . GLY F 2 94  ? 113.664 120.444 108.980 1.00 76.05  ? 94  GLY F O     1 
ATOM 4457  N N     . ARG F 2 95  ? 112.667 121.970 110.292 1.00 69.59  ? 95  ARG F N     1 
ATOM 4458  C CA    . ARG F 2 95  ? 112.989 123.124 109.465 1.00 69.59  ? 95  ARG F CA    1 
ATOM 4459  C C     . ARG F 2 95  ? 113.471 124.264 110.346 1.00 69.59  ? 95  ARG F C     1 
ATOM 4460  O O     . ARG F 2 95  ? 112.938 125.371 110.297 1.00 69.59  ? 95  ARG F O     1 
ATOM 4461  C CB    . ARG F 2 95  ? 111.791 123.571 108.639 1.00 69.59  ? 95  ARG F CB    1 
ATOM 4462  C CG    . ARG F 2 95  ? 111.340 122.557 107.633 1.00 69.59  ? 95  ARG F CG    1 
ATOM 4463  C CD    . ARG F 2 95  ? 110.238 123.090 106.771 1.00 69.59  ? 95  ARG F CD    1 
ATOM 4464  N NE    . ARG F 2 95  ? 109.681 122.042 105.931 1.00 69.59  ? 95  ARG F NE    1 
ATOM 4465  C CZ    . ARG F 2 95  ? 110.183 121.680 104.757 1.00 69.59  ? 95  ARG F CZ    1 
ATOM 4466  N NH1   . ARG F 2 95  ? 111.267 122.275 104.278 1.00 69.59  ? 95  ARG F NH1   1 
ATOM 4467  N NH2   . ARG F 2 95  ? 109.602 120.716 104.065 1.00 69.59  ? 95  ARG F NH2   1 
ATOM 4468  N N     . THR F 2 96  ? 114.452 123.982 111.201 1.00 61.66  ? 96  THR F N     1 
ATOM 4469  C CA    . THR F 2 96  ? 114.843 124.901 112.265 1.00 61.66  ? 96  THR F CA    1 
ATOM 4470  C C     . THR F 2 96  ? 115.456 126.187 111.715 1.00 61.66  ? 96  THR F C     1 
ATOM 4471  O O     . THR F 2 96  ? 116.209 126.176 110.740 1.00 61.66  ? 96  THR F O     1 
ATOM 4472  C CB    . THR F 2 96  ? 115.834 124.211 113.195 1.00 61.66  ? 96  THR F CB    1 
ATOM 4473  O OG1   . THR F 2 96  ? 115.330 122.916 113.526 1.00 61.66  ? 96  THR F OG1   1 
ATOM 4474  C CG2   . THR F 2 96  ? 116.000 124.984 114.499 1.00 61.66  ? 96  THR F CG2   1 
ATOM 4475  N N     . LEU F 2 97  ? 115.124 127.297 112.364 1.00 56.38  ? 97  LEU F N     1 
ATOM 4476  C CA    . LEU F 2 97  ? 115.371 128.645 111.873 1.00 56.38  ? 97  LEU F CA    1 
ATOM 4477  C C     . LEU F 2 97  ? 115.909 129.478 113.018 1.00 56.38  ? 97  LEU F C     1 
ATOM 4478  O O     . LEU F 2 97  ? 115.176 129.770 113.965 1.00 56.38  ? 97  LEU F O     1 
ATOM 4479  C CB    . LEU F 2 97  ? 114.078 129.250 111.350 1.00 56.38  ? 97  LEU F CB    1 
ATOM 4480  C CG    . LEU F 2 97  ? 114.071 130.713 110.949 1.00 56.38  ? 97  LEU F CG    1 
ATOM 4481  C CD1   . LEU F 2 97  ? 114.957 130.959 109.763 1.00 56.38  ? 97  LEU F CD1   1 
ATOM 4482  C CD2   . LEU F 2 97  ? 112.659 131.105 110.638 1.00 56.38  ? 97  LEU F CD2   1 
ATOM 4483  N N     . TYR F 2 98  ? 117.169 129.879 112.938 1.00 50.16  ? 98  TYR F N     1 
ATOM 4484  C CA    . TYR F 2 98  ? 117.737 130.669 114.017 1.00 50.16  ? 98  TYR F CA    1 
ATOM 4485  C C     . TYR F 2 98  ? 117.348 132.126 113.816 1.00 50.16  ? 98  TYR F C     1 
ATOM 4486  O O     . TYR F 2 98  ? 116.694 132.488 112.840 1.00 50.16  ? 98  TYR F O     1 
ATOM 4487  C CB    . TYR F 2 98  ? 119.253 130.547 114.054 1.00 50.16  ? 98  TYR F CB    1 
ATOM 4488  C CG    . TYR F 2 98  ? 119.812 129.163 114.259 1.00 50.16  ? 98  TYR F CG    1 
ATOM 4489  C CD1   . TYR F 2 98  ? 119.053 128.140 114.793 1.00 50.16  ? 98  TYR F CD1   1 
ATOM 4490  C CD2   . TYR F 2 98  ? 121.114 128.881 113.889 1.00 50.16  ? 98  TYR F CD2   1 
ATOM 4491  C CE1   . TYR F 2 98  ? 119.578 126.884 114.950 1.00 50.16  ? 98  TYR F CE1   1 
ATOM 4492  C CE2   . TYR F 2 98  ? 121.644 127.639 114.046 1.00 50.16  ? 98  TYR F CE2   1 
ATOM 4493  C CZ    . TYR F 2 98  ? 120.875 126.642 114.574 1.00 50.16  ? 98  TYR F CZ    1 
ATOM 4494  O OH    . TYR F 2 98  ? 121.391 125.391 114.725 1.00 50.16  ? 98  TYR F OH    1 
ATOM 4495  N N     . GLY F 2 99  ? 117.783 132.986 114.724 1.00 57.35  ? 99  GLY F N     1 
ATOM 4496  C CA    . GLY F 2 99  ? 117.580 134.404 114.541 1.00 57.35  ? 99  GLY F CA    1 
ATOM 4497  C C     . GLY F 2 99  ? 116.320 134.965 115.143 1.00 57.35  ? 99  GLY F C     1 
ATOM 4498  O O     . GLY F 2 99  ? 115.992 136.125 114.874 1.00 57.35  ? 99  GLY F O     1 
ATOM 4499  N N     . PHE F 2 100 ? 115.591 134.185 115.926 1.00 59.97  ? 100 PHE F N     1 
ATOM 4500  C CA    . PHE F 2 100 ? 114.468 134.726 116.674 1.00 59.97  ? 100 PHE F CA    1 
ATOM 4501  C C     . PHE F 2 100 ? 114.444 134.168 118.084 1.00 59.97  ? 100 PHE F C     1 
ATOM 4502  O O     . PHE F 2 100 ? 113.431 134.312 118.770 1.00 59.97  ? 100 PHE F O     1 
ATOM 4503  C CB    . PHE F 2 100 ? 113.142 134.424 115.988 1.00 59.97  ? 100 PHE F CB    1 
ATOM 4504  C CG    . PHE F 2 100 ? 113.039 134.957 114.589 1.00 59.97  ? 100 PHE F CG    1 
ATOM 4505  C CD1   . PHE F 2 100 ? 112.832 136.298 114.356 1.00 59.97  ? 100 PHE F CD1   1 
ATOM 4506  C CD2   . PHE F 2 100 ? 113.116 134.108 113.512 1.00 59.97  ? 100 PHE F CD2   1 
ATOM 4507  C CE1   . PHE F 2 100 ? 112.733 136.774 113.078 1.00 59.97  ? 100 PHE F CE1   1 
ATOM 4508  C CE2   . PHE F 2 100 ? 113.018 134.586 112.245 1.00 59.97  ? 100 PHE F CE2   1 
ATOM 4509  C CZ    . PHE F 2 100 ? 112.822 135.918 112.029 1.00 59.97  ? 100 PHE F CZ    1 
ATOM 4510  N N     . GLY F 2 101 ? 115.518 133.527 118.523 1.00 82.45  ? 101 GLY F N     1 
ATOM 4511  C CA    . GLY F 2 101 ? 115.576 132.938 119.842 1.00 82.45  ? 101 GLY F CA    1 
ATOM 4512  C C     . GLY F 2 101 ? 115.205 131.474 119.802 1.00 82.45  ? 101 GLY F C     1 
ATOM 4513  O O     . GLY F 2 101 ? 114.339 131.083 119.018 1.00 82.45  ? 101 GLY F O     1 
ATOM 4514  N N     . GLY F 2 102 ? 115.863 130.654 120.617 1.00 91.69  ? 102 GLY F N     1 
ATOM 4515  C CA    . GLY F 2 102 ? 115.496 129.255 120.772 1.00 91.69  ? 102 GLY F CA    1 
ATOM 4516  C C     . GLY F 2 102 ? 115.743 128.339 119.584 1.00 91.69  ? 102 GLY F C     1 
ATOM 4517  O O     . GLY F 2 102 ? 115.674 127.115 119.711 1.00 91.69  ? 102 GLY F O     1 
ATOM 4518  O OXT   . GLY F 2 102 ? 116.013 128.775 118.466 1.00 91.69  ? 102 GLY F OXT   1 
ATOM 4519  N N     . THR G 3 16  ? 90.767  97.240  138.752 1.00 89.20  ? 16  THR G N     1 
ATOM 4520  C CA    . THR G 3 16  ? 91.993  97.832  138.234 1.00 89.20  ? 16  THR G CA    1 
ATOM 4521  C C     . THR G 3 16  ? 91.743  99.268  137.819 1.00 89.20  ? 16  THR G C     1 
ATOM 4522  O O     . THR G 3 16  ? 90.597  99.666  137.631 1.00 89.20  ? 16  THR G O     1 
ATOM 4523  C CB    . THR G 3 16  ? 92.516  97.066  137.031 1.00 89.20  ? 16  THR G CB    1 
ATOM 4524  O OG1   . THR G 3 16  ? 91.576  97.186  135.958 1.00 89.20  ? 16  THR G OG1   1 
ATOM 4525  C CG2   . THR G 3 16  ? 92.684  95.601  137.382 1.00 89.20  ? 16  THR G CG2   1 
ATOM 4526  N N     . ARG G 3 17  ? 92.817  100.046 137.667 1.00 80.32  ? 17  ARG G N     1 
ATOM 4527  C CA    . ARG G 3 17  ? 92.651  101.414 137.191 1.00 80.32  ? 17  ARG G CA    1 
ATOM 4528  C C     . ARG G 3 17  ? 92.275  101.442 135.720 1.00 80.32  ? 17  ARG G C     1 
ATOM 4529  O O     . ARG G 3 17  ? 91.637  102.396 135.259 1.00 80.32  ? 17  ARG G O     1 
ATOM 4530  C CB    . ARG G 3 17  ? 93.912  102.232 137.442 1.00 80.32  ? 17  ARG G CB    1 
ATOM 4531  C CG    . ARG G 3 17  ? 94.170  102.469 138.910 1.00 80.32  ? 17  ARG G CG    1 
ATOM 4532  C CD    . ARG G 3 17  ? 95.196  103.556 139.131 1.00 80.32  ? 17  ARG G CD    1 
ATOM 4533  N NE    . ARG G 3 17  ? 96.559  103.187 138.800 1.00 80.32  ? 17  ARG G NE    1 
ATOM 4534  C CZ    . ARG G 3 17  ? 97.555  104.063 138.722 1.00 80.32  ? 17  ARG G CZ    1 
ATOM 4535  N NH1   . ARG G 3 17  ? 97.327  105.352 138.925 1.00 80.32  ? 17  ARG G NH1   1 
ATOM 4536  N NH2   . ARG G 3 17  ? 98.779  103.654 138.427 1.00 80.32  ? 17  ARG G NH2   1 
ATOM 4537  N N     . SER G 3 18  ? 92.645  100.398 134.982 1.00 81.93  ? 18  SER G N     1 
ATOM 4538  C CA    . SER G 3 18  ? 92.087  100.195 133.656 1.00 81.93  ? 18  SER G CA    1 
ATOM 4539  C C     . SER G 3 18  ? 90.583  99.973  133.721 1.00 81.93  ? 18  SER G C     1 
ATOM 4540  O O     . SER G 3 18  ? 89.856  100.399 132.819 1.00 81.93  ? 18  SER G O     1 
ATOM 4541  C CB    . SER G 3 18  ? 92.773  99.009  132.989 1.00 81.93  ? 18  SER G CB    1 
ATOM 4542  O OG    . SER G 3 18  ? 94.164  99.237  132.873 1.00 81.93  ? 18  SER G OG    1 
ATOM 4543  N N     . SER G 3 19  ? 90.098  99.318  134.780 1.00 88.26  ? 19  SER G N     1 
ATOM 4544  C CA    . SER G 3 19  ? 88.662  99.191  134.995 1.00 88.26  ? 19  SER G CA    1 
ATOM 4545  C C     . SER G 3 19  ? 88.074  100.400 135.703 1.00 88.26  ? 19  SER G C     1 
ATOM 4546  O O     . SER G 3 19  ? 86.864  100.625 135.611 1.00 88.26  ? 19  SER G O     1 
ATOM 4547  C CB    . SER G 3 19  ? 88.351  97.936  135.807 1.00 88.26  ? 19  SER G CB    1 
ATOM 4548  O OG    . SER G 3 19  ? 88.849  98.054  137.127 1.00 88.26  ? 19  SER G OG    1 
ATOM 4549  N N     . ARG G 3 20  ? 88.894  101.173 136.417 1.00 90.63  ? 20  ARG G N     1 
ATOM 4550  C CA    . ARG G 3 20  ? 88.435  102.465 136.907 1.00 90.63  ? 20  ARG G CA    1 
ATOM 4551  C C     . ARG G 3 20  ? 88.211  103.445 135.772 1.00 90.63  ? 20  ARG G C     1 
ATOM 4552  O O     . ARG G 3 20  ? 87.433  104.389 135.929 1.00 90.63  ? 20  ARG G O     1 
ATOM 4553  C CB    . ARG G 3 20  ? 89.437  103.075 137.885 1.00 90.63  ? 20  ARG G CB    1 
ATOM 4554  C CG    . ARG G 3 20  ? 89.578  102.379 139.225 1.00 90.63  ? 20  ARG G CG    1 
ATOM 4555  C CD    . ARG G 3 20  ? 90.640  103.095 140.049 1.00 90.63  ? 20  ARG G CD    1 
ATOM 4556  N NE    . ARG G 3 20  ? 90.924  102.444 141.324 1.00 90.63  ? 20  ARG G NE    1 
ATOM 4557  C CZ    . ARG G 3 20  ? 90.302  102.733 142.461 1.00 90.63  ? 20  ARG G CZ    1 
ATOM 4558  N NH1   . ARG G 3 20  ? 89.357  103.662 142.484 1.00 90.63  ? 20  ARG G NH1   1 
ATOM 4559  N NH2   . ARG G 3 20  ? 90.624  102.096 143.574 1.00 90.63  ? 20  ARG G NH2   1 
ATOM 4560  N N     . ALA G 3 21  ? 88.879  103.247 134.639 1.00 88.31  ? 21  ALA G N     1 
ATOM 4561  C CA    . ALA G 3 21  ? 88.644  104.062 133.462 1.00 88.31  ? 21  ALA G CA    1 
ATOM 4562  C C     . ALA G 3 21  ? 87.916  103.326 132.348 1.00 88.31  ? 21  ALA G C     1 
ATOM 4563  O O     . ALA G 3 21  ? 87.493  103.967 131.381 1.00 88.31  ? 21  ALA G O     1 
ATOM 4564  C CB    . ALA G 3 21  ? 89.971  104.604 132.920 1.00 88.31  ? 21  ALA G CB    1 
ATOM 4565  N N     . GLY G 3 22  ? 87.749  102.013 132.451 1.00 85.80  ? 22  GLY G N     1 
ATOM 4566  C CA    . GLY G 3 22  ? 87.079  101.280 131.395 1.00 85.80  ? 22  GLY G CA    1 
ATOM 4567  C C     . GLY G 3 22  ? 87.942  101.041 130.178 1.00 85.80  ? 22  GLY G C     1 
ATOM 4568  O O     . GLY G 3 22  ? 87.471  101.200 129.046 1.00 85.80  ? 22  GLY G O     1 
ATOM 4569  N N     . LEU G 3 23  ? 89.203  100.673 130.378 1.00 77.99  ? 23  LEU G N     1 
ATOM 4570  C CA    . LEU G 3 23  ? 90.105  100.421 129.266 1.00 77.99  ? 23  LEU G CA    1 
ATOM 4571  C C     . LEU G 3 23  ? 90.724  99.043  129.390 1.00 77.99  ? 23  LEU G C     1 
ATOM 4572  O O     . LEU G 3 23  ? 90.312  98.245  130.236 1.00 77.99  ? 23  LEU G O     1 
ATOM 4573  C CB    . LEU G 3 23  ? 91.211  101.466 129.203 1.00 77.99  ? 23  LEU G CB    1 
ATOM 4574  C CG    . LEU G 3 23  ? 90.951  102.778 128.474 1.00 77.99  ? 23  LEU G CG    1 
ATOM 4575  C CD1   . LEU G 3 23  ? 90.043  103.706 129.241 1.00 77.99  ? 23  LEU G CD1   1 
ATOM 4576  C CD2   . LEU G 3 23  ? 92.277  103.441 128.207 1.00 77.99  ? 23  LEU G CD2   1 
ATOM 4577  N N     . GLN G 3 24  ? 91.703  98.748  128.537 1.00 78.12  ? 24  GLN G N     1 
ATOM 4578  C CA    . GLN G 3 24  ? 92.454  97.503  128.618 1.00 78.12  ? 24  GLN G CA    1 
ATOM 4579  C C     . GLN G 3 24  ? 93.948  97.751  128.471 1.00 78.12  ? 24  GLN G C     1 
ATOM 4580  O O     . GLN G 3 24  ? 94.657  96.924  127.891 1.00 78.12  ? 24  GLN G O     1 
ATOM 4581  C CB    . GLN G 3 24  ? 92.004  96.505  127.552 1.00 78.12  ? 24  GLN G CB    1 
ATOM 4582  C CG    . GLN G 3 24  ? 90.547  96.084  127.636 1.00 78.12  ? 24  GLN G CG    1 
ATOM 4583  C CD    . GLN G 3 24  ? 90.224  95.300  128.891 1.00 78.12  ? 24  GLN G CD    1 
ATOM 4584  O OE1   . GLN G 3 24  ? 90.999  94.447  129.320 1.00 78.12  ? 24  GLN G OE1   1 
ATOM 4585  N NE2   . GLN G 3 24  ? 89.076  95.589  129.489 1.00 78.12  ? 24  GLN G NE2   1 
ATOM 4586  N N     . PHE G 3 25  ? 94.440  98.881  128.974 1.00 74.98  ? 25  PHE G N     1 
ATOM 4587  C CA    . PHE G 3 25  ? 95.851  99.225  128.948 1.00 74.98  ? 25  PHE G CA    1 
ATOM 4588  C C     . PHE G 3 25  ? 96.387  99.486  130.348 1.00 74.98  ? 25  PHE G C     1 
ATOM 4589  O O     . PHE G 3 25  ? 95.659  99.981  131.210 1.00 74.98  ? 25  PHE G O     1 
ATOM 4590  C CB    . PHE G 3 25  ? 96.123  100.447 128.059 1.00 74.98  ? 25  PHE G CB    1 
ATOM 4591  C CG    . PHE G 3 25  ? 96.476  100.093 126.654 1.00 74.98  ? 25  PHE G CG    1 
ATOM 4592  C CD1   . PHE G 3 25  ? 96.674  98.780  126.294 1.00 74.98  ? 25  PHE G CD1   1 
ATOM 4593  C CD2   . PHE G 3 25  ? 96.712  101.075 125.719 1.00 74.98  ? 25  PHE G CD2   1 
ATOM 4594  C CE1   . PHE G 3 25  ? 97.031  98.451  125.014 1.00 74.98  ? 25  PHE G CE1   1 
ATOM 4595  C CE2   . PHE G 3 25  ? 97.082  100.747 124.441 1.00 74.98  ? 25  PHE G CE2   1 
ATOM 4596  C CZ    . PHE G 3 25  ? 97.237  99.433  124.088 1.00 74.98  ? 25  PHE G CZ    1 
ATOM 4597  N N     . PRO G 3 26  ? 97.657  99.163  130.608 1.00 71.76  ? 26  PRO G N     1 
ATOM 4598  C CA    . PRO G 3 26  ? 98.193  99.297  131.966 1.00 71.76  ? 26  PRO G CA    1 
ATOM 4599  C C     . PRO G 3 26  ? 98.453  100.751 132.326 1.00 71.76  ? 26  PRO G C     1 
ATOM 4600  O O     . PRO G 3 26  ? 99.396  101.371 131.833 1.00 71.76  ? 26  PRO G O     1 
ATOM 4601  C CB    . PRO G 3 26  ? 99.491  98.483  131.906 1.00 71.76  ? 26  PRO G CB    1 
ATOM 4602  C CG    . PRO G 3 26  ? 99.887  98.509  130.487 1.00 71.76  ? 26  PRO G CG    1 
ATOM 4603  C CD    . PRO G 3 26  ? 98.630  98.524  129.701 1.00 71.76  ? 26  PRO G CD    1 
ATOM 4604  N N     . VAL G 3 27  ? 97.613  101.293 133.202 1.00 66.16  ? 27  VAL G N     1 
ATOM 4605  C CA    . VAL G 3 27  ? 97.828  102.657 133.656 1.00 66.16  ? 27  VAL G CA    1 
ATOM 4606  C C     . VAL G 3 27  ? 99.058  102.721 134.541 1.00 66.16  ? 27  VAL G C     1 
ATOM 4607  O O     . VAL G 3 27  ? 99.822  103.689 134.494 1.00 66.16  ? 27  VAL G O     1 
ATOM 4608  C CB    . VAL G 3 27  ? 96.567  103.163 134.375 1.00 66.16  ? 27  VAL G CB    1 
ATOM 4609  C CG1   . VAL G 3 27  ? 96.738  104.577 134.870 1.00 66.16  ? 27  VAL G CG1   1 
ATOM 4610  C CG2   . VAL G 3 27  ? 95.390  103.081 133.440 1.00 66.16  ? 27  VAL G CG2   1 
ATOM 4611  N N     . GLY G 3 28  ? 99.305  101.673 135.318 1.00 70.96  ? 28  GLY G N     1 
ATOM 4612  C CA    . GLY G 3 28  ? 100.443 101.693 136.215 1.00 70.96  ? 28  GLY G CA    1 
ATOM 4613  C C     . GLY G 3 28  ? 101.762 101.540 135.491 1.00 70.96  ? 28  GLY G C     1 
ATOM 4614  O O     . GLY G 3 28  ? 102.739 102.206 135.831 1.00 70.96  ? 28  GLY G O     1 
ATOM 4615  N N     . ARG G 3 29  ? 101.810 100.666 134.484 1.00 77.63  ? 29  ARG G N     1 
ATOM 4616  C CA    . ARG G 3 29  ? 103.062 100.439 133.770 1.00 77.63  ? 29  ARG G CA    1 
ATOM 4617  C C     . ARG G 3 29  ? 103.417 101.631 132.884 1.00 77.63  ? 29  ARG G C     1 
ATOM 4618  O O     . ARG G 3 29  ? 104.573 102.078 132.865 1.00 77.63  ? 29  ARG G O     1 
ATOM 4619  C CB    . ARG G 3 29  ? 102.972 99.162  132.936 1.00 77.63  ? 29  ARG G CB    1 
ATOM 4620  C CG    . ARG G 3 29  ? 104.279 98.784  132.273 1.00 77.63  ? 29  ARG G CG    1 
ATOM 4621  C CD    . ARG G 3 29  ? 104.125 97.646  131.276 1.00 77.63  ? 29  ARG G CD    1 
ATOM 4622  N NE    . ARG G 3 29  ? 103.783 96.375  131.896 1.00 77.63  ? 29  ARG G NE    1 
ATOM 4623  C CZ    . ARG G 3 29  ? 103.486 95.279  131.208 1.00 77.63  ? 29  ARG G CZ    1 
ATOM 4624  N NH1   . ARG G 3 29  ? 103.497 95.306  129.889 1.00 77.63  ? 29  ARG G NH1   1 
ATOM 4625  N NH2   . ARG G 3 29  ? 103.185 94.156  131.837 1.00 77.63  ? 29  ARG G NH2   1 
ATOM 4626  N N     . VAL G 3 30  ? 102.431 102.155 132.147 1.00 70.70  ? 30  VAL G N     1 
ATOM 4627  C CA    . VAL G 3 30  ? 102.628 103.370 131.362 1.00 70.70  ? 30  VAL G CA    1 
ATOM 4628  C C     . VAL G 3 30  ? 102.969 104.536 132.276 1.00 70.70  ? 30  VAL G C     1 
ATOM 4629  O O     . VAL G 3 30  ? 103.859 105.334 131.978 1.00 70.70  ? 30  VAL G O     1 
ATOM 4630  C CB    . VAL G 3 30  ? 101.377 103.650 130.510 1.00 70.70  ? 30  VAL G CB    1 
ATOM 4631  C CG1   . VAL G 3 30  ? 101.419 105.016 129.905 1.00 70.70  ? 30  VAL G CG1   1 
ATOM 4632  C CG2   . VAL G 3 30  ? 101.267 102.638 129.402 1.00 70.70  ? 30  VAL G CG2   1 
ATOM 4633  N N     . HIS G 3 31  ? 102.318 104.595 133.434 1.00 68.31  ? 31  HIS G N     1 
ATOM 4634  C CA    . HIS G 3 31  ? 102.544 105.657 134.407 1.00 68.31  ? 31  HIS G CA    1 
ATOM 4635  C C     . HIS G 3 31  ? 103.965 105.635 134.949 1.00 68.31  ? 31  HIS G C     1 
ATOM 4636  O O     . HIS G 3 31  ? 104.616 106.684 135.064 1.00 68.31  ? 31  HIS G O     1 
ATOM 4637  C CB    . HIS G 3 31  ? 101.558 105.489 135.547 1.00 68.31  ? 31  HIS G CB    1 
ATOM 4638  C CG    . HIS G 3 31  ? 101.676 106.535 136.590 1.00 68.31  ? 31  HIS G CG    1 
ATOM 4639  N ND1   . HIS G 3 31  ? 101.182 107.806 136.420 1.00 68.31  ? 31  HIS G ND1   1 
ATOM 4640  C CD2   . HIS G 3 31  ? 102.232 106.504 137.820 1.00 68.31  ? 31  HIS G CD2   1 
ATOM 4641  C CE1   . HIS G 3 31  ? 101.426 108.515 137.505 1.00 68.31  ? 31  HIS G CE1   1 
ATOM 4642  N NE2   . HIS G 3 31  ? 102.063 107.748 138.370 1.00 68.31  ? 31  HIS G NE2   1 
ATOM 4643  N N     . ARG G 3 32  ? 104.451 104.443 135.291 1.00 74.54  ? 32  ARG G N     1 
ATOM 4644  C CA    . ARG G 3 32  ? 105.836 104.270 135.703 1.00 74.54  ? 32  ARG G CA    1 
ATOM 4645  C C     . ARG G 3 32  ? 106.779 104.667 134.581 1.00 74.54  ? 32  ARG G C     1 
ATOM 4646  O O     . ARG G 3 32  ? 107.810 105.307 134.821 1.00 74.54  ? 32  ARG G O     1 
ATOM 4647  C CB    . ARG G 3 32  ? 106.051 102.816 136.125 1.00 74.54  ? 32  ARG G CB    1 
ATOM 4648  C CG    . ARG G 3 32  ? 107.356 102.487 136.829 1.00 74.54  ? 32  ARG G CG    1 
ATOM 4649  C CD    . ARG G 3 32  ? 108.414 101.924 135.885 1.00 74.54  ? 32  ARG G CD    1 
ATOM 4650  N NE    . ARG G 3 32  ? 107.951 100.740 135.170 1.00 74.54  ? 32  ARG G NE    1 
ATOM 4651  C CZ    . ARG G 3 32  ? 108.584 100.196 134.137 1.00 74.54  ? 32  ARG G CZ    1 
ATOM 4652  N NH1   . ARG G 3 32  ? 109.722 100.715 133.704 1.00 74.54  ? 32  ARG G NH1   1 
ATOM 4653  N NH2   . ARG G 3 32  ? 108.084 99.123  133.543 1.00 74.54  ? 32  ARG G NH2   1 
ATOM 4654  N N     . LEU G 3 33  ? 106.420 104.333 133.343 1.00 73.90  ? 33  LEU G N     1 
ATOM 4655  C CA    . LEU G 3 33  ? 107.258 104.724 132.222 1.00 73.90  ? 33  LEU G CA    1 
ATOM 4656  C C     . LEU G 3 33  ? 107.217 106.218 131.944 1.00 73.90  ? 33  LEU G C     1 
ATOM 4657  O O     . LEU G 3 33  ? 108.155 106.738 131.337 1.00 73.90  ? 33  LEU G O     1 
ATOM 4658  C CB    . LEU G 3 33  ? 106.858 103.940 130.984 1.00 73.90  ? 33  LEU G CB    1 
ATOM 4659  C CG    . LEU G 3 33  ? 107.332 102.498 131.039 1.00 73.90  ? 33  LEU G CG    1 
ATOM 4660  C CD1   . LEU G 3 33  ? 106.711 101.692 129.918 1.00 73.90  ? 33  LEU G CD1   1 
ATOM 4661  C CD2   . LEU G 3 33  ? 108.844 102.502 130.923 1.00 73.90  ? 33  LEU G CD2   1 
ATOM 4662  N N     . LEU G 3 34  ? 106.167 106.924 132.363 1.00 68.62  ? 34  LEU G N     1 
ATOM 4663  C CA    . LEU G 3 34  ? 106.223 108.374 132.270 1.00 68.62  ? 34  LEU G CA    1 
ATOM 4664  C C     . LEU G 3 34  ? 107.053 108.969 133.387 1.00 68.62  ? 34  LEU G C     1 
ATOM 4665  O O     . LEU G 3 34  ? 107.659 110.025 133.196 1.00 68.62  ? 34  LEU G O     1 
ATOM 4666  C CB    . LEU G 3 34  ? 104.839 109.017 132.305 1.00 68.62  ? 34  LEU G CB    1 
ATOM 4667  C CG    . LEU G 3 34  ? 104.089 109.328 131.008 1.00 68.62  ? 34  LEU G CG    1 
ATOM 4668  C CD1   . LEU G 3 34  ? 105.000 110.036 130.017 1.00 68.62  ? 34  LEU G CD1   1 
ATOM 4669  C CD2   . LEU G 3 34  ? 103.396 108.159 130.396 1.00 68.62  ? 34  LEU G CD2   1 
ATOM 4670  N N     . ARG G 3 35  ? 107.075 108.343 134.561 1.00 71.07  ? 35  ARG G N     1 
ATOM 4671  C CA    . ARG G 3 35  ? 107.878 108.938 135.616 1.00 71.07  ? 35  ARG G CA    1 
ATOM 4672  C C     . ARG G 3 35  ? 109.348 108.609 135.489 1.00 71.07  ? 35  ARG G C     1 
ATOM 4673  O O     . ARG G 3 35  ? 110.174 109.309 136.077 1.00 71.07  ? 35  ARG G O     1 
ATOM 4674  C CB    . ARG G 3 35  ? 107.425 108.493 136.998 1.00 71.07  ? 35  ARG G CB    1 
ATOM 4675  C CG    . ARG G 3 35  ? 106.081 108.977 137.449 1.00 71.07  ? 35  ARG G CG    1 
ATOM 4676  C CD    . ARG G 3 35  ? 105.913 108.500 138.863 1.00 71.07  ? 35  ARG G CD    1 
ATOM 4677  N NE    . ARG G 3 35  ? 105.953 107.043 138.913 1.00 71.07  ? 35  ARG G NE    1 
ATOM 4678  C CZ    . ARG G 3 35  ? 106.147 106.342 140.022 1.00 71.07  ? 35  ARG G CZ    1 
ATOM 4679  N NH1   . ARG G 3 35  ? 106.341 106.969 141.172 1.00 71.07  ? 35  ARG G NH1   1 
ATOM 4680  N NH2   . ARG G 3 35  ? 106.168 105.018 139.978 1.00 71.07  ? 35  ARG G NH2   1 
ATOM 4681  N N     . LYS G 3 36  ? 109.704 107.569 134.756 1.00 71.35  ? 36  LYS G N     1 
ATOM 4682  C CA    . LYS G 3 36  ? 111.075 107.084 134.772 1.00 71.35  ? 36  LYS G CA    1 
ATOM 4683  C C     . LYS G 3 36  ? 111.759 107.243 133.427 1.00 71.35  ? 36  LYS G C     1 
ATOM 4684  O O     . LYS G 3 36  ? 112.448 106.345 132.949 1.00 71.35  ? 36  LYS G O     1 
ATOM 4685  C CB    . LYS G 3 36  ? 111.128 105.639 135.240 1.00 71.35  ? 36  LYS G CB    1 
ATOM 4686  C CG    . LYS G 3 36  ? 110.820 105.539 136.705 1.00 71.35  ? 36  LYS G CG    1 
ATOM 4687  C CD    . LYS G 3 36  ? 111.022 104.156 137.232 1.00 71.35  ? 36  LYS G CD    1 
ATOM 4688  C CE    . LYS G 3 36  ? 110.702 104.158 138.692 1.00 71.35  ? 36  LYS G CE    1 
ATOM 4689  N NZ    . LYS G 3 36  ? 111.693 105.045 139.345 1.00 71.35  ? 36  LYS G NZ    1 
ATOM 4690  N N     . GLY G 3 37  ? 111.581 108.398 132.814 1.00 73.92  ? 37  GLY G N     1 
ATOM 4691  C CA    . GLY G 3 37  ? 112.343 108.713 131.635 1.00 73.92  ? 37  GLY G CA    1 
ATOM 4692  C C     . GLY G 3 37  ? 112.778 110.154 131.671 1.00 73.92  ? 37  GLY G C     1 
ATOM 4693  O O     . GLY G 3 37  ? 113.265 110.674 130.665 1.00 73.92  ? 37  GLY G O     1 
ATOM 4694  N N     . ASN G 3 38  ? 112.606 110.784 132.835 1.00 76.68  ? 38  ASN G N     1 
ATOM 4695  C CA    . ASN G 3 38  ? 112.925 112.188 133.089 1.00 76.68  ? 38  ASN G CA    1 
ATOM 4696  C C     . ASN G 3 38  ? 112.250 113.102 132.062 1.00 76.68  ? 38  ASN G C     1 
ATOM 4697  O O     . ASN G 3 38  ? 112.885 113.719 131.220 1.00 76.68  ? 38  ASN G O     1 
ATOM 4698  C CB    . ASN G 3 38  ? 114.441 112.419 133.110 1.00 76.68  ? 38  ASN G CB    1 
ATOM 4699  C CG    . ASN G 3 38  ? 115.145 111.614 134.179 1.00 76.68  ? 38  ASN G CG    1 
ATOM 4700  O OD1   . ASN G 3 38  ? 116.011 110.794 133.886 1.00 76.68  ? 38  ASN G OD1   1 
ATOM 4701  N ND2   . ASN G 3 38  ? 114.769 111.837 135.425 1.00 76.68  ? 38  ASN G ND2   1 
ATOM 4702  N N     . TYR G 3 39  ? 110.929 113.130 132.110 1.00 72.63  ? 39  TYR G N     1 
ATOM 4703  C CA    . TYR G 3 39  ? 110.196 114.019 131.222 1.00 72.63  ? 39  TYR G CA    1 
ATOM 4704  C C     . TYR G 3 39  ? 109.675 115.256 131.923 1.00 72.63  ? 39  TYR G C     1 
ATOM 4705  O O     . TYR G 3 39  ? 109.524 116.300 131.283 1.00 72.63  ? 39  TYR G O     1 
ATOM 4706  C CB    . TYR G 3 39  ? 109.036 113.270 130.584 1.00 72.63  ? 39  TYR G CB    1 
ATOM 4707  C CG    . TYR G 3 39  ? 109.497 112.214 129.631 1.00 72.63  ? 39  TYR G CG    1 
ATOM 4708  C CD1   . TYR G 3 39  ? 109.793 112.532 128.321 1.00 72.63  ? 39  TYR G CD1   1 
ATOM 4709  C CD2   . TYR G 3 39  ? 109.665 110.905 130.046 1.00 72.63  ? 39  TYR G CD2   1 
ATOM 4710  C CE1   . TYR G 3 39  ? 110.210 111.576 127.442 1.00 72.63  ? 39  TYR G CE1   1 
ATOM 4711  C CE2   . TYR G 3 39  ? 110.085 109.942 129.174 1.00 72.63  ? 39  TYR G CE2   1 
ATOM 4712  C CZ    . TYR G 3 39  ? 110.357 110.283 127.874 1.00 72.63  ? 39  TYR G CZ    1 
ATOM 4713  O OH    . TYR G 3 39  ? 110.785 109.326 126.993 1.00 72.63  ? 39  TYR G OH    1 
ATOM 4714  N N     . ALA G 3 40  ? 109.399 115.147 133.219 1.00 80.88  ? 40  ALA G N     1 
ATOM 4715  C CA    . ALA G 3 40  ? 109.011 116.252 134.079 1.00 80.88  ? 40  ALA G CA    1 
ATOM 4716  C C     . ALA G 3 40  ? 109.199 115.791 135.508 1.00 80.88  ? 40  ALA G C     1 
ATOM 4717  O O     . ALA G 3 40  ? 108.986 114.618 135.815 1.00 80.88  ? 40  ALA G O     1 
ATOM 4718  C CB    . ALA G 3 40  ? 107.564 116.690 133.852 1.00 80.88  ? 40  ALA G CB    1 
ATOM 4719  N N     . GLU G 3 41  ? 109.605 116.725 136.372 1.00 84.09  ? 41  GLU G N     1 
ATOM 4720  C CA    . GLU G 3 41  ? 109.851 116.376 137.769 1.00 84.09  ? 41  GLU G CA    1 
ATOM 4721  C C     . GLU G 3 41  ? 108.570 115.955 138.477 1.00 84.09  ? 41  GLU G C     1 
ATOM 4722  O O     . GLU G 3 41  ? 108.604 115.109 139.377 1.00 84.09  ? 41  GLU G O     1 
ATOM 4723  C CB    . GLU G 3 41  ? 110.500 117.551 138.498 1.00 84.09  ? 41  GLU G CB    1 
ATOM 4724  C CG    . GLU G 3 41  ? 110.988 117.217 139.905 1.00 84.09  ? 41  GLU G CG    1 
ATOM 4725  C CD    . GLU G 3 41  ? 111.585 118.406 140.605 1.00 84.09  ? 41  GLU G CD    1 
ATOM 4726  O OE1   . GLU G 3 41  ? 111.607 119.497 140.003 1.00 84.09  ? 41  GLU G OE1   1 
ATOM 4727  O OE2   . GLU G 3 41  ? 112.020 118.253 141.762 1.00 84.09  ? 41  GLU G OE2   1 
ATOM 4728  N N     . ARG G 3 42  ? 107.437 116.505 138.070 1.00 81.56  ? 42  ARG G N     1 
ATOM 4729  C CA    . ARG G 3 42  ? 106.145 116.081 138.574 1.00 81.56  ? 42  ARG G CA    1 
ATOM 4730  C C     . ARG G 3 42  ? 105.326 115.539 137.414 1.00 81.56  ? 42  ARG G C     1 
ATOM 4731  O O     . ARG G 3 42  ? 105.442 116.022 136.290 1.00 81.56  ? 42  ARG G O     1 
ATOM 4732  C CB    . ARG G 3 42  ? 105.451 117.241 139.264 1.00 81.56  ? 42  ARG G CB    1 
ATOM 4733  C CG    . ARG G 3 42  ? 106.231 117.694 140.492 1.00 81.56  ? 42  ARG G CG    1 
ATOM 4734  C CD    . ARG G 3 42  ? 105.644 118.904 141.179 1.00 81.56  ? 42  ARG G CD    1 
ATOM 4735  N NE    . ARG G 3 42  ? 104.344 118.612 141.765 1.00 81.56  ? 42  ARG G NE    1 
ATOM 4736  C CZ    . ARG G 3 42  ? 104.178 118.124 142.986 1.00 81.56  ? 42  ARG G CZ    1 
ATOM 4737  N NH1   . ARG G 3 42  ? 105.231 117.875 143.749 1.00 81.56  ? 42  ARG G NH1   1 
ATOM 4738  N NH2   . ARG G 3 42  ? 102.960 117.887 143.445 1.00 81.56  ? 42  ARG G NH2   1 
ATOM 4739  N N     . VAL G 3 43  ? 104.548 114.489 137.666 1.00 76.98  ? 43  VAL G N     1 
ATOM 4740  C CA    . VAL G 3 43  ? 103.671 113.901 136.661 1.00 76.98  ? 43  VAL G CA    1 
ATOM 4741  C C     . VAL G 3 43  ? 102.273 113.841 137.246 1.00 76.98  ? 43  VAL G C     1 
ATOM 4742  O O     . VAL G 3 43  ? 102.078 113.273 138.324 1.00 76.98  ? 43  VAL G O     1 
ATOM 4743  C CB    . VAL G 3 43  ? 104.134 112.496 136.239 1.00 76.98  ? 43  VAL G CB    1 
ATOM 4744  C CG1   . VAL G 3 43  ? 103.173 111.896 135.236 1.00 76.98  ? 43  VAL G CG1   1 
ATOM 4745  C CG2   . VAL G 3 43  ? 105.525 112.546 135.668 1.00 76.98  ? 43  VAL G CG2   1 
ATOM 4746  N N     . GLY G 3 44  ? 101.303 114.386 136.521 1.00 83.54  ? 44  GLY G N     1 
ATOM 4747  C CA    . GLY G 3 44  ? 99.989  114.680 137.051 1.00 83.54  ? 44  GLY G CA    1 
ATOM 4748  C C     . GLY G 3 44  ? 99.144  113.458 137.379 1.00 83.54  ? 44  GLY G C     1 
ATOM 4749  O O     . GLY G 3 44  ? 99.585  112.308 137.365 1.00 83.54  ? 44  GLY G O     1 
ATOM 4750  N N     . ALA G 3 45  ? 97.878  113.739 137.678 1.00 80.38  ? 45  ALA G N     1 
ATOM 4751  C CA    . ALA G 3 45  ? 96.985  112.710 138.193 1.00 80.38  ? 45  ALA G CA    1 
ATOM 4752  C C     . ALA G 3 45  ? 96.537  111.748 137.102 1.00 80.38  ? 45  ALA G C     1 
ATOM 4753  O O     . ALA G 3 45  ? 96.771  110.540 137.192 1.00 80.38  ? 45  ALA G O     1 
ATOM 4754  C CB    . ALA G 3 45  ? 95.771  113.359 138.854 1.00 80.38  ? 45  ALA G CB    1 
ATOM 4755  N N     . GLY G 3 46  ? 95.884  112.268 136.067 1.00 71.50  ? 46  GLY G N     1 
ATOM 4756  C CA    . GLY G 3 46  ? 95.218  111.422 135.099 1.00 71.50  ? 46  GLY G CA    1 
ATOM 4757  C C     . GLY G 3 46  ? 95.847  111.415 133.727 1.00 71.50  ? 46  GLY G C     1 
ATOM 4758  O O     . GLY G 3 46  ? 95.162  111.170 132.733 1.00 71.50  ? 46  GLY G O     1 
ATOM 4759  N N     . ALA G 3 47  ? 97.153  111.667 133.665 1.00 69.99  ? 47  ALA G N     1 
ATOM 4760  C CA    . ALA G 3 47  ? 97.821  111.740 132.364 1.00 69.99  ? 47  ALA G CA    1 
ATOM 4761  C C     . ALA G 3 47  ? 97.946  110.389 131.660 1.00 69.99  ? 47  ALA G C     1 
ATOM 4762  O O     . ALA G 3 47  ? 97.570  110.311 130.471 1.00 69.99  ? 47  ALA G O     1 
ATOM 4763  C CB    . ALA G 3 47  ? 99.166  112.459 132.519 1.00 69.99  ? 47  ALA G CB    1 
ATOM 4764  N N     . PRO G 3 48  ? 98.433  109.296 132.276 1.00 69.33  ? 48  PRO G N     1 
ATOM 4765  C CA    . PRO G 3 48  ? 98.495  108.041 131.515 1.00 69.33  ? 48  PRO G CA    1 
ATOM 4766  C C     . PRO G 3 48  ? 97.144  107.392 131.282 1.00 69.33  ? 48  PRO G C     1 
ATOM 4767  O O     . PRO G 3 48  ? 97.072  106.445 130.488 1.00 69.33  ? 48  PRO G O     1 
ATOM 4768  C CB    . PRO G 3 48  ? 99.393  107.148 132.369 1.00 69.33  ? 48  PRO G CB    1 
ATOM 4769  C CG    . PRO G 3 48  ? 99.193  107.618 133.699 1.00 69.33  ? 48  PRO G CG    1 
ATOM 4770  C CD    . PRO G 3 48  ? 99.041  109.084 133.610 1.00 69.33  ? 48  PRO G CD    1 
ATOM 4771  N N     . VAL G 3 49  ? 96.086  107.850 131.950 1.00 68.75  ? 49  VAL G N     1 
ATOM 4772  C CA    . VAL G 3 49  ? 94.736  107.482 131.540 1.00 68.75  ? 49  VAL G CA    1 
ATOM 4773  C C     . VAL G 3 49  ? 94.466  107.998 130.134 1.00 68.75  ? 49  VAL G C     1 
ATOM 4774  O O     . VAL G 3 49  ? 94.041  107.247 129.241 1.00 68.75  ? 49  VAL G O     1 
ATOM 4775  C CB    . VAL G 3 49  ? 93.709  108.034 132.542 1.00 68.75  ? 49  VAL G CB    1 
ATOM 4776  C CG1   . VAL G 3 49  ? 92.294  107.714 132.089 1.00 68.75  ? 49  VAL G CG1   1 
ATOM 4777  C CG2   . VAL G 3 49  ? 93.971  107.479 133.918 1.00 68.75  ? 49  VAL G CG2   1 
ATOM 4778  N N     . TYR G 3 50  ? 94.740  109.288 129.923 1.00 66.54  ? 50  TYR G N     1 
ATOM 4779  C CA    . TYR G 3 50  ? 94.546  109.919 128.626 1.00 66.54  ? 50  TYR G CA    1 
ATOM 4780  C C     . TYR G 3 50  ? 95.439  109.277 127.579 1.00 66.54  ? 50  TYR G C     1 
ATOM 4781  O O     . TYR G 3 50  ? 94.993  108.952 126.466 1.00 66.54  ? 50  TYR G O     1 
ATOM 4782  C CB    . TYR G 3 50  ? 94.859  111.407 128.739 1.00 66.54  ? 50  TYR G CB    1 
ATOM 4783  C CG    . TYR G 3 50  ? 94.447  112.232 127.546 1.00 66.54  ? 50  TYR G CG    1 
ATOM 4784  C CD1   . TYR G 3 50  ? 93.152  112.701 127.421 1.00 66.54  ? 50  TYR G CD1   1 
ATOM 4785  C CD2   . TYR G 3 50  ? 95.343  112.530 126.537 1.00 66.54  ? 50  TYR G CD2   1 
ATOM 4786  C CE1   . TYR G 3 50  ? 92.769  113.461 126.336 1.00 66.54  ? 50  TYR G CE1   1 
ATOM 4787  C CE2   . TYR G 3 50  ? 94.967  113.279 125.442 1.00 66.54  ? 50  TYR G CE2   1 
ATOM 4788  C CZ    . TYR G 3 50  ? 93.679  113.741 125.352 1.00 66.54  ? 50  TYR G CZ    1 
ATOM 4789  O OH    . TYR G 3 50  ? 93.281  114.486 124.274 1.00 66.54  ? 50  TYR G OH    1 
ATOM 4790  N N     . LEU G 3 51  ? 96.691  109.024 127.945 1.00 62.46  ? 51  LEU G N     1 
ATOM 4791  C CA    . LEU G 3 51  ? 97.635  108.533 126.958 1.00 62.46  ? 51  LEU G CA    1 
ATOM 4792  C C     . LEU G 3 51  ? 97.375  107.073 126.615 1.00 62.46  ? 51  LEU G C     1 
ATOM 4793  O O     . LEU G 3 51  ? 97.507  106.677 125.449 1.00 62.46  ? 51  LEU G O     1 
ATOM 4794  C CB    . LEU G 3 51  ? 99.056  108.769 127.470 1.00 62.46  ? 51  LEU G CB    1 
ATOM 4795  C CG    . LEU G 3 51  ? 100.219 108.749 126.484 1.00 62.46  ? 51  LEU G CG    1 
ATOM 4796  C CD1   . LEU G 3 51  ? 100.820 107.389 126.333 1.00 62.46  ? 51  LEU G CD1   1 
ATOM 4797  C CD2   . LEU G 3 51  ? 99.689  109.245 125.147 1.00 62.46  ? 51  LEU G CD2   1 
ATOM 4798  N N     . ALA G 3 52  ? 96.967  106.279 127.602 1.00 65.31  ? 52  ALA G N     1 
ATOM 4799  C CA    . ALA G 3 52  ? 96.565  104.909 127.328 1.00 65.31  ? 52  ALA G CA    1 
ATOM 4800  C C     . ALA G 3 52  ? 95.316  104.855 126.463 1.00 65.31  ? 52  ALA G C     1 
ATOM 4801  O O     . ALA G 3 52  ? 95.158  103.920 125.668 1.00 65.31  ? 52  ALA G O     1 
ATOM 4802  C CB    . ALA G 3 52  ? 96.335  104.166 128.636 1.00 65.31  ? 52  ALA G CB    1 
ATOM 4803  N N     . ALA G 3 53  ? 94.429  105.847 126.593 1.00 68.38  ? 53  ALA G N     1 
ATOM 4804  C CA    . ALA G 3 53  ? 93.289  105.919 125.685 1.00 68.38  ? 53  ALA G CA    1 
ATOM 4805  C C     . ALA G 3 53  ? 93.737  106.154 124.249 1.00 68.38  ? 53  ALA G C     1 
ATOM 4806  O O     . ALA G 3 53  ? 93.232  105.500 123.319 1.00 68.38  ? 53  ALA G O     1 
ATOM 4807  C CB    . ALA G 3 53  ? 92.329  107.016 126.131 1.00 68.38  ? 53  ALA G CB    1 
ATOM 4808  N N     . VAL G 3 54  ? 94.702  107.062 124.056 1.00 66.65  ? 54  VAL G N     1 
ATOM 4809  C CA    . VAL G 3 54  ? 95.173  107.369 122.706 1.00 66.65  ? 54  VAL G CA    1 
ATOM 4810  C C     . VAL G 3 54  ? 95.848  106.155 122.079 1.00 66.65  ? 54  VAL G C     1 
ATOM 4811  O O     . VAL G 3 54  ? 95.569  105.791 120.924 1.00 66.65  ? 54  VAL G O     1 
ATOM 4812  C CB    . VAL G 3 54  ? 96.108  108.586 122.743 1.00 66.65  ? 54  VAL G CB    1 
ATOM 4813  C CG1   . VAL G 3 54  ? 96.683  108.848 121.385 1.00 66.65  ? 54  VAL G CG1   1 
ATOM 4814  C CG2   . VAL G 3 54  ? 95.347  109.790 123.225 1.00 66.65  ? 54  VAL G CG2   1 
ATOM 4815  N N     . LEU G 3 55  ? 96.685  105.467 122.849 1.00 69.87  ? 55  LEU G N     1 
ATOM 4816  C CA    . LEU G 3 55  ? 97.360  104.298 122.300 1.00 69.87  ? 55  LEU G CA    1 
ATOM 4817  C C     . LEU G 3 55  ? 96.404  103.131 122.077 1.00 69.87  ? 55  LEU G C     1 
ATOM 4818  O O     . LEU G 3 55  ? 96.633  102.318 121.170 1.00 69.87  ? 55  LEU G O     1 
ATOM 4819  C CB    . LEU G 3 55  ? 98.520  103.890 123.201 1.00 69.87  ? 55  LEU G CB    1 
ATOM 4820  C CG    . LEU G 3 55  ? 99.891  104.481 122.860 1.00 69.87  ? 55  LEU G CG    1 
ATOM 4821  C CD1   . LEU G 3 55  ? 99.962  105.970 123.029 1.00 69.87  ? 55  LEU G CD1   1 
ATOM 4822  C CD2   . LEU G 3 55  ? 100.903 103.832 123.751 1.00 69.87  ? 55  LEU G CD2   1 
ATOM 4823  N N     . GLU G 3 56  ? 95.320  103.044 122.856 1.00 75.66  ? 56  GLU G N     1 
ATOM 4824  C CA    . GLU G 3 56  ? 94.337  101.998 122.589 1.00 75.66  ? 56  GLU G CA    1 
ATOM 4825  C C     . GLU G 3 56  ? 93.609  102.264 121.285 1.00 75.66  ? 56  GLU G C     1 
ATOM 4826  O O     . GLU G 3 56  ? 93.337  101.328 120.520 1.00 75.66  ? 56  GLU G O     1 
ATOM 4827  C CB    . GLU G 3 56  ? 93.333  101.867 123.735 1.00 75.66  ? 56  GLU G CB    1 
ATOM 4828  C CG    . GLU G 3 56  ? 92.422  100.648 123.554 1.00 75.66  ? 56  GLU G CG    1 
ATOM 4829  C CD    . GLU G 3 56  ? 91.392  100.479 124.643 1.00 75.66  ? 56  GLU G CD    1 
ATOM 4830  O OE1   . GLU G 3 56  ? 91.316  101.351 125.526 1.00 75.66  ? 56  GLU G OE1   1 
ATOM 4831  O OE2   . GLU G 3 56  ? 90.664  99.464  124.620 1.00 75.66  ? 56  GLU G OE2   1 
ATOM 4832  N N     . TYR G 3 57  ? 93.306  103.537 121.010 1.00 75.40  ? 57  TYR G N     1 
ATOM 4833  C CA    . TYR G 3 57  ? 92.692  103.874 119.732 1.00 75.40  ? 57  TYR G CA    1 
ATOM 4834  C C     . TYR G 3 57  ? 93.609  103.539 118.567 1.00 75.40  ? 57  TYR G C     1 
ATOM 4835  O O     . TYR G 3 57  ? 93.159  102.973 117.564 1.00 75.40  ? 57  TYR G O     1 
ATOM 4836  C CB    . TYR G 3 57  ? 92.326  105.347 119.683 1.00 75.40  ? 57  TYR G CB    1 
ATOM 4837  C CG    . TYR G 3 57  ? 91.713  105.709 118.362 1.00 75.40  ? 57  TYR G CG    1 
ATOM 4838  C CD1   . TYR G 3 57  ? 90.436  105.286 118.044 1.00 75.40  ? 57  TYR G CD1   1 
ATOM 4839  C CD2   . TYR G 3 57  ? 92.410  106.455 117.425 1.00 75.40  ? 57  TYR G CD2   1 
ATOM 4840  C CE1   . TYR G 3 57  ? 89.864  105.601 116.833 1.00 75.40  ? 57  TYR G CE1   1 
ATOM 4841  C CE2   . TYR G 3 57  ? 91.844  106.772 116.212 1.00 75.40  ? 57  TYR G CE2   1 
ATOM 4842  C CZ    . TYR G 3 57  ? 90.574  106.341 115.922 1.00 75.40  ? 57  TYR G CZ    1 
ATOM 4843  O OH    . TYR G 3 57  ? 90.004  106.660 114.713 1.00 75.40  ? 57  TYR G OH    1 
ATOM 4844  N N     . LEU G 3 58  ? 94.899  103.860 118.691 1.00 74.78  ? 58  LEU G N     1 
ATOM 4845  C CA    . LEU G 3 58  ? 95.821  103.635 117.579 1.00 74.78  ? 58  LEU G CA    1 
ATOM 4846  C C     . LEU G 3 58  ? 96.044  102.150 117.323 1.00 74.78  ? 58  LEU G C     1 
ATOM 4847  O O     . LEU G 3 58  ? 96.017  101.700 116.164 1.00 74.78  ? 58  LEU G O     1 
ATOM 4848  C CB    . LEU G 3 58  ? 97.139  104.343 117.867 1.00 74.78  ? 58  LEU G CB    1 
ATOM 4849  C CG    . LEU G 3 58  ? 96.929  105.851 117.864 1.00 74.78  ? 58  LEU G CG    1 
ATOM 4850  C CD1   . LEU G 3 58  ? 98.131  106.596 118.377 1.00 74.78  ? 58  LEU G CD1   1 
ATOM 4851  C CD2   . LEU G 3 58  ? 96.643  106.249 116.459 1.00 74.78  ? 58  LEU G CD2   1 
ATOM 4852  N N     . THR G 3 59  ? 96.251  101.386 118.402 1.00 77.45  ? 59  THR G N     1 
ATOM 4853  C CA    . THR G 3 59  ? 96.368  99.935  118.312 1.00 77.45  ? 59  THR G CA    1 
ATOM 4854  C C     . THR G 3 59  ? 95.133  99.318  117.669 1.00 77.45  ? 59  THR G C     1 
ATOM 4855  O O     . THR G 3 59  ? 95.247  98.465  116.777 1.00 77.45  ? 59  THR G O     1 
ATOM 4856  C CB    . THR G 3 59  ? 96.573  99.360  119.709 1.00 77.45  ? 59  THR G CB    1 
ATOM 4857  O OG1   . THR G 3 59  ? 97.729  99.955  120.307 1.00 77.45  ? 59  THR G OG1   1 
ATOM 4858  C CG2   . THR G 3 59  ? 96.759  97.861  119.647 1.00 77.45  ? 59  THR G CG2   1 
ATOM 4859  N N     . ALA G 3 60  ? 93.948  99.783  118.074 1.00 79.64  ? 60  ALA G N     1 
ATOM 4860  C CA    . ALA G 3 60  ? 92.705  99.272  117.506 1.00 79.64  ? 60  ALA G CA    1 
ATOM 4861  C C     . ALA G 3 60  ? 92.571  99.609  116.028 1.00 79.64  ? 60  ALA G C     1 
ATOM 4862  O O     . ALA G 3 60  ? 92.010  98.815  115.262 1.00 79.64  ? 60  ALA G O     1 
ATOM 4863  C CB    . ALA G 3 60  ? 91.512  99.826  118.281 1.00 79.64  ? 60  ALA G CB    1 
ATOM 4864  N N     . GLU G 3 61  ? 93.096  100.760 115.604 1.00 81.21  ? 61  GLU G N     1 
ATOM 4865  C CA    . GLU G 3 61  ? 93.014  101.122 114.193 1.00 81.21  ? 61  GLU G CA    1 
ATOM 4866  C C     . GLU G 3 61  ? 93.900  100.233 113.335 1.00 81.21  ? 61  GLU G C     1 
ATOM 4867  O O     . GLU G 3 61  ? 93.440  99.680  112.323 1.00 81.21  ? 61  GLU G O     1 
ATOM 4868  C CB    . GLU G 3 61  ? 93.389  102.585 113.995 1.00 81.21  ? 61  GLU G CB    1 
ATOM 4869  C CG    . GLU G 3 61  ? 92.339  103.554 114.470 1.00 81.21  ? 61  GLU G CG    1 
ATOM 4870  C CD    . GLU G 3 61  ? 91.070  103.479 113.654 1.00 81.21  ? 61  GLU G CD    1 
ATOM 4871  O OE1   . GLU G 3 61  ? 91.153  103.203 112.440 1.00 81.21  ? 61  GLU G OE1   1 
ATOM 4872  O OE2   . GLU G 3 61  ? 89.984  103.697 114.226 1.00 81.21  ? 61  GLU G OE2   1 
ATOM 4873  N N     . ILE G 3 62  ? 95.173  100.087 113.718 1.00 79.72  ? 62  ILE G N     1 
ATOM 4874  C CA    . ILE G 3 62  ? 96.089  99.299  112.897 1.00 79.72  ? 62  ILE G CA    1 
ATOM 4875  C C     . ILE G 3 62  ? 95.700  97.829  112.898 1.00 79.72  ? 62  ILE G C     1 
ATOM 4876  O O     . ILE G 3 62  ? 95.638  97.198  111.835 1.00 79.72  ? 62  ILE G O     1 
ATOM 4877  C CB    . ILE G 3 62  ? 97.541  99.508  113.351 1.00 79.72  ? 62  ILE G CB    1 
ATOM 4878  C CG1   . ILE G 3 62  ? 98.011  100.888 112.933 1.00 79.72  ? 62  ILE G CG1   1 
ATOM 4879  C CG2   . ILE G 3 62  ? 98.461  98.480  112.767 1.00 79.72  ? 62  ILE G CG2   1 
ATOM 4880  C CD1   . ILE G 3 62  ? 99.379  101.204 113.414 1.00 79.72  ? 62  ILE G CD1   1 
ATOM 4881  N N     . LEU G 3 63  ? 95.379  97.271  114.071 1.00 82.51  ? 63  LEU G N     1 
ATOM 4882  C CA    . LEU G 3 63  ? 94.958  95.875  114.098 1.00 82.51  ? 63  LEU G CA    1 
ATOM 4883  C C     . LEU G 3 63  ? 93.615  95.674  113.409 1.00 82.51  ? 63  LEU G C     1 
ATOM 4884  O O     . LEU G 3 63  ? 93.352  94.588  112.879 1.00 82.51  ? 63  LEU G O     1 
ATOM 4885  C CB    . LEU G 3 63  ? 94.893  95.345  115.527 1.00 82.51  ? 63  LEU G CB    1 
ATOM 4886  C CG    . LEU G 3 63  ? 96.171  94.743  116.104 1.00 82.51  ? 63  LEU G CG    1 
ATOM 4887  C CD1   . LEU G 3 63  ? 97.126  95.795  116.534 1.00 82.51  ? 63  LEU G CD1   1 
ATOM 4888  C CD2   . LEU G 3 63  ? 95.853  93.843  117.258 1.00 82.51  ? 63  LEU G CD2   1 
ATOM 4889  N N     . GLU G 3 64  ? 92.775  96.707  113.379 1.00 87.05  ? 64  GLU G N     1 
ATOM 4890  C CA    . GLU G 3 64  ? 91.523  96.616  112.641 1.00 87.05  ? 64  GLU G CA    1 
ATOM 4891  C C     . GLU G 3 64  ? 91.772  96.502  111.145 1.00 87.05  ? 64  GLU G C     1 
ATOM 4892  O O     . GLU G 3 64  ? 91.209  95.625  110.477 1.00 87.05  ? 64  GLU G O     1 
ATOM 4893  C CB    . GLU G 3 64  ? 90.649  97.828  112.942 1.00 87.05  ? 64  GLU G CB    1 
ATOM 4894  C CG    . GLU G 3 64  ? 89.294  97.769  112.274 1.00 87.05  ? 64  GLU G CG    1 
ATOM 4895  C CD    . GLU G 3 64  ? 88.431  98.958  112.624 1.00 87.05  ? 64  GLU G CD    1 
ATOM 4896  O OE1   . GLU G 3 64  ? 88.912  99.839  113.369 1.00 87.05  ? 64  GLU G OE1   1 
ATOM 4897  O OE2   . GLU G 3 64  ? 87.274  99.013  112.156 1.00 87.05  ? 64  GLU G OE2   1 
ATOM 4898  N N     . LEU G 3 65  ? 92.626  97.375  110.602 1.00 81.58  ? 65  LEU G N     1 
ATOM 4899  C CA    . LEU G 3 65  ? 92.881  97.336  109.166 1.00 81.58  ? 65  LEU G CA    1 
ATOM 4900  C C     . LEU G 3 65  ? 93.681  96.108  108.762 1.00 81.58  ? 65  LEU G C     1 
ATOM 4901  O O     . LEU G 3 65  ? 93.506  95.594  107.651 1.00 81.58  ? 65  LEU G O     1 
ATOM 4902  C CB    . LEU G 3 65  ? 93.596  98.605  108.721 1.00 81.58  ? 65  LEU G CB    1 
ATOM 4903  C CG    . LEU G 3 65  ? 92.700  99.836  108.799 1.00 81.58  ? 65  LEU G CG    1 
ATOM 4904  C CD1   . LEU G 3 65  ? 93.482  101.079 108.437 1.00 81.58  ? 65  LEU G CD1   1 
ATOM 4905  C CD2   . LEU G 3 65  ? 91.498  99.666  107.887 1.00 81.58  ? 65  LEU G CD2   1 
ATOM 4906  N N     . ALA G 3 66  ? 94.543  95.610  109.645 1.00 85.16  ? 66  ALA G N     1 
ATOM 4907  C CA    . ALA G 3 66  ? 95.186  94.335  109.370 1.00 85.16  ? 66  ALA G CA    1 
ATOM 4908  C C     . ALA G 3 66  ? 94.216  93.176  109.501 1.00 85.16  ? 66  ALA G C     1 
ATOM 4909  O O     . ALA G 3 66  ? 94.474  92.108  108.945 1.00 85.16  ? 66  ALA G O     1 
ATOM 4910  C CB    . ALA G 3 66  ? 96.376  94.122  110.300 1.00 85.16  ? 66  ALA G CB    1 
ATOM 4911  N N     . GLY G 3 67  ? 93.120  93.354  110.238 1.00 88.37  ? 67  GLY G N     1 
ATOM 4912  C CA    . GLY G 3 67  ? 92.086  92.334  110.249 1.00 88.37  ? 67  GLY G CA    1 
ATOM 4913  C C     . GLY G 3 67  ? 91.293  92.310  108.958 1.00 88.37  ? 67  GLY G C     1 
ATOM 4914  O O     . GLY G 3 67  ? 91.018  91.237  108.405 1.00 88.37  ? 67  GLY G O     1 
ATOM 4915  N N     . ASN G 3 68  ? 90.915  93.493  108.463 1.00 90.56  ? 68  ASN G N     1 
ATOM 4916  C CA    . ASN G 3 68  ? 90.183  93.585  107.204 1.00 90.56  ? 68  ASN G CA    1 
ATOM 4917  C C     . ASN G 3 68  ? 91.028  93.083  106.047 1.00 90.56  ? 68  ASN G C     1 
ATOM 4918  O O     . ASN G 3 68  ? 90.567  92.282  105.224 1.00 90.56  ? 68  ASN G O     1 
ATOM 4919  C CB    . ASN G 3 68  ? 89.750  95.024  106.959 1.00 90.56  ? 68  ASN G CB    1 
ATOM 4920  C CG    . ASN G 3 68  ? 88.682  95.469  107.915 1.00 90.56  ? 68  ASN G CG    1 
ATOM 4921  O OD1   . ASN G 3 68  ? 87.738  94.730  108.193 1.00 90.56  ? 68  ASN G OD1   1 
ATOM 4922  N ND2   . ASN G 3 68  ? 88.826  96.680  108.440 1.00 90.56  ? 68  ASN G ND2   1 
ATOM 4923  N N     . ALA G 3 69  ? 92.289  93.509  105.993 1.00 88.25  ? 69  ALA G N     1 
ATOM 4924  C CA    . ALA G 3 69  ? 93.195  92.952  105.003 1.00 88.25  ? 69  ALA G CA    1 
ATOM 4925  C C     . ALA G 3 69  ? 93.533  91.500  105.299 1.00 88.25  ? 69  ALA G C     1 
ATOM 4926  O O     . ALA G 3 69  ? 93.914  90.767  104.382 1.00 88.25  ? 69  ALA G O     1 
ATOM 4927  C CB    . ALA G 3 69  ? 94.472  93.782  104.921 1.00 88.25  ? 69  ALA G CB    1 
ATOM 4928  N N     . ALA G 3 70  ? 93.369  91.062  106.547 1.00 88.15  ? 70  ALA G N     1 
ATOM 4929  C CA    . ALA G 3 70  ? 93.691  89.685  106.890 1.00 88.15  ? 70  ALA G CA    1 
ATOM 4930  C C     . ALA G 3 70  ? 92.659  88.720  106.326 1.00 88.15  ? 70  ALA G C     1 
ATOM 4931  O O     . ALA G 3 70  ? 93.017  87.645  105.831 1.00 88.15  ? 70  ALA G O     1 
ATOM 4932  C CB    . ALA G 3 70  ? 93.811  89.534  108.403 1.00 88.15  ? 70  ALA G CB    1 
ATOM 4933  N N     . ARG G 3 71  ? 91.375  89.075  106.388 1.00 90.68  ? 71  ARG G N     1 
ATOM 4934  C CA    . ARG G 3 71  ? 90.412  88.289  105.627 1.00 90.68  ? 71  ARG G CA    1 
ATOM 4935  C C     . ARG G 3 71  ? 90.593  88.507  104.137 1.00 90.68  ? 71  ARG G C     1 
ATOM 4936  O O     . ARG G 3 71  ? 90.537  87.553  103.355 1.00 90.68  ? 71  ARG G O     1 
ATOM 4937  C CB    . ARG G 3 71  ? 88.978  88.624  106.014 1.00 90.68  ? 71  ARG G CB    1 
ATOM 4938  C CG    . ARG G 3 71  ? 88.520  88.083  107.333 1.00 90.68  ? 71  ARG G CG    1 
ATOM 4939  C CD    . ARG G 3 71  ? 87.048  88.369  107.500 1.00 90.68  ? 71  ARG G CD    1 
ATOM 4940  N NE    . ARG G 3 71  ? 86.796  89.800  107.617 1.00 90.68  ? 71  ARG G NE    1 
ATOM 4941  C CZ    . ARG G 3 71  ? 86.142  90.516  106.711 1.00 90.68  ? 71  ARG G CZ    1 
ATOM 4942  N NH1   . ARG G 3 71  ? 85.681  89.927  105.622 1.00 90.68  ? 71  ARG G NH1   1 
ATOM 4943  N NH2   . ARG G 3 71  ? 85.955  91.815  106.891 1.00 90.68  ? 71  ARG G NH2   1 
ATOM 4944  N N     . ASP G 3 72  ? 90.847  89.747  103.724 1.00 98.62  ? 72  ASP G N     1 
ATOM 4945  C CA    . ASP G 3 72  ? 90.875  90.065  102.301 1.00 98.62  ? 72  ASP G CA    1 
ATOM 4946  C C     . ASP G 3 72  ? 92.159  89.639  101.603 1.00 98.62  ? 72  ASP G C     1 
ATOM 4947  O O     . ASP G 3 72  ? 92.358  90.004  100.443 1.00 98.62  ? 72  ASP G O     1 
ATOM 4948  C CB    . ASP G 3 72  ? 90.638  91.558  102.091 1.00 98.62  ? 72  ASP G CB    1 
ATOM 4949  C CG    . ASP G 3 72  ? 89.208  91.954  102.374 1.00 98.62  ? 72  ASP G CG    1 
ATOM 4950  O OD1   . ASP G 3 72  ? 88.315  91.099  102.199 1.00 98.62  ? 72  ASP G OD1   1 
ATOM 4951  O OD2   . ASP G 3 72  ? 88.977  93.114  102.773 1.00 98.62  ? 72  ASP G OD2   1 
ATOM 4952  N N     . ASN G 3 73  ? 93.032  88.891  102.268 1.00 94.42  ? 73  ASN G N     1 
ATOM 4953  C CA    . ASN G 3 73  ? 94.037  88.117  101.555 1.00 94.42  ? 73  ASN G CA    1 
ATOM 4954  C C     . ASN G 3 73  ? 94.097  86.691  102.086 1.00 94.42  ? 73  ASN G C     1 
ATOM 4955  O O     . ASN G 3 73  ? 95.152  86.051  102.005 1.00 94.42  ? 73  ASN G O     1 
ATOM 4956  C CB    . ASN G 3 73  ? 95.397  88.806  101.607 1.00 94.42  ? 73  ASN G CB    1 
ATOM 4957  C CG    . ASN G 3 73  ? 95.487  89.967  100.628 1.00 94.42  ? 73  ASN G CG    1 
ATOM 4958  O OD1   . ASN G 3 73  ? 95.097  89.843  99.469  1.00 94.42  ? 73  ASN G OD1   1 
ATOM 4959  N ND2   . ASN G 3 73  ? 95.977  91.104  101.096 1.00 94.42  ? 73  ASN G ND2   1 
ATOM 4960  N N     . LYS G 3 74  ? 92.985  86.212  102.651 1.00 95.91  ? 74  LYS G N     1 
ATOM 4961  C CA    . LYS G 3 74  ? 92.681  84.793  102.840 1.00 95.91  ? 74  LYS G CA    1 
ATOM 4962  C C     . LYS G 3 74  ? 93.667  84.095  103.777 1.00 95.91  ? 74  LYS G C     1 
ATOM 4963  O O     . LYS G 3 74  ? 94.295  83.094  103.430 1.00 95.91  ? 74  LYS G O     1 
ATOM 4964  C CB    . LYS G 3 74  ? 92.602  84.074  101.492 1.00 95.91  ? 74  LYS G CB    1 
ATOM 4965  C CG    . LYS G 3 74  ? 91.378  84.427  100.674 1.00 95.91  ? 74  LYS G CG    1 
ATOM 4966  C CD    . LYS G 3 74  ? 91.303  83.549  99.438  1.00 95.91  ? 74  LYS G CD    1 
ATOM 4967  C CE    . LYS G 3 74  ? 90.039  83.810  98.638  1.00 95.91  ? 74  LYS G CE    1 
ATOM 4968  N NZ    . LYS G 3 74  ? 89.925  82.907  97.458  1.00 95.91  ? 74  LYS G NZ    1 
ATOM 4969  N N     . LYS G 3 75  ? 93.793  84.645  104.980 1.00 90.33  ? 75  LYS G N     1 
ATOM 4970  C CA    . LYS G 3 75  ? 94.451  83.975  106.090 1.00 90.33  ? 75  LYS G CA    1 
ATOM 4971  C C     . LYS G 3 75  ? 93.573  84.129  107.323 1.00 90.33  ? 75  LYS G C     1 
ATOM 4972  O O     . LYS G 3 75  ? 92.523  84.773  107.286 1.00 90.33  ? 75  LYS G O     1 
ATOM 4973  C CB    . LYS G 3 75  ? 95.852  84.539  106.352 1.00 90.33  ? 75  LYS G CB    1 
ATOM 4974  C CG    . LYS G 3 75  ? 96.830  84.389  105.206 1.00 90.33  ? 75  LYS G CG    1 
ATOM 4975  C CD    . LYS G 3 75  ? 97.179  82.943  104.964 1.00 90.33  ? 75  LYS G CD    1 
ATOM 4976  C CE    . LYS G 3 75  ? 98.151  82.820  103.821 1.00 90.33  ? 75  LYS G CE    1 
ATOM 4977  N NZ    . LYS G 3 75  ? 98.435  81.397  103.529 1.00 90.33  ? 75  LYS G NZ    1 
ATOM 4978  N N     . THR G 3 76  ? 93.997  83.517  108.424 1.00 93.48  ? 76  THR G N     1 
ATOM 4979  C CA    . THR G 3 76  ? 93.332  83.681  109.711 1.00 93.48  ? 76  THR G CA    1 
ATOM 4980  C C     . THR G 3 76  ? 94.305  84.162  110.775 1.00 93.48  ? 76  THR G C     1 
ATOM 4981  O O     . THR G 3 76  ? 94.117  83.897  111.961 1.00 93.48  ? 76  THR G O     1 
ATOM 4982  C CB    . THR G 3 76  ? 92.676  82.381  110.165 1.00 93.48  ? 76  THR G CB    1 
ATOM 4983  O OG1   . THR G 3 76  ? 93.667  81.348  110.231 1.00 93.48  ? 76  THR G OG1   1 
ATOM 4984  C CG2   . THR G 3 76  ? 91.557  81.976  109.221 1.00 93.48  ? 76  THR G CG2   1 
ATOM 4985  N N     . ARG G 3 77  ? 95.343  84.878  110.361 1.00 92.23  ? 77  ARG G N     1 
ATOM 4986  C CA    . ARG G 3 77  ? 96.428  85.222  111.266 1.00 92.23  ? 77  ARG G CA    1 
ATOM 4987  C C     . ARG G 3 77  ? 97.193  86.399  110.690 1.00 92.23  ? 77  ARG G C     1 
ATOM 4988  O O     . ARG G 3 77  ? 97.625  86.352  109.535 1.00 92.23  ? 77  ARG G O     1 
ATOM 4989  C CB    . ARG G 3 77  ? 97.349  84.025  111.468 1.00 92.23  ? 77  ARG G CB    1 
ATOM 4990  C CG    . ARG G 3 77  ? 98.496  84.283  112.393 1.00 92.23  ? 77  ARG G CG    1 
ATOM 4991  C CD    . ARG G 3 77  ? 99.280  83.015  112.638 1.00 92.23  ? 77  ARG G CD    1 
ATOM 4992  N NE    . ARG G 3 77  ? 98.512  82.059  113.426 1.00 92.23  ? 77  ARG G NE    1 
ATOM 4993  C CZ    . ARG G 3 77  ? 98.041  80.909  112.959 1.00 92.23  ? 77  ARG G CZ    1 
ATOM 4994  N NH1   . ARG G 3 77  ? 98.249  80.573  111.693 1.00 92.23  ? 77  ARG G NH1   1 
ATOM 4995  N NH2   . ARG G 3 77  ? 97.354  80.107  113.760 1.00 92.23  ? 77  ARG G NH2   1 
ATOM 4996  N N     . ILE G 3 78  ? 97.363  87.444  111.490 1.00 84.75  ? 78  ILE G N     1 
ATOM 4997  C CA    . ILE G 3 78  ? 98.047  88.647  111.032 1.00 84.75  ? 78  ILE G CA    1 
ATOM 4998  C C     . ILE G 3 78  ? 99.544  88.387  110.984 1.00 84.75  ? 78  ILE G C     1 
ATOM 4999  O O     . ILE G 3 78  ? 100.155 88.025  111.993 1.00 84.75  ? 78  ILE G O     1 
ATOM 5000  C CB    . ILE G 3 78  ? 97.728  89.841  111.932 1.00 84.75  ? 78  ILE G CB    1 
ATOM 5001  C CG1   . ILE G 3 78  ? 96.253  90.188  111.813 1.00 84.75  ? 78  ILE G CG1   1 
ATOM 5002  C CG2   . ILE G 3 78  ? 98.561  91.025  111.549 1.00 84.75  ? 78  ILE G CG2   1 
ATOM 5003  C CD1   . ILE G 3 78  ? 95.796  91.188  112.831 1.00 84.75  ? 78  ILE G CD1   1 
ATOM 5004  N N     . ILE G 3 79  ? 100.130 88.570  109.809 1.00 80.30  ? 79  ILE G N     1 
ATOM 5005  C CA    . ILE G 3 79  ? 101.572 88.496  109.608 1.00 80.30  ? 79  ILE G CA    1 
ATOM 5006  C C     . ILE G 3 79  ? 102.046 89.929  109.395 1.00 80.30  ? 79  ILE G C     1 
ATOM 5007  O O     . ILE G 3 79  ? 101.204 90.800  109.134 1.00 80.30  ? 79  ILE G O     1 
ATOM 5008  C CB    . ILE G 3 79  ? 101.902 87.576  108.426 1.00 80.30  ? 79  ILE G CB    1 
ATOM 5009  C CG1   . ILE G 3 79  ? 101.322 88.149  107.138 1.00 80.30  ? 79  ILE G CG1   1 
ATOM 5010  C CG2   . ILE G 3 79  ? 101.352 86.197  108.685 1.00 80.30  ? 79  ILE G CG2   1 
ATOM 5011  C CD1   . ILE G 3 79  ? 101.754 87.406  105.905 1.00 80.30  ? 79  ILE G CD1   1 
ATOM 5012  N N     . PRO G 3 80  ? 103.344 90.239  109.521 1.00 75.28  ? 80  PRO G N     1 
ATOM 5013  C CA    . PRO G 3 80  ? 103.785 91.627  109.304 1.00 75.28  ? 80  PRO G CA    1 
ATOM 5014  C C     . PRO G 3 80  ? 103.570 92.164  107.895 1.00 75.28  ? 80  PRO G C     1 
ATOM 5015  O O     . PRO G 3 80  ? 103.586 93.390  107.733 1.00 75.28  ? 80  PRO G O     1 
ATOM 5016  C CB    . PRO G 3 80  ? 105.278 91.576  109.647 1.00 75.28  ? 80  PRO G CB    1 
ATOM 5017  C CG    . PRO G 3 80  ? 105.400 90.478  110.573 1.00 75.28  ? 80  PRO G CG    1 
ATOM 5018  C CD    . PRO G 3 80  ? 104.419 89.448  110.145 1.00 75.28  ? 80  PRO G CD    1 
ATOM 5019  N N     . ARG G 3 81  ? 103.391 91.303  106.882 1.00 77.25  ? 81  ARG G N     1 
ATOM 5020  C CA    . ARG G 3 81  ? 103.032 91.779  105.546 1.00 77.25  ? 81  ARG G CA    1 
ATOM 5021  C C     . ARG G 3 81  ? 101.700 92.504  105.564 1.00 77.25  ? 81  ARG G C     1 
ATOM 5022  O O     . ARG G 3 81  ? 101.549 93.574  104.960 1.00 77.25  ? 81  ARG G O     1 
ATOM 5023  C CB    . ARG G 3 81  ? 102.976 90.613  104.562 1.00 77.25  ? 81  ARG G CB    1 
ATOM 5024  C CG    . ARG G 3 81  ? 102.476 90.990  103.172 1.00 77.25  ? 81  ARG G CG    1 
ATOM 5025  C CD    . ARG G 3 81  ? 103.451 91.905  102.489 1.00 77.25  ? 81  ARG G CD    1 
ATOM 5026  N NE    . ARG G 3 81  ? 103.026 92.318  101.159 1.00 77.25  ? 81  ARG G NE    1 
ATOM 5027  C CZ    . ARG G 3 81  ? 103.655 93.233  100.435 1.00 77.25  ? 81  ARG G CZ    1 
ATOM 5028  N NH1   . ARG G 3 81  ? 104.741 93.819  100.910 1.00 77.25  ? 81  ARG G NH1   1 
ATOM 5029  N NH2   . ARG G 3 81  ? 103.205 93.558  99.233  1.00 77.25  ? 81  ARG G NH2   1 
ATOM 5030  N N     . HIS G 3 82  ? 100.730 91.947  106.279 1.00 81.11  ? 82  HIS G N     1 
ATOM 5031  C CA    . HIS G 3 82  ? 99.475  92.641  106.473 1.00 81.11  ? 82  HIS G CA    1 
ATOM 5032  C C     . HIS G 3 82  ? 99.628  93.908  107.296 1.00 81.11  ? 82  HIS G C     1 
ATOM 5033  O O     . HIS G 3 82  ? 98.784  94.793  107.180 1.00 81.11  ? 82  HIS G O     1 
ATOM 5034  C CB    . HIS G 3 82  ? 98.452  91.719  107.123 1.00 81.11  ? 82  HIS G CB    1 
ATOM 5035  C CG    . HIS G 3 82  ? 97.883  90.700  106.191 1.00 81.11  ? 82  HIS G CG    1 
ATOM 5036  N ND1   . HIS G 3 82  ? 98.419  89.441  106.039 1.00 81.11  ? 82  HIS G ND1   1 
ATOM 5037  C CD2   . HIS G 3 82  ? 96.823  90.760  105.353 1.00 81.11  ? 82  HIS G CD2   1 
ATOM 5038  C CE1   . HIS G 3 82  ? 97.711  88.767  105.152 1.00 81.11  ? 82  HIS G CE1   1 
ATOM 5039  N NE2   . HIS G 3 82  ? 96.735  89.545  104.722 1.00 81.11  ? 82  HIS G NE2   1 
ATOM 5040  N N     . LEU G 3 83  ? 100.673 94.031  108.116 1.00 77.77  ? 83  LEU G N     1 
ATOM 5041  C CA    . LEU G 3 83  ? 100.914 95.323  108.748 1.00 77.77  ? 83  LEU G CA    1 
ATOM 5042  C C     . LEU G 3 83  ? 101.526 96.319  107.779 1.00 77.77  ? 83  LEU G C     1 
ATOM 5043  O O     . LEU G 3 83  ? 101.262 97.523  107.892 1.00 77.77  ? 83  LEU G O     1 
ATOM 5044  C CB    . LEU G 3 83  ? 101.800 95.173  109.980 1.00 77.77  ? 83  LEU G CB    1 
ATOM 5045  C CG    . LEU G 3 83  ? 101.066 94.487  111.127 1.00 77.77  ? 83  LEU G CG    1 
ATOM 5046  C CD1   . LEU G 3 83  ? 101.951 94.353  112.340 1.00 77.77  ? 83  LEU G CD1   1 
ATOM 5047  C CD2   . LEU G 3 83  ? 99.811  95.238  111.478 1.00 77.77  ? 83  LEU G CD2   1 
ATOM 5048  N N     . GLN G 3 84  ? 102.318 95.834  106.820 1.00 76.19  ? 84  GLN G N     1 
ATOM 5049  C CA    . GLN G 3 84  ? 102.839 96.688  105.758 1.00 76.19  ? 84  GLN G CA    1 
ATOM 5050  C C     . GLN G 3 84  ? 101.708 97.274  104.925 1.00 76.19  ? 84  GLN G C     1 
ATOM 5051  O O     . GLN G 3 84  ? 101.510 98.495  104.906 1.00 76.19  ? 84  GLN G O     1 
ATOM 5052  C CB    . GLN G 3 84  ? 103.806 95.905  104.875 1.00 76.19  ? 84  GLN G CB    1 
ATOM 5053  C CG    . GLN G 3 84  ? 104.393 96.693  103.732 1.00 76.19  ? 84  GLN G CG    1 
ATOM 5054  C CD    . GLN G 3 84  ? 105.433 97.681  104.176 1.00 76.19  ? 84  GLN G CD    1 
ATOM 5055  O OE1   . GLN G 3 84  ? 106.277 97.369  105.006 1.00 76.19  ? 84  GLN G OE1   1 
ATOM 5056  N NE2   . GLN G 3 84  ? 105.390 98.878  103.614 1.00 76.19  ? 84  GLN G NE2   1 
ATOM 5057  N N     . LEU G 3 85  ? 100.917 96.423  104.263 1.00 78.34  ? 85  LEU G N     1 
ATOM 5058  C CA    . LEU G 3 85  ? 99.897  97.046  103.428 1.00 78.34  ? 85  LEU G CA    1 
ATOM 5059  C C     . LEU G 3 85  ? 98.671  97.457  104.220 1.00 78.34  ? 85  LEU G C     1 
ATOM 5060  O O     . LEU G 3 85  ? 97.795  98.128  103.668 1.00 78.34  ? 85  LEU G O     1 
ATOM 5061  C CB    . LEU G 3 85  ? 99.469  96.158  102.259 1.00 78.34  ? 85  LEU G CB    1 
ATOM 5062  C CG    . LEU G 3 85  ? 98.403  95.082  102.381 1.00 78.34  ? 85  LEU G CG    1 
ATOM 5063  C CD1   . LEU G 3 85  ? 97.874  94.762  100.996 1.00 78.34  ? 85  LEU G CD1   1 
ATOM 5064  C CD2   . LEU G 3 85  ? 98.979  93.853  102.988 1.00 78.34  ? 85  LEU G CD2   1 
ATOM 5065  N N     . ALA G 3 86  ? 98.591  97.091  105.494 1.00 75.97  ? 86  ALA G N     1 
ATOM 5066  C CA    . ALA G 3 86  ? 97.559  97.666  106.342 1.00 75.97  ? 86  ALA G CA    1 
ATOM 5067  C C     . ALA G 3 86  ? 97.870  99.117  106.646 1.00 75.97  ? 86  ALA G C     1 
ATOM 5068  O O     . ALA G 3 86  ? 97.000  99.985  106.527 1.00 75.97  ? 86  ALA G O     1 
ATOM 5069  C CB    . ALA G 3 86  ? 97.422  96.876  107.637 1.00 75.97  ? 86  ALA G CB    1 
ATOM 5070  N N     . VAL G 3 87  ? 99.112  99.400  107.040 1.00 77.95  ? 87  VAL G N     1 
ATOM 5071  C CA    . VAL G 3 87  ? 99.461  100.772 107.384 1.00 77.95  ? 87  VAL G CA    1 
ATOM 5072  C C     . VAL G 3 87  ? 99.563  101.637 106.134 1.00 77.95  ? 87  VAL G C     1 
ATOM 5073  O O     . VAL G 3 87  ? 99.030  102.752 106.097 1.00 77.95  ? 87  VAL G O     1 
ATOM 5074  C CB    . VAL G 3 87  ? 100.755 100.800 108.214 1.00 77.95  ? 87  VAL G CB    1 
ATOM 5075  C CG1   . VAL G 3 87  ? 101.253 102.206 108.364 1.00 77.95  ? 87  VAL G CG1   1 
ATOM 5076  C CG2   . VAL G 3 87  ? 100.491 100.238 109.588 1.00 77.95  ? 87  VAL G CG2   1 
ATOM 5077  N N     . ARG G 3 88  ? 100.185 101.122 105.072 1.00 71.30  ? 88  ARG G N     1 
ATOM 5078  C CA    . ARG G 3 88  ? 100.457 101.986 103.926 1.00 71.30  ? 88  ARG G CA    1 
ATOM 5079  C C     . ARG G 3 88  ? 99.231  102.306 103.078 1.00 71.30  ? 88  ARG G C     1 
ATOM 5080  O O     . ARG G 3 88  ? 99.372  103.065 102.115 1.00 71.30  ? 88  ARG G O     1 
ATOM 5081  C CB    . ARG G 3 88  ? 101.527 101.370 103.030 1.00 71.30  ? 88  ARG G CB    1 
ATOM 5082  C CG    . ARG G 3 88  ? 102.868 101.206 103.696 1.00 71.30  ? 88  ARG G CG    1 
ATOM 5083  C CD    . ARG G 3 88  ? 103.482 102.533 104.063 1.00 71.30  ? 88  ARG G CD    1 
ATOM 5084  N NE    . ARG G 3 88  ? 104.851 102.356 104.527 1.00 71.30  ? 88  ARG G NE    1 
ATOM 5085  C CZ    . ARG G 3 88  ? 105.184 102.117 105.785 1.00 71.30  ? 88  ARG G CZ    1 
ATOM 5086  N NH1   . ARG G 3 88  ? 104.247 102.026 106.707 1.00 71.30  ? 88  ARG G NH1   1 
ATOM 5087  N NH2   . ARG G 3 88  ? 106.454 101.967 106.115 1.00 71.30  ? 88  ARG G NH2   1 
ATOM 5088  N N     . ASN G 3 89  ? 98.048  101.783 103.393 1.00 79.19  ? 89  ASN G N     1 
ATOM 5089  C CA    . ASN G 3 89  ? 96.867  102.097 102.598 1.00 79.19  ? 89  ASN G CA    1 
ATOM 5090  C C     . ASN G 3 89  ? 96.018  103.219 103.172 1.00 79.19  ? 89  ASN G C     1 
ATOM 5091  O O     . ASN G 3 89  ? 95.386  103.949 102.402 1.00 79.19  ? 89  ASN G O     1 
ATOM 5092  C CB    . ASN G 3 89  ? 96.007  100.851 102.403 1.00 79.19  ? 89  ASN G CB    1 
ATOM 5093  C CG    . ASN G 3 89  ? 96.479  100.011 101.250 1.00 79.19  ? 89  ASN G CG    1 
ATOM 5094  O OD1   . ASN G 3 89  ? 96.754  100.535 100.173 1.00 79.19  ? 89  ASN G OD1   1 
ATOM 5095  N ND2   . ASN G 3 89  ? 96.595  98.708  101.466 1.00 79.19  ? 89  ASN G ND2   1 
ATOM 5096  N N     . ASP G 3 90  ? 95.955  103.375 104.487 1.00 81.87  ? 90  ASP G N     1 
ATOM 5097  C CA    . ASP G 3 90  ? 95.390  104.607 105.006 1.00 81.87  ? 90  ASP G CA    1 
ATOM 5098  C C     . ASP G 3 90  ? 96.380  105.736 104.786 1.00 81.87  ? 90  ASP G C     1 
ATOM 5099  O O     . ASP G 3 90  ? 97.595  105.534 104.808 1.00 81.87  ? 90  ASP G O     1 
ATOM 5100  C CB    . ASP G 3 90  ? 95.064  104.491 106.491 1.00 81.87  ? 90  ASP G CB    1 
ATOM 5101  C CG    . ASP G 3 90  ? 94.416  105.751 107.041 1.00 81.87  ? 90  ASP G CG    1 
ATOM 5102  O OD1   . ASP G 3 90  ? 93.218  105.969 106.770 1.00 81.87  ? 90  ASP G OD1   1 
ATOM 5103  O OD2   . ASP G 3 90  ? 95.120  106.541 107.708 1.00 81.87  ? 90  ASP G OD2   1 
ATOM 5104  N N     . GLU G 3 91  ? 95.851  106.932 104.550 1.00 82.79  ? 91  GLU G N     1 
ATOM 5105  C CA    . GLU G 3 91  ? 96.721  108.077 104.338 1.00 82.79  ? 91  GLU G CA    1 
ATOM 5106  C C     . GLU G 3 91  ? 97.357  108.521 105.648 1.00 82.79  ? 91  GLU G C     1 
ATOM 5107  O O     . GLU G 3 91  ? 98.572  108.732 105.723 1.00 82.79  ? 91  GLU G O     1 
ATOM 5108  C CB    . GLU G 3 91  ? 95.924  109.212 103.701 1.00 82.79  ? 91  GLU G CB    1 
ATOM 5109  C CG    . GLU G 3 91  ? 96.758  110.272 103.010 1.00 82.79  ? 91  GLU G CG    1 
ATOM 5110  C CD    . GLU G 3 91  ? 97.269  111.335 103.948 1.00 82.79  ? 91  GLU G CD    1 
ATOM 5111  O OE1   . GLU G 3 91  ? 96.645  111.543 105.005 1.00 82.79  ? 91  GLU G OE1   1 
ATOM 5112  O OE2   . GLU G 3 91  ? 98.282  111.976 103.615 1.00 82.79  ? 91  GLU G OE2   1 
ATOM 5113  N N     . GLU G 3 92  ? 96.556  108.635 106.700 1.00 82.85  ? 92  GLU G N     1 
ATOM 5114  C CA    . GLU G 3 92  ? 97.017  109.305 107.905 1.00 82.85  ? 92  GLU G CA    1 
ATOM 5115  C C     . GLU G 3 92  ? 97.907  108.415 108.757 1.00 82.85  ? 92  GLU G C     1 
ATOM 5116  O O     . GLU G 3 92  ? 98.864  108.907 109.370 1.00 82.85  ? 92  GLU G O     1 
ATOM 5117  C CB    . GLU G 3 92  ? 95.805  109.805 108.678 1.00 82.85  ? 92  GLU G CB    1 
ATOM 5118  C CG    . GLU G 3 92  ? 95.063  110.845 107.863 1.00 82.85  ? 92  GLU G CG    1 
ATOM 5119  C CD    . GLU G 3 92  ? 93.806  111.338 108.521 1.00 82.85  ? 92  GLU G CD    1 
ATOM 5120  O OE1   . GLU G 3 92  ? 93.433  110.788 109.573 1.00 82.85  ? 92  GLU G OE1   1 
ATOM 5121  O OE2   . GLU G 3 92  ? 93.190  112.279 107.980 1.00 82.85  ? 92  GLU G OE2   1 
ATOM 5122  N N     . LEU G 3 93  ? 97.629  107.113 108.780 1.00 78.60  ? 93  LEU G N     1 
ATOM 5123  C CA    . LEU G 3 93  ? 98.527  106.173 109.439 1.00 78.60  ? 93  LEU G CA    1 
ATOM 5124  C C     . LEU G 3 93  ? 99.863  106.095 108.723 1.00 78.60  ? 93  LEU G C     1 
ATOM 5125  O O     . LEU G 3 93  ? 100.896 105.884 109.364 1.00 78.60  ? 93  LEU G O     1 
ATOM 5126  C CB    . LEU G 3 93  ? 97.883  104.793 109.495 1.00 78.60  ? 93  LEU G CB    1 
ATOM 5127  C CG    . LEU G 3 93  ? 96.574  104.748 110.271 1.00 78.60  ? 93  LEU G CG    1 
ATOM 5128  C CD1   . LEU G 3 93  ? 95.925  103.398 110.123 1.00 78.60  ? 93  LEU G CD1   1 
ATOM 5129  C CD2   . LEU G 3 93  ? 96.832  105.056 111.721 1.00 78.60  ? 93  LEU G CD2   1 
ATOM 5130  N N     . ASN G 3 94  ? 99.859  106.263 107.400 1.00 76.75  ? 94  ASN G N     1 
ATOM 5131  C CA    . ASN G 3 94  ? 101.109 106.343 106.657 1.00 76.75  ? 94  ASN G CA    1 
ATOM 5132  C C     . ASN G 3 94  ? 101.855 107.623 106.993 1.00 76.75  ? 94  ASN G C     1 
ATOM 5133  O O     . ASN G 3 94  ? 103.084 107.618 107.099 1.00 76.75  ? 94  ASN G O     1 
ATOM 5134  C CB    . ASN G 3 94  ? 100.831 106.271 105.162 1.00 76.75  ? 94  ASN G CB    1 
ATOM 5135  C CG    . ASN G 3 94  ? 102.078 106.012 104.344 1.00 76.75  ? 94  ASN G CG    1 
ATOM 5136  O OD1   . ASN G 3 94  ? 103.169 105.826 104.877 1.00 76.75  ? 94  ASN G OD1   1 
ATOM 5137  N ND2   . ASN G 3 94  ? 101.917 105.996 103.030 1.00 76.75  ? 94  ASN G ND2   1 
ATOM 5138  N N     . LYS G 3 95  ? 101.129 108.728 107.176 1.00 74.46  ? 95  LYS G N     1 
ATOM 5139  C CA    . LYS G 3 95  ? 101.784 109.990 107.502 1.00 74.46  ? 95  LYS G CA    1 
ATOM 5140  C C     . LYS G 3 95  ? 102.345 109.983 108.919 1.00 74.46  ? 95  LYS G C     1 
ATOM 5141  O O     . LYS G 3 95  ? 103.336 110.665 109.197 1.00 74.46  ? 95  LYS G O     1 
ATOM 5142  C CB    . LYS G 3 95  ? 100.804 111.144 107.304 1.00 74.46  ? 95  LYS G CB    1 
ATOM 5143  C CG    . LYS G 3 95  ? 101.417 112.516 107.421 1.00 74.46  ? 95  LYS G CG    1 
ATOM 5144  C CD    . LYS G 3 95  ? 100.409 113.593 107.126 1.00 74.46  ? 95  LYS G CD    1 
ATOM 5145  C CE    . LYS G 3 95  ? 100.184 113.679 105.629 1.00 74.46  ? 95  LYS G CE    1 
ATOM 5146  N NZ    . LYS G 3 95  ? 99.290  114.793 105.227 1.00 74.46  ? 95  LYS G NZ    1 
ATOM 5147  N N     . LEU G 3 96  ? 101.771 109.193 109.820 1.00 72.50  ? 96  LEU G N     1 
ATOM 5148  C CA    . LEU G 3 96  ? 102.414 109.079 111.120 1.00 72.50  ? 96  LEU G CA    1 
ATOM 5149  C C     . LEU G 3 96  ? 103.657 108.210 111.041 1.00 72.50  ? 96  LEU G C     1 
ATOM 5150  O O     . LEU G 3 96  ? 104.607 108.428 111.796 1.00 72.50  ? 96  LEU G O     1 
ATOM 5151  C CB    . LEU G 3 96  ? 101.432 108.533 112.150 1.00 72.50  ? 96  LEU G CB    1 
ATOM 5152  C CG    . LEU G 3 96  ? 101.790 108.612 113.636 1.00 72.50  ? 96  LEU G CG    1 
ATOM 5153  C CD1   . LEU G 3 96  ? 100.528 108.848 114.400 1.00 72.50  ? 96  LEU G CD1   1 
ATOM 5154  C CD2   . LEU G 3 96  ? 102.421 107.345 114.157 1.00 72.50  ? 96  LEU G CD2   1 
ATOM 5155  N N     . LEU G 3 97  ? 103.688 107.247 110.123 1.00 68.45  ? 97  LEU G N     1 
ATOM 5156  C CA    . LEU G 3 97  ? 104.747 106.247 110.077 1.00 68.45  ? 97  LEU G CA    1 
ATOM 5157  C C     . LEU G 3 97  ? 105.571 106.331 108.802 1.00 68.45  ? 97  LEU G C     1 
ATOM 5158  O O     . LEU G 3 97  ? 106.111 105.327 108.343 1.00 68.45  ? 97  LEU G O     1 
ATOM 5159  C CB    . LEU G 3 97  ? 104.162 104.849 110.218 1.00 68.45  ? 97  LEU G CB    1 
ATOM 5160  C CG    . LEU G 3 97  ? 103.492 104.632 111.557 1.00 68.45  ? 97  LEU G CG    1 
ATOM 5161  C CD1   . LEU G 3 97  ? 102.872 103.282 111.555 1.00 68.45  ? 97  LEU G CD1   1 
ATOM 5162  C CD2   . LEU G 3 97  ? 104.540 104.718 112.614 1.00 68.45  ? 97  LEU G CD2   1 
ATOM 5163  N N     . GLY G 3 98  ? 105.693 107.527 108.232 1.00 70.41  ? 98  GLY G N     1 
ATOM 5164  C CA    . GLY G 3 98  ? 106.331 107.660 106.938 1.00 70.41  ? 98  GLY G CA    1 
ATOM 5165  C C     . GLY G 3 98  ? 107.831 107.523 106.943 1.00 70.41  ? 98  GLY G C     1 
ATOM 5166  O O     . GLY G 3 98  ? 108.427 107.373 105.875 1.00 70.41  ? 98  GLY G O     1 
ATOM 5167  N N     . ARG G 3 99  ? 108.461 107.580 108.111 1.00 75.12  ? 99  ARG G N     1 
ATOM 5168  C CA    . ARG G 3 99  ? 109.903 107.420 108.215 1.00 75.12  ? 99  ARG G CA    1 
ATOM 5169  C C     . ARG G 3 99  ? 110.271 106.095 108.856 1.00 75.12  ? 99  ARG G C     1 
ATOM 5170  O O     . ARG G 3 99  ? 111.406 105.923 109.303 1.00 75.12  ? 99  ARG G O     1 
ATOM 5171  C CB    . ARG G 3 99  ? 110.518 108.568 109.015 1.00 75.12  ? 99  ARG G CB    1 
ATOM 5172  C CG    . ARG G 3 99  ? 110.184 109.943 108.489 1.00 75.12  ? 99  ARG G CG    1 
ATOM 5173  C CD    . ARG G 3 99  ? 110.796 110.177 107.125 1.00 75.12  ? 99  ARG G CD    1 
ATOM 5174  N NE    . ARG G 3 99  ? 110.339 111.437 106.541 1.00 75.12  ? 99  ARG G NE    1 
ATOM 5175  C CZ    . ARG G 3 99  ? 110.570 111.804 105.285 1.00 75.12  ? 99  ARG G CZ    1 
ATOM 5176  N NH1   . ARG G 3 99  ? 111.257 111.010 104.477 1.00 75.12  ? 99  ARG G NH1   1 
ATOM 5177  N NH2   . ARG G 3 99  ? 110.112 112.962 104.834 1.00 75.12  ? 99  ARG G NH2   1 
ATOM 5178  N N     . VAL G 3 100 ? 109.332 105.162 108.929 1.00 70.01  ? 100 VAL G N     1 
ATOM 5179  C CA    . VAL G 3 100 ? 109.516 103.930 109.680 1.00 70.01  ? 100 VAL G CA    1 
ATOM 5180  C C     . VAL G 3 100 ? 109.463 102.760 108.723 1.00 70.01  ? 100 VAL G C     1 
ATOM 5181  O O     . VAL G 3 100 ? 108.434 102.517 108.082 1.00 70.01  ? 100 VAL G O     1 
ATOM 5182  C CB    . VAL G 3 100 ? 108.462 103.766 110.777 1.00 70.01  ? 100 VAL G CB    1 
ATOM 5183  C CG1   . VAL G 3 100 ? 108.530 102.379 111.328 1.00 70.01  ? 100 VAL G CG1   1 
ATOM 5184  C CG2   . VAL G 3 100 ? 108.708 104.767 111.889 1.00 70.01  ? 100 VAL G CG2   1 
ATOM 5185  N N     . THR G 3 101 ? 110.562 102.035 108.631 1.00 69.28  ? 101 THR G N     1 
ATOM 5186  C CA    . THR G 3 101 ? 110.546 100.748 107.970 1.00 69.28  ? 101 THR G CA    1 
ATOM 5187  C C     . THR G 3 101 ? 110.046 99.724  108.973 1.00 69.28  ? 101 THR G C     1 
ATOM 5188  O O     . THR G 3 101 ? 110.322 99.832  110.168 1.00 69.28  ? 101 THR G O     1 
ATOM 5189  C CB    . THR G 3 101 ? 111.947 100.386 107.473 1.00 69.28  ? 101 THR G CB    1 
ATOM 5190  O OG1   . THR G 3 101 ? 112.454 101.453 106.664 1.00 69.28  ? 101 THR G OG1   1 
ATOM 5191  C CG2   . THR G 3 101 ? 111.921 99.126  106.627 1.00 69.28  ? 101 THR G CG2   1 
ATOM 5192  N N     . ILE G 3 102 ? 109.261 98.764  108.503 1.00 63.70  ? 102 ILE G N     1 
ATOM 5193  C CA    . ILE G 3 102 ? 108.885 97.610  109.299 1.00 63.70  ? 102 ILE G CA    1 
ATOM 5194  C C     . ILE G 3 102 ? 109.382 96.356  108.600 1.00 63.70  ? 102 ILE G C     1 
ATOM 5195  O O     . ILE G 3 102 ? 109.157 96.171  107.400 1.00 63.70  ? 102 ILE G O     1 
ATOM 5196  C CB    . ILE G 3 102 ? 107.376 97.586  109.565 1.00 63.70  ? 102 ILE G CB    1 
ATOM 5197  C CG1   . ILE G 3 102 ? 106.595 97.842  108.296 1.00 63.70  ? 102 ILE G CG1   1 
ATOM 5198  C CG2   . ILE G 3 102 ? 107.026 98.648  110.541 1.00 63.70  ? 102 ILE G CG2   1 
ATOM 5199  C CD1   . ILE G 3 102 ? 105.132 97.702  108.485 1.00 63.70  ? 102 ILE G CD1   1 
ATOM 5200  N N     . ALA G 3 103 ? 110.111 95.529  109.342 1.00 68.66  ? 103 ALA G N     1 
ATOM 5201  C CA    . ALA G 3 103 ? 110.829 94.400  108.774 1.00 68.66  ? 103 ALA G CA    1 
ATOM 5202  C C     . ALA G 3 103 ? 109.865 93.323  108.313 1.00 68.66  ? 103 ALA G C     1 
ATOM 5203  O O     . ALA G 3 103 ? 108.769 93.179  108.858 1.00 68.66  ? 103 ALA G O     1 
ATOM 5204  C CB    . ALA G 3 103 ? 111.791 93.819  109.803 1.00 68.66  ? 103 ALA G CB    1 
ATOM 5205  N N     . GLN G 3 104 ? 110.301 92.555  107.307 1.00 68.83  ? 104 GLN G N     1 
ATOM 5206  C CA    . GLN G 3 104 ? 109.465 91.595  106.577 1.00 68.83  ? 104 GLN G CA    1 
ATOM 5207  C C     . GLN G 3 104 ? 108.178 92.240  106.071 1.00 68.83  ? 104 GLN G C     1 
ATOM 5208  O O     . GLN G 3 104 ? 107.100 91.643  106.104 1.00 68.83  ? 104 GLN G O     1 
ATOM 5209  C CB    . GLN G 3 104 ? 109.151 90.353  107.415 1.00 68.83  ? 104 GLN G CB    1 
ATOM 5210  C CG    . GLN G 3 104 ? 110.294 89.370  107.593 1.00 68.83  ? 104 GLN G CG    1 
ATOM 5211  C CD    . GLN G 3 104 ? 111.239 89.762  108.702 1.00 68.83  ? 104 GLN G CD    1 
ATOM 5212  O OE1   . GLN G 3 104 ? 110.936 90.637  109.499 1.00 68.83  ? 104 GLN G OE1   1 
ATOM 5213  N NE2   . GLN G 3 104 ? 112.383 89.096  108.773 1.00 68.83  ? 104 GLN G NE2   1 
ATOM 5214  N N     . GLY G 3 105 ? 108.286 93.479  105.610 1.00 72.11  ? 105 GLY G N     1 
ATOM 5215  C CA    . GLY G 3 105 ? 107.126 94.173  105.105 1.00 72.11  ? 105 GLY G CA    1 
ATOM 5216  C C     . GLY G 3 105 ? 107.028 94.115  103.599 1.00 72.11  ? 105 GLY G C     1 
ATOM 5217  O O     . GLY G 3 105 ? 105.958 93.853  103.053 1.00 72.11  ? 105 GLY G O     1 
ATOM 5218  N N     . GLY G 3 106 ? 108.135 94.344  102.914 1.00 74.37  ? 106 GLY G N     1 
ATOM 5219  C CA    . GLY G 3 106 ? 108.086 94.439  101.476 1.00 74.37  ? 106 GLY G CA    1 
ATOM 5220  C C     . GLY G 3 106 ? 107.468 95.752  101.030 1.00 74.37  ? 106 GLY G C     1 
ATOM 5221  O O     . GLY G 3 106 ? 107.445 96.749  101.757 1.00 74.37  ? 106 GLY G O     1 
ATOM 5222  N N     . VAL G 3 107 ? 106.955 95.742  99.804  1.00 72.68  ? 107 VAL G N     1 
ATOM 5223  C CA    . VAL G 3 107 ? 106.435 96.935  99.152  1.00 72.68  ? 107 VAL G CA    1 
ATOM 5224  C C     . VAL G 3 107 ? 104.984 96.687  98.763  1.00 72.68  ? 107 VAL G C     1 
ATOM 5225  O O     . VAL G 3 107 ? 104.649 95.623  98.234  1.00 72.68  ? 107 VAL G O     1 
ATOM 5226  C CB    . VAL G 3 107 ? 107.277 97.301  97.910  1.00 72.68  ? 107 VAL G CB    1 
ATOM 5227  C CG1   . VAL G 3 107 ? 106.782 98.573  97.269  1.00 72.68  ? 107 VAL G CG1   1 
ATOM 5228  C CG2   . VAL G 3 107 ? 108.743 97.434  98.257  1.00 72.68  ? 107 VAL G CG2   1 
ATOM 5229  N N     . LEU G 3 108 ? 104.123 97.660  99.044  1.00 75.01  ? 108 LEU G N     1 
ATOM 5230  C CA    . LEU G 3 108 ? 102.773 97.640  98.505  1.00 75.01  ? 108 LEU G CA    1 
ATOM 5231  C C     . LEU G 3 108 ? 102.834 97.781  96.985  1.00 75.01  ? 108 LEU G C     1 
ATOM 5232  O O     . LEU G 3 108 ? 103.612 98.595  96.478  1.00 75.01  ? 108 LEU G O     1 
ATOM 5233  C CB    . LEU G 3 108 ? 101.956 98.776  99.121  1.00 75.01  ? 108 LEU G CB    1 
ATOM 5234  C CG    . LEU G 3 108 ? 100.441 98.859  98.936  1.00 75.01  ? 108 LEU G CG    1 
ATOM 5235  C CD1   . LEU G 3 108 ? 99.853  99.453  100.187 1.00 75.01  ? 108 LEU G CD1   1 
ATOM 5236  C CD2   . LEU G 3 108 ? 100.041 99.707  97.743  1.00 75.01  ? 108 LEU G CD2   1 
ATOM 5237  N N     . PRO G 3 109 ? 102.016 97.017  96.224  1.00 75.76  ? 109 PRO G N     1 
ATOM 5238  C CA    . PRO G 3 109 ? 102.198 96.960  94.765  1.00 75.76  ? 109 PRO G CA    1 
ATOM 5239  C C     . PRO G 3 109 ? 101.863 98.251  94.041  1.00 75.76  ? 109 PRO G C     1 
ATOM 5240  O O     . PRO G 3 109 ? 100.699 98.610  93.850  1.00 75.76  ? 109 PRO G O     1 
ATOM 5241  C CB    . PRO G 3 109 ? 101.247 95.837  94.336  1.00 75.76  ? 109 PRO G CB    1 
ATOM 5242  C CG    . PRO G 3 109 ? 101.066 95.020  95.535  1.00 75.76  ? 109 PRO G CG    1 
ATOM 5243  C CD    . PRO G 3 109 ? 101.087 95.977  96.686  1.00 75.76  ? 109 PRO G CD    1 
ATOM 5244  N N     . ASN G 3 110 ? 102.912 98.947  93.629  1.00 84.04  ? 110 ASN G N     1 
ATOM 5245  C CA    . ASN G 3 110 ? 102.818 100.175 92.864  1.00 84.04  ? 110 ASN G CA    1 
ATOM 5246  C C     . ASN G 3 110 ? 103.530 99.940  91.545  1.00 84.04  ? 110 ASN G C     1 
ATOM 5247  O O     . ASN G 3 110 ? 104.639 99.398  91.523  1.00 84.04  ? 110 ASN G O     1 
ATOM 5248  C CB    . ASN G 3 110 ? 103.457 101.338 93.625  1.00 84.04  ? 110 ASN G CB    1 
ATOM 5249  C CG    . ASN G 3 110 ? 103.154 102.688 93.007  1.00 84.04  ? 110 ASN G CG    1 
ATOM 5250  O OD1   . ASN G 3 110 ? 102.436 102.788 92.017  1.00 84.04  ? 110 ASN G OD1   1 
ATOM 5251  N ND2   . ASN G 3 110 ? 103.710 103.738 93.596  1.00 84.04  ? 110 ASN G ND2   1 
ATOM 5252  N N     . ILE G 3 111 ? 102.880 100.314 90.449  1.00 89.91  ? 111 ILE G N     1 
ATOM 5253  C CA    . ILE G 3 111 ? 103.440 100.195 89.111  1.00 89.91  ? 111 ILE G CA    1 
ATOM 5254  C C     . ILE G 3 111 ? 103.217 101.527 88.417  1.00 89.91  ? 111 ILE G C     1 
ATOM 5255  O O     . ILE G 3 111 ? 102.080 102.008 88.353  1.00 89.91  ? 111 ILE G O     1 
ATOM 5256  C CB    . ILE G 3 111 ? 102.796 99.053  88.309  1.00 89.91  ? 111 ILE G CB    1 
ATOM 5257  C CG1   . ILE G 3 111 ? 103.052 97.701  88.971  1.00 89.91  ? 111 ILE G CG1   1 
ATOM 5258  C CG2   . ILE G 3 111 ? 103.346 99.025  86.901  1.00 89.91  ? 111 ILE G CG2   1 
ATOM 5259  C CD1   . ILE G 3 111 ? 102.179 96.593  88.448  1.00 89.91  ? 111 ILE G CD1   1 
ATOM 5260  N N     . GLN G 3 112 ? 104.291 102.130 87.921  1.00 100.16 ? 112 GLN G N     1 
ATOM 5261  C CA    . GLN G 3 112 ? 104.163 103.373 87.181  1.00 100.16 ? 112 GLN G CA    1 
ATOM 5262  C C     . GLN G 3 112 ? 103.479 103.132 85.841  1.00 100.16 ? 112 GLN G C     1 
ATOM 5263  O O     . GLN G 3 112 ? 103.504 102.031 85.285  1.00 100.16 ? 112 GLN G O     1 
ATOM 5264  C CB    . GLN G 3 112 ? 105.527 104.016 86.965  1.00 100.16 ? 112 GLN G CB    1 
ATOM 5265  C CG    . GLN G 3 112 ? 106.186 104.481 88.241  1.00 100.16 ? 112 GLN G CG    1 
ATOM 5266  C CD    . GLN G 3 112 ? 105.443 105.625 88.893  1.00 100.16 ? 112 GLN G CD    1 
ATOM 5267  O OE1   . GLN G 3 112 ? 104.937 106.521 88.219  1.00 100.16 ? 112 GLN G OE1   1 
ATOM 5268  N NE2   . GLN G 3 112 ? 105.377 105.603 90.217  1.00 100.16 ? 112 GLN G NE2   1 
ATOM 5269  N N     . SER G 3 113 ? 102.865 104.193 85.321  1.00 103.69 ? 113 SER G N     1 
ATOM 5270  C CA    . SER G 3 113 ? 101.959 104.046 84.190  1.00 103.69 ? 113 SER G CA    1 
ATOM 5271  C C     . SER G 3 113 ? 102.701 103.746 82.897  1.00 103.69 ? 113 SER G C     1 
ATOM 5272  O O     . SER G 3 113 ? 102.151 103.085 82.011  1.00 103.69 ? 113 SER G O     1 
ATOM 5273  C CB    . SER G 3 113 ? 101.113 105.308 84.041  1.00 103.69 ? 113 SER G CB    1 
ATOM 5274  O OG    . SER G 3 113 ? 100.271 105.492 85.168  1.00 103.69 ? 113 SER G OG    1 
ATOM 5275  N N     . VAL G 3 114 ? 103.946 104.206 82.769  1.00 103.64 ? 114 VAL G N     1 
ATOM 5276  C CA    . VAL G 3 114 ? 104.693 103.941 81.545  1.00 103.64 ? 114 VAL G CA    1 
ATOM 5277  C C     . VAL G 3 114 ? 105.215 102.520 81.486  1.00 103.64 ? 114 VAL G C     1 
ATOM 5278  O O     . VAL G 3 114 ? 105.658 102.080 80.419  1.00 103.64 ? 114 VAL G O     1 
ATOM 5279  C CB    . VAL G 3 114 ? 105.882 104.906 81.373  1.00 103.64 ? 114 VAL G CB    1 
ATOM 5280  C CG1   . VAL G 3 114 ? 105.405 106.344 81.383  1.00 103.64 ? 114 VAL G CG1   1 
ATOM 5281  C CG2   . VAL G 3 114 ? 106.920 104.674 82.436  1.00 103.64 ? 114 VAL G CG2   1 
ATOM 5282  N N     . LEU G 3 115 ? 105.176 101.785 82.598  1.00 106.12 ? 115 LEU G N     1 
ATOM 5283  C CA    . LEU G 3 115 ? 105.675 100.418 82.584  1.00 106.12 ? 115 LEU G CA    1 
ATOM 5284  C C     . LEU G 3 115 ? 104.616 99.437  82.110  1.00 106.12 ? 115 LEU G C     1 
ATOM 5285  O O     . LEU G 3 115 ? 104.964 98.401  81.533  1.00 106.12 ? 115 LEU G O     1 
ATOM 5286  C CB    . LEU G 3 115 ? 106.175 100.023 83.971  1.00 106.12 ? 115 LEU G CB    1 
ATOM 5287  C CG    . LEU G 3 115 ? 107.393 100.795 84.469  1.00 106.12 ? 115 LEU G CG    1 
ATOM 5288  C CD1   . LEU G 3 115 ? 107.689 100.410 85.897  1.00 106.12 ? 115 LEU G CD1   1 
ATOM 5289  C CD2   . LEU G 3 115 ? 108.594 100.549 83.600  1.00 106.12 ? 115 LEU G CD2   1 
ATOM 5290  N N     . LEU G 3 116 ? 103.342 99.747  82.348  1.00 110.81 ? 116 LEU G N     1 
ATOM 5291  C CA    . LEU G 3 116 ? 102.255 98.895  81.888  1.00 110.81 ? 116 LEU G CA    1 
ATOM 5292  C C     . LEU G 3 116 ? 102.232 98.862  80.363  1.00 110.81 ? 116 LEU G C     1 
ATOM 5293  O O     . LEU G 3 116 ? 102.505 99.884  79.724  1.00 110.81 ? 116 LEU G O     1 
ATOM 5294  C CB    . LEU G 3 116 ? 100.913 99.396  82.422  1.00 110.81 ? 116 LEU G CB    1 
ATOM 5295  C CG    . LEU G 3 116 ? 100.682 99.243  83.920  1.00 110.81 ? 116 LEU G CG    1 
ATOM 5296  C CD1   . LEU G 3 116 ? 99.367  99.889  84.301  1.00 110.81 ? 116 LEU G CD1   1 
ATOM 5297  C CD2   . LEU G 3 116 ? 100.693 97.777  84.292  1.00 110.81 ? 116 LEU G CD2   1 
ATOM 5298  N N     . PRO G 3 117 ? 101.942 97.711  79.757  1.00 114.21 ? 117 PRO G N     1 
ATOM 5299  C CA    . PRO G 3 117 ? 102.180 97.546  78.320  1.00 114.21 ? 117 PRO G CA    1 
ATOM 5300  C C     . PRO G 3 117 ? 101.245 98.375  77.453  1.00 114.21 ? 117 PRO G C     1 
ATOM 5301  O O     . PRO G 3 117 ? 100.109 98.679  77.823  1.00 114.21 ? 117 PRO G O     1 
ATOM 5302  C CB    . PRO G 3 117 ? 101.948 96.048  78.098  1.00 114.21 ? 117 PRO G CB    1 
ATOM 5303  C CG    . PRO G 3 117 ? 102.153 95.435  79.432  1.00 114.21 ? 117 PRO G CG    1 
ATOM 5304  C CD    . PRO G 3 117 ? 101.620 96.429  80.399  1.00 114.21 ? 117 PRO G CD    1 
ATOM 5305  N N     . LYS G 3 118 ? 101.761 98.750  76.287  1.00 122.66 ? 118 LYS G N     1 
ATOM 5306  C CA    . LYS G 3 118 ? 101.092 99.659  75.357  1.00 122.66 ? 118 LYS G CA    1 
ATOM 5307  C C     . LYS G 3 118 ? 100.275 98.885  74.328  1.00 122.66 ? 118 LYS G C     1 
ATOM 5308  O O     . LYS G 3 118 ? 100.409 99.064  73.118  1.00 122.66 ? 118 LYS G O     1 
ATOM 5309  C CB    . LYS G 3 118 ? 102.123 100.555 74.678  1.00 122.66 ? 118 LYS G CB    1 
ATOM 5310  C CG    . LYS G 3 118 ? 102.515 101.824 75.442  1.00 122.66 ? 118 LYS G CG    1 
ATOM 5311  C CD    . LYS G 3 118 ? 103.437 101.553 76.628  1.00 122.66 ? 118 LYS G CD    1 
ATOM 5312  C CE    . LYS G 3 118 ? 104.788 101.007 76.199  1.00 122.66 ? 118 LYS G CE    1 
ATOM 5313  N NZ    . LYS G 3 118 ? 105.698 100.788 77.362  1.00 122.66 ? 118 LYS G NZ    1 
ATOM 5314  N N     . LYS G 3 119 ? 99.402  98.019  74.823  1.00 125.01 ? 119 LYS G N     1 
ATOM 5315  C CA    . LYS G 3 119 ? 98.678  97.083  73.980  1.00 125.01 ? 119 LYS G CA    1 
ATOM 5316  C C     . LYS G 3 119 ? 97.472  97.770  73.344  1.00 125.01 ? 119 LYS G C     1 
ATOM 5317  O O     . LYS G 3 119 ? 97.301  98.990  73.413  1.00 125.01 ? 119 LYS G O     1 
ATOM 5318  C CB    . LYS G 3 119 ? 98.262  95.869  74.802  1.00 125.01 ? 119 LYS G CB    1 
ATOM 5319  C CG    . LYS G 3 119 ? 99.422  95.035  75.308  1.00 125.01 ? 119 LYS G CG    1 
ATOM 5320  C CD    . LYS G 3 119 ? 98.922  93.838  76.092  1.00 125.01 ? 119 LYS G CD    1 
ATOM 5321  C CE    . LYS G 3 119 ? 100.070 92.988  76.593  1.00 125.01 ? 119 LYS G CE    1 
ATOM 5322  N NZ    . LYS G 3 119 ? 99.571  91.823  77.367  1.00 125.01 ? 119 LYS G NZ    1 
ATOM 5323  N N     . THR G 3 120 ? 96.620  96.974  72.708  1.00 132.13 ? 120 THR G N     1 
ATOM 5324  C CA    . THR G 3 120 ? 95.363  97.454  72.156  1.00 132.13 ? 120 THR G CA    1 
ATOM 5325  C C     . THR G 3 120 ? 94.205  96.792  72.890  1.00 132.13 ? 120 THR G C     1 
ATOM 5326  O O     . THR G 3 120 ? 94.374  95.738  73.502  1.00 132.13 ? 120 THR G O     1 
ATOM 5327  C CB    . THR G 3 120 ? 95.248  97.160  70.649  1.00 132.13 ? 120 THR G CB    1 
ATOM 5328  O OG1   . THR G 3 120 ? 95.329  95.747  70.429  1.00 132.13 ? 120 THR G OG1   1 
ATOM 5329  C CG2   . THR G 3 120 ? 96.358  97.852  69.878  1.00 132.13 ? 120 THR G CG2   1 
ATOM 5330  N N     . LYS H 4 28  ? 115.662 84.289  132.827 1.00 104.56 ? 28  LYS H N     1 
ATOM 5331  C CA    . LYS H 4 28  ? 115.959 85.624  132.322 1.00 104.56 ? 28  LYS H CA    1 
ATOM 5332  C C     . LYS H 4 28  ? 115.589 86.693  133.336 1.00 104.56 ? 28  LYS H C     1 
ATOM 5333  O O     . LYS H 4 28  ? 114.879 86.426  134.306 1.00 104.56 ? 28  LYS H O     1 
ATOM 5334  C CB    . LYS H 4 28  ? 115.204 85.885  131.021 1.00 104.56 ? 28  LYS H CB    1 
ATOM 5335  C CG    . LYS H 4 28  ? 115.605 84.997  129.871 1.00 104.56 ? 28  LYS H CG    1 
ATOM 5336  C CD    . LYS H 4 28  ? 114.749 85.274  128.647 1.00 104.56 ? 28  LYS H CD    1 
ATOM 5337  C CE    . LYS H 4 28  ? 115.087 84.310  127.525 1.00 104.56 ? 28  LYS H CE    1 
ATOM 5338  N NZ    . LYS H 4 28  ? 114.187 84.477  126.357 1.00 104.56 ? 28  LYS H NZ    1 
ATOM 5339  N N     . THR H 4 29  ? 116.069 87.911  133.111 1.00 106.03 ? 29  THR H N     1 
ATOM 5340  C CA    . THR H 4 29  ? 115.525 89.060  133.814 1.00 106.03 ? 29  THR H CA    1 
ATOM 5341  C C     . THR H 4 29  ? 114.218 89.451  133.138 1.00 106.03 ? 29  THR H C     1 
ATOM 5342  O O     . THR H 4 29  ? 114.140 89.511  131.906 1.00 106.03 ? 29  THR H O     1 
ATOM 5343  C CB    . THR H 4 29  ? 116.515 90.223  133.812 1.00 106.03 ? 29  THR H CB    1 
ATOM 5344  O OG1   . THR H 4 29  ? 117.744 89.790  134.403 1.00 106.03 ? 29  THR H OG1   1 
ATOM 5345  C CG2   . THR H 4 29  ? 115.975 91.401  134.621 1.00 106.03 ? 29  THR H CG2   1 
ATOM 5346  N N     . ARG H 4 30  ? 113.199 89.714  133.949 1.00 97.22  ? 30  ARG H N     1 
ATOM 5347  C CA    . ARG H 4 30  ? 111.812 89.807  133.507 1.00 97.22  ? 30  ARG H CA    1 
ATOM 5348  C C     . ARG H 4 30  ? 111.630 91.049  132.647 1.00 97.22  ? 30  ARG H C     1 
ATOM 5349  O O     . ARG H 4 30  ? 111.487 92.161  133.153 1.00 97.22  ? 30  ARG H O     1 
ATOM 5350  C CB    . ARG H 4 30  ? 110.916 89.838  134.735 1.00 97.22  ? 30  ARG H CB    1 
ATOM 5351  C CG    . ARG H 4 30  ? 109.444 89.706  134.483 1.00 97.22  ? 30  ARG H CG    1 
ATOM 5352  C CD    . ARG H 4 30  ? 108.695 89.743  135.801 1.00 97.22  ? 30  ARG H CD    1 
ATOM 5353  N NE    . ARG H 4 30  ? 109.014 88.605  136.660 1.00 97.22  ? 30  ARG H NE    1 
ATOM 5354  C CZ    . ARG H 4 30  ? 109.740 88.696  137.770 1.00 97.22  ? 30  ARG H CZ    1 
ATOM 5355  N NH1   . ARG H 4 30  ? 110.249 89.867  138.119 1.00 97.22  ? 30  ARG H NH1   1 
ATOM 5356  N NH2   . ARG H 4 30  ? 109.986 87.620  138.508 1.00 97.22  ? 30  ARG H NH2   1 
ATOM 5357  N N     . LYS H 4 31  ? 111.653 90.855  131.335 1.00 87.35  ? 31  LYS H N     1 
ATOM 5358  C CA    . LYS H 4 31  ? 111.430 91.932  130.386 1.00 87.35  ? 31  LYS H CA    1 
ATOM 5359  C C     . LYS H 4 31  ? 109.946 92.268  130.330 1.00 87.35  ? 31  LYS H C     1 
ATOM 5360  O O     . LYS H 4 31  ? 109.100 91.376  130.288 1.00 87.35  ? 31  LYS H O     1 
ATOM 5361  C CB    . LYS H 4 31  ? 111.925 91.504  129.003 1.00 87.35  ? 31  LYS H CB    1 
ATOM 5362  C CG    . LYS H 4 31  ? 111.819 92.538  127.896 1.00 87.35  ? 31  LYS H CG    1 
ATOM 5363  C CD    . LYS H 4 31  ? 112.852 93.636  128.051 1.00 87.35  ? 31  LYS H CD    1 
ATOM 5364  C CE    . LYS H 4 31  ? 112.896 94.541  126.830 1.00 87.35  ? 31  LYS H CE    1 
ATOM 5365  N NZ    . LYS H 4 31  ? 111.660 95.346  126.681 1.00 87.35  ? 31  LYS H NZ    1 
ATOM 5366  N N     . GLU H 4 32  ? 109.625 93.554  130.328 1.00 85.33  ? 32  GLU H N     1 
ATOM 5367  C CA    . GLU H 4 32  ? 108.234 93.916  130.134 1.00 85.33  ? 32  GLU H CA    1 
ATOM 5368  C C     . GLU H 4 32  ? 107.871 93.791  128.654 1.00 85.33  ? 32  GLU H C     1 
ATOM 5369  O O     . GLU H 4 32  ? 108.730 93.600  127.793 1.00 85.33  ? 32  GLU H O     1 
ATOM 5370  C CB    . GLU H 4 32  ? 107.981 95.339  130.621 1.00 85.33  ? 32  GLU H CB    1 
ATOM 5371  C CG    . GLU H 4 32  ? 108.461 96.420  129.657 1.00 85.33  ? 32  GLU H CG    1 
ATOM 5372  C CD    . GLU H 4 32  ? 109.908 96.811  129.841 1.00 85.33  ? 32  GLU H CD    1 
ATOM 5373  O OE1   . GLU H 4 32  ? 110.648 96.089  130.537 1.00 85.33  ? 32  GLU H OE1   1 
ATOM 5374  O OE2   . GLU H 4 32  ? 110.306 97.847  129.272 1.00 85.33  ? 32  GLU H OE2   1 
ATOM 5375  N N     . SER H 4 33  ? 106.583 93.902  128.353 1.00 71.84  ? 33  SER H N     1 
ATOM 5376  C CA    . SER H 4 33  ? 106.129 93.886  126.964 1.00 71.84  ? 33  SER H CA    1 
ATOM 5377  C C     . SER H 4 33  ? 104.835 94.683  126.865 1.00 71.84  ? 33  SER H C     1 
ATOM 5378  O O     . SER H 4 33  ? 104.506 95.473  127.754 1.00 71.84  ? 33  SER H O     1 
ATOM 5379  C CB    . SER H 4 33  ? 105.954 92.445  126.465 1.00 71.84  ? 33  SER H CB    1 
ATOM 5380  O OG    . SER H 4 33  ? 105.410 92.443  125.159 1.00 71.84  ? 33  SER H OG    1 
ATOM 5381  N N     . TYR H 4 34  ? 104.117 94.493  125.763 1.00 64.47  ? 34  TYR H N     1 
ATOM 5382  C CA    . TYR H 4 34  ? 102.731 94.916  125.631 1.00 64.47  ? 34  TYR H CA    1 
ATOM 5383  C C     . TYR H 4 34  ? 101.864 93.805  125.071 1.00 64.47  ? 34  TYR H C     1 
ATOM 5384  O O     . TYR H 4 34  ? 100.676 94.037  124.828 1.00 64.47  ? 34  TYR H O     1 
ATOM 5385  C CB    . TYR H 4 34  ? 102.599 96.134  124.717 1.00 64.47  ? 34  TYR H CB    1 
ATOM 5386  C CG    . TYR H 4 34  ? 103.044 97.432  125.311 1.00 64.47  ? 34  TYR H CG    1 
ATOM 5387  C CD1   . TYR H 4 34  ? 102.182 98.188  126.089 1.00 64.47  ? 34  TYR H CD1   1 
ATOM 5388  C CD2   . TYR H 4 34  ? 104.320 97.907  125.091 1.00 64.47  ? 34  TYR H CD2   1 
ATOM 5389  C CE1   . TYR H 4 34  ? 102.584 99.384  126.628 1.00 64.47  ? 34  TYR H CE1   1 
ATOM 5390  C CE2   . TYR H 4 34  ? 104.735 99.098  125.630 1.00 64.47  ? 34  TYR H CE2   1 
ATOM 5391  C CZ    . TYR H 4 34  ? 103.865 99.831  126.395 1.00 64.47  ? 34  TYR H CZ    1 
ATOM 5392  O OH    . TYR H 4 34  ? 104.292 101.021 126.924 1.00 64.47  ? 34  TYR H OH    1 
ATOM 5393  N N     . ALA H 4 35  ? 102.428 92.608  124.887 1.00 66.81  ? 35  ALA H N     1 
ATOM 5394  C CA    . ALA H 4 35  ? 101.901 91.649  123.922 1.00 66.81  ? 35  ALA H CA    1 
ATOM 5395  C C     . ALA H 4 35  ? 100.534 91.114  124.311 1.00 66.81  ? 35  ALA H C     1 
ATOM 5396  O O     . ALA H 4 35  ? 99.690  90.890  123.434 1.00 66.81  ? 35  ALA H O     1 
ATOM 5397  C CB    . ALA H 4 35  ? 102.884 90.497  123.754 1.00 66.81  ? 35  ALA H CB    1 
ATOM 5398  N N     . ILE H 4 36  ? 100.278 90.941  125.609 1.00 71.18  ? 36  ILE H N     1 
ATOM 5399  C CA    . ILE H 4 36  ? 98.964  90.466  126.008 1.00 71.18  ? 36  ILE H CA    1 
ATOM 5400  C C     . ILE H 4 36  ? 97.925  91.559  125.854 1.00 71.18  ? 36  ILE H C     1 
ATOM 5401  O O     . ILE H 4 36  ? 96.743  91.259  125.659 1.00 71.18  ? 36  ILE H O     1 
ATOM 5402  C CB    . ILE H 4 36  ? 98.958  89.919  127.444 1.00 71.18  ? 36  ILE H CB    1 
ATOM 5403  C CG1   . ILE H 4 36  ? 99.261  91.018  128.441 1.00 71.18  ? 36  ILE H CG1   1 
ATOM 5404  C CG2   . ILE H 4 36  ? 99.978  88.822  127.604 1.00 71.18  ? 36  ILE H CG2   1 
ATOM 5405  C CD1   . ILE H 4 36  ? 98.903  90.623  129.826 1.00 71.18  ? 36  ILE H CD1   1 
ATOM 5406  N N     . TYR H 4 37  ? 98.335  92.825  125.880 1.00 70.66  ? 37  TYR H N     1 
ATOM 5407  C CA    . TYR H 4 37  ? 97.366  93.889  125.694 1.00 70.66  ? 37  TYR H CA    1 
ATOM 5408  C C     . TYR H 4 37  ? 96.977  94.014  124.230 1.00 70.66  ? 37  TYR H C     1 
ATOM 5409  O O     . TYR H 4 37  ? 95.790  94.163  123.914 1.00 70.66  ? 37  TYR H O     1 
ATOM 5410  C CB    . TYR H 4 37  ? 97.927  95.204  126.213 1.00 70.66  ? 37  TYR H CB    1 
ATOM 5411  C CG    . TYR H 4 37  ? 98.305  95.156  127.663 1.00 70.66  ? 37  TYR H CG    1 
ATOM 5412  C CD1   . TYR H 4 37  ? 97.344  95.167  128.653 1.00 70.66  ? 37  TYR H CD1   1 
ATOM 5413  C CD2   . TYR H 4 37  ? 99.629  95.124  128.042 1.00 70.66  ? 37  TYR H CD2   1 
ATOM 5414  C CE1   . TYR H 4 37  ? 97.696  95.124  129.983 1.00 70.66  ? 37  TYR H CE1   1 
ATOM 5415  C CE2   . TYR H 4 37  ? 99.989  95.091  129.364 1.00 70.66  ? 37  TYR H CE2   1 
ATOM 5416  C CZ    . TYR H 4 37  ? 99.021  95.091  130.328 1.00 70.66  ? 37  TYR H CZ    1 
ATOM 5417  O OH    . TYR H 4 37  ? 99.369  95.060  131.647 1.00 70.66  ? 37  TYR H OH    1 
ATOM 5418  N N     . VAL H 4 38  ? 97.967  93.938  123.335 1.00 73.69  ? 38  VAL H N     1 
ATOM 5419  C CA    . VAL H 4 38  ? 97.708  93.923  121.898 1.00 73.69  ? 38  VAL H CA    1 
ATOM 5420  C C     . VAL H 4 38  ? 96.862  92.715  121.535 1.00 73.69  ? 38  VAL H C     1 
ATOM 5421  O O     . VAL H 4 38  ? 95.956  92.798  120.692 1.00 73.69  ? 38  VAL H O     1 
ATOM 5422  C CB    . VAL H 4 38  ? 99.038  93.946  121.123 1.00 73.69  ? 38  VAL H CB    1 
ATOM 5423  C CG1   . VAL H 4 38  ? 98.817  93.864  119.626 1.00 73.69  ? 38  VAL H CG1   1 
ATOM 5424  C CG2   . VAL H 4 38  ? 99.794  95.197  121.455 1.00 73.69  ? 38  VAL H CG2   1 
ATOM 5425  N N     . TYR H 4 39  ? 97.102  91.590  122.211 1.00 76.72  ? 39  TYR H N     1 
ATOM 5426  C CA    . TYR H 4 39  ? 96.243  90.435  122.017 1.00 76.72  ? 39  TYR H CA    1 
ATOM 5427  C C     . TYR H 4 39  ? 94.826  90.712  122.501 1.00 76.72  ? 39  TYR H C     1 
ATOM 5428  O O     . TYR H 4 39  ? 93.864  90.248  121.880 1.00 76.72  ? 39  TYR H O     1 
ATOM 5429  C CB    . TYR H 4 39  ? 96.829  89.220  122.729 1.00 76.72  ? 39  TYR H CB    1 
ATOM 5430  C CG    . TYR H 4 39  ? 96.112  87.941  122.398 1.00 76.72  ? 39  TYR H CG    1 
ATOM 5431  C CD1   . TYR H 4 39  ? 96.377  87.269  121.216 1.00 76.72  ? 39  TYR H CD1   1 
ATOM 5432  C CD2   . TYR H 4 39  ? 95.148  87.422  123.252 1.00 76.72  ? 39  TYR H CD2   1 
ATOM 5433  C CE1   . TYR H 4 39  ? 95.715  86.104  120.900 1.00 76.72  ? 39  TYR H CE1   1 
ATOM 5434  C CE2   . TYR H 4 39  ? 94.477  86.262  122.943 1.00 76.72  ? 39  TYR H CE2   1 
ATOM 5435  C CZ    . TYR H 4 39  ? 94.764  85.606  121.765 1.00 76.72  ? 39  TYR H CZ    1 
ATOM 5436  O OH    . TYR H 4 39  ? 94.100  84.443  121.451 1.00 76.72  ? 39  TYR H OH    1 
ATOM 5437  N N     . LYS H 4 40  ? 94.672  91.498  123.572 1.00 76.03  ? 40  LYS H N     1 
ATOM 5438  C CA    . LYS H 4 40  ? 93.330  91.798  124.063 1.00 76.03  ? 40  LYS H CA    1 
ATOM 5439  C C     . LYS H 4 40  ? 92.571  92.725  123.124 1.00 76.03  ? 40  LYS H C     1 
ATOM 5440  O O     . LYS H 4 40  ? 91.362  92.549  122.920 1.00 76.03  ? 40  LYS H O     1 
ATOM 5441  C CB    . LYS H 4 40  ? 93.387  92.397  125.464 1.00 76.03  ? 40  LYS H CB    1 
ATOM 5442  C CG    . LYS H 4 40  ? 93.610  91.379  126.563 1.00 76.03  ? 40  LYS H CG    1 
ATOM 5443  C CD    . LYS H 4 40  ? 93.552  92.043  127.920 1.00 76.03  ? 40  LYS H CD    1 
ATOM 5444  C CE    . LYS H 4 40  ? 93.735  91.039  129.033 1.00 76.03  ? 40  LYS H CE    1 
ATOM 5445  N NZ    . LYS H 4 40  ? 93.638  91.694  130.359 1.00 76.03  ? 40  LYS H NZ    1 
ATOM 5446  N N     . VAL H 4 41  ? 93.251  93.713  122.539 1.00 80.32  ? 41  VAL H N     1 
ATOM 5447  C CA    . VAL H 4 41  ? 92.559  94.582  121.594 1.00 80.32  ? 41  VAL H CA    1 
ATOM 5448  C C     . VAL H 4 41  ? 92.249  93.812  120.319 1.00 80.32  ? 41  VAL H C     1 
ATOM 5449  O O     . VAL H 4 41  ? 91.227  94.061  119.662 1.00 80.32  ? 41  VAL H O     1 
ATOM 5450  C CB    . VAL H 4 41  ? 93.394  95.844  121.319 1.00 80.32  ? 41  VAL H CB    1 
ATOM 5451  C CG1   . VAL H 4 41  ? 92.625  96.845  120.478 1.00 80.32  ? 41  VAL H CG1   1 
ATOM 5452  C CG2   . VAL H 4 41  ? 93.807  96.475  122.609 1.00 80.32  ? 41  VAL H CG2   1 
ATOM 5453  N N     . LEU H 4 42  ? 93.091  92.830  119.980 1.00 86.00  ? 42  LEU H N     1 
ATOM 5454  C CA    . LEU H 4 42  ? 92.767  91.928  118.881 1.00 86.00  ? 42  LEU H CA    1 
ATOM 5455  C C     . LEU H 4 42  ? 91.519  91.113  119.191 1.00 86.00  ? 42  LEU H C     1 
ATOM 5456  O O     . LEU H 4 42  ? 90.693  90.870  118.303 1.00 86.00  ? 42  LEU H O     1 
ATOM 5457  C CB    . LEU H 4 42  ? 93.943  91.002  118.595 1.00 86.00  ? 42  LEU H CB    1 
ATOM 5458  C CG    . LEU H 4 42  ? 93.745  90.118  117.368 1.00 86.00  ? 42  LEU H CG    1 
ATOM 5459  C CD1   . LEU H 4 42  ? 93.614  90.987  116.142 1.00 86.00  ? 42  LEU H CD1   1 
ATOM 5460  C CD2   . LEU H 4 42  ? 94.873  89.134  117.204 1.00 86.00  ? 42  LEU H CD2   1 
ATOM 5461  N N     . LYS H 4 43  ? 91.345  90.714  120.454 1.00 87.30  ? 43  LYS H N     1 
ATOM 5462  C CA    . LYS H 4 43  ? 90.098  90.064  120.842 1.00 87.30  ? 43  LYS H CA    1 
ATOM 5463  C C     . LYS H 4 43  ? 88.918  91.025  120.792 1.00 87.30  ? 43  LYS H C     1 
ATOM 5464  O O     . LYS H 4 43  ? 87.783  90.589  120.583 1.00 87.30  ? 43  LYS H O     1 
ATOM 5465  C CB    . LYS H 4 43  ? 90.219  89.457  122.238 1.00 87.30  ? 43  LYS H CB    1 
ATOM 5466  C CG    . LYS H 4 43  ? 91.272  88.357  122.405 1.00 87.30  ? 43  LYS H CG    1 
ATOM 5467  C CD    . LYS H 4 43  ? 90.885  87.022  121.770 1.00 87.30  ? 43  LYS H CD    1 
ATOM 5468  C CE    . LYS H 4 43  ? 91.591  86.766  120.444 1.00 87.30  ? 43  LYS H CE    1 
ATOM 5469  N NZ    . LYS H 4 43  ? 91.290  85.411  119.908 1.00 87.30  ? 43  LYS H NZ    1 
ATOM 5470  N N     . GLN H 4 44  ? 89.155  92.326  120.962 1.00 85.87  ? 44  GLN H N     1 
ATOM 5471  C CA    . GLN H 4 44  ? 88.031  93.250  120.866 1.00 85.87  ? 44  GLN H CA    1 
ATOM 5472  C C     . GLN H 4 44  ? 87.611  93.516  119.426 1.00 85.87  ? 44  GLN H C     1 
ATOM 5473  O O     . GLN H 4 44  ? 86.414  93.625  119.147 1.00 85.87  ? 44  GLN H O     1 
ATOM 5474  C CB    . GLN H 4 44  ? 88.348  94.570  121.556 1.00 85.87  ? 44  GLN H CB    1 
ATOM 5475  C CG    . GLN H 4 44  ? 88.361  94.489  123.058 1.00 85.87  ? 44  GLN H CG    1 
ATOM 5476  C CD    . GLN H 4 44  ? 88.458  95.855  123.699 1.00 85.87  ? 44  GLN H CD    1 
ATOM 5477  O OE1   . GLN H 4 44  ? 88.579  96.866  123.011 1.00 85.87  ? 44  GLN H OE1   1 
ATOM 5478  N NE2   . GLN H 4 44  ? 88.384  95.894  125.021 1.00 85.87  ? 44  GLN H NE2   1 
ATOM 5479  N N     . VAL H 4 45  ? 88.560  93.632  118.497 1.00 90.60  ? 45  VAL H N     1 
ATOM 5480  C CA    . VAL H 4 45  ? 88.217  94.108  117.156 1.00 90.60  ? 45  VAL H CA    1 
ATOM 5481  C C     . VAL H 4 45  ? 87.717  92.969  116.276 1.00 90.60  ? 45  VAL H C     1 
ATOM 5482  O O     . VAL H 4 45  ? 86.572  92.975  115.813 1.00 90.60  ? 45  VAL H O     1 
ATOM 5483  C CB    . VAL H 4 45  ? 89.416  94.817  116.509 1.00 90.60  ? 45  VAL H CB    1 
ATOM 5484  C CG1   . VAL H 4 45  ? 89.066  95.212  115.098 1.00 90.60  ? 45  VAL H CG1   1 
ATOM 5485  C CG2   . VAL H 4 45  ? 89.787  96.034  117.305 1.00 90.60  ? 45  VAL H CG2   1 
ATOM 5486  N N     . HIS H 4 46  ? 88.576  91.987  116.011 1.00 94.50  ? 46  HIS H N     1 
ATOM 5487  C CA    . HIS H 4 46  ? 88.204  90.781  115.277 1.00 94.50  ? 46  HIS H CA    1 
ATOM 5488  C C     . HIS H 4 46  ? 88.443  89.615  116.221 1.00 94.50  ? 46  HIS H C     1 
ATOM 5489  O O     . HIS H 4 46  ? 89.568  89.102  116.304 1.00 94.50  ? 46  HIS H O     1 
ATOM 5490  C CB    . HIS H 4 46  ? 89.009  90.627  113.993 1.00 94.50  ? 46  HIS H CB    1 
ATOM 5491  C CG    . HIS H 4 46  ? 88.716  91.674  112.966 1.00 94.50  ? 46  HIS H CG    1 
ATOM 5492  N ND1   . HIS H 4 46  ? 87.558  91.678  112.218 1.00 94.50  ? 46  HIS H ND1   1 
ATOM 5493  C CD2   . HIS H 4 46  ? 89.438  92.739  112.546 1.00 94.50  ? 46  HIS H CD2   1 
ATOM 5494  C CE1   . HIS H 4 46  ? 87.575  92.707  111.389 1.00 94.50  ? 46  HIS H CE1   1 
ATOM 5495  N NE2   . HIS H 4 46  ? 88.705  93.366  111.569 1.00 94.50  ? 46  HIS H NE2   1 
ATOM 5496  N N     . PRO H 4 47  ? 87.413  89.167  116.946 1.00 94.03  ? 47  PRO H N     1 
ATOM 5497  C CA    . PRO H 4 47  ? 87.644  88.276  118.095 1.00 94.03  ? 47  PRO H CA    1 
ATOM 5498  C C     . PRO H 4 47  ? 88.123  86.889  117.723 1.00 94.03  ? 47  PRO H C     1 
ATOM 5499  O O     . PRO H 4 47  ? 88.779  86.240  118.544 1.00 94.03  ? 47  PRO H O     1 
ATOM 5500  C CB    . PRO H 4 47  ? 86.267  88.214  118.767 1.00 94.03  ? 47  PRO H CB    1 
ATOM 5501  C CG    . PRO H 4 47  ? 85.543  89.425  118.275 1.00 94.03  ? 47  PRO H CG    1 
ATOM 5502  C CD    . PRO H 4 47  ? 86.016  89.615  116.871 1.00 94.03  ? 47  PRO H CD    1 
ATOM 5503  N N     . ASP H 4 48  ? 87.829  86.413  116.520 1.00 94.98  ? 48  ASP H N     1 
ATOM 5504  C CA    . ASP H 4 48  ? 88.244  85.082  116.094 1.00 94.98  ? 48  ASP H CA    1 
ATOM 5505  C C     . ASP H 4 48  ? 89.174  85.261  114.903 1.00 94.98  ? 48  ASP H C     1 
ATOM 5506  O O     . ASP H 4 48  ? 88.760  85.124  113.750 1.00 94.98  ? 48  ASP H O     1 
ATOM 5507  C CB    . ASP H 4 48  ? 87.046  84.282  115.752 1.00 94.98  ? 48  ASP H CB    1 
ATOM 5508  C CG    . ASP H 4 48  ? 86.089  84.168  116.912 1.00 94.98  ? 48  ASP H CG    1 
ATOM 5509  O OD1   . ASP H 4 48  ? 86.552  84.193  118.070 1.00 94.98  ? 48  ASP H OD1   1 
ATOM 5510  O OD2   . ASP H 4 48  ? 84.870  84.078  116.668 1.00 94.98  ? 48  ASP H OD2   1 
ATOM 5511  N N     . THR H 4 49  ? 90.441  85.550  115.193 1.00 91.02  ? 49  THR H N     1 
ATOM 5512  C CA    . THR H 4 49  ? 91.473  85.870  114.215 1.00 91.02  ? 49  THR H CA    1 
ATOM 5513  C C     . THR H 4 49  ? 92.805  85.849  114.949 1.00 91.02  ? 49  THR H C     1 
ATOM 5514  O O     . THR H 4 49  ? 92.910  86.391  116.049 1.00 91.02  ? 49  THR H O     1 
ATOM 5515  C CB    . THR H 4 49  ? 91.245  87.250  113.561 1.00 91.02  ? 49  THR H CB    1 
ATOM 5516  O OG1   . THR H 4 49  ? 90.016  87.263  112.824 1.00 91.02  ? 49  THR H OG1   1 
ATOM 5517  C CG2   . THR H 4 49  ? 92.367  87.609  112.607 1.00 91.02  ? 49  THR H CG2   1 
ATOM 5518  N N     . GLY H 4 50  ? 93.814  85.219  114.346 1.00 85.64  ? 50  GLY H N     1 
ATOM 5519  C CA    . GLY H 4 50  ? 95.108  85.091  114.978 1.00 85.64  ? 50  GLY H CA    1 
ATOM 5520  C C     . GLY H 4 50  ? 96.073  86.212  114.631 1.00 85.64  ? 50  GLY H C     1 
ATOM 5521  O O     . GLY H 4 50  ? 95.758  87.151  113.903 1.00 85.64  ? 50  GLY H O     1 
ATOM 5522  N N     . ILE H 4 51  ? 97.281  86.093  115.175 1.00 78.30  ? 51  ILE H N     1 
ATOM 5523  C CA    . ILE H 4 51  ? 98.366  87.032  114.915 1.00 78.30  ? 51  ILE H CA    1 
ATOM 5524  C C     . ILE H 4 51  ? 99.682  86.278  115.062 1.00 78.30  ? 51  ILE H C     1 
ATOM 5525  O O     . ILE H 4 51  ? 99.797  85.367  115.884 1.00 78.30  ? 51  ILE H O     1 
ATOM 5526  C CB    . ILE H 4 51  ? 98.273  88.262  115.848 1.00 78.30  ? 51  ILE H CB    1 
ATOM 5527  C CG1   . ILE H 4 51  ? 99.312  89.318  115.482 1.00 78.30  ? 51  ILE H CG1   1 
ATOM 5528  C CG2   . ILE H 4 51  ? 98.372  87.872  117.309 1.00 78.30  ? 51  ILE H CG2   1 
ATOM 5529  C CD1   . ILE H 4 51  ? 99.118  90.624  116.184 1.00 78.30  ? 51  ILE H CD1   1 
ATOM 5530  N N     . SER H 4 52  ? 100.658 86.609  114.227 1.00 74.71  ? 52  SER H N     1 
ATOM 5531  C CA    . SER H 4 52  ? 101.935 85.919  114.281 1.00 74.71  ? 52  SER H CA    1 
ATOM 5532  C C     . SER H 4 52  ? 102.882 86.624  115.248 1.00 74.71  ? 52  SER H C     1 
ATOM 5533  O O     . SER H 4 52  ? 102.617 87.727  115.723 1.00 74.71  ? 52  SER H O     1 
ATOM 5534  C CB    . SER H 4 52  ? 102.542 85.839  112.893 1.00 74.71  ? 52  SER H CB    1 
ATOM 5535  O OG    . SER H 4 52  ? 102.801 87.143  112.422 1.00 74.71  ? 52  SER H OG    1 
ATOM 5536  N N     . SER H 4 53  ? 104.010 85.968  115.534 1.00 74.76  ? 53  SER H N     1 
ATOM 5537  C CA    . SER H 4 53  ? 104.874 86.404  116.628 1.00 74.76  ? 53  SER H CA    1 
ATOM 5538  C C     . SER H 4 53  ? 105.700 87.629  116.264 1.00 74.76  ? 53  SER H C     1 
ATOM 5539  O O     . SER H 4 53  ? 105.825 88.560  117.075 1.00 74.76  ? 53  SER H O     1 
ATOM 5540  C CB    . SER H 4 53  ? 105.800 85.268  117.051 1.00 74.76  ? 53  SER H CB    1 
ATOM 5541  O OG    . SER H 4 53  ? 106.679 85.693  118.074 1.00 74.76  ? 53  SER H OG    1 
ATOM 5542  N N     . LYS H 4 54  ? 106.284 87.644  115.065 1.00 67.40  ? 54  LYS H N     1 
ATOM 5543  C CA    . LYS H 4 54  ? 107.060 88.811  114.668 1.00 67.40  ? 54  LYS H CA    1 
ATOM 5544  C C     . LYS H 4 54  ? 106.170 90.018  114.446 1.00 67.40  ? 54  LYS H C     1 
ATOM 5545  O O     . LYS H 4 54  ? 106.612 91.147  114.664 1.00 67.40  ? 54  LYS H O     1 
ATOM 5546  C CB    . LYS H 4 54  ? 107.883 88.524  113.420 1.00 67.40  ? 54  LYS H CB    1 
ATOM 5547  C CG    . LYS H 4 54  ? 109.054 87.610  113.681 1.00 67.40  ? 54  LYS H CG    1 
ATOM 5548  C CD    . LYS H 4 54  ? 109.875 87.399  112.429 1.00 67.40  ? 54  LYS H CD    1 
ATOM 5549  C CE    . LYS H 4 54  ? 110.676 88.640  112.094 1.00 67.40  ? 54  LYS H CE    1 
ATOM 5550  N NZ    . LYS H 4 54  ? 111.752 88.910  113.085 1.00 67.40  ? 54  LYS H NZ    1 
ATOM 5551  N N     . ALA H 4 55  ? 104.914 89.802  114.063 1.00 71.18  ? 55  ALA H N     1 
ATOM 5552  C CA    . ALA H 4 55  ? 103.974 90.912  113.998 1.00 71.18  ? 55  ALA H CA    1 
ATOM 5553  C C     . ALA H 4 55  ? 103.668 91.452  115.379 1.00 71.18  ? 55  ALA H C     1 
ATOM 5554  O O     . ALA H 4 55  ? 103.469 92.662  115.545 1.00 71.18  ? 55  ALA H O     1 
ATOM 5555  C CB    . ALA H 4 55  ? 102.690 90.470  113.310 1.00 71.18  ? 55  ALA H CB    1 
ATOM 5556  N N     . MET H 4 56  ? 103.637 90.573  116.375 1.00 75.88  ? 56  MET H N     1 
ATOM 5557  C CA    . MET H 4 56  ? 103.463 91.011  117.749 1.00 75.88  ? 56  MET H CA    1 
ATOM 5558  C C     . MET H 4 56  ? 104.648 91.844  118.211 1.00 75.88  ? 56  MET H C     1 
ATOM 5559  O O     . MET H 4 56  ? 104.471 92.855  118.905 1.00 75.88  ? 56  MET H O     1 
ATOM 5560  C CB    . MET H 4 56  ? 103.261 89.799  118.647 1.00 75.88  ? 56  MET H CB    1 
ATOM 5561  C CG    . MET H 4 56  ? 102.999 90.165  120.061 1.00 75.88  ? 56  MET H CG    1 
ATOM 5562  S SD    . MET H 4 56  ? 101.550 91.215  120.143 1.00 75.88  ? 56  MET H SD    1 
ATOM 5563  C CE    . MET H 4 56  ? 100.282 90.029  119.732 1.00 75.88  ? 56  MET H CE    1 
ATOM 5564  N N     . SER H 4 57  ? 105.860 91.472  117.795 1.00 65.23  ? 57  SER H N     1 
ATOM 5565  C CA    . SER H 4 57  ? 106.997 92.316  118.142 1.00 65.23  ? 57  SER H CA    1 
ATOM 5566  C C     . SER H 4 57  ? 107.010 93.616  117.338 1.00 65.23  ? 57  SER H C     1 
ATOM 5567  O O     . SER H 4 57  ? 107.543 94.628  117.823 1.00 65.23  ? 57  SER H O     1 
ATOM 5568  C CB    . SER H 4 57  ? 108.301 91.555  117.957 1.00 65.23  ? 57  SER H CB    1 
ATOM 5569  O OG    . SER H 4 57  ? 109.390 92.378  118.313 1.00 65.23  ? 57  SER H OG    1 
ATOM 5570  N N     . ILE H 4 58  ? 106.419 93.618  116.135 1.00 62.23  ? 58  ILE H N     1 
ATOM 5571  C CA    . ILE H 4 58  ? 106.238 94.867  115.394 1.00 62.23  ? 58  ILE H CA    1 
ATOM 5572  C C     . ILE H 4 58  ? 105.345 95.813  116.171 1.00 62.23  ? 58  ILE H C     1 
ATOM 5573  O O     . ILE H 4 58  ? 105.698 96.976  116.389 1.00 62.23  ? 58  ILE H O     1 
ATOM 5574  C CB    . ILE H 4 58  ? 105.668 94.604  113.989 1.00 62.23  ? 58  ILE H CB    1 
ATOM 5575  C CG1   . ILE H 4 58  ? 106.693 93.955  113.064 1.00 62.23  ? 58  ILE H CG1   1 
ATOM 5576  C CG2   . ILE H 4 58  ? 105.172 95.892  113.361 1.00 62.23  ? 58  ILE H CG2   1 
ATOM 5577  C CD1   . ILE H 4 58  ? 107.808 94.864  112.633 1.00 62.23  ? 58  ILE H CD1   1 
ATOM 5578  N N     . MET H 4 59  ? 104.187 95.320  116.624 1.00 66.25  ? 59  MET H N     1 
ATOM 5579  C CA    . MET H 4 59  ? 103.275 96.179  117.371 1.00 66.25  ? 59  MET H CA    1 
ATOM 5580  C C     . MET H 4 59  ? 103.866 96.621  118.692 1.00 66.25  ? 59  MET H C     1 
ATOM 5581  O O     . MET H 4 59  ? 103.589 97.739  119.140 1.00 66.25  ? 59  MET H O     1 
ATOM 5582  C CB    . MET H 4 59  ? 101.941 95.489  117.630 1.00 66.25  ? 59  MET H CB    1 
ATOM 5583  C CG    . MET H 4 59  ? 101.057 95.363  116.426 1.00 66.25  ? 59  MET H CG    1 
ATOM 5584  S SD    . MET H 4 59  ? 100.824 96.954  115.624 1.00 66.25  ? 59  MET H SD    1 
ATOM 5585  C CE    . MET H 4 59  ? 100.059 97.925  116.918 1.00 66.25  ? 59  MET H CE    1 
ATOM 5586  N N     . ASN H 4 60  ? 104.687 95.770  119.313 1.00 64.38  ? 60  ASN H N     1 
ATOM 5587  C CA    . ASN H 4 60  ? 105.368 96.151  120.545 1.00 64.38  ? 60  ASN H CA    1 
ATOM 5588  C C     . ASN H 4 60  ? 106.293 97.338  120.313 1.00 64.38  ? 60  ASN H C     1 
ATOM 5589  O O     . ASN H 4 60  ? 106.219 98.350  121.028 1.00 64.38  ? 60  ASN H O     1 
ATOM 5590  C CB    . ASN H 4 60  ? 106.151 94.961  121.080 1.00 64.38  ? 60  ASN H CB    1 
ATOM 5591  C CG    . ASN H 4 60  ? 106.589 95.150  122.504 1.00 64.38  ? 60  ASN H CG    1 
ATOM 5592  O OD1   . ASN H 4 60  ? 106.269 96.152  123.133 1.00 64.38  ? 60  ASN H OD1   1 
ATOM 5593  N ND2   . ASN H 4 60  ? 107.338 94.186  123.025 1.00 64.38  ? 60  ASN H ND2   1 
ATOM 5594  N N     . SER H 4 61  ? 107.144 97.250  119.288 1.00 59.76  ? 61  SER H N     1 
ATOM 5595  C CA    . SER H 4 61  ? 108.025 98.372  118.990 1.00 59.76  ? 61  SER H CA    1 
ATOM 5596  C C     . SER H 4 61  ? 107.275 99.586  118.468 1.00 59.76  ? 61  SER H C     1 
ATOM 5597  O O     . SER H 4 61  ? 107.767 100.710 118.612 1.00 59.76  ? 61  SER H O     1 
ATOM 5598  C CB    . SER H 4 61  ? 109.090 97.956  117.987 1.00 59.76  ? 61  SER H CB    1 
ATOM 5599  O OG    . SER H 4 61  ? 109.965 96.999  118.553 1.00 59.76  ? 61  SER H OG    1 
ATOM 5600  N N     . PHE H 4 62  ? 106.091 99.388  117.893 1.00 58.77  ? 62  PHE H N     1 
ATOM 5601  C CA    . PHE H 4 62  ? 105.264 100.516 117.479 1.00 58.77  ? 62  PHE H CA    1 
ATOM 5602  C C     . PHE H 4 62  ? 104.757 101.292 118.679 1.00 58.77  ? 62  PHE H C     1 
ATOM 5603  O O     . PHE H 4 62  ? 104.800 102.530 118.700 1.00 58.77  ? 62  PHE H O     1 
ATOM 5604  C CB    . PHE H 4 62  ? 104.088 100.025 116.646 1.00 58.77  ? 62  PHE H CB    1 
ATOM 5605  C CG    . PHE H 4 62  ? 103.101 101.091 116.338 1.00 58.77  ? 62  PHE H CG    1 
ATOM 5606  C CD1   . PHE H 4 62  ? 103.387 102.060 115.411 1.00 58.77  ? 62  PHE H CD1   1 
ATOM 5607  C CD2   . PHE H 4 62  ? 101.878 101.131 116.986 1.00 58.77  ? 62  PHE H CD2   1 
ATOM 5608  C CE1   . PHE H 4 62  ? 102.476 103.055 115.131 1.00 58.77  ? 62  PHE H CE1   1 
ATOM 5609  C CE2   . PHE H 4 62  ? 100.964 102.126 116.712 1.00 58.77  ? 62  PHE H CE2   1 
ATOM 5610  C CZ    . PHE H 4 62  ? 101.265 103.091 115.783 1.00 58.77  ? 62  PHE H CZ    1 
ATOM 5611  N N     . VAL H 4 63  ? 104.238 100.570 119.670 1.00 59.55  ? 63  VAL H N     1 
ATOM 5612  C CA    . VAL H 4 63  ? 103.725 101.191 120.882 1.00 59.55  ? 63  VAL H CA    1 
ATOM 5613  C C     . VAL H 4 63  ? 104.840 101.900 121.641 1.00 59.55  ? 63  VAL H C     1 
ATOM 5614  O O     . VAL H 4 63  ? 104.641 103.011 122.158 1.00 59.55  ? 63  VAL H O     1 
ATOM 5615  C CB    . VAL H 4 63  ? 103.013 100.127 121.732 1.00 59.55  ? 63  VAL H CB    1 
ATOM 5616  C CG1   . VAL H 4 63  ? 102.689 100.641 123.098 1.00 59.55  ? 63  VAL H CG1   1 
ATOM 5617  C CG2   . VAL H 4 63  ? 101.739 99.710  121.042 1.00 59.55  ? 63  VAL H CG2   1 
ATOM 5618  N N     . ASN H 4 64  ? 106.045 101.309 121.674 1.00 59.32  ? 64  ASN H N     1 
ATOM 5619  C CA    . ASN H 4 64  ? 107.165 102.031 122.280 1.00 59.32  ? 64  ASN H CA    1 
ATOM 5620  C C     . ASN H 4 64  ? 107.525 103.285 121.494 1.00 59.32  ? 64  ASN H C     1 
ATOM 5621  O O     . ASN H 4 64  ? 107.737 104.338 122.100 1.00 59.32  ? 64  ASN H O     1 
ATOM 5622  C CB    . ASN H 4 64  ? 108.395 101.144 122.436 1.00 59.32  ? 64  ASN H CB    1 
ATOM 5623  C CG    . ASN H 4 64  ? 108.339 100.294 123.685 1.00 59.32  ? 64  ASN H CG    1 
ATOM 5624  O OD1   . ASN H 4 64  ? 107.848 100.737 124.719 1.00 59.32  ? 64  ASN H OD1   1 
ATOM 5625  N ND2   . ASN H 4 64  ? 108.876 99.086  123.611 1.00 59.32  ? 64  ASN H ND2   1 
ATOM 5626  N N     . ASP H 4 65  ? 107.524 103.209 120.156 1.00 63.93  ? 65  ASP H N     1 
ATOM 5627  C CA    . ASP H 4 65  ? 107.922 104.346 119.318 1.00 63.93  ? 65  ASP H CA    1 
ATOM 5628  C C     . ASP H 4 65  ? 106.978 105.531 119.482 1.00 63.93  ? 65  ASP H C     1 
ATOM 5629  O O     . ASP H 4 65  ? 107.429 106.672 119.684 1.00 63.93  ? 65  ASP H O     1 
ATOM 5630  C CB    . ASP H 4 65  ? 107.971 103.920 117.850 1.00 63.93  ? 65  ASP H CB    1 
ATOM 5631  C CG    . ASP H 4 65  ? 108.632 104.960 116.939 1.00 63.93  ? 65  ASP H CG    1 
ATOM 5632  O OD1   . ASP H 4 65  ? 109.126 106.001 117.422 1.00 63.93  ? 65  ASP H OD1   1 
ATOM 5633  O OD2   . ASP H 4 65  ? 108.651 104.732 115.712 1.00 63.93  ? 65  ASP H OD2   1 
ATOM 5634  N N     . VAL H 4 66  ? 105.668 105.283 119.373 1.00 60.61  ? 66  VAL H N     1 
ATOM 5635  C CA    . VAL H 4 66  ? 104.698 106.351 119.598 1.00 60.61  ? 66  VAL H CA    1 
ATOM 5636  C C     . VAL H 4 66  ? 104.808 106.866 121.021 1.00 60.61  ? 66  VAL H C     1 
ATOM 5637  O O     . VAL H 4 66  ? 104.801 108.081 121.250 1.00 60.61  ? 66  VAL H O     1 
ATOM 5638  C CB    . VAL H 4 66  ? 103.275 105.869 119.271 1.00 60.61  ? 66  VAL H CB    1 
ATOM 5639  C CG1   . VAL H 4 66  ? 102.233 106.908 119.658 1.00 60.61  ? 66  VAL H CG1   1 
ATOM 5640  C CG2   . VAL H 4 66  ? 103.179 105.581 117.806 1.00 60.61  ? 66  VAL H CG2   1 
ATOM 5641  N N     . PHE H 4 67  ? 105.043 105.957 121.969 1.00 60.47  ? 67  PHE H N     1 
ATOM 5642  C CA    . PHE H 4 67  ? 105.120 106.325 123.375 1.00 60.47  ? 67  PHE H CA    1 
ATOM 5643  C C     . PHE H 4 67  ? 106.262 107.295 123.665 1.00 60.47  ? 67  PHE H C     1 
ATOM 5644  O O     . PHE H 4 67  ? 106.077 108.264 124.411 1.00 60.47  ? 67  PHE H O     1 
ATOM 5645  C CB    . PHE H 4 67  ? 105.255 105.078 124.223 1.00 60.47  ? 67  PHE H CB    1 
ATOM 5646  C CG    . PHE H 4 67  ? 105.264 105.357 125.673 1.00 60.47  ? 67  PHE H CG    1 
ATOM 5647  C CD1   . PHE H 4 67  ? 104.114 105.769 126.303 1.00 60.47  ? 67  PHE H CD1   1 
ATOM 5648  C CD2   . PHE H 4 67  ? 106.418 105.198 126.412 1.00 60.47  ? 67  PHE H CD2   1 
ATOM 5649  C CE1   . PHE H 4 67  ? 104.113 106.021 127.635 1.00 60.47  ? 67  PHE H CE1   1 
ATOM 5650  C CE2   . PHE H 4 67  ? 106.422 105.451 127.750 1.00 60.47  ? 67  PHE H CE2   1 
ATOM 5651  C CZ    . PHE H 4 67  ? 105.268 105.865 128.361 1.00 60.47  ? 67  PHE H CZ    1 
ATOM 5652  N N     . GLU H 4 68  ? 107.435 107.095 123.056 1.00 63.15  ? 68  GLU H N     1 
ATOM 5653  C CA    . GLU H 4 68  ? 108.461 108.112 123.265 1.00 63.15  ? 68  GLU H CA    1 
ATOM 5654  C C     . GLU H 4 68  ? 108.250 109.339 122.386 1.00 63.15  ? 68  GLU H C     1 
ATOM 5655  O O     . GLU H 4 68  ? 108.811 110.397 122.701 1.00 63.15  ? 68  GLU H O     1 
ATOM 5656  C CB    . GLU H 4 68  ? 109.897 107.608 123.033 1.00 63.15  ? 68  GLU H CB    1 
ATOM 5657  C CG    . GLU H 4 68  ? 110.338 107.556 121.580 1.00 63.15  ? 68  GLU H CG    1 
ATOM 5658  C CD    . GLU H 4 68  ? 110.520 106.159 121.041 1.00 63.15  ? 68  GLU H CD    1 
ATOM 5659  O OE1   . GLU H 4 68  ? 110.354 105.194 121.805 1.00 63.15  ? 68  GLU H OE1   1 
ATOM 5660  O OE2   . GLU H 4 68  ? 110.800 106.020 119.833 1.00 63.15  ? 68  GLU H OE2   1 
ATOM 5661  N N     . ARG H 4 69  ? 107.469 109.238 121.300 1.00 61.77  ? 69  ARG H N     1 
ATOM 5662  C CA    . ARG H 4 69  ? 107.165 110.441 120.528 1.00 61.77  ? 69  ARG H CA    1 
ATOM 5663  C C     . ARG H 4 69  ? 106.316 111.421 121.330 1.00 61.77  ? 69  ARG H C     1 
ATOM 5664  O O     . ARG H 4 69  ? 106.733 112.560 121.568 1.00 61.77  ? 69  ARG H O     1 
ATOM 5665  C CB    . ARG H 4 69  ? 106.470 110.100 119.218 1.00 61.77  ? 69  ARG H CB    1 
ATOM 5666  C CG    . ARG H 4 69  ? 107.381 109.673 118.100 1.00 61.77  ? 69  ARG H CG    1 
ATOM 5667  C CD    . ARG H 4 69  ? 106.558 109.451 116.840 1.00 61.77  ? 69  ARG H CD    1 
ATOM 5668  N NE    . ARG H 4 69  ? 107.364 109.046 115.693 1.00 61.77  ? 69  ARG H NE    1 
ATOM 5669  C CZ    . ARG H 4 69  ? 106.858 108.737 114.507 1.00 61.77  ? 69  ARG H CZ    1 
ATOM 5670  N NH1   . ARG H 4 69  ? 105.552 108.780 114.320 1.00 61.77  ? 69  ARG H NH1   1 
ATOM 5671  N NH2   . ARG H 4 69  ? 107.652 108.382 113.510 1.00 61.77  ? 69  ARG H NH2   1 
ATOM 5672  N N     . ILE H 4 70  ? 105.123 111.000 121.768 1.00 63.06  ? 70  ILE H N     1 
ATOM 5673  C CA    . ILE H 4 70  ? 104.302 111.914 122.567 1.00 63.06  ? 70  ILE H CA    1 
ATOM 5674  C C     . ILE H 4 70  ? 104.855 112.139 123.971 1.00 63.06  ? 70  ILE H C     1 
ATOM 5675  O O     . ILE H 4 70  ? 104.505 113.137 124.610 1.00 63.06  ? 70  ILE H O     1 
ATOM 5676  C CB    . ILE H 4 70  ? 102.824 111.476 122.647 1.00 63.06  ? 70  ILE H CB    1 
ATOM 5677  C CG1   . ILE H 4 70  ? 102.678 109.972 122.622 1.00 63.06  ? 70  ILE H CG1   1 
ATOM 5678  C CG2   . ILE H 4 70  ? 102.025 112.044 121.531 1.00 63.06  ? 70  ILE H CG2   1 
ATOM 5679  C CD1   . ILE H 4 70  ? 103.008 109.285 123.873 1.00 63.06  ? 70  ILE H CD1   1 
ATOM 5680  N N     . ALA H 4 71  ? 105.683 111.229 124.488 1.00 63.59  ? 71  ALA H N     1 
ATOM 5681  C CA    . ALA H 4 71  ? 106.341 111.521 125.753 1.00 63.59  ? 71  ALA H CA    1 
ATOM 5682  C C     . ALA H 4 71  ? 107.347 112.652 125.590 1.00 63.59  ? 71  ALA H C     1 
ATOM 5683  O O     . ALA H 4 71  ? 107.408 113.558 126.428 1.00 63.59  ? 71  ALA H O     1 
ATOM 5684  C CB    . ALA H 4 71  ? 107.013 110.268 126.303 1.00 63.59  ? 71  ALA H CB    1 
ATOM 5685  N N     . GLY H 4 72  ? 108.124 112.634 124.504 1.00 64.26  ? 72  GLY H N     1 
ATOM 5686  C CA    . GLY H 4 72  ? 109.067 113.716 124.273 1.00 64.26  ? 72  GLY H CA    1 
ATOM 5687  C C     . GLY H 4 72  ? 108.385 115.026 123.929 1.00 64.26  ? 72  GLY H C     1 
ATOM 5688  O O     . GLY H 4 72  ? 108.819 116.101 124.366 1.00 64.26  ? 72  GLY H O     1 
ATOM 5689  N N     . GLU H 4 73  ? 107.311 114.956 123.140 1.00 66.53  ? 73  GLU H N     1 
ATOM 5690  C CA    . GLU H 4 73  ? 106.519 116.146 122.858 1.00 66.53  ? 73  GLU H CA    1 
ATOM 5691  C C     . GLU H 4 73  ? 105.895 116.716 124.118 1.00 66.53  ? 73  GLU H C     1 
ATOM 5692  O O     . GLU H 4 73  ? 105.785 117.939 124.259 1.00 66.53  ? 73  GLU H O     1 
ATOM 5693  C CB    . GLU H 4 73  ? 105.432 115.825 121.844 1.00 66.53  ? 73  GLU H CB    1 
ATOM 5694  C CG    . GLU H 4 73  ? 105.929 115.602 120.454 1.00 66.53  ? 73  GLU H CG    1 
ATOM 5695  C CD    . GLU H 4 73  ? 106.427 116.871 119.824 1.00 66.53  ? 73  GLU H CD    1 
ATOM 5696  O OE1   . GLU H 4 73  ? 105.935 117.956 120.196 1.00 66.53  ? 73  GLU H OE1   1 
ATOM 5697  O OE2   . GLU H 4 73  ? 107.302 116.785 118.940 1.00 66.53  ? 73  GLU H OE2   1 
ATOM 5698  N N     . ALA H 4 74  ? 105.496 115.852 125.048 1.00 69.31  ? 74  ALA H N     1 
ATOM 5699  C CA    . ALA H 4 74  ? 105.060 116.343 126.343 1.00 69.31  ? 74  ALA H CA    1 
ATOM 5700  C C     . ALA H 4 74  ? 106.214 116.950 127.117 1.00 69.31  ? 74  ALA H C     1 
ATOM 5701  O O     . ALA H 4 74  ? 106.003 117.875 127.908 1.00 69.31  ? 74  ALA H O     1 
ATOM 5702  C CB    . ALA H 4 74  ? 104.426 115.214 127.141 1.00 69.31  ? 74  ALA H CB    1 
ATOM 5703  N N     . SER H 4 75  ? 107.437 116.460 126.888 1.00 70.54  ? 75  SER H N     1 
ATOM 5704  C CA    . SER H 4 75  ? 108.585 116.972 127.628 1.00 70.54  ? 75  SER H CA    1 
ATOM 5705  C C     . SER H 4 75  ? 108.916 118.393 127.216 1.00 70.54  ? 75  SER H C     1 
ATOM 5706  O O     . SER H 4 75  ? 108.985 119.294 128.061 1.00 70.54  ? 75  SER H O     1 
ATOM 5707  C CB    . SER H 4 75  ? 109.804 116.077 127.431 1.00 70.54  ? 75  SER H CB    1 
ATOM 5708  O OG    . SER H 4 75  ? 110.946 116.663 128.030 1.00 70.54  ? 75  SER H OG    1 
ATOM 5709  N N     . ARG H 4 76  ? 109.120 118.622 125.923 1.00 72.19  ? 76  ARG H N     1 
ATOM 5710  C CA    . ARG H 4 76  ? 109.516 119.970 125.543 1.00 72.19  ? 76  ARG H CA    1 
ATOM 5711  C C     . ARG H 4 76  ? 108.315 120.898 125.461 1.00 72.19  ? 76  ARG H C     1 
ATOM 5712  O O     . ARG H 4 76  ? 108.453 122.103 125.713 1.00 72.19  ? 76  ARG H O     1 
ATOM 5713  C CB    . ARG H 4 76  ? 110.315 119.942 124.241 1.00 72.19  ? 76  ARG H CB    1 
ATOM 5714  C CG    . ARG H 4 76  ? 109.579 119.550 123.013 1.00 72.19  ? 76  ARG H CG    1 
ATOM 5715  C CD    . ARG H 4 76  ? 110.586 119.388 121.910 1.00 72.19  ? 76  ARG H CD    1 
ATOM 5716  N NE    . ARG H 4 76  ? 111.444 118.244 122.188 1.00 72.19  ? 76  ARG H NE    1 
ATOM 5717  C CZ    . ARG H 4 76  ? 111.181 117.010 121.773 1.00 72.19  ? 76  ARG H CZ    1 
ATOM 5718  N NH1   . ARG H 4 76  ? 110.099 116.777 121.051 1.00 72.19  ? 76  ARG H NH1   1 
ATOM 5719  N NH2   . ARG H 4 76  ? 111.992 116.010 122.071 1.00 72.19  ? 76  ARG H NH2   1 
ATOM 5720  N N     . LEU H 4 77  ? 107.128 120.347 125.185 1.00 70.09  ? 77  LEU H N     1 
ATOM 5721  C CA    . LEU H 4 77  ? 105.914 121.149 125.215 1.00 70.09  ? 77  LEU H CA    1 
ATOM 5722  C C     . LEU H 4 77  ? 105.572 121.581 126.627 1.00 70.09  ? 77  LEU H C     1 
ATOM 5723  O O     . LEU H 4 77  ? 104.944 122.625 126.816 1.00 70.09  ? 77  LEU H O     1 
ATOM 5724  C CB    . LEU H 4 77  ? 104.764 120.368 124.588 1.00 70.09  ? 77  LEU H CB    1 
ATOM 5725  C CG    . LEU H 4 77  ? 103.420 121.025 124.250 1.00 70.09  ? 77  LEU H CG    1 
ATOM 5726  C CD1   . LEU H 4 77  ? 102.425 121.001 125.387 1.00 70.09  ? 77  LEU H CD1   1 
ATOM 5727  C CD2   . LEU H 4 77  ? 103.625 122.454 123.792 1.00 70.09  ? 77  LEU H CD2   1 
ATOM 5728  N N     . ALA H 4 78  ? 105.949 120.795 127.625 1.00 71.54  ? 78  ALA H N     1 
ATOM 5729  C CA    . ALA H 4 78  ? 105.828 121.275 128.988 1.00 71.54  ? 78  ALA H CA    1 
ATOM 5730  C C     . ALA H 4 78  ? 107.015 122.124 129.394 1.00 71.54  ? 78  ALA H C     1 
ATOM 5731  O O     . ALA H 4 78  ? 106.929 122.871 130.373 1.00 71.54  ? 78  ALA H O     1 
ATOM 5732  C CB    . ALA H 4 78  ? 105.677 120.105 129.952 1.00 71.54  ? 78  ALA H CB    1 
ATOM 5733  N N     . HIS H 4 79  ? 108.120 122.024 128.669 1.00 72.62  ? 79  HIS H N     1 
ATOM 5734  C CA    . HIS H 4 79  ? 109.272 122.824 129.035 1.00 72.62  ? 79  HIS H CA    1 
ATOM 5735  C C     . HIS H 4 79  ? 109.127 124.256 128.554 1.00 72.62  ? 79  HIS H C     1 
ATOM 5736  O O     . HIS H 4 79  ? 109.722 125.164 129.140 1.00 72.62  ? 79  HIS H O     1 
ATOM 5737  C CB    . HIS H 4 79  ? 110.548 122.209 128.469 1.00 72.62  ? 79  HIS H CB    1 
ATOM 5738  C CG    . HIS H 4 79  ? 111.793 122.846 128.993 1.00 72.62  ? 79  HIS H CG    1 
ATOM 5739  N ND1   . HIS H 4 79  ? 112.245 122.638 130.277 1.00 72.62  ? 79  HIS H ND1   1 
ATOM 5740  C CD2   . HIS H 4 79  ? 112.663 123.709 128.422 1.00 72.62  ? 79  HIS H CD2   1 
ATOM 5741  C CE1   . HIS H 4 79  ? 113.346 123.338 130.471 1.00 72.62  ? 79  HIS H CE1   1 
ATOM 5742  N NE2   . HIS H 4 79  ? 113.624 123.993 129.359 1.00 72.62  ? 79  HIS H NE2   1 
ATOM 5743  N N     . TYR H 4 80  ? 108.338 124.474 127.506 1.00 77.16  ? 80  TYR H N     1 
ATOM 5744  C CA    . TYR H 4 80  ? 108.243 125.809 126.926 1.00 77.16  ? 80  TYR H CA    1 
ATOM 5745  C C     . TYR H 4 80  ? 107.491 126.764 127.838 1.00 77.16  ? 80  TYR H C     1 
ATOM 5746  O O     . TYR H 4 80  ? 107.847 127.941 127.939 1.00 77.16  ? 80  TYR H O     1 
ATOM 5747  C CB    . TYR H 4 80  ? 107.556 125.743 125.566 1.00 77.16  ? 80  TYR H CB    1 
ATOM 5748  C CG    . TYR H 4 80  ? 108.345 125.023 124.496 1.00 77.16  ? 80  TYR H CG    1 
ATOM 5749  C CD1   . TYR H 4 80  ? 109.719 124.823 124.622 1.00 77.16  ? 80  TYR H CD1   1 
ATOM 5750  C CD2   . TYR H 4 80  ? 107.708 124.513 123.370 1.00 77.16  ? 80  TYR H CD2   1 
ATOM 5751  C CE1   . TYR H 4 80  ? 110.427 124.158 123.650 1.00 77.16  ? 80  TYR H CE1   1 
ATOM 5752  C CE2   . TYR H 4 80  ? 108.415 123.847 122.392 1.00 77.16  ? 80  TYR H CE2   1 
ATOM 5753  C CZ    . TYR H 4 80  ? 109.771 123.682 122.537 1.00 77.16  ? 80  TYR H CZ    1 
ATOM 5754  O OH    . TYR H 4 80  ? 110.484 123.021 121.572 1.00 77.16  ? 80  TYR H OH    1 
ATOM 5755  N N     . ASN H 4 81  ? 106.463 126.278 128.523 1.00 77.97  ? 81  ASN H N     1 
ATOM 5756  C CA    . ASN H 4 81  ? 105.579 127.133 129.298 1.00 77.97  ? 81  ASN H CA    1 
ATOM 5757  C C     . ASN H 4 81  ? 106.043 127.339 130.725 1.00 77.97  ? 81  ASN H C     1 
ATOM 5758  O O     . ASN H 4 81  ? 105.228 127.755 131.557 1.00 77.97  ? 81  ASN H O     1 
ATOM 5759  C CB    . ASN H 4 81  ? 104.172 126.552 129.322 1.00 77.97  ? 81  ASN H CB    1 
ATOM 5760  C CG    . ASN H 4 81  ? 103.536 126.562 127.984 1.00 77.97  ? 81  ASN H CG    1 
ATOM 5761  O OD1   . ASN H 4 81  ? 103.659 127.522 127.233 1.00 77.97  ? 81  ASN H OD1   1 
ATOM 5762  N ND2   . ASN H 4 81  ? 102.852 125.489 127.663 1.00 77.97  ? 81  ASN H ND2   1 
ATOM 5763  N N     . LYS H 4 82  ? 107.308 127.021 131.026 1.00 81.12  ? 82  LYS H N     1 
ATOM 5764  C CA    . LYS H 4 82  ? 107.909 127.167 132.358 1.00 81.12  ? 82  LYS H CA    1 
ATOM 5765  C C     . LYS H 4 82  ? 107.162 126.353 133.410 1.00 81.12  ? 82  LYS H C     1 
ATOM 5766  O O     . LYS H 4 82  ? 107.067 126.750 134.572 1.00 81.12  ? 82  LYS H O     1 
ATOM 5767  C CB    . LYS H 4 82  ? 108.003 128.640 132.767 1.00 81.12  ? 82  LYS H CB    1 
ATOM 5768  C CG    . LYS H 4 82  ? 108.929 129.433 131.878 1.00 81.12  ? 82  LYS H CG    1 
ATOM 5769  C CD    . LYS H 4 82  ? 108.726 130.910 132.077 1.00 81.12  ? 82  LYS H CD    1 
ATOM 5770  C CE    . LYS H 4 82  ? 109.178 131.352 133.446 1.00 81.12  ? 82  LYS H CE    1 
ATOM 5771  N NZ    . LYS H 4 82  ? 110.654 131.251 133.576 1.00 81.12  ? 82  LYS H NZ    1 
ATOM 5772  N N     . ARG H 4 83  ? 106.618 125.215 132.998 1.00 81.05  ? 83  ARG H N     1 
ATOM 5773  C CA    . ARG H 4 83  ? 105.955 124.286 133.894 1.00 81.05  ? 83  ARG H CA    1 
ATOM 5774  C C     . ARG H 4 83  ? 106.921 123.180 134.301 1.00 81.05  ? 83  ARG H C     1 
ATOM 5775  O O     . ARG H 4 83  ? 108.041 123.077 133.801 1.00 81.05  ? 83  ARG H O     1 
ATOM 5776  C CB    . ARG H 4 83  ? 104.721 123.687 133.223 1.00 81.05  ? 83  ARG H CB    1 
ATOM 5777  C CG    . ARG H 4 83  ? 103.677 124.694 132.822 1.00 81.05  ? 83  ARG H CG    1 
ATOM 5778  C CD    . ARG H 4 83  ? 102.997 125.294 134.022 1.00 81.05  ? 83  ARG H CD    1 
ATOM 5779  N NE    . ARG H 4 83  ? 101.831 126.082 133.634 1.00 81.05  ? 83  ARG H NE    1 
ATOM 5780  C CZ    . ARG H 4 83  ? 101.853 127.382 133.373 1.00 81.05  ? 83  ARG H CZ    1 
ATOM 5781  N NH1   . ARG H 4 83  ? 102.984 128.061 133.456 1.00 81.05  ? 83  ARG H NH1   1 
ATOM 5782  N NH2   . ARG H 4 83  ? 100.737 128.002 133.032 1.00 81.05  ? 83  ARG H NH2   1 
ATOM 5783  N N     . SER H 4 84  ? 106.467 122.342 135.227 1.00 83.17  ? 84  SER H N     1 
ATOM 5784  C CA    . SER H 4 84  ? 107.240 121.189 135.664 1.00 83.17  ? 84  SER H CA    1 
ATOM 5785  C C     . SER H 4 84  ? 106.342 119.981 135.891 1.00 83.17  ? 84  SER H C     1 
ATOM 5786  O O     . SER H 4 84  ? 106.643 119.127 136.732 1.00 83.17  ? 84  SER H O     1 
ATOM 5787  C CB    . SER H 4 84  ? 108.018 121.525 136.925 1.00 83.17  ? 84  SER H CB    1 
ATOM 5788  O OG    . SER H 4 84  ? 107.126 121.923 137.942 1.00 83.17  ? 84  SER H OG    1 
ATOM 5789  N N     . THR H 4 85  ? 105.234 119.899 135.154 1.00 83.30  ? 85  THR H N     1 
ATOM 5790  C CA    . THR H 4 85  ? 104.204 118.897 135.394 1.00 83.30  ? 85  THR H CA    1 
ATOM 5791  C C     . THR H 4 85  ? 103.561 118.525 134.067 1.00 83.30  ? 85  THR H C     1 
ATOM 5792  O O     . THR H 4 85  ? 103.251 119.406 133.264 1.00 83.30  ? 85  THR H O     1 
ATOM 5793  C CB    . THR H 4 85  ? 103.147 119.424 136.377 1.00 83.30  ? 85  THR H CB    1 
ATOM 5794  O OG1   . THR H 4 85  ? 103.777 119.828 137.597 1.00 83.30  ? 85  THR H OG1   1 
ATOM 5795  C CG2   . THR H 4 85  ? 102.127 118.355 136.709 1.00 83.30  ? 85  THR H CG2   1 
ATOM 5796  N N     . ILE H 4 86  ? 103.383 117.234 133.830 1.00 74.61  ? 86  ILE H N     1 
ATOM 5797  C CA    . ILE H 4 86  ? 102.698 116.741 132.647 1.00 74.61  ? 86  ILE H CA    1 
ATOM 5798  C C     . ILE H 4 86  ? 101.283 116.358 133.054 1.00 74.61  ? 86  ILE H C     1 
ATOM 5799  O O     . ILE H 4 86  ? 101.079 115.365 133.759 1.00 74.61  ? 86  ILE H O     1 
ATOM 5800  C CB    . ILE H 4 86  ? 103.438 115.552 132.027 1.00 74.61  ? 86  ILE H CB    1 
ATOM 5801  C CG1   . ILE H 4 86  ? 104.802 115.990 131.522 1.00 74.61  ? 86  ILE H CG1   1 
ATOM 5802  C CG2   . ILE H 4 86  ? 102.664 114.984 130.890 1.00 74.61  ? 86  ILE H CG2   1 
ATOM 5803  C CD1   . ILE H 4 86  ? 105.666 114.861 131.063 1.00 74.61  ? 86  ILE H CD1   1 
ATOM 5804  N N     . THR H 4 87  ? 100.298 117.138 132.615 1.00 81.77  ? 87  THR H N     1 
ATOM 5805  C CA    . THR H 4 87  ? 98.890  116.832 132.826 1.00 81.77  ? 87  THR H CA    1 
ATOM 5806  C C     . THR H 4 87  ? 98.231  116.525 131.488 1.00 81.77  ? 87  THR H C     1 
ATOM 5807  O O     . THR H 4 87  ? 98.863  116.558 130.431 1.00 81.77  ? 87  THR H O     1 
ATOM 5808  C CB    . THR H 4 87  ? 98.170  117.985 133.526 1.00 81.77  ? 87  THR H CB    1 
ATOM 5809  O OG1   . THR H 4 87  ? 98.150  119.127 132.664 1.00 81.77  ? 87  THR H OG1   1 
ATOM 5810  C CG2   . THR H 4 87  ? 98.876  118.342 134.819 1.00 81.77  ? 87  THR H CG2   1 
ATOM 5811  N N     . SER H 4 88  ? 96.932  116.242 131.539 1.00 86.01  ? 88  SER H N     1 
ATOM 5812  C CA    . SER H 4 88  ? 96.239  115.740 130.362 1.00 86.01  ? 88  SER H CA    1 
ATOM 5813  C C     . SER H 4 88  ? 96.025  116.802 129.297 1.00 86.01  ? 88  SER H C     1 
ATOM 5814  O O     . SER H 4 88  ? 95.805  116.451 128.134 1.00 86.01  ? 88  SER H O     1 
ATOM 5815  C CB    . SER H 4 88  ? 94.898  115.142 130.763 1.00 86.01  ? 88  SER H CB    1 
ATOM 5816  O OG    . SER H 4 88  ? 95.096  114.016 131.596 1.00 86.01  ? 88  SER H OG    1 
ATOM 5817  N N     . ARG H 4 89  ? 96.070  118.082 129.662 1.00 85.32  ? 89  ARG H N     1 
ATOM 5818  C CA    . ARG H 4 89  ? 96.001  119.133 128.656 1.00 85.32  ? 89  ARG H CA    1 
ATOM 5819  C C     . ARG H 4 89  ? 97.233  119.098 127.761 1.00 85.32  ? 89  ARG H C     1 
ATOM 5820  O O     . ARG H 4 89  ? 97.137  119.300 126.543 1.00 85.32  ? 89  ARG H O     1 
ATOM 5821  C CB    . ARG H 4 89  ? 95.844  120.487 129.350 1.00 85.32  ? 89  ARG H CB    1 
ATOM 5822  C CG    . ARG H 4 89  ? 95.788  121.690 128.430 1.00 85.32  ? 89  ARG H CG    1 
ATOM 5823  C CD    . ARG H 4 89  ? 94.565  121.629 127.547 1.00 85.32  ? 89  ARG H CD    1 
ATOM 5824  N NE    . ARG H 4 89  ? 94.456  122.783 126.656 1.00 85.32  ? 89  ARG H NE    1 
ATOM 5825  C CZ    . ARG H 4 89  ? 93.739  123.871 126.919 1.00 85.32  ? 89  ARG H CZ    1 
ATOM 5826  N NH1   . ARG H 4 89  ? 93.051  123.955 128.046 1.00 85.32  ? 89  ARG H NH1   1 
ATOM 5827  N NH2   . ARG H 4 89  ? 93.695  124.869 126.047 1.00 85.32  ? 89  ARG H NH2   1 
ATOM 5828  N N     . GLU H 4 90  ? 98.388  118.782 128.348 1.00 82.64  ? 90  GLU H N     1 
ATOM 5829  C CA    . GLU H 4 90  ? 99.629  118.685 127.591 1.00 82.64  ? 90  GLU H CA    1 
ATOM 5830  C C     . GLU H 4 90  ? 99.613  117.493 126.655 1.00 82.64  ? 90  GLU H C     1 
ATOM 5831  O O     . GLU H 4 90  ? 100.099 117.580 125.521 1.00 82.64  ? 90  GLU H O     1 
ATOM 5832  C CB    . GLU H 4 90  ? 100.812 118.594 128.547 1.00 82.64  ? 90  GLU H CB    1 
ATOM 5833  C CG    . GLU H 4 90  ? 101.159 119.905 129.221 1.00 82.64  ? 90  GLU H CG    1 
ATOM 5834  C CD    . GLU H 4 90  ? 100.281 120.229 130.413 1.00 82.64  ? 90  GLU H CD    1 
ATOM 5835  O OE1   . GLU H 4 90  ? 99.440  119.391 130.787 1.00 82.64  ? 90  GLU H OE1   1 
ATOM 5836  O OE2   . GLU H 4 90  ? 100.417 121.337 130.970 1.00 82.64  ? 90  GLU H OE2   1 
ATOM 5837  N N     . ILE H 4 91  ? 99.057  116.373 127.107 1.00 79.46  ? 91  ILE H N     1 
ATOM 5838  C CA    . ILE H 4 91  ? 98.971  115.224 126.226 1.00 79.46  ? 91  ILE H CA    1 
ATOM 5839  C C     . ILE H 4 91  ? 97.938  115.479 125.137 1.00 79.46  ? 91  ILE H C     1 
ATOM 5840  O O     . ILE H 4 91  ? 98.085  114.992 124.013 1.00 79.46  ? 91  ILE H O     1 
ATOM 5841  C CB    . ILE H 4 91  ? 98.651  113.959 127.030 1.00 79.46  ? 91  ILE H CB    1 
ATOM 5842  C CG1   . ILE H 4 91  ? 99.577  113.847 128.229 1.00 79.46  ? 91  ILE H CG1   1 
ATOM 5843  C CG2   . ILE H 4 91  ? 98.876  112.732 126.183 1.00 79.46  ? 91  ILE H CG2   1 
ATOM 5844  C CD1   . ILE H 4 91  ? 101.018 113.674 127.865 1.00 79.46  ? 91  ILE H CD1   1 
ATOM 5845  N N     . GLN H 4 92  ? 96.902  116.273 125.431 1.00 85.45  ? 92  GLN H N     1 
ATOM 5846  C CA    . GLN H 4 92  ? 95.927  116.624 124.401 1.00 85.45  ? 92  GLN H CA    1 
ATOM 5847  C C     . GLN H 4 92  ? 96.550  117.490 123.316 1.00 85.45  ? 92  GLN H C     1 
ATOM 5848  O O     . GLN H 4 92  ? 96.306  117.272 122.120 1.00 85.45  ? 92  GLN H O     1 
ATOM 5849  C CB    . GLN H 4 92  ? 94.732  117.340 125.022 1.00 85.45  ? 92  GLN H CB    1 
ATOM 5850  C CG    . GLN H 4 92  ? 93.693  117.759 124.001 1.00 85.45  ? 92  GLN H CG    1 
ATOM 5851  C CD    . GLN H 4 92  ? 92.502  118.421 124.630 1.00 85.45  ? 92  GLN H CD    1 
ATOM 5852  O OE1   . GLN H 4 92  ? 92.430  118.562 125.846 1.00 85.45  ? 92  GLN H OE1   1 
ATOM 5853  N NE2   . GLN H 4 92  ? 91.564  118.851 123.803 1.00 85.45  ? 92  GLN H NE2   1 
ATOM 5854  N N     . THR H 4 93  ? 97.366  118.463 123.717 1.00 80.99  ? 93  THR H N     1 
ATOM 5855  C CA    . THR H 4 93  ? 98.070  119.287 122.746 1.00 80.99  ? 93  THR H CA    1 
ATOM 5856  C C     . THR H 4 93  ? 99.041  118.456 121.920 1.00 80.99  ? 93  THR H C     1 
ATOM 5857  O O     . THR H 4 93  ? 99.052  118.544 120.686 1.00 80.99  ? 93  THR H O     1 
ATOM 5858  C CB    . THR H 4 93  ? 98.805  120.407 123.468 1.00 80.99  ? 93  THR H CB    1 
ATOM 5859  O OG1   . THR H 4 93  ? 97.853  121.232 124.148 1.00 80.99  ? 93  THR H OG1   1 
ATOM 5860  C CG2   . THR H 4 93  ? 99.592  121.242 122.488 1.00 80.99  ? 93  THR H CG2   1 
ATOM 5861  N N     . ALA H 4 94  ? 99.829  117.607 122.584 1.00 77.60  ? 94  ALA H N     1 
ATOM 5862  C CA    . ALA H 4 94  ? 100.863 116.854 121.884 1.00 77.60  ? 94  ALA H CA    1 
ATOM 5863  C C     . ALA H 4 94  ? 100.274 115.808 120.950 1.00 77.60  ? 94  ALA H C     1 
ATOM 5864  O O     . ALA H 4 94  ? 100.838 115.548 119.879 1.00 77.60  ? 94  ALA H O     1 
ATOM 5865  C CB    . ALA H 4 94  ? 101.803 116.199 122.888 1.00 77.60  ? 94  ALA H CB    1 
ATOM 5866  N N     . VAL H 4 95  ? 99.132  115.228 121.315 1.00 77.99  ? 95  VAL H N     1 
ATOM 5867  C CA    . VAL H 4 95  ? 98.426  114.368 120.378 1.00 77.99  ? 95  VAL H CA    1 
ATOM 5868  C C     . VAL H 4 95  ? 97.871  115.194 119.229 1.00 77.99  ? 95  VAL H C     1 
ATOM 5869  O O     . VAL H 4 95  ? 97.960  114.793 118.062 1.00 77.99  ? 95  VAL H O     1 
ATOM 5870  C CB    . VAL H 4 95  ? 97.342  113.560 121.105 1.00 77.99  ? 95  VAL H CB    1 
ATOM 5871  C CG1   . VAL H 4 95  ? 96.406  112.896 120.127 1.00 77.99  ? 95  VAL H CG1   1 
ATOM 5872  C CG2   . VAL H 4 95  ? 97.999  112.486 121.921 1.00 77.99  ? 95  VAL H CG2   1 
ATOM 5873  N N     . ARG H 4 96  ? 97.405  116.414 119.515 1.00 77.82  ? 96  ARG H N     1 
ATOM 5874  C CA    . ARG H 4 96  ? 97.018  117.284 118.406 1.00 77.82  ? 96  ARG H CA    1 
ATOM 5875  C C     . ARG H 4 96  ? 98.196  117.822 117.611 1.00 77.82  ? 96  ARG H C     1 
ATOM 5876  O O     . ARG H 4 96  ? 97.971  118.545 116.641 1.00 77.82  ? 96  ARG H O     1 
ATOM 5877  C CB    . ARG H 4 96  ? 96.184  118.462 118.888 1.00 77.82  ? 96  ARG H CB    1 
ATOM 5878  C CG    . ARG H 4 96  ? 94.752  118.140 119.207 1.00 77.82  ? 96  ARG H CG    1 
ATOM 5879  C CD    . ARG H 4 96  ? 94.055  119.412 119.596 1.00 77.82  ? 96  ARG H CD    1 
ATOM 5880  N NE    . ARG H 4 96  ? 94.084  120.352 118.485 1.00 77.82  ? 96  ARG H NE    1 
ATOM 5881  C CZ    . ARG H 4 96  ? 93.799  121.642 118.597 1.00 77.82  ? 96  ARG H CZ    1 
ATOM 5882  N NH1   . ARG H 4 96  ? 93.468  122.150 119.776 1.00 77.82  ? 96  ARG H NH1   1 
ATOM 5883  N NH2   . ARG H 4 96  ? 93.856  122.429 117.533 1.00 77.82  ? 96  ARG H NH2   1 
ATOM 5884  N N     . LEU H 4 97  ? 99.431  117.513 117.980 1.00 74.35  ? 97  LEU H N     1 
ATOM 5885  C CA    . LEU H 4 97  ? 100.553 117.793 117.107 1.00 74.35  ? 97  LEU H CA    1 
ATOM 5886  C C     . LEU H 4 97  ? 101.011 116.582 116.316 1.00 74.35  ? 97  LEU H C     1 
ATOM 5887  O O     . LEU H 4 97  ? 101.364 116.722 115.142 1.00 74.35  ? 97  LEU H O     1 
ATOM 5888  C CB    . LEU H 4 97  ? 101.720 118.340 117.916 1.00 74.35  ? 97  LEU H CB    1 
ATOM 5889  C CG    . LEU H 4 97  ? 101.447 119.743 118.423 1.00 74.35  ? 97  LEU H CG    1 
ATOM 5890  C CD1   . LEU H 4 97  ? 102.577 120.183 119.308 1.00 74.35  ? 97  LEU H CD1   1 
ATOM 5891  C CD2   . LEU H 4 97  ? 101.274 120.676 117.247 1.00 74.35  ? 97  LEU H CD2   1 
ATOM 5892  N N     . LEU H 4 98  ? 101.020 115.393 116.908 1.00 76.19  ? 98  LEU H N     1 
ATOM 5893  C CA    . LEU H 4 98  ? 101.537 114.264 116.147 1.00 76.19  ? 98  LEU H CA    1 
ATOM 5894  C C     . LEU H 4 98  ? 100.478 113.548 115.334 1.00 76.19  ? 98  LEU H C     1 
ATOM 5895  O O     . LEU H 4 98  ? 100.786 113.023 114.260 1.00 76.19  ? 98  LEU H O     1 
ATOM 5896  C CB    . LEU H 4 98  ? 102.214 113.259 117.066 1.00 76.19  ? 98  LEU H CB    1 
ATOM 5897  C CG    . LEU H 4 98  ? 103.481 113.843 117.662 1.00 76.19  ? 98  LEU H CG    1 
ATOM 5898  C CD1   . LEU H 4 98  ? 104.087 112.842 118.586 1.00 76.19  ? 98  LEU H CD1   1 
ATOM 5899  C CD2   . LEU H 4 98  ? 104.457 114.217 116.568 1.00 76.19  ? 98  LEU H CD2   1 
ATOM 5900  N N     . LEU H 4 99  ? 99.267  113.512 115.802 1.00 86.04  ? 99  LEU H N     1 
ATOM 5901  C CA    . LEU H 4 99  ? 98.258  112.720 115.124 1.00 86.04  ? 99  LEU H CA    1 
ATOM 5902  C C     . LEU H 4 99  ? 97.658  113.521 113.975 1.00 86.04  ? 99  LEU H C     1 
ATOM 5903  O O     . LEU H 4 99  ? 97.182  114.637 114.189 1.00 86.04  ? 99  LEU H O     1 
ATOM 5904  C CB    . LEU H 4 99  ? 97.178  112.291 116.102 1.00 86.04  ? 99  LEU H CB    1 
ATOM 5905  C CG    . LEU H 4 99  ? 97.341  110.980 116.875 1.00 86.04  ? 99  LEU H CG    1 
ATOM 5906  C CD1   . LEU H 4 99  ? 97.311  109.842 115.899 1.00 86.04  ? 99  LEU H CD1   1 
ATOM 5907  C CD2   . LEU H 4 99  ? 98.596  110.910 117.720 1.00 86.04  ? 99  LEU H CD2   1 
ATOM 5908  N N     . PRO H 4 100 ? 97.671  113.000 112.764 1.00 89.46  ? 100 PRO H N     1 
ATOM 5909  C CA    . PRO H 4 100 ? 97.256  113.804 111.609 1.00 89.46  ? 100 PRO H CA    1 
ATOM 5910  C C     . PRO H 4 100 ? 95.753  113.947 111.425 1.00 89.46  ? 100 PRO H C     1 
ATOM 5911  O O     . PRO H 4 100 ? 95.149  113.155 110.698 1.00 89.46  ? 100 PRO H O     1 
ATOM 5912  C CB    . PRO H 4 100 ? 97.871  113.045 110.426 1.00 89.46  ? 100 PRO H CB    1 
ATOM 5913  C CG    . PRO H 4 100 ? 98.939  112.213 111.013 1.00 89.46  ? 100 PRO H CG    1 
ATOM 5914  C CD    . PRO H 4 100 ? 98.407  111.803 112.345 1.00 89.46  ? 100 PRO H CD    1 
ATOM 5915  N N     . GLY H 4 101 ? 95.127  114.919 112.082 1.00 93.59  ? 101 GLY H N     1 
ATOM 5916  C CA    . GLY H 4 101 ? 93.810  115.358 111.653 1.00 93.59  ? 101 GLY H CA    1 
ATOM 5917  C C     . GLY H 4 101 ? 92.638  114.534 112.139 1.00 93.59  ? 101 GLY H C     1 
ATOM 5918  O O     . GLY H 4 101 ? 92.209  114.683 113.285 1.00 93.59  ? 101 GLY H O     1 
ATOM 5919  N N     . GLU H 4 102 ? 92.082  113.698 111.255 1.00 100.30 ? 102 GLU H N     1 
ATOM 5920  C CA    . GLU H 4 102 ? 91.014  112.784 111.650 1.00 100.30 ? 102 GLU H CA    1 
ATOM 5921  C C     . GLU H 4 102 ? 91.483  111.813 112.721 1.00 100.30 ? 102 GLU H C     1 
ATOM 5922  O O     . GLU H 4 102 ? 90.715  111.454 113.620 1.00 100.30 ? 102 GLU H O     1 
ATOM 5923  C CB    . GLU H 4 102 ? 90.509  112.010 110.434 1.00 100.30 ? 102 GLU H CB    1 
ATOM 5924  C CG    . GLU H 4 102 ? 89.781  112.841 109.394 1.00 100.30 ? 102 GLU H CG    1 
ATOM 5925  C CD    . GLU H 4 102 ? 88.394  113.248 109.837 1.00 100.30 ? 102 GLU H CD    1 
ATOM 5926  O OE1   . GLU H 4 102 ? 87.769  112.483 110.599 1.00 100.30 ? 102 GLU H OE1   1 
ATOM 5927  O OE2   . GLU H 4 102 ? 87.922  114.321 109.409 1.00 100.30 ? 102 GLU H OE2   1 
ATOM 5928  N N     . LEU H 4 103 ? 92.747  111.401 112.650 1.00 96.39  ? 103 LEU H N     1 
ATOM 5929  C CA    . LEU H 4 103 ? 93.351  110.603 113.703 1.00 96.39  ? 103 LEU H CA    1 
ATOM 5930  C C     . LEU H 4 103 ? 93.530  111.373 114.997 1.00 96.39  ? 103 LEU H C     1 
ATOM 5931  O O     . LEU H 4 103 ? 93.631  110.753 116.060 1.00 96.39  ? 103 LEU H O     1 
ATOM 5932  C CB    . LEU H 4 103 ? 94.696  110.060 113.238 1.00 96.39  ? 103 LEU H CB    1 
ATOM 5933  C CG    . LEU H 4 103 ? 94.696  108.614 112.763 1.00 96.39  ? 103 LEU H CG    1 
ATOM 5934  C CD1   . LEU H 4 103 ? 94.429  107.772 113.961 1.00 96.39  ? 103 LEU H CD1   1 
ATOM 5935  C CD2   . LEU H 4 103 ? 93.645  108.328 111.716 1.00 96.39  ? 103 LEU H CD2   1 
ATOM 5936  N N     . ALA H 4 104 ? 93.588  112.700 114.944 1.00 92.81  ? 104 ALA H N     1 
ATOM 5937  C CA    . ALA H 4 104 ? 93.655  113.445 116.191 1.00 92.81  ? 104 ALA H CA    1 
ATOM 5938  C C     . ALA H 4 104 ? 92.308  113.469 116.895 1.00 92.81  ? 104 ALA H C     1 
ATOM 5939  O O     . ALA H 4 104 ? 92.248  113.313 118.119 1.00 92.81  ? 104 ALA H O     1 
ATOM 5940  C CB    . ALA H 4 104 ? 94.143  114.867 115.934 1.00 92.81  ? 104 ALA H CB    1 
ATOM 5941  N N     . LYS H 4 105 ? 91.225  113.622 116.129 1.00 92.96  ? 105 LYS H N     1 
ATOM 5942  C CA    . LYS H 4 105 ? 89.925  113.959 116.700 1.00 92.96  ? 105 LYS H CA    1 
ATOM 5943  C C     . LYS H 4 105 ? 89.354  112.811 117.515 1.00 92.96  ? 105 LYS H C     1 
ATOM 5944  O O     . LYS H 4 105 ? 88.902  113.010 118.648 1.00 92.96  ? 105 LYS H O     1 
ATOM 5945  C CB    . LYS H 4 105 ? 88.962  114.355 115.586 1.00 92.96  ? 105 LYS H CB    1 
ATOM 5946  C CG    . LYS H 4 105 ? 89.316  115.674 114.939 1.00 92.96  ? 105 LYS H CG    1 
ATOM 5947  C CD    . LYS H 4 105 ? 88.491  115.926 113.703 1.00 92.96  ? 105 LYS H CD    1 
ATOM 5948  C CE    . LYS H 4 105 ? 87.050  116.198 114.046 1.00 92.96  ? 105 LYS H CE    1 
ATOM 5949  N NZ    . LYS H 4 105 ? 86.313  116.598 112.825 1.00 92.96  ? 105 LYS H NZ    1 
ATOM 5950  N N     . HIS H 4 106 ? 89.377  111.600 116.962 1.00 93.96  ? 106 HIS H N     1 
ATOM 5951  C CA    . HIS H 4 106 ? 88.838  110.464 117.696 1.00 93.96  ? 106 HIS H CA    1 
ATOM 5952  C C     . HIS H 4 106 ? 89.756  110.057 118.833 1.00 93.96  ? 106 HIS H C     1 
ATOM 5953  O O     . HIS H 4 106 ? 89.297  109.478 119.824 1.00 93.96  ? 106 HIS H O     1 
ATOM 5954  C CB    . HIS H 4 106 ? 88.592  109.300 116.746 1.00 93.96  ? 106 HIS H CB    1 
ATOM 5955  C CG    . HIS H 4 106 ? 87.532  109.579 115.731 1.00 93.96  ? 106 HIS H CG    1 
ATOM 5956  N ND1   . HIS H 4 106 ? 86.190  109.575 116.041 1.00 93.96  ? 106 HIS H ND1   1 
ATOM 5957  C CD2   . HIS H 4 106 ? 87.614  109.895 114.418 1.00 93.96  ? 106 HIS H CD2   1 
ATOM 5958  C CE1   . HIS H 4 106 ? 85.489  109.864 114.960 1.00 93.96  ? 106 HIS H CE1   1 
ATOM 5959  N NE2   . HIS H 4 106 ? 86.330  110.061 113.961 1.00 93.96  ? 106 HIS H NE2   1 
ATOM 5960  N N     . ALA H 4 107 ? 91.046  110.361 118.712 1.00 95.47  ? 107 ALA H N     1 
ATOM 5961  C CA    . ALA H 4 107 ? 91.948  110.179 119.837 1.00 95.47  ? 107 ALA H CA    1 
ATOM 5962  C C     . ALA H 4 107 ? 91.598  111.127 120.974 1.00 95.47  ? 107 ALA H C     1 
ATOM 5963  O O     . ALA H 4 107 ? 91.683  110.754 122.148 1.00 95.47  ? 107 ALA H O     1 
ATOM 5964  C CB    . ALA H 4 107 ? 93.390  110.388 119.390 1.00 95.47  ? 107 ALA H CB    1 
ATOM 5965  N N     . VAL H 4 108 ? 91.185  112.348 120.647 1.00 100.98 ? 108 VAL H N     1 
ATOM 5966  C CA    . VAL H 4 108 ? 90.797  113.285 121.693 1.00 100.98 ? 108 VAL H CA    1 
ATOM 5967  C C     . VAL H 4 108 ? 89.421  112.926 122.258 1.00 100.98 ? 108 VAL H C     1 
ATOM 5968  O O     . VAL H 4 108 ? 89.171  113.107 123.457 1.00 100.98 ? 108 VAL H O     1 
ATOM 5969  C CB    . VAL H 4 108 ? 90.879  114.723 121.141 1.00 100.98 ? 108 VAL H CB    1 
ATOM 5970  C CG1   . VAL H 4 108 ? 90.309  115.755 122.108 1.00 100.98 ? 108 VAL H CG1   1 
ATOM 5971  C CG2   . VAL H 4 108 ? 92.331  115.077 120.857 1.00 100.98 ? 108 VAL H CG2   1 
ATOM 5972  N N     . SER H 4 109 ? 88.533  112.356 121.439 1.00 101.37 ? 109 SER H N     1 
ATOM 5973  C CA    . SER H 4 109 ? 87.224  111.954 121.946 1.00 101.37 ? 109 SER H CA    1 
ATOM 5974  C C     . SER H 4 109 ? 87.334  110.747 122.870 1.00 101.37 ? 109 SER H C     1 
ATOM 5975  O O     . SER H 4 109 ? 86.702  110.711 123.935 1.00 101.37 ? 109 SER H O     1 
ATOM 5976  C CB    . SER H 4 109 ? 86.283  111.662 120.780 1.00 101.37 ? 109 SER H CB    1 
ATOM 5977  O OG    . SER H 4 109 ? 86.041  112.832 120.019 1.00 101.37 ? 109 SER H OG    1 
ATOM 5978  N N     . GLU H 4 110 ? 88.152  109.762 122.492 1.00 101.11 ? 110 GLU H N     1 
ATOM 5979  C CA    . GLU H 4 110 ? 88.425  108.649 123.392 1.00 101.11 ? 110 GLU H CA    1 
ATOM 5980  C C     . GLU H 4 110 ? 89.215  109.095 124.610 1.00 101.11 ? 110 GLU H C     1 
ATOM 5981  O O     . GLU H 4 110 ? 89.058  108.521 125.694 1.00 101.11 ? 110 GLU H O     1 
ATOM 5982  C CB    . GLU H 4 110 ? 89.179  107.549 122.653 1.00 101.11 ? 110 GLU H CB    1 
ATOM 5983  C CG    . GLU H 4 110 ? 88.324  106.762 121.687 1.00 101.11 ? 110 GLU H CG    1 
ATOM 5984  C CD    . GLU H 4 110 ? 87.341  105.856 122.403 1.00 101.11 ? 110 GLU H CD    1 
ATOM 5985  O OE1   . GLU H 4 110 ? 87.687  105.351 123.490 1.00 101.11 ? 110 GLU H OE1   1 
ATOM 5986  O OE2   . GLU H 4 110 ? 86.223  105.650 121.886 1.00 101.11 ? 110 GLU H OE2   1 
ATOM 5987  N N     . GLY H 4 111 ? 90.044  110.125 124.458 1.00 101.06 ? 111 GLY H N     1 
ATOM 5988  C CA    . GLY H 4 111 ? 90.823  110.599 125.585 1.00 101.06 ? 111 GLY H CA    1 
ATOM 5989  C C     . GLY H 4 111 ? 89.969  111.297 126.624 1.00 101.06 ? 111 GLY H C     1 
ATOM 5990  O O     . GLY H 4 111 ? 90.092  111.036 127.821 1.00 101.06 ? 111 GLY H O     1 
ATOM 5991  N N     . THR H 4 112 ? 89.083  112.183 126.178 1.00 103.84 ? 112 THR H N     1 
ATOM 5992  C CA    . THR H 4 112 ? 88.177  112.851 127.101 1.00 103.84 ? 112 THR H CA    1 
ATOM 5993  C C     . THR H 4 112 ? 87.169  111.869 127.678 1.00 103.84 ? 112 THR H C     1 
ATOM 5994  O O     . THR H 4 112 ? 86.788  111.985 128.850 1.00 103.84 ? 112 THR H O     1 
ATOM 5995  C CB    . THR H 4 112 ? 87.468  113.998 126.383 1.00 103.84 ? 112 THR H CB    1 
ATOM 5996  O OG1   . THR H 4 112 ? 88.446  114.846 125.771 1.00 103.84 ? 112 THR H OG1   1 
ATOM 5997  C CG2   . THR H 4 112 ? 86.649  114.837 127.355 1.00 103.84 ? 112 THR H CG2   1 
ATOM 5998  N N     . LYS H 4 113 ? 86.763  110.873 126.883 1.00 100.83 ? 113 LYS H N     1 
ATOM 5999  C CA    . LYS H 4 113 ? 85.870  109.838 127.391 1.00 100.83 ? 113 LYS H CA    1 
ATOM 6000  C C     . LYS H 4 113 ? 86.550  108.988 128.458 1.00 100.83 ? 113 LYS H C     1 
ATOM 6001  O O     . LYS H 4 113 ? 85.893  108.535 129.400 1.00 100.83 ? 113 LYS H O     1 
ATOM 6002  C CB    . LYS H 4 113 ? 85.377  108.966 126.237 1.00 100.83 ? 113 LYS H CB    1 
ATOM 6003  C CG    . LYS H 4 113 ? 84.320  107.942 126.622 1.00 100.83 ? 113 LYS H CG    1 
ATOM 6004  C CD    . LYS H 4 113 ? 83.784  107.201 125.411 1.00 100.83 ? 113 LYS H CD    1 
ATOM 6005  C CE    . LYS H 4 113 ? 84.794  106.190 124.897 1.00 100.83 ? 113 LYS H CE    1 
ATOM 6006  N NZ    . LYS H 4 113 ? 84.255  105.358 123.784 1.00 100.83 ? 113 LYS H NZ    1 
ATOM 6007  N N     . ALA H 4 114 ? 87.864  108.801 128.360 1.00 100.47 ? 114 ALA H N     1 
ATOM 6008  C CA    . ALA H 4 114 ? 88.555  108.018 129.374 1.00 100.47 ? 114 ALA H CA    1 
ATOM 6009  C C     . ALA H 4 114 ? 88.918  108.842 130.598 1.00 100.47 ? 114 ALA H C     1 
ATOM 6010  O O     . ALA H 4 114 ? 88.987  108.296 131.703 1.00 100.47 ? 114 ALA H O     1 
ATOM 6011  C CB    . ALA H 4 114 ? 89.817  107.399 128.795 1.00 100.47 ? 114 ALA H CB    1 
ATOM 6012  N N     . VAL H 4 115 ? 89.190  110.133 130.420 1.00 102.53 ? 115 VAL H N     1 
ATOM 6013  C CA    . VAL H 4 115 ? 89.418  111.006 131.566 1.00 102.53 ? 115 VAL H CA    1 
ATOM 6014  C C     . VAL H 4 115 ? 88.143  111.148 132.383 1.00 102.53 ? 115 VAL H C     1 
ATOM 6015  O O     . VAL H 4 115 ? 88.143  110.943 133.602 1.00 102.53 ? 115 VAL H O     1 
ATOM 6016  C CB    . VAL H 4 115 ? 89.941  112.376 131.100 1.00 102.53 ? 115 VAL H CB    1 
ATOM 6017  C CG1   . VAL H 4 115 ? 89.916  113.374 132.243 1.00 102.53 ? 115 VAL H CG1   1 
ATOM 6018  C CG2   . VAL H 4 115 ? 91.350  112.238 130.581 1.00 102.53 ? 115 VAL H CG2   1 
ATOM 6019  N N     . THR H 4 116 ? 87.038  111.490 131.719 1.00 104.83 ? 116 THR H N     1 
ATOM 6020  C CA    . THR H 4 116 ? 85.776  111.675 132.420 1.00 104.83 ? 116 THR H CA    1 
ATOM 6021  C C     . THR H 4 116 ? 85.239  110.350 132.934 1.00 104.83 ? 116 THR H C     1 
ATOM 6022  O O     . THR H 4 116 ? 84.750  110.270 134.067 1.00 104.83 ? 116 THR H O     1 
ATOM 6023  C CB    . THR H 4 116 ? 84.769  112.342 131.491 1.00 104.83 ? 116 THR H CB    1 
ATOM 6024  O OG1   . THR H 4 116 ? 85.330  113.564 130.999 1.00 104.83 ? 116 THR H OG1   1 
ATOM 6025  C CG2   . THR H 4 116 ? 83.484  112.659 132.229 1.00 104.83 ? 116 THR H CG2   1 
ATOM 6026  N N     . LYS H 4 117 ? 85.358  109.294 132.126 1.00 100.91 ? 117 LYS H N     1 
ATOM 6027  C CA    . LYS H 4 117 ? 84.898  107.971 132.534 1.00 100.91 ? 117 LYS H CA    1 
ATOM 6028  C C     . LYS H 4 117 ? 85.727  107.431 133.689 1.00 100.91 ? 117 LYS H C     1 
ATOM 6029  O O     . LYS H 4 117 ? 85.219  106.668 134.517 1.00 100.91 ? 117 LYS H O     1 
ATOM 6030  C CB    . LYS H 4 117 ? 84.949  107.024 131.336 1.00 100.91 ? 117 LYS H CB    1 
ATOM 6031  C CG    . LYS H 4 117 ? 84.263  105.679 131.525 1.00 100.91 ? 117 LYS H CG    1 
ATOM 6032  C CD    . LYS H 4 117 ? 84.317  104.879 130.225 1.00 100.91 ? 117 LYS H CD    1 
ATOM 6033  C CE    . LYS H 4 117 ? 83.460  103.621 130.276 1.00 100.91 ? 117 LYS H CE    1 
ATOM 6034  N NZ    . LYS H 4 117 ? 83.979  102.605 131.224 1.00 100.91 ? 117 LYS H NZ    1 
ATOM 6035  N N     . TYR H 4 118 ? 86.995  107.831 133.771 1.00 102.97 ? 118 TYR H N     1 
ATOM 6036  C CA    . TYR H 4 118 ? 87.776  107.556 134.968 1.00 102.97 ? 118 TYR H CA    1 
ATOM 6037  C C     . TYR H 4 118 ? 87.283  108.384 136.140 1.00 102.97 ? 118 TYR H C     1 
ATOM 6038  O O     . TYR H 4 118 ? 87.137  107.872 137.255 1.00 102.97 ? 118 TYR H O     1 
ATOM 6039  C CB    . TYR H 4 118 ? 89.253  107.845 134.710 1.00 102.97 ? 118 TYR H CB    1 
ATOM 6040  C CG    . TYR H 4 118 ? 90.135  107.644 135.922 1.00 102.97 ? 118 TYR H CG    1 
ATOM 6041  C CD1   . TYR H 4 118 ? 90.487  106.371 136.344 1.00 102.97 ? 118 TYR H CD1   1 
ATOM 6042  C CD2   . TYR H 4 118 ? 90.609  108.733 136.646 1.00 102.97 ? 118 TYR H CD2   1 
ATOM 6043  C CE1   . TYR H 4 118 ? 91.285  106.188 137.449 1.00 102.97 ? 118 TYR H CE1   1 
ATOM 6044  C CE2   . TYR H 4 118 ? 91.402  108.558 137.749 1.00 102.97 ? 118 TYR H CE2   1 
ATOM 6045  C CZ    . TYR H 4 118 ? 91.739  107.284 138.147 1.00 102.97 ? 118 TYR H CZ    1 
ATOM 6046  O OH    . TYR H 4 118 ? 92.536  107.103 139.255 1.00 102.97 ? 118 TYR H OH    1 
ATOM 6047  N N     . THR H 4 119 ? 87.024  109.666 135.901 1.00 103.23 ? 119 THR H N     1 
ATOM 6048  C CA    . THR H 4 119 ? 86.805  110.620 136.974 1.00 103.23 ? 119 THR H CA    1 
ATOM 6049  C C     . THR H 4 119 ? 85.454  110.415 137.649 1.00 103.23 ? 119 THR H C     1 
ATOM 6050  O O     . THR H 4 119 ? 85.302  110.754 138.828 1.00 103.23 ? 119 THR H O     1 
ATOM 6051  C CB    . THR H 4 119 ? 86.933  112.030 136.395 1.00 103.23 ? 119 THR H CB    1 
ATOM 6052  O OG1   . THR H 4 119 ? 88.117  112.089 135.595 1.00 103.23 ? 119 THR H OG1   1 
ATOM 6053  C CG2   . THR H 4 119 ? 87.074  113.074 137.491 1.00 103.23 ? 119 THR H CG2   1 
ATOM 6054  N N     . SER H 4 120 ? 84.494  109.807 136.948 1.00 105.13 ? 120 SER H N     1 
ATOM 6055  C CA    . SER H 4 120 ? 83.158  109.595 137.495 1.00 105.13 ? 120 SER H CA    1 
ATOM 6056  C C     . SER H 4 120 ? 83.145  108.617 138.663 1.00 105.13 ? 120 SER H C     1 
ATOM 6057  O O     . SER H 4 120 ? 82.195  108.627 139.450 1.00 105.13 ? 120 SER H O     1 
ATOM 6058  C CB    . SER H 4 120 ? 82.215  109.094 136.400 1.00 105.13 ? 120 SER H CB    1 
ATOM 6059  O OG    . SER H 4 120 ? 82.050  110.062 135.376 1.00 105.13 ? 120 SER H OG    1 
ATOM 6060  N N     . ALA H 4 121 ? 84.167  107.779 138.792 1.00 105.42 ? 121 ALA H N     1 
ATOM 6061  C CA    . ALA H 4 121 ? 84.286  106.910 139.952 1.00 105.42 ? 121 ALA H CA    1 
ATOM 6062  C C     . ALA H 4 121 ? 84.918  107.666 141.115 1.00 105.42 ? 121 ALA H C     1 
ATOM 6063  O O     . ALA H 4 121 ? 85.567  108.694 140.919 1.00 105.42 ? 121 ALA H O     1 
ATOM 6064  C CB    . ALA H 4 121 ? 85.102  105.677 139.612 1.00 105.42 ? 121 ALA H CB    1 
ATOM 6065  P P     . DA  I 5 1   ? 135.213 133.559 65.675  1.00 109.49 ? -73 DA  I P     1 
ATOM 6066  O OP1   . DA  I 5 1   ? 135.761 134.433 66.735  1.00 109.49 ? -73 DA  I OP1   1 
ATOM 6067  O OP2   . DA  I 5 1   ? 133.757 133.549 65.408  1.00 109.49 ? -73 DA  I OP2   1 
ATOM 6068  O "O5'" . DA  I 5 1   ? 135.971 133.857 64.295  1.00 109.49 ? -73 DA  I "O5'" 1 
ATOM 6069  C "C5'" . DA  I 5 1   ? 137.339 134.267 64.299  1.00 109.49 ? -73 DA  I "C5'" 1 
ATOM 6070  C "C4'" . DA  I 5 1   ? 137.485 135.671 63.739  1.00 109.49 ? -73 DA  I "C4'" 1 
ATOM 6071  O "O4'" . DA  I 5 1   ? 136.382 135.936 62.824  1.00 109.49 ? -73 DA  I "O4'" 1 
ATOM 6072  C "C3'" . DA  I 5 1   ? 137.425 136.794 64.780  1.00 109.49 ? -73 DA  I "C3'" 1 
ATOM 6073  O "O3'" . DA  I 5 1   ? 138.225 137.907 64.361  1.00 109.49 ? -73 DA  I "O3'" 1 
ATOM 6074  C "C2'" . DA  I 5 1   ? 135.954 137.149 64.751  1.00 109.49 ? -73 DA  I "C2'" 1 
ATOM 6075  C "C1'" . DA  I 5 1   ? 135.718 137.100 63.258  1.00 109.49 ? -73 DA  I "C1'" 1 
ATOM 6076  N N9    . DA  I 5 1   ? 134.314 137.034 62.884  1.00 109.49 ? -73 DA  I N9    1 
ATOM 6077  C C8    . DA  I 5 1   ? 133.564 135.918 62.641  1.00 109.49 ? -73 DA  I C8    1 
ATOM 6078  N N7    . DA  I 5 1   ? 132.317 136.182 62.321  1.00 109.49 ? -73 DA  I N7    1 
ATOM 6079  C C5    . DA  I 5 1   ? 132.255 137.564 62.357  1.00 109.49 ? -73 DA  I C5    1 
ATOM 6080  C C6    . DA  I 5 1   ? 131.214 138.480 62.116  1.00 109.49 ? -73 DA  I C6    1 
ATOM 6081  N N6    . DA  I 5 1   ? 129.974 138.114 61.770  1.00 109.49 ? -73 DA  I N6    1 
ATOM 6082  N N1    . DA  I 5 1   ? 131.500 139.797 62.238  1.00 109.49 ? -73 DA  I N1    1 
ATOM 6083  C C2    . DA  I 5 1   ? 132.737 140.159 62.591  1.00 109.49 ? -73 DA  I C2    1 
ATOM 6084  N N3    . DA  I 5 1   ? 133.789 139.395 62.836  1.00 109.49 ? -73 DA  I N3    1 
ATOM 6085  C C4    . DA  I 5 1   ? 133.478 138.099 62.704  1.00 109.49 ? -73 DA  I C4    1 
ATOM 6086  P P     . DC  I 5 2   ? 139.004 138.797 65.451  1.00 110.37 ? -72 DC  I P     1 
ATOM 6087  O OP1   . DC  I 5 2   ? 140.413 138.356 65.445  1.00 110.37 ? -72 DC  I OP1   1 
ATOM 6088  O OP2   . DC  I 5 2   ? 138.227 138.731 66.706  1.00 110.37 ? -72 DC  I OP2   1 
ATOM 6089  O "O5'" . DC  I 5 2   ? 138.935 140.299 64.886  1.00 110.37 ? -72 DC  I "O5'" 1 
ATOM 6090  C "C5'" . DC  I 5 2   ? 139.752 141.321 65.484  1.00 110.37 ? -72 DC  I "C5'" 1 
ATOM 6091  C "C4'" . DC  I 5 2   ? 139.256 142.714 65.126  1.00 110.37 ? -72 DC  I "C4'" 1 
ATOM 6092  O "O4'" . DC  I 5 2   ? 137.894 142.628 64.642  1.00 110.37 ? -72 DC  I "O4'" 1 
ATOM 6093  C "C3'" . DC  I 5 2   ? 139.170 143.688 66.291  1.00 110.37 ? -72 DC  I "C3'" 1 
ATOM 6094  O "O3'" . DC  I 5 2   ? 139.084 145.023 65.785  1.00 110.37 ? -72 DC  I "O3'" 1 
ATOM 6095  C "C2'" . DC  I 5 2   ? 137.847 143.261 66.893  1.00 110.37 ? -72 DC  I "C2'" 1 
ATOM 6096  C "C1'" . DC  I 5 2   ? 137.019 143.157 65.624  1.00 110.37 ? -72 DC  I "C1'" 1 
ATOM 6097  N N1    . DC  I 5 2   ? 135.865 142.259 65.727  1.00 110.37 ? -72 DC  I N1    1 
ATOM 6098  C C2    . DC  I 5 2   ? 134.618 142.708 65.315  1.00 110.37 ? -72 DC  I C2    1 
ATOM 6099  O O2    . DC  I 5 2   ? 134.514 143.861 64.896  1.00 110.37 ? -72 DC  I O2    1 
ATOM 6100  N N3    . DC  I 5 2   ? 133.561 141.866 65.393  1.00 110.37 ? -72 DC  I N3    1 
ATOM 6101  C C4    . DC  I 5 2   ? 133.727 140.627 65.854  1.00 110.37 ? -72 DC  I C4    1 
ATOM 6102  N N4    . DC  I 5 2   ? 132.657 139.828 65.914  1.00 110.37 ? -72 DC  I N4    1 
ATOM 6103  C C5    . DC  I 5 2   ? 134.997 140.154 66.278  1.00 110.37 ? -72 DC  I C5    1 
ATOM 6104  C C6    . DC  I 5 2   ? 136.031 140.992 66.189  1.00 110.37 ? -72 DC  I C6    1 
ATOM 6105  P P     . DA  I 5 3   ? 139.500 146.284 66.693  1.00 110.64 ? -71 DA  I P     1 
ATOM 6106  O OP1   . DA  I 5 3   ? 140.969 146.413 66.604  1.00 110.64 ? -71 DA  I OP1   1 
ATOM 6107  O OP2   . DA  I 5 3   ? 138.858 146.153 68.017  1.00 110.64 ? -71 DA  I OP2   1 
ATOM 6108  O "O5'" . DA  I 5 3   ? 138.829 147.533 65.948  1.00 110.64 ? -71 DA  I "O5'" 1 
ATOM 6109  C "C5'" . DA  I 5 3   ? 137.576 147.372 65.284  1.00 110.64 ? -71 DA  I "C5'" 1 
ATOM 6110  C "C4'" . DA  I 5 3   ? 136.609 148.502 65.611  1.00 110.64 ? -71 DA  I "C4'" 1 
ATOM 6111  O "O4'" . DA  I 5 3   ? 135.289 147.937 65.809  1.00 110.64 ? -71 DA  I "O4'" 1 
ATOM 6112  C "C3'" . DA  I 5 3   ? 136.879 149.237 66.909  1.00 110.64 ? -71 DA  I "C3'" 1 
ATOM 6113  O "O3'" . DA  I 5 3   ? 136.124 150.450 66.933  1.00 110.64 ? -71 DA  I "O3'" 1 
ATOM 6114  C "C2'" . DA  I 5 3   ? 136.319 148.238 67.903  1.00 110.64 ? -71 DA  I "C2'" 1 
ATOM 6115  C "C1'" . DA  I 5 3   ? 135.021 147.858 67.201  1.00 110.64 ? -71 DA  I "C1'" 1 
ATOM 6116  N N9    . DA  I 5 3   ? 134.567 146.512 67.512  1.00 110.64 ? -71 DA  I N9    1 
ATOM 6117  C C8    . DA  I 5 3   ? 135.338 145.451 67.876  1.00 110.64 ? -71 DA  I C8    1 
ATOM 6118  N N7    . DA  I 5 3   ? 134.659 144.352 68.088  1.00 110.64 ? -71 DA  I N7    1 
ATOM 6119  C C5    . DA  I 5 3   ? 133.352 144.723 67.850  1.00 110.64 ? -71 DA  I C5    1 
ATOM 6120  C C6    . DA  I 5 3   ? 132.145 144.014 67.902  1.00 110.64 ? -71 DA  I C6    1 
ATOM 6121  N N6    . DA  I 5 3   ? 132.075 142.726 68.230  1.00 110.64 ? -71 DA  I N6    1 
ATOM 6122  N N1    . DA  I 5 3   ? 131.008 144.682 67.604  1.00 110.64 ? -71 DA  I N1    1 
ATOM 6123  C C2    . DA  I 5 3   ? 131.088 145.976 67.281  1.00 110.64 ? -71 DA  I C2    1 
ATOM 6124  N N3    . DA  I 5 3   ? 132.169 146.746 67.193  1.00 110.64 ? -71 DA  I N3    1 
ATOM 6125  C C4    . DA  I 5 3   ? 133.276 146.052 67.495  1.00 110.64 ? -71 DA  I C4    1 
ATOM 6126  P P     . DG  I 5 4   ? 136.473 151.620 67.981  1.00 109.78 ? -70 DG  I P     1 
ATOM 6127  O OP1   . DG  I 5 4   ? 137.766 152.197 67.564  1.00 109.78 ? -70 DG  I OP1   1 
ATOM 6128  O OP2   . DG  I 5 4   ? 136.290 151.131 69.363  1.00 109.78 ? -70 DG  I OP2   1 
ATOM 6129  O "O5'" . DG  I 5 4   ? 135.327 152.703 67.739  1.00 109.78 ? -70 DG  I "O5'" 1 
ATOM 6130  C "C5'" . DG  I 5 4   ? 134.208 152.376 66.934  1.00 109.78 ? -70 DG  I "C5'" 1 
ATOM 6131  C "C4'" . DG  I 5 4   ? 132.912 152.381 67.737  1.00 109.78 ? -70 DG  I "C4'" 1 
ATOM 6132  O "O4'" . DG  I 5 4   ? 132.553 151.026 68.110  1.00 109.78 ? -70 DG  I "O4'" 1 
ATOM 6133  C "C3'" . DG  I 5 4   ? 132.925 153.179 69.041  1.00 109.78 ? -70 DG  I "C3'" 1 
ATOM 6134  O "O3'" . DG  I 5 4   ? 131.655 153.782 69.220  1.00 109.78 ? -70 DG  I "O3'" 1 
ATOM 6135  C "C2'" . DG  I 5 4   ? 133.162 152.094 70.086  1.00 109.78 ? -70 DG  I "C2'" 1 
ATOM 6136  C "C1'" . DG  I 5 4   ? 132.331 150.971 69.499  1.00 109.78 ? -70 DG  I "C1'" 1 
ATOM 6137  N N9    . DG  I 5 4   ? 132.709 149.649 69.957  1.00 109.78 ? -70 DG  I N9    1 
ATOM 6138  C C8    . DG  I 5 4   ? 133.968 149.192 70.228  1.00 109.78 ? -70 DG  I C8    1 
ATOM 6139  N N7    . DG  I 5 4   ? 133.998 147.942 70.597  1.00 109.78 ? -70 DG  I N7    1 
ATOM 6140  C C5    . DG  I 5 4   ? 132.670 147.558 70.580  1.00 109.78 ? -70 DG  I C5    1 
ATOM 6141  C C6    . DG  I 5 4   ? 132.074 146.322 70.896  1.00 109.78 ? -70 DG  I C6    1 
ATOM 6142  O O6    . DG  I 5 4   ? 132.620 145.277 71.272  1.00 109.78 ? -70 DG  I O6    1 
ATOM 6143  N N1    . DG  I 5 4   ? 130.695 146.369 70.745  1.00 109.78 ? -70 DG  I N1    1 
ATOM 6144  C C2    . DG  I 5 4   ? 129.986 147.473 70.338  1.00 109.78 ? -70 DG  I C2    1 
ATOM 6145  N N2    . DG  I 5 4   ? 128.661 147.334 70.246  1.00 109.78 ? -70 DG  I N2    1 
ATOM 6146  N N3    . DG  I 5 4   ? 130.533 148.631 70.041  1.00 109.78 ? -70 DG  I N3    1 
ATOM 6147  C C4    . DG  I 5 4   ? 131.869 148.601 70.182  1.00 109.78 ? -70 DG  I C4    1 
ATOM 6148  P P     . DG  I 5 5   ? 131.509 155.168 70.014  1.00 104.13 ? -69 DG  I P     1 
ATOM 6149  O OP1   . DG  I 5 5   ? 131.346 156.234 69.001  1.00 104.13 ? -69 DG  I OP1   1 
ATOM 6150  O OP2   . DG  I 5 5   ? 132.619 155.250 70.987  1.00 104.13 ? -69 DG  I OP2   1 
ATOM 6151  O "O5'" . DG  I 5 5   ? 130.135 155.001 70.820  1.00 104.13 ? -69 DG  I "O5'" 1 
ATOM 6152  C "C5'" . DG  I 5 5   ? 128.910 155.424 70.230  1.00 104.13 ? -69 DG  I "C5'" 1 
ATOM 6153  C "C4'" . DG  I 5 5   ? 127.737 154.587 70.714  1.00 104.13 ? -69 DG  I "C4'" 1 
ATOM 6154  O "O4'" . DG  I 5 5   ? 128.135 153.196 70.829  1.00 104.13 ? -69 DG  I "O4'" 1 
ATOM 6155  C "C3'" . DG  I 5 5   ? 127.171 154.969 72.075  1.00 104.13 ? -69 DG  I "C3'" 1 
ATOM 6156  O "O3'" . DG  I 5 5   ? 125.762 154.725 72.072  1.00 104.13 ? -69 DG  I "O3'" 1 
ATOM 6157  C "C2'" . DG  I 5 5   ? 127.912 154.015 73.011  1.00 104.13 ? -69 DG  I "C2'" 1 
ATOM 6158  C "C1'" . DG  I 5 5   ? 127.974 152.754 72.164  1.00 104.13 ? -69 DG  I "C1'" 1 
ATOM 6159  N N9    . DG  I 5 5   ? 129.093 151.861 72.481  1.00 104.13 ? -69 DG  I N9    1 
ATOM 6160  C C8    . DG  I 5 5   ? 130.429 152.140 72.347  1.00 104.13 ? -69 DG  I C8    1 
ATOM 6161  N N7    . DG  I 5 5   ? 131.205 151.148 72.684  1.00 104.13 ? -69 DG  I N7    1 
ATOM 6162  C C5    . DG  I 5 5   ? 130.331 150.137 73.047  1.00 104.13 ? -69 DG  I C5    1 
ATOM 6163  C C6    . DG  I 5 5   ? 130.598 148.823 73.493  1.00 104.13 ? -69 DG  I C6    1 
ATOM 6164  O O6    . DG  I 5 5   ? 131.696 148.280 73.673  1.00 104.13 ? -69 DG  I O6    1 
ATOM 6165  N N1    . DG  I 5 5   ? 129.431 148.128 73.768  1.00 104.13 ? -69 DG  I N1    1 
ATOM 6166  C C2    . DG  I 5 5   ? 128.164 148.633 73.615  1.00 104.13 ? -69 DG  I C2    1 
ATOM 6167  N N2    . DG  I 5 5   ? 127.155 147.806 73.921  1.00 104.13 ? -69 DG  I N2    1 
ATOM 6168  N N3    . DG  I 5 5   ? 127.898 149.860 73.191  1.00 104.13 ? -69 DG  I N3    1 
ATOM 6169  C C4    . DG  I 5 5   ? 129.026 150.555 72.928  1.00 104.13 ? -69 DG  I C4    1 
ATOM 6170  P P     . DA  I 5 6   ? 124.782 155.383 73.168  1.00 102.03 ? -68 DA  I P     1 
ATOM 6171  O OP1   . DA  I 5 6   ? 123.857 156.285 72.454  1.00 102.03 ? -68 DA  I OP1   1 
ATOM 6172  O OP2   . DA  I 5 6   ? 125.571 155.914 74.300  1.00 102.03 ? -68 DA  I OP2   1 
ATOM 6173  O "O5'" . DA  I 5 6   ? 123.940 154.132 73.701  1.00 102.03 ? -68 DA  I "O5'" 1 
ATOM 6174  C "C5'" . DA  I 5 6   ? 124.463 152.810 73.549  1.00 102.03 ? -68 DA  I "C5'" 1 
ATOM 6175  C "C4'" . DA  I 5 6   ? 124.734 152.175 74.898  1.00 102.03 ? -68 DA  I "C4'" 1 
ATOM 6176  O "O4'" . DA  I 5 6   ? 126.031 151.516 74.909  1.00 102.03 ? -68 DA  I "O4'" 1 
ATOM 6177  C "C3'" . DA  I 5 6   ? 124.760 153.154 76.086  1.00 102.03 ? -68 DA  I "C3'" 1 
ATOM 6178  O "O3'" . DA  I 5 6   ? 124.113 152.573 77.204  1.00 102.03 ? -68 DA  I "O3'" 1 
ATOM 6179  C "C2'" . DA  I 5 6   ? 126.254 153.261 76.362  1.00 102.03 ? -68 DA  I "C2'" 1 
ATOM 6180  C "C1'" . DA  I 5 6   ? 126.612 151.812 76.145  1.00 102.03 ? -68 DA  I "C1'" 1 
ATOM 6181  N N9    . DA  I 5 6   ? 128.040 151.519 76.137  1.00 102.03 ? -68 DA  I N9    1 
ATOM 6182  C C8    . DA  I 5 6   ? 129.061 152.362 75.813  1.00 102.03 ? -68 DA  I C8    1 
ATOM 6183  N N7    . DA  I 5 6   ? 130.250 151.819 75.918  1.00 102.03 ? -68 DA  I N7    1 
ATOM 6184  C C5    . DA  I 5 6   ? 129.989 150.536 76.356  1.00 102.03 ? -68 DA  I C5    1 
ATOM 6185  C C6    . DA  I 5 6   ? 130.827 149.452 76.668  1.00 102.03 ? -68 DA  I C6    1 
ATOM 6186  N N6    . DA  I 5 6   ? 132.153 149.501 76.563  1.00 102.03 ? -68 DA  I N6    1 
ATOM 6187  N N1    . DA  I 5 6   ? 130.246 148.304 77.067  1.00 102.03 ? -68 DA  I N1    1 
ATOM 6188  C C2    . DA  I 5 6   ? 128.914 148.255 77.165  1.00 102.03 ? -68 DA  I C2    1 
ATOM 6189  N N3    . DA  I 5 6   ? 128.024 149.212 76.910  1.00 102.03 ? -68 DA  I N3    1 
ATOM 6190  C C4    . DA  I 5 6   ? 128.634 150.335 76.503  1.00 102.03 ? -68 DA  I C4    1 
ATOM 6191  P P     . DT  I 5 7   ? 122.512 152.453 77.322  1.00 97.31  ? -67 DT  I P     1 
ATOM 6192  O OP1   . DT  I 5 7   ? 121.791 152.697 76.056  1.00 97.31  ? -67 DT  I OP1   1 
ATOM 6193  O OP2   . DT  I 5 7   ? 122.145 153.257 78.500  1.00 97.31  ? -67 DT  I OP2   1 
ATOM 6194  O "O5'" . DT  I 5 7   ? 122.338 150.929 77.762  1.00 97.31  ? -67 DT  I "O5'" 1 
ATOM 6195  C "C5'" . DT  I 5 7   ? 123.445 150.026 77.616  1.00 97.31  ? -67 DT  I "C5'" 1 
ATOM 6196  C "C4'" . DT  I 5 7   ? 124.033 149.645 78.963  1.00 97.31  ? -67 DT  I "C4'" 1 
ATOM 6197  O "O4'" . DT  I 5 7   ? 125.498 149.664 78.906  1.00 97.31  ? -67 DT  I "O4'" 1 
ATOM 6198  C "C3'" . DT  I 5 7   ? 123.664 150.578 80.120  1.00 97.31  ? -67 DT  I "C3'" 1 
ATOM 6199  O "O3'" . DT  I 5 7   ? 123.465 149.822 81.281  1.00 97.31  ? -67 DT  I "O3'" 1 
ATOM 6200  C "C2'" . DT  I 5 7   ? 124.913 151.431 80.233  1.00 97.31  ? -67 DT  I "C2'" 1 
ATOM 6201  C "C1'" . DT  I 5 7   ? 125.943 150.337 80.056  1.00 97.31  ? -67 DT  I "C1'" 1 
ATOM 6202  N N1    . DT  I 5 7   ? 127.352 150.805 79.886  1.00 97.31  ? -67 DT  I N1    1 
ATOM 6203  C C2    . DT  I 5 7   ? 128.379 149.936 80.143  1.00 97.31  ? -67 DT  I C2    1 
ATOM 6204  O O2    . DT  I 5 7   ? 128.206 148.786 80.490  1.00 97.31  ? -67 DT  I O2    1 
ATOM 6205  N N3    . DT  I 5 7   ? 129.626 150.466 79.972  1.00 97.31  ? -67 DT  I N3    1 
ATOM 6206  C C4    . DT  I 5 7   ? 129.946 151.746 79.586  1.00 97.31  ? -67 DT  I C4    1 
ATOM 6207  O O4    . DT  I 5 7   ? 131.106 152.124 79.459  1.00 97.31  ? -67 DT  I O4    1 
ATOM 6208  C C5    . DT  I 5 7   ? 128.821 152.611 79.346  1.00 97.31  ? -67 DT  I C5    1 
ATOM 6209  C C7    . DT  I 5 7   ? 129.038 154.033 78.925  1.00 97.31  ? -67 DT  I C7    1 
ATOM 6210  C C6    . DT  I 5 7   ? 127.595 152.108 79.522  1.00 97.31  ? -67 DT  I C6    1 
ATOM 6211  P P     . DG  I 5 8   ? 121.982 149.436 81.738  1.00 90.52  ? -66 DG  I P     1 
ATOM 6212  O OP1   . DG  I 5 8   ? 121.480 148.424 80.787  1.00 90.52  ? -66 DG  I OP1   1 
ATOM 6213  O OP2   . DG  I 5 8   ? 121.228 150.691 81.945  1.00 90.52  ? -66 DG  I OP2   1 
ATOM 6214  O "O5'" . DG  I 5 8   ? 122.201 148.722 83.147  1.00 90.52  ? -66 DG  I "O5'" 1 
ATOM 6215  C "C5'" . DG  I 5 8   ? 122.378 147.320 83.199  1.00 90.52  ? -66 DG  I "C5'" 1 
ATOM 6216  C "C4'" . DG  I 5 8   ? 123.745 146.963 83.745  1.00 90.52  ? -66 DG  I "C4'" 1 
ATOM 6217  O "O4'" . DG  I 5 8   ? 124.744 147.834 83.175  1.00 90.52  ? -66 DG  I "O4'" 1 
ATOM 6218  C "C3'" . DG  I 5 8   ? 123.889 147.066 85.261  1.00 90.52  ? -66 DG  I "C3'" 1 
ATOM 6219  O "O3'" . DG  I 5 8   ? 124.303 145.801 85.769  1.00 90.52  ? -66 DG  I "O3'" 1 
ATOM 6220  C "C2'" . DG  I 5 8   ? 124.955 148.157 85.467  1.00 90.52  ? -66 DG  I "C2'" 1 
ATOM 6221  C "C1'" . DG  I 5 8   ? 125.705 148.144 84.147  1.00 90.52  ? -66 DG  I "C1'" 1 
ATOM 6222  N N9    . DG  I 5 8   ? 126.270 149.432 83.784  1.00 90.52  ? -66 DG  I N9    1 
ATOM 6223  C C8    . DG  I 5 8   ? 125.570 150.571 83.511  1.00 90.52  ? -66 DG  I C8    1 
ATOM 6224  N N7    . DG  I 5 8   ? 126.326 151.584 83.199  1.00 90.52  ? -66 DG  I N7    1 
ATOM 6225  C C5    . DG  I 5 8   ? 127.610 151.076 83.238  1.00 90.52  ? -66 DG  I C5    1 
ATOM 6226  C C6    . DG  I 5 8   ? 128.840 151.714 82.984  1.00 90.52  ? -66 DG  I C6    1 
ATOM 6227  O O6    . DG  I 5 8   ? 129.039 152.887 82.655  1.00 90.52  ? -66 DG  I O6    1 
ATOM 6228  N N1    . DG  I 5 8   ? 129.910 150.852 83.147  1.00 90.52  ? -66 DG  I N1    1 
ATOM 6229  C C2    . DG  I 5 8   ? 129.804 149.535 83.501  1.00 90.52  ? -66 DG  I C2    1 
ATOM 6230  N N2    . DG  I 5 8   ? 130.956 148.867 83.625  1.00 90.52  ? -66 DG  I N2    1 
ATOM 6231  N N3    . DG  I 5 8   ? 128.653 148.919 83.751  1.00 90.52  ? -66 DG  I N3    1 
ATOM 6232  C C4    . DG  I 5 8   ? 127.599 149.749 83.593  1.00 90.52  ? -66 DG  I C4    1 
ATOM 6233  P P     . DT  I 5 9   ? 124.331 145.505 87.346  1.00 90.25  ? -65 DT  I P     1 
ATOM 6234  O OP1   . DT  I 5 9   ? 123.865 144.121 87.565  1.00 90.25  ? -65 DT  I OP1   1 
ATOM 6235  O OP2   . DT  I 5 9   ? 123.632 146.598 88.051  1.00 90.25  ? -65 DT  I OP2   1 
ATOM 6236  O "O5'" . DT  I 5 9   ? 125.886 145.575 87.691  1.00 90.25  ? -65 DT  I "O5'" 1 
ATOM 6237  C "C5'" . DT  I 5 9   ? 126.838 145.213 86.700  1.00 90.25  ? -65 DT  I "C5'" 1 
ATOM 6238  C "C4'" . DT  I 5 9   ? 128.246 145.550 87.145  1.00 90.25  ? -65 DT  I "C4'" 1 
ATOM 6239  O "O4'" . DT  I 5 9   ? 128.689 146.786 86.510  1.00 90.25  ? -65 DT  I "O4'" 1 
ATOM 6240  C "C3'" . DT  I 5 9   ? 128.425 145.769 88.651  1.00 90.25  ? -65 DT  I "C3'" 1 
ATOM 6241  O "O3'" . DT  I 5 9   ? 129.675 145.218 89.055  1.00 90.25  ? -65 DT  I "O3'" 1 
ATOM 6242  C "C2'" . DT  I 5 9   ? 128.443 147.289 88.746  1.00 90.25  ? -65 DT  I "C2'" 1 
ATOM 6243  C "C1'" . DT  I 5 9   ? 129.244 147.613 87.502  1.00 90.25  ? -65 DT  I "C1'" 1 
ATOM 6244  N N1    . DT  I 5 9   ? 129.150 149.033 87.082  1.00 90.25  ? -65 DT  I N1    1 
ATOM 6245  C C2    . DT  I 5 9   ? 130.296 149.715 86.739  1.00 90.25  ? -65 DT  I C2    1 
ATOM 6246  O O2    . DT  I 5 9   ? 131.402 149.215 86.764  1.00 90.25  ? -65 DT  I O2    1 
ATOM 6247  N N3    . DT  I 5 9   ? 130.094 151.020 86.380  1.00 90.25  ? -65 DT  I N3    1 
ATOM 6248  C C4    . DT  I 5 9   ? 128.892 151.687 86.323  1.00 90.25  ? -65 DT  I C4    1 
ATOM 6249  O O4    . DT  I 5 9   ? 128.806 152.860 85.982  1.00 90.25  ? -65 DT  I O4    1 
ATOM 6250  C C5    . DT  I 5 9   ? 127.739 150.913 86.699  1.00 90.25  ? -65 DT  I C5    1 
ATOM 6251  C C7    . DT  I 5 9   ? 126.382 151.537 86.685  1.00 90.25  ? -65 DT  I C7    1 
ATOM 6252  C C6    . DT  I 5 9   ? 127.922 149.640 87.057  1.00 90.25  ? -65 DT  I C6    1 
ATOM 6253  P P     . DA  I 5 10  ? 130.000 144.919 90.601  1.00 89.13  ? -64 DA  I P     1 
ATOM 6254  O OP1   . DA  I 5 10  ? 130.176 143.455 90.709  1.00 89.13  ? -64 DA  I OP1   1 
ATOM 6255  O OP2   . DA  I 5 10  ? 128.997 145.594 91.454  1.00 89.13  ? -64 DA  I OP2   1 
ATOM 6256  O "O5'" . DA  I 5 10  ? 131.427 145.614 90.839  1.00 89.13  ? -64 DA  I "O5'" 1 
ATOM 6257  C "C5'" . DA  I 5 10  ? 132.620 144.985 90.360  1.00 89.13  ? -64 DA  I "C5'" 1 
ATOM 6258  C "C4'" . DA  I 5 10  ? 133.780 145.970 90.253  1.00 89.13  ? -64 DA  I "C4'" 1 
ATOM 6259  O "O4'" . DA  I 5 10  ? 133.358 147.148 89.519  1.00 89.13  ? -64 DA  I "O4'" 1 
ATOM 6260  C "C3'" . DA  I 5 10  ? 134.342 146.490 91.579  1.00 89.13  ? -64 DA  I "C3'" 1 
ATOM 6261  O "O3'" . DA  I 5 10  ? 135.753 146.686 91.471  1.00 89.13  ? -64 DA  I "O3'" 1 
ATOM 6262  C "C2'" . DA  I 5 10  ? 133.628 147.821 91.738  1.00 89.13  ? -64 DA  I "C2'" 1 
ATOM 6263  C "C1'" . DA  I 5 10  ? 133.590 148.303 90.298  1.00 89.13  ? -64 DA  I "C1'" 1 
ATOM 6264  N N9    . DA  I 5 10  ? 132.507 149.225 90.048  1.00 89.13  ? -64 DA  I N9    1 
ATOM 6265  C C8    . DA  I 5 10  ? 131.190 148.929 90.068  1.00 89.13  ? -64 DA  I C8    1 
ATOM 6266  N N7    . DA  I 5 10  ? 130.414 149.942 89.820  1.00 89.13  ? -64 DA  I N7    1 
ATOM 6267  C C5    . DA  I 5 10  ? 131.292 150.981 89.620  1.00 89.13  ? -64 DA  I C5    1 
ATOM 6268  C C6    . DA  I 5 10  ? 131.091 152.329 89.318  1.00 89.13  ? -64 DA  I C6    1 
ATOM 6269  N N6    . DA  I 5 10  ? 129.880 152.862 89.151  1.00 89.13  ? -64 DA  I N6    1 
ATOM 6270  N N1    . DA  I 5 10  ? 132.179 153.112 89.192  1.00 89.13  ? -64 DA  I N1    1 
ATOM 6271  C C2    . DA  I 5 10  ? 133.390 152.569 89.373  1.00 89.13  ? -64 DA  I C2    1 
ATOM 6272  N N3    . DA  I 5 10  ? 133.700 151.303 89.649  1.00 89.13  ? -64 DA  I N3    1 
ATOM 6273  C C4    . DA  I 5 10  ? 132.593 150.557 89.752  1.00 89.13  ? -64 DA  I C4    1 
ATOM 6274  P P     . DT  I 5 11  ? 136.602 147.183 92.739  1.00 86.43  ? -63 DT  I P     1 
ATOM 6275  O OP1   . DT  I 5 11  ? 137.967 146.656 92.579  1.00 86.43  ? -63 DT  I OP1   1 
ATOM 6276  O OP2   . DT  I 5 11  ? 135.835 146.842 93.951  1.00 86.43  ? -63 DT  I OP2   1 
ATOM 6277  O "O5'" . DT  I 5 11  ? 136.647 148.782 92.601  1.00 86.43  ? -63 DT  I "O5'" 1 
ATOM 6278  C "C5'" . DT  I 5 11  ? 137.545 149.390 91.676  1.00 86.43  ? -63 DT  I "C5'" 1 
ATOM 6279  C "C4'" . DT  I 5 11  ? 137.851 150.838 92.047  1.00 86.43  ? -63 DT  I "C4'" 1 
ATOM 6280  O "O4'" . DT  I 5 11  ? 136.734 151.691 91.689  1.00 86.43  ? -63 DT  I "O4'" 1 
ATOM 6281  C "C3'" . DT  I 5 11  ? 138.141 151.110 93.525  1.00 86.43  ? -63 DT  I "C3'" 1 
ATOM 6282  O "O3'" . DT  I 5 11  ? 139.256 151.989 93.632  1.00 86.43  ? -63 DT  I "O3'" 1 
ATOM 6283  C "C2'" . DT  I 5 11  ? 136.852 151.776 94.013  1.00 86.43  ? -63 DT  I "C2'" 1 
ATOM 6284  C "C1'" . DT  I 5 11  ? 136.410 152.532 92.772  1.00 86.43  ? -63 DT  I "C1'" 1 
ATOM 6285  N N1    . DT  I 5 11  ? 134.946 152.800 92.717  1.00 86.43  ? -63 DT  I N1    1 
ATOM 6286  C C2    . DT  I 5 11  ? 134.500 154.076 92.465  1.00 86.43  ? -63 DT  I C2    1 
ATOM 6287  O O2    . DT  I 5 11  ? 135.244 155.021 92.299  1.00 86.43  ? -63 DT  I O2    1 
ATOM 6288  N N3    . DT  I 5 11  ? 133.139 154.206 92.421  1.00 86.43  ? -63 DT  I N3    1 
ATOM 6289  C C4    . DT  I 5 11  ? 132.202 153.205 92.598  1.00 86.43  ? -63 DT  I C4    1 
ATOM 6290  O O4    . DT  I 5 11  ? 130.998 153.410 92.544  1.00 86.43  ? -63 DT  I O4    1 
ATOM 6291  C C5    . DT  I 5 11  ? 132.736 151.896 92.854  1.00 86.43  ? -63 DT  I C5    1 
ATOM 6292  C C7    . DT  I 5 11  ? 131.808 150.739 93.081  1.00 86.43  ? -63 DT  I C7    1 
ATOM 6293  C C6    . DT  I 5 11  ? 134.067 151.756 92.898  1.00 86.43  ? -63 DT  I C6    1 
ATOM 6294  P P     . DA  I 5 12  ? 139.873 152.365 95.067  1.00 86.37  ? -62 DA  I P     1 
ATOM 6295  O OP1   . DA  I 5 12  ? 141.301 152.695 94.880  1.00 86.37  ? -62 DA  I OP1   1 
ATOM 6296  O OP2   . DA  I 5 12  ? 139.495 151.288 96.005  1.00 86.37  ? -62 DA  I OP2   1 
ATOM 6297  O "O5'" . DA  I 5 12  ? 139.101 153.705 95.478  1.00 86.37  ? -62 DA  I "O5'" 1 
ATOM 6298  C "C5'" . DA  I 5 12  ? 139.619 154.547 96.504  1.00 86.37  ? -62 DA  I "C5'" 1 
ATOM 6299  C "C4'" . DA  I 5 12  ? 139.633 155.997 96.053  1.00 86.37  ? -62 DA  I "C4'" 1 
ATOM 6300  O "O4'" . DA  I 5 12  ? 138.489 156.242 95.204  1.00 86.37  ? -62 DA  I "O4'" 1 
ATOM 6301  C "C3'" . DA  I 5 12  ? 139.510 157.015 97.169  1.00 86.37  ? -62 DA  I "C3'" 1 
ATOM 6302  O "O3'" . DA  I 5 12  ? 140.025 158.268 96.751  1.00 86.37  ? -62 DA  I "O3'" 1 
ATOM 6303  C "C2'" . DA  I 5 12  ? 138.007 157.076 97.353  1.00 86.37  ? -62 DA  I "C2'" 1 
ATOM 6304  C "C1'" . DA  I 5 12  ? 137.516 156.978 95.917  1.00 86.37  ? -62 DA  I "C1'" 1 
ATOM 6305  N N9    . DA  I 5 12  ? 136.254 156.280 95.793  1.00 86.37  ? -62 DA  I N9    1 
ATOM 6306  C C8    . DA  I 5 12  ? 136.066 154.930 95.764  1.00 86.37  ? -62 DA  I C8    1 
ATOM 6307  N N7    . DA  I 5 12  ? 134.811 154.577 95.643  1.00 86.37  ? -62 DA  I N7    1 
ATOM 6308  C C5    . DA  I 5 12  ? 134.136 155.783 95.571  1.00 86.37  ? -62 DA  I C5    1 
ATOM 6309  C C6    . DA  I 5 12  ? 132.776 156.098 95.429  1.00 86.37  ? -62 DA  I C6    1 
ATOM 6310  N N6    . DA  I 5 12  ? 131.824 155.175 95.331  1.00 86.37  ? -62 DA  I N6    1 
ATOM 6311  N N1    . DA  I 5 12  ? 132.433 157.398 95.393  1.00 86.37  ? -62 DA  I N1    1 
ATOM 6312  C C2    . DA  I 5 12  ? 133.394 158.323 95.498  1.00 86.37  ? -62 DA  I C2    1 
ATOM 6313  N N3    . DA  I 5 12  ? 134.707 158.147 95.632  1.00 86.37  ? -62 DA  I N3    1 
ATOM 6314  C C4    . DA  I 5 12  ? 135.012 156.841 95.659  1.00 86.37  ? -62 DA  I C4    1 
ATOM 6315  P P     . DT  I 5 13  ? 140.497 159.345 97.846  1.00 87.54  ? -61 DT  I P     1 
ATOM 6316  O OP1   . DT  I 5 13  ? 141.341 160.349 97.168  1.00 87.54  ? -61 DT  I OP1   1 
ATOM 6317  O OP2   . DT  I 5 13  ? 141.042 158.597 98.992  1.00 87.54  ? -61 DT  I OP2   1 
ATOM 6318  O "O5'" . DT  I 5 13  ? 139.137 160.036 98.326  1.00 87.54  ? -61 DT  I "O5'" 1 
ATOM 6319  C "C5'" . DT  I 5 13  ? 138.337 160.738 97.391  1.00 87.54  ? -61 DT  I "C5'" 1 
ATOM 6320  C "C4'" . DT  I 5 13  ? 137.170 161.425 98.071  1.00 87.54  ? -61 DT  I "C4'" 1 
ATOM 6321  O "O4'" . DT  I 5 13  ? 135.943 160.702 97.782  1.00 87.54  ? -61 DT  I "O4'" 1 
ATOM 6322  C "C3'" . DT  I 5 13  ? 137.261 161.515 99.598  1.00 87.54  ? -61 DT  I "C3'" 1 
ATOM 6323  O "O3'" . DT  I 5 13  ? 136.839 162.804 100.034 1.00 87.54  ? -61 DT  I "O3'" 1 
ATOM 6324  C "C2'" . DT  I 5 13  ? 136.287 160.439 100.046 1.00 87.54  ? -61 DT  I "C2'" 1 
ATOM 6325  C "C1'" . DT  I 5 13  ? 135.225 160.548 98.976  1.00 87.54  ? -61 DT  I "C1'" 1 
ATOM 6326  N N1    . DT  I 5 13  ? 134.399 159.341 98.876  1.00 87.54  ? -61 DT  I N1    1 
ATOM 6327  C C2    . DT  I 5 13  ? 133.042 159.457 98.713  1.00 87.54  ? -61 DT  I C2    1 
ATOM 6328  O O2    . DT  I 5 13  ? 132.461 160.523 98.639  1.00 87.54  ? -61 DT  I O2    1 
ATOM 6329  N N3    . DT  I 5 13  ? 132.382 158.267 98.650  1.00 87.54  ? -61 DT  I N3    1 
ATOM 6330  C C4    . DT  I 5 13  ? 132.936 157.002 98.725  1.00 87.54  ? -61 DT  I C4    1 
ATOM 6331  O O4    . DT  I 5 13  ? 132.265 155.984 98.658  1.00 87.54  ? -61 DT  I O4    1 
ATOM 6332  C C5    . DT  I 5 13  ? 134.352 156.960 98.905  1.00 87.54  ? -61 DT  I C5    1 
ATOM 6333  C C7    . DT  I 5 13  ? 135.051 155.644 99.011  1.00 87.54  ? -61 DT  I C7    1 
ATOM 6334  C C6    . DT  I 5 13  ? 135.008 158.116 98.970  1.00 87.54  ? -61 DT  I C6    1 
ATOM 6335  P P     . DA  I 5 14  ? 137.040 163.275 101.561 1.00 88.40  ? -60 DA  I P     1 
ATOM 6336  O OP1   . DA  I 5 14  ? 137.753 164.566 101.505 1.00 88.40  ? -60 DA  I OP1   1 
ATOM 6337  O OP2   . DA  I 5 14  ? 137.602 162.190 102.394 1.00 88.40  ? -60 DA  I OP2   1 
ATOM 6338  O "O5'" . DA  I 5 14  ? 135.553 163.568 102.059 1.00 88.40  ? -60 DA  I "O5'" 1 
ATOM 6339  C "C5'" . DA  I 5 14  ? 134.953 164.824 101.763 1.00 88.40  ? -60 DA  I "C5'" 1 
ATOM 6340  C "C4'" . DA  I 5 14  ? 133.438 164.730 101.754 1.00 88.40  ? -60 DA  I "C4'" 1 
ATOM 6341  O "O4'" . DA  I 5 14  ? 133.029 163.435 101.235 1.00 88.40  ? -60 DA  I "O4'" 1 
ATOM 6342  C "C3'" . DA  I 5 14  ? 132.767 164.849 103.118 1.00 88.40  ? -60 DA  I "C3'" 1 
ATOM 6343  O "O3'" . DA  I 5 14  ? 131.507 165.454 102.953 1.00 88.40  ? -60 DA  I "O3'" 1 
ATOM 6344  C "C2'" . DA  I 5 14  ? 132.608 163.393 103.507 1.00 88.40  ? -60 DA  I "C2'" 1 
ATOM 6345  C "C1'" . DA  I 5 14  ? 132.176 162.821 102.175 1.00 88.40  ? -60 DA  I "C1'" 1 
ATOM 6346  N N9    . DA  I 5 14  ? 132.289 161.366 102.048 1.00 88.40  ? -60 DA  I N9    1 
ATOM 6347  C C8    . DA  I 5 14  ? 133.427 160.614 102.025 1.00 88.40  ? -60 DA  I C8    1 
ATOM 6348  N N7    . DA  I 5 14  ? 133.210 159.329 101.876 1.00 88.40  ? -60 DA  I N7    1 
ATOM 6349  C C5    . DA  I 5 14  ? 131.837 159.241 101.774 1.00 88.40  ? -60 DA  I C5    1 
ATOM 6350  C C6    . DA  I 5 14  ? 130.961 158.155 101.589 1.00 88.40  ? -60 DA  I C6    1 
ATOM 6351  N N6    . DA  I 5 14  ? 131.369 156.888 101.477 1.00 88.40  ? -60 DA  I N6    1 
ATOM 6352  N N1    . DA  I 5 14  ? 129.637 158.420 101.526 1.00 88.40  ? -60 DA  I N1    1 
ATOM 6353  C C2    . DA  I 5 14  ? 129.231 159.686 101.636 1.00 88.40  ? -60 DA  I C2    1 
ATOM 6354  N N3    . DA  I 5 14  ? 129.959 160.783 101.812 1.00 88.40  ? -60 DA  I N3    1 
ATOM 6355  C C4    . DA  I 5 14  ? 131.260 160.489 101.870 1.00 88.40  ? -60 DA  I C4    1 
ATOM 6356  P P     . DT  I 5 15  ? 130.951 166.489 104.042 1.00 90.82  ? -59 DT  I P     1 
ATOM 6357  O OP1   . DT  I 5 15  ? 131.291 167.846 103.559 1.00 90.82  ? -59 DT  I OP1   1 
ATOM 6358  O OP2   . DT  I 5 15  ? 131.431 166.047 105.370 1.00 90.82  ? -59 DT  I OP2   1 
ATOM 6359  O "O5'" . DT  I 5 15  ? 129.359 166.301 103.970 1.00 90.82  ? -59 DT  I "O5'" 1 
ATOM 6360  C "C5'" . DT  I 5 15  ? 128.800 165.083 103.473 1.00 90.82  ? -59 DT  I "C5'" 1 
ATOM 6361  C "C4'" . DT  I 5 15  ? 127.857 164.468 104.490 1.00 90.82  ? -59 DT  I "C4'" 1 
ATOM 6362  O "O4'" . DT  I 5 15  ? 127.914 163.017 104.377 1.00 90.82  ? -59 DT  I "O4'" 1 
ATOM 6363  C "C3'" . DT  I 5 15  ? 128.237 164.740 105.941 1.00 90.82  ? -59 DT  I "C3'" 1 
ATOM 6364  O "O3'" . DT  I 5 15  ? 127.149 164.445 106.769 1.00 90.82  ? -59 DT  I "O3'" 1 
ATOM 6365  C "C2'" . DT  I 5 15  ? 129.275 163.670 106.129 1.00 90.82  ? -59 DT  I "C2'" 1 
ATOM 6366  C "C1'" . DT  I 5 15  ? 128.457 162.519 105.578 1.00 90.82  ? -59 DT  I "C1'" 1 
ATOM 6367  N N1    . DT  I 5 15  ? 129.214 161.288 105.332 1.00 90.82  ? -59 DT  I N1    1 
ATOM 6368  C C2    . DT  I 5 15  ? 128.529 160.143 105.036 1.00 90.82  ? -59 DT  I C2    1 
ATOM 6369  O O2    . DT  I 5 15  ? 127.317 160.099 104.937 1.00 90.82  ? -59 DT  I O2    1 
ATOM 6370  N N3    . DT  I 5 15  ? 129.315 159.045 104.848 1.00 90.82  ? -59 DT  I N3    1 
ATOM 6371  C C4    . DT  I 5 15  ? 130.685 158.981 104.932 1.00 90.82  ? -59 DT  I C4    1 
ATOM 6372  O O4    . DT  I 5 15  ? 131.303 157.946 104.744 1.00 90.82  ? -59 DT  I O4    1 
ATOM 6373  C C5    . DT  I 5 15  ? 131.340 160.220 105.264 1.00 90.82  ? -59 DT  I C5    1 
ATOM 6374  C C7    . DT  I 5 15  ? 132.829 160.272 105.403 1.00 90.82  ? -59 DT  I C7    1 
ATOM 6375  C C6    . DT  I 5 15  ? 130.579 161.295 105.458 1.00 90.82  ? -59 DT  I C6    1 
ATOM 6376  P P     . DC  I 5 16  ? 126.081 165.560 107.175 1.00 89.22  ? -58 DC  I P     1 
ATOM 6377  O OP1   . DC  I 5 16  ? 126.284 166.749 106.319 1.00 89.22  ? -58 DC  I OP1   1 
ATOM 6378  O OP2   . DC  I 5 16  ? 126.127 165.674 108.649 1.00 89.22  ? -58 DC  I OP2   1 
ATOM 6379  O "O5'" . DC  I 5 16  ? 124.697 164.859 106.816 1.00 89.22  ? -58 DC  I "O5'" 1 
ATOM 6380  C "C5'" . DC  I 5 16  ? 123.725 164.712 107.810 1.00 89.22  ? -58 DC  I "C5'" 1 
ATOM 6381  C "C4'" . DC  I 5 16  ? 123.666 163.290 108.338 1.00 89.22  ? -58 DC  I "C4'" 1 
ATOM 6382  O "O4'" . DC  I 5 16  ? 124.839 162.510 107.943 1.00 89.22  ? -58 DC  I "O4'" 1 
ATOM 6383  C "C3'" . DC  I 5 16  ? 123.607 163.186 109.864 1.00 89.22  ? -58 DC  I "C3'" 1 
ATOM 6384  O "O3'" . DC  I 5 16  ? 122.707 162.175 110.222 1.00 89.22  ? -58 DC  I "O3'" 1 
ATOM 6385  C "C2'" . DC  I 5 16  ? 125.024 162.747 110.190 1.00 89.22  ? -58 DC  I "C2'" 1 
ATOM 6386  C "C1'" . DC  I 5 16  ? 125.208 161.754 109.070 1.00 89.22  ? -58 DC  I "C1'" 1 
ATOM 6387  N N1    . DC  I 5 16  ? 126.600 161.210 108.928 1.00 89.22  ? -58 DC  I N1    1 
ATOM 6388  C C2    . DC  I 5 16  ? 126.798 159.841 108.673 1.00 89.22  ? -58 DC  I C2    1 
ATOM 6389  O O2    . DC  I 5 16  ? 125.821 159.097 108.541 1.00 89.22  ? -58 DC  I O2    1 
ATOM 6390  N N3    . DC  I 5 16  ? 128.064 159.372 108.563 1.00 89.22  ? -58 DC  I N3    1 
ATOM 6391  C C4    . DC  I 5 16  ? 129.093 160.206 108.706 1.00 89.22  ? -58 DC  I C4    1 
ATOM 6392  N N4    . DC  I 5 16  ? 130.324 159.709 108.586 1.00 89.22  ? -58 DC  I N4    1 
ATOM 6393  C C5    . DC  I 5 16  ? 128.910 161.586 108.986 1.00 89.22  ? -58 DC  I C5    1 
ATOM 6394  C C6    . DC  I 5 16  ? 127.662 162.040 109.083 1.00 89.22  ? -58 DC  I C6    1 
ATOM 6395  P P     . DT  I 5 17  ? 121.162 162.483 110.521 1.00 89.59  ? -57 DT  I P     1 
ATOM 6396  O OP1   . DT  I 5 17  ? 120.567 163.212 109.384 1.00 89.59  ? -57 DT  I OP1   1 
ATOM 6397  O OP2   . DT  I 5 17  ? 121.067 163.059 111.877 1.00 89.59  ? -57 DT  I OP2   1 
ATOM 6398  O "O5'" . DT  I 5 17  ? 120.548 161.014 110.555 1.00 89.59  ? -57 DT  I "O5'" 1 
ATOM 6399  C "C5'" . DT  I 5 17  ? 121.259 159.953 109.909 1.00 89.59  ? -57 DT  I "C5'" 1 
ATOM 6400  C "C4'" . DT  I 5 17  ? 121.742 158.935 110.921 1.00 89.59  ? -57 DT  I "C4'" 1 
ATOM 6401  O "O4'" . DT  I 5 17  ? 123.176 158.700 110.772 1.00 89.59  ? -57 DT  I "O4'" 1 
ATOM 6402  C "C3'" . DT  I 5 17  ? 121.554 159.350 112.384 1.00 89.59  ? -57 DT  I "C3'" 1 
ATOM 6403  O "O3'" . DT  I 5 17  ? 121.195 158.222 113.143 1.00 89.59  ? -57 DT  I "O3'" 1 
ATOM 6404  C "C2'" . DT  I 5 17  ? 122.953 159.808 112.751 1.00 89.59  ? -57 DT  I "C2'" 1 
ATOM 6405  C "C1'" . DT  I 5 17  ? 123.715 158.705 112.066 1.00 89.59  ? -57 DT  I "C1'" 1 
ATOM 6406  N N1    . DT  I 5 17  ? 125.187 158.877 112.040 1.00 89.59  ? -57 DT  I N1    1 
ATOM 6407  C C2    . DT  I 5 17  ? 125.972 157.789 111.770 1.00 89.59  ? -57 DT  I C2    1 
ATOM 6408  O O2    . DT  I 5 17  ? 125.518 156.691 111.521 1.00 89.59  ? -57 DT  I O2    1 
ATOM 6409  N N3    . DT  I 5 17  ? 127.317 158.035 111.788 1.00 89.59  ? -57 DT  I N3    1 
ATOM 6410  C C4    . DT  I 5 17  ? 127.936 159.233 112.056 1.00 89.59  ? -57 DT  I C4    1 
ATOM 6411  O O4    . DT  I 5 17  ? 129.152 159.358 112.046 1.00 89.59  ? -57 DT  I O4    1 
ATOM 6412  C C5    . DT  I 5 17  ? 127.054 160.328 112.350 1.00 89.59  ? -57 DT  I C5    1 
ATOM 6413  C C7    . DT  I 5 17  ? 127.619 161.680 112.662 1.00 89.59  ? -57 DT  I C7    1 
ATOM 6414  C C6    . DT  I 5 17  ? 125.737 160.094 112.347 1.00 89.59  ? -57 DT  I C6    1 
ATOM 6415  P P     . DG  I 5 18  ? 119.659 157.942 113.497 1.00 89.56  ? -56 DG  I P     1 
ATOM 6416  O OP1   . DG  I 5 18  ? 118.837 158.769 112.592 1.00 89.56  ? -56 DG  I OP1   1 
ATOM 6417  O OP2   . DG  I 5 18  ? 119.518 158.084 114.959 1.00 89.56  ? -56 DG  I OP2   1 
ATOM 6418  O "O5'" . DG  I 5 18  ? 119.468 156.399 113.135 1.00 89.56  ? -56 DG  I "O5'" 1 
ATOM 6419  C "C5'" . DG  I 5 18  ? 120.425 155.748 112.315 1.00 89.56  ? -56 DG  I "C5'" 1 
ATOM 6420  C "C4'" . DG  I 5 18  ? 121.337 154.848 113.135 1.00 89.56  ? -56 DG  I "C4'" 1 
ATOM 6421  O "O4'" . DG  I 5 18  ? 122.654 155.452 113.289 1.00 89.56  ? -56 DG  I "O4'" 1 
ATOM 6422  C "C3'" . DG  I 5 18  ? 120.858 154.550 114.550 1.00 89.56  ? -56 DG  I "C3'" 1 
ATOM 6423  O "O3'" . DG  I 5 18  ? 121.192 153.225 114.866 1.00 89.56  ? -56 DG  I "O3'" 1 
ATOM 6424  C "C2'" . DG  I 5 18  ? 121.699 155.522 115.378 1.00 89.56  ? -56 DG  I "C2'" 1 
ATOM 6425  C "C1'" . DG  I 5 18  ? 123.016 155.387 114.649 1.00 89.56  ? -56 DG  I "C1'" 1 
ATOM 6426  N N9    . DG  I 5 18  ? 123.973 156.446 114.922 1.00 89.56  ? -56 DG  I N9    1 
ATOM 6427  C C8    . DG  I 5 18  ? 123.701 157.714 115.355 1.00 89.56  ? -56 DG  I C8    1 
ATOM 6428  N N7    . DG  I 5 18  ? 124.765 158.461 115.474 1.00 89.56  ? -56 DG  I N7    1 
ATOM 6429  C C5    . DG  I 5 18  ? 125.814 157.618 115.128 1.00 89.56  ? -56 DG  I C5    1 
ATOM 6430  C C6    . DG  I 5 18  ? 127.212 157.857 115.090 1.00 89.56  ? -56 DG  I C6    1 
ATOM 6431  O O6    . DG  I 5 18  ? 127.823 158.895 115.356 1.00 89.56  ? -56 DG  I O6    1 
ATOM 6432  N N1    . DG  I 5 18  ? 127.914 156.734 114.687 1.00 89.56  ? -56 DG  I N1    1 
ATOM 6433  C C2    . DG  I 5 18  ? 127.348 155.532 114.358 1.00 89.56  ? -56 DG  I C2    1 
ATOM 6434  N N2    . DG  I 5 18  ? 128.189 154.561 113.996 1.00 89.56  ? -56 DG  I N2    1 
ATOM 6435  N N3    . DG  I 5 18  ? 126.044 155.290 114.390 1.00 89.56  ? -56 DG  I N3    1 
ATOM 6436  C C4    . DG  I 5 18  ? 125.341 156.375 114.784 1.00 89.56  ? -56 DG  I C4    1 
ATOM 6437  P P     . DA  I 5 19  ? 120.129 152.037 114.717 1.00 83.84  ? -55 DA  I P     1 
ATOM 6438  O OP1   . DA  I 5 19  ? 119.297 152.290 113.524 1.00 83.84  ? -55 DA  I OP1   1 
ATOM 6439  O OP2   . DA  I 5 19  ? 119.482 151.864 116.029 1.00 83.84  ? -55 DA  I OP2   1 
ATOM 6440  O "O5'" . DA  I 5 19  ? 121.056 150.756 114.475 1.00 83.84  ? -55 DA  I "O5'" 1 
ATOM 6441  C "C5'" . DA  I 5 19  ? 122.362 150.933 113.943 1.00 83.84  ? -55 DA  I "C5'" 1 
ATOM 6442  C "C4'" . DA  I 5 19  ? 123.309 149.802 114.328 1.00 83.84  ? -55 DA  I "C4'" 1 
ATOM 6443  O "O4'" . DA  I 5 19  ? 124.426 150.336 115.065 1.00 83.84  ? -55 DA  I "O4'" 1 
ATOM 6444  C "C3'" . DA  I 5 19  ? 122.757 148.718 115.229 1.00 83.84  ? -55 DA  I "C3'" 1 
ATOM 6445  O "O3'" . DA  I 5 19  ? 123.515 147.497 114.989 1.00 83.84  ? -55 DA  I "O3'" 1 
ATOM 6446  C "C2'" . DA  I 5 19  ? 122.972 149.309 116.628 1.00 83.84  ? -55 DA  I "C2'" 1 
ATOM 6447  C "C1'" . DA  I 5 19  ? 124.172 150.237 116.456 1.00 83.84  ? -55 DA  I "C1'" 1 
ATOM 6448  N N9    . DA  I 5 19  ? 123.902 151.573 116.943 1.00 83.84  ? -55 DA  I N9    1 
ATOM 6449  C C8    . DA  I 5 19  ? 122.685 152.078 117.271 1.00 83.84  ? -55 DA  I C8    1 
ATOM 6450  N N7    . DA  I 5 19  ? 122.713 153.328 117.635 1.00 83.84  ? -55 DA  I N7    1 
ATOM 6451  C C5    . DA  I 5 19  ? 124.039 153.668 117.537 1.00 83.84  ? -55 DA  I C5    1 
ATOM 6452  C C6    . DA  I 5 19  ? 124.715 154.857 117.783 1.00 83.84  ? -55 DA  I C6    1 
ATOM 6453  N N6    . DA  I 5 19  ? 124.108 155.968 118.200 1.00 83.84  ? -55 DA  I N6    1 
ATOM 6454  N N1    . DA  I 5 19  ? 126.044 154.867 117.591 1.00 83.84  ? -55 DA  I N1    1 
ATOM 6455  C C2    . DA  I 5 19  ? 126.649 153.749 117.180 1.00 83.84  ? -55 DA  I C2    1 
ATOM 6456  N N3    . DA  I 5 19  ? 126.112 152.570 116.906 1.00 83.84  ? -55 DA  I N3    1 
ATOM 6457  C C4    . DA  I 5 19  ? 124.792 152.598 117.108 1.00 83.84  ? -55 DA  I C4    1 
ATOM 6458  P P     . DC  I 5 20  ? 123.944 146.446 116.136 1.00 81.79  ? -54 DC  I P     1 
ATOM 6459  O OP1   . DC  I 5 20  ? 124.374 145.264 115.369 1.00 81.79  ? -54 DC  I OP1   1 
ATOM 6460  O OP2   . DC  I 5 20  ? 122.950 146.225 117.208 1.00 81.79  ? -54 DC  I OP2   1 
ATOM 6461  O "O5'" . DC  I 5 20  ? 125.277 147.057 116.750 1.00 81.79  ? -54 DC  I "O5'" 1 
ATOM 6462  C "C5'" . DC  I 5 20  ? 126.497 146.958 116.025 1.00 81.79  ? -54 DC  I "C5'" 1 
ATOM 6463  C "C4'" . DC  I 5 20  ? 127.705 147.400 116.849 1.00 81.79  ? -54 DC  I "C4'" 1 
ATOM 6464  O "O4'" . DC  I 5 20  ? 127.467 148.692 117.469 1.00 81.79  ? -54 DC  I "O4'" 1 
ATOM 6465  C "C3'" . DC  I 5 20  ? 128.101 146.484 117.989 1.00 81.79  ? -54 DC  I "C3'" 1 
ATOM 6466  O "O3'" . DC  I 5 20  ? 129.469 146.616 118.208 1.00 81.79  ? -54 DC  I "O3'" 1 
ATOM 6467  C "C2'" . DC  I 5 20  ? 127.323 147.073 119.150 1.00 81.79  ? -54 DC  I "C2'" 1 
ATOM 6468  C "C1'" . DC  I 5 20  ? 127.496 148.560 118.882 1.00 81.79  ? -54 DC  I "C1'" 1 
ATOM 6469  N N1    . DC  I 5 20  ? 126.399 149.397 119.414 1.00 81.79  ? -54 DC  I N1    1 
ATOM 6470  C C2    . DC  I 5 20  ? 126.639 150.729 119.738 1.00 81.79  ? -54 DC  I C2    1 
ATOM 6471  O O2    . DC  I 5 20  ? 127.776 151.181 119.624 1.00 81.79  ? -54 DC  I O2    1 
ATOM 6472  N N3    . DC  I 5 20  ? 125.615 151.487 120.191 1.00 81.79  ? -54 DC  I N3    1 
ATOM 6473  C C4    . DC  I 5 20  ? 124.402 150.966 120.309 1.00 81.79  ? -54 DC  I C4    1 
ATOM 6474  N N4    . DC  I 5 20  ? 123.419 151.753 120.761 1.00 81.79  ? -54 DC  I N4    1 
ATOM 6475  C C5    . DC  I 5 20  ? 124.135 149.612 119.978 1.00 81.79  ? -54 DC  I C5    1 
ATOM 6476  C C6    . DC  I 5 20  ? 125.153 148.872 119.536 1.00 81.79  ? -54 DC  I C6    1 
ATOM 6477  P P     . DA  I 5 21  ? 130.399 145.319 118.279 1.00 81.10  ? -53 DA  I P     1 
ATOM 6478  O OP1   . DA  I 5 21  ? 131.051 145.195 116.958 1.00 81.10  ? -53 DA  I OP1   1 
ATOM 6479  O OP2   . DA  I 5 21  ? 129.562 144.214 118.799 1.00 81.10  ? -53 DA  I OP2   1 
ATOM 6480  O "O5'" . DA  I 5 21  ? 131.503 145.718 119.367 1.00 81.10  ? -53 DA  I "O5'" 1 
ATOM 6481  C "C5'" . DA  I 5 21  ? 132.423 146.751 119.075 1.00 81.10  ? -53 DA  I "C5'" 1 
ATOM 6482  C "C4'" . DA  I 5 21  ? 132.657 147.649 120.274 1.00 81.10  ? -53 DA  I "C4'" 1 
ATOM 6483  O "O4'" . DA  I 5 21  ? 131.439 148.344 120.622 1.00 81.10  ? -53 DA  I "O4'" 1 
ATOM 6484  C "C3'" . DA  I 5 21  ? 133.125 146.949 121.546 1.00 81.10  ? -53 DA  I "C3'" 1 
ATOM 6485  O "O3'" . DA  I 5 21  ? 134.242 147.654 122.066 1.00 81.10  ? -53 DA  I "O3'" 1 
ATOM 6486  C "C2'" . DA  I 5 21  ? 131.903 147.034 122.466 1.00 81.10  ? -53 DA  I "C2'" 1 
ATOM 6487  C "C1'" . DA  I 5 21  ? 131.295 148.345 122.020 1.00 81.10  ? -53 DA  I "C1'" 1 
ATOM 6488  N N9    . DA  I 5 21  ? 129.877 148.477 122.313 1.00 81.10  ? -53 DA  I N9    1 
ATOM 6489  C C8    . DA  I 5 21  ? 128.915 147.549 122.086 1.00 81.10  ? -53 DA  I C8    1 
ATOM 6490  N N7    . DA  I 5 21  ? 127.708 147.941 122.402 1.00 81.10  ? -53 DA  I N7    1 
ATOM 6491  C C5    . DA  I 5 21  ? 127.892 149.219 122.879 1.00 81.10  ? -53 DA  I C5    1 
ATOM 6492  C C6    . DA  I 5 21  ? 126.999 150.171 123.394 1.00 81.10  ? -53 DA  I C6    1 
ATOM 6493  N N6    . DA  I 5 21  ? 125.687 149.958 123.503 1.00 81.10  ? -53 DA  I N6    1 
ATOM 6494  N N1    . DA  I 5 21  ? 127.509 151.351 123.800 1.00 81.10  ? -53 DA  I N1    1 
ATOM 6495  C C2    . DA  I 5 21  ? 128.832 151.549 123.704 1.00 81.10  ? -53 DA  I C2    1 
ATOM 6496  N N3    . DA  I 5 21  ? 129.767 150.734 123.222 1.00 81.10  ? -53 DA  I N3    1 
ATOM 6497  C C4    . DA  I 5 21  ? 129.226 149.571 122.832 1.00 81.10  ? -53 DA  I C4    1 
ATOM 6498  P P     . DC  I 5 22  ? 134.909 147.269 123.477 1.00 80.60  ? -52 DC  I P     1 
ATOM 6499  O OP1   . DC  I 5 22  ? 136.319 147.698 123.390 1.00 80.60  ? -52 DC  I OP1   1 
ATOM 6500  O OP2   . DC  I 5 22  ? 134.598 145.872 123.844 1.00 80.60  ? -52 DC  I OP2   1 
ATOM 6501  O "O5'" . DC  I 5 22  ? 134.192 148.250 124.502 1.00 80.60  ? -52 DC  I "O5'" 1 
ATOM 6502  C "C5'" . DC  I 5 22  ? 134.094 149.623 124.185 1.00 80.60  ? -52 DC  I "C5'" 1 
ATOM 6503  C "C4'" . DC  I 5 22  ? 133.457 150.389 125.318 1.00 80.60  ? -52 DC  I "C4'" 1 
ATOM 6504  O "O4'" . DC  I 5 22  ? 132.011 150.335 125.209 1.00 80.60  ? -52 DC  I "O4'" 1 
ATOM 6505  C "C3'" . DC  I 5 22  ? 133.786 149.858 126.717 1.00 80.60  ? -52 DC  I "C3'" 1 
ATOM 6506  O "O3'" . DC  I 5 22  ? 134.119 150.941 127.556 1.00 80.60  ? -52 DC  I "O3'" 1 
ATOM 6507  C "C2'" . DC  I 5 22  ? 132.472 149.222 127.149 1.00 80.60  ? -52 DC  I "C2'" 1 
ATOM 6508  C "C1'" . DC  I 5 22  ? 131.512 150.186 126.505 1.00 80.60  ? -52 DC  I "C1'" 1 
ATOM 6509  N N1    . DC  I 5 22  ? 130.131 149.718 126.452 1.00 80.60  ? -52 DC  I N1    1 
ATOM 6510  C C2    . DC  I 5 22  ? 129.115 150.557 126.905 1.00 80.60  ? -52 DC  I C2    1 
ATOM 6511  O O2    . DC  I 5 22  ? 129.405 151.684 127.317 1.00 80.60  ? -52 DC  I O2    1 
ATOM 6512  N N3    . DC  I 5 22  ? 127.845 150.126 126.858 1.00 80.60  ? -52 DC  I N3    1 
ATOM 6513  C C4    . DC  I 5 22  ? 127.580 148.913 126.410 1.00 80.60  ? -52 DC  I C4    1 
ATOM 6514  N N4    . DC  I 5 22  ? 126.305 148.531 126.387 1.00 80.60  ? -52 DC  I N4    1 
ATOM 6515  C C5    . DC  I 5 22  ? 128.604 148.034 125.955 1.00 80.60  ? -52 DC  I C5    1 
ATOM 6516  C C6    . DC  I 5 22  ? 129.857 148.475 125.997 1.00 80.60  ? -52 DC  I C6    1 
ATOM 6517  P P     . DG  I 5 23  ? 135.196 150.760 128.730 1.00 83.16  ? -51 DG  I P     1 
ATOM 6518  O OP1   . DG  I 5 23  ? 136.405 151.511 128.325 1.00 83.16  ? -51 DG  I OP1   1 
ATOM 6519  O OP2   . DG  I 5 23  ? 135.309 149.317 129.032 1.00 83.16  ? -51 DG  I OP2   1 
ATOM 6520  O "O5'" . DG  I 5 23  ? 134.512 151.487 129.981 1.00 83.16  ? -51 DG  I "O5'" 1 
ATOM 6521  C "C5'" . DG  I 5 23  ? 134.387 152.905 129.998 1.00 83.16  ? -51 DG  I "C5'" 1 
ATOM 6522  C "C4'" . DG  I 5 23  ? 133.235 153.353 130.884 1.00 83.16  ? -51 DG  I "C4'" 1 
ATOM 6523  O "O4'" . DG  I 5 23  ? 131.988 152.801 130.388 1.00 83.16  ? -51 DG  I "O4'" 1 
ATOM 6524  C "C3'" . DG  I 5 23  ? 133.327 152.937 132.356 1.00 83.16  ? -51 DG  I "C3'" 1 
ATOM 6525  O "O3'" . DG  I 5 23  ? 132.897 154.012 133.190 1.00 83.16  ? -51 DG  I "O3'" 1 
ATOM 6526  C "C2'" . DG  I 5 23  ? 132.363 151.769 132.431 1.00 83.16  ? -51 DG  I "C2'" 1 
ATOM 6527  C "C1'" . DG  I 5 23  ? 131.294 152.190 131.447 1.00 83.16  ? -51 DG  I "C1'" 1 
ATOM 6528  N N9    . DG  I 5 23  ? 130.559 151.066 130.903 1.00 83.16  ? -51 DG  I N9    1 
ATOM 6529  C C8    . DG  I 5 23  ? 131.091 149.998 130.240 1.00 83.16  ? -51 DG  I C8    1 
ATOM 6530  N N7    . DG  I 5 23  ? 130.204 149.134 129.853 1.00 83.16  ? -51 DG  I N7    1 
ATOM 6531  C C5    . DG  I 5 23  ? 129.004 149.661 130.292 1.00 83.16  ? -51 DG  I C5    1 
ATOM 6532  C C6    . DG  I 5 23  ? 127.703 149.161 130.154 1.00 83.16  ? -51 DG  I C6    1 
ATOM 6533  O O6    . DG  I 5 23  ? 127.348 148.117 129.602 1.00 83.16  ? -51 DG  I O6    1 
ATOM 6534  N N1    . DG  I 5 23  ? 126.764 149.995 130.736 1.00 83.16  ? -51 DG  I N1    1 
ATOM 6535  C C2    . DG  I 5 23  ? 127.050 151.173 131.373 1.00 83.16  ? -51 DG  I C2    1 
ATOM 6536  N N2    . DG  I 5 23  ? 126.010 151.849 131.872 1.00 83.16  ? -51 DG  I N2    1 
ATOM 6537  N N3    . DG  I 5 23  ? 128.275 151.661 131.507 1.00 83.16  ? -51 DG  I N3    1 
ATOM 6538  C C4    . DG  I 5 23  ? 129.199 150.854 130.937 1.00 83.16  ? -51 DG  I C4    1 
ATOM 6539  P P     . DT  I 5 24  ? 132.829 153.851 134.791 1.00 81.88  ? -50 DT  I P     1 
ATOM 6540  O OP1   . DT  I 5 24  ? 133.144 155.184 135.343 1.00 81.88  ? -50 DT  I OP1   1 
ATOM 6541  O OP2   . DT  I 5 24  ? 133.634 152.689 135.229 1.00 81.88  ? -50 DT  I OP2   1 
ATOM 6542  O "O5'" . DT  I 5 24  ? 131.285 153.552 135.091 1.00 81.88  ? -50 DT  I "O5'" 1 
ATOM 6543  C "C5'" . DT  I 5 24  ? 130.353 154.631 135.137 1.00 81.88  ? -50 DT  I "C5'" 1 
ATOM 6544  C "C4'" . DT  I 5 24  ? 129.116 154.282 135.963 1.00 81.88  ? -50 DT  I "C4'" 1 
ATOM 6545  O "O4'" . DT  I 5 24  ? 128.311 153.297 135.266 1.00 81.88  ? -50 DT  I "O4'" 1 
ATOM 6546  C "C3'" . DT  I 5 24  ? 129.373 153.710 137.358 1.00 81.88  ? -50 DT  I "C3'" 1 
ATOM 6547  O "O3'" . DT  I 5 24  ? 128.444 154.283 138.280 1.00 81.88  ? -50 DT  I "O3'" 1 
ATOM 6548  C "C2'" . DT  I 5 24  ? 129.132 152.213 137.164 1.00 81.88  ? -50 DT  I "C2'" 1 
ATOM 6549  C "C1'" . DT  I 5 24  ? 128.029 152.212 136.123 1.00 81.88  ? -50 DT  I "C1'" 1 
ATOM 6550  N N1    . DT  I 5 24  ? 128.001 150.994 135.293 1.00 81.88  ? -50 DT  I N1    1 
ATOM 6551  C C2    . DT  I 5 24  ? 126.799 150.404 135.009 1.00 81.88  ? -50 DT  I C2    1 
ATOM 6552  O O2    . DT  I 5 24  ? 125.737 150.820 135.426 1.00 81.88  ? -50 DT  I O2    1 
ATOM 6553  N N3    . DT  I 5 24  ? 126.884 149.298 134.216 1.00 81.88  ? -50 DT  I N3    1 
ATOM 6554  C C4    . DT  I 5 24  ? 128.027 148.747 133.683 1.00 81.88  ? -50 DT  I C4    1 
ATOM 6555  O O4    . DT  I 5 24  ? 128.013 147.751 132.982 1.00 81.88  ? -50 DT  I O4    1 
ATOM 6556  C C5    . DT  I 5 24  ? 129.243 149.409 134.015 1.00 81.88  ? -50 DT  I C5    1 
ATOM 6557  C C7    . DT  I 5 24  ? 130.534 148.866 133.501 1.00 81.88  ? -50 DT  I C7    1 
ATOM 6558  C C6    . DT  I 5 24  ? 129.180 150.494 134.791 1.00 81.88  ? -50 DT  I C6    1 
ATOM 6559  P P     . DG  I 5 25  ? 128.416 153.835 139.825 1.00 78.22  ? -49 DG  I P     1 
ATOM 6560  O OP1   . DG  I 5 25  ? 127.923 154.997 140.595 1.00 78.22  ? -49 DG  I OP1   1 
ATOM 6561  O OP2   . DG  I 5 25  ? 129.729 153.256 140.184 1.00 78.22  ? -49 DG  I OP2   1 
ATOM 6562  O "O5'" . DG  I 5 25  ? 127.296 152.687 139.871 1.00 78.22  ? -49 DG  I "O5'" 1 
ATOM 6563  C "C5'" . DG  I 5 25  ? 126.003 152.935 139.305 1.00 78.22  ? -49 DG  I "C5'" 1 
ATOM 6564  C "C4'" . DG  I 5 25  ? 124.992 151.818 139.595 1.00 78.22  ? -49 DG  I "C4'" 1 
ATOM 6565  O "O4'" . DG  I 5 25  ? 125.116 150.744 138.635 1.00 78.22  ? -49 DG  I "O4'" 1 
ATOM 6566  C "C3'" . DG  I 5 25  ? 125.050 151.151 140.957 1.00 78.22  ? -49 DG  I "C3'" 1 
ATOM 6567  O "O3'" . DG  I 5 25  ? 123.731 150.772 141.304 1.00 78.22  ? -49 DG  I "O3'" 1 
ATOM 6568  C "C2'" . DG  I 5 25  ? 125.918 149.925 140.678 1.00 78.22  ? -49 DG  I "C2'" 1 
ATOM 6569  C "C1'" . DG  I 5 25  ? 125.427 149.530 139.296 1.00 78.22  ? -49 DG  I "C1'" 1 
ATOM 6570  N N9    . DG  I 5 25  ? 126.408 148.860 138.458 1.00 78.22  ? -49 DG  I N9    1 
ATOM 6571  C C8    . DG  I 5 25  ? 127.714 149.222 138.260 1.00 78.22  ? -49 DG  I C8    1 
ATOM 6572  N N7    . DG  I 5 25  ? 128.331 148.476 137.389 1.00 78.22  ? -49 DG  I N7    1 
ATOM 6573  C C5    . DG  I 5 25  ? 127.363 147.577 136.969 1.00 78.22  ? -49 DG  I C5    1 
ATOM 6574  C C6    . DG  I 5 25  ? 127.443 146.525 136.037 1.00 78.22  ? -49 DG  I C6    1 
ATOM 6575  O O6    . DG  I 5 25  ? 128.415 146.162 135.371 1.00 78.22  ? -49 DG  I O6    1 
ATOM 6576  N N1    . DG  I 5 25  ? 126.237 145.862 135.908 1.00 78.22  ? -49 DG  I N1    1 
ATOM 6577  C C2    . DG  I 5 25  ? 125.094 146.172 136.597 1.00 78.22  ? -49 DG  I C2    1 
ATOM 6578  N N2    . DG  I 5 25  ? 124.017 145.418 136.336 1.00 78.22  ? -49 DG  I N2    1 
ATOM 6579  N N3    . DG  I 5 25  ? 125.005 147.157 137.469 1.00 78.22  ? -49 DG  I N3    1 
ATOM 6580  C C4    . DG  I 5 25  ? 126.173 147.814 137.605 1.00 78.22  ? -49 DG  I C4    1 
ATOM 6581  P P     . DC  I 5 26  ? 123.322 150.454 142.821 1.00 73.50  ? -48 DC  I P     1 
ATOM 6582  O OP1   . DC  I 5 26  ? 122.173 151.321 143.147 1.00 73.50  ? -48 DC  I OP1   1 
ATOM 6583  O OP2   . DC  I 5 26  ? 124.538 150.498 143.655 1.00 73.50  ? -48 DC  I OP2   1 
ATOM 6584  O "O5'" . DC  I 5 26  ? 122.804 148.942 142.757 1.00 73.50  ? -48 DC  I "O5'" 1 
ATOM 6585  C "C5'" . DC  I 5 26  ? 121.720 148.594 141.887 1.00 73.50  ? -48 DC  I "C5'" 1 
ATOM 6586  C "C4'" . DC  I 5 26  ? 121.652 147.090 141.632 1.00 73.50  ? -48 DC  I "C4'" 1 
ATOM 6587  O "O4'" . DC  I 5 26  ? 122.718 146.688 140.737 1.00 73.50  ? -48 DC  I "O4'" 1 
ATOM 6588  C "C3'" . DC  I 5 26  ? 121.788 146.198 142.865 1.00 73.50  ? -48 DC  I "C3'" 1 
ATOM 6589  O "O3'" . DC  I 5 26  ? 120.941 145.071 142.722 1.00 73.50  ? -48 DC  I "O3'" 1 
ATOM 6590  C "C2'" . DC  I 5 26  ? 123.251 145.777 142.796 1.00 73.50  ? -48 DC  I "C2'" 1 
ATOM 6591  C "C1'" . DC  I 5 26  ? 123.405 145.596 141.303 1.00 73.50  ? -48 DC  I "C1'" 1 
ATOM 6592  N N1    . DC  I 5 26  ? 124.803 145.637 140.815 1.00 73.50  ? -48 DC  I N1    1 
ATOM 6593  C C2    . DC  I 5 26  ? 125.167 144.856 139.719 1.00 73.50  ? -48 DC  I C2    1 
ATOM 6594  O O2    . DC  I 5 26  ? 124.334 144.112 139.203 1.00 73.50  ? -48 DC  I O2    1 
ATOM 6595  N N3    . DC  I 5 26  ? 126.439 144.904 139.269 1.00 73.50  ? -48 DC  I N3    1 
ATOM 6596  C C4    . DC  I 5 26  ? 127.321 145.703 139.856 1.00 73.50  ? -48 DC  I C4    1 
ATOM 6597  N N4    . DC  I 5 26  ? 128.564 145.722 139.365 1.00 73.50  ? -48 DC  I N4    1 
ATOM 6598  C C5    . DC  I 5 26  ? 126.967 146.521 140.966 1.00 73.50  ? -48 DC  I C5    1 
ATOM 6599  C C6    . DC  I 5 26  ? 125.706 146.457 141.407 1.00 73.50  ? -48 DC  I C6    1 
ATOM 6600  P P     . DC  I 5 27  ? 119.479 145.043 143.388 1.00 64.71  ? -47 DC  I P     1 
ATOM 6601  O OP1   . DC  I 5 27  ? 118.686 146.173 142.859 1.00 64.71  ? -47 DC  I OP1   1 
ATOM 6602  O OP2   . DC  I 5 27  ? 119.668 144.899 144.845 1.00 64.71  ? -47 DC  I OP2   1 
ATOM 6603  O "O5'" . DC  I 5 27  ? 118.851 143.681 142.836 1.00 64.71  ? -47 DC  I "O5'" 1 
ATOM 6604  C "C5'" . DC  I 5 27  ? 119.394 143.084 141.660 1.00 64.71  ? -47 DC  I "C5'" 1 
ATOM 6605  C "C4'" . DC  I 5 27  ? 119.803 141.642 141.905 1.00 64.71  ? -47 DC  I "C4'" 1 
ATOM 6606  O "O4'" . DC  I 5 27  ? 121.238 141.502 141.760 1.00 64.71  ? -47 DC  I "O4'" 1 
ATOM 6607  C "C3'" . DC  I 5 27  ? 119.488 141.097 143.288 1.00 64.71  ? -47 DC  I "C3'" 1 
ATOM 6608  O "O3'" . DC  I 5 27  ? 119.272 139.698 143.194 1.00 64.71  ? -47 DC  I "O3'" 1 
ATOM 6609  C "C2'" . DC  I 5 27  ? 120.790 141.385 144.028 1.00 64.71  ? -47 DC  I "C2'" 1 
ATOM 6610  C "C1'" . DC  I 5 27  ? 121.779 140.980 142.957 1.00 64.71  ? -47 DC  I "C1'" 1 
ATOM 6611  N N1    . DC  I 5 27  ? 123.139 141.540 143.118 1.00 64.71  ? -47 DC  I N1    1 
ATOM 6612  C C2    . DC  I 5 27  ? 124.119 141.192 142.195 1.00 64.71  ? -47 DC  I C2    1 
ATOM 6613  O O2    . DC  I 5 27  ? 123.838 140.409 141.283 1.00 64.71  ? -47 DC  I O2    1 
ATOM 6614  N N3    . DC  I 5 27  ? 125.356 141.709 142.323 1.00 64.71  ? -47 DC  I N3    1 
ATOM 6615  C C4    . DC  I 5 27  ? 125.625 142.550 143.312 1.00 64.71  ? -47 DC  I C4    1 
ATOM 6616  N N4    . DC  I 5 27  ? 126.868 143.030 143.393 1.00 64.71  ? -47 DC  I N4    1 
ATOM 6617  C C5    . DC  I 5 27  ? 124.642 142.916 144.272 1.00 64.71  ? -47 DC  I C5    1 
ATOM 6618  C C6    . DC  I 5 27  ? 123.417 142.403 144.131 1.00 64.71  ? -47 DC  I C6    1 
ATOM 6619  P P     . DT  I 5 28  ? 117.822 139.090 142.859 1.00 61.09  ? -46 DT  I P     1 
ATOM 6620  O OP1   . DT  I 5 28  ? 116.981 140.074 142.145 1.00 61.09  ? -46 DT  I OP1   1 
ATOM 6621  O OP2   . DT  I 5 28  ? 117.329 138.490 144.115 1.00 61.09  ? -46 DT  I OP2   1 
ATOM 6622  O "O5'" . DT  I 5 28  ? 118.156 137.908 141.842 1.00 61.09  ? -46 DT  I "O5'" 1 
ATOM 6623  C "C5'" . DT  I 5 28  ? 119.303 138.015 141.012 1.00 61.09  ? -46 DT  I "C5'" 1 
ATOM 6624  C "C4'" . DT  I 5 28  ? 120.069 136.705 140.918 1.00 61.09  ? -46 DT  I "C4'" 1 
ATOM 6625  O "O4'" . DT  I 5 28  ? 121.415 136.880 141.429 1.00 61.09  ? -46 DT  I "O4'" 1 
ATOM 6626  C "C3'" . DT  I 5 28  ? 119.493 135.553 141.712 1.00 61.09  ? -46 DT  I "C3'" 1 
ATOM 6627  O "O3'" . DT  I 5 28  ? 119.886 134.337 141.112 1.00 61.09  ? -46 DT  I "O3'" 1 
ATOM 6628  C "C2'" . DT  I 5 28  ? 120.167 135.739 143.067 1.00 61.09  ? -46 DT  I "C2'" 1 
ATOM 6629  C "C1'" . DT  I 5 28  ? 121.565 136.181 142.652 1.00 61.09  ? -46 DT  I "C1'" 1 
ATOM 6630  N N1    . DT  I 5 28  ? 122.213 137.093 143.609 1.00 61.09  ? -46 DT  I N1    1 
ATOM 6631  C C2    . DT  I 5 28  ? 123.507 137.457 143.392 1.00 61.09  ? -46 DT  I C2    1 
ATOM 6632  O O2    . DT  I 5 28  ? 124.161 137.041 142.461 1.00 61.09  ? -46 DT  I O2    1 
ATOM 6633  N N3    . DT  I 5 28  ? 124.016 138.328 144.303 1.00 61.09  ? -46 DT  I N3    1 
ATOM 6634  C C4    . DT  I 5 28  ? 123.376 138.857 145.394 1.00 61.09  ? -46 DT  I C4    1 
ATOM 6635  O O4    . DT  I 5 28  ? 123.928 139.631 146.162 1.00 61.09  ? -46 DT  I O4    1 
ATOM 6636  C C5    . DT  I 5 28  ? 122.010 138.440 145.566 1.00 61.09  ? -46 DT  I C5    1 
ATOM 6637  C C7    . DT  I 5 28  ? 121.203 138.947 146.723 1.00 61.09  ? -46 DT  I C7    1 
ATOM 6638  C C6    . DT  I 5 28  ? 121.499 137.592 144.670 1.00 61.09  ? -46 DT  I C6    1 
ATOM 6639  P P     . DG  I 5 29  ? 118.881 133.542 140.149 1.00 60.33  ? -45 DG  I P     1 
ATOM 6640  O OP1   . DG  I 5 29  ? 118.165 134.533 139.320 1.00 60.33  ? -45 DG  I OP1   1 
ATOM 6641  O OP2   . DG  I 5 29  ? 118.133 132.586 140.990 1.00 60.33  ? -45 DG  I OP2   1 
ATOM 6642  O "O5'" . DG  I 5 29  ? 119.852 132.704 139.204 1.00 60.33  ? -45 DG  I "O5'" 1 
ATOM 6643  C "C5'" . DG  I 5 29  ? 120.806 133.374 138.404 1.00 60.33  ? -45 DG  I "C5'" 1 
ATOM 6644  C "C4'" . DG  I 5 29  ? 122.229 132.956 138.748 1.00 60.33  ? -45 DG  I "C4'" 1 
ATOM 6645  O "O4'" . DG  I 5 29  ? 122.618 133.515 140.024 1.00 60.33  ? -45 DG  I "O4'" 1 
ATOM 6646  C "C3'" . DG  I 5 29  ? 122.476 131.454 138.871 1.00 60.33  ? -45 DG  I "C3'" 1 
ATOM 6647  O "O3'" . DG  I 5 29  ? 123.749 131.167 138.363 1.00 60.33  ? -45 DG  I "O3'" 1 
ATOM 6648  C "C2'" . DG  I 5 29  ? 122.452 131.243 140.379 1.00 60.33  ? -45 DG  I "C2'" 1 
ATOM 6649  C "C1'" . DG  I 5 29  ? 123.170 132.493 140.814 1.00 60.33  ? -45 DG  I "C1'" 1 
ATOM 6650  N N9    . DG  I 5 29  ? 122.978 132.842 142.210 1.00 60.33  ? -45 DG  I N9    1 
ATOM 6651  C C8    . DG  I 5 29  ? 121.842 132.700 142.958 1.00 60.33  ? -45 DG  I C8    1 
ATOM 6652  N N7    . DG  I 5 29  ? 121.973 133.135 144.179 1.00 60.33  ? -45 DG  I N7    1 
ATOM 6653  C C5    . DG  I 5 29  ? 123.279 133.578 144.235 1.00 60.33  ? -45 DG  I C5    1 
ATOM 6654  C C6    . DG  I 5 29  ? 123.995 134.152 145.296 1.00 60.33  ? -45 DG  I C6    1 
ATOM 6655  O O6    . DG  I 5 29  ? 123.610 134.382 146.445 1.00 60.33  ? -45 DG  I O6    1 
ATOM 6656  N N1    . DG  I 5 29  ? 125.295 134.453 144.929 1.00 60.33  ? -45 DG  I N1    1 
ATOM 6657  C C2    . DG  I 5 29  ? 125.827 134.243 143.689 1.00 60.33  ? -45 DG  I C2    1 
ATOM 6658  N N2    . DG  I 5 29  ? 127.098 134.600 143.517 1.00 60.33  ? -45 DG  I N2    1 
ATOM 6659  N N3    . DG  I 5 29  ? 125.165 133.715 142.686 1.00 60.33  ? -45 DG  I N3    1 
ATOM 6660  C C4    . DG  I 5 29  ? 123.902 133.412 143.029 1.00 60.33  ? -45 DG  I C4    1 
ATOM 6661  P P     . DG  I 5 30  ? 124.106 129.697 137.828 1.00 62.42  ? -44 DG  I P     1 
ATOM 6662  O OP1   . DG  I 5 30  ? 123.963 129.744 136.355 1.00 62.42  ? -44 DG  I OP1   1 
ATOM 6663  O OP2   . DG  I 5 30  ? 123.352 128.685 138.598 1.00 62.42  ? -44 DG  I OP2   1 
ATOM 6664  O "O5'" . DG  I 5 30  ? 125.651 129.537 138.208 1.00 62.42  ? -44 DG  I "O5'" 1 
ATOM 6665  C "C5'" . DG  I 5 30  ? 126.626 130.341 137.554 1.00 62.42  ? -44 DG  I "C5'" 1 
ATOM 6666  C "C4'" . DG  I 5 30  ? 127.837 130.565 138.435 1.00 62.42  ? -44 DG  I "C4'" 1 
ATOM 6667  O "O4'" . DG  I 5 30  ? 127.419 131.175 139.675 1.00 62.42  ? -44 DG  I "O4'" 1 
ATOM 6668  C "C3'" . DG  I 5 30  ? 128.607 129.306 138.813 1.00 62.42  ? -44 DG  I "C3'" 1 
ATOM 6669  O "O3'" . DG  I 5 30  ? 130.002 129.558 138.750 1.00 62.42  ? -44 DG  I "O3'" 1 
ATOM 6670  C "C2'" . DG  I 5 30  ? 128.148 129.030 140.238 1.00 62.42  ? -44 DG  I "C2'" 1 
ATOM 6671  C "C1'" . DG  I 5 30  ? 127.894 130.427 140.763 1.00 62.42  ? -44 DG  I "C1'" 1 
ATOM 6672  N N9    . DG  I 5 30  ? 126.885 130.479 141.803 1.00 62.42  ? -44 DG  I N9    1 
ATOM 6673  C C8    . DG  I 5 30  ? 125.581 130.097 141.700 1.00 62.42  ? -44 DG  I C8    1 
ATOM 6674  N N7    . DG  I 5 30  ? 124.901 130.275 142.794 1.00 62.42  ? -44 DG  I N7    1 
ATOM 6675  C C5    . DG  I 5 30  ? 125.822 130.802 143.678 1.00 62.42  ? -44 DG  I C5    1 
ATOM 6676  C C6    . DG  I 5 30  ? 125.664 131.207 145.013 1.00 62.42  ? -44 DG  I C6    1 
ATOM 6677  O O6    . DG  I 5 30  ? 124.652 131.153 145.713 1.00 62.42  ? -44 DG  I O6    1 
ATOM 6678  N N1    . DG  I 5 30  ? 126.846 131.694 145.543 1.00 62.42  ? -44 DG  I N1    1 
ATOM 6679  C C2    . DG  I 5 30  ? 128.026 131.791 144.862 1.00 62.42  ? -44 DG  I C2    1 
ATOM 6680  N N2    . DG  I 5 30  ? 129.065 132.282 145.536 1.00 62.42  ? -44 DG  I N2    1 
ATOM 6681  N N3    . DG  I 5 30  ? 128.184 131.423 143.606 1.00 62.42  ? -44 DG  I N3    1 
ATOM 6682  C C4    . DG  I 5 30  ? 127.042 130.948 143.077 1.00 62.42  ? -44 DG  I C4    1 
ATOM 6683  P P     . DA  I 5 31  ? 131.059 128.352 138.854 1.00 63.52  ? -43 DA  I P     1 
ATOM 6684  O OP1   . DA  I 5 31  ? 132.267 128.740 138.104 1.00 63.52  ? -43 DA  I OP1   1 
ATOM 6685  O OP2   . DA  I 5 31  ? 130.379 127.076 138.600 1.00 63.52  ? -43 DA  I OP2   1 
ATOM 6686  O "O5'" . DA  I 5 31  ? 131.457 128.336 140.383 1.00 63.52  ? -43 DA  I "O5'" 1 
ATOM 6687  C "C5'" . DA  I 5 31  ? 131.929 129.503 140.973 1.00 63.52  ? -43 DA  I "C5'" 1 
ATOM 6688  C "C4'" . DA  I 5 31  ? 131.957 129.357 142.471 1.00 63.52  ? -43 DA  I "C4'" 1 
ATOM 6689  O "O4'" . DA  I 5 31  ? 130.616 129.439 143.004 1.00 63.52  ? -43 DA  I "O4'" 1 
ATOM 6690  C "C3'" . DA  I 5 31  ? 132.518 128.028 142.985 1.00 63.52  ? -43 DA  I "C3'" 1 
ATOM 6691  O "O3'" . DA  I 5 31  ? 133.390 128.297 144.050 1.00 63.52  ? -43 DA  I "O3'" 1 
ATOM 6692  C "C2'" . DA  I 5 31  ? 131.265 127.308 143.481 1.00 63.52  ? -43 DA  I "C2'" 1 
ATOM 6693  C "C1'" . DA  I 5 31  ? 130.520 128.494 144.026 1.00 63.52  ? -43 DA  I "C1'" 1 
ATOM 6694  N N9    . DA  I 5 31  ? 129.124 128.271 144.324 1.00 63.52  ? -43 DA  I N9    1 
ATOM 6695  C C8    . DA  I 5 31  ? 128.150 127.853 143.471 1.00 63.52  ? -43 DA  I C8    1 
ATOM 6696  N N7    . DA  I 5 31  ? 126.966 127.778 144.023 1.00 63.52  ? -43 DA  I N7    1 
ATOM 6697  C C5    . DA  I 5 31  ? 127.188 128.173 145.329 1.00 63.52  ? -43 DA  I C5    1 
ATOM 6698  C C6    . DA  I 5 31  ? 126.339 128.303 146.437 1.00 63.52  ? -43 DA  I C6    1 
ATOM 6699  N N6    . DA  I 5 31  ? 125.038 128.039 146.386 1.00 63.52  ? -43 DA  I N6    1 
ATOM 6700  N N1    . DA  I 5 31  ? 126.878 128.732 147.600 1.00 63.52  ? -43 DA  I N1    1 
ATOM 6701  C C2    . DA  I 5 31  ? 128.185 129.002 147.641 1.00 63.52  ? -43 DA  I C2    1 
ATOM 6702  N N3    . DA  I 5 31  ? 129.083 128.911 146.665 1.00 63.52  ? -43 DA  I N3    1 
ATOM 6703  C C4    . DA  I 5 31  ? 128.511 128.488 145.526 1.00 63.52  ? -43 DA  I C4    1 
ATOM 6704  P P     . DG  I 5 32  ? 134.779 127.517 144.190 1.00 65.86  ? -42 DG  I P     1 
ATOM 6705  O OP1   . DG  I 5 32  ? 135.718 128.010 143.159 1.00 65.86  ? -42 DG  I OP1   1 
ATOM 6706  O OP2   . DG  I 5 32  ? 134.482 126.077 144.276 1.00 65.86  ? -42 DG  I OP2   1 
ATOM 6707  O "O5'" . DG  I 5 32  ? 135.298 127.979 145.617 1.00 65.86  ? -42 DG  I "O5'" 1 
ATOM 6708  C "C5'" . DG  I 5 32  ? 134.458 128.772 146.434 1.00 65.86  ? -42 DG  I "C5'" 1 
ATOM 6709  C "C4'" . DG  I 5 32  ? 134.284 128.137 147.799 1.00 65.86  ? -42 DG  I "C4'" 1 
ATOM 6710  O "O4'" . DG  I 5 32  ? 132.872 127.932 148.071 1.00 65.86  ? -42 DG  I "O4'" 1 
ATOM 6711  C "C3'" . DG  I 5 32  ? 134.942 126.773 147.964 1.00 65.86  ? -42 DG  I "C3'" 1 
ATOM 6712  O "O3'" . DG  I 5 32  ? 135.452 126.661 149.266 1.00 65.86  ? -42 DG  I "O3'" 1 
ATOM 6713  C "C2'" . DG  I 5 32  ? 133.778 125.818 147.744 1.00 65.86  ? -42 DG  I "C2'" 1 
ATOM 6714  C "C1'" . DG  I 5 32  ? 132.652 126.584 148.407 1.00 65.86  ? -42 DG  I "C1'" 1 
ATOM 6715  N N9    . DG  I 5 32  ? 131.344 126.209 147.915 1.00 65.86  ? -42 DG  I N9    1 
ATOM 6716  C C8    . DG  I 5 32  ? 131.022 125.878 146.632 1.00 65.86  ? -42 DG  I C8    1 
ATOM 6717  N N7    . DG  I 5 32  ? 129.769 125.591 146.469 1.00 65.86  ? -42 DG  I N7    1 
ATOM 6718  C C5    . DG  I 5 32  ? 129.225 125.738 147.727 1.00 65.86  ? -42 DG  I C5    1 
ATOM 6719  C C6    . DG  I 5 32  ? 127.899 125.564 148.162 1.00 65.86  ? -42 DG  I C6    1 
ATOM 6720  O O6    . DG  I 5 32  ? 126.918 125.224 147.499 1.00 65.86  ? -42 DG  I O6    1 
ATOM 6721  N N1    . DG  I 5 32  ? 127.764 125.813 149.519 1.00 65.86  ? -42 DG  I N1    1 
ATOM 6722  C C2    . DG  I 5 32  ? 128.784 126.190 150.352 1.00 65.86  ? -42 DG  I C2    1 
ATOM 6723  N N2    . DG  I 5 32  ? 128.451 126.393 151.633 1.00 65.86  ? -42 DG  I N2    1 
ATOM 6724  N N3    . DG  I 5 32  ? 130.039 126.366 149.955 1.00 65.86  ? -42 DG  I N3    1 
ATOM 6725  C C4    . DG  I 5 32  ? 130.181 126.123 148.631 1.00 65.86  ? -42 DG  I C4    1 
ATOM 6726  P P     . DA  I 5 33  ? 136.666 125.664 149.583 1.00 66.41  ? -41 DA  I P     1 
ATOM 6727  O OP1   . DA  I 5 33  ? 137.865 126.509 149.767 1.00 66.41  ? -41 DA  I OP1   1 
ATOM 6728  O OP2   . DA  I 5 33  ? 136.684 124.582 148.575 1.00 66.41  ? -41 DA  I OP2   1 
ATOM 6729  O "O5'" . DA  I 5 33  ? 136.237 125.016 150.975 1.00 66.41  ? -41 DA  I "O5'" 1 
ATOM 6730  C "C5'" . DA  I 5 33  ? 135.604 125.826 151.948 1.00 66.41  ? -41 DA  I "C5'" 1 
ATOM 6731  C "C4'" . DA  I 5 33  ? 134.538 125.053 152.696 1.00 66.41  ? -41 DA  I "C4'" 1 
ATOM 6732  O "O4'" . DA  I 5 33  ? 133.319 124.986 151.907 1.00 66.41  ? -41 DA  I "O4'" 1 
ATOM 6733  C "C3'" . DA  I 5 33  ? 134.896 123.600 153.034 1.00 66.41  ? -41 DA  I "C3'" 1 
ATOM 6734  O "O3'" . DA  I 5 33  ? 134.539 123.327 154.385 1.00 66.41  ? -41 DA  I "O3'" 1 
ATOM 6735  C "C2'" . DA  I 5 33  ? 134.023 122.813 152.065 1.00 66.41  ? -41 DA  I "C2'" 1 
ATOM 6736  C "C1'" . DA  I 5 33  ? 132.800 123.693 152.045 1.00 66.41  ? -41 DA  I "C1'" 1 
ATOM 6737  N N9    . DA  I 5 33  ? 131.904 123.407 150.946 1.00 66.41  ? -41 DA  I N9    1 
ATOM 6738  C C8    . DA  I 5 33  ? 132.231 123.298 149.630 1.00 66.41  ? -41 DA  I C8    1 
ATOM 6739  N N7    . DA  I 5 33  ? 131.217 123.018 148.858 1.00 66.41  ? -41 DA  I N7    1 
ATOM 6740  C C5    . DA  I 5 33  ? 130.151 122.932 149.734 1.00 66.41  ? -41 DA  I C5    1 
ATOM 6741  C C6    . DA  I 5 33  ? 128.795 122.643 149.540 1.00 66.41  ? -41 DA  I C6    1 
ATOM 6742  N N6    . DA  I 5 33  ? 128.275 122.399 148.340 1.00 66.41  ? -41 DA  I N6    1 
ATOM 6743  N N1    . DA  I 5 33  ? 127.990 122.617 150.624 1.00 66.41  ? -41 DA  I N1    1 
ATOM 6744  C C2    . DA  I 5 33  ? 128.518 122.867 151.826 1.00 66.41  ? -41 DA  I C2    1 
ATOM 6745  N N3    . DA  I 5 33  ? 129.787 123.139 152.133 1.00 66.41  ? -41 DA  I N3    1 
ATOM 6746  C C4    . DA  I 5 33  ? 130.556 123.156 151.027 1.00 66.41  ? -41 DA  I C4    1 
ATOM 6747  P P     . DC  I 5 34  ? 135.224 122.121 155.197 1.00 64.05  ? -40 DC  I P     1 
ATOM 6748  O OP1   . DC  I 5 34  ? 134.695 122.184 156.575 1.00 64.05  ? -40 DC  I OP1   1 
ATOM 6749  O OP2   . DC  I 5 34  ? 136.683 122.199 154.976 1.00 64.05  ? -40 DC  I OP2   1 
ATOM 6750  O "O5'" . DC  I 5 34  ? 134.673 120.799 154.479 1.00 64.05  ? -40 DC  I "O5'" 1 
ATOM 6751  C "C5'" . DC  I 5 34  ? 134.208 119.703 155.248 1.00 64.05  ? -40 DC  I "C5'" 1 
ATOM 6752  C "C4'" . DC  I 5 34  ? 132.701 119.755 155.405 1.00 64.05  ? -40 DC  I "C4'" 1 
ATOM 6753  O "O4'" . DC  I 5 34  ? 132.131 120.398 154.258 1.00 64.05  ? -40 DC  I "O4'" 1 
ATOM 6754  C "C3'" . DC  I 5 34  ? 132.023 118.399 155.493 1.00 64.05  ? -40 DC  I "C3'" 1 
ATOM 6755  O "O3'" . DC  I 5 34  ? 131.854 118.034 156.861 1.00 64.05  ? -40 DC  I "O3'" 1 
ATOM 6756  C "C2'" . DC  I 5 34  ? 130.670 118.615 154.817 1.00 64.05  ? -40 DC  I "C2'" 1 
ATOM 6757  C "C1'" . DC  I 5 34  ? 130.818 119.936 154.053 1.00 64.05  ? -40 DC  I "C1'" 1 
ATOM 6758  N N1    . DC  I 5 34  ? 130.611 119.831 152.574 1.00 64.05  ? -40 DC  I N1    1 
ATOM 6759  C C2    . DC  I 5 34  ? 129.338 119.569 152.032 1.00 64.05  ? -40 DC  I C2    1 
ATOM 6760  O O2    . DC  I 5 34  ? 128.366 119.411 152.776 1.00 64.05  ? -40 DC  I O2    1 
ATOM 6761  N N3    . DC  I 5 34  ? 129.210 119.502 150.686 1.00 64.05  ? -40 DC  I N3    1 
ATOM 6762  C C4    . DC  I 5 34  ? 130.274 119.675 149.901 1.00 64.05  ? -40 DC  I C4    1 
ATOM 6763  N N4    . DC  I 5 34  ? 130.098 119.603 148.582 1.00 64.05  ? -40 DC  I N4    1 
ATOM 6764  C C5    . DC  I 5 34  ? 131.561 119.952 150.430 1.00 64.05  ? -40 DC  I C5    1 
ATOM 6765  C C6    . DC  I 5 34  ? 131.679 120.028 151.754 1.00 64.05  ? -40 DC  I C6    1 
ATOM 6766  P P     . DT  I 5 35  ? 131.820 116.486 157.299 1.00 60.87  ? -39 DT  I P     1 
ATOM 6767  O OP1   . DT  I 5 35  ? 131.797 116.453 158.777 1.00 60.87  ? -39 DT  I OP1   1 
ATOM 6768  O OP2   . DT  I 5 35  ? 132.899 115.781 156.578 1.00 60.87  ? -39 DT  I OP2   1 
ATOM 6769  O "O5'" . DT  I 5 35  ? 130.415 115.947 156.748 1.00 60.87  ? -39 DT  I "O5'" 1 
ATOM 6770  C "C5'" . DT  I 5 35  ? 129.214 116.332 157.398 1.00 60.87  ? -39 DT  I "C5'" 1 
ATOM 6771  C "C4'" . DT  I 5 35  ? 127.986 115.828 156.656 1.00 60.87  ? -39 DT  I "C4'" 1 
ATOM 6772  O "O4'" . DT  I 5 35  ? 127.981 116.327 155.295 1.00 60.87  ? -39 DT  I "O4'" 1 
ATOM 6773  C "C3'" . DT  I 5 35  ? 127.850 114.308 156.548 1.00 60.87  ? -39 DT  I "C3'" 1 
ATOM 6774  O "O3'" . DT  I 5 35  ? 126.514 113.946 156.838 1.00 60.87  ? -39 DT  I "O3'" 1 
ATOM 6775  C "C2'" . DT  I 5 35  ? 128.186 114.042 155.085 1.00 60.87  ? -39 DT  I "C2'" 1 
ATOM 6776  C "C1'" . DT  I 5 35  ? 127.608 115.278 154.439 1.00 60.87  ? -39 DT  I "C1'" 1 
ATOM 6777  N N1    . DT  I 5 35  ? 128.163 115.544 153.118 1.00 60.87  ? -39 DT  I N1    1 
ATOM 6778  C C2    . DT  I 5 35  ? 127.355 115.467 152.022 1.00 60.87  ? -39 DT  I C2    1 
ATOM 6779  O O2    . DT  I 5 35  ? 126.178 115.187 152.085 1.00 60.87  ? -39 DT  I O2    1 
ATOM 6780  N N3    . DT  I 5 35  ? 127.974 115.733 150.842 1.00 60.87  ? -39 DT  I N3    1 
ATOM 6781  C C4    . DT  I 5 35  ? 129.297 116.062 150.661 1.00 60.87  ? -39 DT  I C4    1 
ATOM 6782  O O4    . DT  I 5 35  ? 129.770 116.289 149.564 1.00 60.87  ? -39 DT  I O4    1 
ATOM 6783  C C5    . DT  I 5 35  ? 130.084 116.122 151.855 1.00 60.87  ? -39 DT  I C5    1 
ATOM 6784  C C7    . DT  I 5 35  ? 131.537 116.465 151.783 1.00 60.87  ? -39 DT  I C7    1 
ATOM 6785  C C6    . DT  I 5 35  ? 129.487 115.853 153.009 1.00 60.87  ? -39 DT  I C6    1 
ATOM 6786  P P     . DA  I 5 36  ? 126.125 112.441 157.248 1.00 63.77  ? -38 DA  I P     1 
ATOM 6787  O OP1   . DA  I 5 36  ? 125.717 112.450 158.669 1.00 63.77  ? -38 DA  I OP1   1 
ATOM 6788  O OP2   . DA  I 5 36  ? 127.173 111.498 156.802 1.00 63.77  ? -38 DA  I OP2   1 
ATOM 6789  O "O5'" . DA  I 5 36  ? 124.827 112.164 156.372 1.00 63.77  ? -38 DA  I "O5'" 1 
ATOM 6790  C "C5'" . DA  I 5 36  ? 124.789 112.583 155.022 1.00 63.77  ? -38 DA  I "C5'" 1 
ATOM 6791  C "C4'" . DA  I 5 36  ? 123.945 111.632 154.210 1.00 63.77  ? -38 DA  I "C4'" 1 
ATOM 6792  O "O4'" . DA  I 5 36  ? 124.466 111.579 152.870 1.00 63.77  ? -38 DA  I "O4'" 1 
ATOM 6793  C "C3'" . DA  I 5 36  ? 124.017 110.201 154.676 1.00 63.77  ? -38 DA  I "C3'" 1 
ATOM 6794  O "O3'" . DA  I 5 36  ? 122.990 109.459 154.084 1.00 63.77  ? -38 DA  I "O3'" 1 
ATOM 6795  C "C2'" . DA  I 5 36  ? 125.365 109.795 154.121 1.00 63.77  ? -38 DA  I "C2'" 1 
ATOM 6796  C "C1'" . DA  I 5 36  ? 125.336 110.474 152.756 1.00 63.77  ? -38 DA  I "C1'" 1 
ATOM 6797  N N9    . DA  I 5 36  ? 126.633 110.967 152.340 1.00 63.77  ? -38 DA  I N9    1 
ATOM 6798  C C8    . DA  I 5 36  ? 127.758 111.073 153.104 1.00 63.77  ? -38 DA  I C8    1 
ATOM 6799  N N7    . DA  I 5 36  ? 128.789 111.556 152.460 1.00 63.77  ? -38 DA  I N7    1 
ATOM 6800  C C5    . DA  I 5 36  ? 128.302 111.783 151.188 1.00 63.77  ? -38 DA  I C5    1 
ATOM 6801  C C6    . DA  I 5 36  ? 128.894 112.296 150.029 1.00 63.77  ? -38 DA  I C6    1 
ATOM 6802  N N6    . DA  I 5 36  ? 130.171 112.679 149.964 1.00 63.77  ? -38 DA  I N6    1 
ATOM 6803  N N1    . DA  I 5 36  ? 128.126 112.390 148.927 1.00 63.77  ? -38 DA  I N1    1 
ATOM 6804  C C2    . DA  I 5 36  ? 126.850 112.004 148.990 1.00 63.77  ? -38 DA  I C2    1 
ATOM 6805  N N3    . DA  I 5 36  ? 126.184 111.509 150.025 1.00 63.77  ? -38 DA  I N3    1 
ATOM 6806  C C4    . DA  I 5 36  ? 126.975 111.425 151.100 1.00 63.77  ? -38 DA  I C4    1 
ATOM 6807  P P     . DG  I 5 37  ? 122.369 108.209 154.869 1.00 64.91  ? -37 DG  I P     1 
ATOM 6808  O OP1   . DG  I 5 37  ? 121.484 108.738 155.932 1.00 64.91  ? -37 DG  I OP1   1 
ATOM 6809  O OP2   . DG  I 5 37  ? 123.499 107.321 155.211 1.00 64.91  ? -37 DG  I OP2   1 
ATOM 6810  O "O5'" . DG  I 5 37  ? 121.501 107.448 153.765 1.00 64.91  ? -37 DG  I "O5'" 1 
ATOM 6811  C "C5'" . DG  I 5 37  ? 120.667 108.180 152.872 1.00 64.91  ? -37 DG  I "C5'" 1 
ATOM 6812  C "C4'" . DG  I 5 37  ? 121.016 107.893 151.422 1.00 64.91  ? -37 DG  I "C4'" 1 
ATOM 6813  O "O4'" . DG  I 5 37  ? 122.387 108.285 151.159 1.00 64.91  ? -37 DG  I "O4'" 1 
ATOM 6814  C "C3'" . DG  I 5 37  ? 120.911 106.433 150.985 1.00 64.91  ? -37 DG  I "C3'" 1 
ATOM 6815  O "O3'" . DG  I 5 37  ? 120.438 106.398 149.655 1.00 64.91  ? -37 DG  I "O3'" 1 
ATOM 6816  C "C2'" . DG  I 5 37  ? 122.359 105.977 151.055 1.00 64.91  ? -37 DG  I "C2'" 1 
ATOM 6817  C "C1'" . DG  I 5 37  ? 123.056 107.216 150.544 1.00 64.91  ? -37 DG  I "C1'" 1 
ATOM 6818  N N9    . DG  I 5 37  ? 124.454 107.292 150.904 1.00 64.91  ? -37 DG  I N9    1 
ATOM 6819  C C8    . DG  I 5 37  ? 125.006 106.977 152.109 1.00 64.91  ? -37 DG  I C8    1 
ATOM 6820  N N7    . DG  I 5 37  ? 126.296 107.150 152.150 1.00 64.91  ? -37 DG  I N7    1 
ATOM 6821  C C5    . DG  I 5 37  ? 126.616 107.608 150.887 1.00 64.91  ? -37 DG  I C5    1 
ATOM 6822  C C6    . DG  I 5 37  ? 127.867 107.964 150.340 1.00 64.91  ? -37 DG  I C6    1 
ATOM 6823  O O6    . DG  I 5 37  ? 128.976 107.942 150.884 1.00 64.91  ? -37 DG  I O6    1 
ATOM 6824  N N1    . DG  I 5 37  ? 127.750 108.376 149.024 1.00 64.91  ? -37 DG  I N1    1 
ATOM 6825  C C2    . DG  I 5 37  ? 126.572 108.435 148.323 1.00 64.91  ? -37 DG  I C2    1 
ATOM 6826  N N2    . DG  I 5 37  ? 126.656 108.858 147.058 1.00 64.91  ? -37 DG  I N2    1 
ATOM 6827  N N3    . DG  I 5 37  ? 125.392 108.103 148.825 1.00 64.91  ? -37 DG  I N3    1 
ATOM 6828  C C4    . DG  I 5 37  ? 125.491 107.701 150.106 1.00 64.91  ? -37 DG  I C4    1 
ATOM 6829  P P     . DG  I 5 38  ? 119.742 105.088 149.041 1.00 61.00  ? -36 DG  I P     1 
ATOM 6830  O OP1   . DG  I 5 38  ? 118.357 105.055 149.549 1.00 61.00  ? -36 DG  I OP1   1 
ATOM 6831  O OP2   . DG  I 5 38  ? 120.628 103.920 149.227 1.00 61.00  ? -36 DG  I OP2   1 
ATOM 6832  O "O5'" . DG  I 5 38  ? 119.707 105.405 147.477 1.00 61.00  ? -36 DG  I "O5'" 1 
ATOM 6833  C "C5'" . DG  I 5 38  ? 120.487 106.484 146.959 1.00 61.00  ? -36 DG  I "C5'" 1 
ATOM 6834  C "C4'" . DG  I 5 38  ? 121.463 106.007 145.899 1.00 61.00  ? -36 DG  I "C4'" 1 
ATOM 6835  O "O4'" . DG  I 5 38  ? 122.829 106.137 146.384 1.00 61.00  ? -36 DG  I "O4'" 1 
ATOM 6836  C "C3'" . DG  I 5 38  ? 121.318 104.551 145.488 1.00 61.00  ? -36 DG  I "C3'" 1 
ATOM 6837  O "O3'" . DG  I 5 38  ? 121.705 104.420 144.159 1.00 61.00  ? -36 DG  I "O3'" 1 
ATOM 6838  C "C2'" . DG  I 5 38  ? 122.343 103.876 146.382 1.00 61.00  ? -36 DG  I "C2'" 1 
ATOM 6839  C "C1'" . DG  I 5 38  ? 123.468 104.885 146.291 1.00 61.00  ? -36 DG  I "C1'" 1 
ATOM 6840  N N9    . DG  I 5 38  ? 124.432 104.771 147.373 1.00 61.00  ? -36 DG  I N9    1 
ATOM 6841  C C8    . DG  I 5 38  ? 124.176 104.372 148.655 1.00 61.00  ? -36 DG  I C8    1 
ATOM 6842  N N7    . DG  I 5 38  ? 125.225 104.365 149.421 1.00 61.00  ? -36 DG  I N7    1 
ATOM 6843  C C5    . DG  I 5 38  ? 126.251 104.769 148.589 1.00 61.00  ? -36 DG  I C5    1 
ATOM 6844  C C6    . DG  I 5 38  ? 127.620 104.940 148.864 1.00 61.00  ? -36 DG  I C6    1 
ATOM 6845  O O6    . DG  I 5 38  ? 128.214 104.766 149.933 1.00 61.00  ? -36 DG  I O6    1 
ATOM 6846  N N1    . DG  I 5 38  ? 128.316 105.371 147.745 1.00 61.00  ? -36 DG  I N1    1 
ATOM 6847  C C2    . DG  I 5 38  ? 127.755 105.606 146.516 1.00 61.00  ? -36 DG  I C2    1 
ATOM 6848  N N2    . DG  I 5 38  ? 128.586 106.028 145.556 1.00 61.00  ? -36 DG  I N2    1 
ATOM 6849  N N3    . DG  I 5 38  ? 126.470 105.442 146.242 1.00 61.00  ? -36 DG  I N3    1 
ATOM 6850  C C4    . DG  I 5 38  ? 125.781 105.024 147.321 1.00 61.00  ? -36 DG  I C4    1 
ATOM 6851  P P     . DG  I 5 39  ? 120.632 104.389 142.971 1.00 58.50  ? -35 DG  I P     1 
ATOM 6852  O OP1   . DG  I 5 39  ? 119.560 105.356 143.274 1.00 58.50  ? -35 DG  I OP1   1 
ATOM 6853  O OP2   . DG  I 5 39  ? 120.271 102.980 142.718 1.00 58.50  ? -35 DG  I OP2   1 
ATOM 6854  O "O5'" . DG  I 5 39  ? 121.490 104.928 141.740 1.00 58.50  ? -35 DG  I "O5'" 1 
ATOM 6855  C "C5'" . DG  I 5 39  ? 122.384 106.013 141.951 1.00 58.50  ? -35 DG  I "C5'" 1 
ATOM 6856  C "C4'" . DG  I 5 39  ? 123.644 105.879 141.112 1.00 58.50  ? -35 DG  I "C4'" 1 
ATOM 6857  O "O4'" . DG  I 5 39  ? 124.756 105.447 141.928 1.00 58.50  ? -35 DG  I "O4'" 1 
ATOM 6858  C "C3'" . DG  I 5 39  ? 123.568 104.918 139.946 1.00 58.50  ? -35 DG  I "C3'" 1 
ATOM 6859  O "O3'" . DG  I 5 39  ? 124.270 105.491 138.860 1.00 58.50  ? -35 DG  I "O3'" 1 
ATOM 6860  C "C2'" . DG  I 5 39  ? 124.229 103.643 140.485 1.00 58.50  ? -35 DG  I "C2'" 1 
ATOM 6861  C "C1'" . DG  I 5 39  ? 125.181 104.152 141.561 1.00 58.50  ? -35 DG  I "C1'" 1 
ATOM 6862  N N9    . DG  I 5 39  ? 125.180 103.343 142.776 1.00 58.50  ? -35 DG  I N9    1 
ATOM 6863  C C8    . DG  I 5 39  ? 124.104 102.717 143.342 1.00 58.50  ? -35 DG  I C8    1 
ATOM 6864  N N7    . DG  I 5 39  ? 124.387 102.092 144.446 1.00 58.50  ? -35 DG  I N7    1 
ATOM 6865  C C5    . DG  I 5 39  ? 125.737 102.329 144.636 1.00 58.50  ? -35 DG  I C5    1 
ATOM 6866  C C6    . DG  I 5 39  ? 126.594 101.917 145.681 1.00 58.50  ? -35 DG  I C6    1 
ATOM 6867  O O6    . DG  I 5 39  ? 126.326 101.210 146.660 1.00 58.50  ? -35 DG  I O6    1 
ATOM 6868  N N1    . DG  I 5 39  ? 127.896 102.360 145.486 1.00 58.50  ? -35 DG  I N1    1 
ATOM 6869  C C2    . DG  I 5 39  ? 128.307 103.126 144.428 1.00 58.50  ? -35 DG  I C2    1 
ATOM 6870  N N2    . DG  I 5 39  ? 129.604 103.475 144.412 1.00 58.50  ? -35 DG  I N2    1 
ATOM 6871  N N3    . DG  I 5 39  ? 127.508 103.539 143.454 1.00 58.50  ? -35 DG  I N3    1 
ATOM 6872  C C4    . DG  I 5 39  ? 126.241 103.104 143.622 1.00 58.50  ? -35 DG  I C4    1 
ATOM 6873  P P     . DA  I 5 40  ? 124.499 104.699 137.487 1.00 59.75  ? -34 DA  I P     1 
ATOM 6874  O OP1   . DA  I 5 40  ? 124.584 105.709 136.417 1.00 59.75  ? -34 DA  I OP1   1 
ATOM 6875  O OP2   . DA  I 5 40  ? 123.501 103.618 137.350 1.00 59.75  ? -34 DA  I OP2   1 
ATOM 6876  O "O5'" . DA  I 5 40  ? 125.960 104.106 137.676 1.00 59.75  ? -34 DA  I "O5'" 1 
ATOM 6877  C "C5'" . DA  I 5 40  ? 126.957 104.922 138.274 1.00 59.75  ? -34 DA  I "C5'" 1 
ATOM 6878  C "C4'" . DA  I 5 40  ? 128.186 104.118 138.639 1.00 59.75  ? -34 DA  I "C4'" 1 
ATOM 6879  O "O4'" . DA  I 5 40  ? 128.014 103.502 139.946 1.00 59.75  ? -34 DA  I "O4'" 1 
ATOM 6880  C "C3'" . DA  I 5 40  ? 128.518 102.976 137.679 1.00 59.75  ? -34 DA  I "C3'" 1 
ATOM 6881  O "O3'" . DA  I 5 40  ? 129.923 102.927 137.461 1.00 59.75  ? -34 DA  I "O3'" 1 
ATOM 6882  C "C2'" . DA  I 5 40  ? 128.044 101.761 138.458 1.00 59.75  ? -34 DA  I "C2'" 1 
ATOM 6883  C "C1'" . DA  I 5 40  ? 128.446 102.176 139.854 1.00 59.75  ? -34 DA  I "C1'" 1 
ATOM 6884  N N9    . DA  I 5 40  ? 127.819 101.389 140.900 1.00 59.75  ? -34 DA  I N9    1 
ATOM 6885  C C8    . DA  I 5 40  ? 126.521 100.995 140.953 1.00 59.75  ? -34 DA  I C8    1 
ATOM 6886  N N7    . DA  I 5 40  ? 126.229 100.285 142.008 1.00 59.75  ? -34 DA  I N7    1 
ATOM 6887  C C5    . DA  I 5 40  ? 127.424 100.186 142.679 1.00 59.75  ? -34 DA  I C5    1 
ATOM 6888  C C6    . DA  I 5 40  ? 127.774 99.545  143.860 1.00 59.75  ? -34 DA  I C6    1 
ATOM 6889  N N6    . DA  I 5 40  ? 126.894 98.877  144.599 1.00 59.75  ? -34 DA  I N6    1 
ATOM 6890  N N1    . DA  I 5 40  ? 129.047 99.644  144.280 1.00 59.75  ? -34 DA  I N1    1 
ATOM 6891  C C2    . DA  I 5 40  ? 129.918 100.323 143.531 1.00 59.75  ? -34 DA  I C2    1 
ATOM 6892  N N3    . DA  I 5 40  ? 129.701 100.967 142.387 1.00 59.75  ? -34 DA  I N3    1 
ATOM 6893  C C4    . DA  I 5 40  ? 128.420 100.852 142.012 1.00 59.75  ? -34 DA  I C4    1 
ATOM 6894  P P     . DG  I 5 41  ? 130.518 102.401 136.065 1.00 65.49  ? -33 DG  I P     1 
ATOM 6895  O OP1   . DG  I 5 41  ? 130.556 103.545 135.135 1.00 65.49  ? -33 DG  I OP1   1 
ATOM 6896  O OP2   . DG  I 5 41  ? 129.791 101.170 135.703 1.00 65.49  ? -33 DG  I OP2   1 
ATOM 6897  O "O5'" . DG  I 5 41  ? 132.018 101.986 136.415 1.00 65.49  ? -33 DG  I "O5'" 1 
ATOM 6898  C "C5'" . DG  I 5 41  ? 132.910 102.945 136.965 1.00 65.49  ? -33 DG  I "C5'" 1 
ATOM 6899  C "C4'" . DG  I 5 41  ? 133.865 102.317 137.976 1.00 65.49  ? -33 DG  I "C4'" 1 
ATOM 6900  O "O4'" . DG  I 5 41  ? 133.129 101.763 139.097 1.00 65.49  ? -33 DG  I "O4'" 1 
ATOM 6901  C "C3'" . DG  I 5 41  ? 134.747 101.194 137.456 1.00 65.49  ? -33 DG  I "C3'" 1 
ATOM 6902  O "O3'" . DG  I 5 41  ? 136.026 101.291 138.059 1.00 65.49  ? -33 DG  I "O3'" 1 
ATOM 6903  C "C2'" . DG  I 5 41  ? 134.007 99.935  137.905 1.00 65.49  ? -33 DG  I "C2'" 1 
ATOM 6904  C "C1'" . DG  I 5 41  ? 133.383 100.377 139.222 1.00 65.49  ? -33 DG  I "C1'" 1 
ATOM 6905  N N9    . DG  I 5 41  ? 132.107 99.733  139.512 1.00 65.49  ? -33 DG  I N9    1 
ATOM 6906  C C8    . DG  I 5 41  ? 130.953 99.869  138.800 1.00 65.49  ? -33 DG  I C8    1 
ATOM 6907  N N7    . DG  I 5 41  ? 129.960 99.192  139.286 1.00 65.49  ? -33 DG  I N7    1 
ATOM 6908  C C5    . DG  I 5 41  ? 130.476 98.589  140.403 1.00 65.49  ? -33 DG  I C5    1 
ATOM 6909  C C6    . DG  I 5 41  ? 129.851 97.740  141.331 1.00 65.49  ? -33 DG  I C6    1 
ATOM 6910  O O6    . DG  I 5 41  ? 128.679 97.352  141.345 1.00 65.49  ? -33 DG  I O6    1 
ATOM 6911  N N1    . DG  I 5 41  ? 130.722 97.337  142.322 1.00 65.49  ? -33 DG  I N1    1 
ATOM 6912  C C2    . DG  I 5 41  ? 132.040 97.708  142.401 1.00 65.49  ? -33 DG  I C2    1 
ATOM 6913  N N2    . DG  I 5 41  ? 132.732 97.216  143.436 1.00 65.49  ? -33 DG  I N2    1 
ATOM 6914  N N3    . DG  I 5 41  ? 132.639 98.510  141.532 1.00 65.49  ? -33 DG  I N3    1 
ATOM 6915  C C4    . DG  I 5 41  ? 131.798 98.911  140.565 1.00 65.49  ? -33 DG  I C4    1 
ATOM 6916  P P     . DT  I 5 42  ? 137.271 100.473 137.465 1.00 73.91  ? -32 DT  I P     1 
ATOM 6917  O OP1   . DT  I 5 42  ? 138.515 101.133 137.911 1.00 73.91  ? -32 DT  I OP1   1 
ATOM 6918  O OP2   . DT  I 5 42  ? 137.023 100.266 136.023 1.00 73.91  ? -32 DT  I OP2   1 
ATOM 6919  O "O5'" . DT  I 5 42  ? 137.186 99.078  138.228 1.00 73.91  ? -32 DT  I "O5'" 1 
ATOM 6920  C "C5'" . DT  I 5 42  ? 137.114 99.070  139.638 1.00 73.91  ? -32 DT  I "C5'" 1 
ATOM 6921  C "C4'" . DT  I 5 42  ? 136.912 97.665  140.156 1.00 73.91  ? -32 DT  I "C4'" 1 
ATOM 6922  O "O4'" . DT  I 5 42  ? 135.499 97.379  140.317 1.00 73.91  ? -32 DT  I "O4'" 1 
ATOM 6923  C "C3'" . DT  I 5 42  ? 137.466 96.556  139.264 1.00 73.91  ? -32 DT  I "C3'" 1 
ATOM 6924  O "O3'" . DT  I 5 42  ? 138.210 95.678  140.070 1.00 73.91  ? -32 DT  I "O3'" 1 
ATOM 6925  C "C2'" . DT  I 5 42  ? 136.198 95.884  138.727 1.00 73.91  ? -32 DT  I "C2'" 1 
ATOM 6926  C "C1'" . DT  I 5 42  ? 135.282 96.052  139.914 1.00 73.91  ? -32 DT  I "C1'" 1 
ATOM 6927  N N1    . DT  I 5 42  ? 133.855 95.886  139.602 1.00 73.91  ? -32 DT  I N1    1 
ATOM 6928  C C2    . DT  I 5 42  ? 133.059 95.150  140.445 1.00 73.91  ? -32 DT  I C2    1 
ATOM 6929  O O2    . DT  I 5 42  ? 133.471 94.613  141.453 1.00 73.91  ? -32 DT  I O2    1 
ATOM 6930  N N3    . DT  I 5 42  ? 131.753 95.073  140.068 1.00 73.91  ? -32 DT  I N3    1 
ATOM 6931  C C4    . DT  I 5 42  ? 131.181 95.642  138.953 1.00 73.91  ? -32 DT  I C4    1 
ATOM 6932  O O4    . DT  I 5 42  ? 129.995 95.524  138.691 1.00 73.91  ? -32 DT  I O4    1 
ATOM 6933  C C5    . DT  I 5 42  ? 132.070 96.395  138.119 1.00 73.91  ? -32 DT  I C5    1 
ATOM 6934  C C7    . DT  I 5 42  ? 131.555 97.051  136.873 1.00 73.91  ? -32 DT  I C7    1 
ATOM 6935  C C6    . DT  I 5 42  ? 133.350 96.477  138.479 1.00 73.91  ? -32 DT  I C6    1 
ATOM 6936  P P     . DA  I 5 43  ? 139.274 94.661  139.436 1.00 85.13  ? -31 DA  I P     1 
ATOM 6937  O OP1   . DA  I 5 43  ? 140.603 95.132  139.879 1.00 85.13  ? -31 DA  I OP1   1 
ATOM 6938  O OP2   . DA  I 5 43  ? 139.008 94.466  137.995 1.00 85.13  ? -31 DA  I OP2   1 
ATOM 6939  O "O5'" . DA  I 5 43  ? 138.926 93.292  140.174 1.00 85.13  ? -31 DA  I "O5'" 1 
ATOM 6940  C "C5'" . DA  I 5 43  ? 137.616 93.086  140.665 1.00 85.13  ? -31 DA  I "C5'" 1 
ATOM 6941  C "C4'" . DA  I 5 43  ? 137.535 91.793  141.435 1.00 85.13  ? -31 DA  I "C4'" 1 
ATOM 6942  O "O4'" . DA  I 5 43  ? 136.148 91.421  141.601 1.00 85.13  ? -31 DA  I "O4'" 1 
ATOM 6943  C "C3'" . DA  I 5 43  ? 138.162 90.616  140.738 1.00 85.13  ? -31 DA  I "C3'" 1 
ATOM 6944  O "O3'" . DA  I 5 43  ? 138.483 89.628  141.689 1.00 85.13  ? -31 DA  I "O3'" 1 
ATOM 6945  C "C2'" . DA  I 5 43  ? 137.040 90.167  139.806 1.00 85.13  ? -31 DA  I "C2'" 1 
ATOM 6946  C "C1'" . DA  I 5 43  ? 135.784 90.464  140.626 1.00 85.13  ? -31 DA  I "C1'" 1 
ATOM 6947  N N9    . DA  I 5 43  ? 134.689 91.024  139.841 1.00 85.13  ? -31 DA  I N9    1 
ATOM 6948  C C8    . DA  I 5 43  ? 134.778 92.007  138.906 1.00 85.13  ? -31 DA  I C8    1 
ATOM 6949  N N7    . DA  I 5 43  ? 133.632 92.332  138.369 1.00 85.13  ? -31 DA  I N7    1 
ATOM 6950  C C5    . DA  I 5 43  ? 132.725 91.499  138.986 1.00 85.13  ? -31 DA  I C5    1 
ATOM 6951  C C6    . DA  I 5 43  ? 131.332 91.353  138.856 1.00 85.13  ? -31 DA  I C6    1 
ATOM 6952  N N6    . DA  I 5 43  ? 130.601 92.071  138.007 1.00 85.13  ? -31 DA  I N6    1 
ATOM 6953  N N1    . DA  I 5 43  ? 130.718 90.431  139.626 1.00 85.13  ? -31 DA  I N1    1 
ATOM 6954  C C2    . DA  I 5 43  ? 131.457 89.716  140.478 1.00 85.13  ? -31 DA  I C2    1 
ATOM 6955  N N3    . DA  I 5 43  ? 132.777 89.764  140.685 1.00 85.13  ? -31 DA  I N3    1 
ATOM 6956  C C4    . DA  I 5 43  ? 133.354 90.690  139.905 1.00 85.13  ? -31 DA  I C4    1 
ATOM 6957  P P     . DA  I 5 44  ? 139.308 88.328  141.250 1.00 87.88  ? -30 DA  I P     1 
ATOM 6958  O OP1   . DA  I 5 44  ? 140.080 87.867  142.424 1.00 87.88  ? -30 DA  I OP1   1 
ATOM 6959  O OP2   . DA  I 5 44  ? 140.006 88.653  139.988 1.00 87.88  ? -30 DA  I OP2   1 
ATOM 6960  O "O5'" . DA  I 5 44  ? 138.169 87.254  140.950 1.00 87.88  ? -30 DA  I "O5'" 1 
ATOM 6961  C "C5'" . DA  I 5 44  ? 137.296 86.872  141.986 1.00 87.88  ? -30 DA  I "C5'" 1 
ATOM 6962  C "C4'" . DA  I 5 44  ? 136.059 86.197  141.437 1.00 87.88  ? -30 DA  I "C4'" 1 
ATOM 6963  O "O4'" . DA  I 5 44  ? 135.286 87.137  140.683 1.00 87.88  ? -30 DA  I "O4'" 1 
ATOM 6964  C "C3'" . DA  I 5 44  ? 136.314 85.021  140.488 1.00 87.88  ? -30 DA  I "C3'" 1 
ATOM 6965  O "O3'" . DA  I 5 44  ? 135.971 83.803  141.148 1.00 87.88  ? -30 DA  I "O3'" 1 
ATOM 6966  C "C2'" . DA  I 5 44  ? 135.400 85.303  139.279 1.00 87.88  ? -30 DA  I "C2'" 1 
ATOM 6967  C "C1'" . DA  I 5 44  ? 134.496 86.408  139.795 1.00 87.88  ? -30 DA  I "C1'" 1 
ATOM 6968  N N9    . DA  I 5 44  ? 134.025 87.316  138.768 1.00 87.88  ? -30 DA  I N9    1 
ATOM 6969  C C8    . DA  I 5 44  ? 134.767 88.211  138.063 1.00 87.88  ? -30 DA  I C8    1 
ATOM 6970  N N7    . DA  I 5 44  ? 134.072 88.914  137.208 1.00 87.88  ? -30 DA  I N7    1 
ATOM 6971  C C5    . DA  I 5 44  ? 132.784 88.457  137.376 1.00 87.88  ? -30 DA  I C5    1 
ATOM 6972  C C6    . DA  I 5 44  ? 131.573 88.800  136.760 1.00 87.88  ? -30 DA  I C6    1 
ATOM 6973  N N6    . DA  I 5 44  ? 131.474 89.735  135.816 1.00 87.88  ? -30 DA  I N6    1 
ATOM 6974  N N1    . DA  I 5 44  ? 130.459 88.155  137.158 1.00 87.88  ? -30 DA  I N1    1 
ATOM 6975  C C2    . DA  I 5 44  ? 130.564 87.222  138.110 1.00 87.88  ? -30 DA  I C2    1 
ATOM 6976  N N3    . DA  I 5 44  ? 131.653 86.808  138.755 1.00 87.88  ? -30 DA  I N3    1 
ATOM 6977  C C4    . DA  I 5 44  ? 132.737 87.471  138.334 1.00 87.88  ? -30 DA  I C4    1 
ATOM 6978  P P     . DT  I 5 45  ? 136.138 82.381  140.418 1.00 90.01  ? -29 DT  I P     1 
ATOM 6979  O OP1   . DT  I 5 45  ? 136.398 81.384  141.476 1.00 90.01  ? -29 DT  I OP1   1 
ATOM 6980  O OP2   . DT  I 5 45  ? 137.086 82.513  139.292 1.00 90.01  ? -29 DT  I OP2   1 
ATOM 6981  O "O5'" . DT  I 5 45  ? 134.685 82.097  139.830 1.00 90.01  ? -29 DT  I "O5'" 1 
ATOM 6982  C "C5'" . DT  I 5 45  ? 133.559 82.287  140.663 1.00 90.01  ? -29 DT  I "C5'" 1 
ATOM 6983  C "C4'" . DT  I 5 45  ? 132.257 82.138  139.895 1.00 90.01  ? -29 DT  I "C4'" 1 
ATOM 6984  O "O4'" . DT  I 5 45  ? 132.006 83.316  139.080 1.00 90.01  ? -29 DT  I "O4'" 1 
ATOM 6985  C "C3'" . DT  I 5 45  ? 132.180 80.946  138.936 1.00 90.01  ? -29 DT  I "C3'" 1 
ATOM 6986  O "O3'" . DT  I 5 45  ? 130.890 80.391  139.029 1.00 90.01  ? -29 DT  I "O3'" 1 
ATOM 6987  C "C2'" . DT  I 5 45  ? 132.380 81.620  137.588 1.00 90.01  ? -29 DT  I "C2'" 1 
ATOM 6988  C "C1'" . DT  I 5 45  ? 131.579 82.878  137.818 1.00 90.01  ? -29 DT  I "C1'" 1 
ATOM 6989  N N1    . DT  I 5 45  ? 131.820 83.942  136.830 1.00 90.01  ? -29 DT  I N1    1 
ATOM 6990  C C2    . DT  I 5 45  ? 130.756 84.461  136.130 1.00 90.01  ? -29 DT  I C2    1 
ATOM 6991  O O2    . DT  I 5 45  ? 129.613 84.081  136.276 1.00 90.01  ? -29 DT  I O2    1 
ATOM 6992  N N3    . DT  I 5 45  ? 131.083 85.440  135.242 1.00 90.01  ? -29 DT  I N3    1 
ATOM 6993  C C4    . DT  I 5 45  ? 132.336 85.942  134.994 1.00 90.01  ? -29 DT  I C4    1 
ATOM 6994  O O4    . DT  I 5 45  ? 132.533 86.825  134.176 1.00 90.01  ? -29 DT  I O4    1 
ATOM 6995  C C5    . DT  I 5 45  ? 133.403 85.355  135.760 1.00 90.01  ? -29 DT  I C5    1 
ATOM 6996  C C7    . DT  I 5 45  ? 134.811 85.818  135.564 1.00 90.01  ? -29 DT  I C7    1 
ATOM 6997  C C6    . DT  I 5 45  ? 133.097 84.393  136.631 1.00 90.01  ? -29 DT  I C6    1 
ATOM 6998  P P     . DC  I 5 46  ? 130.564 78.903  138.522 1.00 86.26  ? -28 DC  I P     1 
ATOM 6999  O OP1   . DC  I 5 46  ? 130.844 77.976  139.637 1.00 86.26  ? -28 DC  I OP1   1 
ATOM 7000  O OP2   . DC  I 5 46  ? 131.165 78.670  137.191 1.00 86.26  ? -28 DC  I OP2   1 
ATOM 7001  O "O5'" . DC  I 5 46  ? 128.991 78.967  138.307 1.00 86.26  ? -28 DC  I "O5'" 1 
ATOM 7002  C "C5'" . DC  I 5 46  ? 128.387 80.229  138.051 1.00 86.26  ? -28 DC  I "C5'" 1 
ATOM 7003  C "C4'" . DC  I 5 46  ? 127.263 80.099  137.048 1.00 86.26  ? -28 DC  I "C4'" 1 
ATOM 7004  O "O4'" . DC  I 5 46  ? 127.426 81.097  136.006 1.00 86.26  ? -28 DC  I "O4'" 1 
ATOM 7005  C "C3'" . DC  I 5 46  ? 127.212 78.774  136.319 1.00 86.26  ? -28 DC  I "C3'" 1 
ATOM 7006  O "O3'" . DC  I 5 46  ? 125.887 78.530  135.895 1.00 86.26  ? -28 DC  I "O3'" 1 
ATOM 7007  C "C2'" . DC  I 5 46  ? 128.153 79.028  135.143 1.00 86.26  ? -28 DC  I "C2'" 1 
ATOM 7008  C "C1'" . DC  I 5 46  ? 127.833 80.478  134.796 1.00 86.26  ? -28 DC  I "C1'" 1 
ATOM 7009  N N1    . DC  I 5 46  ? 128.993 81.251  134.256 1.00 86.26  ? -28 DC  I N1    1 
ATOM 7010  C C2    . DC  I 5 46  ? 128.776 82.236  133.293 1.00 86.26  ? -28 DC  I C2    1 
ATOM 7011  O O2    . DC  I 5 46  ? 127.628 82.437  132.892 1.00 86.26  ? -28 DC  I O2    1 
ATOM 7012  N N3    . DC  I 5 46  ? 129.831 82.942  132.825 1.00 86.26  ? -28 DC  I N3    1 
ATOM 7013  C C4    . DC  I 5 46  ? 131.050 82.693  133.287 1.00 86.26  ? -28 DC  I C4    1 
ATOM 7014  N N4    . DC  I 5 46  ? 132.066 83.411  132.801 1.00 86.26  ? -28 DC  I N4    1 
ATOM 7015  C C5    . DC  I 5 46  ? 131.288 81.692  134.262 1.00 86.26  ? -28 DC  I C5    1 
ATOM 7016  C C6    . DC  I 5 46  ? 130.242 81.012  134.727 1.00 86.26  ? -28 DC  I C6    1 
ATOM 7017  P P     . DC  I 5 47  ? 125.469 77.105  135.289 1.00 74.41  ? -27 DC  I P     1 
ATOM 7018  O OP1   . DC  I 5 47  ? 124.145 76.762  135.846 1.00 74.41  ? -27 DC  I OP1   1 
ATOM 7019  O OP2   . DC  I 5 47  ? 126.600 76.166  135.443 1.00 74.41  ? -27 DC  I OP2   1 
ATOM 7020  O "O5'" . DC  I 5 47  ? 125.308 77.408  133.735 1.00 74.41  ? -27 DC  I "O5'" 1 
ATOM 7021  C "C5'" . DC  I 5 47  ? 124.656 78.594  133.321 1.00 74.41  ? -27 DC  I "C5'" 1 
ATOM 7022  C "C4'" . DC  I 5 47  ? 124.968 78.924  131.872 1.00 74.41  ? -27 DC  I "C4'" 1 
ATOM 7023  O "O4'" . DC  I 5 47  ? 126.238 79.612  131.781 1.00 74.41  ? -27 DC  I "O4'" 1 
ATOM 7024  C "C3'" . DC  I 5 47  ? 125.069 77.726  130.918 1.00 74.41  ? -27 DC  I "C3'" 1 
ATOM 7025  O "O3'" . DC  I 5 47  ? 124.465 78.058  129.672 1.00 74.41  ? -27 DC  I "O3'" 1 
ATOM 7026  C "C2'" . DC  I 5 47  ? 126.576 77.586  130.755 1.00 74.41  ? -27 DC  I "C2'" 1 
ATOM 7027  C "C1'" . DC  I 5 47  ? 126.956 79.049  130.721 1.00 74.41  ? -27 DC  I "C1'" 1 
ATOM 7028  N N1    . DC  I 5 47  ? 128.387 79.328  130.929 1.00 74.41  ? -27 DC  I N1    1 
ATOM 7029  C C2    . DC  I 5 47  ? 128.978 80.385  130.243 1.00 74.41  ? -27 DC  I C2    1 
ATOM 7030  O O2    . DC  I 5 47  ? 128.288 81.049  129.466 1.00 74.41  ? -27 DC  I O2    1 
ATOM 7031  N N3    . DC  I 5 47  ? 130.287 80.648  130.445 1.00 74.41  ? -27 DC  I N3    1 
ATOM 7032  C C4    . DC  I 5 47  ? 130.987 79.903  131.296 1.00 74.41  ? -27 DC  I C4    1 
ATOM 7033  N N4    . DC  I 5 47  ? 132.278 80.195  131.466 1.00 74.41  ? -27 DC  I N4    1 
ATOM 7034  C C5    . DC  I 5 47  ? 130.399 78.823  132.006 1.00 74.41  ? -27 DC  I C5    1 
ATOM 7035  C C6    . DC  I 5 47  ? 129.107 78.575  131.792 1.00 74.41  ? -27 DC  I C6    1 
ATOM 7036  P P     . DC  I 5 48  ? 122.885 77.879  129.433 1.00 60.87  ? -26 DC  I P     1 
ATOM 7037  O OP1   . DC  I 5 48  ? 122.202 77.601  130.713 1.00 60.87  ? -26 DC  I OP1   1 
ATOM 7038  O OP2   . DC  I 5 48  ? 122.733 76.930  128.316 1.00 60.87  ? -26 DC  I OP2   1 
ATOM 7039  O "O5'" . DC  I 5 48  ? 122.425 79.308  128.878 1.00 60.87  ? -26 DC  I "O5'" 1 
ATOM 7040  C "C5'" . DC  I 5 48  ? 123.337 80.413  128.915 1.00 60.87  ? -26 DC  I "C5'" 1 
ATOM 7041  C "C4'" . DC  I 5 48  ? 123.663 80.928  127.524 1.00 60.87  ? -26 DC  I "C4'" 1 
ATOM 7042  O "O4'" . DC  I 5 48  ? 125.106 80.963  127.348 1.00 60.87  ? -26 DC  I "O4'" 1 
ATOM 7043  C "C3'" . DC  I 5 48  ? 123.163 80.067  126.377 1.00 60.87  ? -26 DC  I "C3'" 1 
ATOM 7044  O "O3'" . DC  I 5 48  ? 123.106 80.854  125.186 1.00 60.87  ? -26 DC  I "O3'" 1 
ATOM 7045  C "C2'" . DC  I 5 48  ? 124.300 79.071  126.284 1.00 60.87  ? -26 DC  I "C2'" 1 
ATOM 7046  C "C1'" . DC  I 5 48  ? 125.463 80.042  126.336 1.00 60.87  ? -26 DC  I "C1'" 1 
ATOM 7047  N N1    . DC  I 5 48  ? 126.768 79.441  126.695 1.00 60.87  ? -26 DC  I N1    1 
ATOM 7048  C C2    . DC  I 5 48  ? 127.928 80.192  126.527 1.00 60.87  ? -26 DC  I C2    1 
ATOM 7049  O O2    . DC  I 5 48  ? 127.850 81.332  126.065 1.00 60.87  ? -26 DC  I O2    1 
ATOM 7050  N N3    . DC  I 5 48  ? 129.113 79.655  126.874 1.00 60.87  ? -26 DC  I N3    1 
ATOM 7051  C C4    . DC  I 5 48  ? 129.171 78.427  127.366 1.00 60.87  ? -26 DC  I C4    1 
ATOM 7052  N N4    . DC  I 5 48  ? 130.374 77.954  127.700 1.00 60.87  ? -26 DC  I N4    1 
ATOM 7053  C C5    . DC  I 5 48  ? 128.003 77.636  127.541 1.00 60.87  ? -26 DC  I C5    1 
ATOM 7054  C C6    . DC  I 5 48  ? 126.829 78.181  127.202 1.00 60.87  ? -26 DC  I C6    1 
ATOM 7055  P P     . DC  I 5 49  ? 121.758 81.603  124.732 1.00 52.34  ? -25 DC  I P     1 
ATOM 7056  O OP1   . DC  I 5 49  ? 120.991 82.007  125.924 1.00 52.34  ? -25 DC  I OP1   1 
ATOM 7057  O OP2   . DC  I 5 49  ? 121.114 80.786  123.690 1.00 52.34  ? -25 DC  I OP2   1 
ATOM 7058  O "O5'" . DC  I 5 49  ? 122.293 82.916  124.006 1.00 52.34  ? -25 DC  I "O5'" 1 
ATOM 7059  C "C5'" . DC  I 5 49  ? 123.497 83.514  124.455 1.00 52.34  ? -25 DC  I "C5'" 1 
ATOM 7060  C "C4'" . DC  I 5 49  ? 124.570 83.480  123.379 1.00 52.34  ? -25 DC  I "C4'" 1 
ATOM 7061  O "O4'" . DC  I 5 49  ? 125.542 82.424  123.657 1.00 52.34  ? -25 DC  I "O4'" 1 
ATOM 7062  C "C3'" . DC  I 5 49  ? 124.067 83.206  121.965 1.00 52.34  ? -25 DC  I "C3'" 1 
ATOM 7063  O "O3'" . DC  I 5 49  ? 124.858 83.938  121.047 1.00 52.34  ? -25 DC  I "O3'" 1 
ATOM 7064  C "C2'" . DC  I 5 49  ? 124.337 81.719  121.838 1.00 52.34  ? -25 DC  I "C2'" 1 
ATOM 7065  C "C1'" . DC  I 5 49  ? 125.701 81.656  122.487 1.00 52.34  ? -25 DC  I "C1'" 1 
ATOM 7066  N N1    . DC  I 5 49  ? 126.155 80.286  122.865 1.00 52.34  ? -25 DC  I N1    1 
ATOM 7067  C C2    . DC  I 5 49  ? 127.492 80.074  123.190 1.00 52.34  ? -25 DC  I C2    1 
ATOM 7068  O O2    . DC  I 5 49  ? 128.273 81.018  123.148 1.00 52.34  ? -25 DC  I O2    1 
ATOM 7069  N N3    . DC  I 5 49  ? 127.896 78.837  123.547 1.00 52.34  ? -25 DC  I N3    1 
ATOM 7070  C C4    . DC  I 5 49  ? 127.027 77.839  123.582 1.00 52.34  ? -25 DC  I C4    1 
ATOM 7071  N N4    . DC  I 5 49  ? 127.475 76.631  123.938 1.00 52.34  ? -25 DC  I N4    1 
ATOM 7072  C C5    . DC  I 5 49  ? 125.660 78.026  123.239 1.00 52.34  ? -25 DC  I C5    1 
ATOM 7073  C C6    . DC  I 5 49  ? 125.269 79.255  122.890 1.00 52.34  ? -25 DC  I C6    1 
ATOM 7074  P P     . DT  I 5 50  ? 124.293 84.341  119.600 1.00 46.45  ? -24 DT  I P     1 
ATOM 7075  O OP1   . DT  I 5 50  ? 123.461 85.545  119.786 1.00 46.45  ? -24 DT  I OP1   1 
ATOM 7076  O OP2   . DT  I 5 50  ? 123.729 83.140  118.954 1.00 46.45  ? -24 DT  I OP2   1 
ATOM 7077  O "O5'" . DT  I 5 50  ? 125.609 84.748  118.791 1.00 46.45  ? -24 DT  I "O5'" 1 
ATOM 7078  C "C5'" . DT  I 5 50  ? 126.476 85.738  119.318 1.00 46.45  ? -24 DT  I "C5'" 1 
ATOM 7079  C "C4'" . DT  I 5 50  ? 127.925 85.350  119.115 1.00 46.45  ? -24 DT  I "C4'" 1 
ATOM 7080  O "O4'" . DT  I 5 50  ? 128.194 84.111  119.820 1.00 46.45  ? -24 DT  I "O4'" 1 
ATOM 7081  C "C3'" . DT  I 5 50  ? 128.314 85.107  117.661 1.00 46.45  ? -24 DT  I "C3'" 1 
ATOM 7082  O "O3'" . DT  I 5 50  ? 129.452 85.861  117.313 1.00 46.45  ? -24 DT  I "O3'" 1 
ATOM 7083  C "C2'" . DT  I 5 50  ? 128.606 83.618  117.601 1.00 46.45  ? -24 DT  I "C2'" 1 
ATOM 7084  C "C1'" . DT  I 5 50  ? 129.011 83.296  119.023 1.00 46.45  ? -24 DT  I "C1'" 1 
ATOM 7085  N N1    . DT  I 5 50  ? 128.759 81.856  119.376 1.00 46.45  ? -24 DT  I N1    1 
ATOM 7086  C C2    . DT  I 5 50  ? 129.802 81.041  119.770 1.00 46.45  ? -24 DT  I C2    1 
ATOM 7087  O O2    . DT  I 5 50  ? 130.945 81.424  119.884 1.00 46.45  ? -24 DT  I O2    1 
ATOM 7088  N N3    . DT  I 5 50  ? 129.440 79.755  120.050 1.00 46.45  ? -24 DT  I N3    1 
ATOM 7089  C C4    . DT  I 5 50  ? 128.188 79.209  119.961 1.00 46.45  ? -24 DT  I C4    1 
ATOM 7090  O O4    . DT  I 5 50  ? 127.955 78.045  120.229 1.00 46.45  ? -24 DT  I O4    1 
ATOM 7091  C C5    . DT  I 5 50  ? 127.157 80.099  119.531 1.00 46.45  ? -24 DT  I C5    1 
ATOM 7092  C C7    . DT  I 5 50  ? 125.762 79.589  119.377 1.00 46.45  ? -24 DT  I C7    1 
ATOM 7093  C C6    . DT  I 5 50  ? 127.480 81.370  119.281 1.00 46.45  ? -24 DT  I C6    1 
ATOM 7094  P P     . DT  I 5 51  ? 129.930 85.921  115.780 1.00 55.97  ? -23 DT  I P     1 
ATOM 7095  O OP1   . DT  I 5 51  ? 130.600 87.213  115.563 1.00 55.97  ? -23 DT  I OP1   1 
ATOM 7096  O OP2   . DT  I 5 51  ? 128.802 85.524  114.919 1.00 55.97  ? -23 DT  I OP2   1 
ATOM 7097  O "O5'" . DT  I 5 51  ? 131.034 84.785  115.676 1.00 55.97  ? -23 DT  I "O5'" 1 
ATOM 7098  C "C5'" . DT  I 5 51  ? 132.257 84.964  116.326 1.00 55.97  ? -23 DT  I "C5'" 1 
ATOM 7099  C "C4'" . DT  I 5 51  ? 133.036 83.673  116.362 1.00 55.97  ? -23 DT  I "C4'" 1 
ATOM 7100  O "O4'" . DT  I 5 51  ? 132.210 82.621  116.911 1.00 55.97  ? -23 DT  I "O4'" 1 
ATOM 7101  C "C3'" . DT  I 5 51  ? 133.504 83.165  114.997 1.00 55.97  ? -23 DT  I "C3'" 1 
ATOM 7102  O "O3'" . DT  I 5 51  ? 134.891 82.906  115.041 1.00 55.97  ? -23 DT  I "O3'" 1 
ATOM 7103  C "C2'" . DT  I 5 51  ? 132.703 81.878  114.800 1.00 55.97  ? -23 DT  I "C2'" 1 
ATOM 7104  C "C1'" . DT  I 5 51  ? 132.525 81.445  116.232 1.00 55.97  ? -23 DT  I "C1'" 1 
ATOM 7105  N N1    . DT  I 5 51  ? 131.453 80.474  116.439 1.00 55.97  ? -23 DT  I N1    1 
ATOM 7106  C C2    . DT  I 5 51  ? 131.773 79.249  116.933 1.00 55.97  ? -23 DT  I C2    1 
ATOM 7107  O O2    . DT  I 5 51  ? 132.914 78.910  117.178 1.00 55.97  ? -23 DT  I O2    1 
ATOM 7108  N N3    . DT  I 5 51  ? 130.716 78.402  117.091 1.00 55.97  ? -23 DT  I N3    1 
ATOM 7109  C C4    . DT  I 5 51  ? 129.393 78.669  116.836 1.00 55.97  ? -23 DT  I C4    1 
ATOM 7110  O O4    . DT  I 5 51  ? 128.512 77.842  117.021 1.00 55.97  ? -23 DT  I O4    1 
ATOM 7111  C C5    . DT  I 5 51  ? 129.120 79.987  116.334 1.00 55.97  ? -23 DT  I C5    1 
ATOM 7112  C C7    . DT  I 5 51  ? 127.715 80.381  115.992 1.00 55.97  ? -23 DT  I C7    1 
ATOM 7113  C C6    . DT  I 5 51  ? 130.157 80.817  116.156 1.00 55.97  ? -23 DT  I C6    1 
ATOM 7114  P P     . DG  I 5 52  ? 135.739 82.841  113.682 1.00 62.03  ? -22 DG  I P     1 
ATOM 7115  O OP1   . DG  I 5 52  ? 137.057 83.453  113.944 1.00 62.03  ? -22 DG  I OP1   1 
ATOM 7116  O OP2   . DG  I 5 52  ? 134.870 83.355  112.606 1.00 62.03  ? -22 DG  I OP2   1 
ATOM 7117  O "O5'" . DG  I 5 52  ? 135.949 81.279  113.434 1.00 62.03  ? -22 DG  I "O5'" 1 
ATOM 7118  C "C5'" . DG  I 5 52  ? 136.671 80.505  114.381 1.00 62.03  ? -22 DG  I "C5'" 1 
ATOM 7119  C "C4'" . DG  I 5 52  ? 136.623 79.027  114.031 1.00 62.03  ? -22 DG  I "C4'" 1 
ATOM 7120  O "O4'" . DG  I 5 52  ? 135.422 78.428  114.582 1.00 62.03  ? -22 DG  I "O4'" 1 
ATOM 7121  C "C3'" . DG  I 5 52  ? 136.598 78.713  112.534 1.00 62.03  ? -22 DG  I "C3'" 1 
ATOM 7122  O "O3'" . DG  I 5 52  ? 137.468 77.632  112.261 1.00 62.03  ? -22 DG  I "O3'" 1 
ATOM 7123  C "C2'" . DG  I 5 52  ? 135.146 78.319  112.295 1.00 62.03  ? -22 DG  I "C2'" 1 
ATOM 7124  C "C1'" . DG  I 5 52  ? 134.839 77.617  113.597 1.00 62.03  ? -22 DG  I "C1'" 1 
ATOM 7125  N N9    . DG  I 5 52  ? 133.416 77.479  113.875 1.00 62.03  ? -22 DG  I N9    1 
ATOM 7126  C C8    . DG  I 5 52  ? 132.456 78.452  113.814 1.00 62.03  ? -22 DG  I C8    1 
ATOM 7127  N N7    . DG  I 5 52  ? 131.265 78.022  114.119 1.00 62.03  ? -22 DG  I N7    1 
ATOM 7128  C C5    . DG  I 5 52  ? 131.454 76.681  114.404 1.00 62.03  ? -22 DG  I C5    1 
ATOM 7129  C C6    . DG  I 5 52  ? 130.527 75.692  114.797 1.00 62.03  ? -22 DG  I C6    1 
ATOM 7130  O O6    . DG  I 5 52  ? 129.310 75.803  114.987 1.00 62.03  ? -22 DG  I O6    1 
ATOM 7131  N N1    . DG  I 5 52  ? 131.141 74.456  114.974 1.00 62.03  ? -22 DG  I N1    1 
ATOM 7132  C C2    . DG  I 5 52  ? 132.478 74.217  114.796 1.00 62.03  ? -22 DG  I C2    1 
ATOM 7133  N N2    . DG  I 5 52  ? 132.897 72.964  115.013 1.00 62.03  ? -22 DG  I N2    1 
ATOM 7134  N N3    . DG  I 5 52  ? 133.350 75.134  114.426 1.00 62.03  ? -22 DG  I N3    1 
ATOM 7135  C C4    . DG  I 5 52  ? 132.772 76.337  114.259 1.00 62.03  ? -22 DG  I C4    1 
ATOM 7136  P P     . DG  I 5 53  ? 138.242 77.546  110.856 1.00 69.68  ? -21 DG  I P     1 
ATOM 7137  O OP1   . DG  I 5 53  ? 139.576 78.160  111.030 1.00 69.68  ? -21 DG  I OP1   1 
ATOM 7138  O OP2   . DG  I 5 53  ? 137.333 78.037  109.800 1.00 69.68  ? -21 DG  I OP2   1 
ATOM 7139  O "O5'" . DG  I 5 53  ? 138.427 75.980  110.629 1.00 69.68  ? -21 DG  I "O5'" 1 
ATOM 7140  C "C5'" . DG  I 5 53  ? 138.353 75.100  111.736 1.00 69.68  ? -21 DG  I "C5'" 1 
ATOM 7141  C "C4'" . DG  I 5 53  ? 137.571 73.853  111.379 1.00 69.68  ? -21 DG  I "C4'" 1 
ATOM 7142  O "O4'" . DG  I 5 53  ? 136.212 73.957  111.882 1.00 69.68  ? -21 DG  I "O4'" 1 
ATOM 7143  C "C3'" . DG  I 5 53  ? 137.441 73.587  109.880 1.00 69.68  ? -21 DG  I "C3'" 1 
ATOM 7144  O "O3'" . DG  I 5 53  ? 137.620 72.220  109.633 1.00 69.68  ? -21 DG  I "O3'" 1 
ATOM 7145  C "C2'" . DG  I 5 53  ? 136.009 74.005  109.591 1.00 69.68  ? -21 DG  I "C2'" 1 
ATOM 7146  C "C1'" . DG  I 5 53  ? 135.339 73.548  110.864 1.00 69.68  ? -21 DG  I "C1'" 1 
ATOM 7147  N N9    . DG  I 5 53  ? 134.026 74.139  111.083 1.00 69.68  ? -21 DG  I N9    1 
ATOM 7148  C C8    . DG  I 5 53  ? 133.688 75.462  111.009 1.00 69.68  ? -21 DG  I C8    1 
ATOM 7149  N N7    . DG  I 5 53  ? 132.429 75.690  111.237 1.00 69.68  ? -21 DG  I N7    1 
ATOM 7150  C C5    . DG  I 5 53  ? 131.902 74.434  111.480 1.00 69.68  ? -21 DG  I C5    1 
ATOM 7151  C C6    . DG  I 5 53  ? 130.584 74.046  111.792 1.00 69.68  ? -21 DG  I C6    1 
ATOM 7152  O O6    . DG  I 5 53  ? 129.585 74.758  111.919 1.00 69.68  ? -21 DG  I O6    1 
ATOM 7153  N N1    . DG  I 5 53  ? 130.477 72.671  111.955 1.00 69.68  ? -21 DG  I N1    1 
ATOM 7154  C C2    . DG  I 5 53  ? 131.512 71.785  111.827 1.00 69.68  ? -21 DG  I C2    1 
ATOM 7155  N N2    . DG  I 5 53  ? 131.219 70.494  112.025 1.00 69.68  ? -21 DG  I N2    1 
ATOM 7156  N N3    . DG  I 5 53  ? 132.751 72.136  111.542 1.00 69.68  ? -21 DG  I N3    1 
ATOM 7157  C C4    . DG  I 5 53  ? 132.872 73.471  111.389 1.00 69.68  ? -21 DG  I C4    1 
ATOM 7158  P P     . DC  I 5 54  ? 138.218 71.720  108.232 1.00 76.47  ? -20 DC  I P     1 
ATOM 7159  O OP1   . DC  I 5 54  ? 139.669 71.996  108.222 1.00 76.47  ? -20 DC  I OP1   1 
ATOM 7160  O OP2   . DC  I 5 54  ? 137.367 72.258  107.154 1.00 76.47  ? -20 DC  I OP2   1 
ATOM 7161  O "O5'" . DC  I 5 54  ? 138.003 70.143  108.293 1.00 76.47  ? -20 DC  I "O5'" 1 
ATOM 7162  C "C5'" . DC  I 5 54  ? 137.104 69.598  109.244 1.00 76.47  ? -20 DC  I "C5'" 1 
ATOM 7163  C "C4'" . DC  I 5 54  ? 135.922 68.961  108.552 1.00 76.47  ? -20 DC  I "C4'" 1 
ATOM 7164  O "O4'" . DC  I 5 54  ? 134.696 69.643  108.942 1.00 76.47  ? -20 DC  I "O4'" 1 
ATOM 7165  C "C3'" . DC  I 5 54  ? 135.970 69.030  107.022 1.00 76.47  ? -20 DC  I "C3'" 1 
ATOM 7166  O "O3'" . DC  I 5 54  ? 135.578 67.791  106.471 1.00 76.47  ? -20 DC  I "O3'" 1 
ATOM 7167  C "C2'" . DC  I 5 54  ? 134.955 70.115  106.705 1.00 76.47  ? -20 DC  I "C2'" 1 
ATOM 7168  C "C1'" . DC  I 5 54  ? 133.932 69.854  107.786 1.00 76.47  ? -20 DC  I "C1'" 1 
ATOM 7169  N N1    . DC  I 5 54  ? 132.990 70.986  107.996 1.00 76.47  ? -20 DC  I N1    1 
ATOM 7170  C C2    . DC  I 5 54  ? 131.645 70.725  108.256 1.00 76.47  ? -20 DC  I C2    1 
ATOM 7171  O O2    . DC  I 5 54  ? 131.264 69.553  108.331 1.00 76.47  ? -20 DC  I O2    1 
ATOM 7172  N N3    . DC  I 5 54  ? 130.801 71.766  108.428 1.00 76.47  ? -20 DC  I N3    1 
ATOM 7173  C C4    . DC  I 5 54  ? 131.254 73.014  108.339 1.00 76.47  ? -20 DC  I C4    1 
ATOM 7174  N N4    . DC  I 5 54  ? 130.380 74.005  108.514 1.00 76.47  ? -20 DC  I N4    1 
ATOM 7175  C C5    . DC  I 5 54  ? 132.616 73.300  108.054 1.00 76.47  ? -20 DC  I C5    1 
ATOM 7176  C C6    . DC  I 5 54  ? 133.440 72.264  107.891 1.00 76.47  ? -20 DC  I C6    1 
ATOM 7177  P P     . DG  I 5 55  ? 136.123 67.332  105.032 1.00 81.16  ? -19 DG  I P     1 
ATOM 7178  O OP1   . DG  I 5 55  ? 137.312 66.483  105.263 1.00 81.16  ? -19 DG  I OP1   1 
ATOM 7179  O OP2   . DG  I 5 55  ? 136.229 68.516  104.154 1.00 81.16  ? -19 DG  I OP2   1 
ATOM 7180  O "O5'" . DG  I 5 55  ? 134.939 66.430  104.459 1.00 81.16  ? -19 DG  I "O5'" 1 
ATOM 7181  C "C5'" . DG  I 5 55  ? 134.269 65.522  105.315 1.00 81.16  ? -19 DG  I "C5'" 1 
ATOM 7182  C "C4'" . DG  I 5 55  ? 132.792 65.457  104.979 1.00 81.16  ? -19 DG  I "C4'" 1 
ATOM 7183  O "O4'" . DG  I 5 55  ? 132.114 66.625  105.514 1.00 81.16  ? -19 DG  I "O4'" 1 
ATOM 7184  C "C3'" . DG  I 5 55  ? 132.471 65.422  103.486 1.00 81.16  ? -19 DG  I "C3'" 1 
ATOM 7185  O "O3'" . DG  I 5 55  ? 131.478 64.452  103.245 1.00 81.16  ? -19 DG  I "O3'" 1 
ATOM 7186  C "C2'" . DG  I 5 55  ? 131.950 66.830  103.211 1.00 81.16  ? -19 DG  I "C2'" 1 
ATOM 7187  C "C1'" . DG  I 5 55  ? 131.275 67.168  104.525 1.00 81.16  ? -19 DG  I "C1'" 1 
ATOM 7188  N N9    . DG  I 5 55  ? 131.158 68.604  104.754 1.00 81.16  ? -19 DG  I N9    1 
ATOM 7189  C C8    . DG  I 5 55  ? 132.178 69.511  104.762 1.00 81.16  ? -19 DG  I C8    1 
ATOM 7190  N N7    . DG  I 5 55  ? 131.793 70.729  104.998 1.00 81.16  ? -19 DG  I N7    1 
ATOM 7191  C C5    . DG  I 5 55  ? 130.423 70.627  105.135 1.00 81.16  ? -19 DG  I C5    1 
ATOM 7192  C C6    . DG  I 5 55  ? 129.469 71.621  105.409 1.00 81.16  ? -19 DG  I C6    1 
ATOM 7193  O O6    . DG  I 5 55  ? 129.654 72.829  105.559 1.00 81.16  ? -19 DG  I O6    1 
ATOM 7194  N N1    . DG  I 5 55  ? 128.182 71.102  105.468 1.00 81.16  ? -19 DG  I N1    1 
ATOM 7195  C C2    . DG  I 5 55  ? 127.860 69.781  105.305 1.00 81.16  ? -19 DG  I C2    1 
ATOM 7196  N N2    . DG  I 5 55  ? 126.562 69.466  105.404 1.00 81.16  ? -19 DG  I N2    1 
ATOM 7197  N N3    . DG  I 5 55  ? 128.751 68.830  105.058 1.00 81.16  ? -19 DG  I N3    1 
ATOM 7198  C C4    . DG  I 5 55  ? 130.011 69.326  104.992 1.00 81.16  ? -19 DG  I C4    1 
ATOM 7199  P P     . DG  I 5 56  ? 131.318 63.771  101.798 1.00 83.24  ? -18 DG  I P     1 
ATOM 7200  O OP1   . DG  I 5 56  ? 131.943 62.435  101.865 1.00 83.24  ? -18 DG  I OP1   1 
ATOM 7201  O OP2   . DG  I 5 56  ? 131.739 64.716  100.743 1.00 83.24  ? -18 DG  I OP2   1 
ATOM 7202  O "O5'" . DG  I 5 56  ? 129.742 63.586  101.673 1.00 83.24  ? -18 DG  I "O5'" 1 
ATOM 7203  C "C5'" . DG  I 5 56  ? 128.892 64.219  102.625 1.00 83.24  ? -18 DG  I "C5'" 1 
ATOM 7204  C "C4'" . DG  I 5 56  ? 127.544 64.540  102.016 1.00 83.24  ? -18 DG  I "C4'" 1 
ATOM 7205  O "O4'" . DG  I 5 56  ? 127.186 65.908  102.348 1.00 83.24  ? -18 DG  I "O4'" 1 
ATOM 7206  C "C3'" . DG  I 5 56  ? 127.501 64.471  100.499 1.00 83.24  ? -18 DG  I "C3'" 1 
ATOM 7207  O "O3'" . DG  I 5 56  ? 126.162 64.194  100.069 1.00 83.24  ? -18 DG  I "O3'" 1 
ATOM 7208  C "C2'" . DG  I 5 56  ? 127.938 65.880  100.130 1.00 83.24  ? -18 DG  I "C2'" 1 
ATOM 7209  C "C1'" . DG  I 5 56  ? 127.208 66.702  101.182 1.00 83.24  ? -18 DG  I "C1'" 1 
ATOM 7210  N N9    . DG  I 5 56  ? 127.873 67.955  101.493 1.00 83.24  ? -18 DG  I N9    1 
ATOM 7211  C C8    . DG  I 5 56  ? 129.221 68.169  101.558 1.00 83.24  ? -18 DG  I C8    1 
ATOM 7212  N N7    . DG  I 5 56  ? 129.540 69.392  101.857 1.00 83.24  ? -18 DG  I N7    1 
ATOM 7213  C C5    . DG  I 5 56  ? 128.321 70.030  102.006 1.00 83.24  ? -18 DG  I C5    1 
ATOM 7214  C C6    . DG  I 5 56  ? 128.037 71.375  102.317 1.00 83.24  ? -18 DG  I C6    1 
ATOM 7215  O O6    . DG  I 5 56  ? 128.835 72.288  102.543 1.00 83.24  ? -18 DG  I O6    1 
ATOM 7216  N N1    . DG  I 5 56  ? 126.671 71.619  102.361 1.00 83.24  ? -18 DG  I N1    1 
ATOM 7217  C C2    . DG  I 5 56  ? 125.698 70.684  102.124 1.00 83.24  ? -18 DG  I C2    1 
ATOM 7218  N N2    . DG  I 5 56  ? 124.431 71.114  102.208 1.00 83.24  ? -18 DG  I N2    1 
ATOM 7219  N N3    . DG  I 5 56  ? 125.950 69.416  101.818 1.00 83.24  ? -18 DG  I N3    1 
ATOM 7220  C C4    . DG  I 5 56  ? 127.282 69.163  101.779 1.00 83.24  ? -18 DG  I C4    1 
ATOM 7221  P P     . DT  I 5 57  ? 125.844 63.675  98.577  1.00 82.19  ? -17 DT  I P     1 
ATOM 7222  O OP1   . DT  I 5 57  ? 125.348 62.289  98.688  1.00 82.19  ? -17 DT  I OP1   1 
ATOM 7223  O OP2   . DT  I 5 57  ? 126.994 63.950  97.693  1.00 82.19  ? -17 DT  I OP2   1 
ATOM 7224  O "O5'" . DT  I 5 57  ? 124.642 64.623  98.125  1.00 82.19  ? -17 DT  I "O5'" 1 
ATOM 7225  C "C5'" . DT  I 5 57  ? 124.617 65.933  98.626  1.00 82.19  ? -17 DT  I "C5'" 1 
ATOM 7226  C "C4'" . DT  I 5 57  ? 123.327 66.649  98.328  1.00 82.19  ? -17 DT  I "C4'" 1 
ATOM 7227  O "O4'" . DT  I 5 57  ? 123.436 68.010  98.809  1.00 82.19  ? -17 DT  I "O4'" 1 
ATOM 7228  C "C3'" . DT  I 5 57  ? 123.011 66.811  96.869  1.00 82.19  ? -17 DT  I "C3'" 1 
ATOM 7229  O "O3'" . DT  I 5 57  ? 121.646 67.147  96.749  1.00 82.19  ? -17 DT  I "O3'" 1 
ATOM 7230  C "C2'" . DT  I 5 57  ? 123.925 67.981  96.501  1.00 82.19  ? -17 DT  I "C2'" 1 
ATOM 7231  C "C1'" . DT  I 5 57  ? 123.826 68.862  97.745  1.00 82.19  ? -17 DT  I "C1'" 1 
ATOM 7232  N N1    . DT  I 5 57  ? 125.102 69.542  98.136  1.00 82.19  ? -17 DT  I N1    1 
ATOM 7233  C C2    . DT  I 5 57  ? 125.040 70.769  98.740  1.00 82.19  ? -17 DT  I C2    1 
ATOM 7234  O O2    . DT  I 5 57  ? 123.997 71.350  98.943  1.00 82.19  ? -17 DT  I O2    1 
ATOM 7235  N N3    . DT  I 5 57  ? 126.251 71.310  99.076  1.00 82.19  ? -17 DT  I N3    1 
ATOM 7236  C C4    . DT  I 5 57  ? 127.490 70.746  98.884  1.00 82.19  ? -17 DT  I C4    1 
ATOM 7237  O O4    . DT  I 5 57  ? 128.522 71.301  99.226  1.00 82.19  ? -17 DT  I O4    1 
ATOM 7238  C C5    . DT  I 5 57  ? 127.488 69.451  98.262  1.00 82.19  ? -17 DT  I C5    1 
ATOM 7239  C C7    . DT  I 5 57  ? 128.781 68.744  98.003  1.00 82.19  ? -17 DT  I C7    1 
ATOM 7240  C C6    . DT  I 5 57  ? 126.309 68.918  97.918  1.00 82.19  ? -17 DT  I C6    1 
ATOM 7241  P P     . DT  I 5 58  ? 120.974 67.380  95.314  1.00 78.77  ? -16 DT  I P     1 
ATOM 7242  O OP1   . DT  I 5 58  ? 119.549 67.005  95.434  1.00 78.77  ? -16 DT  I OP1   1 
ATOM 7243  O OP2   . DT  I 5 58  ? 121.823 66.759  94.276  1.00 78.77  ? -16 DT  I OP2   1 
ATOM 7244  O "O5'" . DT  I 5 58  ? 121.057 68.951  95.130  1.00 78.77  ? -16 DT  I "O5'" 1 
ATOM 7245  C "C5'" . DT  I 5 58  ? 120.616 69.802  96.163  1.00 78.77  ? -16 DT  I "C5'" 1 
ATOM 7246  C "C4'" . DT  I 5 58  ? 120.771 71.253  95.764  1.00 78.77  ? -16 DT  I "C4'" 1 
ATOM 7247  O "O4'" . DT  I 5 58  ? 122.126 71.693  96.008  1.00 78.77  ? -16 DT  I "O4'" 1 
ATOM 7248  C "C3'" . DT  I 5 58  ? 120.470 71.552  94.308  1.00 78.77  ? -16 DT  I "C3'" 1 
ATOM 7249  O "O3'" . DT  I 5 58  ? 119.753 72.750  94.225  1.00 78.77  ? -16 DT  I "O3'" 1 
ATOM 7250  C "C2'" . DT  I 5 58  ? 121.855 71.663  93.656  1.00 78.77  ? -16 DT  I "C2'" 1 
ATOM 7251  C "C1'" . DT  I 5 58  ? 122.753 72.095  94.808  1.00 78.77  ? -16 DT  I "C1'" 1 
ATOM 7252  N N1    . DT  I 5 58  ? 124.093 71.464  94.790  1.00 78.77  ? -16 DT  I N1    1 
ATOM 7253  C C2    . DT  I 5 58  ? 125.051 71.923  95.656  1.00 78.77  ? -16 DT  I C2    1 
ATOM 7254  O O2    . DT  I 5 58  ? 124.863 72.840  96.430  1.00 78.77  ? -16 DT  I O2    1 
ATOM 7255  N N3    . DT  I 5 58  ? 126.248 71.267  95.589  1.00 78.77  ? -16 DT  I N3    1 
ATOM 7256  C C4    . DT  I 5 58  ? 126.577 70.218  94.757  1.00 78.77  ? -16 DT  I C4    1 
ATOM 7257  O O4    . DT  I 5 58  ? 127.685 69.693  94.770  1.00 78.77  ? -16 DT  I O4    1 
ATOM 7258  C C5    . DT  I 5 58  ? 125.525 69.781  93.875  1.00 78.77  ? -16 DT  I C5    1 
ATOM 7259  C C7    . DT  I 5 58  ? 125.765 68.648  92.926  1.00 78.77  ? -16 DT  I C7    1 
ATOM 7260  C C6    . DT  I 5 58  ? 124.346 70.417  93.933  1.00 78.77  ? -16 DT  I C6    1 
ATOM 7261  P P     . DA  I 5 59  ? 118.188 72.731  93.873  1.00 78.93  ? -15 DA  I P     1 
ATOM 7262  O OP1   . DA  I 5 59  ? 117.509 71.933  94.909  1.00 78.93  ? -15 DA  I OP1   1 
ATOM 7263  O OP2   . DA  I 5 59  ? 118.066 72.340  92.456  1.00 78.93  ? -15 DA  I OP2   1 
ATOM 7264  O "O5'" . DA  I 5 59  ? 117.748 74.269  94.001  1.00 78.93  ? -15 DA  I "O5'" 1 
ATOM 7265  C "C5'" . DA  I 5 59  ? 117.671 74.895  95.291  1.00 78.93  ? -15 DA  I "C5'" 1 
ATOM 7266  C "C4'" . DA  I 5 59  ? 118.219 76.329  95.290  1.00 78.93  ? -15 DA  I "C4'" 1 
ATOM 7267  O "O4'" . DA  I 5 59  ? 119.640 76.338  95.016  1.00 78.93  ? -15 DA  I "O4'" 1 
ATOM 7268  C "C3'" . DA  I 5 59  ? 117.595 77.302  94.303  1.00 78.93  ? -15 DA  I "C3'" 1 
ATOM 7269  O "O3'" . DA  I 5 59  ? 117.520 78.592  94.916  1.00 78.93  ? -15 DA  I "O3'" 1 
ATOM 7270  C "C2'" . DA  I 5 59  ? 118.566 77.271  93.119  1.00 78.93  ? -15 DA  I "C2'" 1 
ATOM 7271  C "C1'" . DA  I 5 59  ? 119.909 76.944  93.763  1.00 78.93  ? -15 DA  I "C1'" 1 
ATOM 7272  N N9    . DA  I 5 59  ? 120.684 75.984  92.995  1.00 78.93  ? -15 DA  I N9    1 
ATOM 7273  C C8    . DA  I 5 59  ? 120.189 74.970  92.243  1.00 78.93  ? -15 DA  I C8    1 
ATOM 7274  N N7    . DA  I 5 59  ? 121.100 74.218  91.702  1.00 78.93  ? -15 DA  I N7    1 
ATOM 7275  C C5    . DA  I 5 59  ? 122.282 74.781  92.122  1.00 78.93  ? -15 DA  I C5    1 
ATOM 7276  C C6    . DA  I 5 59  ? 123.616 74.446  91.880  1.00 78.93  ? -15 DA  I C6    1 
ATOM 7277  N N6    . DA  I 5 59  ? 123.981 73.418  91.116  1.00 78.93  ? -15 DA  I N6    1 
ATOM 7278  N N1    . DA  I 5 59  ? 124.563 75.215  92.437  1.00 78.93  ? -15 DA  I N1    1 
ATOM 7279  C C2    . DA  I 5 59  ? 124.191 76.244  93.201  1.00 78.93  ? -15 DA  I C2    1 
ATOM 7280  N N3    . DA  I 5 59  ? 122.962 76.656  93.499  1.00 78.93  ? -15 DA  I N3    1 
ATOM 7281  C C4    . DA  I 5 59  ? 122.047 75.871  92.925  1.00 78.93  ? -15 DA  I C4    1 
ATOM 7282  P P     . DA  I 5 60  ? 117.222 79.931  94.074  1.00 75.51  ? -14 DA  I P     1 
ATOM 7283  O OP1   . DA  I 5 60  ? 116.602 80.868  95.030  1.00 75.51  ? -14 DA  I OP1   1 
ATOM 7284  O OP2   . DA  I 5 60  ? 116.508 79.665  92.804  1.00 75.51  ? -14 DA  I OP2   1 
ATOM 7285  O "O5'" . DA  I 5 60  ? 118.678 80.485  93.751  1.00 75.51  ? -14 DA  I "O5'" 1 
ATOM 7286  C "C5'" . DA  I 5 60  ? 119.628 80.589  94.796  1.00 75.51  ? -14 DA  I "C5'" 1 
ATOM 7287  C "C4'" . DA  I 5 60  ? 120.966 81.082  94.279  1.00 75.51  ? -14 DA  I "C4'" 1 
ATOM 7288  O "O4'" . DA  I 5 60  ? 121.661 80.016  93.583  1.00 75.51  ? -14 DA  I "O4'" 1 
ATOM 7289  C "C3'" . DA  I 5 60  ? 120.902 82.248  93.308  1.00 75.51  ? -14 DA  I "C3'" 1 
ATOM 7290  O "O3'" . DA  I 5 60  ? 121.941 83.137  93.615  1.00 75.51  ? -14 DA  I "O3'" 1 
ATOM 7291  C "C2'" . DA  I 5 60  ? 121.116 81.576  91.947  1.00 75.51  ? -14 DA  I "C2'" 1 
ATOM 7292  C "C1'" . DA  I 5 60  ? 122.074 80.461  92.310  1.00 75.51  ? -14 DA  I "C1'" 1 
ATOM 7293  N N9    . DA  I 5 60  ? 122.012 79.318  91.414  1.00 75.51  ? -14 DA  I N9    1 
ATOM 7294  C C8    . DA  I 5 60  ? 120.891 78.703  90.965  1.00 75.51  ? -14 DA  I C8    1 
ATOM 7295  N N7    . DA  I 5 60  ? 121.123 77.664  90.210  1.00 75.51  ? -14 DA  I N7    1 
ATOM 7296  C C5    . DA  I 5 60  ? 122.494 77.603  90.148  1.00 75.51  ? -14 DA  I C5    1 
ATOM 7297  C C6    . DA  I 5 60  ? 123.367 76.727  89.496  1.00 75.51  ? -14 DA  I C6    1 
ATOM 7298  N N6    . DA  I 5 60  ? 122.951 75.713  88.742  1.00 75.51  ? -14 DA  I N6    1 
ATOM 7299  N N1    . DA  I 5 60  ? 124.684 76.935  89.637  1.00 75.51  ? -14 DA  I N1    1 
ATOM 7300  C C2    . DA  I 5 60  ? 125.097 77.955  90.388  1.00 75.51  ? -14 DA  I C2    1 
ATOM 7301  N N3    . DA  I 5 60  ? 124.366 78.844  91.058  1.00 75.51  ? -14 DA  I N3    1 
ATOM 7302  C C4    . DA  I 5 60  ? 123.062 78.604  90.898  1.00 75.51  ? -14 DA  I C4    1 
ATOM 7303  P P     . DA  I 5 61  ? 121.924 84.648  93.083  1.00 68.44  ? -13 DA  I P     1 
ATOM 7304  O OP1   . DA  I 5 61  ? 121.780 85.501  94.279  1.00 68.44  ? -13 DA  I OP1   1 
ATOM 7305  O OP2   . DA  I 5 61  ? 120.972 84.808  91.962  1.00 68.44  ? -13 DA  I OP2   1 
ATOM 7306  O "O5'" . DA  I 5 61  ? 123.392 84.820  92.489  1.00 68.44  ? -13 DA  I "O5'" 1 
ATOM 7307  C "C5'" . DA  I 5 61  ? 124.474 84.152  93.102  1.00 68.44  ? -13 DA  I "C5'" 1 
ATOM 7308  C "C4'" . DA  I 5 61  ? 125.582 83.900  92.104  1.00 68.44  ? -13 DA  I "C4'" 1 
ATOM 7309  O "O4'" . DA  I 5 61  ? 125.348 82.659  91.405  1.00 68.44  ? -13 DA  I "O4'" 1 
ATOM 7310  C "C3'" . DA  I 5 61  ? 125.743 84.969  91.035  1.00 68.44  ? -13 DA  I "C3'" 1 
ATOM 7311  O "O3'" . DA  I 5 61  ? 127.091 85.372  91.003  1.00 68.44  ? -13 DA  I "O3'" 1 
ATOM 7312  C "C2'" . DA  I 5 61  ? 125.309 84.267  89.739  1.00 68.44  ? -13 DA  I "C2'" 1 
ATOM 7313  C "C1'" . DA  I 5 61  ? 125.624 82.821  90.034  1.00 68.44  ? -13 DA  I "C1'" 1 
ATOM 7314  N N9    . DA  I 5 61  ? 124.774 81.883  89.329  1.00 68.44  ? -13 DA  I N9    1 
ATOM 7315  C C8    . DA  I 5 61  ? 123.424 81.837  89.380  1.00 68.44  ? -13 DA  I C8    1 
ATOM 7316  N N7    . DA  I 5 61  ? 122.896 80.868  88.685  1.00 68.44  ? -13 DA  I N7    1 
ATOM 7317  C C5    . DA  I 5 61  ? 123.980 80.227  88.140  1.00 68.44  ? -13 DA  I C5    1 
ATOM 7318  C C6    . DA  I 5 61  ? 124.088 79.109  87.300  1.00 68.44  ? -13 DA  I C6    1 
ATOM 7319  N N6    . DA  I 5 61  ? 123.035 78.435  86.846  1.00 68.44  ? -13 DA  I N6    1 
ATOM 7320  N N1    . DA  I 5 61  ? 125.321 78.716  86.933  1.00 68.44  ? -13 DA  I N1    1 
ATOM 7321  C C2    . DA  I 5 61  ? 126.372 79.405  87.390  1.00 68.44  ? -13 DA  I C2    1 
ATOM 7322  N N3    . DA  I 5 61  ? 126.393 80.470  88.192  1.00 68.44  ? -13 DA  I N3    1 
ATOM 7323  C C4    . DA  I 5 61  ? 125.153 80.833  88.531  1.00 68.44  ? -13 DA  I C4    1 
ATOM 7324  P P     . DA  I 5 62  ? 127.608 86.484  89.972  1.00 64.84  ? -12 DA  I P     1 
ATOM 7325  O OP1   . DA  I 5 62  ? 128.702 87.201  90.657  1.00 64.84  ? -12 DA  I OP1   1 
ATOM 7326  O OP2   . DA  I 5 62  ? 126.473 87.261  89.438  1.00 64.84  ? -12 DA  I OP2   1 
ATOM 7327  O "O5'" . DA  I 5 62  ? 128.227 85.612  88.798  1.00 64.84  ? -12 DA  I "O5'" 1 
ATOM 7328  C "C5'" . DA  I 5 62  ? 128.931 84.420  89.117  1.00 64.84  ? -12 DA  I "C5'" 1 
ATOM 7329  C "C4'" . DA  I 5 62  ? 129.672 83.877  87.916  1.00 64.84  ? -12 DA  I "C4'" 1 
ATOM 7330  O "O4'" . DA  I 5 62  ? 128.904 82.827  87.289  1.00 64.84  ? -12 DA  I "O4'" 1 
ATOM 7331  C "C3'" . DA  I 5 62  ? 129.981 84.883  86.829  1.00 64.84  ? -12 DA  I "C3'" 1 
ATOM 7332  O "O3'" . DA  I 5 62  ? 131.247 84.590  86.292  1.00 64.84  ? -12 DA  I "O3'" 1 
ATOM 7333  C "C2'" . DA  I 5 62  ? 128.860 84.662  85.807  1.00 64.84  ? -12 DA  I "C2'" 1 
ATOM 7334  C "C1'" . DA  I 5 62  ? 128.557 83.180  85.964  1.00 64.84  ? -12 DA  I "C1'" 1 
ATOM 7335  N N9    . DA  I 5 62  ? 127.151 82.845  85.788  1.00 64.84  ? -12 DA  I N9    1 
ATOM 7336  C C8    . DA  I 5 62  ? 126.085 83.451  86.375  1.00 64.84  ? -12 DA  I C8    1 
ATOM 7337  N N7    . DA  I 5 62  ? 124.934 82.916  86.062  1.00 64.84  ? -12 DA  I N7    1 
ATOM 7338  C C5    . DA  I 5 62  ? 125.272 81.879  85.225  1.00 64.84  ? -12 DA  I C5    1 
ATOM 7339  C C6    . DA  I 5 62  ? 124.505 80.931  84.546  1.00 64.84  ? -12 DA  I C6    1 
ATOM 7340  N N6    . DA  I 5 62  ? 123.179 80.873  84.627  1.00 64.84  ? -12 DA  I N6    1 
ATOM 7341  N N1    . DA  I 5 62  ? 125.152 80.027  83.792  1.00 64.84  ? -12 DA  I N1    1 
ATOM 7342  C C2    . DA  I 5 62  ? 126.481 80.089  83.717  1.00 64.84  ? -12 DA  I C2    1 
ATOM 7343  N N3    . DA  I 5 62  ? 127.310 80.941  84.305  1.00 64.84  ? -12 DA  I N3    1 
ATOM 7344  C C4    . DA  I 5 62  ? 126.635 81.819  85.047  1.00 64.84  ? -12 DA  I C4    1 
ATOM 7345  P P     . DC  I 5 63  ? 131.930 85.578  85.232  1.00 66.41  ? -11 DC  I P     1 
ATOM 7346  O OP1   . DC  I 5 63  ? 133.387 85.510  85.477  1.00 66.41  ? -11 DC  I OP1   1 
ATOM 7347  O OP2   . DC  I 5 63  ? 131.245 86.886  85.305  1.00 66.41  ? -11 DC  I OP2   1 
ATOM 7348  O "O5'" . DC  I 5 63  ? 131.584 84.903  83.823  1.00 66.41  ? -11 DC  I "O5'" 1 
ATOM 7349  C "C5'" . DC  I 5 63  ? 131.643 83.486  83.688  1.00 66.41  ? -11 DC  I "C5'" 1 
ATOM 7350  C "C4'" . DC  I 5 63  ? 131.080 83.042  82.353  1.00 66.41  ? -11 DC  I "C4'" 1 
ATOM 7351  O "O4'" . DC  I 5 63  ? 129.680 82.688  82.490  1.00 66.41  ? -11 DC  I "O4'" 1 
ATOM 7352  C "C3'" . DC  I 5 63  ? 131.140 84.090  81.241  1.00 66.41  ? -11 DC  I "C3'" 1 
ATOM 7353  O "O3'" . DC  I 5 63  ? 131.632 83.483  80.069  1.00 66.41  ? -11 DC  I "O3'" 1 
ATOM 7354  C "C2'" . DC  I 5 63  ? 129.679 84.495  81.079  1.00 66.41  ? -11 DC  I "C2'" 1 
ATOM 7355  C "C1'" . DC  I 5 63  ? 128.994 83.183  81.373  1.00 66.41  ? -11 DC  I "C1'" 1 
ATOM 7356  N N1    . DC  I 5 63  ? 127.570 83.328  81.721  1.00 66.41  ? -11 DC  I N1    1 
ATOM 7357  C C2    . DC  I 5 63  ? 126.620 82.494  81.126  1.00 66.41  ? -11 DC  I C2    1 
ATOM 7358  O O2    . DC  I 5 63  ? 126.990 81.645  80.306  1.00 66.41  ? -11 DC  I O2    1 
ATOM 7359  N N3    . DC  I 5 63  ? 125.317 82.646  81.465  1.00 66.41  ? -11 DC  I N3    1 
ATOM 7360  C C4    . DC  I 5 63  ? 124.965 83.573  82.353  1.00 66.41  ? -11 DC  I C4    1 
ATOM 7361  N N4    . DC  I 5 63  ? 123.674 83.687  82.662  1.00 66.41  ? -11 DC  I N4    1 
ATOM 7362  C C5    . DC  I 5 63  ? 125.918 84.430  82.963  1.00 66.41  ? -11 DC  I C5    1 
ATOM 7363  C C6    . DC  I 5 63  ? 127.196 84.274  82.621  1.00 66.41  ? -11 DC  I C6    1 
ATOM 7364  P P     . DG  I 5 64  ? 132.278 84.361  78.892  1.00 74.87  ? -10 DG  I P     1 
ATOM 7365  O OP1   . DG  I 5 64  ? 133.716 84.027  78.844  1.00 74.87  ? -10 DG  I OP1   1 
ATOM 7366  O OP2   . DG  I 5 64  ? 131.874 85.772  79.046  1.00 74.87  ? -10 DG  I OP2   1 
ATOM 7367  O "O5'" . DG  I 5 64  ? 131.575 83.783  77.583  1.00 74.87  ? -10 DG  I "O5'" 1 
ATOM 7368  C "C5'" . DG  I 5 64  ? 131.507 82.378  77.390  1.00 74.87  ? -10 DG  I "C5'" 1 
ATOM 7369  C "C4'" . DG  I 5 64  ? 130.485 82.017  76.327  1.00 74.87  ? -10 DG  I "C4'" 1 
ATOM 7370  O "O4'" . DG  I 5 64  ? 129.161 81.957  76.914  1.00 74.87  ? -10 DG  I "O4'" 1 
ATOM 7371  C "C3'" . DG  I 5 64  ? 130.404 82.983  75.153  1.00 74.87  ? -10 DG  I "C3'" 1 
ATOM 7372  O "O3'" . DG  I 5 64  ? 130.360 82.253  73.940  1.00 74.87  ? -10 DG  I "O3'" 1 
ATOM 7373  C "C2'" . DG  I 5 64  ? 129.110 83.757  75.405  1.00 74.87  ? -10 DG  I "C2'" 1 
ATOM 7374  C "C1'" . DG  I 5 64  ? 128.262 82.776  76.202  1.00 74.87  ? -10 DG  I "C1'" 1 
ATOM 7375  N N9    . DG  I 5 64  ? 127.411 83.441  77.178  1.00 74.87  ? -10 DG  I N9    1 
ATOM 7376  C C8    . DG  I 5 64  ? 127.830 84.304  78.152  1.00 74.87  ? -10 DG  I C8    1 
ATOM 7377  N N7    . DG  I 5 64  ? 126.870 84.757  78.898  1.00 74.87  ? -10 DG  I N7    1 
ATOM 7378  C C5    . DG  I 5 64  ? 125.733 84.157  78.389  1.00 74.87  ? -10 DG  I C5    1 
ATOM 7379  C C6    . DG  I 5 64  ? 124.393 84.279  78.798  1.00 74.87  ? -10 DG  I C6    1 
ATOM 7380  O O6    . DG  I 5 64  ? 123.940 84.962  79.719  1.00 74.87  ? -10 DG  I O6    1 
ATOM 7381  N N1    . DG  I 5 64  ? 123.545 83.512  78.020  1.00 74.87  ? -10 DG  I N1    1 
ATOM 7382  C C2    . DG  I 5 64  ? 123.940 82.722  76.975  1.00 74.87  ? -10 DG  I C2    1 
ATOM 7383  N N2    . DG  I 5 64  ? 122.970 82.051  76.344  1.00 74.87  ? -10 DG  I N2    1 
ATOM 7384  N N3    . DG  I 5 64  ? 125.201 82.597  76.572  1.00 74.87  ? -10 DG  I N3    1 
ATOM 7385  C C4    . DG  I 5 64  ? 126.043 83.330  77.335  1.00 74.87  ? -10 DG  I C4    1 
ATOM 7386  P P     . DC  I 5 65  ? 130.352 83.012  72.525  1.00 79.71  ? -9  DC  I P     1 
ATOM 7387  O OP1   . DC  I 5 65  ? 131.022 82.130  71.549  1.00 79.71  ? -9  DC  I OP1   1 
ATOM 7388  O OP2   . DC  I 5 65  ? 130.842 84.394  72.710  1.00 79.71  ? -9  DC  I OP2   1 
ATOM 7389  O "O5'" . DC  I 5 65  ? 128.805 83.081  72.152  1.00 79.71  ? -9  DC  I "O5'" 1 
ATOM 7390  C "C5'" . DC  I 5 65  ? 127.982 81.939  72.340  1.00 79.71  ? -9  DC  I "C5'" 1 
ATOM 7391  C "C4'" . DC  I 5 65  ? 126.544 82.244  71.976  1.00 79.71  ? -9  DC  I "C4'" 1 
ATOM 7392  O "O4'" . DC  I 5 65  ? 125.834 82.753  73.136  1.00 79.71  ? -9  DC  I "O4'" 1 
ATOM 7393  C "C3'" . DC  I 5 65  ? 126.370 83.295  70.884  1.00 79.71  ? -9  DC  I "C3'" 1 
ATOM 7394  O "O3'" . DC  I 5 65  ? 125.351 82.887  70.001  1.00 79.71  ? -9  DC  I "O3'" 1 
ATOM 7395  C "C2'" . DC  I 5 65  ? 125.956 84.533  71.670  1.00 79.71  ? -9  DC  I "C2'" 1 
ATOM 7396  C "C1'" . DC  I 5 65  ? 125.119 83.903  72.762  1.00 79.71  ? -9  DC  I "C1'" 1 
ATOM 7397  N N1    . DC  I 5 65  ? 124.969 84.756  73.950  1.00 79.71  ? -9  DC  I N1    1 
ATOM 7398  C C2    . DC  I 5 65  ? 123.705 84.972  74.498  1.00 79.71  ? -9  DC  I C2    1 
ATOM 7399  O O2    . DC  I 5 65  ? 122.720 84.450  73.975  1.00 79.71  ? -9  DC  I O2    1 
ATOM 7400  N N3    . DC  I 5 65  ? 123.596 85.756  75.586  1.00 79.71  ? -9  DC  I N3    1 
ATOM 7401  C C4    . DC  I 5 65  ? 124.682 86.311  76.116  1.00 79.71  ? -9  DC  I C4    1 
ATOM 7402  N N4    . DC  I 5 65  ? 124.528 87.078  77.190  1.00 79.71  ? -9  DC  I N4    1 
ATOM 7403  C C5    . DC  I 5 65  ? 125.974 86.111  75.566  1.00 79.71  ? -9  DC  I C5    1 
ATOM 7404  C C6    . DC  I 5 65  ? 126.069 85.325  74.499  1.00 79.71  ? -9  DC  I C6    1 
ATOM 7405  P P     . DG  I 5 66  ? 125.228 83.553  68.547  1.00 79.77  ? -8  DG  I P     1 
ATOM 7406  O OP1   . DG  I 5 66  ? 124.440 82.622  67.710  1.00 79.77  ? -8  DG  I OP1   1 
ATOM 7407  O OP2   . DG  I 5 66  ? 126.582 83.971  68.125  1.00 79.77  ? -8  DG  I OP2   1 
ATOM 7408  O "O5'" . DG  I 5 66  ? 124.396 84.887  68.809  1.00 79.77  ? -8  DG  I "O5'" 1 
ATOM 7409  C "C5'" . DG  I 5 66  ? 123.544 85.392  67.814  1.00 79.77  ? -8  DG  I "C5'" 1 
ATOM 7410  C "C4'" . DG  I 5 66  ? 122.122 84.947  68.065  1.00 79.77  ? -8  DG  I "C4'" 1 
ATOM 7411  O "O4'" . DG  I 5 66  ? 121.923 84.794  69.486  1.00 79.77  ? -8  DG  I "O4'" 1 
ATOM 7412  C "C3'" . DG  I 5 66  ? 121.067 85.931  67.607  1.00 79.77  ? -8  DG  I "C3'" 1 
ATOM 7413  O "O3'" . DG  I 5 66  ? 119.880 85.264  67.236  1.00 79.77  ? -8  DG  I "O3'" 1 
ATOM 7414  C "C2'" . DG  I 5 66  ? 120.856 86.803  68.834  1.00 79.77  ? -8  DG  I "C2'" 1 
ATOM 7415  C "C1'" . DG  I 5 66  ? 121.177 85.880  69.996  1.00 79.77  ? -8  DG  I "C1'" 1 
ATOM 7416  N N9    . DG  I 5 66  ? 121.957 86.530  71.045  1.00 79.77  ? -8  DG  I N9    1 
ATOM 7417  C C8    . DG  I 5 66  ? 123.317 86.672  71.097  1.00 79.77  ? -8  DG  I C8    1 
ATOM 7418  N N7    . DG  I 5 66  ? 123.737 87.288  72.163  1.00 79.77  ? -8  DG  I N7    1 
ATOM 7419  C C5    . DG  I 5 66  ? 122.579 87.589  72.852  1.00 79.77  ? -8  DG  I C5    1 
ATOM 7420  C C6    . DG  I 5 66  ? 122.406 88.255  74.073  1.00 79.77  ? -8  DG  I C6    1 
ATOM 7421  O O6    . DG  I 5 66  ? 123.270 88.726  74.810  1.00 79.77  ? -8  DG  I O6    1 
ATOM 7422  N N1    . DG  I 5 66  ? 121.068 88.346  74.425  1.00 79.77  ? -8  DG  I N1    1 
ATOM 7423  C C2    . DG  I 5 66  ? 120.028 87.858  73.680  1.00 79.77  ? -8  DG  I C2    1 
ATOM 7424  N N2    . DG  I 5 66  ? 118.800 88.035  74.179  1.00 79.77  ? -8  DG  I N2    1 
ATOM 7425  N N3    . DG  I 5 66  ? 120.178 87.226  72.529  1.00 79.77  ? -8  DG  I N3    1 
ATOM 7426  C C4    . DG  I 5 66  ? 121.475 87.128  72.179  1.00 79.77  ? -8  DG  I C4    1 
ATOM 7427  P P     . DG  I 5 67  ? 118.993 85.854  66.037  1.00 76.82  ? -7  DG  I P     1 
ATOM 7428  O OP1   . DG  I 5 67  ? 117.867 84.931  65.781  1.00 76.82  ? -7  DG  I OP1   1 
ATOM 7429  O OP2   . DG  I 5 67  ? 119.946 86.204  64.965  1.00 76.82  ? -7  DG  I OP2   1 
ATOM 7430  O "O5'" . DG  I 5 67  ? 118.407 87.224  66.615  1.00 76.82  ? -7  DG  I "O5'" 1 
ATOM 7431  C "C5'" . DG  I 5 67  ? 117.378 87.199  67.592  1.00 76.82  ? -7  DG  I "C5'" 1 
ATOM 7432  C "C4'" . DG  I 5 67  ? 117.177 88.573  68.204  1.00 76.82  ? -7  DG  I "C4'" 1 
ATOM 7433  O "O4'" . DG  I 5 67  ? 118.234 88.856  69.168  1.00 76.82  ? -7  DG  I "O4'" 1 
ATOM 7434  C "C3'" . DG  I 5 67  ? 117.188 89.736  67.206  1.00 76.82  ? -7  DG  I "C3'" 1 
ATOM 7435  O "O3'" . DG  I 5 67  ? 116.112 90.607  67.481  1.00 76.82  ? -7  DG  I "O3'" 1 
ATOM 7436  C "C2'" . DG  I 5 67  ? 118.526 90.413  67.494  1.00 76.82  ? -7  DG  I "C2'" 1 
ATOM 7437  C "C1'" . DG  I 5 67  ? 118.642 90.186  68.991  1.00 76.82  ? -7  DG  I "C1'" 1 
ATOM 7438  N N9    . DG  I 5 67  ? 119.999 90.357  69.514  1.00 76.82  ? -7  DG  I N9    1 
ATOM 7439  C C8    . DG  I 5 67  ? 121.176 90.160  68.841  1.00 76.82  ? -7  DG  I C8    1 
ATOM 7440  N N7    . DG  I 5 67  ? 122.236 90.392  69.557  1.00 76.82  ? -7  DG  I N7    1 
ATOM 7441  C C5    . DG  I 5 67  ? 121.733 90.803  70.776  1.00 76.82  ? -7  DG  I C5    1 
ATOM 7442  C C6    . DG  I 5 67  ? 122.412 91.206  71.947  1.00 76.82  ? -7  DG  I C6    1 
ATOM 7443  O O6    . DG  I 5 67  ? 123.631 91.284  72.142  1.00 76.82  ? -7  DG  I O6    1 
ATOM 7444  N N1    . DG  I 5 67  ? 121.527 91.546  72.961  1.00 76.82  ? -7  DG  I N1    1 
ATOM 7445  C C2    . DG  I 5 67  ? 120.161 91.501  72.857  1.00 76.82  ? -7  DG  I C2    1 
ATOM 7446  N N2    . DG  I 5 67  ? 119.479 91.864  73.949  1.00 76.82  ? -7  DG  I N2    1 
ATOM 7447  N N3    . DG  I 5 67  ? 119.509 91.126  71.763  1.00 76.82  ? -7  DG  I N3    1 
ATOM 7448  C C4    . DG  I 5 67  ? 120.356 90.792  70.767  1.00 76.82  ? -7  DG  I C4    1 
ATOM 7449  P P     . DG  I 5 68  ? 114.740 90.499  66.656  1.00 72.72  ? -6  DG  I P     1 
ATOM 7450  O OP1   . DG  I 5 68  ? 114.227 89.124  66.794  1.00 72.72  ? -6  DG  I OP1   1 
ATOM 7451  O OP2   . DG  I 5 68  ? 114.979 91.072  65.316  1.00 72.72  ? -6  DG  I OP2   1 
ATOM 7452  O "O5'" . DG  I 5 68  ? 113.750 91.476  67.439  1.00 72.72  ? -6  DG  I "O5'" 1 
ATOM 7453  C "C5'" . DG  I 5 68  ? 113.646 91.395  68.864  1.00 72.72  ? -6  DG  I "C5'" 1 
ATOM 7454  C "C4'" . DG  I 5 68  ? 113.902 92.744  69.531  1.00 72.72  ? -6  DG  I "C4'" 1 
ATOM 7455  O "O4'" . DG  I 5 68  ? 115.320 92.907  69.814  1.00 72.72  ? -6  DG  I "O4'" 1 
ATOM 7456  C "C3'" . DG  I 5 68  ? 113.507 93.976  68.715  1.00 72.72  ? -6  DG  I "C3'" 1 
ATOM 7457  O "O3'" . DG  I 5 68  ? 112.998 94.968  69.584  1.00 72.72  ? -6  DG  I "O3'" 1 
ATOM 7458  C "C2'" . DG  I 5 68  ? 114.845 94.413  68.141  1.00 72.72  ? -6  DG  I "C2'" 1 
ATOM 7459  C "C1'" . DG  I 5 68  ? 115.714 94.173  69.350  1.00 72.72  ? -6  DG  I "C1'" 1 
ATOM 7460  N N9    . DG  I 5 68  ? 117.130 94.156  69.054  1.00 72.72  ? -6  DG  I N9    1 
ATOM 7461  C C8    . DG  I 5 68  ? 117.730 93.737  67.900  1.00 72.72  ? -6  DG  I C8    1 
ATOM 7462  N N7    . DG  I 5 68  ? 119.028 93.847  67.921  1.00 72.72  ? -6  DG  I N7    1 
ATOM 7463  C C5    . DG  I 5 68  ? 119.298 94.390  69.166  1.00 72.72  ? -6  DG  I C5    1 
ATOM 7464  C C6    . DG  I 5 68  ? 120.527 94.750  69.758  1.00 72.72  ? -6  DG  I C6    1 
ATOM 7465  O O6    . DG  I 5 68  ? 121.666 94.642  69.301  1.00 72.72  ? -6  DG  I O6    1 
ATOM 7466  N N1    . DG  I 5 68  ? 120.351 95.268  71.033  1.00 72.72  ? -6  DG  I N1    1 
ATOM 7467  C C2    . DG  I 5 68  ? 119.140 95.426  71.658  1.00 72.72  ? -6  DG  I C2    1 
ATOM 7468  N N2    . DG  I 5 68  ? 119.169 95.945  72.898  1.00 72.72  ? -6  DG  I N2    1 
ATOM 7469  N N3    . DG  I 5 68  ? 117.977 95.097  71.112  1.00 72.72  ? -6  DG  I N3    1 
ATOM 7470  C C4    . DG  I 5 68  ? 118.135 94.589  69.869  1.00 72.72  ? -6  DG  I C4    1 
ATOM 7471  P P     . DG  I 5 69  ? 111.418 95.215  69.696  1.00 66.23  ? -5  DG  I P     1 
ATOM 7472  O OP1   . DG  I 5 69  ? 110.741 93.916  69.495  1.00 66.23  ? -5  DG  I OP1   1 
ATOM 7473  O OP2   . DG  I 5 69  ? 111.100 96.371  68.837  1.00 66.23  ? -5  DG  I OP2   1 
ATOM 7474  O "O5'" . DG  I 5 69  ? 111.198 95.711  71.203  1.00 66.23  ? -5  DG  I "O5'" 1 
ATOM 7475  C "C5'" . DG  I 5 69  ? 112.167 95.431  72.210  1.00 66.23  ? -5  DG  I "C5'" 1 
ATOM 7476  C "C4'" . DG  I 5 69  ? 112.946 96.681  72.642  1.00 66.23  ? -5  DG  I "C4'" 1 
ATOM 7477  O "O4'" . DG  I 5 69  ? 114.158 96.817  71.861  1.00 66.23  ? -5  DG  I "O4'" 1 
ATOM 7478  C "C3'" . DG  I 5 69  ? 112.236 98.029  72.501  1.00 66.23  ? -5  DG  I "C3'" 1 
ATOM 7479  O "O3'" . DG  I 5 69  ? 112.719 98.898  73.498  1.00 66.23  ? -5  DG  I "O3'" 1 
ATOM 7480  C "C2'" . DG  I 5 69  ? 112.743 98.498  71.146  1.00 66.23  ? -5  DG  I "C2'" 1 
ATOM 7481  C "C1'" . DG  I 5 69  ? 114.190 98.118  71.318  1.00 66.23  ? -5  DG  I "C1'" 1 
ATOM 7482  N N9    . DG  I 5 69  ? 114.962 98.074  70.103  1.00 66.23  ? -5  DG  I N9    1 
ATOM 7483  C C8    . DG  I 5 69  ? 114.541 97.729  68.851  1.00 66.23  ? -5  DG  I C8    1 
ATOM 7484  N N7    . DG  I 5 69  ? 115.498 97.752  67.966  1.00 66.23  ? -5  DG  I N7    1 
ATOM 7485  C C5    . DG  I 5 69  ? 116.609 98.144  68.693  1.00 66.23  ? -5  DG  I C5    1 
ATOM 7486  C C6    . DG  I 5 69  ? 117.936 98.363  68.286  1.00 66.23  ? -5  DG  I C6    1 
ATOM 7487  O O6    . DG  I 5 69  ? 118.430 98.224  67.167  1.00 66.23  ? -5  DG  I O6    1 
ATOM 7488  N N1    . DG  I 5 69  ? 118.742 98.749  69.350  1.00 66.23  ? -5  DG  I N1    1 
ATOM 7489  C C2    . DG  I 5 69  ? 118.303 98.920  70.633  1.00 66.23  ? -5  DG  I C2    1 
ATOM 7490  N N2    . DG  I 5 69  ? 119.218 99.293  71.525  1.00 66.23  ? -5  DG  I N2    1 
ATOM 7491  N N3    . DG  I 5 69  ? 117.069 98.718  71.021  1.00 66.23  ? -5  DG  I N3    1 
ATOM 7492  C C4    . DG  I 5 69  ? 116.283 98.338  70.005  1.00 66.23  ? -5  DG  I C4    1 
ATOM 7493  P P     . DG  I 5 70  ? 111.990 99.013  74.918  1.00 66.02  ? -4  DG  I P     1 
ATOM 7494  O OP1   . DG  I 5 70  ? 112.273 97.775  75.667  1.00 66.02  ? -4  DG  I OP1   1 
ATOM 7495  O OP2   . DG  I 5 70  ? 110.591 99.438  74.704  1.00 66.02  ? -4  DG  I OP2   1 
ATOM 7496  O "O5'" . DG  I 5 70  ? 112.782 100.193 75.631  1.00 66.02  ? -4  DG  I "O5'" 1 
ATOM 7497  C "C5'" . DG  I 5 70  ? 114.030 99.930  76.243  1.00 66.02  ? -4  DG  I "C5'" 1 
ATOM 7498  C "C4'" . DG  I 5 70  ? 115.039 101.031 75.965  1.00 66.02  ? -4  DG  I "C4'" 1 
ATOM 7499  O "O4'" . DG  I 5 70  ? 115.545 100.903 74.615  1.00 66.02  ? -4  DG  I "O4'" 1 
ATOM 7500  C "C3'" . DG  I 5 70  ? 114.532 102.469 76.081  1.00 66.02  ? -4  DG  I "C3'" 1 
ATOM 7501  O "O3'" . DG  I 5 70  ? 115.564 103.246 76.607  1.00 66.02  ? -4  DG  I "O3'" 1 
ATOM 7502  C "C2'" . DG  I 5 70  ? 114.289 102.840 74.626  1.00 66.02  ? -4  DG  I "C2'" 1 
ATOM 7503  C "C1'" . DG  I 5 70  ? 115.475 102.158 73.985  1.00 66.02  ? -4  DG  I "C1'" 1 
ATOM 7504  N N9    . DG  I 5 70  ? 115.337 101.946 72.552  1.00 66.02  ? -4  DG  I N9    1 
ATOM 7505  C C8    . DG  I 5 70  ? 114.198 101.604 71.872  1.00 66.02  ? -4  DG  I C8    1 
ATOM 7506  N N7    . DG  I 5 70  ? 114.381 101.466 70.591  1.00 66.02  ? -4  DG  I N7    1 
ATOM 7507  C C5    . DG  I 5 70  ? 115.726 101.735 70.413  1.00 66.02  ? -4  DG  I C5    1 
ATOM 7508  C C6    . DG  I 5 70  ? 116.501 101.745 69.235  1.00 66.02  ? -4  DG  I C6    1 
ATOM 7509  O O6    . DG  I 5 70  ? 116.144 101.506 68.077  1.00 66.02  ? -4  DG  I O6    1 
ATOM 7510  N N1    . DG  I 5 70  ? 117.824 102.070 69.495  1.00 66.02  ? -4  DG  I N1    1 
ATOM 7511  C C2    . DG  I 5 70  ? 118.331 102.352 70.736  1.00 66.02  ? -4  DG  I C2    1 
ATOM 7512  N N2    . DG  I 5 70  ? 119.632 102.648 70.790  1.00 66.02  ? -4  DG  I N2    1 
ATOM 7513  N N3    . DG  I 5 70  ? 117.615 102.346 71.849  1.00 66.02  ? -4  DG  I N3    1 
ATOM 7514  C C4    . DG  I 5 70  ? 116.327 102.031 71.611  1.00 66.02  ? -4  DG  I C4    1 
ATOM 7515  P P     . DA  I 5 71  ? 115.265 104.608 77.392  1.00 69.61  ? -3  DA  I P     1 
ATOM 7516  O OP1   . DA  I 5 71  ? 115.026 104.267 78.804  1.00 69.61  ? -3  DA  I OP1   1 
ATOM 7517  O OP2   . DA  I 5 71  ? 114.238 105.360 76.655  1.00 69.61  ? -3  DA  I OP2   1 
ATOM 7518  O "O5'" . DA  I 5 71  ? 116.645 105.389 77.265  1.00 69.61  ? -3  DA  I "O5'" 1 
ATOM 7519  C "C5'" . DA  I 5 71  ? 117.861 104.654 77.309  1.00 69.61  ? -3  DA  I "C5'" 1 
ATOM 7520  C "C4'" . DA  I 5 71  ? 118.951 105.297 76.464  1.00 69.61  ? -3  DA  I "C4'" 1 
ATOM 7521  O "O4'" . DA  I 5 71  ? 118.792 104.934 75.073  1.00 69.61  ? -3  DA  I "O4'" 1 
ATOM 7522  C "C3'" . DA  I 5 71  ? 119.007 106.811 76.504  1.00 69.61  ? -3  DA  I "C3'" 1 
ATOM 7523  O "O3'" . DA  I 5 71  ? 120.342 107.210 76.539  1.00 69.61  ? -3  DA  I "O3'" 1 
ATOM 7524  C "C2'" . DA  I 5 71  ? 118.332 107.224 75.198  1.00 69.61  ? -3  DA  I "C2'" 1 
ATOM 7525  C "C1'" . DA  I 5 71  ? 118.736 106.095 74.270  1.00 69.61  ? -3  DA  I "C1'" 1 
ATOM 7526  N N9    . DA  I 5 71  ? 117.781 105.827 73.206  1.00 69.61  ? -3  DA  I N9    1 
ATOM 7527  C C8    . DA  I 5 71  ? 116.457 105.554 73.354  1.00 69.61  ? -3  DA  I C8    1 
ATOM 7528  N N7    . DA  I 5 71  ? 115.836 105.310 72.231  1.00 69.61  ? -3  DA  I N7    1 
ATOM 7529  C C5    . DA  I 5 71  ? 116.827 105.408 71.282  1.00 69.61  ? -3  DA  I C5    1 
ATOM 7530  C C6    . DA  I 5 71  ? 116.809 105.269 69.890  1.00 69.61  ? -3  DA  I C6    1 
ATOM 7531  N N6    . DA  I 5 71  ? 115.705 104.973 69.205  1.00 69.61  ? -3  DA  I N6    1 
ATOM 7532  N N1    . DA  I 5 71  ? 117.968 105.439 69.222  1.00 69.61  ? -3  DA  I N1    1 
ATOM 7533  C C2    . DA  I 5 71  ? 119.072 105.739 69.912  1.00 69.61  ? -3  DA  I C2    1 
ATOM 7534  N N3    . DA  I 5 71  ? 119.208 105.903 71.229  1.00 69.61  ? -3  DA  I N3    1 
ATOM 7535  C C4    . DA  I 5 71  ? 118.035 105.725 71.860  1.00 69.61  ? -3  DA  I C4    1 
ATOM 7536  P P     . DC  I 5 72  ? 120.715 108.728 76.877  1.00 73.45  ? -2  DC  I P     1 
ATOM 7537  O OP1   . DC  I 5 72  ? 122.007 108.736 77.589  1.00 73.45  ? -2  DC  I OP1   1 
ATOM 7538  O OP2   . DC  I 5 72  ? 119.522 109.345 77.490  1.00 73.45  ? -2  DC  I OP2   1 
ATOM 7539  O "O5'" . DC  I 5 72  ? 120.927 109.378 75.441  1.00 73.45  ? -2  DC  I "O5'" 1 
ATOM 7540  C "C5'" . DC  I 5 72  ? 121.685 108.687 74.456  1.00 73.45  ? -2  DC  I "C5'" 1 
ATOM 7541  C "C4'" . DC  I 5 72  ? 121.640 109.415 73.128  1.00 73.45  ? -2  DC  I "C4'" 1 
ATOM 7542  O "O4'" . DC  I 5 72  ? 120.603 108.845 72.286  1.00 73.45  ? -2  DC  I "O4'" 1 
ATOM 7543  C "C3'" . DC  I 5 72  ? 121.324 110.912 73.212  1.00 73.45  ? -2  DC  I "C3'" 1 
ATOM 7544  O "O3'" . DC  I 5 72  ? 122.096 111.599 72.247  1.00 73.45  ? -2  DC  I "O3'" 1 
ATOM 7545  C "C2'" . DC  I 5 72  ? 119.845 110.951 72.839  1.00 73.45  ? -2  DC  I "C2'" 1 
ATOM 7546  C "C1'" . DC  I 5 72  ? 119.846 109.900 71.756  1.00 73.45  ? -2  DC  I "C1'" 1 
ATOM 7547  N N1    . DC  I 5 72  ? 118.514 109.405 71.372  1.00 73.45  ? -2  DC  I N1    1 
ATOM 7548  C C2    . DC  I 5 72  ? 118.260 109.139 70.034  1.00 73.45  ? -2  DC  I C2    1 
ATOM 7549  O O2    . DC  I 5 72  ? 119.158 109.330 69.218  1.00 73.45  ? -2  DC  I O2    1 
ATOM 7550  N N3    . DC  I 5 72  ? 117.044 108.687 69.674  1.00 73.45  ? -2  DC  I N3    1 
ATOM 7551  C C4    . DC  I 5 72  ? 116.108 108.508 70.594  1.00 73.45  ? -2  DC  I C4    1 
ATOM 7552  N N4    . DC  I 5 72  ? 114.923 108.049 70.197  1.00 73.45  ? -2  DC  I N4    1 
ATOM 7553  C C5    . DC  I 5 72  ? 116.350 108.766 71.971  1.00 73.45  ? -2  DC  I C5    1 
ATOM 7554  C C6    . DC  I 5 72  ? 117.557 109.217 72.310  1.00 73.45  ? -2  DC  I C6    1 
ATOM 7555  P P     . DA  I 5 73  ? 123.057 112.812 72.667  1.00 83.32  ? -1  DA  I P     1 
ATOM 7556  O OP1   . DA  I 5 73  ? 124.263 112.210 73.269  1.00 83.32  ? -1  DA  I OP1   1 
ATOM 7557  O OP2   . DA  I 5 73  ? 122.277 113.788 73.450  1.00 83.32  ? -1  DA  I OP2   1 
ATOM 7558  O "O5'" . DA  I 5 73  ? 123.425 113.491 71.266  1.00 83.32  ? -1  DA  I "O5'" 1 
ATOM 7559  C "C5'" . DA  I 5 73  ? 124.057 112.717 70.247  1.00 83.32  ? -1  DA  I "C5'" 1 
ATOM 7560  C "C4'" . DA  I 5 73  ? 123.446 112.981 68.877  1.00 83.32  ? -1  DA  I "C4'" 1 
ATOM 7561  O "O4'" . DA  I 5 73  ? 122.164 112.320 68.771  1.00 83.32  ? -1  DA  I "O4'" 1 
ATOM 7562  C "C3'" . DA  I 5 73  ? 123.204 114.452 68.534  1.00 83.32  ? -1  DA  I "C3'" 1 
ATOM 7563  O "O3'" . DA  I 5 73  ? 123.770 114.744 67.267  1.00 83.32  ? -1  DA  I "O3'" 1 
ATOM 7564  C "C2'" . DA  I 5 73  ? 121.680 114.575 68.509  1.00 83.32  ? -1  DA  I "C2'" 1 
ATOM 7565  C "C1'" . DA  I 5 73  ? 121.254 113.173 68.129  1.00 83.32  ? -1  DA  I "C1'" 1 
ATOM 7566  N N9    . DA  I 5 73  ? 119.931 112.845 68.608  1.00 83.32  ? -1  DA  I N9    1 
ATOM 7567  C C8    . DA  I 5 73  ? 119.521 112.825 69.899  1.00 83.32  ? -1  DA  I C8    1 
ATOM 7568  N N7    . DA  I 5 73  ? 118.271 112.483 70.054  1.00 83.32  ? -1  DA  I N7    1 
ATOM 7569  C C5    . DA  I 5 73  ? 117.831 112.277 68.768  1.00 83.32  ? -1  DA  I C5    1 
ATOM 7570  C C6    . DA  I 5 73  ? 116.591 111.898 68.249  1.00 83.32  ? -1  DA  I C6    1 
ATOM 7571  N N6    . DA  I 5 73  ? 115.526 111.655 69.010  1.00 83.32  ? -1  DA  I N6    1 
ATOM 7572  N N1    . DA  I 5 73  ? 116.480 111.782 66.912  1.00 83.32  ? -1  DA  I N1    1 
ATOM 7573  C C2    . DA  I 5 73  ? 117.553 112.017 66.150  1.00 83.32  ? -1  DA  I C2    1 
ATOM 7574  N N3    . DA  I 5 73  ? 118.772 112.386 66.528  1.00 83.32  ? -1  DA  I N3    1 
ATOM 7575  C C4    . DA  I 5 73  ? 118.846 112.485 67.863  1.00 83.32  ? -1  DA  I C4    1 
ATOM 7576  P P     . DG  I 5 74  ? 123.759 116.244 66.694  1.00 93.79  ? 0   DG  I P     1 
ATOM 7577  O OP1   . DG  I 5 74  ? 124.991 116.400 65.895  1.00 93.79  ? 0   DG  I OP1   1 
ATOM 7578  O OP2   . DG  I 5 74  ? 123.495 117.185 67.802  1.00 93.79  ? 0   DG  I OP2   1 
ATOM 7579  O "O5'" . DG  I 5 74  ? 122.519 116.257 65.690  1.00 93.79  ? 0   DG  I "O5'" 1 
ATOM 7580  C "C5'" . DG  I 5 74  ? 122.621 115.571 64.459  1.00 93.79  ? 0   DG  I "C5'" 1 
ATOM 7581  C "C4'" . DG  I 5 74  ? 121.317 115.609 63.689  1.00 93.79  ? 0   DG  I "C4'" 1 
ATOM 7582  O "O4'" . DG  I 5 74  ? 120.257 115.019 64.482  1.00 93.79  ? 0   DG  I "O4'" 1 
ATOM 7583  C "C3'" . DG  I 5 74  ? 120.813 117.002 63.293  1.00 93.79  ? 0   DG  I "C3'" 1 
ATOM 7584  O "O3'" . DG  I 5 74  ? 120.250 116.924 61.987  1.00 93.79  ? 0   DG  I "O3'" 1 
ATOM 7585  C "C2'" . DG  I 5 74  ? 119.734 117.254 64.337  1.00 93.79  ? 0   DG  I "C2'" 1 
ATOM 7586  C "C1'" . DG  I 5 74  ? 119.144 115.869 64.424  1.00 93.79  ? 0   DG  I "C1'" 1 
ATOM 7587  N N9    . DG  I 5 74  ? 118.324 115.639 65.595  1.00 93.79  ? 0   DG  I N9    1 
ATOM 7588  C C8    . DG  I 5 74  ? 118.724 115.659 66.903  1.00 93.79  ? 0   DG  I C8    1 
ATOM 7589  N N7    . DG  I 5 74  ? 117.761 115.399 67.740  1.00 93.79  ? 0   DG  I N7    1 
ATOM 7590  C C5    . DG  I 5 74  ? 116.660 115.180 66.929  1.00 93.79  ? 0   DG  I C5    1 
ATOM 7591  C C6    . DG  I 5 74  ? 115.329 114.862 67.269  1.00 93.79  ? 0   DG  I C6    1 
ATOM 7592  O O6    . DG  I 5 74  ? 114.845 114.689 68.387  1.00 93.79  ? 0   DG  I O6    1 
ATOM 7593  N N1    . DG  I 5 74  ? 114.528 114.740 66.148  1.00 93.79  ? 0   DG  I N1    1 
ATOM 7594  C C2    . DG  I 5 74  ? 114.958 114.905 64.856  1.00 93.79  ? 0   DG  I C2    1 
ATOM 7595  N N2    . DG  I 5 74  ? 114.037 114.744 63.900  1.00 93.79  ? 0   DG  I N2    1 
ATOM 7596  N N3    . DG  I 5 74  ? 116.202 115.207 64.524  1.00 93.79  ? 0   DG  I N3    1 
ATOM 7597  C C4    . DG  I 5 74  ? 116.993 115.329 65.608  1.00 93.79  ? 0   DG  I C4    1 
ATOM 7598  P P     . DC  I 5 75  ? 119.951 118.235 61.106  1.00 96.35  ? 1   DC  I P     1 
ATOM 7599  O OP1   . DC  I 5 75  ? 120.981 118.270 60.050  1.00 96.35  ? 1   DC  I OP1   1 
ATOM 7600  O OP2   . DC  I 5 75  ? 119.718 119.428 61.948  1.00 96.35  ? 1   DC  I OP2   1 
ATOM 7601  O "O5'" . DC  I 5 75  ? 118.568 117.880 60.412  1.00 96.35  ? 1   DC  I "O5'" 1 
ATOM 7602  C "C5'" . DC  I 5 75  ? 117.622 117.100 61.111  1.00 96.35  ? 1   DC  I "C5'" 1 
ATOM 7603  C "C4'" . DC  I 5 75  ? 116.274 117.787 61.122  1.00 96.35  ? 1   DC  I "C4'" 1 
ATOM 7604  O "O4'" . DC  I 5 75  ? 115.622 117.520 62.387  1.00 96.35  ? 1   DC  I "O4'" 1 
ATOM 7605  C "C3'" . DC  I 5 75  ? 116.332 119.311 61.014  1.00 96.35  ? 1   DC  I "C3'" 1 
ATOM 7606  O "O3'" . DC  I 5 75  ? 115.132 119.789 60.437  1.00 96.35  ? 1   DC  I "O3'" 1 
ATOM 7607  C "C2'" . DC  I 5 75  ? 116.419 119.708 62.472  1.00 96.35  ? 1   DC  I "C2'" 1 
ATOM 7608  C "C1'" . DC  I 5 75  ? 115.396 118.745 63.035  1.00 96.35  ? 1   DC  I "C1'" 1 
ATOM 7609  N N1    . DC  I 5 75  ? 115.461 118.554 64.493  1.00 96.35  ? 1   DC  I N1    1 
ATOM 7610  C C2    . DC  I 5 75  ? 114.307 118.200 65.150  1.00 96.35  ? 1   DC  I C2    1 
ATOM 7611  O O2    . DC  I 5 75  ? 113.278 118.050 64.491  1.00 96.35  ? 1   DC  I O2    1 
ATOM 7612  N N3    . DC  I 5 75  ? 114.331 118.028 66.479  1.00 96.35  ? 1   DC  I N3    1 
ATOM 7613  C C4    . DC  I 5 75  ? 115.462 118.218 67.149  1.00 96.35  ? 1   DC  I C4    1 
ATOM 7614  N N4    . DC  I 5 75  ? 115.433 118.028 68.469  1.00 96.35  ? 1   DC  I N4    1 
ATOM 7615  C C5    . DC  I 5 75  ? 116.670 118.582 66.496  1.00 96.35  ? 1   DC  I C5    1 
ATOM 7616  C C6    . DC  I 5 75  ? 116.621 118.745 65.174  1.00 96.35  ? 1   DC  I C6    1 
ATOM 7617  P P     . DG  I 5 76  ? 115.160 120.756 59.153  1.00 91.67  ? 2   DG  I P     1 
ATOM 7618  O OP1   . DG  I 5 76  ? 115.567 119.964 57.974  1.00 91.67  ? 2   DG  I OP1   1 
ATOM 7619  O OP2   . DG  I 5 76  ? 115.903 121.982 59.502  1.00 91.67  ? 2   DG  I OP2   1 
ATOM 7620  O "O5'" . DG  I 5 76  ? 113.630 121.163 58.973  1.00 91.67  ? 2   DG  I "O5'" 1 
ATOM 7621  C "C5'" . DG  I 5 76  ? 112.636 120.147 58.920  1.00 91.67  ? 2   DG  I "C5'" 1 
ATOM 7622  C "C4'" . DG  I 5 76  ? 111.463 120.453 59.841  1.00 91.67  ? 2   DG  I "C4'" 1 
ATOM 7623  O "O4'" . DG  I 5 76  ? 111.825 120.193 61.220  1.00 91.67  ? 2   DG  I "O4'" 1 
ATOM 7624  C "C3'" . DG  I 5 76  ? 110.943 121.890 59.813  1.00 91.67  ? 2   DG  I "C3'" 1 
ATOM 7625  O "O3'" . DG  I 5 76  ? 109.542 121.857 59.917  1.00 91.67  ? 2   DG  I "O3'" 1 
ATOM 7626  C "C2'" . DG  I 5 76  ? 111.557 122.483 61.074  1.00 91.67  ? 2   DG  I "C2'" 1 
ATOM 7627  C "C1'" . DG  I 5 76  ? 111.428 121.294 62.001  1.00 91.67  ? 2   DG  I "C1'" 1 
ATOM 7628  N N9    . DG  I 5 76  ? 112.276 121.347 63.182  1.00 91.67  ? 2   DG  I N9    1 
ATOM 7629  C C8    . DG  I 5 76  ? 113.599 121.694 63.238  1.00 91.67  ? 2   DG  I C8    1 
ATOM 7630  N N7    . DG  I 5 76  ? 114.103 121.622 64.437  1.00 91.67  ? 2   DG  I N7    1 
ATOM 7631  C C5    . DG  I 5 76  ? 113.041 121.208 65.223  1.00 91.67  ? 2   DG  I C5    1 
ATOM 7632  C C6    . DG  I 5 76  ? 112.980 120.967 66.607  1.00 91.67  ? 2   DG  I C6    1 
ATOM 7633  O O6    . DG  I 5 76  ? 113.884 121.071 67.440  1.00 91.67  ? 2   DG  I O6    1 
ATOM 7634  N N1    . DG  I 5 76  ? 111.713 120.564 67.001  1.00 91.67  ? 2   DG  I N1    1 
ATOM 7635  C C2    . DG  I 5 76  ? 110.641 120.410 66.157  1.00 91.67  ? 2   DG  I C2    1 
ATOM 7636  N N2    . DG  I 5 76  ? 109.492 120.012 66.713  1.00 91.67  ? 2   DG  I N2    1 
ATOM 7637  N N3    . DG  I 5 76  ? 110.686 120.637 64.860  1.00 91.67  ? 2   DG  I N3    1 
ATOM 7638  C C4    . DG  I 5 76  ? 111.913 121.027 64.464  1.00 91.67  ? 2   DG  I C4    1 
ATOM 7639  P P     . DC  I 5 77  ? 108.622 122.783 58.986  1.00 87.00  ? 3   DC  I P     1 
ATOM 7640  O OP1   . DC  I 5 77  ? 108.021 121.908 57.959  1.00 87.00  ? 3   DC  I OP1   1 
ATOM 7641  O OP2   . DC  I 5 77  ? 109.394 123.978 58.592  1.00 87.00  ? 3   DC  I OP2   1 
ATOM 7642  O "O5'" . DC  I 5 77  ? 107.467 123.250 59.976  1.00 87.00  ? 3   DC  I "O5'" 1 
ATOM 7643  C "C5'" . DC  I 5 77  ? 106.821 122.288 60.793  1.00 87.00  ? 3   DC  I "C5'" 1 
ATOM 7644  C "C4'" . DC  I 5 77  ? 106.432 122.884 62.129  1.00 87.00  ? 3   DC  I "C4'" 1 
ATOM 7645  O "O4'" . DC  I 5 77  ? 107.512 122.701 63.083  1.00 87.00  ? 3   DC  I "O4'" 1 
ATOM 7646  C "C3'" . DC  I 5 77  ? 106.146 124.390 62.112  1.00 87.00  ? 3   DC  I "C3'" 1 
ATOM 7647  O "O3'" . DC  I 5 77  ? 105.012 124.657 62.904  1.00 87.00  ? 3   DC  I "O3'" 1 
ATOM 7648  C "C2'" . DC  I 5 77  ? 107.398 124.968 62.755  1.00 87.00  ? 3   DC  I "C2'" 1 
ATOM 7649  C "C1'" . DC  I 5 77  ? 107.653 123.898 63.791  1.00 87.00  ? 3   DC  I "C1'" 1 
ATOM 7650  N N1    . DC  I 5 77  ? 108.985 123.959 64.414  1.00 87.00  ? 3   DC  I N1    1 
ATOM 7651  C C2    . DC  I 5 77  ? 109.111 123.680 65.768  1.00 87.00  ? 3   DC  I C2    1 
ATOM 7652  O O2    . DC  I 5 77  ? 108.101 123.381 66.409  1.00 87.00  ? 3   DC  I O2    1 
ATOM 7653  N N3    . DC  I 5 77  ? 110.330 123.758 66.345  1.00 87.00  ? 3   DC  I N3    1 
ATOM 7654  C C4    . DC  I 5 77  ? 111.386 124.100 65.616  1.00 87.00  ? 3   DC  I C4    1 
ATOM 7655  N N4    . DC  I 5 77  ? 112.572 124.164 66.224  1.00 87.00  ? 3   DC  I N4    1 
ATOM 7656  C C5    . DC  I 5 77  ? 111.276 124.386 64.227  1.00 87.00  ? 3   DC  I C5    1 
ATOM 7657  C C6    . DC  I 5 77  ? 110.064 124.314 63.677  1.00 87.00  ? 3   DC  I C6    1 
ATOM 7658  P P     . DG  I 5 78  ? 104.029 125.865 62.530  1.00 80.00  ? 4   DG  I P     1 
ATOM 7659  O OP1   . DG  I 5 78  ? 103.213 125.424 61.381  1.00 80.00  ? 4   DG  I OP1   1 
ATOM 7660  O OP2   . DG  I 5 78  ? 104.841 127.094 62.439  1.00 80.00  ? 4   DG  I OP2   1 
ATOM 7661  O "O5'" . DG  I 5 78  ? 103.105 126.018 63.822  1.00 80.00  ? 4   DG  I "O5'" 1 
ATOM 7662  C "C5'" . DG  I 5 78  ? 102.706 124.866 64.559  1.00 80.00  ? 4   DG  I "C5'" 1 
ATOM 7663  C "C4'" . DG  I 5 78  ? 102.935 125.046 66.057  1.00 80.00  ? 4   DG  I "C4'" 1 
ATOM 7664  O "O4'" . DG  I 5 78  ? 104.352 124.950 66.357  1.00 80.00  ? 4   DG  I "O4'" 1 
ATOM 7665  C "C3'" . DG  I 5 78  ? 102.476 126.381 66.643  1.00 80.00  ? 4   DG  I "C3'" 1 
ATOM 7666  O "O3'" . DG  I 5 78  ? 101.912 126.170 67.926  1.00 80.00  ? 4   DG  I "O3'" 1 
ATOM 7667  C "C2'" . DG  I 5 78  ? 103.779 127.160 66.744  1.00 80.00  ? 4   DG  I "C2'" 1 
ATOM 7668  C "C1'" . DG  I 5 78  ? 104.746 126.072 67.114  1.00 80.00  ? 4   DG  I "C1'" 1 
ATOM 7669  N N9    . DG  I 5 78  ? 106.129 126.372 66.790  1.00 80.00  ? 4   DG  I N9    1 
ATOM 7670  C C8    . DG  I 5 78  ? 106.635 126.786 65.586  1.00 80.00  ? 4   DG  I C8    1 
ATOM 7671  N N7    . DG  I 5 78  ? 107.930 126.943 65.595  1.00 80.00  ? 4   DG  I N7    1 
ATOM 7672  C C5    . DG  I 5 78  ? 108.293 126.621 66.895  1.00 80.00  ? 4   DG  I C5    1 
ATOM 7673  C C6    . DG  I 5 78  ? 109.561 126.591 67.508  1.00 80.00  ? 4   DG  I C6    1 
ATOM 7674  O O6    . DG  I 5 78  ? 110.655 126.873 67.017  1.00 80.00  ? 4   DG  I O6    1 
ATOM 7675  N N1    . DG  I 5 78  ? 109.484 126.194 68.840  1.00 80.00  ? 4   DG  I N1    1 
ATOM 7676  C C2    . DG  I 5 78  ? 108.329 125.857 69.489  1.00 80.00  ? 4   DG  I C2    1 
ATOM 7677  N N2    . DG  I 5 78  ? 108.446 125.493 70.774  1.00 80.00  ? 4   DG  I N2    1 
ATOM 7678  N N3    . DG  I 5 78  ? 107.137 125.873 68.925  1.00 80.00  ? 4   DG  I N3    1 
ATOM 7679  C C4    . DG  I 5 78  ? 107.196 126.259 67.632  1.00 80.00  ? 4   DG  I C4    1 
ATOM 7680  P P     . DT  I 5 79  ? 100.860 127.213 68.550  1.00 79.22  ? 5   DT  I P     1 
ATOM 7681  O OP1   . DT  I 5 79  ? 99.514  126.792 68.110  1.00 79.22  ? 5   DT  I OP1   1 
ATOM 7682  O OP2   . DT  I 5 79  ? 101.310 128.595 68.271  1.00 79.22  ? 5   DT  I OP2   1 
ATOM 7683  O "O5'" . DT  I 5 79  ? 100.989 126.955 70.122  1.00 79.22  ? 5   DT  I "O5'" 1 
ATOM 7684  C "C5'" . DT  I 5 79  ? 102.224 126.460 70.651  1.00 79.22  ? 5   DT  I "C5'" 1 
ATOM 7685  C "C4'" . DT  I 5 79  ? 102.724 127.287 71.832  1.00 79.22  ? 5   DT  I "C4'" 1 
ATOM 7686  O "O4'" . DT  I 5 79  ? 104.049 127.796 71.537  1.00 79.22  ? 5   DT  I "O4'" 1 
ATOM 7687  C "C3'" . DT  I 5 79  ? 101.908 128.520 72.183  1.00 79.22  ? 5   DT  I "C3'" 1 
ATOM 7688  O "O3'" . DT  I 5 79  ? 102.189 128.899 73.529  1.00 79.22  ? 5   DT  I "O3'" 1 
ATOM 7689  C "C2'" . DT  I 5 79  ? 102.501 129.538 71.220  1.00 79.22  ? 5   DT  I "C2'" 1 
ATOM 7690  C "C1'" . DT  I 5 79  ? 103.982 129.197 71.351  1.00 79.22  ? 5   DT  I "C1'" 1 
ATOM 7691  N N1    . DT  I 5 79  ? 104.822 129.563 70.163  1.00 79.22  ? 5   DT  I N1    1 
ATOM 7692  C C2    . DT  I 5 79  ? 106.186 129.497 70.283  1.00 79.22  ? 5   DT  I C2    1 
ATOM 7693  O O2    . DT  I 5 79  ? 106.744 129.171 71.309  1.00 79.22  ? 5   DT  I O2    1 
ATOM 7694  N N3    . DT  I 5 79  ? 106.879 129.841 69.161  1.00 79.22  ? 5   DT  I N3    1 
ATOM 7695  C C4    . DT  I 5 79  ? 106.365 130.227 67.944  1.00 79.22  ? 5   DT  I C4    1 
ATOM 7696  O O4    . DT  I 5 79  ? 107.082 130.511 66.994  1.00 79.22  ? 5   DT  I O4    1 
ATOM 7697  C C5    . DT  I 5 79  ? 104.925 130.278 67.870  1.00 79.22  ? 5   DT  I C5    1 
ATOM 7698  C C7    . DT  I 5 79  ? 104.254 130.705 66.595  1.00 79.22  ? 5   DT  I C7    1 
ATOM 7699  C C6    . DT  I 5 79  ? 104.224 129.945 68.973  1.00 79.22  ? 5   DT  I C6    1 
ATOM 7700  P P     . DA  I 5 80  ? 101.327 128.344 74.769  1.00 76.06  ? 6   DA  I P     1 
ATOM 7701  O OP1   . DA  I 5 80  ? 100.838 126.979 74.486  1.00 76.06  ? 6   DA  I OP1   1 
ATOM 7702  O OP2   . DA  I 5 80  ? 100.347 129.391 75.116  1.00 76.06  ? 6   DA  I OP2   1 
ATOM 7703  O "O5'" . DA  I 5 80  ? 102.395 128.292 75.962  1.00 76.06  ? 6   DA  I "O5'" 1 
ATOM 7704  C "C5'" . DA  I 5 80  ? 103.786 128.152 75.658  1.00 76.06  ? 6   DA  I "C5'" 1 
ATOM 7705  C "C4'" . DA  I 5 80  ? 104.633 129.240 76.309  1.00 76.06  ? 6   DA  I "C4'" 1 
ATOM 7706  O "O4'" . DA  I 5 80  ? 105.313 130.019 75.286  1.00 76.06  ? 6   DA  I "O4'" 1 
ATOM 7707  C "C3'" . DA  I 5 80  ? 103.885 130.267 77.130  1.00 76.06  ? 6   DA  I "C3'" 1 
ATOM 7708  O "O3'" . DA  I 5 80  ? 104.780 130.829 78.040  1.00 76.06  ? 6   DA  I "O3'" 1 
ATOM 7709  C "C2'" . DA  I 5 80  ? 103.526 131.287 76.068  1.00 76.06  ? 6   DA  I "C2'" 1 
ATOM 7710  C "C1'" . DA  I 5 80  ? 104.847 131.357 75.325  1.00 76.06  ? 6   DA  I "C1'" 1 
ATOM 7711  N N9    . DA  I 5 80  ? 104.723 131.830 73.955  1.00 76.06  ? 6   DA  I N9    1 
ATOM 7712  C C8    . DA  I 5 80  ? 103.571 132.133 73.292  1.00 76.06  ? 6   DA  I C8    1 
ATOM 7713  N N7    . DA  I 5 80  ? 103.758 132.512 72.052  1.00 76.06  ? 6   DA  I N7    1 
ATOM 7714  C C5    . DA  I 5 80  ? 105.129 132.452 71.891  1.00 76.06  ? 6   DA  I C5    1 
ATOM 7715  C C6    . DA  I 5 80  ? 105.969 132.734 70.797  1.00 76.06  ? 6   DA  I C6    1 
ATOM 7716  N N6    . DA  I 5 80  ? 105.514 133.142 69.612  1.00 76.06  ? 6   DA  I N6    1 
ATOM 7717  N N1    . DA  I 5 80  ? 107.297 132.568 70.967  1.00 76.06  ? 6   DA  I N1    1 
ATOM 7718  C C2    . DA  I 5 80  ? 107.747 132.156 72.158  1.00 76.06  ? 6   DA  I C2    1 
ATOM 7719  N N3    . DA  I 5 80  ? 107.055 131.863 73.259  1.00 76.06  ? 6   DA  I N3    1 
ATOM 7720  C C4    . DA  I 5 80  ? 105.740 132.030 73.054  1.00 76.06  ? 6   DA  I C4    1 
ATOM 7721  P P     . DC  I 5 81  ? 104.691 130.462 79.594  1.00 68.29  ? 7   DC  I P     1 
ATOM 7722  O OP1   . DC  I 5 81  ? 104.588 128.993 79.714  1.00 68.29  ? 7   DC  I OP1   1 
ATOM 7723  O OP2   . DC  I 5 81  ? 103.686 131.373 80.176  1.00 68.29  ? 7   DC  I OP2   1 
ATOM 7724  O "O5'" . DC  I 5 81  ? 106.107 130.896 80.165  1.00 68.29  ? 7   DC  I "O5'" 1 
ATOM 7725  C "C5'" . DC  I 5 81  ? 107.254 130.661 79.393  1.00 68.29  ? 7   DC  I "C5'" 1 
ATOM 7726  C "C4'" . DC  I 5 81  ? 107.953 131.956 79.062  1.00 68.29  ? 7   DC  I "C4'" 1 
ATOM 7727  O "O4'" . DC  I 5 81  ? 107.454 132.487 77.809  1.00 68.29  ? 7   DC  I "O4'" 1 
ATOM 7728  C "C3'" . DC  I 5 81  ? 107.801 133.070 80.086  1.00 68.29  ? 7   DC  I "C3'" 1 
ATOM 7729  O "O3'" . DC  I 5 81  ? 109.050 133.702 80.229  1.00 68.29  ? 7   DC  I "O3'" 1 
ATOM 7730  C "C2'" . DC  I 5 81  ? 106.788 133.993 79.410  1.00 68.29  ? 7   DC  I "C2'" 1 
ATOM 7731  C "C1'" . DC  I 5 81  ? 107.241 133.863 77.971  1.00 68.29  ? 7   DC  I "C1'" 1 
ATOM 7732  N N1    . DC  I 5 81  ? 106.255 134.313 76.945  1.00 68.29  ? 7   DC  I N1    1 
ATOM 7733  C C2    . DC  I 5 81  ? 106.711 134.660 75.673  1.00 68.29  ? 7   DC  I C2    1 
ATOM 7734  O O2    . DC  I 5 81  ? 107.916 134.628 75.433  1.00 68.29  ? 7   DC  I O2    1 
ATOM 7735  N N3    . DC  I 5 81  ? 105.826 135.066 74.740  1.00 68.29  ? 7   DC  I N3    1 
ATOM 7736  C C4    . DC  I 5 81  ? 104.530 135.109 75.028  1.00 68.29  ? 7   DC  I C4    1 
ATOM 7737  N N4    . DC  I 5 81  ? 103.692 135.512 74.066  1.00 68.29  ? 7   DC  I N4    1 
ATOM 7738  C C5    . DC  I 5 81  ? 104.039 134.760 76.320  1.00 68.29  ? 7   DC  I C5    1 
ATOM 7739  C C6    . DC  I 5 81  ? 104.930 134.368 77.241  1.00 68.29  ? 7   DC  I C6    1 
ATOM 7740  P P     . DG  I 5 82  ? 109.684 133.964 81.677  1.00 60.89  ? 8   DG  I P     1 
ATOM 7741  O OP1   . DG  I 5 82  ? 110.105 132.676 82.244  1.00 60.89  ? 8   DG  I OP1   1 
ATOM 7742  O OP2   . DG  I 5 82  ? 108.781 134.860 82.425  1.00 60.89  ? 8   DG  I OP2   1 
ATOM 7743  O "O5'" . DG  I 5 82  ? 111.015 134.765 81.356  1.00 60.89  ? 8   DG  I "O5'" 1 
ATOM 7744  C "C5'" . DG  I 5 82  ? 111.897 134.278 80.370  1.00 60.89  ? 8   DG  I "C5'" 1 
ATOM 7745  C "C4'" . DG  I 5 82  ? 112.470 135.408 79.525  1.00 60.89  ? 8   DG  I "C4'" 1 
ATOM 7746  O "O4'" . DG  I 5 82  ? 111.501 135.831 78.544  1.00 60.89  ? 8   DG  I "O4'" 1 
ATOM 7747  C "C3'" . DG  I 5 82  ? 112.894 136.671 80.269  1.00 60.89  ? 8   DG  I "C3'" 1 
ATOM 7748  O "O3'" . DG  I 5 82  ? 114.069 137.181 79.656  1.00 60.89  ? 8   DG  I "O3'" 1 
ATOM 7749  C "C2'" . DG  I 5 82  ? 111.700 137.606 80.069  1.00 60.89  ? 8   DG  I "C2'" 1 
ATOM 7750  C "C1'" . DG  I 5 82  ? 111.235 137.211 78.679  1.00 60.89  ? 8   DG  I "C1'" 1 
ATOM 7751  N N9    . DG  I 5 82  ? 109.813 137.383 78.454  1.00 60.89  ? 8   DG  I N9    1 
ATOM 7752  C C8    . DG  I 5 82  ? 108.794 136.885 79.213  1.00 60.89  ? 8   DG  I C8    1 
ATOM 7753  N N7    . DG  I 5 82  ? 107.616 137.170 78.746  1.00 60.89  ? 8   DG  I N7    1 
ATOM 7754  C C5    . DG  I 5 82  ? 107.876 137.876 77.595  1.00 60.89  ? 8   DG  I C5    1 
ATOM 7755  C C6    . DG  I 5 82  ? 106.992 138.447 76.673  1.00 60.89  ? 8   DG  I C6    1 
ATOM 7756  O O6    . DG  I 5 82  ? 105.759 138.430 76.686  1.00 60.89  ? 8   DG  I O6    1 
ATOM 7757  N N1    . DG  I 5 82  ? 107.665 139.092 75.652  1.00 60.89  ? 8   DG  I N1    1 
ATOM 7758  C C2    . DG  I 5 82  ? 109.025 139.185 75.549  1.00 60.89  ? 8   DG  I C2    1 
ATOM 7759  N N2    . DG  I 5 82  ? 109.498 139.837 74.487  1.00 60.89  ? 8   DG  I N2    1 
ATOM 7760  N N3    . DG  I 5 82  ? 109.867 138.642 76.403  1.00 60.89  ? 8   DG  I N3    1 
ATOM 7761  C C4    . DG  I 5 82  ? 109.224 138.012 77.400  1.00 60.89  ? 8   DG  I C4    1 
ATOM 7762  P P     . DT  I 5 83  ? 114.835 138.460 80.244  1.00 62.82  ? 9   DT  I P     1 
ATOM 7763  O OP1   . DT  I 5 83  ? 116.240 138.352 79.801  1.00 62.82  ? 9   DT  I OP1   1 
ATOM 7764  O OP2   . DT  I 5 83  ? 114.513 138.592 81.677  1.00 62.82  ? 9   DT  I OP2   1 
ATOM 7765  O "O5'" . DT  I 5 83  ? 114.179 139.677 79.458  1.00 62.82  ? 9   DT  I "O5'" 1 
ATOM 7766  C "C5'" . DT  I 5 83  ? 114.085 139.623 78.055  1.00 62.82  ? 9   DT  I "C5'" 1 
ATOM 7767  C "C4'" . DT  I 5 83  ? 113.935 141.010 77.469  1.00 62.82  ? 9   DT  I "C4'" 1 
ATOM 7768  O "O4'" . DT  I 5 83  ? 112.571 141.219 77.057  1.00 62.82  ? 9   DT  I "O4'" 1 
ATOM 7769  C "C3'" . DT  I 5 83  ? 114.279 142.159 78.402  1.00 62.82  ? 9   DT  I "C3'" 1 
ATOM 7770  O "O3'" . DT  I 5 83  ? 114.965 143.135 77.672  1.00 62.82  ? 9   DT  I "O3'" 1 
ATOM 7771  C "C2'" . DT  I 5 83  ? 112.914 142.654 78.860  1.00 62.82  ? 9   DT  I "C2'" 1 
ATOM 7772  C "C1'" . DT  I 5 83  ? 112.061 142.388 77.637  1.00 62.82  ? 9   DT  I "C1'" 1 
ATOM 7773  N N1    . DT  I 5 83  ? 110.681 142.108 77.964  1.00 62.82  ? 9   DT  I N1    1 
ATOM 7774  C C2    . DT  I 5 83  ? 109.688 142.583 77.158  1.00 62.82  ? 9   DT  I C2    1 
ATOM 7775  O O2    . DT  I 5 83  ? 109.895 143.264 76.175  1.00 62.82  ? 9   DT  I O2    1 
ATOM 7776  N N3    . DT  I 5 83  ? 108.431 142.239 77.552  1.00 62.82  ? 9   DT  I N3    1 
ATOM 7777  C C4    . DT  I 5 83  ? 108.085 141.475 78.642  1.00 62.82  ? 9   DT  I C4    1 
ATOM 7778  O O4    . DT  I 5 83  ? 106.926 141.216 78.922  1.00 62.82  ? 9   DT  I O4    1 
ATOM 7779  C C5    . DT  I 5 83  ? 109.181 141.006 79.435  1.00 62.82  ? 9   DT  I C5    1 
ATOM 7780  C C7    . DT  I 5 83  ? 108.927 140.168 80.647  1.00 62.82  ? 9   DT  I C7    1 
ATOM 7781  C C6    . DT  I 5 83  ? 110.410 141.335 79.058  1.00 62.82  ? 9   DT  I C6    1 
ATOM 7782  P P     . DG  I 5 84  ? 115.481 144.475 78.382  1.00 68.40  ? 10  DG  I P     1 
ATOM 7783  O OP1   . DG  I 5 84  ? 116.638 144.940 77.598  1.00 68.40  ? 10  DG  I OP1   1 
ATOM 7784  O OP2   . DG  I 5 84  ? 115.581 144.272 79.842  1.00 68.40  ? 10  DG  I OP2   1 
ATOM 7785  O "O5'" . DG  I 5 84  ? 114.325 145.510 78.073  1.00 68.40  ? 10  DG  I "O5'" 1 
ATOM 7786  C "C5'" . DG  I 5 84  ? 113.971 145.725 76.747  1.00 68.40  ? 10  DG  I "C5'" 1 
ATOM 7787  C "C4'" . DG  I 5 84  ? 112.833 146.698 76.657  1.00 68.40  ? 10  DG  I "C4'" 1 
ATOM 7788  O "O4'" . DG  I 5 84  ? 111.583 146.007 76.899  1.00 68.40  ? 10  DG  I "O4'" 1 
ATOM 7789  C "C3'" . DG  I 5 84  ? 112.894 147.848 77.660  1.00 68.40  ? 10  DG  I "C3'" 1 
ATOM 7790  O "O3'" . DG  I 5 84  ? 112.673 149.061 76.969  1.00 68.40  ? 10  DG  I "O3'" 1 
ATOM 7791  C "C2'" . DG  I 5 84  ? 111.752 147.522 78.616  1.00 68.40  ? 10  DG  I "C2'" 1 
ATOM 7792  C "C1'" . DG  I 5 84  ? 110.780 146.830 77.688  1.00 68.40  ? 10  DG  I "C1'" 1 
ATOM 7793  N N9    . DG  I 5 84  ? 109.818 146.012 78.396  1.00 68.40  ? 10  DG  I N9    1 
ATOM 7794  C C8    . DG  I 5 84  ? 110.079 145.177 79.443  1.00 68.40  ? 10  DG  I C8    1 
ATOM 7795  N N7    . DG  I 5 84  ? 109.026 144.577 79.898  1.00 68.40  ? 10  DG  I N7    1 
ATOM 7796  C C5    . DG  I 5 84  ? 108.000 145.050 79.108  1.00 68.40  ? 10  DG  I C5    1 
ATOM 7797  C C6    . DG  I 5 84  ? 106.634 144.744 79.143  1.00 68.40  ? 10  DG  I C6    1 
ATOM 7798  O O6    . DG  I 5 84  ? 106.060 143.966 79.900  1.00 68.40  ? 10  DG  I O6    1 
ATOM 7799  N N1    . DG  I 5 84  ? 105.921 145.434 78.179  1.00 68.40  ? 10  DG  I N1    1 
ATOM 7800  C C2    . DG  I 5 84  ? 106.467 146.311 77.281  1.00 68.40  ? 10  DG  I C2    1 
ATOM 7801  N N2    . DG  I 5 84  ? 105.614 146.878 76.417  1.00 68.40  ? 10  DG  I N2    1 
ATOM 7802  N N3    . DG  I 5 84  ? 107.762 146.611 77.235  1.00 68.40  ? 10  DG  I N3    1 
ATOM 7803  C C4    . DG  I 5 84  ? 108.465 145.938 78.179  1.00 68.40  ? 10  DG  I C4    1 
ATOM 7804  P P     . DC  I 5 85  ? 112.783 150.495 77.684  1.00 70.25  ? 11  DC  I P     1 
ATOM 7805  O OP1   . DC  I 5 85  ? 113.714 151.273 76.847  1.00 70.25  ? 11  DC  I OP1   1 
ATOM 7806  O OP2   . DC  I 5 85  ? 113.054 150.393 79.132  1.00 70.25  ? 11  DC  I OP2   1 
ATOM 7807  O "O5'" . DC  I 5 85  ? 111.323 151.094 77.483  1.00 70.25  ? 11  DC  I "O5'" 1 
ATOM 7808  C "C5'" . DC  I 5 85  ? 110.797 151.173 76.176  1.00 70.25  ? 11  DC  I "C5'" 1 
ATOM 7809  C "C4'" . DC  I 5 85  ? 109.291 151.329 76.191  1.00 70.25  ? 11  DC  I "C4'" 1 
ATOM 7810  O "O4'" . DC  I 5 85  ? 108.681 150.201 76.868  1.00 70.25  ? 11  DC  I "O4'" 1 
ATOM 7811  C "C3'" . DC  I 5 85  ? 108.766 152.579 76.895  1.00 70.25  ? 11  DC  I "C3'" 1 
ATOM 7812  O "O3'" . DC  I 5 85  ? 107.702 153.139 76.130  1.00 70.25  ? 11  DC  I "O3'" 1 
ATOM 7813  C "C2'" . DC  I 5 85  ? 108.266 152.031 78.229  1.00 70.25  ? 11  DC  I "C2'" 1 
ATOM 7814  C "C1'" . DC  I 5 85  ? 107.743 150.672 77.806  1.00 70.25  ? 11  DC  I "C1'" 1 
ATOM 7815  N N1    . DC  I 5 85  ? 107.677 149.691 78.907  1.00 70.25  ? 11  DC  I N1    1 
ATOM 7816  C C2    . DC  I 5 85  ? 106.449 149.137 79.293  1.00 70.25  ? 11  DC  I C2    1 
ATOM 7817  O O2    . DC  I 5 85  ? 105.416 149.482 78.718  1.00 70.25  ? 11  DC  I O2    1 
ATOM 7818  N N3    . DC  I 5 85  ? 106.430 148.233 80.298  1.00 70.25  ? 11  DC  I N3    1 
ATOM 7819  C C4    . DC  I 5 85  ? 107.566 147.881 80.893  1.00 70.25  ? 11  DC  I C4    1 
ATOM 7820  N N4    . DC  I 5 85  ? 107.507 146.990 81.883  1.00 70.25  ? 11  DC  I N4    1 
ATOM 7821  C C5    . DC  I 5 85  ? 108.817 148.432 80.511  1.00 70.25  ? 11  DC  I C5    1 
ATOM 7822  C C6    . DC  I 5 85  ? 108.823 149.322 79.525  1.00 70.25  ? 11  DC  I C6    1 
ATOM 7823  P P     . DG  I 5 86  ? 107.341 154.699 76.240  1.00 76.60  ? 12  DG  I P     1 
ATOM 7824  O OP1   . DG  I 5 86  ? 106.932 155.146 74.895  1.00 76.60  ? 12  DG  I OP1   1 
ATOM 7825  O OP2   . DG  I 5 86  ? 108.456 155.382 76.922  1.00 76.60  ? 12  DG  I OP2   1 
ATOM 7826  O "O5'" . DG  I 5 86  ? 106.065 154.726 77.201  1.00 76.60  ? 12  DG  I "O5'" 1 
ATOM 7827  C "C5'" . DG  I 5 86  ? 104.926 155.489 76.840  1.00 76.60  ? 12  DG  I "C5'" 1 
ATOM 7828  C "C4'" . DG  I 5 86  ? 103.661 154.883 77.419  1.00 76.60  ? 12  DG  I "C4'" 1 
ATOM 7829  O "O4'" . DG  I 5 86  ? 103.974 153.602 78.019  1.00 76.60  ? 12  DG  I "O4'" 1 
ATOM 7830  C "C3'" . DG  I 5 86  ? 102.988 155.712 78.516  1.00 76.60  ? 12  DG  I "C3'" 1 
ATOM 7831  O "O3'" . DG  I 5 86  ? 101.583 155.736 78.320  1.00 76.60  ? 12  DG  I "O3'" 1 
ATOM 7832  C "C2'" . DG  I 5 86  ? 103.354 154.963 79.782  1.00 76.60  ? 12  DG  I "C2'" 1 
ATOM 7833  C "C1'" . DG  I 5 86  ? 103.387 153.535 79.289  1.00 76.60  ? 12  DG  I "C1'" 1 
ATOM 7834  N N9    . DG  I 5 86  ? 104.197 152.659 80.122  1.00 76.60  ? 12  DG  I N9    1 
ATOM 7835  C C8    . DG  I 5 86  ? 105.559 152.686 80.256  1.00 76.60  ? 12  DG  I C8    1 
ATOM 7836  N N7    . DG  I 5 86  ? 106.018 151.779 81.070  1.00 76.60  ? 12  DG  I N7    1 
ATOM 7837  C C5    . DG  I 5 86  ? 104.884 151.108 81.509  1.00 76.60  ? 12  DG  I C5    1 
ATOM 7838  C C6    . DG  I 5 86  ? 104.760 150.025 82.406  1.00 76.60  ? 12  DG  I C6    1 
ATOM 7839  O O6    . DG  I 5 86  ? 105.655 149.433 83.011  1.00 76.60  ? 12  DG  I O6    1 
ATOM 7840  N N1    . DG  I 5 86  ? 103.435 149.644 82.581  1.00 76.60  ? 12  DG  I N1    1 
ATOM 7841  C C2    . DG  I 5 86  ? 102.362 150.232 81.956  1.00 76.60  ? 12  DG  I C2    1 
ATOM 7842  N N2    . DG  I 5 86  ? 101.153 149.726 82.244  1.00 76.60  ? 12  DG  I N2    1 
ATOM 7843  N N3    . DG  I 5 86  ? 102.465 151.251 81.111  1.00 76.60  ? 12  DG  I N3    1 
ATOM 7844  C C4    . DG  I 5 86  ? 103.754 151.632 80.931  1.00 76.60  ? 12  DG  I C4    1 
ATOM 7845  P P     . DT  I 5 87  ? 100.642 156.621 79.280  1.00 81.88  ? 13  DT  I P     1 
ATOM 7846  O OP1   . DT  I 5 87  ? 99.482  157.062 78.481  1.00 81.88  ? 13  DT  I OP1   1 
ATOM 7847  O OP2   . DT  I 5 87  ? 101.460 157.621 79.996  1.00 81.88  ? 13  DT  I OP2   1 
ATOM 7848  O "O5'" . DT  I 5 87  ? 100.114 155.580 80.361  1.00 81.88  ? 13  DT  I "O5'" 1 
ATOM 7849  C "C5'" . DT  I 5 87  ? 99.220  154.556 79.970  1.00 81.88  ? 13  DT  I "C5'" 1 
ATOM 7850  C "C4'" . DT  I 5 87  ? 98.603  153.884 81.181  1.00 81.88  ? 13  DT  I "C4'" 1 
ATOM 7851  O "O4'" . DT  I 5 87  ? 99.579  153.025 81.824  1.00 81.88  ? 13  DT  I "O4'" 1 
ATOM 7852  C "C3'" . DT  I 5 87  ? 98.091  154.831 82.261  1.00 81.88  ? 13  DT  I "C3'" 1 
ATOM 7853  O "O3'" . DT  I 5 87  ? 96.817  154.382 82.686  1.00 81.88  ? 13  DT  I "O3'" 1 
ATOM 7854  C "C2'" . DT  I 5 87  ? 99.154  154.718 83.366  1.00 81.88  ? 13  DT  I "C2'" 1 
ATOM 7855  C "C1'" . DT  I 5 87  ? 99.600  153.279 83.210  1.00 81.88  ? 13  DT  I "C1'" 1 
ATOM 7856  N N1    . DT  I 5 87  ? 100.975 152.981 83.695  1.00 81.88  ? 13  DT  I N1    1 
ATOM 7857  C C2    . DT  I 5 87  ? 101.160 151.913 84.532  1.00 81.88  ? 13  DT  I C2    1 
ATOM 7858  O O2    . DT  I 5 87  ? 100.250 151.211 84.922  1.00 81.88  ? 13  DT  I O2    1 
ATOM 7859  N N3    . DT  I 5 87  ? 102.460 151.681 84.885  1.00 81.88  ? 13  DT  I N3    1 
ATOM 7860  C C4    . DT  I 5 87  ? 103.567 152.398 84.496  1.00 81.88  ? 13  DT  I C4    1 
ATOM 7861  O O4    . DT  I 5 87  ? 104.696 152.126 84.873  1.00 81.88  ? 13  DT  I O4    1 
ATOM 7862  C C5    . DT  I 5 87  ? 103.309 153.498 83.624  1.00 81.88  ? 13  DT  I C5    1 
ATOM 7863  C C7    . DT  I 5 87  ? 104.452 154.337 83.157  1.00 81.88  ? 13  DT  I C7    1 
ATOM 7864  C C6    . DT  I 5 87  ? 102.041 153.731 83.249  1.00 81.88  ? 13  DT  I C6    1 
ATOM 7865  P P     . DT  I 5 88  ? 95.997  155.161 83.822  1.00 84.35  ? 14  DT  I P     1 
ATOM 7866  O OP1   . DT  I 5 88  ? 94.567  154.998 83.495  1.00 84.35  ? 14  DT  I OP1   1 
ATOM 7867  O OP2   . DT  I 5 88  ? 96.544  156.522 84.010  1.00 84.35  ? 14  DT  I OP2   1 
ATOM 7868  O "O5'" . DT  I 5 88  ? 96.295  154.308 85.130  1.00 84.35  ? 14  DT  I "O5'" 1 
ATOM 7869  C "C5'" . DT  I 5 88  ? 95.782  152.982 85.249  1.00 84.35  ? 14  DT  I "C5'" 1 
ATOM 7870  C "C4'" . DT  I 5 88  ? 96.227  152.304 86.544  1.00 84.35  ? 14  DT  I "C4'" 1 
ATOM 7871  O "O4'" . DT  I 5 88  ? 97.670  152.161 86.573  1.00 84.35  ? 14  DT  I "O4'" 1 
ATOM 7872  C "C3'" . DT  I 5 88  ? 95.872  153.030 87.846  1.00 84.35  ? 14  DT  I "C3'" 1 
ATOM 7873  O "O3'" . DT  I 5 88  ? 95.706  152.082 88.870  1.00 84.35  ? 14  DT  I "O3'" 1 
ATOM 7874  C "C2'" . DT  I 5 88  ? 97.153  153.792 88.106  1.00 84.35  ? 14  DT  I "C2'" 1 
ATOM 7875  C "C1'" . DT  I 5 88  ? 98.131  152.680 87.797  1.00 84.35  ? 14  DT  I "C1'" 1 
ATOM 7876  N N1    . DT  I 5 88  ? 99.543  153.088 87.632  1.00 84.35  ? 14  DT  I N1    1 
ATOM 7877  C C2    . DT  I 5 88  ? 100.522 152.277 88.140  1.00 84.35  ? 14  DT  I C2    1 
ATOM 7878  O O2    . DT  I 5 88  ? 100.286 151.254 88.748  1.00 84.35  ? 14  DT  I O2    1 
ATOM 7879  N N3    . DT  I 5 88  ? 101.795 152.710 87.920  1.00 84.35  ? 14  DT  I N3    1 
ATOM 7880  C C4    . DT  I 5 88  ? 102.180 153.848 87.250  1.00 84.35  ? 14  DT  I C4    1 
ATOM 7881  O O4    . DT  I 5 88  ? 103.355 154.155 87.106  1.00 84.35  ? 14  DT  I O4    1 
ATOM 7882  C C5    . DT  I 5 88  ? 101.108 154.651 86.730  1.00 84.35  ? 14  DT  I C5    1 
ATOM 7883  C C7    . DT  I 5 88  ? 101.414 155.916 85.991  1.00 84.35  ? 14  DT  I C7    1 
ATOM 7884  C C6    . DT  I 5 88  ? 99.852  154.234 86.937  1.00 84.35  ? 14  DT  I C6    1 
ATOM 7885  P P     . DT  I 5 89  ? 94.300  151.373 89.178  1.00 82.82  ? 15  DT  I P     1 
ATOM 7886  O OP1   . DT  I 5 89  ? 93.717  150.782 87.957  1.00 82.82  ? 15  DT  I OP1   1 
ATOM 7887  O OP2   . DT  I 5 89  ? 93.505  152.318 89.983  1.00 82.82  ? 15  DT  I OP2   1 
ATOM 7888  O "O5'" . DT  I 5 89  ? 94.748  150.175 90.130  1.00 82.82  ? 15  DT  I "O5'" 1 
ATOM 7889  C "C5'" . DT  I 5 89  ? 96.121  149.772 90.145  1.00 82.82  ? 15  DT  I "C5'" 1 
ATOM 7890  C "C4'" . DT  I 5 89  ? 96.754  150.049 91.497  1.00 82.82  ? 15  DT  I "C4'" 1 
ATOM 7891  O "O4'" . DT  I 5 89  ? 98.075  150.640 91.328  1.00 82.82  ? 15  DT  I "O4'" 1 
ATOM 7892  C "C3'" . DT  I 5 89  ? 95.971  151.024 92.380  1.00 82.82  ? 15  DT  I "C3'" 1 
ATOM 7893  O "O3'" . DT  I 5 89  ? 95.966  150.565 93.713  1.00 82.82  ? 15  DT  I "O3'" 1 
ATOM 7894  C "C2'" . DT  I 5 89  ? 96.778  152.313 92.246  1.00 82.82  ? 15  DT  I "C2'" 1 
ATOM 7895  C "C1'" . DT  I 5 89  ? 98.183  151.746 92.195  1.00 82.82  ? 15  DT  I "C1'" 1 
ATOM 7896  N N1    . DT  I 5 89  ? 99.218  152.685 91.658  1.00 82.82  ? 15  DT  I N1    1 
ATOM 7897  C C2    . DT  I 5 89  ? 100.537 152.326 91.716  1.00 82.82  ? 15  DT  I C2    1 
ATOM 7898  O O2    . DT  I 5 89  ? 100.919 151.285 92.200  1.00 82.82  ? 15  DT  I O2    1 
ATOM 7899  N N3    . DT  I 5 89  ? 101.403 153.242 91.192  1.00 82.82  ? 15  DT  I N3    1 
ATOM 7900  C C4    . DT  I 5 89  ? 101.087 154.459 90.624  1.00 82.82  ? 15  DT  I C4    1 
ATOM 7901  O O4    . DT  I 5 89  ? 101.933 155.215 90.174  1.00 82.82  ? 15  DT  I O4    1 
ATOM 7902  C C5    . DT  I 5 89  ? 99.689  154.775 90.589  1.00 82.82  ? 15  DT  I C5    1 
ATOM 7903  C C7    . DT  I 5 89  ? 99.232  156.081 89.999  1.00 82.82  ? 15  DT  I C7    1 
ATOM 7904  C C6    . DT  I 5 89  ? 98.833  153.891 91.122  1.00 82.82  ? 15  DT  I C6    1 
ATOM 7905  P P     . DA  I 5 90  ? 95.131  149.264 94.146  1.00 75.58  ? 16  DA  I P     1 
ATOM 7906  O OP1   . DA  I 5 90  ? 94.149  148.909 93.101  1.00 75.58  ? 16  DA  I OP1   1 
ATOM 7907  O OP2   . DA  I 5 90  ? 94.661  149.506 95.523  1.00 75.58  ? 16  DA  I OP2   1 
ATOM 7908  O "O5'" . DA  I 5 90  ? 96.247  148.132 94.251  1.00 75.58  ? 16  DA  I "O5'" 1 
ATOM 7909  C "C5'" . DA  I 5 90  ? 96.507  147.527 95.499  1.00 75.58  ? 16  DA  I "C5'" 1 
ATOM 7910  C "C4'" . DA  I 5 90  ? 97.699  148.168 96.185  1.00 75.58  ? 16  DA  I "C4'" 1 
ATOM 7911  O "O4'" . DA  I 5 90  ? 98.049  149.419 95.534  1.00 75.58  ? 16  DA  I "O4'" 1 
ATOM 7912  C "C3'" . DA  I 5 90  ? 97.482  148.512 97.661  1.00 75.58  ? 16  DA  I "C3'" 1 
ATOM 7913  O "O3'" . DA  I 5 90  ? 98.620  148.136 98.404  1.00 75.58  ? 16  DA  I "O3'" 1 
ATOM 7914  C "C2'" . DA  I 5 90  ? 97.329  150.031 97.632  1.00 75.58  ? 16  DA  I "C2'" 1 
ATOM 7915  C "C1'" . DA  I 5 90  ? 98.312  150.367 96.535  1.00 75.58  ? 16  DA  I "C1'" 1 
ATOM 7916  N N9    . DA  I 5 90  ? 98.172  151.704 95.978  1.00 75.58  ? 16  DA  I N9    1 
ATOM 7917  C C8    . DA  I 5 90  ? 97.027  152.423 95.833  1.00 75.58  ? 16  DA  I C8    1 
ATOM 7918  N N7    . DA  I 5 90  ? 97.207  153.596 95.286  1.00 75.58  ? 16  DA  I N7    1 
ATOM 7919  C C5    . DA  I 5 90  ? 98.564  153.654 95.072  1.00 75.58  ? 16  DA  I C5    1 
ATOM 7920  C C6    . DA  I 5 90  ? 99.387  154.636 94.513  1.00 75.58  ? 16  DA  I C6    1 
ATOM 7921  N N6    . DA  I 5 90  ? 98.924  155.802 94.067  1.00 75.58  ? 16  DA  I N6    1 
ATOM 7922  N N1    . DA  I 5 90  ? 100.709 154.386 94.444  1.00 75.58  ? 16  DA  I N1    1 
ATOM 7923  C C2    . DA  I 5 90  ? 101.159 153.212 94.894  1.00 75.58  ? 16  DA  I C2    1 
ATOM 7924  N N3    . DA  I 5 90  ? 100.477 152.209 95.435  1.00 75.58  ? 16  DA  I N3    1 
ATOM 7925  C C4    . DA  I 5 90  ? 99.175  152.495 95.490  1.00 75.58  ? 16  DA  I C4    1 
ATOM 7926  P P     . DA  I 5 91  ? 98.650  146.756 99.220  1.00 71.50  ? 17  DA  I P     1 
ATOM 7927  O OP1   . DA  I 5 91  ? 98.077  145.700 98.359  1.00 71.50  ? 17  DA  I OP1   1 
ATOM 7928  O OP2   . DA  I 5 91  ? 98.058  147.000 100.550 1.00 71.50  ? 17  DA  I OP2   1 
ATOM 7929  O "O5'" . DA  I 5 91  ? 100.212 146.493 99.429  1.00 71.50  ? 17  DA  I "O5'" 1 
ATOM 7930  C "C5'" . DA  I 5 91  ? 101.108 146.687 98.344  1.00 71.50  ? 17  DA  I "C5'" 1 
ATOM 7931  C "C4'" . DA  I 5 91  ? 102.490 147.138 98.803  1.00 71.50  ? 17  DA  I "C4'" 1 
ATOM 7932  O "O4'" . DA  I 5 91  ? 102.692 148.526 98.451  1.00 71.50  ? 17  DA  I "O4'" 1 
ATOM 7933  C "C3'" . DA  I 5 91  ? 102.784 147.054 100.288 1.00 71.50  ? 17  DA  I "C3'" 1 
ATOM 7934  O "O3'" . DA  I 5 91  ? 104.188 146.842 100.467 1.00 71.50  ? 17  DA  I "O3'" 1 
ATOM 7935  C "C2'" . DA  I 5 91  ? 102.357 148.434 100.784 1.00 71.50  ? 17  DA  I "C2'" 1 
ATOM 7936  C "C1'" . DA  I 5 91  ? 102.739 149.333 99.615  1.00 71.50  ? 17  DA  I "C1'" 1 
ATOM 7937  N N9    . DA  I 5 91  ? 101.825 150.458 99.408  1.00 71.50  ? 17  DA  I N9    1 
ATOM 7938  C C8    . DA  I 5 91  ? 100.468 150.407 99.408  1.00 71.50  ? 17  DA  I C8    1 
ATOM 7939  N N7    . DA  I 5 91  ? 99.895  151.557 99.175  1.00 71.50  ? 17  DA  I N7    1 
ATOM 7940  C C5    . DA  I 5 91  ? 100.942 152.420 98.982  1.00 71.50  ? 17  DA  I C5    1 
ATOM 7941  C C6    . DA  I 5 91  ? 100.985 153.789 98.687  1.00 71.50  ? 17  DA  I C6    1 
ATOM 7942  N N6    . DA  I 5 91  ? 99.892  154.530 98.533  1.00 71.50  ? 17  DA  I N6    1 
ATOM 7943  N N1    . DA  I 5 91  ? 102.192 154.372 98.574  1.00 71.50  ? 17  DA  I N1    1 
ATOM 7944  C C2    . DA  I 5 91  ? 103.281 153.611 98.732  1.00 71.50  ? 17  DA  I C2    1 
ATOM 7945  N N3    . DA  I 5 91  ? 103.362 152.310 99.013  1.00 71.50  ? 17  DA  I N3    1 
ATOM 7946  C C4    . DA  I 5 91  ? 102.145 151.769 99.117  1.00 71.50  ? 17  DA  I C4    1 
ATOM 7947  P P     . DG  I 5 92  ? 104.844 146.738 101.933 1.00 74.64  ? 18  DG  I P     1 
ATOM 7948  O OP1   . DG  I 5 92  ? 105.999 145.823 101.833 1.00 74.64  ? 18  DG  I OP1   1 
ATOM 7949  O OP2   . DG  I 5 92  ? 103.802 146.457 102.940 1.00 74.64  ? 18  DG  I OP2   1 
ATOM 7950  O "O5'" . DG  I 5 92  ? 105.441 148.191 102.179 1.00 74.64  ? 18  DG  I "O5'" 1 
ATOM 7951  C "C5'" . DG  I 5 92  ? 106.634 148.548 101.533 1.00 74.64  ? 18  DG  I "C5'" 1 
ATOM 7952  C "C4'" . DG  I 5 92  ? 107.031 149.971 101.858 1.00 74.64  ? 18  DG  I "C4'" 1 
ATOM 7953  O "O4'" . DG  I 5 92  ? 105.988 150.886 101.441 1.00 74.64  ? 18  DG  I "O4'" 1 
ATOM 7954  C "C3'" . DG  I 5 92  ? 107.293 150.250 103.329 1.00 74.64  ? 18  DG  I "C3'" 1 
ATOM 7955  O "O3'" . DG  I 5 92  ? 108.514 150.949 103.452 1.00 74.64  ? 18  DG  I "O3'" 1 
ATOM 7956  C "C2'" . DG  I 5 92  ? 106.092 151.104 103.754 1.00 74.64  ? 18  DG  I "C2'" 1 
ATOM 7957  C "C1'" . DG  I 5 92  ? 105.730 151.817 102.462 1.00 74.64  ? 18  DG  I "C1'" 1 
ATOM 7958  N N9    . DG  I 5 92  ? 104.323 152.187 102.358 1.00 74.64  ? 18  DG  I N9    1 
ATOM 7959  C C8    . DG  I 5 92  ? 103.257 151.340 102.416 1.00 74.64  ? 18  DG  I C8    1 
ATOM 7960  N N7    . DG  I 5 92  ? 102.109 151.926 102.265 1.00 74.64  ? 18  DG  I N7    1 
ATOM 7961  C C5    . DG  I 5 92  ? 102.432 153.254 102.085 1.00 74.64  ? 18  DG  I C5    1 
ATOM 7962  C C6    . DG  I 5 92  ? 101.590 154.365 101.885 1.00 74.64  ? 18  DG  I C6    1 
ATOM 7963  O O6    . DG  I 5 92  ? 100.355 154.385 101.814 1.00 74.64  ? 18  DG  I O6    1 
ATOM 7964  N N1    . DG  I 5 92  ? 102.314 155.546 101.755 1.00 74.64  ? 18  DG  I N1    1 
ATOM 7965  C C2    . DG  I 5 92  ? 103.687 155.634 101.823 1.00 74.64  ? 18  DG  I C2    1 
ATOM 7966  N N2    . DG  I 5 92  ? 104.214 156.860 101.681 1.00 74.64  ? 18  DG  I N2    1 
ATOM 7967  N N3    . DG  I 5 92  ? 104.490 154.590 102.018 1.00 74.64  ? 18  DG  I N3    1 
ATOM 7968  C C4    . DG  I 5 92  ? 103.794 153.437 102.132 1.00 74.64  ? 18  DG  I C4    1 
ATOM 7969  P P     . DC  I 5 93  ? 109.149 151.237 104.894 1.00 80.08  ? 19  DC  I P     1 
ATOM 7970  O OP1   . DC  I 5 93  ? 110.618 151.209 104.740 1.00 80.08  ? 19  DC  I OP1   1 
ATOM 7971  O OP2   . DC  I 5 93  ? 108.508 150.333 105.871 1.00 80.08  ? 19  DC  I OP2   1 
ATOM 7972  O "O5'" . DC  I 5 93  ? 108.689 152.734 105.200 1.00 80.08  ? 19  DC  I "O5'" 1 
ATOM 7973  C "C5'" . DC  I 5 93  ? 108.742 153.705 104.165 1.00 80.08  ? 19  DC  I "C5'" 1 
ATOM 7974  C "C4'" . DC  I 5 93  ? 108.104 155.020 104.588 1.00 80.08  ? 19  DC  I "C4'" 1 
ATOM 7975  O "O4'" . DC  I 5 93  ? 106.681 155.018 104.292 1.00 80.08  ? 19  DC  I "O4'" 1 
ATOM 7976  C "C3'" . DC  I 5 93  ? 108.211 155.366 106.071 1.00 80.08  ? 19  DC  I "C3'" 1 
ATOM 7977  O "O3'" . DC  I 5 93  ? 108.444 156.739 106.188 1.00 80.08  ? 19  DC  I "O3'" 1 
ATOM 7978  C "C2'" . DC  I 5 93  ? 106.819 155.021 106.584 1.00 80.08  ? 19  DC  I "C2'" 1 
ATOM 7979  C "C1'" . DC  I 5 93  ? 106.004 155.518 105.416 1.00 80.08  ? 19  DC  I "C1'" 1 
ATOM 7980  N N1    . DC  I 5 93  ? 104.629 155.032 105.374 1.00 80.08  ? 19  DC  I N1    1 
ATOM 7981  C C2    . DC  I 5 93  ? 103.593 155.943 105.198 1.00 80.08  ? 19  DC  I C2    1 
ATOM 7982  O O2    . DC  I 5 93  ? 103.863 157.143 105.103 1.00 80.08  ? 19  DC  I O2    1 
ATOM 7983  N N3    . DC  I 5 93  ? 102.324 155.488 105.138 1.00 80.08  ? 19  DC  I N3    1 
ATOM 7984  C C4    . DC  I 5 93  ? 102.082 154.186 105.245 1.00 80.08  ? 19  DC  I C4    1 
ATOM 7985  N N4    . DC  I 5 93  ? 100.811 153.780 105.174 1.00 80.08  ? 19  DC  I N4    1 
ATOM 7986  C C5    . DC  I 5 93  ? 103.131 153.240 105.425 1.00 80.08  ? 19  DC  I C5    1 
ATOM 7987  C C6    . DC  I 5 93  ? 104.379 153.706 105.479 1.00 80.08  ? 19  DC  I C6    1 
ATOM 7988  P P     . DG  I 5 94  ? 109.750 157.274 106.938 1.00 86.67  ? 20  DG  I P     1 
ATOM 7989  O OP1   . DG  I 5 94  ? 110.750 157.595 105.895 1.00 86.67  ? 20  DG  I OP1   1 
ATOM 7990  O OP2   . DG  I 5 94  ? 110.064 156.299 108.005 1.00 86.67  ? 20  DG  I OP2   1 
ATOM 7991  O "O5'" . DG  I 5 94  ? 109.248 158.623 107.636 1.00 86.67  ? 20  DG  I "O5'" 1 
ATOM 7992  C "C5'" . DG  I 5 94  ? 107.983 159.171 107.285 1.00 86.67  ? 20  DG  I "C5'" 1 
ATOM 7993  C "C4'" . DG  I 5 94  ? 107.050 159.183 108.481 1.00 86.67  ? 20  DG  I "C4'" 1 
ATOM 7994  O "O4'" . DG  I 5 94  ? 105.788 158.610 108.108 1.00 86.67  ? 20  DG  I "O4'" 1 
ATOM 7995  C "C3'" . DG  I 5 94  ? 107.510 158.333 109.660 1.00 86.67  ? 20  DG  I "C3'" 1 
ATOM 7996  O "O3'" . DG  I 5 94  ? 108.279 159.086 110.654 1.00 86.67  ? 20  DG  I "O3'" 1 
ATOM 7997  C "C2'" . DG  I 5 94  ? 106.221 157.734 110.235 1.00 86.67  ? 20  DG  I "C2'" 1 
ATOM 7998  C "C1'" . DG  I 5 94  ? 105.136 158.231 109.284 1.00 86.67  ? 20  DG  I "C1'" 1 
ATOM 7999  N N9    . DG  I 5 94  ? 104.175 157.190 108.995 1.00 86.67  ? 20  DG  I N9    1 
ATOM 8000  C C8    . DG  I 5 94  ? 104.438 155.852 108.918 1.00 86.67  ? 20  DG  I C8    1 
ATOM 8001  N N7    . DG  I 5 94  ? 103.393 155.128 108.672 1.00 86.67  ? 20  DG  I N7    1 
ATOM 8002  C C5    . DG  I 5 94  ? 102.359 156.043 108.615 1.00 86.67  ? 20  DG  I C5    1 
ATOM 8003  C C6    . DG  I 5 94  ? 100.995 155.834 108.379 1.00 86.67  ? 20  DG  I C6    1 
ATOM 8004  O O6    . DG  I 5 94  ? 100.412 154.764 108.184 1.00 86.67  ? 20  DG  I O6    1 
ATOM 8005  N N1    . DG  I 5 94  ? 100.283 157.021 108.412 1.00 86.67  ? 20  DG  I N1    1 
ATOM 8006  C C2    . DG  I 5 94  ? 100.825 158.263 108.619 1.00 86.67  ? 20  DG  I C2    1 
ATOM 8007  N N2    . DG  I 5 94  ? 99.970  159.291 108.598 1.00 86.67  ? 20  DG  I N2    1 
ATOM 8008  N N3    . DG  I 5 94  ? 102.114 158.479 108.837 1.00 86.67  ? 20  DG  I N3    1 
ATOM 8009  C C4    . DG  I 5 94  ? 102.819 157.322 108.820 1.00 86.67  ? 20  DG  I C4    1 
ATOM 8010  P P     . DG  I 5 95  ? 107.951 160.594 111.133 1.00 87.78  ? 21  DG  I P     1 
ATOM 8011  O OP1   . DG  I 5 95  ? 108.431 161.572 110.135 1.00 87.78  ? 21  DG  I OP1   1 
ATOM 8012  O OP2   . DG  I 5 95  ? 108.527 160.660 112.489 1.00 87.78  ? 21  DG  I OP2   1 
ATOM 8013  O "O5'" . DG  I 5 95  ? 106.365 160.687 111.353 1.00 87.78  ? 21  DG  I "O5'" 1 
ATOM 8014  C "C5'" . DG  I 5 95  ? 105.857 161.304 112.540 1.00 87.78  ? 21  DG  I "C5'" 1 
ATOM 8015  C "C4'" . DG  I 5 95  ? 104.342 161.429 112.510 1.00 87.78  ? 21  DG  I "C4'" 1 
ATOM 8016  O "O4'" . DG  I 5 95  ? 103.776 160.295 111.814 1.00 87.78  ? 21  DG  I "O4'" 1 
ATOM 8017  C "C3'" . DG  I 5 95  ? 103.684 161.458 113.896 1.00 87.78  ? 21  DG  I "C3'" 1 
ATOM 8018  O "O3'" . DG  I 5 95  ? 102.944 162.652 114.085 1.00 87.78  ? 21  DG  I "O3'" 1 
ATOM 8019  C "C2'" . DG  I 5 95  ? 102.776 160.231 113.918 1.00 87.78  ? 21  DG  I "C2'" 1 
ATOM 8020  C "C1'" . DG  I 5 95  ? 102.581 159.918 112.446 1.00 87.78  ? 21  DG  I "C1'" 1 
ATOM 8021  N N9    . DG  I 5 95  ? 102.352 158.497 112.197 1.00 87.78  ? 21  DG  I N9    1 
ATOM 8022  C C8    . DG  I 5 95  ? 103.298 157.509 112.130 1.00 87.78  ? 21  DG  I C8    1 
ATOM 8023  N N7    . DG  I 5 95  ? 102.803 156.328 111.906 1.00 87.78  ? 21  DG  I N7    1 
ATOM 8024  C C5    . DG  I 5 95  ? 101.440 156.545 111.822 1.00 87.78  ? 21  DG  I C5    1 
ATOM 8025  C C6    . DG  I 5 95  ? 100.392 155.635 111.591 1.00 87.78  ? 21  DG  I C6    1 
ATOM 8026  O O6    . DG  I 5 95  ? 100.462 154.418 111.407 1.00 87.78  ? 21  DG  I O6    1 
ATOM 8027  N N1    . DG  I 5 95  ? 99.154  156.267 111.578 1.00 87.78  ? 21  DG  I N1    1 
ATOM 8028  C C2    . DG  I 5 95  ? 98.959  157.610 111.771 1.00 87.78  ? 21  DG  I C2    1 
ATOM 8029  N N2    . DG  I 5 95  ? 97.695  158.044 111.728 1.00 87.78  ? 21  DG  I N2    1 
ATOM 8030  N N3    . DG  I 5 95  ? 99.937  158.475 111.990 1.00 87.78  ? 21  DG  I N3    1 
ATOM 8031  C C4    . DG  I 5 95  ? 101.145 157.874 112.001 1.00 87.78  ? 21  DG  I C4    1 
ATOM 8032  P P     . DT  I 5 96  ? 102.468 163.071 115.564 1.00 87.62  ? 22  DT  I P     1 
ATOM 8033  O OP1   . DT  I 5 96  ? 102.296 164.536 115.596 1.00 87.62  ? 22  DT  I OP1   1 
ATOM 8034  O OP2   . DT  I 5 96  ? 103.389 162.432 116.524 1.00 87.62  ? 22  DT  I OP2   1 
ATOM 8035  O "O5'" . DT  I 5 96  ? 101.043 162.363 115.738 1.00 87.62  ? 22  DT  I "O5'" 1 
ATOM 8036  C "C5'" . DT  I 5 96  ? 99.978  162.682 114.856 1.00 87.62  ? 22  DT  I "C5'" 1 
ATOM 8037  C "C4'" . DT  I 5 96  ? 98.742  161.859 115.174 1.00 87.62  ? 22  DT  I "C4'" 1 
ATOM 8038  O "O4'" . DT  I 5 96  ? 98.880  160.521 114.624 1.00 87.62  ? 22  DT  I "O4'" 1 
ATOM 8039  C "C3'" . DT  I 5 96  ? 98.445  161.676 116.667 1.00 87.62  ? 22  DT  I "C3'" 1 
ATOM 8040  O "O3'" . DT  I 5 96  ? 97.090  161.993 116.929 1.00 87.62  ? 22  DT  I "O3'" 1 
ATOM 8041  C "C2'" . DT  I 5 96  ? 98.722  160.192 116.904 1.00 87.62  ? 22  DT  I "C2'" 1 
ATOM 8042  C "C1'" . DT  I 5 96  ? 98.364  159.606 115.556 1.00 87.62  ? 22  DT  I "C1'" 1 
ATOM 8043  N N1    . DT  I 5 96  ? 98.969  158.279 115.321 1.00 87.62  ? 22  DT  I N1    1 
ATOM 8044  C C2    . DT  I 5 96  ? 98.159  157.222 115.022 1.00 87.62  ? 22  DT  I C2    1 
ATOM 8045  O O2    . DT  I 5 96  ? 96.953  157.314 114.917 1.00 87.62  ? 22  DT  I O2    1 
ATOM 8046  N N3    . DT  I 5 96  ? 98.813  156.044 114.833 1.00 87.62  ? 22  DT  I N3    1 
ATOM 8047  C C4    . DT  I 5 96  ? 100.164 155.817 114.923 1.00 87.62  ? 22  DT  I C4    1 
ATOM 8048  O O4    . DT  I 5 96  ? 100.657 154.711 114.736 1.00 87.62  ? 22  DT  I O4    1 
ATOM 8049  C C5    . DT  I 5 96  ? 100.957 156.966 115.247 1.00 87.62  ? 22  DT  I C5    1 
ATOM 8050  C C7    . DT  I 5 96  ? 102.440 156.838 115.381 1.00 87.62  ? 22  DT  I C7    1 
ATOM 8051  C C6    . DT  I 5 96  ? 100.329 158.128 115.435 1.00 87.62  ? 22  DT  I C6    1 
ATOM 8052  P P     . DG  I 5 97  ? 96.510  161.915 118.425 1.00 83.74  ? 23  DG  I P     1 
ATOM 8053  O OP1   . DG  I 5 97  ? 95.407  162.893 118.503 1.00 83.74  ? 23  DG  I OP1   1 
ATOM 8054  O OP2   . DG  I 5 97  ? 97.628  161.981 119.391 1.00 83.74  ? 23  DG  I OP2   1 
ATOM 8055  O "O5'" . DG  I 5 97  ? 95.857  160.465 118.508 1.00 83.74  ? 23  DG  I "O5'" 1 
ATOM 8056  C "C5'" . DG  I 5 97  ? 94.542  160.272 118.039 1.00 83.74  ? 23  DG  I "C5'" 1 
ATOM 8057  C "C4'" . DG  I 5 97  ? 93.990  158.927 118.472 1.00 83.74  ? 23  DG  I "C4'" 1 
ATOM 8058  O "O4'" . DG  I 5 97  ? 94.854  157.860 118.011 1.00 83.74  ? 23  DG  I "O4'" 1 
ATOM 8059  C "C3'" . DG  I 5 97  ? 93.850  158.710 119.980 1.00 83.74  ? 23  DG  I "C3'" 1 
ATOM 8060  O "O3'" . DG  I 5 97  ? 92.687  157.948 120.198 1.00 83.74  ? 23  DG  I "O3'" 1 
ATOM 8061  C "C2'" . DG  I 5 97  ? 95.094  157.885 120.304 1.00 83.74  ? 23  DG  I "C2'" 1 
ATOM 8062  C "C1'" . DG  I 5 97  ? 95.105  156.992 119.089 1.00 83.74  ? 23  DG  I "C1'" 1 
ATOM 8063  N N9    . DG  I 5 97  ? 96.354  156.297 118.835 1.00 83.74  ? 23  DG  I N9    1 
ATOM 8064  C C8    . DG  I 5 97  ? 97.623  156.818 118.841 1.00 83.74  ? 23  DG  I C8    1 
ATOM 8065  N N7    . DG  I 5 97  ? 98.538  155.942 118.535 1.00 83.74  ? 23  DG  I N7    1 
ATOM 8066  C C5    . DG  I 5 97  ? 97.823  154.775 118.304 1.00 83.74  ? 23  DG  I C5    1 
ATOM 8067  C C6    . DG  I 5 97  ? 98.269  153.488 117.942 1.00 83.74  ? 23  DG  I C6    1 
ATOM 8068  O O6    . DG  I 5 97  ? 99.426  153.104 117.735 1.00 83.74  ? 23  DG  I O6    1 
ATOM 8069  N N1    . DG  I 5 97  ? 97.210  152.594 117.824 1.00 83.74  ? 23  DG  I N1    1 
ATOM 8070  C C2    . DG  I 5 97  ? 95.886  152.914 118.005 1.00 83.74  ? 23  DG  I C2    1 
ATOM 8071  N N2    . DG  I 5 97  ? 94.999  151.923 117.841 1.00 83.74  ? 23  DG  I N2    1 
ATOM 8072  N N3    . DG  I 5 97  ? 95.461  154.111 118.352 1.00 83.74  ? 23  DG  I N3    1 
ATOM 8073  C C4    . DG  I 5 97  ? 96.479  154.988 118.475 1.00 83.74  ? 23  DG  I C4    1 
ATOM 8074  P P     . DC  I 5 98  ? 91.913  157.978 121.601 1.00 84.24  ? 24  DC  I P     1 
ATOM 8075  O OP1   . DC  I 5 98  ? 91.083  159.199 121.607 1.00 84.24  ? 24  DC  I OP1   1 
ATOM 8076  O OP2   . DC  I 5 98  ? 92.872  157.725 122.698 1.00 84.24  ? 24  DC  I OP2   1 
ATOM 8077  O "O5'" . DC  I 5 98  ? 90.952  156.710 121.495 1.00 84.24  ? 24  DC  I "O5'" 1 
ATOM 8078  C "C5'" . DC  I 5 98  ? 91.169  155.754 120.459 1.00 84.24  ? 24  DC  I "C5'" 1 
ATOM 8079  C "C4'" . DC  I 5 98  ? 91.246  154.353 121.027 1.00 84.24  ? 24  DC  I "C4'" 1 
ATOM 8080  O "O4'" . DC  I 5 98  ? 92.525  153.744 120.676 1.00 84.24  ? 24  DC  I "O4'" 1 
ATOM 8081  C "C3'" . DC  I 5 98  ? 91.164  154.283 122.544 1.00 84.24  ? 24  DC  I "C3'" 1 
ATOM 8082  O "O3'" . DC  I 5 98  ? 90.515  153.103 122.906 1.00 84.24  ? 24  DC  I "O3'" 1 
ATOM 8083  C "C2'" . DC  I 5 98  ? 92.631  154.235 122.930 1.00 84.24  ? 24  DC  I "C2'" 1 
ATOM 8084  C "C1'" . DC  I 5 98  ? 93.158  153.307 121.858 1.00 84.24  ? 24  DC  I "C1'" 1 
ATOM 8085  N N1    . DC  I 5 98  ? 94.638  153.370 121.675 1.00 84.24  ? 24  DC  I N1    1 
ATOM 8086  C C2    . DC  I 5 98  ? 95.330  152.244 121.220 1.00 84.24  ? 24  DC  I C2    1 
ATOM 8087  O O2    . DC  I 5 98  ? 94.706  151.214 120.963 1.00 84.24  ? 24  DC  I O2    1 
ATOM 8088  N N3    . DC  I 5 98  ? 96.671  152.317 121.064 1.00 84.24  ? 24  DC  I N3    1 
ATOM 8089  C C4    . DC  I 5 98  ? 97.312  153.447 121.350 1.00 84.24  ? 24  DC  I C4    1 
ATOM 8090  N N4    . DC  I 5 98  ? 98.635  153.475 121.180 1.00 84.24  ? 24  DC  I N4    1 
ATOM 8091  C C5    . DC  I 5 98  ? 96.627  154.600 121.824 1.00 84.24  ? 24  DC  I C5    1 
ATOM 8092  C C6    . DC  I 5 98  ? 95.305  154.517 121.969 1.00 84.24  ? 24  DC  I C6    1 
ATOM 8093  P P     . DT  I 5 99  ? 89.794  152.953 124.332 1.00 80.98  ? 25  DT  I P     1 
ATOM 8094  O OP1   . DT  I 5 99  ? 88.520  153.700 124.268 1.00 80.98  ? 25  DT  I OP1   1 
ATOM 8095  O OP2   . DT  I 5 99  ? 90.763  153.250 125.409 1.00 80.98  ? 25  DT  I OP2   1 
ATOM 8096  O "O5'" . DT  I 5 99  ? 89.483  151.392 124.385 1.00 80.98  ? 25  DT  I "O5'" 1 
ATOM 8097  C "C5'" . DT  I 5 99  ? 89.865  150.576 123.283 1.00 80.98  ? 25  DT  I "C5'" 1 
ATOM 8098  C "C4'" . DT  I 5 99  ? 90.871  149.532 123.710 1.00 80.98  ? 25  DT  I "C4'" 1 
ATOM 8099  O "O4'" . DT  I 5 99  ? 92.225  150.012 123.505 1.00 80.98  ? 25  DT  I "O4'" 1 
ATOM 8100  C "C3'" . DT  I 5 99  ? 90.785  149.134 125.180 1.00 80.98  ? 25  DT  I "C3'" 1 
ATOM 8101  O "O3'" . DT  I 5 99  ? 90.856  147.736 125.278 1.00 80.98  ? 25  DT  I "O3'" 1 
ATOM 8102  C "C2'" . DT  I 5 99  ? 92.037  149.787 125.776 1.00 80.98  ? 25  DT  I "C2'" 1 
ATOM 8103  C "C1'" . DT  I 5 99  ? 92.991  149.633 124.614 1.00 80.98  ? 25  DT  I "C1'" 1 
ATOM 8104  N N1    . DT  I 5 99  ? 94.207  150.493 124.676 1.00 80.98  ? 25  DT  I N1    1 
ATOM 8105  C C2    . DT  I 5 99  ? 95.411  149.970 124.278 1.00 80.98  ? 25  DT  I C2    1 
ATOM 8106  O O2    . DT  I 5 99  ? 95.542  148.830 123.883 1.00 80.98  ? 25  DT  I O2    1 
ATOM 8107  N N3    . DT  I 5 99  ? 96.466  150.833 124.357 1.00 80.98  ? 25  DT  I N3    1 
ATOM 8108  C C4    . DT  I 5 99  ? 96.441  152.136 124.784 1.00 80.98  ? 25  DT  I C4    1 
ATOM 8109  O O4    . DT  I 5 99  ? 97.445  152.833 124.821 1.00 80.98  ? 25  DT  I O4    1 
ATOM 8110  C C5    . DT  I 5 99  ? 95.151  152.626 125.185 1.00 80.98  ? 25  DT  I C5    1 
ATOM 8111  C C7    . DT  I 5 99  ? 95.012  154.034 125.677 1.00 80.98  ? 25  DT  I C7    1 
ATOM 8112  C C6    . DT  I 5 99  ? 94.104  151.790 125.113 1.00 80.98  ? 25  DT  I C6    1 
ATOM 8113  P P     . DA  I 5 100 ? 89.550  146.801 125.201 1.00 80.06  ? 26  DA  I P     1 
ATOM 8114  O OP1   . DA  I 5 100 ? 88.436  147.517 124.548 1.00 80.06  ? 26  DA  I OP1   1 
ATOM 8115  O OP2   . DA  I 5 100 ? 89.343  146.252 126.556 1.00 80.06  ? 26  DA  I OP2   1 
ATOM 8116  O "O5'" . DA  I 5 100 ? 90.036  145.593 124.268 1.00 80.06  ? 26  DA  I "O5'" 1 
ATOM 8117  C "C5'" . DA  I 5 100 ? 91.224  145.747 123.488 1.00 80.06  ? 26  DA  I "C5'" 1 
ATOM 8118  C "C4'" . DA  I 5 100 ? 91.936  144.421 123.246 1.00 80.06  ? 26  DA  I "C4'" 1 
ATOM 8119  O "O4'" . DA  I 5 100 ? 93.330  144.535 123.599 1.00 80.06  ? 26  DA  I "O4'" 1 
ATOM 8120  C "C3'" . DA  I 5 100 ? 91.463  143.237 124.053 1.00 80.06  ? 26  DA  I "C3'" 1 
ATOM 8121  O "O3'" . DA  I 5 100 ? 91.880  142.051 123.373 1.00 80.06  ? 26  DA  I "O3'" 1 
ATOM 8122  C "C2'" . DA  I 5 100 ? 92.213  143.439 125.372 1.00 80.06  ? 26  DA  I "C2'" 1 
ATOM 8123  C "C1'" . DA  I 5 100 ? 93.524  144.088 124.932 1.00 80.06  ? 26  DA  I "C1'" 1 
ATOM 8124  N N9    . DA  I 5 100 ? 93.867  145.262 125.705 1.00 80.06  ? 26  DA  I N9    1 
ATOM 8125  C C8    . DA  I 5 100 ? 93.016  146.025 126.432 1.00 80.06  ? 26  DA  I C8    1 
ATOM 8126  N N7    . DA  I 5 100 ? 93.571  147.072 126.974 1.00 80.06  ? 26  DA  I N7    1 
ATOM 8127  C C5    . DA  I 5 100 ? 94.883  146.988 126.574 1.00 80.06  ? 26  DA  I C5    1 
ATOM 8128  C C6    . DA  I 5 100 ? 95.995  147.791 126.836 1.00 80.06  ? 26  DA  I C6    1 
ATOM 8129  N N6    . DA  I 5 100 ? 95.937  148.894 127.583 1.00 80.06  ? 26  DA  I N6    1 
ATOM 8130  N N1    . DA  I 5 100 ? 97.166  147.429 126.296 1.00 80.06  ? 26  DA  I N1    1 
ATOM 8131  C C2    . DA  I 5 100 ? 97.219  146.324 125.542 1.00 80.06  ? 26  DA  I C2    1 
ATOM 8132  N N3    . DA  I 5 100 ? 96.238  145.482 125.235 1.00 80.06  ? 26  DA  I N3    1 
ATOM 8133  C C4    . DA  I 5 100 ? 95.087  145.877 125.788 1.00 80.06  ? 26  DA  I C4    1 
ATOM 8134  P P     . DG  I 5 101 ? 91.826  140.596 124.054 1.00 80.22  ? 27  DG  I P     1 
ATOM 8135  O OP1   . DG  I 5 101 ? 91.687  139.655 122.926 1.00 80.22  ? 27  DG  I OP1   1 
ATOM 8136  O OP2   . DG  I 5 101 ? 90.836  140.546 125.151 1.00 80.22  ? 27  DG  I OP2   1 
ATOM 8137  O "O5'" . DG  I 5 101 ? 93.293  140.406 124.656 1.00 80.22  ? 27  DG  I "O5'" 1 
ATOM 8138  C "C5'" . DG  I 5 101 ? 94.397  140.302 123.777 1.00 80.22  ? 27  DG  I "C5'" 1 
ATOM 8139  C "C4'" . DG  I 5 101 ? 95.721  140.381 124.515 1.00 80.22  ? 27  DG  I "C4'" 1 
ATOM 8140  O "O4'" . DG  I 5 101 ? 95.828  141.633 125.247 1.00 80.22  ? 27  DG  I "O4'" 1 
ATOM 8141  C "C3'" . DG  I 5 101 ? 95.974  139.282 125.532 1.00 80.22  ? 27  DG  I "C3'" 1 
ATOM 8142  O "O3'" . DG  I 5 101 ? 97.334  138.939 125.479 1.00 80.22  ? 27  DG  I "O3'" 1 
ATOM 8143  C "C2'" . DG  I 5 101 ? 95.642  139.980 126.849 1.00 80.22  ? 27  DG  I "C2'" 1 
ATOM 8144  C "C1'" . DG  I 5 101 ? 96.216  141.358 126.576 1.00 80.22  ? 27  DG  I "C1'" 1 
ATOM 8145  N N9    . DG  I 5 101 ? 95.683  142.418 127.432 1.00 80.22  ? 27  DG  I N9    1 
ATOM 8146  C C8    . DG  I 5 101 ? 94.393  142.543 127.860 1.00 80.22  ? 27  DG  I C8    1 
ATOM 8147  N N7    . DG  I 5 101 ? 94.176  143.611 128.566 1.00 80.22  ? 27  DG  I N7    1 
ATOM 8148  C C5    . DG  I 5 101 ? 95.408  144.223 128.645 1.00 80.22  ? 27  DG  I C5    1 
ATOM 8149  C C6    . DG  I 5 101 ? 95.781  145.404 129.307 1.00 80.22  ? 27  DG  I C6    1 
ATOM 8150  O O6    . DG  I 5 101 ? 95.070  146.164 129.970 1.00 80.22  ? 27  DG  I O6    1 
ATOM 8151  N N1    . DG  I 5 101 ? 97.123  145.686 129.137 1.00 80.22  ? 27  DG  I N1    1 
ATOM 8152  C C2    . DG  I 5 101 ? 98.002  144.915 128.430 1.00 80.22  ? 27  DG  I C2    1 
ATOM 8153  N N2    . DG  I 5 101 ? 99.263  145.358 128.380 1.00 80.22  ? 27  DG  I N2    1 
ATOM 8154  N N3    . DG  I 5 101 ? 97.664  143.801 127.791 1.00 80.22  ? 27  DG  I N3    1 
ATOM 8155  C C4    . DG  I 5 101 ? 96.353  143.516 127.944 1.00 80.22  ? 27  DG  I C4    1 
ATOM 8156  P P     . DA  I 5 102 ? 97.817  137.430 125.715 1.00 76.89  ? 28  DA  I P     1 
ATOM 8157  O OP1   . DA  I 5 102 ? 97.633  136.691 124.449 1.00 76.89  ? 28  DA  I OP1   1 
ATOM 8158  O OP2   . DA  I 5 102 ? 97.162  136.935 126.939 1.00 76.89  ? 28  DA  I OP2   1 
ATOM 8159  O "O5'" . DA  I 5 102 ? 99.382  137.596 126.001 1.00 76.89  ? 28  DA  I "O5'" 1 
ATOM 8160  C "C5'" . DA  I 5 102 ? 100.188 138.375 125.107 1.00 76.89  ? 28  DA  I "C5'" 1 
ATOM 8161  C "C4'" . DA  I 5 102 ? 101.482 138.882 125.745 1.00 76.89  ? 28  DA  I "C4'" 1 
ATOM 8162  O "O4'" . DA  I 5 102 ? 101.230 140.052 126.546 1.00 76.89  ? 28  DA  I "O4'" 1 
ATOM 8163  C "C3'" . DA  I 5 102 ? 102.234 137.926 126.646 1.00 76.89  ? 28  DA  I "C3'" 1 
ATOM 8164  O "O3'" . DA  I 5 102 ? 103.622 138.203 126.544 1.00 76.89  ? 28  DA  I "O3'" 1 
ATOM 8165  C "C2'" . DA  I 5 102 ? 101.698 138.274 128.033 1.00 76.89  ? 28  DA  I "C2'" 1 
ATOM 8166  C "C1'" . DA  I 5 102 ? 101.406 139.765 127.919 1.00 76.89  ? 28  DA  I "C1'" 1 
ATOM 8167  N N9    . DA  I 5 102 ? 100.181 140.166 128.565 1.00 76.89  ? 28  DA  I N9    1 
ATOM 8168  C C8    . DA  I 5 102 ? 98.978  139.566 128.434 1.00 76.89  ? 28  DA  I C8    1 
ATOM 8169  N N7    . DA  I 5 102 ? 98.025  140.152 129.099 1.00 76.89  ? 28  DA  I N7    1 
ATOM 8170  C C5    . DA  I 5 102 ? 98.631  141.236 129.668 1.00 76.89  ? 28  DA  I C5    1 
ATOM 8171  C C6    . DA  I 5 102 ? 98.143  142.244 130.493 1.00 76.89  ? 28  DA  I C6    1 
ATOM 8172  N N6    . DA  I 5 102 ? 96.867  142.317 130.863 1.00 76.89  ? 28  DA  I N6    1 
ATOM 8173  N N1    . DA  I 5 102 ? 99.008  143.183 130.912 1.00 76.89  ? 28  DA  I N1    1 
ATOM 8174  C C2    . DA  I 5 102 ? 100.288 143.097 130.531 1.00 76.89  ? 28  DA  I C2    1 
ATOM 8175  N N3    . DA  I 5 102 ? 100.863 142.183 129.754 1.00 76.89  ? 28  DA  I N3    1 
ATOM 8176  C C4    . DA  I 5 102 ? 99.966  141.272 129.353 1.00 76.89  ? 28  DA  I C4    1 
ATOM 8177  P P     . DG  I 5 103 ? 104.706 137.303 127.315 1.00 75.77  ? 29  DG  I P     1 
ATOM 8178  O OP1   . DG  I 5 103 ? 105.964 137.392 126.550 1.00 75.77  ? 29  DG  I OP1   1 
ATOM 8179  O OP2   . DG  I 5 103 ? 104.124 135.981 127.611 1.00 75.77  ? 29  DG  I OP2   1 
ATOM 8180  O "O5'" . DG  I 5 103 ? 104.892 138.045 128.713 1.00 75.77  ? 29  DG  I "O5'" 1 
ATOM 8181  C "C5'" . DG  I 5 103 ? 105.116 139.440 128.755 1.00 75.77  ? 29  DG  I "C5'" 1 
ATOM 8182  C "C4'" . DG  I 5 103 ? 105.134 139.920 130.189 1.00 75.77  ? 29  DG  I "C4'" 1 
ATOM 8183  O "O4'" . DG  I 5 103 ? 103.807 140.325 130.586 1.00 75.77  ? 29  DG  I "O4'" 1 
ATOM 8184  C "C3'" . DG  I 5 103 ? 105.587 138.873 131.198 1.00 75.77  ? 29  DG  I "C3'" 1 
ATOM 8185  O "O3'" . DG  I 5 103 ? 106.673 139.403 131.945 1.00 75.77  ? 29  DG  I "O3'" 1 
ATOM 8186  C "C2'" . DG  I 5 103 ? 104.339 138.618 132.053 1.00 75.77  ? 29  DG  I "C2'" 1 
ATOM 8187  C "C1'" . DG  I 5 103 ? 103.564 139.905 131.900 1.00 75.77  ? 29  DG  I "C1'" 1 
ATOM 8188  N N9    . DG  I 5 103 ? 102.128 139.730 132.042 1.00 75.77  ? 29  DG  I N9    1 
ATOM 8189  C C8    . DG  I 5 103 ? 101.358 138.795 131.415 1.00 75.77  ? 29  DG  I C8    1 
ATOM 8190  N N7    . DG  I 5 103 ? 100.097 138.882 131.701 1.00 75.77  ? 29  DG  I N7    1 
ATOM 8191  C C5    . DG  I 5 103 ? 100.023 139.948 132.578 1.00 75.77  ? 29  DG  I C5    1 
ATOM 8192  C C6    . DG  I 5 103 ? 98.909  140.500 133.238 1.00 75.77  ? 29  DG  I C6    1 
ATOM 8193  O O6    . DG  I 5 103 ? 97.728  140.154 133.161 1.00 75.77  ? 29  DG  I O6    1 
ATOM 8194  N N1    . DG  I 5 103 ? 99.267  141.568 134.044 1.00 75.77  ? 29  DG  I N1    1 
ATOM 8195  C C2    . DG  I 5 103 ? 100.545 142.034 134.200 1.00 75.77  ? 29  DG  I C2    1 
ATOM 8196  N N2    . DG  I 5 103 ? 100.703 143.076 135.020 1.00 75.77  ? 29  DG  I N2    1 
ATOM 8197  N N3    . DG  I 5 103 ? 101.600 141.520 133.591 1.00 75.77  ? 29  DG  I N3    1 
ATOM 8198  C C4    . DG  I 5 103 ? 101.263 140.490 132.790 1.00 75.77  ? 29  DG  I C4    1 
ATOM 8199  P P     . DC  I 5 104 ? 107.268 138.657 133.237 1.00 79.78  ? 30  DC  I P     1 
ATOM 8200  O OP1   . DC  I 5 104 ? 108.677 139.060 133.331 1.00 79.78  ? 30  DC  I OP1   1 
ATOM 8201  O OP2   . DC  I 5 104 ? 106.963 137.208 133.219 1.00 79.78  ? 30  DC  I OP2   1 
ATOM 8202  O "O5'" . DC  I 5 104 ? 106.524 139.390 134.436 1.00 79.78  ? 30  DC  I "O5'" 1 
ATOM 8203  C "C5'" . DC  I 5 104 ? 106.278 140.780 134.338 1.00 79.78  ? 30  DC  I "C5'" 1 
ATOM 8204  C "C4'" . DC  I 5 104 ? 106.072 141.401 135.696 1.00 79.78  ? 30  DC  I "C4'" 1 
ATOM 8205  O "O4'" . DC  I 5 104 ? 104.667 141.592 135.937 1.00 79.78  ? 30  DC  I "O4'" 1 
ATOM 8206  C "C3'" . DC  I 5 104 ? 106.608 140.601 136.860 1.00 79.78  ? 30  DC  I "C3'" 1 
ATOM 8207  O "O3'" . DC  I 5 104 ? 107.170 141.489 137.798 1.00 79.78  ? 30  DC  I "O3'" 1 
ATOM 8208  C "C2'" . DC  I 5 104 ? 105.378 139.881 137.415 1.00 79.78  ? 30  DC  I "C2'" 1 
ATOM 8209  C "C1'" . DC  I 5 104 ? 104.211 140.751 136.967 1.00 79.78  ? 30  DC  I "C1'" 1 
ATOM 8210  N N1    . DC  I 5 104 ? 103.066 139.978 136.435 1.00 79.78  ? 30  DC  I N1    1 
ATOM 8211  C C2    . DC  I 5 104 ? 101.770 140.285 136.850 1.00 79.78  ? 30  DC  I C2    1 
ATOM 8212  O O2    . DC  I 5 104 ? 101.603 141.196 137.662 1.00 79.78  ? 30  DC  I O2    1 
ATOM 8213  N N3    . DC  I 5 104 ? 100.736 139.580 136.347 1.00 79.78  ? 30  DC  I N3    1 
ATOM 8214  C C4    . DC  I 5 104 ? 100.964 138.602 135.472 1.00 79.78  ? 30  DC  I C4    1 
ATOM 8215  N N4    . DC  I 5 104 ? 99.913  137.927 135.004 1.00 79.78  ? 30  DC  I N4    1 
ATOM 8216  C C5    . DC  I 5 104 ? 102.277 138.272 135.039 1.00 79.78  ? 30  DC  I C5    1 
ATOM 8217  C C6    . DC  I 5 104 ? 103.287 138.993 135.528 1.00 79.78  ? 30  DC  I C6    1 
ATOM 8218  P P     . DT  I 5 105 ? 108.104 140.948 138.985 1.00 80.73  ? 31  DT  I P     1 
ATOM 8219  O OP1   . DT  I 5 105 ? 109.073 142.019 139.287 1.00 80.73  ? 31  DT  I OP1   1 
ATOM 8220  O OP2   . DT  I 5 105 ? 108.628 139.614 138.625 1.00 80.73  ? 31  DT  I OP2   1 
ATOM 8221  O "O5'" . DT  I 5 105 ? 107.078 140.808 140.203 1.00 80.73  ? 31  DT  I "O5'" 1 
ATOM 8222  C "C5'" . DT  I 5 105 ? 106.186 141.880 140.491 1.00 80.73  ? 31  DT  I "C5'" 1 
ATOM 8223  C "C4'" . DT  I 5 105 ? 105.107 141.439 141.453 1.00 80.73  ? 31  DT  I "C4'" 1 
ATOM 8224  O "O4'" . DT  I 5 105 ? 103.998 140.873 140.724 1.00 80.73  ? 31  DT  I "O4'" 1 
ATOM 8225  C "C3'" . DT  I 5 105 ? 105.542 140.374 142.456 1.00 80.73  ? 31  DT  I "C3'" 1 
ATOM 8226  O "O3'" . DT  I 5 105 ? 105.451 140.913 143.774 1.00 80.73  ? 31  DT  I "O3'" 1 
ATOM 8227  C "C2'" . DT  I 5 105 ? 104.559 139.220 142.220 1.00 80.73  ? 31  DT  I "C2'" 1 
ATOM 8228  C "C1'" . DT  I 5 105 ? 103.398 139.899 141.524 1.00 80.73  ? 31  DT  I "C1'" 1 
ATOM 8229  N N1    . DT  I 5 105 ? 102.623 138.976 140.646 1.00 80.73  ? 31  DT  I N1    1 
ATOM 8230  C C2    . DT  I 5 105 ? 101.245 138.923 140.738 1.00 80.73  ? 31  DT  I C2    1 
ATOM 8231  O O2    . DT  I 5 105 ? 100.602 139.602 141.516 1.00 80.73  ? 31  DT  I O2    1 
ATOM 8232  N N3    . DT  I 5 105 ? 100.650 138.032 139.880 1.00 80.73  ? 31  DT  I N3    1 
ATOM 8233  C C4    . DT  I 5 105 ? 101.279 137.220 138.968 1.00 80.73  ? 31  DT  I C4    1 
ATOM 8234  O O4    . DT  I 5 105 ? 100.668 136.453 138.239 1.00 80.73  ? 31  DT  I O4    1 
ATOM 8235  C C5    . DT  I 5 105 ? 102.714 137.332 138.928 1.00 80.73  ? 31  DT  I C5    1 
ATOM 8236  C C7    . DT  I 5 105 ? 103.508 136.486 137.982 1.00 80.73  ? 31  DT  I C7    1 
ATOM 8237  C C6    . DT  I 5 105 ? 103.305 138.191 139.759 1.00 80.73  ? 31  DT  I C6    1 
ATOM 8238  P P     . DG  I 5 106 ? 105.652 140.010 145.092 1.00 88.46  ? 32  DG  I P     1 
ATOM 8239  O OP1   . DG  I 5 106 ? 106.214 140.924 146.107 1.00 88.46  ? 32  DG  I OP1   1 
ATOM 8240  O OP2   . DG  I 5 106 ? 106.400 138.768 144.804 1.00 88.46  ? 32  DG  I OP2   1 
ATOM 8241  O "O5'" . DG  I 5 106 ? 104.151 139.647 145.515 1.00 88.46  ? 32  DG  I "O5'" 1 
ATOM 8242  C "C5'" . DG  I 5 106 ? 103.195 140.702 145.652 1.00 88.46  ? 32  DG  I "C5'" 1 
ATOM 8243  C "C4'" . DG  I 5 106 ? 101.777 140.183 145.829 1.00 88.46  ? 32  DG  I "C4'" 1 
ATOM 8244  O "O4'" . DG  I 5 106 ? 101.339 139.477 144.640 1.00 88.46  ? 32  DG  I "O4'" 1 
ATOM 8245  C "C3'" . DG  I 5 106 ? 101.555 139.218 146.991 1.00 88.46  ? 32  DG  I "C3'" 1 
ATOM 8246  O "O3'" . DG  I 5 106 ? 100.295 139.492 147.566 1.00 88.46  ? 32  DG  I "O3'" 1 
ATOM 8247  C "C2'" . DG  I 5 106 ? 101.547 137.867 146.286 1.00 88.46  ? 32  DG  I "C2'" 1 
ATOM 8248  C "C1'" . DG  I 5 106 ? 100.801 138.227 145.023 1.00 88.46  ? 32  DG  I "C1'" 1 
ATOM 8249  N N9    . DG  I 5 106 ? 100.990 137.297 143.916 1.00 88.46  ? 32  DG  I N9    1 
ATOM 8250  C C8    . DG  I 5 106 ? 102.164 137.013 143.281 1.00 88.46  ? 32  DG  I C8    1 
ATOM 8251  N N7    . DG  I 5 106 ? 102.037 136.177 142.299 1.00 88.46  ? 32  DG  I N7    1 
ATOM 8252  C C5    . DG  I 5 106 ? 100.690 135.882 142.282 1.00 88.46  ? 32  DG  I C5    1 
ATOM 8253  C C6    . DG  I 5 106 ? 99.972  135.030 141.432 1.00 88.46  ? 32  DG  I C6    1 
ATOM 8254  O O6    . DG  I 5 106 ? 100.406 134.339 140.503 1.00 88.46  ? 32  DG  I O6    1 
ATOM 8255  N N1    . DG  I 5 106 ? 98.621  135.008 141.749 1.00 88.46  ? 32  DG  I N1    1 
ATOM 8256  C C2    . DG  I 5 106 ? 98.040  135.733 142.758 1.00 88.46  ? 32  DG  I C2    1 
ATOM 8257  N N2    . DG  I 5 106 ? 96.720  135.586 142.910 1.00 88.46  ? 32  DG  I N2    1 
ATOM 8258  N N3    . DG  I 5 106 ? 98.707  136.544 143.562 1.00 88.46  ? 32  DG  I N3    1 
ATOM 8259  C C4    . DG  I 5 106 ? 100.024 136.568 143.265 1.00 88.46  ? 32  DG  I C4    1 
ATOM 8260  P P     . DT  I 5 107 ? 99.900  138.941 149.020 1.00 95.07  ? 33  DT  I P     1 
ATOM 8261  O OP1   . DT  I 5 107 ? 99.775  140.126 149.892 1.00 95.07  ? 33  DT  I OP1   1 
ATOM 8262  O OP2   . DT  I 5 107 ? 100.792 137.833 149.422 1.00 95.07  ? 33  DT  I OP2   1 
ATOM 8263  O "O5'" . DT  I 5 107 ? 98.435  138.351 148.805 1.00 95.07  ? 33  DT  I "O5'" 1 
ATOM 8264  C "C5'" . DT  I 5 107 ? 98.140  137.553 147.667 1.00 95.07  ? 33  DT  I "C5'" 1 
ATOM 8265  C "C4'" . DT  I 5 107 ? 96.835  136.819 147.878 1.00 95.07  ? 33  DT  I "C4'" 1 
ATOM 8266  O "O4'" . DT  I 5 107 ? 96.620  135.871 146.805 1.00 95.07  ? 33  DT  I "O4'" 1 
ATOM 8267  C "C3'" . DT  I 5 107 ? 96.802  135.972 149.118 1.00 95.07  ? 33  DT  I "C3'" 1 
ATOM 8268  O "O3'" . DT  I 5 107 ? 95.467  135.671 149.425 1.00 95.07  ? 33  DT  I "O3'" 1 
ATOM 8269  C "C2'" . DT  I 5 107 ? 97.566  134.744 148.639 1.00 95.07  ? 33  DT  I "C2'" 1 
ATOM 8270  C "C1'" . DT  I 5 107 ? 96.995  134.569 147.234 1.00 95.07  ? 33  DT  I "C1'" 1 
ATOM 8271  N N1    . DT  I 5 107 ? 97.958  134.040 146.220 1.00 95.07  ? 33  DT  I N1    1 
ATOM 8272  C C2    . DT  I 5 107 ? 97.479  133.303 145.159 1.00 95.07  ? 33  DT  I C2    1 
ATOM 8273  O O2    . DT  I 5 107 ? 96.309  133.014 145.022 1.00 95.07  ? 33  DT  I O2    1 
ATOM 8274  N N3    . DT  I 5 107 ? 98.425  132.906 144.265 1.00 95.07  ? 33  DT  I N3    1 
ATOM 8275  C C4    . DT  I 5 107 ? 99.769  133.176 144.315 1.00 95.07  ? 33  DT  I C4    1 
ATOM 8276  O O4    . DT  I 5 107 ? 100.548 132.771 143.466 1.00 95.07  ? 33  DT  I O4    1 
ATOM 8277  C C5    . DT  I 5 107 ? 100.203 133.961 145.437 1.00 95.07  ? 33  DT  I C5    1 
ATOM 8278  C C7    . DT  I 5 107 ? 101.644 134.305 145.589 1.00 95.07  ? 33  DT  I C7    1 
ATOM 8279  C C6    . DT  I 5 107 ? 99.289  134.359 146.321 1.00 95.07  ? 33  DT  I C6    1 
ATOM 8280  P P     . DC  I 5 108 ? 95.096  135.046 150.850 1.00 99.52  ? 34  DC  I P     1 
ATOM 8281  O OP1   . DC  I 5 108 ? 93.883  135.741 151.331 1.00 99.52  ? 34  DC  I OP1   1 
ATOM 8282  O OP2   . DC  I 5 108 ? 96.327  135.064 151.665 1.00 99.52  ? 34  DC  I OP2   1 
ATOM 8283  O "O5'" . DC  I 5 108 ? 94.738  133.526 150.506 1.00 99.52  ? 34  DC  I "O5'" 1 
ATOM 8284  C "C5'" . DC  I 5 108 ? 93.644  133.240 149.643 1.00 99.52  ? 34  DC  I "C5'" 1 
ATOM 8285  C "C4'" . DC  I 5 108 ? 93.729  131.835 149.063 1.00 99.52  ? 34  DC  I "C4'" 1 
ATOM 8286  O "O4'" . DC  I 5 108 ? 94.878  131.720 148.184 1.00 99.52  ? 34  DC  I "O4'" 1 
ATOM 8287  C "C3'" . DC  I 5 108 ? 93.870  130.699 150.074 1.00 99.52  ? 34  DC  I "C3'" 1 
ATOM 8288  O "O3'" . DC  I 5 108 ? 93.100  129.606 149.635 1.00 99.52  ? 34  DC  I "O3'" 1 
ATOM 8289  C "C2'" . DC  I 5 108 ? 95.352  130.378 149.989 1.00 99.52  ? 34  DC  I "C2'" 1 
ATOM 8290  C "C1'" . DC  I 5 108 ? 95.559  130.532 148.500 1.00 99.52  ? 34  DC  I "C1'" 1 
ATOM 8291  N N1    . DC  I 5 108 ? 96.968  130.682 148.093 1.00 99.52  ? 34  DC  I N1    1 
ATOM 8292  C C2    . DC  I 5 108 ? 97.376  130.221 146.842 1.00 99.52  ? 34  DC  I C2    1 
ATOM 8293  O O2    . DC  I 5 108 ? 96.551  129.678 146.104 1.00 99.52  ? 34  DC  I O2    1 
ATOM 8294  N N3    . DC  I 5 108 ? 98.666  130.380 146.473 1.00 99.52  ? 34  DC  I N3    1 
ATOM 8295  C C4    . DC  I 5 108 ? 99.525  130.972 147.300 1.00 99.52  ? 34  DC  I C4    1 
ATOM 8296  N N4    . DC  I 5 108 ? 100.789 131.108 146.900 1.00 99.52  ? 34  DC  I N4    1 
ATOM 8297  C C5    . DC  I 5 108 ? 99.126  131.448 148.578 1.00 99.52  ? 34  DC  I C5    1 
ATOM 8298  C C6    . DC  I 5 108 ? 97.852  131.277 148.931 1.00 99.52  ? 34  DC  I C6    1 
ATOM 8299  P P     . DT  I 5 109 ? 92.692  128.430 150.645 1.00 97.01  ? 35  DT  I P     1 
ATOM 8300  O OP1   . DT  I 5 109 ? 91.876  129.048 151.710 1.00 97.01  ? 35  DT  I OP1   1 
ATOM 8301  O OP2   . DT  I 5 109 ? 93.898  127.648 150.997 1.00 97.01  ? 35  DT  I OP2   1 
ATOM 8302  O "O5'" . DT  I 5 109 ? 91.759  127.494 149.752 1.00 97.01  ? 35  DT  I "O5'" 1 
ATOM 8303  C "C5'" . DT  I 5 109 ? 91.757  127.649 148.347 1.00 97.01  ? 35  DT  I "C5'" 1 
ATOM 8304  C "C4'" . DT  I 5 109 ? 92.685  126.645 147.694 1.00 97.01  ? 35  DT  I "C4'" 1 
ATOM 8305  O "O4'" . DT  I 5 109 ? 94.016  127.201 147.560 1.00 97.01  ? 35  DT  I "O4'" 1 
ATOM 8306  C "C3'" . DT  I 5 109 ? 92.859  125.329 148.461 1.00 97.01  ? 35  DT  I "C3'" 1 
ATOM 8307  O "O3'" . DT  I 5 109 ? 92.446  124.249 147.653 1.00 97.01  ? 35  DT  I "O3'" 1 
ATOM 8308  C "C2'" . DT  I 5 109 ? 94.363  125.267 148.746 1.00 97.01  ? 35  DT  I "C2'" 1 
ATOM 8309  C "C1'" . DT  I 5 109 ? 94.909  126.130 147.631 1.00 97.01  ? 35  DT  I "C1'" 1 
ATOM 8310  N N1    . DT  I 5 109 ? 96.281  126.620 147.880 1.00 97.01  ? 35  DT  I N1    1 
ATOM 8311  C C2    . DT  I 5 109 ? 97.212  126.507 146.884 1.00 97.01  ? 35  DT  I C2    1 
ATOM 8312  O O2    . DT  I 5 109 ? 96.960  126.054 145.786 1.00 97.01  ? 35  DT  I O2    1 
ATOM 8313  N N3    . DT  I 5 109 ? 98.454  126.963 147.207 1.00 97.01  ? 35  DT  I N3    1 
ATOM 8314  C C4    . DT  I 5 109 ? 98.854  127.499 148.412 1.00 97.01  ? 35  DT  I C4    1 
ATOM 8315  O O4    . DT  I 5 109 ? 100.000 127.878 148.611 1.00 97.01  ? 35  DT  I O4    1 
ATOM 8316  C C5    . DT  I 5 109 ? 97.832  127.576 149.421 1.00 97.01  ? 35  DT  I C5    1 
ATOM 8317  C C7    . DT  I 5 109 ? 98.155  128.132 150.773 1.00 97.01  ? 35  DT  I C7    1 
ATOM 8318  C C6    . DT  I 5 109 ? 96.608  127.126 149.114 1.00 97.01  ? 35  DT  I C6    1 
ATOM 8319  P P     . DA  I 5 110 ? 91.070  123.494 147.978 1.00 83.51  ? 36  DA  I P     1 
ATOM 8320  O OP1   . DA  I 5 110 ? 89.977  124.397 147.562 1.00 83.51  ? 36  DA  I OP1   1 
ATOM 8321  O OP2   . DA  I 5 110 ? 91.136  123.012 149.374 1.00 83.51  ? 36  DA  I OP2   1 
ATOM 8322  O "O5'" . DA  I 5 110 ? 91.090  122.221 147.019 1.00 83.51  ? 36  DA  I "O5'" 1 
ATOM 8323  C "C5'" . DA  I 5 110 ? 90.964  122.393 145.632 1.00 83.51  ? 36  DA  I "C5'" 1 
ATOM 8324  C "C4'" . DA  I 5 110 ? 92.184  121.859 144.910 1.00 83.51  ? 36  DA  I "C4'" 1 
ATOM 8325  O "O4'" . DA  I 5 110 ? 93.389  122.320 145.568 1.00 83.51  ? 36  DA  I "O4'" 1 
ATOM 8326  C "C3'" . DA  I 5 110 ? 92.299  120.340 144.848 1.00 83.51  ? 36  DA  I "C3'" 1 
ATOM 8327  O "O3'" . DA  I 5 110 ? 92.791  119.979 143.575 1.00 83.51  ? 36  DA  I "O3'" 1 
ATOM 8328  C "C2'" . DA  I 5 110 ? 93.309  120.030 145.956 1.00 83.51  ? 36  DA  I "C2'" 1 
ATOM 8329  C "C1'" . DA  I 5 110 ? 94.232  121.219 145.833 1.00 83.51  ? 36  DA  I "C1'" 1 
ATOM 8330  N N9    . DA  I 5 110 ? 94.974  121.527 147.038 1.00 83.51  ? 36  DA  I N9    1 
ATOM 8331  C C8    . DA  I 5 110 ? 94.463  121.794 148.269 1.00 83.51  ? 36  DA  I C8    1 
ATOM 8332  N N7    . DA  I 5 110 ? 95.373  122.078 149.166 1.00 83.51  ? 36  DA  I N7    1 
ATOM 8333  C C5    . DA  I 5 110 ? 96.558  122.004 148.465 1.00 83.51  ? 36  DA  I C5    1 
ATOM 8334  C C6    . DA  I 5 110 ? 97.894  122.199 148.845 1.00 83.51  ? 36  DA  I C6    1 
ATOM 8335  N N6    . DA  I 5 110 ? 98.255  122.519 150.084 1.00 83.51  ? 36  DA  I N6    1 
ATOM 8336  N N1    . DA  I 5 110 ? 98.849  122.050 147.898 1.00 83.51  ? 36  DA  I N1    1 
ATOM 8337  C C2    . DA  I 5 110 ? 98.469  121.721 146.659 1.00 83.51  ? 36  DA  I C2    1 
ATOM 8338  N N3    . DA  I 5 110 ? 97.241  121.515 146.187 1.00 83.51  ? 36  DA  I N3    1 
ATOM 8339  C C4    . DA  I 5 110 ? 96.327  121.677 147.150 1.00 83.51  ? 36  DA  I C4    1 
ATOM 8340  P P     . DC  I 5 111 ? 92.882  118.442 143.134 1.00 74.23  ? 37  DC  I P     1 
ATOM 8341  O OP1   . DC  I 5 111 ? 92.473  118.416 141.717 1.00 74.23  ? 37  DC  I OP1   1 
ATOM 8342  O OP2   . DC  I 5 111 ? 92.180  117.598 144.124 1.00 74.23  ? 37  DC  I OP2   1 
ATOM 8343  O "O5'" . DC  I 5 111 ? 94.442  118.118 143.226 1.00 74.23  ? 37  DC  I "O5'" 1 
ATOM 8344  C "C5'" . DC  I 5 111 ? 95.352  118.793 142.365 1.00 74.23  ? 37  DC  I "C5'" 1 
ATOM 8345  C "C4'" . DC  I 5 111 ? 96.783  118.314 142.561 1.00 74.23  ? 37  DC  I "C4'" 1 
ATOM 8346  O "O4'" . DC  I 5 111 ? 97.293  118.767 143.834 1.00 74.23  ? 37  DC  I "O4'" 1 
ATOM 8347  C "C3'" . DC  I 5 111 ? 96.986  116.805 142.552 1.00 74.23  ? 37  DC  I "C3'" 1 
ATOM 8348  O "O3'" . DC  I 5 111 ? 98.186  116.516 141.882 1.00 74.23  ? 37  DC  I "O3'" 1 
ATOM 8349  C "C2'" . DC  I 5 111 ? 97.089  116.461 144.039 1.00 74.23  ? 37  DC  I "C2'" 1 
ATOM 8350  C "C1'" . DC  I 5 111 ? 97.834  117.672 144.540 1.00 74.23  ? 37  DC  I "C1'" 1 
ATOM 8351  N N1    . DC  I 5 111 ? 97.658  117.959 145.954 1.00 74.23  ? 37  DC  I N1    1 
ATOM 8352  C C2    . DC  I 5 111 ? 98.779  118.212 146.727 1.00 74.23  ? 37  DC  I C2    1 
ATOM 8353  O O2    . DC  I 5 111 ? 99.888  118.129 146.204 1.00 74.23  ? 37  DC  I O2    1 
ATOM 8354  N N3    . DC  I 5 111 ? 98.625  118.525 148.023 1.00 74.23  ? 37  DC  I N3    1 
ATOM 8355  C C4    . DC  I 5 111 ? 97.401  118.599 148.546 1.00 74.23  ? 37  DC  I C4    1 
ATOM 8356  N N4    . DC  I 5 111 ? 97.303  118.914 149.837 1.00 74.23  ? 37  DC  I N4    1 
ATOM 8357  C C5    . DC  I 5 111 ? 96.233  118.355 147.769 1.00 74.23  ? 37  DC  I C5    1 
ATOM 8358  C C6    . DC  I 5 111 ? 96.408  118.055 146.481 1.00 74.23  ? 37  DC  I C6    1 
ATOM 8359  P P     . DG  I 5 112 ? 98.275  115.215 140.958 1.00 64.34  ? 38  DG  I P     1 
ATOM 8360  O OP1   . DG  I 5 112 ? 98.068  115.643 139.557 1.00 64.34  ? 38  DG  I OP1   1 
ATOM 8361  O OP2   . DG  I 5 112 ? 97.397  114.211 141.592 1.00 64.34  ? 38  DG  I OP2   1 
ATOM 8362  O "O5'" . DG  I 5 112 ? 99.772  114.707 141.145 1.00 64.34  ? 38  DG  I "O5'" 1 
ATOM 8363  C "C5'" . DG  I 5 112 ? 100.834 115.426 140.572 1.00 64.34  ? 38  DG  I "C5'" 1 
ATOM 8364  C "C4'" . DG  I 5 112 ? 102.087 115.316 141.419 1.00 64.34  ? 38  DG  I "C4'" 1 
ATOM 8365  O "O4'" . DG  I 5 112 ? 101.764 115.594 142.799 1.00 64.34  ? 38  DG  I "O4'" 1 
ATOM 8366  C "C3'" . DG  I 5 112 ? 102.774 113.955 141.423 1.00 64.34  ? 38  DG  I "C3'" 1 
ATOM 8367  O "O3'" . DG  I 5 112 ? 104.174 114.147 141.504 1.00 64.34  ? 38  DG  I "O3'" 1 
ATOM 8368  C "C2'" . DG  I 5 112 ? 102.221 113.305 142.682 1.00 64.34  ? 38  DG  I "C2'" 1 
ATOM 8369  C "C1'" . DG  I 5 112 ? 102.135 114.498 143.605 1.00 64.34  ? 38  DG  I "C1'" 1 
ATOM 8370  N N9    . DG  I 5 112 ? 101.141 114.361 144.645 1.00 64.34  ? 38  DG  I N9    1 
ATOM 8371  C C8    . DG  I 5 112 ? 99.792  114.199 144.483 1.00 64.34  ? 38  DG  I C8    1 
ATOM 8372  N N7    . DG  I 5 112 ? 99.146  114.130 145.606 1.00 64.34  ? 38  DG  I N7    1 
ATOM 8373  C C5    . DG  I 5 112 ? 100.134 114.263 146.570 1.00 64.34  ? 38  DG  I C5    1 
ATOM 8374  C C6    . DG  I 5 112 ? 100.041 114.259 147.978 1.00 64.34  ? 38  DG  I C6    1 
ATOM 8375  O O6    . DG  I 5 112 ? 99.029  114.145 148.679 1.00 64.34  ? 38  DG  I O6    1 
ATOM 8376  N N1    . DG  I 5 112 ? 101.285 114.427 148.579 1.00 64.34  ? 38  DG  I N1    1 
ATOM 8377  C C2    . DG  I 5 112 ? 102.463 114.572 147.898 1.00 64.34  ? 38  DG  I C2    1 
ATOM 8378  N N2    . DG  I 5 112 ? 103.564 114.731 148.638 1.00 64.34  ? 38  DG  I N2    1 
ATOM 8379  N N3    . DG  I 5 112 ? 102.560 114.570 146.583 1.00 64.34  ? 38  DG  I N3    1 
ATOM 8380  C C4    . DG  I 5 112 ? 101.362 114.410 145.989 1.00 64.34  ? 38  DG  I C4    1 
ATOM 8381  P P     . DA  I 5 113 ? 105.189 112.921 141.309 1.00 63.75  ? 39  DA  I P     1 
ATOM 8382  O OP1   . DA  I 5 113 ? 106.258 113.350 140.396 1.00 63.75  ? 39  DA  I OP1   1 
ATOM 8383  O OP2   . DA  I 5 113 ? 104.431 111.707 140.960 1.00 63.75  ? 39  DA  I OP2   1 
ATOM 8384  O "O5'" . DA  I 5 113 ? 105.834 112.750 142.752 1.00 63.75  ? 39  DA  I "O5'" 1 
ATOM 8385  C "C5'" . DA  I 5 113 ? 107.236 112.639 142.884 1.00 63.75  ? 39  DA  I "C5'" 1 
ATOM 8386  C "C4'" . DA  I 5 113 ? 107.646 112.840 144.323 1.00 63.75  ? 39  DA  I "C4'" 1 
ATOM 8387  O "O4'" . DA  I 5 113 ? 106.467 113.107 145.120 1.00 63.75  ? 39  DA  I "O4'" 1 
ATOM 8388  C "C3'" . DA  I 5 113 ? 108.314 111.644 144.984 1.00 63.75  ? 39  DA  I "C3'" 1 
ATOM 8389  O "O3'" . DA  I 5 113 ? 109.211 112.121 145.975 1.00 63.75  ? 39  DA  I "O3'" 1 
ATOM 8390  C "C2'" . DA  I 5 113 ? 107.123 110.914 145.587 1.00 63.75  ? 39  DA  I "C2'" 1 
ATOM 8391  C "C1'" . DA  I 5 113 ? 106.280 112.075 146.064 1.00 63.75  ? 39  DA  I "C1'" 1 
ATOM 8392  N N9    . DA  I 5 113 ? 104.863 111.771 146.122 1.00 63.75  ? 39  DA  I N9    1 
ATOM 8393  C C8    . DA  I 5 113 ? 104.028 111.564 145.070 1.00 63.75  ? 39  DA  I C8    1 
ATOM 8394  N N7    . DA  I 5 113 ? 102.789 111.325 145.417 1.00 63.75  ? 39  DA  I N7    1 
ATOM 8395  C C5    . DA  I 5 113 ? 102.820 111.376 146.793 1.00 63.75  ? 39  DA  I C5    1 
ATOM 8396  C C6    . DA  I 5 113 ? 101.828 111.207 147.768 1.00 63.75  ? 39  DA  I C6    1 
ATOM 8397  N N6    . DA  I 5 113 ? 100.559 110.926 147.478 1.00 63.75  ? 39  DA  I N6    1 
ATOM 8398  N N1    . DA  I 5 113 ? 102.192 111.322 149.056 1.00 63.75  ? 39  DA  I N1    1 
ATOM 8399  C C2    . DA  I 5 113 ? 103.464 111.599 149.345 1.00 63.75  ? 39  DA  I C2    1 
ATOM 8400  N N3    . DA  I 5 113 ? 104.484 111.782 148.515 1.00 63.75  ? 39  DA  I N3    1 
ATOM 8401  C C4    . DA  I 5 113 ? 104.087 111.667 147.243 1.00 63.75  ? 39  DA  I C4    1 
ATOM 8402  P P     . DC  I 5 114 ? 109.883 111.157 147.073 1.00 67.38  ? 40  DC  I P     1 
ATOM 8403  O OP1   . DC  I 5 114 ? 111.193 111.775 147.350 1.00 67.38  ? 40  DC  I OP1   1 
ATOM 8404  O OP2   . DC  I 5 114 ? 109.859 109.724 146.705 1.00 67.38  ? 40  DC  I OP2   1 
ATOM 8405  O "O5'" . DC  I 5 114 ? 108.965 111.370 148.362 1.00 67.38  ? 40  DC  I "O5'" 1 
ATOM 8406  C "C5'" . DC  I 5 114 ? 109.565 111.654 149.624 1.00 67.38  ? 40  DC  I "C5'" 1 
ATOM 8407  C "C4'" . DC  I 5 114 ? 109.322 110.515 150.595 1.00 67.38  ? 40  DC  I "C4'" 1 
ATOM 8408  O "O4'" . DC  I 5 114 ? 107.896 110.304 150.710 1.00 67.38  ? 40  DC  I "O4'" 1 
ATOM 8409  C "C3'" . DC  I 5 114 ? 109.940 109.183 150.172 1.00 67.38  ? 40  DC  I "C3'" 1 
ATOM 8410  O "O3'" . DC  I 5 114 ? 110.834 108.714 151.166 1.00 67.38  ? 40  DC  I "O3'" 1 
ATOM 8411  C "C2'" . DC  I 5 114 ? 108.756 108.244 149.968 1.00 67.38  ? 40  DC  I "C2'" 1 
ATOM 8412  C "C1'" . DC  I 5 114 ? 107.586 108.939 150.635 1.00 67.38  ? 40  DC  I "C1'" 1 
ATOM 8413  N N1    . DC  I 5 114 ? 106.342 108.777 149.841 1.00 67.38  ? 40  DC  I N1    1 
ATOM 8414  C C2    . DC  I 5 114 ? 105.115 108.560 150.476 1.00 67.38  ? 40  DC  I C2    1 
ATOM 8415  O O2    . DC  I 5 114 ? 105.061 108.530 151.711 1.00 67.38  ? 40  DC  I O2    1 
ATOM 8416  N N3    . DC  I 5 114 ? 104.007 108.404 149.715 1.00 67.38  ? 40  DC  I N3    1 
ATOM 8417  C C4    . DC  I 5 114 ? 104.099 108.446 148.393 1.00 67.38  ? 40  DC  I C4    1 
ATOM 8418  N N4    . DC  I 5 114 ? 102.989 108.276 147.688 1.00 67.38  ? 40  DC  I N4    1 
ATOM 8419  C C5    . DC  I 5 114 ? 105.337 108.640 147.733 1.00 67.38  ? 40  DC  I C5    1 
ATOM 8420  C C6    . DC  I 5 114 ? 106.418 108.813 148.485 1.00 67.38  ? 40  DC  I C6    1 
ATOM 8421  P P     . DC  I 5 115 ? 111.498 107.249 151.072 1.00 70.41  ? 41  DC  I P     1 
ATOM 8422  O OP1   . DC  I 5 115 ? 112.760 107.326 151.834 1.00 70.41  ? 41  DC  I OP1   1 
ATOM 8423  O OP2   . DC  I 5 115 ? 111.572 106.770 149.674 1.00 70.41  ? 41  DC  I OP2   1 
ATOM 8424  O "O5'" . DC  I 5 115 ? 110.489 106.344 151.916 1.00 70.41  ? 41  DC  I "O5'" 1 
ATOM 8425  C "C5'" . DC  I 5 115 ? 110.033 106.836 153.165 1.00 70.41  ? 41  DC  I "C5'" 1 
ATOM 8426  C "C4'" . DC  I 5 115 ? 108.751 106.164 153.618 1.00 70.41  ? 41  DC  I "C4'" 1 
ATOM 8427  O "O4'" . DC  I 5 115 ? 107.684 106.381 152.670 1.00 70.41  ? 41  DC  I "O4'" 1 
ATOM 8428  C "C3'" . DC  I 5 115 ? 108.836 104.659 153.821 1.00 70.41  ? 41  DC  I "C3'" 1 
ATOM 8429  O "O3'" . DC  I 5 115 ? 108.538 104.384 155.167 1.00 70.41  ? 41  DC  I "O3'" 1 
ATOM 8430  C "C2'" . DC  I 5 115 ? 107.756 104.107 152.878 1.00 70.41  ? 41  DC  I "C2'" 1 
ATOM 8431  C "C1'" . DC  I 5 115 ? 106.822 105.290 152.751 1.00 70.41  ? 41  DC  I "C1'" 1 
ATOM 8432  N N1    . DC  I 5 115 ? 105.997 105.276 151.537 1.00 70.41  ? 41  DC  I N1    1 
ATOM 8433  C C2    . DC  I 5 115 ? 104.612 105.070 151.623 1.00 70.41  ? 41  DC  I C2    1 
ATOM 8434  O O2    . DC  I 5 115 ? 104.084 104.887 152.724 1.00 70.41  ? 41  DC  I O2    1 
ATOM 8435  N N3    . DC  I 5 115 ? 103.882 105.076 150.482 1.00 70.41  ? 41  DC  I N3    1 
ATOM 8436  C C4    . DC  I 5 115 ? 104.484 105.274 149.309 1.00 70.41  ? 41  DC  I C4    1 
ATOM 8437  N N4    . DC  I 5 115 ? 103.729 105.272 148.208 1.00 70.41  ? 41  DC  I N4    1 
ATOM 8438  C C5    . DC  I 5 115 ? 105.885 105.486 149.213 1.00 70.41  ? 41  DC  I C5    1 
ATOM 8439  C C6    . DC  I 5 115 ? 106.589 105.481 150.340 1.00 70.41  ? 41  DC  I C6    1 
ATOM 8440  P P     . DA  I 5 116 ? 109.019 103.022 155.861 1.00 75.38  ? 42  DA  I P     1 
ATOM 8441  O OP1   . DA  I 5 116 ? 109.999 103.385 156.907 1.00 75.38  ? 42  DA  I OP1   1 
ATOM 8442  O OP2   . DA  I 5 116 ? 109.401 102.051 154.814 1.00 75.38  ? 42  DA  I OP2   1 
ATOM 8443  O "O5'" . DA  I 5 116 ? 107.685 102.492 156.559 1.00 75.38  ? 42  DA  I "O5'" 1 
ATOM 8444  C "C5'" . DA  I 5 116 ? 106.419 102.981 156.119 1.00 75.38  ? 42  DA  I "C5'" 1 
ATOM 8445  C "C4'" . DA  I 5 116 ? 105.578 101.857 155.557 1.00 75.38  ? 42  DA  I "C4'" 1 
ATOM 8446  O "O4'" . DA  I 5 116 ? 104.949 102.275 154.313 1.00 75.38  ? 42  DA  I "O4'" 1 
ATOM 8447  C "C3'" . DA  I 5 116 ? 106.354 100.572 155.214 1.00 75.38  ? 42  DA  I "C3'" 1 
ATOM 8448  O "O3'" . DA  I 5 116 ? 105.640 99.448  155.689 1.00 75.38  ? 42  DA  I "O3'" 1 
ATOM 8449  C "C2'" . DA  I 5 116 ? 106.367 100.596 153.697 1.00 75.38  ? 42  DA  I "C2'" 1 
ATOM 8450  C "C1'" . DA  I 5 116 ? 104.999 101.171 153.463 1.00 75.38  ? 42  DA  I "C1'" 1 
ATOM 8451  N N9    . DA  I 5 116 ? 104.751 101.546 152.085 1.00 75.38  ? 42  DA  I N9    1 
ATOM 8452  C C8    . DA  I 5 116 ? 105.667 101.961 151.164 1.00 75.38  ? 42  DA  I C8    1 
ATOM 8453  N N7    . DA  I 5 116 ? 105.157 102.195 149.985 1.00 75.38  ? 42  DA  I N7    1 
ATOM 8454  C C5    . DA  I 5 116 ? 103.825 101.879 150.140 1.00 75.38  ? 42  DA  I C5    1 
ATOM 8455  C C6    . DA  I 5 116 ? 102.746 101.915 149.259 1.00 75.38  ? 42  DA  I C6    1 
ATOM 8456  N N6    . DA  I 5 116 ? 102.864 102.293 147.992 1.00 75.38  ? 42  DA  I N6    1 
ATOM 8457  N N1    . DA  I 5 116 ? 101.541 101.533 149.725 1.00 75.38  ? 42  DA  I N1    1 
ATOM 8458  C C2    . DA  I 5 116 ? 101.430 101.156 151.002 1.00 75.38  ? 42  DA  I C2    1 
ATOM 8459  N N3    . DA  I 5 116 ? 102.379 101.081 151.928 1.00 75.38  ? 42  DA  I N3    1 
ATOM 8460  C C4    . DA  I 5 116 ? 103.561 101.469 151.426 1.00 75.38  ? 42  DA  I C4    1 
ATOM 8461  P P     . DA  I 5 117 ? 106.388 98.055  155.983 1.00 78.33  ? 43  DA  I P     1 
ATOM 8462  O OP1   . DA  I 5 117 ? 107.015 98.160  157.319 1.00 78.33  ? 43  DA  I OP1   1 
ATOM 8463  O OP2   . DA  I 5 117 ? 107.215 97.682  154.816 1.00 78.33  ? 43  DA  I OP2   1 
ATOM 8464  O "O5'" . DA  I 5 117 ? 105.185 97.008  156.074 1.00 78.33  ? 43  DA  I "O5'" 1 
ATOM 8465  C "C5'" . DA  I 5 117 ? 104.116 97.240  156.980 1.00 78.33  ? 43  DA  I "C5'" 1 
ATOM 8466  C "C4'" . DA  I 5 117 ? 102.776 97.054  156.296 1.00 78.33  ? 43  DA  I "C4'" 1 
ATOM 8467  O "O4'" . DA  I 5 117 ? 102.733 97.860  155.088 1.00 78.33  ? 43  DA  I "O4'" 1 
ATOM 8468  C "C3'" . DA  I 5 117 ? 102.466 95.623  155.862 1.00 78.33  ? 43  DA  I "C3'" 1 
ATOM 8469  O "O3'" . DA  I 5 117 ? 101.111 95.318  156.143 1.00 78.33  ? 43  DA  I "O3'" 1 
ATOM 8470  C "C2'" . DA  I 5 117 ? 102.731 95.649  154.359 1.00 78.33  ? 43  DA  I "C2'" 1 
ATOM 8471  C "C1'" . DA  I 5 117 ? 102.314 97.064  154.003 1.00 78.33  ? 43  DA  I "C1'" 1 
ATOM 8472  N N9    . DA  I 5 117 ? 102.951 97.568  152.794 1.00 78.33  ? 43  DA  I N9    1 
ATOM 8473  C C8    . DA  I 5 117 ? 104.256 97.914  152.655 1.00 78.33  ? 43  DA  I C8    1 
ATOM 8474  N N7    . DA  I 5 117 ? 104.567 98.343  151.459 1.00 78.33  ? 43  DA  I N7    1 
ATOM 8475  C C5    . DA  I 5 117 ? 103.384 98.257  150.757 1.00 78.33  ? 43  DA  I C5    1 
ATOM 8476  C C6    . DA  I 5 117 ? 103.051 98.564  149.427 1.00 78.33  ? 43  DA  I C6    1 
ATOM 8477  N N6    . DA  I 5 117 ? 103.932 99.036  148.545 1.00 78.33  ? 43  DA  I N6    1 
ATOM 8478  N N1    . DA  I 5 117 ? 101.773 98.374  149.041 1.00 78.33  ? 43  DA  I N1    1 
ATOM 8479  C C2    . DA  I 5 117 ? 100.896 97.899  149.937 1.00 78.33  ? 43  DA  I C2    1 
ATOM 8480  N N3    . DA  I 5 117 ? 101.094 97.580  151.216 1.00 78.33  ? 43  DA  I N3    1 
ATOM 8481  C C4    . DA  I 5 117 ? 102.369 97.789  151.566 1.00 78.33  ? 43  DA  I C4    1 
ATOM 8482  P P     . DT  I 5 118 ? 100.563 93.823  155.937 1.00 75.18  ? 44  DT  I P     1 
ATOM 8483  O OP1   . DT  I 5 118 ? 99.450  93.629  156.891 1.00 75.18  ? 44  DT  I OP1   1 
ATOM 8484  O OP2   . DT  I 5 118 ? 101.726 92.912  155.961 1.00 75.18  ? 44  DT  I OP2   1 
ATOM 8485  O "O5'" . DT  I 5 118 ? 99.973  93.825  154.450 1.00 75.18  ? 44  DT  I "O5'" 1 
ATOM 8486  C "C5'" . DT  I 5 118 ? 98.869  94.657  154.131 1.00 75.18  ? 44  DT  I "C5'" 1 
ATOM 8487  C "C4'" . DT  I 5 118 ? 98.299  94.318  152.762 1.00 75.18  ? 44  DT  I "C4'" 1 
ATOM 8488  O "O4'" . DT  I 5 118 ? 99.098  94.939  151.723 1.00 75.18  ? 44  DT  I "O4'" 1 
ATOM 8489  C "C3'" . DT  I 5 118 ? 98.239  92.829  152.412 1.00 75.18  ? 44  DT  I "C3'" 1 
ATOM 8490  O "O3'" . DT  I 5 118 ? 96.991  92.549  151.796 1.00 75.18  ? 44  DT  I "O3'" 1 
ATOM 8491  C "C2'" . DT  I 5 118 ? 99.399  92.665  151.431 1.00 75.18  ? 44  DT  I "C2'" 1 
ATOM 8492  C "C1'" . DT  I 5 118 ? 99.350  93.993  150.715 1.00 75.18  ? 44  DT  I "C1'" 1 
ATOM 8493  N N1    . DT  I 5 118 ? 100.603 94.378  150.046 1.00 75.18  ? 44  DT  I N1    1 
ATOM 8494  C C2    . DT  I 5 118 ? 100.565 94.727  148.727 1.00 75.18  ? 44  DT  I C2    1 
ATOM 8495  O O2    . DT  I 5 118 ? 99.550  94.708  148.066 1.00 75.18  ? 44  DT  I O2    1 
ATOM 8496  N N3    . DT  I 5 118 ? 101.762 95.099  148.197 1.00 75.18  ? 44  DT  I N3    1 
ATOM 8497  C C4    . DT  I 5 118 ? 102.968 95.163  148.847 1.00 75.18  ? 44  DT  I C4    1 
ATOM 8498  O O4    . DT  I 5 118 ? 103.991 95.510  148.283 1.00 75.18  ? 44  DT  I O4    1 
ATOM 8499  C C5    . DT  I 5 118 ? 102.941 94.790  150.235 1.00 75.18  ? 44  DT  I C5    1 
ATOM 8500  C C7    . DT  I 5 118 ? 104.202 94.811  151.042 1.00 75.18  ? 44  DT  I C7    1 
ATOM 8501  C C6    . DT  I 5 118 ? 101.770 94.424  150.765 1.00 75.18  ? 44  DT  I C6    1 
ATOM 8502  P P     . DT  I 5 119 ? 96.628  91.064  151.303 1.00 71.66  ? 45  DT  I P     1 
ATOM 8503  O OP1   . DT  I 5 119 ? 95.163  90.933  151.446 1.00 71.66  ? 45  DT  I OP1   1 
ATOM 8504  O OP2   . DT  I 5 119 ? 97.514  90.093  151.980 1.00 71.66  ? 45  DT  I OP2   1 
ATOM 8505  O "O5'" . DT  I 5 119 ? 96.973  91.078  149.740 1.00 71.66  ? 45  DT  I "O5'" 1 
ATOM 8506  C "C5'" . DT  I 5 119 ? 96.021  91.602  148.812 1.00 71.66  ? 45  DT  I "C5'" 1 
ATOM 8507  C "C4'" . DT  I 5 119 ? 96.404  91.286  147.375 1.00 71.66  ? 45  DT  I "C4'" 1 
ATOM 8508  O "O4'" . DT  I 5 119 ? 97.717  91.822  147.096 1.00 71.66  ? 45  DT  I "O4'" 1 
ATOM 8509  C "C3'" . DT  I 5 119 ? 96.473  89.801  147.025 1.00 71.66  ? 45  DT  I "C3'" 1 
ATOM 8510  O "O3'" . DT  I 5 119 ? 95.918  89.584  145.728 1.00 71.66  ? 45  DT  I "O3'" 1 
ATOM 8511  C "C2'" . DT  I 5 119 ? 97.971  89.518  147.052 1.00 71.66  ? 45  DT  I "C2'" 1 
ATOM 8512  C "C1'" . DT  I 5 119 ? 98.506  90.823  146.508 1.00 71.66  ? 45  DT  I "C1'" 1 
ATOM 8513  N N1    . DT  I 5 119 ? 99.912  91.091  146.848 1.00 71.66  ? 45  DT  I N1    1 
ATOM 8514  C C2    . DT  I 5 119 ? 100.727 91.608  145.886 1.00 71.66  ? 45  DT  I C2    1 
ATOM 8515  O O2    . DT  I 5 119 ? 100.350 91.857  144.762 1.00 71.66  ? 45  DT  I O2    1 
ATOM 8516  N N3    . DT  I 5 119 ? 102.000 91.844  146.282 1.00 71.66  ? 45  DT  I N3    1 
ATOM 8517  C C4    . DT  I 5 119 ? 102.537 91.610  147.521 1.00 71.66  ? 45  DT  I C4    1 
ATOM 8518  O O4    . DT  I 5 119 ? 103.703 91.854  147.781 1.00 71.66  ? 45  DT  I O4    1 
ATOM 8519  C C5    . DT  I 5 119 ? 101.634 91.068  148.491 1.00 71.66  ? 45  DT  I C5    1 
ATOM 8520  C C7    . DT  I 5 119 ? 102.120 90.773  149.878 1.00 71.66  ? 45  DT  I C7    1 
ATOM 8521  C C6    . DT  I 5 119 ? 100.371 90.838  148.117 1.00 71.66  ? 45  DT  I C6    1 
ATOM 8522  P P     . DG  I 5 120 ? 94.517  88.812  145.586 1.00 72.70  ? 46  DG  I P     1 
ATOM 8523  O OP1   . DG  I 5 120 ? 93.545  89.507  146.454 1.00 72.70  ? 46  DG  I OP1   1 
ATOM 8524  O OP2   . DG  I 5 120 ? 94.787  87.371  145.769 1.00 72.70  ? 46  DG  I OP2   1 
ATOM 8525  O "O5'" . DG  I 5 120 ? 94.087  89.005  144.056 1.00 72.70  ? 46  DG  I "O5'" 1 
ATOM 8526  C "C5'" . DG  I 5 120 ? 94.099  90.301  143.434 1.00 72.70  ? 46  DG  I "C5'" 1 
ATOM 8527  C "C4'" . DG  I 5 120 ? 95.082  90.374  142.257 1.00 72.70  ? 46  DG  I "C4'" 1 
ATOM 8528  O "O4'" . DG  I 5 120 ? 96.435  90.263  142.747 1.00 72.70  ? 46  DG  I "O4'" 1 
ATOM 8529  C "C3'" . DG  I 5 120 ? 94.955  89.295  141.170 1.00 72.70  ? 46  DG  I "C3'" 1 
ATOM 8530  O "O3'" . DG  I 5 120 ? 95.399  89.820  139.934 1.00 72.70  ? 46  DG  I "O3'" 1 
ATOM 8531  C "C2'" . DG  I 5 120 ? 95.963  88.263  141.651 1.00 72.70  ? 46  DG  I "C2'" 1 
ATOM 8532  C "C1'" . DG  I 5 120 ? 97.070  89.202  142.080 1.00 72.70  ? 46  DG  I "C1'" 1 
ATOM 8533  N N9    . DG  I 5 120 ? 98.041  88.633  142.980 1.00 72.70  ? 46  DG  I N9    1 
ATOM 8534  C C8    . DG  I 5 120 ? 97.837  87.705  143.964 1.00 72.70  ? 46  DG  I C8    1 
ATOM 8535  N N7    . DG  I 5 120 ? 98.924  87.413  144.622 1.00 72.70  ? 46  DG  I N7    1 
ATOM 8536  C C5    . DG  I 5 120 ? 99.891  88.220  144.044 1.00 72.70  ? 46  DG  I C5    1 
ATOM 8537  C C6    . DG  I 5 120 ? 101.264 88.350  144.331 1.00 72.70  ? 46  DG  I C6    1 
ATOM 8538  O O6    . DG  I 5 120 ? 101.922 87.774  145.197 1.00 72.70  ? 46  DG  I O6    1 
ATOM 8539  N N1    . DG  I 5 120 ? 101.873 89.280  143.501 1.00 72.70  ? 46  DG  I N1    1 
ATOM 8540  C C2    . DG  I 5 120 ? 101.234 89.982  142.512 1.00 72.70  ? 46  DG  I C2    1 
ATOM 8541  N N2    . DG  I 5 120 ? 101.976 90.840  141.810 1.00 72.70  ? 46  DG  I N2    1 
ATOM 8542  N N3    . DG  I 5 120 ? 99.956  89.867  142.238 1.00 72.70  ? 46  DG  I N3    1 
ATOM 8543  C C4    . DG  I 5 120 ? 99.352  88.972  143.038 1.00 72.70  ? 46  DG  I C4    1 
ATOM 8544  P P     . DA  I 5 121 ? 94.410  90.562  138.911 1.00 74.62  ? 47  DA  I P     1 
ATOM 8545  O OP1   . DA  I 5 121 ? 93.291  91.186  139.648 1.00 74.62  ? 47  DA  I OP1   1 
ATOM 8546  O OP2   . DA  I 5 121 ? 94.117  89.614  137.820 1.00 74.62  ? 47  DA  I OP2   1 
ATOM 8547  O "O5'" . DA  I 5 121 ? 95.344  91.698  138.294 1.00 74.62  ? 47  DA  I "O5'" 1 
ATOM 8548  C "C5'" . DA  I 5 121 ? 96.652  91.888  138.834 1.00 74.62  ? 47  DA  I "C5'" 1 
ATOM 8549  C "C4'" . DA  I 5 121 ? 97.710  91.859  137.744 1.00 74.62  ? 47  DA  I "C4'" 1 
ATOM 8550  O "O4'" . DA  I 5 121 ? 98.859  91.081  138.194 1.00 74.62  ? 47  DA  I "O4'" 1 
ATOM 8551  C "C3'" . DA  I 5 121 ? 97.286  91.181  136.465 1.00 74.62  ? 47  DA  I "C3'" 1 
ATOM 8552  O "O3'" . DA  I 5 121 ? 98.155  91.580  135.430 1.00 74.62  ? 47  DA  I "O3'" 1 
ATOM 8553  C "C2'" . DA  I 5 121 ? 97.522  89.732  136.836 1.00 74.62  ? 47  DA  I "C2'" 1 
ATOM 8554  C "C1'" . DA  I 5 121 ? 98.883  89.836  137.513 1.00 74.62  ? 47  DA  I "C1'" 1 
ATOM 8555  N N9    . DA  I 5 121 ? 99.113  88.785  138.497 1.00 74.62  ? 47  DA  I N9    1 
ATOM 8556  C C8    . DA  I 5 121 ? 98.177  87.951  139.016 1.00 74.62  ? 47  DA  I C8    1 
ATOM 8557  N N7    . DA  I 5 121 ? 98.644  87.114  139.906 1.00 74.62  ? 47  DA  I N7    1 
ATOM 8558  C C5    . DA  I 5 121 ? 99.987  87.413  139.971 1.00 74.62  ? 47  DA  I C5    1 
ATOM 8559  C C6    . DA  I 5 121 ? 101.044 86.869  140.727 1.00 74.62  ? 47  DA  I C6    1 
ATOM 8560  N N6    . DA  I 5 121 ? 100.889 85.872  141.605 1.00 74.62  ? 47  DA  I N6    1 
ATOM 8561  N N1    . DA  I 5 121 ? 102.269 87.391  140.554 1.00 74.62  ? 47  DA  I N1    1 
ATOM 8562  C C2    . DA  I 5 121 ? 102.426 88.397  139.688 1.00 74.62  ? 47  DA  I C2    1 
ATOM 8563  N N3    . DA  I 5 121 ? 101.509 88.986  138.915 1.00 74.62  ? 47  DA  I N3    1 
ATOM 8564  C C4    . DA  I 5 121 ? 100.300 88.445  139.111 1.00 74.62  ? 47  DA  I C4    1 
ATOM 8565  P P     . DG  I 5 122 ? 97.655  91.634  133.908 1.00 74.00  ? 48  DG  I P     1 
ATOM 8566  O OP1   . DG  I 5 122 ? 97.074  92.969  133.656 1.00 74.00  ? 48  DG  I OP1   1 
ATOM 8567  O OP2   . DG  I 5 122 ? 96.857  90.425  133.633 1.00 74.00  ? 48  DG  I OP2   1 
ATOM 8568  O "O5'" . DG  I 5 122 ? 99.011  91.507  133.090 1.00 74.00  ? 48  DG  I "O5'" 1 
ATOM 8569  C "C5'" . DG  I 5 122 ? 100.079 92.393  133.369 1.00 74.00  ? 48  DG  I "C5'" 1 
ATOM 8570  C "C4'" . DG  I 5 122 ? 101.425 91.682  133.371 1.00 74.00  ? 48  DG  I "C4'" 1 
ATOM 8571  O "O4'" . DG  I 5 122 ? 101.451 90.667  134.400 1.00 74.00  ? 48  DG  I "O4'" 1 
ATOM 8572  C "C3'" . DG  I 5 122 ? 101.821 90.978  132.078 1.00 74.00  ? 48  DG  I "C3'" 1 
ATOM 8573  O "O3'" . DG  I 5 122 ? 103.209 91.092  131.914 1.00 74.00  ? 48  DG  I "O3'" 1 
ATOM 8574  C "C2'" . DG  I 5 122 ? 101.413 89.532  132.351 1.00 74.00  ? 48  DG  I "C2'" 1 
ATOM 8575  C "C1'" . DG  I 5 122 ? 101.718 89.403  133.830 1.00 74.00  ? 48  DG  I "C1'" 1 
ATOM 8576  N N9    . DG  I 5 122 ? 100.873 88.455  134.519 1.00 74.00  ? 48  DG  I N9    1 
ATOM 8577  C C8    . DG  I 5 122 ? 99.528  88.291  134.362 1.00 74.00  ? 48  DG  I C8    1 
ATOM 8578  N N7    . DG  I 5 122 ? 99.026  87.381  135.143 1.00 74.00  ? 48  DG  I N7    1 
ATOM 8579  C C5    . DG  I 5 122 ? 100.102 86.942  135.881 1.00 74.00  ? 48  DG  I C5    1 
ATOM 8580  C C6    . DG  I 5 122 ? 100.166 85.968  136.888 1.00 74.00  ? 48  DG  I C6    1 
ATOM 8581  O O6    . DG  I 5 122 ? 99.248  85.284  137.354 1.00 74.00  ? 48  DG  I O6    1 
ATOM 8582  N N1    . DG  I 5 122 ? 101.458 85.820  137.369 1.00 74.00  ? 48  DG  I N1    1 
ATOM 8583  C C2    . DG  I 5 122 ? 102.549 86.522  136.916 1.00 74.00  ? 48  DG  I C2    1 
ATOM 8584  N N2    . DG  I 5 122 ? 103.718 86.250  137.503 1.00 74.00  ? 48  DG  I N2    1 
ATOM 8585  N N3    . DG  I 5 122 ? 102.496 87.439  135.974 1.00 74.00  ? 48  DG  I N3    1 
ATOM 8586  C C4    . DG  I 5 122 ? 101.246 87.601  135.511 1.00 74.00  ? 48  DG  I C4    1 
ATOM 8587  P P     . DC  I 5 123 ? 103.915 90.814  130.500 1.00 76.13  ? 49  DC  I P     1 
ATOM 8588  O OP1   . DC  I 5 123 ? 104.410 92.117  130.023 1.00 76.13  ? 49  DC  I OP1   1 
ATOM 8589  O OP2   . DC  I 5 123 ? 103.051 90.000  129.618 1.00 76.13  ? 49  DC  I OP2   1 
ATOM 8590  O "O5'" . DC  I 5 123 ? 105.170 89.921  130.911 1.00 76.13  ? 49  DC  I "O5'" 1 
ATOM 8591  C "C5'" . DC  I 5 123 ? 105.662 89.976  132.249 1.00 76.13  ? 49  DC  I "C5'" 1 
ATOM 8592  C "C4'" . DC  I 5 123 ? 106.396 88.705  132.619 1.00 76.13  ? 49  DC  I "C4'" 1 
ATOM 8593  O "O4'" . DC  I 5 123 ? 105.540 87.862  133.433 1.00 76.13  ? 49  DC  I "O4'" 1 
ATOM 8594  C "C3'" . DC  I 5 123 ? 106.831 87.849  131.438 1.00 76.13  ? 49  DC  I "C3'" 1 
ATOM 8595  O "O3'" . DC  I 5 123 ? 108.090 87.274  131.701 1.00 76.13  ? 49  DC  I "O3'" 1 
ATOM 8596  C "C2'" . DC  I 5 123 ? 105.748 86.789  131.387 1.00 76.13  ? 49  DC  I "C2'" 1 
ATOM 8597  C "C1'" . DC  I 5 123 ? 105.487 86.573  132.865 1.00 76.13  ? 49  DC  I "C1'" 1 
ATOM 8598  N N1    . DC  I 5 123 ? 104.150 85.984  133.153 1.00 76.13  ? 49  DC  I N1    1 
ATOM 8599  C C2    . DC  I 5 123 ? 104.012 85.012  134.142 1.00 76.13  ? 49  DC  I C2    1 
ATOM 8600  O O2    . DC  I 5 123 ? 105.004 84.641  134.772 1.00 76.13  ? 49  DC  I O2    1 
ATOM 8601  N N3    . DC  I 5 123 ? 102.786 84.497  134.382 1.00 76.13  ? 49  DC  I N3    1 
ATOM 8602  C C4    . DC  I 5 123 ? 101.742 84.913  133.677 1.00 76.13  ? 49  DC  I C4    1 
ATOM 8603  N N4    . DC  I 5 123 ? 100.550 84.381  133.947 1.00 76.13  ? 49  DC  I N4    1 
ATOM 8604  C C5    . DC  I 5 123 ? 101.867 85.896  132.666 1.00 76.13  ? 49  DC  I C5    1 
ATOM 8605  C C6    . DC  I 5 123 ? 103.077 86.393  132.440 1.00 76.13  ? 49  DC  I C6    1 
ATOM 8606  P P     . DG  I 5 124 ? 109.076 86.919  130.487 1.00 87.08  ? 50  DG  I P     1 
ATOM 8607  O OP1   . DG  I 5 124 ? 110.264 87.789  130.592 1.00 87.08  ? 50  DG  I OP1   1 
ATOM 8608  O OP2   . DG  I 5 124 ? 108.269 86.919  129.253 1.00 87.08  ? 50  DG  I OP2   1 
ATOM 8609  O "O5'" . DG  I 5 124 ? 109.526 85.417  130.780 1.00 87.08  ? 50  DG  I "O5'" 1 
ATOM 8610  C "C5'" . DG  I 5 124 ? 110.385 85.148  131.877 1.00 87.08  ? 50  DG  I "C5'" 1 
ATOM 8611  C "C4'" . DG  I 5 124 ? 110.346 83.684  132.285 1.00 87.08  ? 50  DG  I "C4'" 1 
ATOM 8612  O "O4'" . DG  I 5 124 ? 109.046 83.355  132.845 1.00 87.08  ? 50  DG  I "O4'" 1 
ATOM 8613  C "C3'" . DG  I 5 124 ? 110.605 82.678  131.173 1.00 87.08  ? 50  DG  I "C3'" 1 
ATOM 8614  O "O3'" . DG  I 5 124 ? 111.403 81.615  131.688 1.00 87.08  ? 50  DG  I "O3'" 1 
ATOM 8615  C "C2'" . DG  I 5 124 ? 109.202 82.210  130.819 1.00 87.08  ? 50  DG  I "C2'" 1 
ATOM 8616  C "C1'" . DG  I 5 124 ? 108.499 82.250  132.167 1.00 87.08  ? 50  DG  I "C1'" 1 
ATOM 8617  N N9    . DG  I 5 124 ? 107.061 82.464  132.037 1.00 87.08  ? 50  DG  I N9    1 
ATOM 8618  C C8    . DG  I 5 124 ? 106.460 83.467  131.341 1.00 87.08  ? 50  DG  I C8    1 
ATOM 8619  N N7    . DG  I 5 124 ? 105.164 83.431  131.380 1.00 87.08  ? 50  DG  I N7    1 
ATOM 8620  C C5    . DG  I 5 124 ? 104.884 82.318  132.135 1.00 87.08  ? 50  DG  I C5    1 
ATOM 8621  C C6    . DG  I 5 124 ? 103.649 81.786  132.502 1.00 87.08  ? 50  DG  I C6    1 
ATOM 8622  O O6    . DG  I 5 124 ? 102.531 82.210  132.216 1.00 87.08  ? 50  DG  I O6    1 
ATOM 8623  N N1    . DG  I 5 124 ? 103.789 80.651  133.276 1.00 87.08  ? 50  DG  I N1    1 
ATOM 8624  C C2    . DG  I 5 124 ? 104.985 80.095  133.644 1.00 87.08  ? 50  DG  I C2    1 
ATOM 8625  N N2    . DG  I 5 124 ? 104.920 78.994  134.401 1.00 87.08  ? 50  DG  I N2    1 
ATOM 8626  N N3    . DG  I 5 124 ? 106.167 80.594  133.309 1.00 87.08  ? 50  DG  I N3    1 
ATOM 8627  C C4    . DG  I 5 124 ? 106.037 81.706  132.558 1.00 87.08  ? 50  DG  I C4    1 
ATOM 8628  P P     . DG  I 5 125 ? 112.077 80.502  130.735 1.00 95.91  ? 51  DG  I P     1 
ATOM 8629  O OP1   . DG  I 5 125 ? 113.539 80.660  130.875 1.00 95.91  ? 51  DG  I OP1   1 
ATOM 8630  O OP2   . DG  I 5 125 ? 111.507 80.502  129.371 1.00 95.91  ? 51  DG  I OP2   1 
ATOM 8631  O "O5'" . DG  I 5 125 ? 111.635 79.135  131.437 1.00 95.91  ? 51  DG  I "O5'" 1 
ATOM 8632  C "C5'" . DG  I 5 125 ? 110.647 79.177  132.472 1.00 95.91  ? 51  DG  I "C5'" 1 
ATOM 8633  C "C4'" . DG  I 5 125 ? 110.235 77.792  132.935 1.00 95.91  ? 51  DG  I "C4'" 1 
ATOM 8634  O "O4'" . DG  I 5 125 ? 108.794 77.731  133.022 1.00 95.91  ? 51  DG  I "O4'" 1 
ATOM 8635  C "C3'" . DG  I 5 125 ? 110.589 76.653  132.010 1.00 95.91  ? 51  DG  I "C3'" 1 
ATOM 8636  O "O3'" . DG  I 5 125 ? 110.505 75.444  132.737 1.00 95.91  ? 51  DG  I "O3'" 1 
ATOM 8637  C "C2'" . DG  I 5 125 ? 109.474 76.746  130.981 1.00 95.91  ? 51  DG  I "C2'" 1 
ATOM 8638  C "C1'" . DG  I 5 125 ? 108.276 77.101  131.861 1.00 95.91  ? 51  DG  I "C1'" 1 
ATOM 8639  N N9    . DG  I 5 125 ? 107.370 78.034  131.231 1.00 95.91  ? 51  DG  I N9    1 
ATOM 8640  C C8    . DG  I 5 125 ? 107.716 79.156  130.544 1.00 95.91  ? 51  DG  I C8    1 
ATOM 8641  N N7    . DG  I 5 125 ? 106.703 79.827  130.094 1.00 95.91  ? 51  DG  I N7    1 
ATOM 8642  C C5    . DG  I 5 125 ? 105.609 79.099  130.510 1.00 95.91  ? 51  DG  I C5    1 
ATOM 8643  C C6    . DG  I 5 125 ? 104.244 79.337  130.308 1.00 95.91  ? 51  DG  I C6    1 
ATOM 8644  O O6    . DG  I 5 125 ? 103.720 80.276  129.707 1.00 95.91  ? 51  DG  I O6    1 
ATOM 8645  N N1    . DG  I 5 125 ? 103.460 78.353  130.889 1.00 95.91  ? 51  DG  I N1    1 
ATOM 8646  C C2    . DG  I 5 125 ? 103.940 77.271  131.579 1.00 95.91  ? 51  DG  I C2    1 
ATOM 8647  N N2    . DG  I 5 125 ? 103.032 76.424  132.071 1.00 95.91  ? 51  DG  I N2    1 
ATOM 8648  N N3    . DG  I 5 125 ? 105.228 77.033  131.776 1.00 95.91  ? 51  DG  I N3    1 
ATOM 8649  C C4    . DG  I 5 125 ? 106.001 77.987  131.213 1.00 95.91  ? 51  DG  I C4    1 
ATOM 8650  P P     . DC  I 5 126 ? 110.921 74.055  132.056 1.00 96.42  ? 52  DC  I P     1 
ATOM 8651  O OP1   . DC  I 5 126 ? 111.359 73.155  133.146 1.00 96.42  ? 52  DC  I OP1   1 
ATOM 8652  O OP2   . DC  I 5 126 ? 111.823 74.373  130.926 1.00 96.42  ? 52  DC  I OP2   1 
ATOM 8653  O "O5'" . DC  I 5 126 ? 109.555 73.496  131.443 1.00 96.42  ? 52  DC  I "O5'" 1 
ATOM 8654  C "C5'" . DC  I 5 126 ? 108.416 73.331  132.274 1.00 96.42  ? 52  DC  I "C5'" 1 
ATOM 8655  C "C4'" . DC  I 5 126 ? 107.226 72.902  131.443 1.00 96.42  ? 52  DC  I "C4'" 1 
ATOM 8656  O "O4'" . DC  I 5 126 ? 106.520 74.073  130.983 1.00 96.42  ? 52  DC  I "O4'" 1 
ATOM 8657  C "C3'" . DC  I 5 126 ? 107.598 72.118  130.192 1.00 96.42  ? 52  DC  I "C3'" 1 
ATOM 8658  O "O3'" . DC  I 5 126 ? 107.283 70.692  130.337 1.00 96.42  ? 52  DC  I "O3'" 1 
ATOM 8659  C "C2'" . DC  I 5 126 ? 106.869 72.822  129.039 1.00 96.42  ? 52  DC  I "C2'" 1 
ATOM 8660  C "C1'" . DC  I 5 126 ? 105.937 73.802  129.738 1.00 96.42  ? 52  DC  I "C1'" 1 
ATOM 8661  N N1    . DC  I 5 126 ? 105.788 75.085  129.012 1.00 96.42  ? 52  DC  I N1    1 
ATOM 8662  C C2    . DC  I 5 126 ? 104.515 75.565  128.695 1.00 96.42  ? 52  DC  I C2    1 
ATOM 8663  O O2    . DC  I 5 126 ? 103.525 74.905  129.016 1.00 96.42  ? 52  DC  I O2    1 
ATOM 8664  N N3    . DC  I 5 126 ? 104.409 76.740  128.030 1.00 96.42  ? 52  DC  I N3    1 
ATOM 8665  C C4    . DC  I 5 126 ? 105.506 77.415  127.693 1.00 96.42  ? 52  DC  I C4    1 
ATOM 8666  N N4    . DC  I 5 126 ? 105.358 78.571  127.047 1.00 96.42  ? 52  DC  I N4    1 
ATOM 8667  C C5    . DC  I 5 126 ? 106.805 76.945  128.015 1.00 96.42  ? 52  DC  I C5    1 
ATOM 8668  C C6    . DC  I 5 126 ? 106.897 75.787  128.665 1.00 96.42  ? 52  DC  I C6    1 
ATOM 8669  P P     . DC  I 5 127 ? 105.818 70.053  130.087 1.00 96.03  ? 53  DC  I P     1 
ATOM 8670  O OP1   . DC  I 5 127 ? 104.743 70.904  130.638 1.00 96.03  ? 53  DC  I OP1   1 
ATOM 8671  O OP2   . DC  I 5 127 ? 105.924 68.669  130.596 1.00 96.03  ? 53  DC  I OP2   1 
ATOM 8672  O "O5'" . DC  I 5 127 ? 105.695 69.922  128.493 1.00 96.03  ? 53  DC  I "O5'" 1 
ATOM 8673  C "C5'" . DC  I 5 127 ? 104.798 68.986  127.907 1.00 96.03  ? 53  DC  I "C5'" 1 
ATOM 8674  C "C4'" . DC  I 5 127 ? 103.361 69.471  127.982 1.00 96.03  ? 53  DC  I "C4'" 1 
ATOM 8675  O "O4'" . DC  I 5 127 ? 103.328 70.928  127.995 1.00 96.03  ? 53  DC  I "O4'" 1 
ATOM 8676  C "C3'" . DC  I 5 127 ? 102.488 69.044  126.812 1.00 96.03  ? 53  DC  I "C3'" 1 
ATOM 8677  O "O3'" . DC  I 5 127 ? 101.168 68.777  127.258 1.00 96.03  ? 53  DC  I "O3'" 1 
ATOM 8678  C "C2'" . DC  I 5 127 ? 102.537 70.262  125.911 1.00 96.03  ? 53  DC  I "C2'" 1 
ATOM 8679  C "C1'" . DC  I 5 127 ? 102.550 71.396  126.913 1.00 96.03  ? 53  DC  I "C1'" 1 
ATOM 8680  N N1    . DC  I 5 127 ? 103.189 72.623  126.378 1.00 96.03  ? 53  DC  I N1    1 
ATOM 8681  C C2    . DC  I 5 127 ? 102.407 73.659  125.846 1.00 96.03  ? 53  DC  I C2    1 
ATOM 8682  O O2    . DC  I 5 127 ? 101.177 73.551  125.837 1.00 96.03  ? 53  DC  I O2    1 
ATOM 8683  N N3    . DC  I 5 127 ? 103.030 74.762  125.362 1.00 96.03  ? 53  DC  I N3    1 
ATOM 8684  C C4    . DC  I 5 127 ? 104.360 74.840  125.389 1.00 96.03  ? 53  DC  I C4    1 
ATOM 8685  N N4    . DC  I 5 127 ? 104.934 75.940  124.901 1.00 96.03  ? 53  DC  I N4    1 
ATOM 8686  C C5    . DC  I 5 127 ? 105.164 73.793  125.914 1.00 96.03  ? 53  DC  I C5    1 
ATOM 8687  C C6    . DC  I 5 127 ? 104.542 72.717  126.389 1.00 96.03  ? 53  DC  I C6    1 
ATOM 8688  P P     . DT  I 5 128 ? 100.046 68.276  126.222 1.00 100.09 ? 54  DT  I P     1 
ATOM 8689  O OP1   . DT  I 5 128 ? 99.025  67.518  126.972 1.00 100.09 ? 54  DT  I OP1   1 
ATOM 8690  O OP2   . DT  I 5 128 ? 100.746 67.627  125.092 1.00 100.09 ? 54  DT  I OP2   1 
ATOM 8691  O "O5'" . DT  I 5 128 ? 99.376  69.631  125.708 1.00 100.09 ? 54  DT  I "O5'" 1 
ATOM 8692  C "C5'" . DT  I 5 128 ? 98.009  69.661  125.355 1.00 100.09 ? 54  DT  I "C5'" 1 
ATOM 8693  C "C4'" . DT  I 5 128 ? 97.833  70.032  123.895 1.00 100.09 ? 54  DT  I "C4'" 1 
ATOM 8694  O "O4'" . DT  I 5 128 ? 98.763  71.096  123.534 1.00 100.09 ? 54  DT  I "O4'" 1 
ATOM 8695  C "C3'" . DT  I 5 128 ? 98.115  68.898  122.908 1.00 100.09 ? 54  DT  I "C3'" 1 
ATOM 8696  O "O3'" . DT  I 5 128 ? 97.244  69.016  121.801 1.00 100.09 ? 54  DT  I "O3'" 1 
ATOM 8697  C "C2'" . DT  I 5 128 ? 99.537  69.206  122.495 1.00 100.09 ? 54  DT  I "C2'" 1 
ATOM 8698  C "C1'" . DT  I 5 128 ? 99.411  70.703  122.351 1.00 100.09 ? 54  DT  I "C1'" 1 
ATOM 8699  N N1    . DT  I 5 128 ? 100.707 71.436  122.192 1.00 100.09 ? 54  DT  I N1    1 
ATOM 8700  C C2    . DT  I 5 128 ? 100.690 72.708  121.683 1.00 100.09 ? 54  DT  I C2    1 
ATOM 8701  O O2    . DT  I 5 128 ? 99.668  73.288  121.372 1.00 100.09 ? 54  DT  I O2    1 
ATOM 8702  N N3    . DT  I 5 128 ? 101.915 73.290  121.562 1.00 100.09 ? 54  DT  I N3    1 
ATOM 8703  C C4    . DT  I 5 128 ? 103.136 72.739  121.881 1.00 100.09 ? 54  DT  I C4    1 
ATOM 8704  O O4    . DT  I 5 128 ? 104.183 73.347  121.736 1.00 100.09 ? 54  DT  I O4    1 
ATOM 8705  C C5    . DT  I 5 128 ? 103.094 71.401  122.392 1.00 100.09 ? 54  DT  I C5    1 
ATOM 8706  C C7    . DT  I 5 128 ? 104.364 70.704  122.763 1.00 100.09 ? 54  DT  I C7    1 
ATOM 8707  C C6    . DT  I 5 128 ? 101.895 70.812  122.510 1.00 100.09 ? 54  DT  I C6    1 
ATOM 8708  P P     . DC  I 5 129 ? 96.516  67.723  121.186 1.00 105.56 ? 55  DC  I P     1 
ATOM 8709  O OP1   . DC  I 5 129 ? 95.988  66.915  122.305 1.00 105.56 ? 55  DC  I OP1   1 
ATOM 8710  O OP2   . DC  I 5 129 ? 97.426  67.107  120.199 1.00 105.56 ? 55  DC  I OP2   1 
ATOM 8711  O "O5'" . DC  I 5 129 ? 95.293  68.343  120.375 1.00 105.56 ? 55  DC  I "O5'" 1 
ATOM 8712  C "C5'" . DC  I 5 129 ? 94.916  69.693  120.607 1.00 105.56 ? 55  DC  I "C5'" 1 
ATOM 8713  C "C4'" . DC  I 5 129 ? 95.379  70.611  119.482 1.00 105.56 ? 55  DC  I "C4'" 1 
ATOM 8714  O "O4'" . DC  I 5 129 ? 96.795  70.909  119.598 1.00 105.56 ? 55  DC  I "O4'" 1 
ATOM 8715  C "C3'" . DC  I 5 129 ? 95.194  70.077  118.060 1.00 105.56 ? 55  DC  I "C3'" 1 
ATOM 8716  O "O3'" . DC  I 5 129 ? 94.808  71.150  117.192 1.00 105.56 ? 55  DC  I "O3'" 1 
ATOM 8717  C "C2'" . DC  I 5 129 ? 96.608  69.614  117.721 1.00 105.56 ? 55  DC  I "C2'" 1 
ATOM 8718  C "C1'" . DC  I 5 129 ? 97.367  70.769  118.320 1.00 105.56 ? 55  DC  I "C1'" 1 
ATOM 8719  N N1    . DC  I 5 129 ? 98.813  70.564  118.476 1.00 105.56 ? 55  DC  I N1    1 
ATOM 8720  C C2    . DC  I 5 129 ? 99.680  71.590  118.122 1.00 105.56 ? 55  DC  I C2    1 
ATOM 8721  O O2    . DC  I 5 129 ? 99.211  72.630  117.658 1.00 105.56 ? 55  DC  I O2    1 
ATOM 8722  N N3    . DC  I 5 129 ? 101.005 71.412  118.289 1.00 105.56 ? 55  DC  I N3    1 
ATOM 8723  C C4    . DC  I 5 129 ? 101.463 70.278  118.804 1.00 105.56 ? 55  DC  I C4    1 
ATOM 8724  N N4    . DC  I 5 129 ? 102.780 70.144  118.946 1.00 105.56 ? 55  DC  I N4    1 
ATOM 8725  C C5    . DC  I 5 129 ? 100.595 69.216  119.162 1.00 105.56 ? 55  DC  I C5    1 
ATOM 8726  C C6    . DC  I 5 129 ? 99.286  69.404  118.989 1.00 105.56 ? 55  DC  I C6    1 
ATOM 8727  P P     . DG  I 5 130 ? 93.614  72.164  117.568 1.00 109.71 ? 56  DG  I P     1 
ATOM 8728  O OP1   . DG  I 5 130 ? 94.165  73.350  118.260 1.00 109.71 ? 56  DG  I OP1   1 
ATOM 8729  O OP2   . DG  I 5 130 ? 92.490  71.401  118.156 1.00 109.71 ? 56  DG  I OP2   1 
ATOM 8730  O "O5'" . DG  I 5 130 ? 93.138  72.708  116.147 1.00 109.71 ? 56  DG  I "O5'" 1 
ATOM 8731  C "C5'" . DG  I 5 130 ? 92.939  74.104  115.954 1.00 109.71 ? 56  DG  I "C5'" 1 
ATOM 8732  C "C4'" . DG  I 5 130 ? 93.741  74.627  114.771 1.00 109.71 ? 56  DG  I "C4'" 1 
ATOM 8733  O "O4'" . DG  I 5 130 ? 95.074  74.059  114.783 1.00 109.71 ? 56  DG  I "O4'" 1 
ATOM 8734  C "C3'" . DG  I 5 130 ? 93.173  74.303  113.396 1.00 109.71 ? 56  DG  I "C3'" 1 
ATOM 8735  O "O3'" . DG  I 5 130 ? 93.517  75.341  112.492 1.00 109.71 ? 56  DG  I "O3'" 1 
ATOM 8736  C "C2'" . DG  I 5 130 ? 93.911  73.017  113.046 1.00 109.71 ? 56  DG  I "C2'" 1 
ATOM 8737  C "C1'" . DG  I 5 130 ? 95.294  73.340  113.590 1.00 109.71 ? 56  DG  I "C1'" 1 
ATOM 8738  N N9    . DG  I 5 130 ? 96.090  72.176  113.928 1.00 109.71 ? 56  DG  I N9    1 
ATOM 8739  C C8    . DG  I 5 130 ? 95.639  70.910  114.190 1.00 109.71 ? 56  DG  I C8    1 
ATOM 8740  N N7    . DG  I 5 130 ? 96.592  70.076  114.483 1.00 109.71 ? 56  DG  I N7    1 
ATOM 8741  C C5    . DG  I 5 130 ? 97.745  70.846  114.437 1.00 109.71 ? 56  DG  I C5    1 
ATOM 8742  C C6    . DG  I 5 130 ? 99.093  70.491  114.672 1.00 109.71 ? 56  DG  I C6    1 
ATOM 8743  O O6    . DG  I 5 130 ? 99.557  69.391  114.991 1.00 109.71 ? 56  DG  I O6    1 
ATOM 8744  N N1    . DG  I 5 130 ? 99.946  71.573  114.505 1.00 109.71 ? 56  DG  I N1    1 
ATOM 8745  C C2    . DG  I 5 130 ? 99.550  72.838  114.159 1.00 109.71 ? 56  DG  I C2    1 
ATOM 8746  N N2    . DG  I 5 130 ? 100.518 73.753  114.049 1.00 109.71 ? 56  DG  I N2    1 
ATOM 8747  N N3    . DG  I 5 130 ? 98.293  73.185  113.936 1.00 109.71 ? 56  DG  I N3    1 
ATOM 8748  C C4    . DG  I 5 130 ? 97.449  72.140  114.094 1.00 109.71 ? 56  DG  I C4    1 
ATOM 8749  P P     . DG  I 5 131 ? 92.508  76.555  112.193 1.00 112.70 ? 57  DG  I P     1 
ATOM 8750  O OP1   . DG  I 5 131 ? 91.959  77.055  113.468 1.00 112.70 ? 57  DG  I OP1   1 
ATOM 8751  O OP2   . DG  I 5 131 ? 91.587  76.129  111.121 1.00 112.70 ? 57  DG  I OP2   1 
ATOM 8752  O "O5'" . DG  I 5 131 ? 93.467  77.682  111.599 1.00 112.70 ? 57  DG  I "O5'" 1 
ATOM 8753  C "C5'" . DG  I 5 131 ? 94.626  78.064  112.328 1.00 112.70 ? 57  DG  I "C5'" 1 
ATOM 8754  C "C4'" . DG  I 5 131 ? 95.846  78.241  111.429 1.00 112.70 ? 57  DG  I "C4'" 1 
ATOM 8755  O "O4'" . DG  I 5 131 ? 96.657  77.038  111.412 1.00 112.70 ? 57  DG  I "O4'" 1 
ATOM 8756  C "C3'" . DG  I 5 131 ? 95.589  78.584  109.975 1.00 112.70 ? 57  DG  I "C3'" 1 
ATOM 8757  O "O3'" . DG  I 5 131 ? 96.640  79.414  109.535 1.00 112.70 ? 57  DG  I "O3'" 1 
ATOM 8758  C "C2'" . DG  I 5 131 ? 95.659  77.212  109.307 1.00 112.70 ? 57  DG  I "C2'" 1 
ATOM 8759  C "C1'" . DG  I 5 131 ? 96.791  76.562  110.084 1.00 112.70 ? 57  DG  I "C1'" 1 
ATOM 8760  N N9    . DG  I 5 131 ? 96.706  75.116  110.155 1.00 112.70 ? 57  DG  I N9    1 
ATOM 8761  C C8    . DG  I 5 131 ? 95.567  74.363  110.146 1.00 112.70 ? 57  DG  I C8    1 
ATOM 8762  N N7    . DG  I 5 131 ? 95.789  73.090  110.275 1.00 112.70 ? 57  DG  I N7    1 
ATOM 8763  C C5    . DG  I 5 131 ? 97.161  72.996  110.411 1.00 112.70 ? 57  DG  I C5    1 
ATOM 8764  C C6    . DG  I 5 131 ? 97.979  71.859  110.590 1.00 112.70 ? 57  DG  I C6    1 
ATOM 8765  O O6    . DG  I 5 131 ? 97.642  70.674  110.672 1.00 112.70 ? 57  DG  I O6    1 
ATOM 8766  N N1    . DG  I 5 131 ? 99.318  72.197  110.668 1.00 112.70 ? 57  DG  I N1    1 
ATOM 8767  C C2    . DG  I 5 131 ? 99.809  73.472  110.591 1.00 112.70 ? 57  DG  I C2    1 
ATOM 8768  N N2    . DG  I 5 131 ? 101.136 73.601  110.692 1.00 112.70 ? 57  DG  I N2    1 
ATOM 8769  N N3    . DG  I 5 131 ? 99.052  74.551  110.423 1.00 112.70 ? 57  DG  I N3    1 
ATOM 8770  C C4    . DG  I 5 131 ? 97.742  74.235  110.348 1.00 112.70 ? 57  DG  I C4    1 
ATOM 8771  P P     . DC  I 5 132 ? 96.458  80.393  108.279 1.00 117.50 ? 58  DC  I P     1 
ATOM 8772  O OP1   . DC  I 5 132 ? 96.274  81.755  108.823 1.00 117.50 ? 58  DC  I OP1   1 
ATOM 8773  O OP2   . DC  I 5 132 ? 95.437  79.834  107.370 1.00 117.50 ? 58  DC  I OP2   1 
ATOM 8774  O "O5'" . DC  I 5 132 ? 97.873  80.300  107.541 1.00 117.50 ? 58  DC  I "O5'" 1 
ATOM 8775  C "C5'" . DC  I 5 132 ? 99.073  80.461  108.291 1.00 117.50 ? 58  DC  I "C5'" 1 
ATOM 8776  C "C4'" . DC  I 5 132 ? 100.219 79.652  107.698 1.00 117.50 ? 58  DC  I "C4'" 1 
ATOM 8777  O "O4'" . DC  I 5 132 ? 100.036 78.239  107.994 1.00 117.50 ? 58  DC  I "O4'" 1 
ATOM 8778  C "C3'" . DC  I 5 132 ? 100.378 79.755  106.185 1.00 117.50 ? 58  DC  I "C3'" 1 
ATOM 8779  O "O3'" . DC  I 5 132 ? 101.752 79.884  105.858 1.00 117.50 ? 58  DC  I "O3'" 1 
ATOM 8780  C "C2'" . DC  I 5 132 ? 99.805  78.430  105.698 1.00 117.50 ? 58  DC  I "C2'" 1 
ATOM 8781  C "C1'" . DC  I 5 132 ? 100.209 77.490  106.818 1.00 117.50 ? 58  DC  I "C1'" 1 
ATOM 8782  N N1    . DC  I 5 132 ? 99.346  76.277  106.904 1.00 117.50 ? 58  DC  I N1    1 
ATOM 8783  C C2    . DC  I 5 132 ? 99.903  75.022  107.196 1.00 117.50 ? 58  DC  I C2    1 
ATOM 8784  O O2    . DC  I 5 132 ? 101.119 74.920  107.375 1.00 117.50 ? 58  DC  I O2    1 
ATOM 8785  N N3    . DC  I 5 132 ? 99.081  73.944  107.264 1.00 117.50 ? 58  DC  I N3    1 
ATOM 8786  C C4    . DC  I 5 132 ? 97.775  74.088  107.057 1.00 117.50 ? 58  DC  I C4    1 
ATOM 8787  N N4    . DC  I 5 132 ? 96.995  73.004  107.138 1.00 117.50 ? 58  DC  I N4    1 
ATOM 8788  C C5    . DC  I 5 132 ? 97.202  75.349  106.753 1.00 117.50 ? 58  DC  I C5    1 
ATOM 8789  C C6    . DC  I 5 132 ? 98.013  76.403  106.695 1.00 117.50 ? 58  DC  I C6    1 
ATOM 8790  P P     . DA  I 5 133 ? 102.214 80.284  104.371 1.00 117.73 ? 59  DA  I P     1 
ATOM 8791  O OP1   . DA  I 5 133 ? 103.158 81.408  104.532 1.00 117.73 ? 59  DA  I OP1   1 
ATOM 8792  O OP2   . DA  I 5 133 ? 101.047 80.453  103.485 1.00 117.73 ? 59  DA  I OP2   1 
ATOM 8793  O "O5'" . DA  I 5 133 ? 103.026 79.002  103.868 1.00 117.73 ? 59  DA  I "O5'" 1 
ATOM 8794  C "C5'" . DA  I 5 133 ? 104.287 78.726  104.434 1.00 117.73 ? 59  DA  I "C5'" 1 
ATOM 8795  C "C4'" . DA  I 5 133 ? 104.559 77.236  104.517 1.00 117.73 ? 59  DA  I "C4'" 1 
ATOM 8796  O "O4'" . DA  I 5 133 ? 103.355 76.499  104.866 1.00 117.73 ? 59  DA  I "O4'" 1 
ATOM 8797  C "C3'" . DA  I 5 133 ? 105.073 76.592  103.241 1.00 117.73 ? 59  DA  I "C3'" 1 
ATOM 8798  O "O3'" . DA  I 5 133 ? 106.050 75.662  103.614 1.00 117.73 ? 59  DA  I "O3'" 1 
ATOM 8799  C "C2'" . DA  I 5 133 ? 103.827 75.887  102.707 1.00 117.73 ? 59  DA  I "C2'" 1 
ATOM 8800  C "C1'" . DA  I 5 133 ? 103.254 75.387  104.008 1.00 117.73 ? 59  DA  I "C1'" 1 
ATOM 8801  N N9    . DA  I 5 133 ? 101.858 74.955  103.977 1.00 117.73 ? 59  DA  I N9    1 
ATOM 8802  C C8    . DA  I 5 133 ? 100.755 75.739  103.833 1.00 117.73 ? 59  DA  I C8    1 
ATOM 8803  N N7    . DA  I 5 133 ? 99.621  75.087  103.910 1.00 117.73 ? 59  DA  I N7    1 
ATOM 8804  C C5    . DA  I 5 133 ? 100.009 73.781  104.121 1.00 117.73 ? 59  DA  I C5    1 
ATOM 8805  C C6    . DA  I 5 133 ? 99.284  72.588  104.276 1.00 117.73 ? 59  DA  I C6    1 
ATOM 8806  N N6    . DA  I 5 133 ? 97.955  72.524  104.242 1.00 117.73 ? 59  DA  I N6    1 
ATOM 8807  N N1    . DA  I 5 133 ? 99.981  71.458  104.464 1.00 117.73 ? 59  DA  I N1    1 
ATOM 8808  C C2    . DA  I 5 133 ? 101.313 71.515  104.486 1.00 117.73 ? 59  DA  I C2    1 
ATOM 8809  N N3    . DA  I 5 133 ? 102.105 72.572  104.358 1.00 117.73 ? 59  DA  I N3    1 
ATOM 8810  C C4    . DA  I 5 133 ? 101.385 73.683  104.173 1.00 117.73 ? 59  DA  I C4    1 
ATOM 8811  P P     . DC  I 5 134 ? 107.360 75.411  102.728 1.00 117.84 ? 60  DC  I P     1 
ATOM 8812  O OP1   . DC  I 5 134 ? 108.524 75.852  103.527 1.00 117.84 ? 60  DC  I OP1   1 
ATOM 8813  O OP2   . DC  I 5 134 ? 107.158 75.973  101.373 1.00 117.84 ? 60  DC  I OP2   1 
ATOM 8814  O "O5'" . DC  I 5 134 ? 107.381 73.820  102.627 1.00 117.84 ? 60  DC  I "O5'" 1 
ATOM 8815  C "C5'" . DC  I 5 134 ? 106.268 73.076  103.137 1.00 117.84 ? 60  DC  I "C5'" 1 
ATOM 8816  C "C4'" . DC  I 5 134 ? 105.654 72.238  102.041 1.00 117.84 ? 60  DC  I "C4'" 1 
ATOM 8817  O "O4'" . DC  I 5 134 ? 104.206 72.178  102.185 1.00 117.84 ? 60  DC  I "O4'" 1 
ATOM 8818  C "C3'" . DC  I 5 134 ? 105.902 72.768  100.625 1.00 117.84 ? 60  DC  I "C3'" 1 
ATOM 8819  O "O3'" . DC  I 5 134 ? 106.332 71.716  99.818  1.00 117.84 ? 60  DC  I "O3'" 1 
ATOM 8820  C "C2'" . DC  I 5 134 ? 104.523 73.252  100.199 1.00 117.84 ? 60  DC  I "C2'" 1 
ATOM 8821  C "C1'" . DC  I 5 134 ? 103.682 72.207  100.889 1.00 117.84 ? 60  DC  I "C1'" 1 
ATOM 8822  N N1    . DC  I 5 134 ? 102.214 72.481  100.914 1.00 117.84 ? 60  DC  I N1    1 
ATOM 8823  C C2    . DC  I 5 134 ? 101.325 71.413  101.027 1.00 117.84 ? 60  DC  I C2    1 
ATOM 8824  O O2    . DC  I 5 134 ? 101.779 70.272  101.126 1.00 117.84 ? 60  DC  I O2    1 
ATOM 8825  N N3    . DC  I 5 134 ? 99.996  71.660  101.035 1.00 117.84 ? 60  DC  I N3    1 
ATOM 8826  C C4    . DC  I 5 134 ? 99.553  72.908  100.922 1.00 117.84 ? 60  DC  I C4    1 
ATOM 8827  N N4    . DC  I 5 134 ? 98.232  73.107  100.937 1.00 117.84 ? 60  DC  I N4    1 
ATOM 8828  C C5    . DC  I 5 134 ? 100.445 74.011  100.789 1.00 117.84 ? 60  DC  I C5    1 
ATOM 8829  C C6    . DC  I 5 134 ? 101.754 73.751  100.781 1.00 117.84 ? 60  DC  I C6    1 
ATOM 8830  P P     . DC  I 5 135 ? 107.464 71.962  98.715  1.00 120.92 ? 61  DC  I P     1 
ATOM 8831  O OP1   . DC  I 5 135 ? 108.709 71.343  99.220  1.00 120.92 ? 61  DC  I OP1   1 
ATOM 8832  O OP2   . DC  I 5 135 ? 107.451 73.404  98.389  1.00 120.92 ? 61  DC  I OP2   1 
ATOM 8833  O "O5'" . DC  I 5 135 ? 106.924 71.151  97.443  1.00 120.92 ? 61  DC  I "O5'" 1 
ATOM 8834  C "C5'" . DC  I 5 135 ? 107.361 69.819  97.208  1.00 120.92 ? 61  DC  I "C5'" 1 
ATOM 8835  C "C4'" . DC  I 5 135 ? 106.303 68.811  97.615  1.00 120.92 ? 61  DC  I "C4'" 1 
ATOM 8836  O "O4'" . DC  I 5 135 ? 105.142 69.494  98.170  1.00 120.92 ? 61  DC  I "O4'" 1 
ATOM 8837  C "C3'" . DC  I 5 135 ? 105.763 67.962  96.469  1.00 120.92 ? 61  DC  I "C3'" 1 
ATOM 8838  O "O3'" . DC  I 5 135 ? 105.488 66.644  96.937  1.00 120.92 ? 61  DC  I "O3'" 1 
ATOM 8839  C "C2'" . DC  I 5 135 ? 104.477 68.696  96.125  1.00 120.92 ? 61  DC  I "C2'" 1 
ATOM 8840  C "C1'" . DC  I 5 135 ? 103.995 69.006  97.522  1.00 120.92 ? 61  DC  I "C1'" 1 
ATOM 8841  N N1    . DC  I 5 135 ? 102.941 70.033  97.579  1.00 120.92 ? 61  DC  I N1    1 
ATOM 8842  C C2    . DC  I 5 135 ? 101.598 69.656  97.746  1.00 120.92 ? 61  DC  I C2    1 
ATOM 8843  O O2    . DC  I 5 135 ? 101.309 68.458  97.812  1.00 120.92 ? 61  DC  I O2    1 
ATOM 8844  N N3    . DC  I 5 135 ? 100.649 70.620  97.786  1.00 120.92 ? 61  DC  I N3    1 
ATOM 8845  C C4    . DC  I 5 135 ? 100.999 71.897  97.694  1.00 120.92 ? 61  DC  I C4    1 
ATOM 8846  N N4    . DC  I 5 135 ? 100.036 72.817  97.745  1.00 120.92 ? 61  DC  I N4    1 
ATOM 8847  C C5    . DC  I 5 135 ? 102.356 72.293  97.531  1.00 120.92 ? 61  DC  I C5    1 
ATOM 8848  C C6    . DC  I 5 135 ? 103.282 71.335  97.475  1.00 120.92 ? 61  DC  I C6    1 
ATOM 8849  P P     . DG  I 5 136 ? 105.637 65.377  95.958  1.00 126.07 ? 62  DG  I P     1 
ATOM 8850  O OP1   . DG  I 5 136 ? 106.648 64.482  96.558  1.00 126.07 ? 62  DG  I OP1   1 
ATOM 8851  O OP2   . DG  I 5 136 ? 105.819 65.876  94.579  1.00 126.07 ? 62  DG  I OP2   1 
ATOM 8852  O "O5'" . DG  I 5 136 ? 104.211 64.651  96.023  1.00 126.07 ? 62  DG  I "O5'" 1 
ATOM 8853  C "C5'" . DG  I 5 136 ? 103.061 65.373  96.430  1.00 126.07 ? 62  DG  I "C5'" 1 
ATOM 8854  C "C4'" . DG  I 5 136 ? 102.010 65.399  95.334  1.00 126.07 ? 62  DG  I "C4'" 1 
ATOM 8855  O "O4'" . DG  I 5 136 ? 101.134 66.535  95.536  1.00 126.07 ? 62  DG  I "O4'" 1 
ATOM 8856  C "C3'" . DG  I 5 136 ? 102.547 65.515  93.902  1.00 126.07 ? 62  DG  I "C3'" 1 
ATOM 8857  O "O3'" . DG  I 5 136 ? 102.042 64.418  93.110  1.00 126.07 ? 62  DG  I "O3'" 1 
ATOM 8858  C "C2'" . DG  I 5 136 ? 102.036 66.879  93.430  1.00 126.07 ? 62  DG  I "C2'" 1 
ATOM 8859  C "C1'" . DG  I 5 136 ? 100.818 67.102  94.295  1.00 126.07 ? 62  DG  I "C1'" 1 
ATOM 8860  N N9    . DG  I 5 136 ? 100.543 68.512  94.495  1.00 126.07 ? 62  DG  I N9    1 
ATOM 8861  C C8    . DG  I 5 136 ? 101.466 69.523  94.543  1.00 126.07 ? 62  DG  I C8    1 
ATOM 8862  N N7    . DG  I 5 136 ? 100.942 70.695  94.738  1.00 126.07 ? 62  DG  I N7    1 
ATOM 8863  C C5    . DG  I 5 136 ? 99.580  70.450  94.789  1.00 126.07 ? 62  DG  I C5    1 
ATOM 8864  C C6    . DG  I 5 136 ? 98.510  71.341  94.980  1.00 126.07 ? 62  DG  I C6    1 
ATOM 8865  O O6    . DG  I 5 136 ? 98.554  72.566  95.120  1.00 126.07 ? 62  DG  I O6    1 
ATOM 8866  N N1    . DG  I 5 136 ? 97.288  70.688  94.956  1.00 126.07 ? 62  DG  I N1    1 
ATOM 8867  C C2    . DG  I 5 136 ? 97.122  69.335  94.793  1.00 126.07 ? 62  DG  I C2    1 
ATOM 8868  N N2    . DG  I 5 136 ? 95.862  68.884  94.810  1.00 126.07 ? 62  DG  I N2    1 
ATOM 8869  N N3    . DG  I 5 136 ? 98.122  68.483  94.624  1.00 126.07 ? 62  DG  I N3    1 
ATOM 8870  C C4    . DG  I 5 136 ? 99.318  69.110  94.637  1.00 126.07 ? 62  DG  I C4    1 
ATOM 8871  P P     . DG  I 5 137 ? 101.989 64.440  91.496  1.00 121.05 ? 63  DG  I P     1 
ATOM 8872  O OP1   . DG  I 5 137 ? 102.053 63.017  91.112  1.00 121.05 ? 63  DG  I OP1   1 
ATOM 8873  O OP2   . DG  I 5 137 ? 102.972 65.340  90.851  1.00 121.05 ? 63  DG  I OP2   1 
ATOM 8874  O "O5'" . DG  I 5 137 ? 100.497 64.913  91.194  1.00 121.05 ? 63  DG  I "O5'" 1 
ATOM 8875  C "C5'" . DG  I 5 137 ? 99.420  64.114  91.679  1.00 121.05 ? 63  DG  I "C5'" 1 
ATOM 8876  C "C4'" . DG  I 5 137 ? 98.072  64.721  91.346  1.00 121.05 ? 63  DG  I "C4'" 1 
ATOM 8877  O "O4'" . DG  I 5 137 ? 97.986  66.057  91.900  1.00 121.05 ? 63  DG  I "O4'" 1 
ATOM 8878  C "C3'" . DG  I 5 137 ? 97.762  64.861  89.855  1.00 121.05 ? 63  DG  I "C3'" 1 
ATOM 8879  O "O3'" . DG  I 5 137 ? 96.411  64.496  89.618  1.00 121.05 ? 63  DG  I "O3'" 1 
ATOM 8880  C "C2'" . DG  I 5 137 ? 97.986  66.346  89.603  1.00 121.05 ? 63  DG  I "C2'" 1 
ATOM 8881  C "C1'" . DG  I 5 137 ? 97.500  66.928  90.913  1.00 121.05 ? 63  DG  I "C1'" 1 
ATOM 8882  N N9    . DG  I 5 137 ? 98.020  68.250  91.179  1.00 121.05 ? 63  DG  I N9    1 
ATOM 8883  C C8    . DG  I 5 137 ? 99.336  68.609  91.264  1.00 121.05 ? 63  DG  I C8    1 
ATOM 8884  N N7    . DG  I 5 137 ? 99.511  69.870  91.512  1.00 121.05 ? 63  DG  I N7    1 
ATOM 8885  C C5    . DG  I 5 137 ? 98.227  70.377  91.597  1.00 121.05 ? 63  DG  I C5    1 
ATOM 8886  C C6    . DG  I 5 137 ? 97.794  71.690  91.844  1.00 121.05 ? 63  DG  I C6    1 
ATOM 8887  O O6    . DG  I 5 137 ? 98.488  72.692  92.053  1.00 121.05 ? 63  DG  I O6    1 
ATOM 8888  N N1    . DG  I 5 137 ? 96.408  71.784  91.849  1.00 121.05 ? 63  DG  I N1    1 
ATOM 8889  C C2    . DG  I 5 137 ? 95.548  70.736  91.633  1.00 121.05 ? 63  DG  I C2    1 
ATOM 8890  N N2    . DG  I 5 137 ? 94.239  71.021  91.671  1.00 121.05 ? 63  DG  I N2    1 
ATOM 8891  N N3    . DG  I 5 137 ? 95.946  69.493  91.396  1.00 121.05 ? 63  DG  I N3    1 
ATOM 8892  C C4    . DG  I 5 137 ? 97.297  69.392  91.393  1.00 121.05 ? 63  DG  I C4    1 
ATOM 8893  P P     . DG  I 5 138 ? 95.825  64.460  88.123  1.00 111.50 ? 64  DG  I P     1 
ATOM 8894  O OP1   . DG  I 5 138 ? 94.722  63.476  88.120  1.00 111.50 ? 64  DG  I OP1   1 
ATOM 8895  O OP2   . DG  I 5 138 ? 96.958  64.296  87.188  1.00 111.50 ? 64  DG  I OP2   1 
ATOM 8896  O "O5'" . DG  I 5 138 ? 95.199  65.919  87.913  1.00 111.50 ? 64  DG  I "O5'" 1 
ATOM 8897  C "C5'" . DG  I 5 138 ? 94.186  66.383  88.792  1.00 111.50 ? 64  DG  I "C5'" 1 
ATOM 8898  C "C4'" . DG  I 5 138 ? 93.629  67.729  88.351  1.00 111.50 ? 64  DG  I "C4'" 1 
ATOM 8899  O "O4'" . DG  I 5 138 ? 94.480  68.806  88.820  1.00 111.50 ? 64  DG  I "O4'" 1 
ATOM 8900  C "C3'" . DG  I 5 138 ? 93.482  67.945  86.840  1.00 111.50 ? 64  DG  I "C3'" 1 
ATOM 8901  O "O3'" . DG  I 5 138 ? 92.258  68.625  86.597  1.00 111.50 ? 64  DG  I "O3'" 1 
ATOM 8902  C "C2'" . DG  I 5 138 ? 94.673  68.846  86.521  1.00 111.50 ? 64  DG  I "C2'" 1 
ATOM 8903  C "C1'" . DG  I 5 138 ? 94.672  69.710  87.760  1.00 111.50 ? 64  DG  I "C1'" 1 
ATOM 8904  N N9    . DG  I 5 138 ? 95.904  70.429  87.998  1.00 111.50 ? 64  DG  I N9    1 
ATOM 8905  C C8    . DG  I 5 138 ? 97.183  69.950  87.885  1.00 111.50 ? 64  DG  I C8    1 
ATOM 8906  N N7    . DG  I 5 138 ? 98.090  70.831  88.190  1.00 111.50 ? 64  DG  I N7    1 
ATOM 8907  C C5    . DG  I 5 138 ? 97.361  71.959  88.528  1.00 111.50 ? 64  DG  I C5    1 
ATOM 8908  C C6    . DG  I 5 138 ? 97.799  73.229  88.939  1.00 111.50 ? 64  DG  I C6    1 
ATOM 8909  O O6    . DG  I 5 138 ? 98.958  73.619  89.099  1.00 111.50 ? 64  DG  I O6    1 
ATOM 8910  N N1    . DG  I 5 138 ? 96.732  74.083  89.196  1.00 111.50 ? 64  DG  I N1    1 
ATOM 8911  C C2    . DG  I 5 138 ? 95.407  73.751  89.057  1.00 111.50 ? 64  DG  I C2    1 
ATOM 8912  N N2    . DG  I 5 138 ? 94.517  74.717  89.333  1.00 111.50 ? 64  DG  I N2    1 
ATOM 8913  N N3    . DG  I 5 138 ? 94.985  72.562  88.665  1.00 111.50 ? 64  DG  I N3    1 
ATOM 8914  C C4    . DG  I 5 138 ? 96.015  71.721  88.422  1.00 111.50 ? 64  DG  I C4    1 
ATOM 8915  P P     . DA  I 5 139 ? 91.531  68.546  85.168  1.00 98.45  ? 65  DA  I P     1 
ATOM 8916  O OP1   . DA  I 5 139 ? 90.347  67.681  85.353  1.00 98.45  ? 65  DA  I OP1   1 
ATOM 8917  O OP2   . DA  I 5 139 ? 92.530  68.220  84.128  1.00 98.45  ? 65  DA  I OP2   1 
ATOM 8918  O "O5'" . DA  I 5 139 ? 91.044  70.046  84.903  1.00 98.45  ? 65  DA  I "O5'" 1 
ATOM 8919  C "C5'" . DA  I 5 139 ? 89.815  70.506  85.456  1.00 98.45  ? 65  DA  I "C5'" 1 
ATOM 8920  C "C4'" . DA  I 5 139 ? 89.787  72.022  85.542  1.00 98.45  ? 65  DA  I "C4'" 1 
ATOM 8921  O "O4'" . DA  I 5 139 ? 91.088  72.505  85.970  1.00 98.45  ? 65  DA  I "O4'" 1 
ATOM 8922  C "C3'" . DA  I 5 139 ? 89.483  72.754  84.234  1.00 98.45  ? 65  DA  I "C3'" 1 
ATOM 8923  O "O3'" . DA  I 5 139 ? 88.729  73.935  84.518  1.00 98.45  ? 65  DA  I "O3'" 1 
ATOM 8924  C "C2'" . DA  I 5 139 ? 90.876  73.084  83.725  1.00 98.45  ? 65  DA  I "C2'" 1 
ATOM 8925  C "C1'" . DA  I 5 139 ? 91.583  73.424  85.019  1.00 98.45  ? 65  DA  I "C1'" 1 
ATOM 8926  N N9    . DA  I 5 139 ? 93.033  73.291  84.961  1.00 98.45  ? 65  DA  I N9    1 
ATOM 8927  C C8    . DA  I 5 139 ? 93.749  72.229  84.484  1.00 98.45  ? 65  DA  I C8    1 
ATOM 8928  N N7    . DA  I 5 139 ? 95.047  72.386  84.572  1.00 98.45  ? 65  DA  I N7    1 
ATOM 8929  C C5    . DA  I 5 139 ? 95.189  73.632  85.153  1.00 98.45  ? 65  DA  I C5    1 
ATOM 8930  C C6    . DA  I 5 139 ? 96.319  74.384  85.519  1.00 98.45  ? 65  DA  I C6    1 
ATOM 8931  N N6    . DA  I 5 139 ? 97.565  73.956  85.341  1.00 98.45  ? 65  DA  I N6    1 
ATOM 8932  N N1    . DA  I 5 139 ? 96.116  75.597  86.076  1.00 98.45  ? 65  DA  I N1    1 
ATOM 8933  C C2    . DA  I 5 139 ? 94.859  76.018  86.254  1.00 98.45  ? 65  DA  I C2    1 
ATOM 8934  N N3    . DA  I 5 139 ? 93.721  75.401  85.952  1.00 98.45  ? 65  DA  I N3    1 
ATOM 8935  C C4    . DA  I 5 139 ? 93.959  74.202  85.401  1.00 98.45  ? 65  DA  I C4    1 
ATOM 8936  P P     . DT  I 5 140 ? 88.311  74.982  83.367  1.00 97.42  ? 66  DT  I P     1 
ATOM 8937  O OP1   . DT  I 5 140 ? 86.958  75.453  83.725  1.00 97.42  ? 66  DT  I OP1   1 
ATOM 8938  O OP2   . DT  I 5 140 ? 88.505  74.404  82.023  1.00 97.42  ? 66  DT  I OP2   1 
ATOM 8939  O "O5'" . DT  I 5 140 ? 89.336  76.199  83.568  1.00 97.42  ? 66  DT  I "O5'" 1 
ATOM 8940  C "C5'" . DT  I 5 140 ? 89.700  76.597  84.893  1.00 97.42  ? 66  DT  I "C5'" 1 
ATOM 8941  C "C4'" . DT  I 5 140 ? 90.181  78.044  84.973  1.00 97.42  ? 66  DT  I "C4'" 1 
ATOM 8942  O "O4'" . DT  I 5 140 ? 91.626  78.097  85.077  1.00 97.42  ? 66  DT  I "O4'" 1 
ATOM 8943  C "C3'" . DT  I 5 140 ? 89.816  78.952  83.820  1.00 97.42  ? 66  DT  I "C3'" 1 
ATOM 8944  O "O3'" . DT  I 5 140 ? 89.612  80.258  84.332  1.00 97.42  ? 66  DT  I "O3'" 1 
ATOM 8945  C "C2'" . DT  I 5 140 ? 91.056  78.874  82.928  1.00 97.42  ? 66  DT  I "C2'" 1 
ATOM 8946  C "C1'" . DT  I 5 140 ? 92.185  78.718  83.937  1.00 97.42  ? 66  DT  I "C1'" 1 
ATOM 8947  N N1    . DT  I 5 140 ? 93.285  77.840  83.471  1.00 97.42  ? 66  DT  I N1    1 
ATOM 8948  C C2    . DT  I 5 140 ? 94.594  78.203  83.712  1.00 97.42  ? 66  DT  I C2    1 
ATOM 8949  O O2    . DT  I 5 140 ? 94.909  79.232  84.276  1.00 97.42  ? 66  DT  I O2    1 
ATOM 8950  N N3    . DT  I 5 140 ? 95.525  77.297  83.271  1.00 97.42  ? 66  DT  I N3    1 
ATOM 8951  C C4    . DT  I 5 140 ? 95.280  76.100  82.628  1.00 97.42  ? 66  DT  I C4    1 
ATOM 8952  O O4    . DT  I 5 140 ? 96.176  75.351  82.260  1.00 97.42  ? 66  DT  I O4    1 
ATOM 8953  C C5    . DT  I 5 140 ? 93.897  75.785  82.415  1.00 97.42  ? 66  DT  I C5    1 
ATOM 8954  C C7    . DT  I 5 140 ? 93.530  74.518  81.721  1.00 97.42  ? 66  DT  I C7    1 
ATOM 8955  C C6    . DT  I 5 140 ? 92.974  76.653  82.846  1.00 97.42  ? 66  DT  I C6    1 
ATOM 8956  P P     . DT  I 5 141 ? 89.257  81.487  83.364  1.00 102.10 ? 67  DT  I P     1 
ATOM 8957  O OP1   . DT  I 5 141 ? 88.474  82.464  84.151  1.00 102.10 ? 67  DT  I OP1   1 
ATOM 8958  O OP2   . DT  I 5 141 ? 88.701  80.960  82.100  1.00 102.10 ? 67  DT  I OP2   1 
ATOM 8959  O "O5'" . DT  I 5 141 ? 90.678  82.139  83.067  1.00 102.10 ? 67  DT  I "O5'" 1 
ATOM 8960  C "C5'" . DT  I 5 141 ? 91.550  82.466  84.148  1.00 102.10 ? 67  DT  I "C5'" 1 
ATOM 8961  C "C4'" . DT  I 5 141 ? 92.846  83.128  83.674  1.00 102.10 ? 67  DT  I "C4'" 1 
ATOM 8962  O "O4'" . DT  I 5 141 ? 93.771  82.141  83.149  1.00 102.10 ? 67  DT  I "O4'" 1 
ATOM 8963  C "C3'" . DT  I 5 141 ? 92.721  84.175  82.580  1.00 102.10 ? 67  DT  I "C3'" 1 
ATOM 8964  O "O3'" . DT  I 5 141 ? 93.741  85.135  82.782  1.00 102.10 ? 67  DT  I "O3'" 1 
ATOM 8965  C "C2'" . DT  I 5 141 ? 92.995  83.348  81.325  1.00 102.10 ? 67  DT  I "C2'" 1 
ATOM 8966  C "C1'" . DT  I 5 141 ? 94.140  82.492  81.827  1.00 102.10 ? 67  DT  I "C1'" 1 
ATOM 8967  N N1    . DT  I 5 141 ? 94.381  81.216  81.106  1.00 102.10 ? 67  DT  I N1    1 
ATOM 8968  C C2    . DT  I 5 141 ? 95.668  80.742  81.029  1.00 102.10 ? 67  DT  I C2    1 
ATOM 8969  O O2    . DT  I 5 141 ? 96.629  81.356  81.444  1.00 102.10 ? 67  DT  I O2    1 
ATOM 8970  N N3    . DT  I 5 141 ? 95.800  79.535  80.411  1.00 102.10 ? 67  DT  I N3    1 
ATOM 8971  C C4    . DT  I 5 141 ? 94.794  78.747  79.901  1.00 102.10 ? 67  DT  I C4    1 
ATOM 8972  O O4    . DT  I 5 141 ? 95.016  77.672  79.360  1.00 102.10 ? 67  DT  I O4    1 
ATOM 8973  C C5    . DT  I 5 141 ? 93.462  79.283  80.035  1.00 102.10 ? 67  DT  I C5    1 
ATOM 8974  C C7    . DT  I 5 141 ? 92.289  78.512  79.504  1.00 102.10 ? 67  DT  I C7    1 
ATOM 8975  C C6    . DT  I 5 141 ? 93.318  80.477  80.637  1.00 102.10 ? 67  DT  I C6    1 
ATOM 8976  P P     . DC  I 5 142 ? 93.519  86.679  82.407  1.00 103.18 ? 68  DC  I P     1 
ATOM 8977  O OP1   . DC  I 5 142 ? 93.459  87.425  83.682  1.00 103.18 ? 68  DC  I OP1   1 
ATOM 8978  O OP2   . DC  I 5 142 ? 92.415  86.785  81.429  1.00 103.18 ? 68  DC  I OP2   1 
ATOM 8979  O "O5'" . DC  I 5 142 ? 94.875  87.067  81.665  1.00 103.18 ? 68  DC  I "O5'" 1 
ATOM 8980  C "C5'" . DC  I 5 142 ? 96.110  86.803  82.301  1.00 103.18 ? 68  DC  I "C5'" 1 
ATOM 8981  C "C4'" . DC  I 5 142 ? 97.194  86.470  81.293  1.00 103.18 ? 68  DC  I "C4'" 1 
ATOM 8982  O "O4'" . DC  I 5 142 ? 97.048  85.105  80.818  1.00 103.18 ? 68  DC  I "O4'" 1 
ATOM 8983  C "C3'" . DC  I 5 142 ? 97.227  87.346  80.042  1.00 103.18 ? 68  DC  I "C3'" 1 
ATOM 8984  O "O3'" . DC  I 5 142 ? 98.562  87.632  79.746  1.00 103.18 ? 68  DC  I "O3'" 1 
ATOM 8985  C "C2'" . DC  I 5 142 ? 96.630  86.431  78.981  1.00 103.18 ? 68  DC  I "C2'" 1 
ATOM 8986  C "C1'" . DC  I 5 142 ? 97.204  85.102  79.422  1.00 103.18 ? 68  DC  I "C1'" 1 
ATOM 8987  N N1    . DC  I 5 142 ? 96.494  83.935  78.881  1.00 103.18 ? 68  DC  I N1    1 
ATOM 8988  C C2    . DC  I 5 142 ? 97.201  82.773  78.601  1.00 103.18 ? 68  DC  I C2    1 
ATOM 8989  O O2    . DC  I 5 142 ? 98.415  82.747  78.785  1.00 103.18 ? 68  DC  I O2    1 
ATOM 8990  N N3    . DC  I 5 142 ? 96.538  81.707  78.106  1.00 103.18 ? 68  DC  I N3    1 
ATOM 8991  C C4    . DC  I 5 142 ? 95.226  81.774  77.906  1.00 103.18 ? 68  DC  I C4    1 
ATOM 8992  N N4    . DC  I 5 142 ? 94.612  80.699  77.415  1.00 103.18 ? 68  DC  I N4    1 
ATOM 8993  C C5    . DC  I 5 142 ? 94.487  82.952  78.184  1.00 103.18 ? 68  DC  I C5    1 
ATOM 8994  C C6    . DC  I 5 142 ? 95.157  83.998  78.667  1.00 103.18 ? 68  DC  I C6    1 
ATOM 8995  P P     . DT  I 5 143 ? 98.968  88.916  78.879  1.00 100.23 ? 69  DT  I P     1 
ATOM 8996  O OP1   . DT  I 5 143 ? 98.683  90.111  79.699  1.00 100.23 ? 69  DT  I OP1   1 
ATOM 8997  O OP2   . DT  I 5 143 ? 98.390  88.793  77.523  1.00 100.23 ? 69  DT  I OP2   1 
ATOM 8998  O "O5'" . DT  I 5 143 ? 100.543 88.741  78.737  1.00 100.23 ? 69  DT  I "O5'" 1 
ATOM 8999  C "C5'" . DT  I 5 143 ? 101.136 87.522  79.157  1.00 100.23 ? 69  DT  I "C5'" 1 
ATOM 9000  C "C4'" . DT  I 5 143 ? 101.778 86.801  77.991  1.00 100.23 ? 69  DT  I "C4'" 1 
ATOM 9001  O "O4'" . DT  I 5 143 ? 100.950 85.683  77.562  1.00 100.23 ? 69  DT  I "O4'" 1 
ATOM 9002  C "C3'" . DT  I 5 143 ? 101.998 87.643  76.742  1.00 100.23 ? 69  DT  I "C3'" 1 
ATOM 9003  O "O3'" . DT  I 5 143 ? 103.222 87.267  76.189  1.00 100.23 ? 69  DT  I "O3'" 1 
ATOM 9004  C "C2'" . DT  I 5 143 ? 100.842 87.196  75.854  1.00 100.23 ? 69  DT  I "C2'" 1 
ATOM 9005  C "C1'" . DT  I 5 143 ? 100.871 85.722  76.159  1.00 100.23 ? 69  DT  I "C1'" 1 
ATOM 9006  N N1    . DT  I 5 143 ? 99.680  84.944  75.717  1.00 100.23 ? 69  DT  I N1    1 
ATOM 9007  C C2    . DT  I 5 143 ? 99.867  83.665  75.259  1.00 100.23 ? 69  DT  I C2    1 
ATOM 9008  O O2    . DT  I 5 143 ? 100.959 83.138  75.193  1.00 100.23 ? 69  DT  I O2    1 
ATOM 9009  N N3    . DT  I 5 143 ? 98.726  83.007  74.897  1.00 100.23 ? 69  DT  I N3    1 
ATOM 9010  C C4    . DT  I 5 143 ? 97.440  83.499  74.935  1.00 100.23 ? 69  DT  I C4    1 
ATOM 9011  O O4    . DT  I 5 143 ? 96.474  82.834  74.583  1.00 100.23 ? 69  DT  I O4    1 
ATOM 9012  C C5    . DT  I 5 143 ? 97.310  84.849  75.420  1.00 100.23 ? 69  DT  I C5    1 
ATOM 9013  C C7    . DT  I 5 143 ? 95.958  85.487  75.498  1.00 100.23 ? 69  DT  I C7    1 
ATOM 9014  C C6    . DT  I 5 143 ? 98.425  85.502  75.787  1.00 100.23 ? 69  DT  I C6    1 
ATOM 9015  P P     . DC  I 5 144 ? 104.074 88.272  75.280  1.00 102.59 ? 70  DC  I P     1 
ATOM 9016  O OP1   . DC  I 5 144 ? 104.780 89.219  76.162  1.00 102.59 ? 70  DC  I OP1   1 
ATOM 9017  O OP2   . DC  I 5 144 ? 103.200 88.789  74.211  1.00 102.59 ? 70  DC  I OP2   1 
ATOM 9018  O "O5'" . DC  I 5 144 ? 105.128 87.290  74.608  1.00 102.59 ? 70  DC  I "O5'" 1 
ATOM 9019  C "C5'" . DC  I 5 144 ? 104.933 85.888  74.742  1.00 102.59 ? 70  DC  I "C5'" 1 
ATOM 9020  C "C4'" . DC  I 5 144 ? 104.826 85.208  73.394  1.00 102.59 ? 70  DC  I "C4'" 1 
ATOM 9021  O "O4'" . DC  I 5 144 ? 103.473 84.706  73.193  1.00 102.59 ? 70  DC  I "O4'" 1 
ATOM 9022  C "C3'" . DC  I 5 144 ? 105.115 86.105  72.203  1.00 102.59 ? 70  DC  I "C3'" 1 
ATOM 9023  O "O3'" . DC  I 5 144 ? 105.741 85.351  71.211  1.00 102.59 ? 70  DC  I "O3'" 1 
ATOM 9024  C "C2'" . DC  I 5 144 ? 103.720 86.516  71.775  1.00 102.59 ? 70  DC  I "C2'" 1 
ATOM 9025  C "C1'" . DC  I 5 144 ? 102.989 85.204  71.968  1.00 102.59 ? 70  DC  I "C1'" 1 
ATOM 9026  N N1    . DC  I 5 144 ? 101.509 85.342  72.048  1.00 102.59 ? 70  DC  I N1    1 
ATOM 9027  C C2    . DC  I 5 144 ? 100.695 84.252  71.741  1.00 102.59 ? 70  DC  I C2    1 
ATOM 9028  O O2    . DC  I 5 144 ? 101.221 83.186  71.414  1.00 102.59 ? 70  DC  I O2    1 
ATOM 9029  N N3    . DC  I 5 144 ? 99.352  84.393  71.820  1.00 102.59 ? 70  DC  I N3    1 
ATOM 9030  C C4    . DC  I 5 144 ? 98.828  85.561  72.176  1.00 102.59 ? 70  DC  I C4    1 
ATOM 9031  N N4    . DC  I 5 144 ? 97.499  85.658  72.243  1.00 102.59 ? 70  DC  I N4    1 
ATOM 9032  C C5    . DC  I 5 144 ? 99.640  86.685  72.486  1.00 102.59 ? 70  DC  I C5    1 
ATOM 9033  C C6    . DC  I 5 144 ? 100.960 86.534  72.400  1.00 102.59 ? 70  DC  I C6    1 
ATOM 9034  P P     . DC  I 5 145 ? 106.738 86.054  70.175  1.00 107.50 ? 71  DC  I P     1 
ATOM 9035  O OP1   . DC  I 5 145 ? 108.113 85.738  70.625  1.00 107.50 ? 71  DC  I OP1   1 
ATOM 9036  O OP2   . DC  I 5 145 ? 106.310 87.464  70.033  1.00 107.50 ? 71  DC  I OP2   1 
ATOM 9037  O "O5'" . DC  I 5 145 ? 106.460 85.277  68.805  1.00 107.50 ? 71  DC  I "O5'" 1 
ATOM 9038  C "C5'" . DC  I 5 145 ? 106.707 83.879  68.737  1.00 107.50 ? 71  DC  I "C5'" 1 
ATOM 9039  C "C4'" . DC  I 5 145 ? 105.555 83.138  68.077  1.00 107.50 ? 71  DC  I "C4'" 1 
ATOM 9040  O "O4'" . DC  I 5 145 ? 104.283 83.539  68.675  1.00 107.50 ? 71  DC  I "O4'" 1 
ATOM 9041  C "C3'" . DC  I 5 145 ? 105.397 83.387  66.574  1.00 107.50 ? 71  DC  I "C3'" 1 
ATOM 9042  O "O3'" . DC  I 5 145 ? 105.039 82.171  65.920  1.00 107.50 ? 71  DC  I "O3'" 1 
ATOM 9043  C "C2'" . DC  I 5 145 ? 104.246 84.372  66.547  1.00 107.50 ? 71  DC  I "C2'" 1 
ATOM 9044  C "C1'" . DC  I 5 145 ? 103.380 83.777  67.629  1.00 107.50 ? 71  DC  I "C1'" 1 
ATOM 9045  N N1    . DC  I 5 145 ? 102.320 84.689  68.071  1.00 107.50 ? 71  DC  I N1    1 
ATOM 9046  C C2    . DC  I 5 145 ? 100.985 84.282  68.018  1.00 107.50 ? 71  DC  I C2    1 
ATOM 9047  O O2    . DC  I 5 145 ? 100.718 83.138  67.639  1.00 107.50 ? 71  DC  I O2    1 
ATOM 9048  N N3    . DC  I 5 145 ? 100.023 85.152  68.406  1.00 107.50 ? 71  DC  I N3    1 
ATOM 9049  C C4    . DC  I 5 145 ? 100.356 86.374  68.810  1.00 107.50 ? 71  DC  I C4    1 
ATOM 9050  N N4    . DC  I 5 145 ? 99.380  87.201  69.183  1.00 107.50 ? 71  DC  I N4    1 
ATOM 9051  C C5    . DC  I 5 145 ? 101.707 86.808  68.849  1.00 107.50 ? 71  DC  I C5    1 
ATOM 9052  C C6    . DC  I 5 145 ? 102.645 85.945  68.459  1.00 107.50 ? 71  DC  I C6    1 
ATOM 9053  P P     . DA  I 5 146 ? 105.286 81.976  64.343  1.00 107.89 ? 72  DA  I P     1 
ATOM 9054  O OP1   . DA  I 5 146 ? 104.890 80.591  64.016  1.00 107.89 ? 72  DA  I OP1   1 
ATOM 9055  O OP2   . DA  I 5 146 ? 106.660 82.430  64.045  1.00 107.89 ? 72  DA  I OP2   1 
ATOM 9056  O "O5'" . DA  I 5 146 ? 104.272 83.007  63.653  1.00 107.89 ? 72  DA  I "O5'" 1 
ATOM 9057  C "C5'" . DA  I 5 146 ? 103.712 82.731  62.379  1.00 107.89 ? 72  DA  I "C5'" 1 
ATOM 9058  C "C4'" . DA  I 5 146 ? 102.351 82.084  62.529  1.00 107.89 ? 72  DA  I "C4'" 1 
ATOM 9059  O "O4'" . DA  I 5 146 ? 101.917 82.200  63.910  1.00 107.89 ? 72  DA  I "O4'" 1 
ATOM 9060  C "C3'" . DA  I 5 146 ? 101.235 82.724  61.724  1.00 107.89 ? 72  DA  I "C3'" 1 
ATOM 9061  O "O3'" . DA  I 5 146 ? 101.194 82.181  60.427  1.00 107.89 ? 72  DA  I "O3'" 1 
ATOM 9062  C "C2'" . DA  I 5 146 ? 100.025 82.315  62.540  1.00 107.89 ? 72  DA  I "C2'" 1 
ATOM 9063  C "C1'" . DA  I 5 146 ? 100.551 82.566  63.942  1.00 107.89 ? 72  DA  I "C1'" 1 
ATOM 9064  N N9    . DA  I 5 146 ? 100.461 83.965  64.336  1.00 107.89 ? 72  DA  I N9    1 
ATOM 9065  C C8    . DA  I 5 146 ? 101.493 84.830  64.557  1.00 107.89 ? 72  DA  I C8    1 
ATOM 9066  N N7    . DA  I 5 146 ? 101.114 86.033  64.898  1.00 107.89 ? 72  DA  I N7    1 
ATOM 9067  C C5    . DA  I 5 146 ? 99.739  85.954  64.894  1.00 107.89 ? 72  DA  I C5    1 
ATOM 9068  C C6    . DA  I 5 146 ? 98.741  86.896  65.166  1.00 107.89 ? 72  DA  I C6    1 
ATOM 9069  N N6    . DA  I 5 146 ? 99.000  88.156  65.510  1.00 107.89 ? 72  DA  I N6    1 
ATOM 9070  N N1    . DA  I 5 146 ? 97.459  86.492  65.072  1.00 107.89 ? 72  DA  I N1    1 
ATOM 9071  C C2    . DA  I 5 146 ? 97.201  85.228  64.729  1.00 107.89 ? 72  DA  I C2    1 
ATOM 9072  N N3    . DA  I 5 146 ? 98.055  84.254  64.447  1.00 107.89 ? 72  DA  I N3    1 
ATOM 9073  C C4    . DA  I 5 146 ? 99.319  84.687  64.548  1.00 107.89 ? 72  DA  I C4    1 
ATOM 9074  P P     . DG  I 5 147 ? 100.834 83.127  59.183  1.00 110.35 ? 73  DG  I P     1 
ATOM 9075  O OP1   . DG  I 5 147 ? 101.442 82.540  57.970  1.00 110.35 ? 73  DG  I OP1   1 
ATOM 9076  O OP2   . DG  I 5 147 ? 101.172 84.508  59.591  1.00 110.35 ? 73  DG  I OP2   1 
ATOM 9077  O "O5'" . DG  I 5 147 ? 99.243  83.031  59.073  1.00 110.35 ? 73  DG  I "O5'" 1 
ATOM 9078  C "C5'" . DG  I 5 147 ? 98.603  81.763  59.072  1.00 110.35 ? 73  DG  I "C5'" 1 
ATOM 9079  C "C4'" . DG  I 5 147 ? 97.202  81.861  59.654  1.00 110.35 ? 73  DG  I "C4'" 1 
ATOM 9080  O "O4'" . DG  I 5 147 ? 97.225  82.700  60.836  1.00 110.35 ? 73  DG  I "O4'" 1 
ATOM 9081  C "C3'" . DG  I 5 147 ? 96.150  82.458  58.725  1.00 110.35 ? 73  DG  I "C3'" 1 
ATOM 9082  O "O3'" . DG  I 5 147 ? 94.908  81.791  58.903  1.00 110.35 ? 73  DG  I "O3'" 1 
ATOM 9083  C "C2'" . DG  I 5 147 ? 96.069  83.914  59.171  1.00 110.35 ? 73  DG  I "C2'" 1 
ATOM 9084  C "C1'" . DG  I 5 147 ? 96.396  83.829  60.658  1.00 110.35 ? 73  DG  I "C1'" 1 
ATOM 9085  N N9    . DG  I 5 147 ? 97.121  84.994  61.129  1.00 110.35 ? 73  DG  I N9    1 
ATOM 9086  C C8    . DG  I 5 147 ? 98.480  85.134  61.227  1.00 110.35 ? 73  DG  I C8    1 
ATOM 9087  N N7    . DG  I 5 147 ? 98.851  86.299  61.667  1.00 110.35 ? 73  DG  I N7    1 
ATOM 9088  C C5    . DG  I 5 147 ? 97.661  86.980  61.858  1.00 110.35 ? 73  DG  I C5    1 
ATOM 9089  C C6    . DG  I 5 147 ? 97.432  88.286  62.332  1.00 110.35 ? 73  DG  I C6    1 
ATOM 9090  O O6    . DG  I 5 147 ? 98.267  89.137  62.668  1.00 110.35 ? 73  DG  I O6    1 
ATOM 9091  N N1    . DG  I 5 147 ? 96.073  88.587  62.373  1.00 110.35 ? 73  DG  I N1    1 
ATOM 9092  C C2    . DG  I 5 147 ? 95.070  87.724  62.019  1.00 110.35 ? 73  DG  I C2    1 
ATOM 9093  N N2    . DG  I 5 147 ? 93.825  88.188  62.138  1.00 110.35 ? 73  DG  I N2    1 
ATOM 9094  N N3    . DG  I 5 147 ? 95.271  86.491  61.583  1.00 110.35 ? 73  DG  I N3    1 
ATOM 9095  C C4    . DG  I 5 147 ? 96.586  86.190  61.526  1.00 110.35 ? 73  DG  I C4    1 
ATOM 9096  P P     . DC  J 6 1   ? 94.502  95.246  65.148  1.00 116.41 ? -73 DC  J P     1 
ATOM 9097  O OP1   . DC  J 6 1   ? 93.850  95.070  66.465  1.00 116.41 ? -73 DC  J OP1   1 
ATOM 9098  O OP2   . DC  J 6 1   ? 95.924  94.870  64.977  1.00 116.41 ? -73 DC  J OP2   1 
ATOM 9099  O "O5'" . DC  J 6 1   ? 93.642  94.477  64.036  1.00 116.41 ? -73 DC  J "O5'" 1 
ATOM 9100  C "C5'" . DC  J 6 1   ? 92.475  95.081  63.481  1.00 116.41 ? -73 DC  J "C5'" 1 
ATOM 9101  C "C4'" . DC  J 6 1   ? 91.687  94.071  62.665  1.00 116.41 ? -73 DC  J "C4'" 1 
ATOM 9102  O "O4'" . DC  J 6 1   ? 92.380  93.819  61.411  1.00 116.41 ? -73 DC  J "O4'" 1 
ATOM 9103  C "C3'" . DC  J 6 1   ? 91.497  92.722  63.348  1.00 116.41 ? -73 DC  J "C3'" 1 
ATOM 9104  O "O3'" . DC  J 6 1   ? 90.187  92.653  63.928  1.00 116.41 ? -73 DC  J "O3'" 1 
ATOM 9105  C "C2'" . DC  J 6 1   ? 91.647  91.709  62.218  1.00 116.41 ? -73 DC  J "C2'" 1 
ATOM 9106  C "C1'" . DC  J 6 1   ? 92.507  92.432  61.168  1.00 116.41 ? -73 DC  J "C1'" 1 
ATOM 9107  N N1    . DC  J 6 1   ? 93.996  92.083  61.174  1.00 116.41 ? -73 DC  J N1    1 
ATOM 9108  C C2    . DC  J 6 1   ? 94.450  90.770  60.900  1.00 116.41 ? -73 DC  J C2    1 
ATOM 9109  O O2    . DC  J 6 1   ? 93.646  89.868  60.653  1.00 116.41 ? -73 DC  J O2    1 
ATOM 9110  N N3    . DC  J 6 1   ? 95.779  90.528  60.910  1.00 116.41 ? -73 DC  J N3    1 
ATOM 9111  C C4    . DC  J 6 1   ? 96.644  91.511  61.161  1.00 116.41 ? -73 DC  J C4    1 
ATOM 9112  N N4    . DC  J 6 1   ? 97.947  91.215  61.157  1.00 116.41 ? -73 DC  J N4    1 
ATOM 9113  C C5    . DC  J 6 1   ? 96.213  92.838  61.425  1.00 116.41 ? -73 DC  J C5    1 
ATOM 9114  C C6    . DC  J 6 1   ? 94.901  93.078  61.413  1.00 116.41 ? -73 DC  J C6    1 
ATOM 9115  P P     . DT  J 6 2   ? 89.972  92.073  65.414  1.00 113.17 ? -72 DT  J P     1 
ATOM 9116  O OP1   . DT  J 6 2   ? 88.589  92.392  65.830  1.00 113.17 ? -72 DT  J OP1   1 
ATOM 9117  O OP2   . DT  J 6 2   ? 91.110  92.535  66.236  1.00 113.17 ? -72 DT  J OP2   1 
ATOM 9118  O "O5'" . DT  J 6 2   ? 90.115  90.487  65.251  1.00 113.17 ? -72 DT  J "O5'" 1 
ATOM 9119  C "C5'" . DT  J 6 2   ? 89.065  89.711  64.677  1.00 113.17 ? -72 DT  J "C5'" 1 
ATOM 9120  C "C4'" . DT  J 6 2   ? 89.493  88.259  64.513  1.00 113.17 ? -72 DT  J "C4'" 1 
ATOM 9121  O "O4'" . DT  J 6 2   ? 90.884  88.214  64.099  1.00 113.17 ? -72 DT  J "O4'" 1 
ATOM 9122  C "C3'" . DT  J 6 2   ? 89.410  87.403  65.780  1.00 113.17 ? -72 DT  J "C3'" 1 
ATOM 9123  O "O3'" . DT  J 6 2   ? 89.043  86.065  65.444  1.00 113.17 ? -72 DT  J "O3'" 1 
ATOM 9124  C "C2'" . DT  J 6 2   ? 90.834  87.467  66.318  1.00 113.17 ? -72 DT  J "C2'" 1 
ATOM 9125  C "C1'" . DT  J 6 2   ? 91.636  87.463  65.031  1.00 113.17 ? -72 DT  J "C1'" 1 
ATOM 9126  N N1    . DT  J 6 2   ? 92.974  88.088  65.174  1.00 113.17 ? -72 DT  J N1    1 
ATOM 9127  C C2    . DT  J 6 2   ? 94.086  87.291  65.183  1.00 113.17 ? -72 DT  J C2    1 
ATOM 9128  O O2    . DT  J 6 2   ? 94.042  86.078  65.062  1.00 113.17 ? -72 DT  J O2    1 
ATOM 9129  N N3    . DT  J 6 2   ? 95.264  87.966  65.320  1.00 113.17 ? -72 DT  J N3    1 
ATOM 9130  C C4    . DT  J 6 2   ? 95.438  89.326  65.457  1.00 113.17 ? -72 DT  J C4    1 
ATOM 9131  O O4    . DT  J 6 2   ? 96.543  89.836  65.579  1.00 113.17 ? -72 DT  J O4    1 
ATOM 9132  C C5    . DT  J 6 2   ? 94.233  90.101  65.447  1.00 113.17 ? -72 DT  J C5    1 
ATOM 9133  C C7    . DT  J 6 2   ? 94.300  91.588  65.591  1.00 113.17 ? -72 DT  J C7    1 
ATOM 9134  C C6    . DT  J 6 2   ? 93.072  89.455  65.310  1.00 113.17 ? -72 DT  J C6    1 
ATOM 9135  P P     . DG  J 6 3   ? 88.582  85.027  66.586  1.00 112.27 ? -71 DG  J P     1 
ATOM 9136  O OP1   . DG  J 6 3   ? 87.319  84.415  66.124  1.00 112.27 ? -71 DG  J OP1   1 
ATOM 9137  O OP2   . DG  J 6 3   ? 88.612  85.696  67.905  1.00 112.27 ? -71 DG  J OP2   1 
ATOM 9138  O "O5'" . DG  J 6 3   ? 89.714  83.895  66.567  1.00 112.27 ? -71 DG  J "O5'" 1 
ATOM 9139  C "C5'" . DG  J 6 3   ? 89.539  82.739  65.753  1.00 112.27 ? -71 DG  J "C5'" 1 
ATOM 9140  C "C4'" . DG  J 6 3   ? 90.785  81.870  65.747  1.00 112.27 ? -71 DG  J "C4'" 1 
ATOM 9141  O "O4'" . DG  J 6 3   ? 91.971  82.709  65.759  1.00 112.27 ? -71 DG  J "O4'" 1 
ATOM 9142  C "C3'" . DG  J 6 3   ? 90.935  80.930  66.943  1.00 112.27 ? -71 DG  J "C3'" 1 
ATOM 9143  O "O3'" . DG  J 6 3   ? 91.556  79.721  66.521  1.00 112.27 ? -71 DG  J "O3'" 1 
ATOM 9144  C "C2'" . DG  J 6 3   ? 91.852  81.725  67.860  1.00 112.27 ? -71 DG  J "C2'" 1 
ATOM 9145  C "C1'" . DG  J 6 3   ? 92.795  82.327  66.837  1.00 112.27 ? -71 DG  J "C1'" 1 
ATOM 9146  N N9    . DG  J 6 3   ? 93.503  83.505  67.306  1.00 112.27 ? -71 DG  J N9    1 
ATOM 9147  C C8    . DG  J 6 3   ? 92.951  84.706  67.665  1.00 112.27 ? -71 DG  J C8    1 
ATOM 9148  N N7    . DG  J 6 3   ? 93.830  85.589  68.035  1.00 112.27 ? -71 DG  J N7    1 
ATOM 9149  C C5    . DG  J 6 3   ? 95.044  84.932  67.909  1.00 112.27 ? -71 DG  J C5    1 
ATOM 9150  C C6    . DG  J 6 3   ? 96.350  85.390  68.168  1.00 112.27 ? -71 DG  J C6    1 
ATOM 9151  O O6    . DG  J 6 3   ? 96.698  86.502  68.575  1.00 112.27 ? -71 DG  J O6    1 
ATOM 9152  N N1    . DG  J 6 3   ? 97.302  84.410  67.912  1.00 112.27 ? -71 DG  J N1    1 
ATOM 9153  C C2    . DG  J 6 3   ? 97.024  83.145  67.458  1.00 112.27 ? -71 DG  J C2    1 
ATOM 9154  N N2    . DG  J 6 3   ? 98.074  82.334  67.267  1.00 112.27 ? -71 DG  J N2    1 
ATOM 9155  N N3    . DG  J 6 3   ? 95.797  82.702  67.211  1.00 112.27 ? -71 DG  J N3    1 
ATOM 9156  C C4    . DG  J 6 3   ? 94.862  83.649  67.458  1.00 112.27 ? -71 DG  J C4    1 
ATOM 9157  P P     . DG  J 6 4   ? 91.240  78.336  67.271  1.00 104.31 ? -70 DG  J P     1 
ATOM 9158  O OP1   . DG  J 6 4   ? 90.053  77.742  66.620  1.00 104.31 ? -70 DG  J OP1   1 
ATOM 9159  O OP2   . DG  J 6 4   ? 91.246  78.584  68.729  1.00 104.31 ? -70 DG  J OP2   1 
ATOM 9160  O "O5'" . DG  J 6 4   ? 92.508  77.425  66.944  1.00 104.31 ? -70 DG  J "O5'" 1 
ATOM 9161  C "C5'" . DG  J 6 4   ? 92.936  76.448  67.881  1.00 104.31 ? -70 DG  J "C5'" 1 
ATOM 9162  C "C4'" . DG  J 6 4   ? 94.449  76.382  67.921  1.00 104.31 ? -70 DG  J "C4'" 1 
ATOM 9163  O "O4'" . DG  J 6 4   ? 94.985  77.732  67.924  1.00 104.31 ? -70 DG  J "O4'" 1 
ATOM 9164  C "C3'" . DG  J 6 4   ? 95.036  75.724  69.163  1.00 104.31 ? -70 DG  J "C3'" 1 
ATOM 9165  O "O3'" . DG  J 6 4   ? 96.325  75.208  68.861  1.00 104.31 ? -70 DG  J "O3'" 1 
ATOM 9166  C "C2'" . DG  J 6 4   ? 95.140  76.910  70.099  1.00 104.31 ? -70 DG  J "C2'" 1 
ATOM 9167  C "C1'" . DG  J 6 4   ? 95.676  77.952  69.136  1.00 104.31 ? -70 DG  J "C1'" 1 
ATOM 9168  N N9    . DG  J 6 4   ? 95.436  79.315  69.566  1.00 104.31 ? -70 DG  J N9    1 
ATOM 9169  C C8    . DG  J 6 4   ? 94.222  79.932  69.717  1.00 104.31 ? -70 DG  J C8    1 
ATOM 9170  N N7    . DG  J 6 4   ? 94.315  81.164  70.125  1.00 104.31 ? -70 DG  J N7    1 
ATOM 9171  C C5    . DG  J 6 4   ? 95.677  81.372  70.253  1.00 104.31 ? -70 DG  J C5    1 
ATOM 9172  C C6    . DG  J 6 4   ? 96.380  82.516  70.665  1.00 104.31 ? -70 DG  J C6    1 
ATOM 9173  O O6    . DG  J 6 4   ? 95.921  83.612  71.001  1.00 104.31 ? -70 DG  J O6    1 
ATOM 9174  N N1    . DG  J 6 4   ? 97.754  82.307  70.655  1.00 104.31 ? -70 DG  J N1    1 
ATOM 9175  C C2    . DG  J 6 4   ? 98.366  81.132  70.297  1.00 104.31 ? -70 DG  J C2    1 
ATOM 9176  N N2    . DG  J 6 4   ? 99.703  81.112  70.350  1.00 104.31 ? -70 DG  J N2    1 
ATOM 9177  N N3    . DG  J 6 4   ? 97.715  80.048  69.911  1.00 104.31 ? -70 DG  J N3    1 
ATOM 9178  C C4    . DG  J 6 4   ? 96.379  80.242  69.914  1.00 104.31 ? -70 DG  J C4    1 
ATOM 9179  P P     . DA  J 6 5   ? 96.915  73.956  69.675  1.00 94.29  ? -69 DA  J P     1 
ATOM 9180  O OP1   . DA  J 6 5   ? 96.736  72.757  68.829  1.00 94.29  ? -69 DA  J OP1   1 
ATOM 9181  O OP2   . DA  J 6 5   ? 96.341  73.990  71.037  1.00 94.29  ? -69 DA  J OP2   1 
ATOM 9182  O "O5'" . DA  J 6 5   ? 98.480  74.273  69.799  1.00 94.29  ? -69 DA  J "O5'" 1 
ATOM 9183  C "C5'" . DA  J 6 5   ? 99.348  73.329  70.419  1.00 94.29  ? -69 DA  J "C5'" 1 
ATOM 9184  C "C4'" . DA  J 6 5   ? 100.725 73.921  70.645  1.00 94.29  ? -69 DA  J "C4'" 1 
ATOM 9185  O "O4'" . DA  J 6 5   ? 100.607 75.360  70.751  1.00 94.29  ? -69 DA  J "O4'" 1 
ATOM 9186  C "C3'" . DA  J 6 5   ? 101.373 73.510  71.947  1.00 94.29  ? -69 DA  J "C3'" 1 
ATOM 9187  O "O3'" . DA  J 6 5   ? 102.772 73.804  71.905  1.00 94.29  ? -69 DA  J "O3'" 1 
ATOM 9188  C "C2'" . DA  J 6 5   ? 100.644 74.431  72.909  1.00 94.29  ? -69 DA  J "C2'" 1 
ATOM 9189  C "C1'" . DA  J 6 5   ? 100.644 75.736  72.119  1.00 94.29  ? -69 DA  J "C1'" 1 
ATOM 9190  N N9    . DA  J 6 5   ? 99.502  76.613  72.386  1.00 94.29  ? -69 DA  J N9    1 
ATOM 9191  C C8    . DA  J 6 5   ? 98.181  76.304  72.246  1.00 94.29  ? -69 DA  J C8    1 
ATOM 9192  N N7    . DA  J 6 5   ? 97.373  77.294  72.538  1.00 94.29  ? -69 DA  J N7    1 
ATOM 9193  C C5    . DA  J 6 5   ? 98.219  78.330  72.877  1.00 94.29  ? -69 DA  J C5    1 
ATOM 9194  C C6    . DA  J 6 5   ? 97.978  79.658  73.278  1.00 94.29  ? -69 DA  J C6    1 
ATOM 9195  N N6    . DA  J 6 5   ? 96.753  80.171  73.415  1.00 94.29  ? -69 DA  J N6    1 
ATOM 9196  N N1    . DA  J 6 5   ? 99.043  80.433  73.554  1.00 94.29  ? -69 DA  J N1    1 
ATOM 9197  C C2    . DA  J 6 5   ? 100.270 79.913  73.422  1.00 94.29  ? -69 DA  J C2    1 
ATOM 9198  N N3    . DA  J 6 5   ? 100.621 78.682  73.048  1.00 94.29  ? -69 DA  J N3    1 
ATOM 9199  C C4    . DA  J 6 5   ? 99.538  77.933  72.789  1.00 94.29  ? -69 DA  J C4    1 
ATOM 9200  P P     . DG  J 6 6   ? 103.804 73.082  72.910  1.00 89.12  ? -68 DG  J P     1 
ATOM 9201  O OP1   . DG  J 6 6   ? 104.742 72.295  72.084  1.00 89.12  ? -68 DG  J OP1   1 
ATOM 9202  O OP2   . DG  J 6 6   ? 103.045 72.403  73.981  1.00 89.12  ? -68 DG  J OP2   1 
ATOM 9203  O "O5'" . DG  J 6 6   ? 104.613 74.295  73.579  1.00 89.12  ? -68 DG  J "O5'" 1 
ATOM 9204  C "C5'" . DG  J 6 6   ? 104.086 75.625  73.535  1.00 89.12  ? -68 DG  J "C5'" 1 
ATOM 9205  C "C4'" . DG  J 6 6   ? 103.737 76.123  74.928  1.00 89.12  ? -68 DG  J "C4'" 1 
ATOM 9206  O "O4'" . DG  J 6 6   ? 102.431 76.769  74.922  1.00 89.12  ? -68 DG  J "O4'" 1 
ATOM 9207  C "C3'" . DG  J 6 6   ? 103.649 75.033  76.006  1.00 89.12  ? -68 DG  J "C3'" 1 
ATOM 9208  O "O3'" . DG  J 6 6   ? 104.325 75.464  77.166  1.00 89.12  ? -68 DG  J "O3'" 1 
ATOM 9209  C "C2'" . DG  J 6 6   ? 102.149 74.927  76.255  1.00 89.12  ? -68 DG  J "C2'" 1 
ATOM 9210  C "C1'" . DG  J 6 6   ? 101.784 76.381  76.102  1.00 89.12  ? -68 DG  J "C1'" 1 
ATOM 9211  N N9    . DG  J 6 6   ? 100.353 76.649  76.032  1.00 89.12  ? -68 DG  J N9    1 
ATOM 9212  C C8    . DG  J 6 6   ? 99.347  75.761  75.758  1.00 89.12  ? -68 DG  J C8    1 
ATOM 9213  N N7    . DG  J 6 6   ? 98.160  76.294  75.786  1.00 89.12  ? -68 DG  J N7    1 
ATOM 9214  C C5    . DG  J 6 6   ? 98.393  77.613  76.133  1.00 89.12  ? -68 DG  J C5    1 
ATOM 9215  C C6    . DG  J 6 6   ? 97.489  78.674  76.330  1.00 89.12  ? -68 DG  J C6    1 
ATOM 9216  O O6    . DG  J 6 6   ? 96.262  78.665  76.222  1.00 89.12  ? -68 DG  J O6    1 
ATOM 9217  N N1    . DG  J 6 6   ? 98.142  79.848  76.659  1.00 89.12  ? -68 DG  J N1    1 
ATOM 9218  C C2    . DG  J 6 6   ? 99.500  79.977  76.791  1.00 89.12  ? -68 DG  J C2    1 
ATOM 9219  N N2    . DG  J 6 6   ? 99.943  81.181  77.146  1.00 89.12  ? -68 DG  J N2    1 
ATOM 9220  N N3    . DG  J 6 6   ? 100.358 78.989  76.631  1.00 89.12  ? -68 DG  J N3    1 
ATOM 9221  C C4    . DG  J 6 6   ? 99.737  77.843  76.295  1.00 89.12  ? -68 DG  J C4    1 
ATOM 9222  P P     . DA  J 6 7   ? 105.818 74.958  77.463  1.00 83.47  ? -67 DA  J P     1 
ATOM 9223  O OP1   . DA  J 6 7   ? 106.453 74.588  76.179  1.00 83.47  ? -67 DA  J OP1   1 
ATOM 9224  O OP2   . DA  J 6 7   ? 105.744 73.972  78.563  1.00 83.47  ? -67 DA  J OP2   1 
ATOM 9225  O "O5'" . DA  J 6 7   ? 106.537 76.261  78.017  1.00 83.47  ? -67 DA  J "O5'" 1 
ATOM 9226  C "C5'" . DA  J 6 7   ? 106.094 77.521  77.587  1.00 83.47  ? -67 DA  J "C5'" 1 
ATOM 9227  C "C4'" . DA  J 6 7   ? 105.480 78.300  78.733  1.00 83.47  ? -67 DA  J "C4'" 1 
ATOM 9228  O "O4'" . DA  J 6 7   ? 104.034 78.262  78.656  1.00 83.47  ? -67 DA  J "O4'" 1 
ATOM 9229  C "C3'" . DA  J 6 7   ? 105.834 77.814  80.133  1.00 83.47  ? -67 DA  J "C3'" 1 
ATOM 9230  O "O3'" . DA  J 6 7   ? 106.051 78.929  80.938  1.00 83.47  ? -67 DA  J "O3'" 1 
ATOM 9231  C "C2'" . DA  J 6 7   ? 104.567 77.085  80.564  1.00 83.47  ? -67 DA  J "C2'" 1 
ATOM 9232  C "C1'" . DA  J 6 7   ? 103.524 77.986  79.940  1.00 83.47  ? -67 DA  J "C1'" 1 
ATOM 9233  N N9    . DA  J 6 7   ? 102.209 77.378  79.781  1.00 83.47  ? -67 DA  J N9    1 
ATOM 9234  C C8    . DA  J 6 7   ? 101.940 76.071  79.512  1.00 83.47  ? -67 DA  J C8    1 
ATOM 9235  N N7    . DA  J 6 7   ? 100.664 75.810  79.379  1.00 83.47  ? -67 DA  J N7    1 
ATOM 9236  C C5    . DA  J 6 7   ? 100.052 77.029  79.599  1.00 83.47  ? -67 DA  J C5    1 
ATOM 9237  C C6    . DA  J 6 7   ? 98.704  77.420  79.612  1.00 83.47  ? -67 DA  J C6    1 
ATOM 9238  N N6    . DA  J 6 7   ? 97.695  76.574  79.400  1.00 83.47  ? -67 DA  J N6    1 
ATOM 9239  N N1    . DA  J 6 7   ? 98.431  78.711  79.871  1.00 83.47  ? -67 DA  J N1    1 
ATOM 9240  C C2    . DA  J 6 7   ? 99.442  79.555  80.097  1.00 83.47  ? -67 DA  J C2    1 
ATOM 9241  N N3    . DA  J 6 7   ? 100.747 79.303  80.102  1.00 83.47  ? -67 DA  J N3    1 
ATOM 9242  C C4    . DA  J 6 7   ? 100.986 78.010  79.842  1.00 83.47  ? -67 DA  J C4    1 
ATOM 9243  P P     . DA  J 6 8   ? 107.078 78.856  82.159  1.00 78.90  ? -66 DA  J P     1 
ATOM 9244  O OP1   . DA  J 6 8   ? 108.270 79.615  81.733  1.00 78.90  ? -66 DA  J OP1   1 
ATOM 9245  O OP2   . DA  J 6 8   ? 107.217 77.445  82.583  1.00 78.90  ? -66 DA  J OP2   1 
ATOM 9246  O "O5'" . DA  J 6 8   ? 106.327 79.668  83.310  1.00 78.90  ? -66 DA  J "O5'" 1 
ATOM 9247  C "C5'" . DA  J 6 8   ? 106.128 81.058  83.158  1.00 78.90  ? -66 DA  J "C5'" 1 
ATOM 9248  C "C4'" . DA  J 6 8   ? 104.777 81.480  83.696  1.00 78.90  ? -66 DA  J "C4'" 1 
ATOM 9249  O "O4'" . DA  J 6 8   ? 103.736 80.663  83.115  1.00 78.90  ? -66 DA  J "O4'" 1 
ATOM 9250  C "C3'" . DA  J 6 8   ? 104.609 81.378  85.211  1.00 78.90  ? -66 DA  J "C3'" 1 
ATOM 9251  O "O3'" . DA  J 6 8   ? 104.098 82.617  85.693  1.00 78.90  ? -66 DA  J "O3'" 1 
ATOM 9252  C "C2'" . DA  J 6 8   ? 103.597 80.234  85.379  1.00 78.90  ? -66 DA  J "C2'" 1 
ATOM 9253  C "C1'" . DA  J 6 8   ? 102.791 80.365  84.106  1.00 78.90  ? -66 DA  J "C1'" 1 
ATOM 9254  N N9    . DA  J 6 8   ? 102.100 79.152  83.703  1.00 78.90  ? -66 DA  J N9    1 
ATOM 9255  C C8    . DA  J 6 8   ? 102.668 77.955  83.387  1.00 78.90  ? -66 DA  J C8    1 
ATOM 9256  N N7    . DA  J 6 8   ? 101.805 77.037  83.034  1.00 78.90  ? -66 DA  J N7    1 
ATOM 9257  C C5    . DA  J 6 8   ? 100.587 77.683  83.109  1.00 78.90  ? -66 DA  J C5    1 
ATOM 9258  C C6    . DA  J 6 8   ? 99.276  77.255  82.859  1.00 78.90  ? -66 DA  J C6    1 
ATOM 9259  N N6    . DA  J 6 8   ? 98.981  76.019  82.464  1.00 78.90  ? -66 DA  J N6    1 
ATOM 9260  N N1    . DA  J 6 8   ? 98.277  78.147  83.023  1.00 78.90  ? -66 DA  J N1    1 
ATOM 9261  C C2    . DA  J 6 8   ? 98.582  79.386  83.418  1.00 78.90  ? -66 DA  J C2    1 
ATOM 9262  N N3    . DA  J 6 8   ? 99.782  79.903  83.687  1.00 78.90  ? -66 DA  J N3    1 
ATOM 9263  C C4    . DA  J 6 8   ? 100.749 78.990  83.509  1.00 78.90  ? -66 DA  J C4    1 
ATOM 9264  P P     . DT  J 6 9   ? 104.116 82.981  87.257  1.00 78.17  ? -65 DT  J P     1 
ATOM 9265  O OP1   . DT  J 6 9   ? 104.701 84.325  87.420  1.00 78.17  ? -65 DT  J OP1   1 
ATOM 9266  O OP2   . DT  J 6 9   ? 104.719 81.862  88.007  1.00 78.17  ? -65 DT  J OP2   1 
ATOM 9267  O "O5'" . DT  J 6 9   ? 102.566 83.069  87.620  1.00 78.17  ? -65 DT  J "O5'" 1 
ATOM 9268  C "C5'" . DT  J 6 9   ? 101.588 83.091  86.578  1.00 78.17  ? -65 DT  J "C5'" 1 
ATOM 9269  C "C4'" . DT  J 6 9   ? 100.188 82.971  87.147  1.00 78.17  ? -65 DT  J "C4'" 1 
ATOM 9270  O "O4'" . DT  J 6 9   ? 99.517  81.805  86.577  1.00 78.17  ? -65 DT  J "O4'" 1 
ATOM 9271  C "C3'" . DT  J 6 9   ? 100.124 82.766  88.655  1.00 78.17  ? -65 DT  J "C3'" 1 
ATOM 9272  O "O3'" . DT  J 6 9   ? 98.893  83.287  89.138  1.00 78.17  ? -65 DT  J "O3'" 1 
ATOM 9273  C "C2'" . DT  J 6 9   ? 100.143 81.251  88.739  1.00 78.17  ? -65 DT  J "C2'" 1 
ATOM 9274  C "C1'" . DT  J 6 9   ? 99.170  80.917  87.624  1.00 78.17  ? -65 DT  J "C1'" 1 
ATOM 9275  N N1    . DT  J 6 9   ? 99.275  79.512  87.125  1.00 78.17  ? -65 DT  J N1    1 
ATOM 9276  C C2    . DT  J 6 9   ? 98.143  78.853  86.692  1.00 78.17  ? -65 DT  J C2    1 
ATOM 9277  O O2    . DT  J 6 9   ? 97.040  79.362  86.675  1.00 78.17  ? -65 DT  J O2    1 
ATOM 9278  N N3    . DT  J 6 9   ? 98.365  77.575  86.235  1.00 78.17  ? -65 DT  J N3    1 
ATOM 9279  C C4    . DT  J 6 9   ? 99.571  76.908  86.201  1.00 78.17  ? -65 DT  J C4    1 
ATOM 9280  O O4    . DT  J 6 9   ? 99.682  75.764  85.782  1.00 78.17  ? -65 DT  J O4    1 
ATOM 9281  C C5    . DT  J 6 9   ? 100.705 77.657  86.680  1.00 78.17  ? -65 DT  J C5    1 
ATOM 9282  C C7    . DT  J 6 9   ? 102.063 77.034  86.691  1.00 78.17  ? -65 DT  J C7    1 
ATOM 9283  C C6    . DT  J 6 9   ? 100.504 78.902  87.115  1.00 78.17  ? -65 DT  J C6    1 
ATOM 9284  P P     . DC  J 6 10  ? 98.646  83.546  90.704  1.00 78.75  ? -64 DC  J P     1 
ATOM 9285  O OP1   . DC  J 6 10  ? 98.460  85.005  90.853  1.00 78.75  ? -64 DC  J OP1   1 
ATOM 9286  O OP2   . DC  J 6 10  ? 99.690  82.865  91.502  1.00 78.75  ? -64 DC  J OP2   1 
ATOM 9287  O "O5'" . DC  J 6 10  ? 97.239  82.833  90.982  1.00 78.75  ? -64 DC  J "O5'" 1 
ATOM 9288  C "C5'" . DC  J 6 10  ? 96.085  83.240  90.251  1.00 78.75  ? -64 DC  J "C5'" 1 
ATOM 9289  C "C4'" . DC  J 6 10  ? 95.059  82.121  90.158  1.00 78.75  ? -64 DC  J "C4'" 1 
ATOM 9290  O "O4'" . DC  J 6 10  ? 95.641  80.974  89.486  1.00 78.75  ? -64 DC  J "O4'" 1 
ATOM 9291  C "C3'" . DC  J 6 10  ? 94.526  81.602  91.497  1.00 78.75  ? -64 DC  J "C3'" 1 
ATOM 9292  O "O3'" . DC  J 6 10  ? 93.118  81.393  91.408  1.00 78.75  ? -64 DC  J "O3'" 1 
ATOM 9293  C "C2'" . DC  J 6 10  ? 95.274  80.284  91.679  1.00 78.75  ? -64 DC  J "C2'" 1 
ATOM 9294  C "C1'" . DC  J 6 10  ? 95.400  79.811  90.242  1.00 78.75  ? -64 DC  J "C1'" 1 
ATOM 9295  N N1    . DC  J 6 10  ? 96.527  78.899  90.032  1.00 78.75  ? -64 DC  J N1    1 
ATOM 9296  C C2    . DC  J 6 10  ? 96.329  77.697  89.373  1.00 78.75  ? -64 DC  J C2    1 
ATOM 9297  O O2    . DC  J 6 10  ? 95.201  77.383  89.023  1.00 78.75  ? -64 DC  J O2    1 
ATOM 9298  N N3    . DC  J 6 10  ? 97.377  76.864  89.204  1.00 78.75  ? -64 DC  J N3    1 
ATOM 9299  C C4    . DC  J 6 10  ? 98.581  77.217  89.634  1.00 78.75  ? -64 DC  J C4    1 
ATOM 9300  N N4    . DC  J 6 10  ? 99.595  76.375  89.433  1.00 78.75  ? -64 DC  J N4    1 
ATOM 9301  C C5    . DC  J 6 10  ? 98.800  78.442  90.302  1.00 78.75  ? -64 DC  J C5    1 
ATOM 9302  C C6    . DC  J 6 10  ? 97.755  79.247  90.475  1.00 78.75  ? -64 DC  J C6    1 
ATOM 9303  P P     . DC  J 6 11  ? 92.255  81.097  92.729  1.00 79.65  ? -63 DC  J P     1 
ATOM 9304  O OP1   . DC  J 6 11  ? 90.994  81.849  92.591  1.00 79.65  ? -63 DC  J OP1   1 
ATOM 9305  O OP2   . DC  J 6 11  ? 93.110  81.327  93.910  1.00 79.65  ? -63 DC  J OP2   1 
ATOM 9306  O "O5'" . DC  J 6 11  ? 91.913  79.535  92.635  1.00 79.65  ? -63 DC  J "O5'" 1 
ATOM 9307  C "C5'" . DC  J 6 11  ? 90.741  79.110  91.944  1.00 79.65  ? -63 DC  J "C5'" 1 
ATOM 9308  C "C4'" . DC  J 6 11  ? 90.465  77.628  92.156  1.00 79.65  ? -63 DC  J "C4'" 1 
ATOM 9309  O "O4'" . DC  J 6 11  ? 91.585  76.847  91.669  1.00 79.65  ? -63 DC  J "O4'" 1 
ATOM 9310  C "C3'" . DC  J 6 11  ? 90.237  77.195  93.606  1.00 79.65  ? -63 DC  J "C3'" 1 
ATOM 9311  O "O3'" . DC  J 6 11  ? 89.172  76.263  93.666  1.00 79.65  ? -63 DC  J "O3'" 1 
ATOM 9312  C "C2'" . DC  J 6 11  ? 91.560  76.538  93.983  1.00 79.65  ? -63 DC  J "C2'" 1 
ATOM 9313  C "C1'" . DC  J 6 11  ? 91.995  75.934  92.659  1.00 79.65  ? -63 DC  J "C1'" 1 
ATOM 9314  N N1    . DC  J 6 11  ? 93.458  75.778  92.556  1.00 79.65  ? -63 DC  J N1    1 
ATOM 9315  C C2    . DC  J 6 11  ? 94.022  74.504  92.468  1.00 79.65  ? -63 DC  J C2    1 
ATOM 9316  O O2    . DC  J 6 11  ? 93.284  73.516  92.477  1.00 79.65  ? -63 DC  J O2    1 
ATOM 9317  N N3    . DC  J 6 11  ? 95.366  74.392  92.382  1.00 79.65  ? -63 DC  J N3    1 
ATOM 9318  C C4    . DC  J 6 11  ? 96.126  75.486  92.379  1.00 79.65  ? -63 DC  J C4    1 
ATOM 9319  N N4    . DC  J 6 11  ? 97.448  75.335  92.292  1.00 79.65  ? -63 DC  J N4    1 
ATOM 9320  C C5    . DC  J 6 11  ? 95.567  76.785  92.477  1.00 79.65  ? -63 DC  J C5    1 
ATOM 9321  C C6    . DC  J 6 11  ? 94.244  76.884  92.554  1.00 79.65  ? -63 DC  J C6    1 
ATOM 9322  P P     . DC  J 6 12  ? 88.287  76.121  94.999  1.00 81.17  ? -62 DC  J P     1 
ATOM 9323  O OP1   . DC  J 6 12  ? 86.929  76.605  94.677  1.00 81.17  ? -62 DC  J OP1   1 
ATOM 9324  O OP2   . DC  J 6 12  ? 89.034  76.730  96.117  1.00 81.17  ? -62 DC  J OP2   1 
ATOM 9325  O "O5'" . DC  J 6 12  ? 88.211  74.541  95.244  1.00 81.17  ? -62 DC  J "O5'" 1 
ATOM 9326  C "C5'" . DC  J 6 12  ? 89.050  73.921  96.215  1.00 81.17  ? -62 DC  J "C5'" 1 
ATOM 9327  C "C4'" . DC  J 6 12  ? 89.244  72.451  95.890  1.00 81.17  ? -62 DC  J "C4'" 1 
ATOM 9328  O "O4'" . DC  J 6 12  ? 90.497  72.281  95.182  1.00 81.17  ? -62 DC  J "O4'" 1 
ATOM 9329  C "C3'" . DC  J 6 12  ? 89.358  71.534  97.094  1.00 81.17  ? -62 DC  J "C3'" 1 
ATOM 9330  O "O3'" . DC  J 6 12  ? 89.030  70.209  96.712  1.00 81.17  ? -62 DC  J "O3'" 1 
ATOM 9331  C "C2'" . DC  J 6 12  ? 90.835  71.655  97.416  1.00 81.17  ? -62 DC  J "C2'" 1 
ATOM 9332  C "C1'" . DC  J 6 12  ? 91.426  71.619  96.017  1.00 81.17  ? -62 DC  J "C1'" 1 
ATOM 9333  N N1    . DC  J 6 12  ? 92.705  72.319  95.915  1.00 81.17  ? -62 DC  J N1    1 
ATOM 9334  C C2    . DC  J 6 12  ? 93.883  71.586  95.820  1.00 81.17  ? -62 DC  J C2    1 
ATOM 9335  O O2    . DC  J 6 12  ? 93.828  70.355  95.837  1.00 81.17  ? -62 DC  J O2    1 
ATOM 9336  N N3    . DC  J 6 12  ? 95.058  72.245  95.732  1.00 81.17  ? -62 DC  J N3    1 
ATOM 9337  C C4    . DC  J 6 12  ? 95.073  73.575  95.722  1.00 81.17  ? -62 DC  J C4    1 
ATOM 9338  N N4    . DC  J 6 12  ? 96.254  74.186  95.628  1.00 81.17  ? -62 DC  J N4    1 
ATOM 9339  C C5    . DC  J 6 12  ? 93.877  74.342  95.817  1.00 81.17  ? -62 DC  J C5    1 
ATOM 9340  C C6    . DC  J 6 12  ? 92.726  73.677  95.903  1.00 81.17  ? -62 DC  J C6    1 
ATOM 9341  P P     . DG  J 6 13  ? 88.345  69.207  97.764  1.00 82.48  ? -61 DG  J P     1 
ATOM 9342  O OP1   . DG  J 6 13  ? 87.349  68.397  97.031  1.00 82.48  ? -61 DG  J OP1   1 
ATOM 9343  O OP2   . DG  J 6 13  ? 87.921  70.010  98.927  1.00 82.48  ? -61 DG  J OP2   1 
ATOM 9344  O "O5'" . DG  J 6 13  ? 89.544  68.265  98.242  1.00 82.48  ? -61 DG  J "O5'" 1 
ATOM 9345  C "C5'" . DG  J 6 13  ? 90.629  67.995  97.365  1.00 82.48  ? -61 DG  J "C5'" 1 
ATOM 9346  C "C4'" . DG  J 6 13  ? 91.560  66.947  97.946  1.00 82.48  ? -61 DG  J "C4'" 1 
ATOM 9347  O "O4'" . DG  J 6 13  ? 92.933  67.390  97.792  1.00 82.48  ? -61 DG  J "O4'" 1 
ATOM 9348  C "C3'" . DG  J 6 13  ? 91.403  66.694  99.434  1.00 82.48  ? -61 DG  J "C3'" 1 
ATOM 9349  O "O3'" . DG  J 6 13  ? 91.920  65.409  99.745  1.00 82.48  ? -61 DG  J "O3'" 1 
ATOM 9350  C "C2'" . DG  J 6 13  ? 92.287  67.785  100.005 1.00 82.48  ? -61 DG  J "C2'" 1 
ATOM 9351  C "C1'" . DG  J 6 13  ? 93.475  67.689  99.064  1.00 82.48  ? -61 DG  J "C1'" 1 
ATOM 9352  N N9    . DG  J 6 13  ? 94.222  68.925  98.955  1.00 82.48  ? -61 DG  J N9    1 
ATOM 9353  C C8    . DG  J 6 13  ? 93.706  70.192  98.912  1.00 82.48  ? -61 DG  J C8    1 
ATOM 9354  N N7    . DG  J 6 13  ? 94.614  71.114  98.808  1.00 82.48  ? -61 DG  J N7    1 
ATOM 9355  C C5    . DG  J 6 13  ? 95.806  70.412  98.765  1.00 82.48  ? -61 DG  J C5    1 
ATOM 9356  C C6    . DG  J 6 13  ? 97.129  70.885  98.661  1.00 82.48  ? -61 DG  J C6    1 
ATOM 9357  O O6    . DG  J 6 13  ? 97.511  72.056  98.575  1.00 82.48  ? -61 DG  J O6    1 
ATOM 9358  N N1    . DG  J 6 13  ? 98.051  69.847  98.673  1.00 82.48  ? -61 DG  J N1    1 
ATOM 9359  C C2    . DG  J 6 13  ? 97.735  68.516  98.768  1.00 82.48  ? -61 DG  J C2    1 
ATOM 9360  N N2    . DG  J 6 13  ? 98.765  67.661  98.757  1.00 82.48  ? -61 DG  J N2    1 
ATOM 9361  N N3    . DG  J 6 13  ? 96.494  68.057  98.872  1.00 82.48  ? -61 DG  J N3    1 
ATOM 9362  C C4    . DG  J 6 13  ? 95.584  69.063  98.861  1.00 82.48  ? -61 DG  J C4    1 
ATOM 9363  P P     . DG  J 6 14  ? 91.565  64.693  101.139 1.00 82.08  ? -60 DG  J P     1 
ATOM 9364  O OP1   . DG  J 6 14  ? 90.911  63.411  100.801 1.00 82.08  ? -60 DG  J OP1   1 
ATOM 9365  O OP2   . DG  J 6 14  ? 90.875  65.654  102.027 1.00 82.08  ? -60 DG  J OP2   1 
ATOM 9366  O "O5'" . DG  J 6 14  ? 92.994  64.382  101.783 1.00 82.08  ? -60 DG  J "O5'" 1 
ATOM 9367  C "C5'" . DG  J 6 14  ? 93.460  63.039  101.865 1.00 82.08  ? -60 DG  J "C5'" 1 
ATOM 9368  C "C4'" . DG  J 6 14  ? 94.974  62.987  101.978 1.00 82.08  ? -60 DG  J "C4'" 1 
ATOM 9369  O "O4'" . DG  J 6 14  ? 95.543  64.227  101.481 1.00 82.08  ? -60 DG  J "O4'" 1 
ATOM 9370  C "C3'" . DG  J 6 14  ? 95.515  62.852  103.392 1.00 82.08  ? -60 DG  J "C3'" 1 
ATOM 9371  O "O3'" . DG  J 6 14  ? 96.806  62.273  103.330 1.00 82.08  ? -60 DG  J "O3'" 1 
ATOM 9372  C "C2'" . DG  J 6 14  ? 95.597  64.308  103.810 1.00 82.08  ? -60 DG  J "C2'" 1 
ATOM 9373  C "C1'" . DG  J 6 14  ? 96.180  64.909  102.546 1.00 82.08  ? -60 DG  J "C1'" 1 
ATOM 9374  N N9    . DG  J 6 14  ? 95.942  66.341  102.386 1.00 82.08  ? -60 DG  J N9    1 
ATOM 9375  C C8    . DG  J 6 14  ? 94.735  66.990  102.362 1.00 82.08  ? -60 DG  J C8    1 
ATOM 9376  N N7    . DG  J 6 14  ? 94.842  68.277  102.180 1.00 82.08  ? -60 DG  J N7    1 
ATOM 9377  C C5    . DG  J 6 14  ? 96.203  68.489  102.069 1.00 82.08  ? -60 DG  J C5    1 
ATOM 9378  C C6    . DG  J 6 14  ? 96.923  69.682  101.855 1.00 82.08  ? -60 DG  J C6    1 
ATOM 9379  O O6    . DG  J 6 14  ? 96.487  70.831  101.732 1.00 82.08  ? -60 DG  J O6    1 
ATOM 9380  N N1    . DG  J 6 14  ? 98.290  69.453  101.805 1.00 82.08  ? -60 DG  J N1    1 
ATOM 9381  C C2    . DG  J 6 14  ? 98.881  68.221  101.932 1.00 82.08  ? -60 DG  J C2    1 
ATOM 9382  N N2    . DG  J 6 14  ? 100.216 68.184  101.858 1.00 82.08  ? -60 DG  J N2    1 
ATOM 9383  N N3    . DG  J 6 14  ? 98.216  67.100  102.134 1.00 82.08  ? -60 DG  J N3    1 
ATOM 9384  C C4    . DG  J 6 14  ? 96.890  67.307  102.186 1.00 82.08  ? -60 DG  J C4    1 
ATOM 9385  P P     . DT  J 6 15  ? 97.484  61.589  104.617 1.00 77.41  ? -59 DT  J P     1 
ATOM 9386  O OP1   . DT  J 6 15  ? 97.380  60.128  104.427 1.00 77.41  ? -59 DT  J OP1   1 
ATOM 9387  O OP2   . DT  J 6 15  ? 96.971  62.205  105.860 1.00 77.41  ? -59 DT  J OP2   1 
ATOM 9388  O "O5'" . DT  J 6 15  ? 99.019  62.005  104.480 1.00 77.41  ? -59 DT  J "O5'" 1 
ATOM 9389  C "C5'" . DT  J 6 15  ? 99.356  63.292  103.988 1.00 77.41  ? -59 DT  J "C5'" 1 
ATOM 9390  C "C4'" . DT  J 6 15  ? 100.633 63.788  104.628 1.00 77.41  ? -59 DT  J "C4'" 1 
ATOM 9391  O "O4'" . DT  J 6 15  ? 100.688 65.230  104.526 1.00 77.41  ? -59 DT  J "O4'" 1 
ATOM 9392  C "C3'" . DT  J 6 15  ? 100.732 63.534  106.114 1.00 77.41  ? -59 DT  J "C3'" 1 
ATOM 9393  O "O3'" . DT  J 6 15  ? 102.062 63.748  106.504 1.00 77.41  ? -59 DT  J "O3'" 1 
ATOM 9394  C "C2'" . DT  J 6 15  ? 99.846  64.647  106.637 1.00 77.41  ? -59 DT  J "C2'" 1 
ATOM 9395  C "C1'" . DT  J 6 15  ? 100.373 65.794  105.789 1.00 77.41  ? -59 DT  J "C1'" 1 
ATOM 9396  N N1    . DT  J 6 15  ? 99.420  66.890  105.568 1.00 77.41  ? -59 DT  J N1    1 
ATOM 9397  C C2    . DT  J 6 15  ? 99.914  68.097  105.176 1.00 77.41  ? -59 DT  J C2    1 
ATOM 9398  O O2    . DT  J 6 15  ? 101.102 68.309  105.021 1.00 77.41  ? -59 DT  J O2    1 
ATOM 9399  N N3    . DT  J 6 15  ? 98.979  69.061  104.977 1.00 77.41  ? -59 DT  J N3    1 
ATOM 9400  C C4    . DT  J 6 15  ? 97.620  68.941  105.116 1.00 77.41  ? -59 DT  J C4    1 
ATOM 9401  O O4    . DT  J 6 15  ? 96.860  69.877  104.917 1.00 77.41  ? -59 DT  J O4    1 
ATOM 9402  C C5    . DT  J 6 15  ? 97.155  67.647  105.528 1.00 77.41  ? -59 DT  J C5    1 
ATOM 9403  C C7    . DT  J 6 15  ? 95.691  67.411  105.723 1.00 77.41  ? -59 DT  J C7    1 
ATOM 9404  C C6    . DT  J 6 15  ? 98.066  66.684  105.729 1.00 77.41  ? -59 DT  J C6    1 
ATOM 9405  P P     . DG  J 6 16  ? 102.681 62.993  107.773 1.00 72.49  ? -58 DG  J P     1 
ATOM 9406  O OP1   . DG  J 6 16  ? 102.903 61.588  107.373 1.00 72.49  ? -58 DG  J OP1   1 
ATOM 9407  O OP2   . DG  J 6 16  ? 101.846 63.302  108.952 1.00 72.49  ? -58 DG  J OP2   1 
ATOM 9408  O "O5'" . DG  J 6 16  ? 104.089 63.718  107.965 1.00 72.49  ? -58 DG  J "O5'" 1 
ATOM 9409  C "C5'" . DG  J 6 16  ? 104.354 64.928  107.258 1.00 72.49  ? -58 DG  J "C5'" 1 
ATOM 9410  C "C4'" . DG  J 6 16  ? 104.667 66.055  108.219 1.00 72.49  ? -58 DG  J "C4'" 1 
ATOM 9411  O "O4'" . DG  J 6 16  ? 103.729 67.149  108.024 1.00 72.49  ? -58 DG  J "O4'" 1 
ATOM 9412  C "C3'" . DG  J 6 16  ? 104.564 65.681  109.695 1.00 72.49  ? -58 DG  J "C3'" 1 
ATOM 9413  O "O3'" . DG  J 6 16  ? 105.487 66.447  110.451 1.00 72.49  ? -58 DG  J "O3'" 1 
ATOM 9414  C "C2'" . DG  J 6 16  ? 103.138 66.112  110.011 1.00 72.49  ? -58 DG  J "C2'" 1 
ATOM 9415  C "C1'" . DG  J 6 16  ? 103.088 67.423  109.247 1.00 72.49  ? -58 DG  J "C1'" 1 
ATOM 9416  N N9    . DG  J 6 16  ? 101.743 67.906  108.973 1.00 72.49  ? -58 DG  J N9    1 
ATOM 9417  C C8    . DG  J 6 16  ? 100.570 67.213  109.114 1.00 72.49  ? -58 DG  J C8    1 
ATOM 9418  N N7    . DG  J 6 16  ? 99.518  67.907  108.793 1.00 72.49  ? -58 DG  J N7    1 
ATOM 9419  C C5    . DG  J 6 16  ? 100.028 69.140  108.416 1.00 72.49  ? -58 DG  J C5    1 
ATOM 9420  C C6    . DG  J 6 16  ? 99.361  70.301  107.963 1.00 72.49  ? -58 DG  J C6    1 
ATOM 9421  O O6    . DG  J 6 16  ? 98.149  70.471  107.803 1.00 72.49  ? -58 DG  J O6    1 
ATOM 9422  N N1    . DG  J 6 16  ? 100.248 71.335  107.682 1.00 72.49  ? -58 DG  J N1    1 
ATOM 9423  C C2    . DG  J 6 16  ? 101.608 71.256  107.824 1.00 72.49  ? -58 DG  J C2    1 
ATOM 9424  N N2    . DG  J 6 16  ? 102.302 72.357  107.499 1.00 72.49  ? -58 DG  J N2    1 
ATOM 9425  N N3    . DG  J 6 16  ? 102.248 70.169  108.242 1.00 72.49  ? -58 DG  J N3    1 
ATOM 9426  C C4    . DG  J 6 16  ? 101.395 69.154  108.517 1.00 72.49  ? -58 DG  J C4    1 
ATOM 9427  P P     . DC  J 6 17  ? 107.033 66.026  110.612 1.00 70.53  ? -57 DC  J P     1 
ATOM 9428  O OP1   . DC  J 6 17  ? 107.519 65.237  109.462 1.00 70.53  ? -57 DC  J OP1   1 
ATOM 9429  O OP2   . DC  J 6 17  ? 107.202 65.460  111.965 1.00 70.53  ? -57 DC  J OP2   1 
ATOM 9430  O "O5'" . DC  J 6 17  ? 107.757 67.445  110.602 1.00 70.53  ? -57 DC  J "O5'" 1 
ATOM 9431  C "C5'" . DC  J 6 17  ? 107.099 68.557  109.990 1.00 70.53  ? -57 DC  J "C5'" 1 
ATOM 9432  C "C4'" . DC  J 6 17  ? 106.690 69.587  111.027 1.00 70.53  ? -57 DC  J "C4'" 1 
ATOM 9433  O "O4'" . DC  J 6 17  ? 105.259 69.847  110.947 1.00 70.53  ? -57 DC  J "O4'" 1 
ATOM 9434  C "C3'" . DC  J 6 17  ? 106.950 69.182  112.476 1.00 70.53  ? -57 DC  J "C3'" 1 
ATOM 9435  O "O3'" . DC  J 6 17  ? 107.380 70.303  113.205 1.00 70.53  ? -57 DC  J "O3'" 1 
ATOM 9436  C "C2'" . DC  J 6 17  ? 105.570 68.738  112.933 1.00 70.53  ? -57 DC  J "C2'" 1 
ATOM 9437  C "C1'" . DC  J 6 17  ? 104.730 69.792  112.250 1.00 70.53  ? -57 DC  J "C1'" 1 
ATOM 9438  N N1    . DC  J 6 17  ? 103.278 69.471  112.184 1.00 70.53  ? -57 DC  J N1    1 
ATOM 9439  C C2    . DC  J 6 17  ? 102.401 70.358  111.557 1.00 70.53  ? -57 DC  J C2    1 
ATOM 9440  O O2    . DC  J 6 17  ? 102.840 71.398  111.063 1.00 70.53  ? -57 DC  J O2    1 
ATOM 9441  N N3    . DC  J 6 17  ? 101.084 70.057  111.512 1.00 70.53  ? -57 DC  J N3    1 
ATOM 9442  C C4    . DC  J 6 17  ? 100.641 68.929  112.054 1.00 70.53  ? -57 DC  J C4    1 
ATOM 9443  N N4    . DC  J 6 17  ? 99.333  68.673  111.979 1.00 70.53  ? -57 DC  J N4    1 
ATOM 9444  C C5    . DC  J 6 17  ? 101.516 68.015  112.703 1.00 70.53  ? -57 DC  J C5    1 
ATOM 9445  C C6    . DC  J 6 17  ? 102.812 68.328  112.754 1.00 70.53  ? -57 DC  J C6    1 
ATOM 9446  P P     . DC  J 6 18  ? 108.937 70.498  113.525 1.00 64.52  ? -56 DC  J P     1 
ATOM 9447  O OP1   . DC  J 6 18  ? 109.670 69.547  112.666 1.00 64.52  ? -56 DC  J OP1   1 
ATOM 9448  O OP2   . DC  J 6 18  ? 109.094 70.446  114.992 1.00 64.52  ? -56 DC  J OP2   1 
ATOM 9449  O "O5'" . DC  J 6 18  ? 109.248 71.997  113.059 1.00 64.52  ? -56 DC  J "O5'" 1 
ATOM 9450  C "C5'" . DC  J 6 18  ? 108.347 72.675  112.195 1.00 64.52  ? -56 DC  J "C5'" 1 
ATOM 9451  C "C4'" . DC  J 6 18  ? 107.434 73.606  112.977 1.00 64.52  ? -56 DC  J "C4'" 1 
ATOM 9452  O "O4'" . DC  J 6 18  ? 106.148 72.968  113.218 1.00 64.52  ? -56 DC  J "O4'" 1 
ATOM 9453  C "C3'" . DC  J 6 18  ? 107.959 74.013  114.346 1.00 64.52  ? -56 DC  J "C3'" 1 
ATOM 9454  O "O3'" . DC  J 6 18  ? 107.726 75.379  114.544 1.00 64.52  ? -56 DC  J "O3'" 1 
ATOM 9455  C "C2'" . DC  J 6 18  ? 107.125 73.163  115.297 1.00 64.52  ? -56 DC  J "C2'" 1 
ATOM 9456  C "C1'" . DC  J 6 18  ? 105.801 73.156  114.569 1.00 64.52  ? -56 DC  J "C1'" 1 
ATOM 9457  N N1    . DC  J 6 18  ? 104.887 72.065  114.982 1.00 64.52  ? -56 DC  J N1    1 
ATOM 9458  C C2    . DC  J 6 18  ? 103.540 72.134  114.633 1.00 64.52  ? -56 DC  J C2    1 
ATOM 9459  O O2    . DC  J 6 18  ? 103.134 73.102  113.992 1.00 64.52  ? -56 DC  J O2    1 
ATOM 9460  N N3    . DC  J 6 18  ? 102.714 71.135  115.004 1.00 64.52  ? -56 DC  J N3    1 
ATOM 9461  C C4    . DC  J 6 18  ? 103.187 70.103  115.699 1.00 64.52  ? -56 DC  J C4    1 
ATOM 9462  N N4    . DC  J 6 18  ? 102.329 69.138  116.037 1.00 64.52  ? -56 DC  J N4    1 
ATOM 9463  C C5    . DC  J 6 18  ? 104.558 70.014  116.073 1.00 64.52  ? -56 DC  J C5    1 
ATOM 9464  C C6    . DC  J 6 18  ? 105.365 71.008  115.694 1.00 64.52  ? -56 DC  J C6    1 
ATOM 9465  P P     . DG  J 6 19  ? 108.965 76.390  114.533 1.00 55.03  ? -55 DG  J P     1 
ATOM 9466  O OP1   . DG  J 6 19  ? 109.645 76.235  113.230 1.00 55.03  ? -55 DG  J OP1   1 
ATOM 9467  O OP2   . DG  J 6 19  ? 109.718 76.186  115.782 1.00 55.03  ? -55 DG  J OP2   1 
ATOM 9468  O "O5'" . DG  J 6 19  ? 108.291 77.830  114.634 1.00 55.03  ? -55 DG  J "O5'" 1 
ATOM 9469  C "C5'" . DG  J 6 19  ? 107.417 78.285  113.611 1.00 55.03  ? -55 DG  J "C5'" 1 
ATOM 9470  C "C4'" . DG  J 6 19  ? 106.036 78.619  114.155 1.00 55.03  ? -55 DG  J "C4'" 1 
ATOM 9471  O "O4'" . DG  J 6 19  ? 105.432 77.432  114.718 1.00 55.03  ? -55 DG  J "O4'" 1 
ATOM 9472  C "C3'" . DG  J 6 19  ? 105.978 79.672  115.260 1.00 55.03  ? -55 DG  J "C3'" 1 
ATOM 9473  O "O3'" . DG  J 6 19  ? 104.779 80.397  115.119 1.00 55.03  ? -55 DG  J "O3'" 1 
ATOM 9474  C "C2'" . DG  J 6 19  ? 105.936 78.817  116.518 1.00 55.03  ? -55 DG  J "C2'" 1 
ATOM 9475  C "C1'" . DG  J 6 19  ? 105.031 77.704  116.046 1.00 55.03  ? -55 DG  J "C1'" 1 
ATOM 9476  N N9    . DG  J 6 19  ? 105.153 76.479  116.812 1.00 55.03  ? -55 DG  J N9    1 
ATOM 9477  C C8    . DG  J 6 19  ? 106.299 75.931  117.325 1.00 55.03  ? -55 DG  J C8    1 
ATOM 9478  N N7    . DG  J 6 19  ? 106.096 74.812  117.955 1.00 55.03  ? -55 DG  J N7    1 
ATOM 9479  C C5    . DG  J 6 19  ? 104.738 74.597  117.823 1.00 55.03  ? -55 DG  J C5    1 
ATOM 9480  C C6    . DG  J 6 19  ? 103.946 73.551  118.303 1.00 55.03  ? -55 DG  J C6    1 
ATOM 9481  O O6    . DG  J 6 19  ? 104.299 72.561  118.942 1.00 55.03  ? -55 DG  J O6    1 
ATOM 9482  N N1    . DG  J 6 19  ? 102.615 73.723  117.971 1.00 55.03  ? -55 DG  J N1    1 
ATOM 9483  C C2    . DG  J 6 19  ? 102.115 74.777  117.259 1.00 55.03  ? -55 DG  J C2    1 
ATOM 9484  N N2    . DG  J 6 19  ? 100.802 74.770  117.033 1.00 55.03  ? -55 DG  J N2    1 
ATOM 9485  N N3    . DG  J 6 19  ? 102.848 75.773  116.811 1.00 55.03  ? -55 DG  J N3    1 
ATOM 9486  C C4    . DG  J 6 19  ? 104.146 75.615  117.128 1.00 55.03  ? -55 DG  J C4    1 
ATOM 9487  P P     . DA  J 6 20  ? 104.579 81.829  115.813 1.00 53.63  ? -54 DA  J P     1 
ATOM 9488  O OP1   . DA  J 6 20  ? 104.756 82.843  114.757 1.00 53.63  ? -54 DA  J OP1   1 
ATOM 9489  O OP2   . DA  J 6 20  ? 105.338 81.932  117.074 1.00 53.63  ? -54 DA  J OP2   1 
ATOM 9490  O "O5'" . DA  J 6 20  ? 103.051 81.813  116.235 1.00 53.63  ? -54 DA  J "O5'" 1 
ATOM 9491  C "C5'" . DA  J 6 20  ? 102.049 81.588  115.264 1.00 53.63  ? -54 DA  J "C5'" 1 
ATOM 9492  C "C4'" . DA  J 6 20  ? 100.710 81.279  115.916 1.00 53.63  ? -54 DA  J "C4'" 1 
ATOM 9493  O "O4'" . DA  J 6 20  ? 100.737 79.950  116.482 1.00 53.63  ? -54 DA  J "O4'" 1 
ATOM 9494  C "C3'" . DA  J 6 20  ? 100.294 82.215  117.040 1.00 53.63  ? -54 DA  J "C3'" 1 
ATOM 9495  O "O3'" . DA  J 6 20  ? 98.908  82.461  116.974 1.00 53.63  ? -54 DA  J "O3'" 1 
ATOM 9496  C "C2'" . DA  J 6 20  ? 100.665 81.458  118.309 1.00 53.63  ? -54 DA  J "C2'" 1 
ATOM 9497  C "C1'" . DA  J 6 20  ? 100.599 79.997  117.887 1.00 53.63  ? -54 DA  J "C1'" 1 
ATOM 9498  N N9    . DA  J 6 20  ? 101.670 79.197  118.463 1.00 53.63  ? -54 DA  J N9    1 
ATOM 9499  C C8    . DA  J 6 20  ? 103.002 79.480  118.436 1.00 53.63  ? -54 DA  J C8    1 
ATOM 9500  N N7    . DA  J 6 20  ? 103.743 78.586  119.036 1.00 53.63  ? -54 DA  J N7    1 
ATOM 9501  C C5    . DA  J 6 20  ? 102.839 77.649  119.475 1.00 53.63  ? -54 DA  J C5    1 
ATOM 9502  C C6    . DA  J 6 20  ? 102.997 76.452  120.180 1.00 53.63  ? -54 DA  J C6    1 
ATOM 9503  N N6    . DA  J 6 20  ? 104.182 75.992  120.580 1.00 53.63  ? -54 DA  J N6    1 
ATOM 9504  N N1    . DA  J 6 20  ? 101.889 75.748  120.472 1.00 53.63  ? -54 DA  J N1    1 
ATOM 9505  C C2    . DA  J 6 20  ? 100.700 76.214  120.074 1.00 53.63  ? -54 DA  J C2    1 
ATOM 9506  N N3    . DA  J 6 20  ? 100.427 77.332  119.407 1.00 53.63  ? -54 DA  J N3    1 
ATOM 9507  C C4    . DA  J 6 20  ? 101.553 78.007  119.132 1.00 53.63  ? -54 DA  J C4    1 
ATOM 9508  P P     . DG  J 6 21  ? 98.225  83.479  118.008 1.00 53.85  ? -53 DG  J P     1 
ATOM 9509  O OP1   . DG  J 6 21  ? 97.063  84.067  117.325 1.00 53.85  ? -53 DG  J OP1   1 
ATOM 9510  O OP2   . DG  J 6 21  ? 99.263  84.370  118.568 1.00 53.85  ? -53 DG  J OP2   1 
ATOM 9511  O "O5'" . DG  J 6 21  ? 97.669  82.532  119.156 1.00 53.85  ? -53 DG  J "O5'" 1 
ATOM 9512  C "C5'" . DG  J 6 21  ? 96.796  81.485  118.820 1.00 53.85  ? -53 DG  J "C5'" 1 
ATOM 9513  C "C4'" . DG  J 6 21  ? 96.588  80.578  120.004 1.00 53.85  ? -53 DG  J "C4'" 1 
ATOM 9514  O "O4'" . DG  J 6 21  ? 97.792  79.815  120.253 1.00 53.85  ? -53 DG  J "O4'" 1 
ATOM 9515  C "C3'" . DG  J 6 21  ? 96.261  81.303  121.306 1.00 53.85  ? -53 DG  J "C3'" 1 
ATOM 9516  O "O3'" . DG  J 6 21  ? 95.060  80.782  121.832 1.00 53.85  ? -53 DG  J "O3'" 1 
ATOM 9517  C "C2'" . DG  J 6 21  ? 97.462  80.998  122.213 1.00 53.85  ? -53 DG  J "C2'" 1 
ATOM 9518  C "C1'" . DG  J 6 21  ? 97.969  79.689  121.638 1.00 53.85  ? -53 DG  J "C1'" 1 
ATOM 9519  N N9    . DG  J 6 21  ? 99.384  79.435  121.895 1.00 53.85  ? -53 DG  J N9    1 
ATOM 9520  C C8    . DG  J 6 21  ? 100.440 80.197  121.478 1.00 53.85  ? -53 DG  J C8    1 
ATOM 9521  N N7    . DG  J 6 21  ? 101.598 79.730  121.834 1.00 53.85  ? -53 DG  J N7    1 
ATOM 9522  C C5    . DG  J 6 21  ? 101.294 78.581  122.541 1.00 53.85  ? -53 DG  J C5    1 
ATOM 9523  C C6    . DG  J 6 21  ? 102.151 77.657  123.173 1.00 53.85  ? -53 DG  J C6    1 
ATOM 9524  O O6    . DG  J 6 21  ? 103.383 77.680  123.230 1.00 53.85  ? -53 DG  J O6    1 
ATOM 9525  N N1    . DG  J 6 21  ? 101.444 76.627  123.782 1.00 53.85  ? -53 DG  J N1    1 
ATOM 9526  C C2    . DG  J 6 21  ? 100.076 76.501  123.774 1.00 53.85  ? -53 DG  J C2    1 
ATOM 9527  N N2    . DG  J 6 21  ? 99.570  75.438  124.420 1.00 53.85  ? -53 DG  J N2    1 
ATOM 9528  N N3    . DG  J 6 21  ? 99.254  77.369  123.186 1.00 53.85  ? -53 DG  J N3    1 
ATOM 9529  C C4    . DG  J 6 21  ? 99.934  78.380  122.588 1.00 53.85  ? -53 DG  J C4    1 
ATOM 9530  P P     . DG  J 6 22  ? 94.300  81.519  123.038 1.00 53.20  ? -52 DG  J P     1 
ATOM 9531  O OP1   . DG  J 6 22  ? 92.862  81.516  122.697 1.00 53.20  ? -52 DG  J OP1   1 
ATOM 9532  O OP2   . DG  J 6 22  ? 94.979  82.796  123.333 1.00 53.20  ? -52 DG  J OP2   1 
ATOM 9533  O "O5'" . DG  J 6 22  ? 94.530  80.537  124.274 1.00 53.20  ? -52 DG  J "O5'" 1 
ATOM 9534  C "C5'" . DG  J 6 22  ? 94.144  79.186  124.161 1.00 53.20  ? -52 DG  J "C5'" 1 
ATOM 9535  C "C4'" . DG  J 6 22  ? 94.815  78.339  125.220 1.00 53.20  ? -52 DG  J "C4'" 1 
ATOM 9536  O "O4'" . DG  J 6 22  ? 96.244  78.296  124.994 1.00 53.20  ? -52 DG  J "O4'" 1 
ATOM 9537  C "C3'" . DG  J 6 22  ? 94.630  78.825  126.658 1.00 53.20  ? -52 DG  J "C3'" 1 
ATOM 9538  O "O3'" . DG  J 6 22  ? 94.220  77.735  127.451 1.00 53.20  ? -52 DG  J "O3'" 1 
ATOM 9539  C "C2'" . DG  J 6 22  ? 96.030  79.301  127.049 1.00 53.20  ? -52 DG  J "C2'" 1 
ATOM 9540  C "C1'" . DG  J 6 22  ? 96.884  78.360  126.236 1.00 53.20  ? -52 DG  J "C1'" 1 
ATOM 9541  N N9    . DG  J 6 22  ? 98.239  78.823  126.026 1.00 53.20  ? -52 DG  J N9    1 
ATOM 9542  C C8    . DG  J 6 22  ? 98.630  79.928  125.329 1.00 53.20  ? -52 DG  J C8    1 
ATOM 9543  N N7    . DG  J 6 22  ? 99.918  80.086  125.295 1.00 53.20  ? -52 DG  J N7    1 
ATOM 9544  C C5    . DG  J 6 22  ? 100.410 79.010  126.014 1.00 53.20  ? -52 DG  J C5    1 
ATOM 9545  C C6    . DG  J 6 22  ? 101.738 78.653  126.318 1.00 53.20  ? -52 DG  J C6    1 
ATOM 9546  O O6    . DG  J 6 22  ? 102.775 79.233  125.993 1.00 53.20  ? -52 DG  J O6    1 
ATOM 9547  N N1    . DG  J 6 22  ? 101.802 77.488  127.064 1.00 53.20  ? -52 DG  J N1    1 
ATOM 9548  C C2    . DG  J 6 22  ? 100.715 76.764  127.475 1.00 53.20  ? -52 DG  J C2    1 
ATOM 9549  N N2    . DG  J 6 22  ? 100.968 75.663  128.196 1.00 53.20  ? -52 DG  J N2    1 
ATOM 9550  N N3    . DG  J 6 22  ? 99.462  77.090  127.196 1.00 53.20  ? -52 DG  J N3    1 
ATOM 9551  C C4    . DG  J 6 22  ? 99.388  78.223  126.466 1.00 53.20  ? -52 DG  J C4    1 
ATOM 9552  P P     . DC  J 6 23  ? 93.369  77.961  128.792 1.00 57.42  ? -51 DC  J P     1 
ATOM 9553  O OP1   . DC  J 6 23  ? 91.989  77.511  128.513 1.00 57.42  ? -51 DC  J OP1   1 
ATOM 9554  O OP2   . DC  J 6 23  ? 93.606  79.337  129.276 1.00 57.42  ? -51 DC  J OP2   1 
ATOM 9555  O "O5'" . DC  J 6 23  ? 94.051  76.942  129.813 1.00 57.42  ? -51 DC  J "O5'" 1 
ATOM 9556  C "C5'" . DC  J 6 23  ? 95.237  76.271  129.422 1.00 57.42  ? -51 DC  J "C5'" 1 
ATOM 9557  C "C4'" . DC  J 6 23  ? 95.882  75.554  130.587 1.00 57.42  ? -51 DC  J "C4'" 1 
ATOM 9558  O "O4'" . DC  J 6 23  ? 97.315  75.730  130.504 1.00 57.42  ? -51 DC  J "O4'" 1 
ATOM 9559  C "C3'" . DC  J 6 23  ? 95.522  76.081  131.964 1.00 57.42  ? -51 DC  J "C3'" 1 
ATOM 9560  O "O3'" . DC  J 6 23  ? 95.865  75.093  132.935 1.00 57.42  ? -51 DC  J "O3'" 1 
ATOM 9561  C "C2'" . DC  J 6 23  ? 96.453  77.273  132.053 1.00 57.42  ? -51 DC  J "C2'" 1 
ATOM 9562  C "C1'" . DC  J 6 23  ? 97.727  76.672  131.477 1.00 57.42  ? -51 DC  J "C1'" 1 
ATOM 9563  N N1    . DC  J 6 23  ? 98.584  77.660  130.823 1.00 57.42  ? -51 DC  J N1    1 
ATOM 9564  C C2    . DC  J 6 23  ? 99.964  77.569  130.962 1.00 57.42  ? -51 DC  J C2    1 
ATOM 9565  O O2    . DC  J 6 23  ? 100.433 76.662  131.652 1.00 57.42  ? -51 DC  J O2    1 
ATOM 9566  N N3    . DC  J 6 23  ? 100.739 78.492  130.359 1.00 57.42  ? -51 DC  J N3    1 
ATOM 9567  C C4    . DC  J 6 23  ? 100.180 79.456  129.632 1.00 57.42  ? -51 DC  J C4    1 
ATOM 9568  N N4    . DC  J 6 23  ? 100.980 80.342  129.043 1.00 57.42  ? -51 DC  J N4    1 
ATOM 9569  C C5    . DC  J 6 23  ? 98.772  79.563  129.482 1.00 57.42  ? -51 DC  J C5    1 
ATOM 9570  C C6    . DC  J 6 23  ? 98.020  78.649  130.084 1.00 57.42  ? -51 DC  J C6    1 
ATOM 9571  P P     . DC  J 6 24  ? 95.344  75.171  134.455 1.00 60.19  ? -50 DC  J P     1 
ATOM 9572  O OP1   . DC  J 6 24  ? 94.358  74.083  134.612 1.00 60.19  ? -50 DC  J OP1   1 
ATOM 9573  O OP2   . DC  J 6 24  ? 94.944  76.551  134.799 1.00 60.19  ? -50 DC  J OP2   1 
ATOM 9574  O "O5'" . DC  J 6 24  ? 96.650  74.807  135.309 1.00 60.19  ? -50 DC  J "O5'" 1 
ATOM 9575  C "C5'" . DC  J 6 24  ? 97.914  74.713  134.655 1.00 60.19  ? -50 DC  J "C5'" 1 
ATOM 9576  C "C4'" . DC  J 6 24  ? 99.047  74.506  135.648 1.00 60.19  ? -50 DC  J "C4'" 1 
ATOM 9577  O "O4'" . DC  J 6 24  ? 100.192 75.306  135.263 1.00 60.19  ? -50 DC  J "O4'" 1 
ATOM 9578  C "C3'" . DC  J 6 24  ? 98.762  74.924  137.072 1.00 60.19  ? -50 DC  J "C3'" 1 
ATOM 9579  O "O3'" . DC  J 6 24  ? 99.643  74.199  137.939 1.00 60.19  ? -50 DC  J "O3'" 1 
ATOM 9580  C "C2'" . DC  J 6 24  ? 99.078  76.423  137.026 1.00 60.19  ? -50 DC  J "C2'" 1 
ATOM 9581  C "C1'" . DC  J 6 24  ? 100.259 76.480  136.061 1.00 60.19  ? -50 DC  J "C1'" 1 
ATOM 9582  N N1    . DC  J 6 24  ? 100.216 77.641  135.140 1.00 60.19  ? -50 DC  J N1    1 
ATOM 9583  C C2    . DC  J 6 24  ? 101.401 78.243  134.726 1.00 60.19  ? -50 DC  J C2    1 
ATOM 9584  O O2    . DC  J 6 24  ? 102.475 77.817  135.161 1.00 60.19  ? -50 DC  J O2    1 
ATOM 9585  N N3    . DC  J 6 24  ? 101.337 79.284  133.865 1.00 60.19  ? -50 DC  J N3    1 
ATOM 9586  C C4    . DC  J 6 24  ? 100.157 79.715  133.429 1.00 60.19  ? -50 DC  J C4    1 
ATOM 9587  N N4    . DC  J 6 24  ? 100.135 80.738  132.580 1.00 60.19  ? -50 DC  J N4    1 
ATOM 9588  C C5    . DC  J 6 24  ? 98.944  79.110  133.834 1.00 60.19  ? -50 DC  J C5    1 
ATOM 9589  C C6    . DC  J 6 24  ? 99.018  78.085  134.676 1.00 60.19  ? -50 DC  J C6    1 
ATOM 9590  P P     . DG  J 6 25  ? 99.837  74.587  139.487 1.00 56.27  ? -49 DG  J P     1 
ATOM 9591  O OP1   . DG  J 6 25  ? 100.307 73.361  140.163 1.00 56.27  ? -49 DG  J OP1   1 
ATOM 9592  O OP2   . DG  J 6 25  ? 98.624  75.258  140.007 1.00 56.27  ? -49 DG  J OP2   1 
ATOM 9593  O "O5'" . DG  J 6 25  ? 101.057 75.617  139.458 1.00 56.27  ? -49 DG  J "O5'" 1 
ATOM 9594  C "C5'" . DG  J 6 25  ? 101.650 76.043  140.660 1.00 56.27  ? -49 DG  J "C5'" 1 
ATOM 9595  C "C4'" . DG  J 6 25  ? 103.100 76.419  140.439 1.00 56.27  ? -49 DG  J "C4'" 1 
ATOM 9596  O "O4'" . DG  J 6 25  ? 103.233 77.127  139.181 1.00 56.27  ? -49 DG  J "O4'" 1 
ATOM 9597  C "C3'" . DG  J 6 25  ? 103.654 77.366  141.474 1.00 56.27  ? -49 DG  J "C3'" 1 
ATOM 9598  O "O3'" . DG  J 6 25  ? 105.056 77.268  141.511 1.00 56.27  ? -49 DG  J "O3'" 1 
ATOM 9599  C "C2'" . DG  J 6 25  ? 103.205 78.707  140.926 1.00 56.27  ? -49 DG  J "C2'" 1 
ATOM 9600  C "C1'" . DG  J 6 25  ? 103.395 78.511  139.427 1.00 56.27  ? -49 DG  J "C1'" 1 
ATOM 9601  N N9    . DG  J 6 25  ? 102.428 79.230  138.599 1.00 56.27  ? -49 DG  J N9    1 
ATOM 9602  C C8    . DG  J 6 25  ? 101.069 79.047  138.565 1.00 56.27  ? -49 DG  J C8    1 
ATOM 9603  N N7    . DG  J 6 25  ? 100.463 79.815  137.704 1.00 56.27  ? -49 DG  J N7    1 
ATOM 9604  C C5    . DG  J 6 25  ? 101.485 80.548  137.126 1.00 56.27  ? -49 DG  J C5    1 
ATOM 9605  C C6    . DG  J 6 25  ? 101.437 81.536  136.122 1.00 56.27  ? -49 DG  J C6    1 
ATOM 9606  O O6    . DG  J 6 25  ? 100.452 81.975  135.532 1.00 56.27  ? -49 DG  J O6    1 
ATOM 9607  N N1    . DG  J 6 25  ? 102.695 82.022  135.816 1.00 56.27  ? -49 DG  J N1    1 
ATOM 9608  C C2    . DG  J 6 25  ? 103.857 81.609  136.407 1.00 56.27  ? -49 DG  J C2    1 
ATOM 9609  N N2    . DG  J 6 25  ? 104.984 82.198  135.980 1.00 56.27  ? -49 DG  J N2    1 
ATOM 9610  N N3    . DG  J 6 25  ? 103.919 80.680  137.349 1.00 56.27  ? -49 DG  J N3    1 
ATOM 9611  C C4    . DG  J 6 25  ? 102.699 80.195  137.658 1.00 56.27  ? -49 DG  J C4    1 
ATOM 9612  P P     . DC  J 6 26  ? 105.851 77.723  142.827 1.00 55.81  ? -48 DC  J P     1 
ATOM 9613  O OP1   . DC  J 6 26  ? 107.139 77.003  142.862 1.00 55.81  ? -48 DC  J OP1   1 
ATOM 9614  O OP2   . DC  J 6 26  ? 104.910 77.620  143.962 1.00 55.81  ? -48 DC  J OP2   1 
ATOM 9615  O "O5'" . DC  J 6 26  ? 106.141 79.269  142.568 1.00 55.81  ? -48 DC  J "O5'" 1 
ATOM 9616  C "C5'" . DC  J 6 26  ? 106.795 79.671  141.371 1.00 55.81  ? -48 DC  J "C5'" 1 
ATOM 9617  C "C4'" . DC  J 6 26  ? 106.737 81.173  141.215 1.00 55.81  ? -48 DC  J "C4'" 1 
ATOM 9618  O "O4'" . DC  J 6 26  ? 105.610 81.532  140.373 1.00 55.81  ? -48 DC  J "O4'" 1 
ATOM 9619  C "C3'" . DC  J 6 26  ? 106.544 81.930  142.526 1.00 55.81  ? -48 DC  J "C3'" 1 
ATOM 9620  O "O3'" . DC  J 6 26  ? 107.467 83.002  142.610 1.00 55.81  ? -48 DC  J "O3'" 1 
ATOM 9621  C "C2'" . DC  J 6 26  ? 105.107 82.427  142.430 1.00 55.81  ? -48 DC  J "C2'" 1 
ATOM 9622  C "C1'" . DC  J 6 26  ? 104.977 82.640  140.944 1.00 55.81  ? -48 DC  J "C1'" 1 
ATOM 9623  N N1    . DC  J 6 26  ? 103.571 82.708  140.472 1.00 55.81  ? -48 DC  J N1    1 
ATOM 9624  C C2    . DC  J 6 26  ? 103.274 83.425  139.323 1.00 55.81  ? -48 DC  J C2    1 
ATOM 9625  O O2    . DC  J 6 26  ? 104.183 83.979  138.711 1.00 55.81  ? -48 DC  J O2    1 
ATOM 9626  N N3    . DC  J 6 26  ? 101.996 83.504  138.910 1.00 55.81  ? -48 DC  J N3    1 
ATOM 9627  C C4    . DC  J 6 26  ? 101.037 82.898  139.601 1.00 55.81  ? -48 DC  J C4    1 
ATOM 9628  N N4    . DC  J 6 26  ? 99.786  83.005  139.151 1.00 55.81  ? -48 DC  J N4    1 
ATOM 9629  C C5    . DC  J 6 26  ? 101.316 82.162  140.783 1.00 55.81  ? -48 DC  J C5    1 
ATOM 9630  C C6    . DC  J 6 26  ? 102.584 82.110  141.186 1.00 55.81  ? -48 DC  J C6    1 
ATOM 9631  P P     . DT  J 6 27  ? 108.724 82.893  143.605 1.00 52.66  ? -47 DT  J P     1 
ATOM 9632  O OP1   . DT  J 6 27  ? 109.729 82.013  142.971 1.00 52.66  ? -47 DT  J OP1   1 
ATOM 9633  O OP2   . DT  J 6 27  ? 108.194 82.573  144.946 1.00 52.66  ? -47 DT  J OP2   1 
ATOM 9634  O "O5'" . DT  J 6 27  ? 109.312 84.375  143.658 1.00 52.66  ? -47 DT  J "O5'" 1 
ATOM 9635  C "C5'" . DT  J 6 27  ? 110.374 84.748  142.794 1.00 52.66  ? -47 DT  J "C5'" 1 
ATOM 9636  C "C4'" . DT  J 6 27  ? 110.028 85.996  141.995 1.00 52.66  ? -47 DT  J "C4'" 1 
ATOM 9637  O "O4'" . DT  J 6 27  ? 108.614 86.014  141.685 1.00 52.66  ? -47 DT  J "O4'" 1 
ATOM 9638  C "C3'" . DT  J 6 27  ? 110.290 87.321  142.689 1.00 52.66  ? -47 DT  J "C3'" 1 
ATOM 9639  O "O3'" . DT  J 6 27  ? 110.548 88.292  141.698 1.00 52.66  ? -47 DT  J "O3'" 1 
ATOM 9640  C "C2'" . DT  J 6 27  ? 108.954 87.581  143.375 1.00 52.66  ? -47 DT  J "C2'" 1 
ATOM 9641  C "C1'" . DT  J 6 27  ? 108.017 87.158  142.267 1.00 52.66  ? -47 DT  J "C1'" 1 
ATOM 9642  N N1    . DT  J 6 27  ? 106.668 86.778  142.699 1.00 52.66  ? -47 DT  J N1    1 
ATOM 9643  C C2    . DT  J 6 27  ? 105.597 87.251  141.992 1.00 52.66  ? -47 DT  J C2    1 
ATOM 9644  O O2    . DT  J 6 27  ? 105.708 88.005  141.042 1.00 52.66  ? -47 DT  J O2    1 
ATOM 9645  N N3    . DT  J 6 27  ? 104.384 86.820  142.430 1.00 52.66  ? -47 DT  J N3    1 
ATOM 9646  C C4    . DT  J 6 27  ? 104.144 85.967  143.487 1.00 52.66  ? -47 DT  J C4    1 
ATOM 9647  O O4    . DT  J 6 27  ? 103.015 85.627  143.797 1.00 52.66  ? -47 DT  J O4    1 
ATOM 9648  C C5    . DT  J 6 27  ? 105.318 85.494  144.180 1.00 52.66  ? -47 DT  J C5    1 
ATOM 9649  C C7    . DT  J 6 27  ? 105.189 84.566  145.348 1.00 52.66  ? -47 DT  J C7    1 
ATOM 9650  C C6    . DT  J 6 27  ? 106.509 85.912  143.752 1.00 52.66  ? -47 DT  J C6    1 
ATOM 9651  P P     . DC  J 6 28  ? 111.371 89.624  142.045 1.00 49.64  ? -46 DC  J P     1 
ATOM 9652  O OP1   . DC  J 6 28  ? 112.641 89.582  141.289 1.00 49.64  ? -46 DC  J OP1   1 
ATOM 9653  O OP2   . DC  J 6 28  ? 111.369 89.804  143.513 1.00 49.64  ? -46 DC  J OP2   1 
ATOM 9654  O "O5'" . DC  J 6 28  ? 110.478 90.772  141.409 1.00 49.64  ? -46 DC  J "O5'" 1 
ATOM 9655  C "C5'" . DC  J 6 28  ? 109.113 90.531  141.160 1.00 49.64  ? -46 DC  J "C5'" 1 
ATOM 9656  C "C4'" . DC  J 6 28  ? 108.412 91.820  140.856 1.00 49.64  ? -46 DC  J "C4'" 1 
ATOM 9657  O "O4'" . DC  J 6 28  ? 107.045 91.728  141.304 1.00 49.64  ? -46 DC  J "O4'" 1 
ATOM 9658  C "C3'" . DC  J 6 28  ? 108.975 92.987  141.618 1.00 49.64  ? -46 DC  J "C3'" 1 
ATOM 9659  O "O3'" . DC  J 6 28  ? 108.550 94.190  141.024 1.00 49.64  ? -46 DC  J "O3'" 1 
ATOM 9660  C "C2'" . DC  J 6 28  ? 108.338 92.770  142.985 1.00 49.64  ? -46 DC  J "C2'" 1 
ATOM 9661  C "C1'" . DC  J 6 28  ? 106.938 92.306  142.590 1.00 49.64  ? -46 DC  J "C1'" 1 
ATOM 9662  N N1    . DC  J 6 28  ? 106.351 91.307  143.497 1.00 49.64  ? -46 DC  J N1    1 
ATOM 9663  C C2    . DC  J 6 28  ? 104.988 91.108  143.465 1.00 49.64  ? -46 DC  J C2    1 
ATOM 9664  O O2    . DC  J 6 28  ? 104.320 91.767  142.681 1.00 49.64  ? -46 DC  J O2    1 
ATOM 9665  N N3    . DC  J 6 28  ? 104.434 90.190  144.277 1.00 49.64  ? -46 DC  J N3    1 
ATOM 9666  C C4    . DC  J 6 28  ? 105.200 89.492  145.101 1.00 49.64  ? -46 DC  J C4    1 
ATOM 9667  N N4    . DC  J 6 28  ? 104.608 88.598  145.893 1.00 49.64  ? -46 DC  J N4    1 
ATOM 9668  C C5    . DC  J 6 28  ? 106.608 89.680  145.155 1.00 49.64  ? -46 DC  J C5    1 
ATOM 9669  C C6    . DC  J 6 28  ? 107.138 90.590  144.337 1.00 49.64  ? -46 DC  J C6    1 
ATOM 9670  P P     . DA  J 6 29  ? 109.541 94.991  140.052 1.00 48.39  ? -45 DA  J P     1 
ATOM 9671  O OP1   . DA  J 6 29  ? 110.287 94.001  139.247 1.00 48.39  ? -45 DA  J OP1   1 
ATOM 9672  O OP2   . DA  J 6 29  ? 110.268 95.979  140.875 1.00 48.39  ? -45 DA  J OP2   1 
ATOM 9673  O "O5'" . DA  J 6 29  ? 108.559 95.778  139.078 1.00 48.39  ? -45 DA  J "O5'" 1 
ATOM 9674  C "C5'" . DA  J 6 29  ? 107.597 95.067  138.330 1.00 48.39  ? -45 DA  J "C5'" 1 
ATOM 9675  C "C4'" . DA  J 6 29  ? 106.188 95.498  138.692 1.00 48.39  ? -45 DA  J "C4'" 1 
ATOM 9676  O "O4'" . DA  J 6 29  ? 105.805 94.914  139.961 1.00 48.39  ? -45 DA  J "O4'" 1 
ATOM 9677  C "C3'" . DA  J 6 29  ? 105.984 97.004  138.849 1.00 48.39  ? -45 DA  J "C3'" 1 
ATOM 9678  O "O3'" . DA  J 6 29  ? 104.757 97.363  138.281 1.00 48.39  ? -45 DA  J "O3'" 1 
ATOM 9679  C "C2'" . DA  J 6 29  ? 105.943 97.179  140.359 1.00 48.39  ? -45 DA  J "C2'" 1 
ATOM 9680  C "C1'" . DA  J 6 29  ? 105.227 95.914  140.756 1.00 48.39  ? -45 DA  J "C1'" 1 
ATOM 9681  N N9    . DA  J 6 29  ? 105.413 95.567  142.152 1.00 48.39  ? -45 DA  J N9    1 
ATOM 9682  C C8    . DA  J 6 29  ? 106.534 95.753  142.900 1.00 48.39  ? -45 DA  J C8    1 
ATOM 9683  N N7    . DA  J 6 29  ? 106.417 95.337  144.134 1.00 48.39  ? -45 DA  J N7    1 
ATOM 9684  C C5    . DA  J 6 29  ? 105.126 94.869  144.199 1.00 48.39  ? -45 DA  J C5    1 
ATOM 9685  C C6    . DA  J 6 29  ? 104.390 94.297  145.234 1.00 48.39  ? -45 DA  J C6    1 
ATOM 9686  N N6    . DA  J 6 29  ? 104.881 94.116  146.458 1.00 48.39  ? -45 DA  J N6    1 
ATOM 9687  N N1    . DA  J 6 29  ? 103.117 93.938  144.975 1.00 48.39  ? -45 DA  J N1    1 
ATOM 9688  C C2    . DA  J 6 29  ? 102.630 94.132  143.749 1.00 48.39  ? -45 DA  J C2    1 
ATOM 9689  N N3    . DA  J 6 29  ? 103.235 94.654  142.691 1.00 48.39  ? -45 DA  J N3    1 
ATOM 9690  C C4    . DA  J 6 29  ? 104.493 94.999  142.986 1.00 48.39  ? -45 DA  J C4    1 
ATOM 9691  P P     . DA  J 6 30  ? 104.461 98.883  137.860 1.00 49.33  ? -44 DA  J P     1 
ATOM 9692  O OP1   . DA  J 6 30  ? 104.477 98.896  136.382 1.00 49.33  ? -44 DA  J OP1   1 
ATOM 9693  O OP2   . DA  J 6 30  ? 105.353 99.810  138.592 1.00 49.33  ? -44 DA  J OP2   1 
ATOM 9694  O "O5'" . DA  J 6 30  ? 102.963 99.118  138.373 1.00 49.33  ? -44 DA  J "O5'" 1 
ATOM 9695  C "C5'" . DA  J 6 30  ? 101.884 98.513  137.676 1.00 49.33  ? -44 DA  J "C5'" 1 
ATOM 9696  C "C4'" . DA  J 6 30  ? 100.829 98.013  138.635 1.00 49.33  ? -44 DA  J "C4'" 1 
ATOM 9697  O "O4'" . DA  J 6 30  ? 101.468 97.450  139.802 1.00 49.33  ? -44 DA  J "O4'" 1 
ATOM 9698  C "C3'" . DA  J 6 30  ? 99.862  99.080  139.145 1.00 49.33  ? -44 DA  J "C3'" 1 
ATOM 9699  O "O3'" . DA  J 6 30  ? 98.526  98.611  138.989 1.00 49.33  ? -44 DA  J "O3'" 1 
ATOM 9700  C "C2'" . DA  J 6 30  ? 100.251 99.242  140.618 1.00 49.33  ? -44 DA  J "C2'" 1 
ATOM 9701  C "C1'" . DA  J 6 30  ? 100.776 97.861  140.946 1.00 49.33  ? -44 DA  J "C1'" 1 
ATOM 9702  N N9    . DA  J 6 30  ? 101.709 97.843  142.056 1.00 49.33  ? -44 DA  J N9    1 
ATOM 9703  C C8    . DA  J 6 30  ? 102.990 98.286  142.042 1.00 49.33  ? -44 DA  J C8    1 
ATOM 9704  N N7    . DA  J 6 30  ? 103.609 98.146  143.183 1.00 49.33  ? -44 DA  J N7    1 
ATOM 9705  C C5    . DA  J 6 30  ? 102.665 97.562  144.000 1.00 49.33  ? -44 DA  J C5    1 
ATOM 9706  C C6    . DA  J 6 30  ? 102.703 97.150  145.335 1.00 49.33  ? -44 DA  J C6    1 
ATOM 9707  N N6    . DA  J 6 30  ? 103.780 97.285  146.102 1.00 49.33  ? -44 DA  J N6    1 
ATOM 9708  N N1    . DA  J 6 30  ? 101.596 96.595  145.855 1.00 49.33  ? -44 DA  J N1    1 
ATOM 9709  C C2    . DA  J 6 30  ? 100.515 96.462  145.083 1.00 49.33  ? -44 DA  J C2    1 
ATOM 9710  N N3    . DA  J 6 30  ? 100.363 96.809  143.807 1.00 49.33  ? -44 DA  J N3    1 
ATOM 9711  C C4    . DA  J 6 30  ? 101.490 97.358  143.322 1.00 49.33  ? -44 DA  J C4    1 
ATOM 9712  P P     . DT  J 6 31  ? 97.271  99.597  139.176 1.00 51.81  ? -43 DT  J P     1 
ATOM 9713  O OP1   . DT  J 6 31  ? 96.108  99.011  138.483 1.00 51.81  ? -43 DT  J OP1   1 
ATOM 9714  O OP2   . DT  J 6 31  ? 97.695  100.969 138.867 1.00 51.81  ? -43 DT  J OP2   1 
ATOM 9715  O "O5'" . DT  J 6 31  ? 96.971  99.524  140.732 1.00 51.81  ? -43 DT  J "O5'" 1 
ATOM 9716  C "C5'" . DT  J 6 31  ? 96.759  98.274  141.346 1.00 51.81  ? -43 DT  J "C5'" 1 
ATOM 9717  C "C4'" . DT  J 6 31  ? 96.441  98.465  142.808 1.00 51.81  ? -43 DT  J "C4'" 1 
ATOM 9718  O "O4'" . DT  J 6 31  ? 97.661  98.381  143.600 1.00 51.81  ? -43 DT  J "O4'" 1 
ATOM 9719  C "C3'" . DT  J 6 31  ? 95.822  99.820  143.140 1.00 51.81  ? -43 DT  J "C3'" 1 
ATOM 9720  O "O3'" . DT  J 6 31  ? 94.716  99.646  143.997 1.00 51.81  ? -43 DT  J "O3'" 1 
ATOM 9721  C "C2'" . DT  J 6 31  ? 96.962  100.541 143.845 1.00 51.81  ? -43 DT  J "C2'" 1 
ATOM 9722  C "C1'" . DT  J 6 31  ? 97.619  99.396  144.565 1.00 51.81  ? -43 DT  J "C1'" 1 
ATOM 9723  N N1    . DT  J 6 31  ? 98.996  99.689  145.036 1.00 51.81  ? -43 DT  J N1    1 
ATOM 9724  C C2    . DT  J 6 31  ? 99.348  99.367  146.330 1.00 51.81  ? -43 DT  J C2    1 
ATOM 9725  O O2    . DT  J 6 31  ? 98.588  98.834  147.112 1.00 51.81  ? -43 DT  J O2    1 
ATOM 9726  N N3    . DT  J 6 31  ? 100.639 99.674  146.665 1.00 51.81  ? -43 DT  J N3    1 
ATOM 9727  C C4    . DT  J 6 31  ? 101.583 100.271 145.857 1.00 51.81  ? -43 DT  J C4    1 
ATOM 9728  O O4    . DT  J 6 31  ? 102.716 100.511 146.247 1.00 51.81  ? -43 DT  J O4    1 
ATOM 9729  C C5    . DT  J 6 31  ? 101.145 100.590 144.519 1.00 51.81  ? -43 DT  J C5    1 
ATOM 9730  C C7    . DT  J 6 31  ? 102.083 101.246 143.562 1.00 51.81  ? -43 DT  J C7    1 
ATOM 9731  C C6    . DT  J 6 31  ? 99.887  100.290 144.178 1.00 51.81  ? -43 DT  J C6    1 
ATOM 9732  P P     . DT  J 6 32  ? 93.577  100.773 144.102 1.00 54.42  ? -42 DT  J P     1 
ATOM 9733  O OP1   . DT  J 6 32  ? 92.557  100.474 143.076 1.00 54.42  ? -42 DT  J OP1   1 
ATOM 9734  O OP2   . DT  J 6 32  ? 94.171  102.121 144.146 1.00 54.42  ? -42 DT  J OP2   1 
ATOM 9735  O "O5'" . DT  J 6 32  ? 92.965  100.519 145.543 1.00 54.42  ? -42 DT  J "O5'" 1 
ATOM 9736  C "C5'" . DT  J 6 32  ? 93.597  99.597  146.410 1.00 54.42  ? -42 DT  J "C5'" 1 
ATOM 9737  C "C4'" . DT  J 6 32  ? 94.000  100.266 147.709 1.00 54.42  ? -42 DT  J "C4'" 1 
ATOM 9738  O "O4'" . DT  J 6 32  ? 95.423  100.480 147.729 1.00 54.42  ? -42 DT  J "O4'" 1 
ATOM 9739  C "C3'" . DT  J 6 32  ? 93.359  101.630 147.972 1.00 54.42  ? -42 DT  J "C3'" 1 
ATOM 9740  O "O3'" . DT  J 6 32  ? 92.583  101.550 149.152 1.00 54.42  ? -42 DT  J "O3'" 1 
ATOM 9741  C "C2'" . DT  J 6 32  ? 94.556  102.590 148.127 1.00 54.42  ? -42 DT  J "C2'" 1 
ATOM 9742  C "C1'" . DT  J 6 32  ? 95.690  101.640 148.461 1.00 54.42  ? -42 DT  J "C1'" 1 
ATOM 9743  N N1    . DT  J 6 32  ? 97.015  102.114 148.049 1.00 54.42  ? -42 DT  J N1    1 
ATOM 9744  C C2    . DT  J 6 32  ? 98.055  102.025 148.929 1.00 54.42  ? -42 DT  J C2    1 
ATOM 9745  O O2    . DT  J 6 32  ? 97.932  101.614 150.065 1.00 54.42  ? -42 DT  J O2    1 
ATOM 9746  N N3    . DT  J 6 32  ? 99.247  102.468 148.443 1.00 54.42  ? -42 DT  J N3    1 
ATOM 9747  C C4    . DT  J 6 32  ? 99.497  102.963 147.187 1.00 54.42  ? -42 DT  J C4    1 
ATOM 9748  O O4    . DT  J 6 32  ? 100.601 103.332 146.837 1.00 54.42  ? -42 DT  J O4    1 
ATOM 9749  C C5    . DT  J 6 32  ? 98.373  103.013 146.309 1.00 54.42  ? -42 DT  J C5    1 
ATOM 9750  C C7    . DT  J 6 32  ? 98.544  103.550 144.922 1.00 54.42  ? -42 DT  J C7    1 
ATOM 9751  C C6    . DT  J 6 32  ? 97.195  102.585 146.772 1.00 54.42  ? -42 DT  J C6    1 
ATOM 9752  P P     . DG  J 6 33  ? 91.710  102.799 149.647 1.00 55.51  ? -41 DG  J P     1 
ATOM 9753  O OP1   . DG  J 6 33  ? 90.521  102.235 150.321 1.00 55.51  ? -41 DG  J OP1   1 
ATOM 9754  O OP2   . DG  J 6 33  ? 91.528  103.740 148.520 1.00 55.51  ? -41 DG  J OP2   1 
ATOM 9755  O "O5'" . DG  J 6 33  ? 92.649  103.491 150.736 1.00 55.51  ? -41 DG  J "O5'" 1 
ATOM 9756  C "C5'" . DG  J 6 33  ? 93.319  102.686 151.694 1.00 55.51  ? -41 DG  J "C5'" 1 
ATOM 9757  C "C4'" . DG  J 6 33  ? 94.242  103.525 152.549 1.00 55.51  ? -41 DG  J "C4'" 1 
ATOM 9758  O "O4'" . DG  J 6 33  ? 95.574  103.525 151.973 1.00 55.51  ? -41 DG  J "O4'" 1 
ATOM 9759  C "C3'" . DG  J 6 33  ? 93.832  104.994 152.680 1.00 55.51  ? -41 DG  J "C3'" 1 
ATOM 9760  O "O3'" . DG  J 6 33  ? 93.920  105.416 154.038 1.00 55.51  ? -41 DG  J "O3'" 1 
ATOM 9761  C "C2'" . DG  J 6 33  ? 94.853  105.715 151.813 1.00 55.51  ? -41 DG  J "C2'" 1 
ATOM 9762  C "C1'" . DG  J 6 33  ? 96.071  104.834 152.000 1.00 55.51  ? -41 DG  J "C1'" 1 
ATOM 9763  N N9    . DG  J 6 33  ? 97.048  104.990 150.938 1.00 55.51  ? -41 DG  J N9    1 
ATOM 9764  C C8    . DG  J 6 33  ? 96.792  105.009 149.592 1.00 55.51  ? -41 DG  J C8    1 
ATOM 9765  N N7    . DG  J 6 33  ? 97.857  105.175 148.866 1.00 55.51  ? -41 DG  J N7    1 
ATOM 9766  C C5    . DG  J 6 33  ? 98.888  105.286 149.792 1.00 55.51  ? -41 DG  J C5    1 
ATOM 9767  C C6    . DG  J 6 33  ? 100.276 105.463 149.587 1.00 55.51  ? -41 DG  J C6    1 
ATOM 9768  O O6    . DG  J 6 33  ? 100.879 105.590 148.519 1.00 55.51  ? -41 DG  J O6    1 
ATOM 9769  N N1    . DG  J 6 33  ? 100.974 105.534 150.784 1.00 55.51  ? -41 DG  J N1    1 
ATOM 9770  C C2    . DG  J 6 33  ? 100.413 105.423 152.024 1.00 55.51  ? -41 DG  J C2    1 
ATOM 9771  N N2    . DG  J 6 33  ? 101.262 105.502 153.056 1.00 55.51  ? -41 DG  J N2    1 
ATOM 9772  N N3    . DG  J 6 33  ? 99.111  105.241 152.238 1.00 55.51  ? -41 DG  J N3    1 
ATOM 9773  C C4    . DG  J 6 33  ? 98.412  105.174 151.072 1.00 55.51  ? -41 DG  J C4    1 
ATOM 9774  P P     . DG  J 6 34  ? 92.724  106.265 154.695 1.00 54.30  ? -40 DG  J P     1 
ATOM 9775  O OP1   . DG  J 6 34  ? 91.924  105.340 155.526 1.00 54.30  ? -40 DG  J OP1   1 
ATOM 9776  O OP2   . DG  J 6 34  ? 92.082  107.037 153.612 1.00 54.30  ? -40 DG  J OP2   1 
ATOM 9777  O "O5'" . DG  J 6 34  ? 93.459  107.319 155.644 1.00 54.30  ? -40 DG  J "O5'" 1 
ATOM 9778  C "C5'" . DG  J 6 34  ? 94.028  108.504 155.098 1.00 54.30  ? -40 DG  J "C5'" 1 
ATOM 9779  C "C4'" . DG  J 6 34  ? 95.529  108.485 155.268 1.00 54.30  ? -40 DG  J "C4'" 1 
ATOM 9780  O "O4'" . DG  J 6 34  ? 96.135  108.042 154.057 1.00 54.30  ? -40 DG  J "O4'" 1 
ATOM 9781  C "C3'" . DG  J 6 34  ? 96.180  109.832 155.562 1.00 54.30  ? -40 DG  J "C3'" 1 
ATOM 9782  O "O3'" . DG  J 6 34  ? 96.374  109.969 156.968 1.00 54.30  ? -40 DG  J "O3'" 1 
ATOM 9783  C "C2'" . DG  J 6 34  ? 97.524  109.769 154.810 1.00 54.30  ? -40 DG  J "C2'" 1 
ATOM 9784  C "C1'" . DG  J 6 34  ? 97.477  108.420 154.095 1.00 54.30  ? -40 DG  J "C1'" 1 
ATOM 9785  N N9    . DG  J 6 34  ? 97.974  108.430 152.727 1.00 54.30  ? -40 DG  J N9    1 
ATOM 9786  C C8    . DG  J 6 34  ? 97.237  108.214 151.592 1.00 54.30  ? -40 DG  J C8    1 
ATOM 9787  N N7    . DG  J 6 34  ? 97.935  108.250 150.501 1.00 54.30  ? -40 DG  J N7    1 
ATOM 9788  C C5    . DG  J 6 34  ? 99.223  108.493 150.938 1.00 54.30  ? -40 DG  J C5    1 
ATOM 9789  C C6    . DG  J 6 34  ? 100.403 108.653 150.198 1.00 54.30  ? -40 DG  J C6    1 
ATOM 9790  O O6    . DG  J 6 34  ? 100.544 108.584 148.974 1.00 54.30  ? -40 DG  J O6    1 
ATOM 9791  N N1    . DG  J 6 34  ? 101.494 108.892 151.015 1.00 54.30  ? -40 DG  J N1    1 
ATOM 9792  C C2    . DG  J 6 34  ? 101.448 108.984 152.385 1.00 54.30  ? -40 DG  J C2    1 
ATOM 9793  N N2    . DG  J 6 34  ? 102.615 109.223 153.001 1.00 54.30  ? -40 DG  J N2    1 
ATOM 9794  N N3    . DG  J 6 34  ? 100.338 108.848 153.097 1.00 54.30  ? -40 DG  J N3    1 
ATOM 9795  C C4    . DG  J 6 34  ? 99.267  108.606 152.307 1.00 54.30  ? -40 DG  J C4    1 
ATOM 9796  P P     . DT  J 6 35  ? 96.559  111.420 157.635 1.00 49.99  ? -39 DT  J P     1 
ATOM 9797  O OP1   . DT  J 6 35  ? 96.369  111.293 159.094 1.00 49.99  ? -39 DT  J OP1   1 
ATOM 9798  O OP2   . DT  J 6 35  ? 95.742  112.387 156.877 1.00 49.99  ? -39 DT  J OP2   1 
ATOM 9799  O "O5'" . DT  J 6 35  ? 98.091  111.761 157.370 1.00 49.99  ? -39 DT  J "O5'" 1 
ATOM 9800  C "C5'" . DT  J 6 35  ? 98.439  112.924 156.658 1.00 49.99  ? -39 DT  J "C5'" 1 
ATOM 9801  C "C4'" . DT  J 6 35  ? 99.939  113.034 156.536 1.00 49.99  ? -39 DT  J "C4'" 1 
ATOM 9802  O "O4'" . DT  J 6 35  ? 100.376 112.307 155.364 1.00 49.99  ? -39 DT  J "O4'" 1 
ATOM 9803  C "C3'" . DT  J 6 35  ? 100.454 114.437 156.311 1.00 49.99  ? -39 DT  J "C3'" 1 
ATOM 9804  O "O3'" . DT  J 6 35  ? 101.828 114.469 156.637 1.00 49.99  ? -39 DT  J "O3'" 1 
ATOM 9805  C "C2'" . DT  J 6 35  ? 100.241 114.577 154.814 1.00 49.99  ? -39 DT  J "C2'" 1 
ATOM 9806  C "C1'" . DT  J 6 35  ? 100.762 113.229 154.361 1.00 49.99  ? -39 DT  J "C1'" 1 
ATOM 9807  N N1    . DT  J 6 35  ? 100.213 112.771 153.088 1.00 49.99  ? -39 DT  J N1    1 
ATOM 9808  C C2    . DT  J 6 35  ? 101.052 112.620 152.033 1.00 49.99  ? -39 DT  J C2    1 
ATOM 9809  O O2    . DT  J 6 35  ? 102.236 112.863 152.094 1.00 49.99  ? -39 DT  J O2    1 
ATOM 9810  N N3    . DT  J 6 35  ? 100.465 112.169 150.897 1.00 49.99  ? -39 DT  J N3    1 
ATOM 9811  C C4    . DT  J 6 35  ? 99.141  111.853 150.719 1.00 49.99  ? -39 DT  J C4    1 
ATOM 9812  O O4    . DT  J 6 35  ? 98.703  111.453 149.652 1.00 49.99  ? -39 DT  J O4    1 
ATOM 9813  C C5    . DT  J 6 35  ? 98.306  112.032 151.870 1.00 49.99  ? -39 DT  J C5    1 
ATOM 9814  C C7    . DT  J 6 35  ? 96.843  111.728 151.788 1.00 49.99  ? -39 DT  J C7    1 
ATOM 9815  C C6    . DT  J 6 35  ? 98.877  112.480 152.990 1.00 49.99  ? -39 DT  J C6    1 
ATOM 9816  P P     . DC  J 6 36  ? 102.684 115.812 156.454 1.00 42.93  ? -38 DC  J P     1 
ATOM 9817  O OP1   . DC  J 6 36  ? 103.774 115.781 157.454 1.00 42.93  ? -38 DC  J OP1   1 
ATOM 9818  O OP2   . DC  J 6 36  ? 101.753 116.960 156.441 1.00 42.93  ? -38 DC  J OP2   1 
ATOM 9819  O "O5'" . DC  J 6 36  ? 103.329 115.646 155.006 1.00 42.93  ? -38 DC  J "O5'" 1 
ATOM 9820  C "C5'" . DC  J 6 36  ? 104.673 116.026 154.793 1.00 42.93  ? -38 DC  J "C5'" 1 
ATOM 9821  C "C4'" . DC  J 6 36  ? 104.764 117.187 153.823 1.00 42.93  ? -38 DC  J "C4'" 1 
ATOM 9822  O "O4'" . DC  J 6 36  ? 103.915 116.930 152.679 1.00 42.93  ? -38 DC  J "O4'" 1 
ATOM 9823  C "C3'" . DC  J 6 36  ? 104.318 118.530 154.376 1.00 42.93  ? -38 DC  J "C3'" 1 
ATOM 9824  O "O3'" . DC  J 6 36  ? 105.113 119.530 153.830 1.00 42.93  ? -38 DC  J "O3'" 1 
ATOM 9825  C "C2'" . DC  J 6 36  ? 102.895 118.642 153.863 1.00 42.93  ? -38 DC  J "C2'" 1 
ATOM 9826  C "C1'" . DC  J 6 36  ? 103.049 118.017 152.492 1.00 42.93  ? -38 DC  J "C1'" 1 
ATOM 9827  N N1    . DC  J 6 36  ? 101.778 117.505 151.908 1.00 42.93  ? -38 DC  J N1    1 
ATOM 9828  C C2    . DC  J 6 36  ? 101.779 116.997 150.613 1.00 42.93  ? -38 DC  J C2    1 
ATOM 9829  O O2    . DC  J 6 36  ? 102.833 116.984 149.974 1.00 42.93  ? -38 DC  J O2    1 
ATOM 9830  N N3    . DC  J 6 36  ? 100.626 116.531 150.092 1.00 42.93  ? -38 DC  J N3    1 
ATOM 9831  C C4    . DC  J 6 36  ? 99.509  116.557 150.810 1.00 42.93  ? -38 DC  J C4    1 
ATOM 9832  N N4    . DC  J 6 36  ? 98.398  116.081 150.248 1.00 42.93  ? -38 DC  J N4    1 
ATOM 9833  C C5    . DC  J 6 36  ? 99.481  117.072 152.135 1.00 42.93  ? -38 DC  J C5    1 
ATOM 9834  C C6    . DC  J 6 36  ? 100.628 117.529 152.641 1.00 42.93  ? -38 DC  J C6    1 
ATOM 9835  P P     . DG  J 6 37  ? 105.810 120.601 154.789 1.00 39.24  ? -37 DG  J P     1 
ATOM 9836  O OP1   . DG  J 6 37  ? 106.633 119.849 155.764 1.00 39.24  ? -37 DG  J OP1   1 
ATOM 9837  O OP2   . DG  J 6 37  ? 104.734 121.505 155.244 1.00 39.24  ? -37 DG  J OP2   1 
ATOM 9838  O "O5'" . DG  J 6 37  ? 106.756 121.439 153.808 1.00 39.24  ? -37 DG  J "O5'" 1 
ATOM 9839  C "C5'" . DG  J 6 37  ? 107.756 120.777 153.037 1.00 39.24  ? -37 DG  J "C5'" 1 
ATOM 9840  C "C4'" . DG  J 6 37  ? 107.472 120.873 151.549 1.00 39.24  ? -37 DG  J "C4'" 1 
ATOM 9841  O "O4'" . DG  J 6 37  ? 106.142 120.369 151.267 1.00 39.24  ? -37 DG  J "O4'" 1 
ATOM 9842  C "C3'" . DG  J 6 37  ? 107.521 122.275 150.953 1.00 39.24  ? -37 DG  J "C3'" 1 
ATOM 9843  O "O3'" . DG  J 6 37  ? 108.064 122.188 149.656 1.00 39.24  ? -37 DG  J "O3'" 1 
ATOM 9844  C "C2'" . DG  J 6 37  ? 106.050 122.655 150.904 1.00 39.24  ? -37 DG  J "C2'" 1 
ATOM 9845  C "C1'" . DG  J 6 37  ? 105.430 121.330 150.535 1.00 39.24  ? -37 DG  J "C1'" 1 
ATOM 9846  N N9    . DG  J 6 37  ? 104.035 121.238 150.894 1.00 39.24  ? -37 DG  J N9    1 
ATOM 9847  C C8    . DG  J 6 37  ? 103.468 121.607 152.077 1.00 39.24  ? -37 DG  J C8    1 
ATOM 9848  N N7    . DG  J 6 37  ? 102.181 121.418 152.115 1.00 39.24  ? -37 DG  J N7    1 
ATOM 9849  C C5    . DG  J 6 37  ? 101.882 120.889 150.876 1.00 39.24  ? -37 DG  J C5    1 
ATOM 9850  C C6    . DG  J 6 37  ? 100.650 120.472 150.343 1.00 39.24  ? -37 DG  J C6    1 
ATOM 9851  O O6    . DG  J 6 37  ? 99.534  120.499 150.875 1.00 39.24  ? -37 DG  J O6    1 
ATOM 9852  N N1    . DG  J 6 37  ? 100.788 119.995 149.051 1.00 39.24  ? -37 DG  J N1    1 
ATOM 9853  C C2    . DG  J 6 37  ? 101.975 119.923 148.367 1.00 39.24  ? -37 DG  J C2    1 
ATOM 9854  N N2    . DG  J 6 37  ? 101.922 119.442 147.125 1.00 39.24  ? -37 DG  J N2    1 
ATOM 9855  N N3    . DG  J 6 37  ? 103.138 120.308 148.861 1.00 39.24  ? -37 DG  J N3    1 
ATOM 9856  C C4    . DG  J 6 37  ? 103.016 120.774 150.114 1.00 39.24  ? -37 DG  J C4    1 
ATOM 9857  P P     . DT  J 6 38  ? 108.652 123.469 148.888 1.00 35.33  ? -36 DT  J P     1 
ATOM 9858  O OP1   . DT  J 6 38  ? 110.070 123.576 149.284 1.00 35.33  ? -36 DT  J OP1   1 
ATOM 9859  O OP2   . DT  J 6 38  ? 107.761 124.639 149.033 1.00 35.33  ? -36 DT  J OP2   1 
ATOM 9860  O "O5'" . DT  J 6 38  ? 108.557 123.020 147.362 1.00 35.33  ? -36 DT  J "O5'" 1 
ATOM 9861  C "C5'" . DT  J 6 38  ? 107.671 121.958 146.999 1.00 35.33  ? -36 DT  J "C5'" 1 
ATOM 9862  C "C4'" . DT  J 6 38  ? 106.607 122.449 146.044 1.00 35.33  ? -36 DT  J "C4'" 1 
ATOM 9863  O "O4'" . DT  J 6 38  ? 105.285 122.334 146.652 1.00 35.33  ? -36 DT  J "O4'" 1 
ATOM 9864  C "C3'" . DT  J 6 38  ? 106.750 123.912 145.636 1.00 35.33  ? -36 DT  J "C3'" 1 
ATOM 9865  O "O3'" . DT  J 6 38  ? 106.492 124.032 144.275 1.00 35.33  ? -36 DT  J "O3'" 1 
ATOM 9866  C "C2'" . DT  J 6 38  ? 105.649 124.583 146.446 1.00 35.33  ? -36 DT  J "C2'" 1 
ATOM 9867  C "C1'" . DT  J 6 38  ? 104.584 123.513 146.364 1.00 35.33  ? -36 DT  J "C1'" 1 
ATOM 9868  N N1    . DT  J 6 38  ? 103.460 123.695 147.328 1.00 35.33  ? -36 DT  J N1    1 
ATOM 9869  C C2    . DT  J 6 38  ? 102.177 123.414 146.926 1.00 35.33  ? -36 DT  J C2    1 
ATOM 9870  O O2    . DT  J 6 38  ? 101.908 122.988 145.825 1.00 35.33  ? -36 DT  J O2    1 
ATOM 9871  N N3    . DT  J 6 38  ? 101.217 123.639 147.878 1.00 35.33  ? -36 DT  J N3    1 
ATOM 9872  C C4    . DT  J 6 38  ? 101.412 124.103 149.161 1.00 35.33  ? -36 DT  J C4    1 
ATOM 9873  O O4    . DT  J 6 38  ? 100.490 124.274 149.948 1.00 35.33  ? -36 DT  J O4    1 
ATOM 9874  C C5    . DT  J 6 38  ? 102.775 124.385 149.512 1.00 35.33  ? -36 DT  J C5    1 
ATOM 9875  C C7    . DT  J 6 38  ? 103.098 124.906 150.878 1.00 35.33  ? -36 DT  J C7    1 
ATOM 9876  C C6    . DT  J 6 38  ? 103.723 124.174 148.590 1.00 35.33  ? -36 DT  J C6    1 
ATOM 9877  P P     . DA  J 6 39  ? 107.685 124.126 143.207 1.00 34.65  ? -35 DA  J P     1 
ATOM 9878  O OP1   . DA  J 6 39  ? 108.722 123.149 143.588 1.00 34.65  ? -35 DA  J OP1   1 
ATOM 9879  O OP2   . DA  J 6 39  ? 108.066 125.540 143.029 1.00 34.65  ? -35 DA  J OP2   1 
ATOM 9880  O "O5'" . DA  J 6 39  ? 106.977 123.641 141.867 1.00 34.65  ? -35 DA  J "O5'" 1 
ATOM 9881  C "C5'" . DA  J 6 39  ? 106.204 122.459 141.893 1.00 34.65  ? -35 DA  J "C5'" 1 
ATOM 9882  C "C4'" . DA  J 6 39  ? 104.903 122.614 141.123 1.00 34.65  ? -35 DA  J "C4'" 1 
ATOM 9883  O "O4'" . DA  J 6 39  ? 103.845 123.074 141.993 1.00 34.65  ? -35 DA  J "O4'" 1 
ATOM 9884  C "C3'" . DA  J 6 39  ? 104.937 123.559 139.940 1.00 34.65  ? -35 DA  J "C3'" 1 
ATOM 9885  O "O3'" . DA  J 6 39  ? 104.223 122.954 138.881 1.00 34.65  ? -35 DA  J "O3'" 1 
ATOM 9886  C "C2'" . DA  J 6 39  ? 104.264 124.831 140.469 1.00 34.65  ? -35 DA  J "C2'" 1 
ATOM 9887  C "C1'" . DA  J 6 39  ? 103.340 124.318 141.564 1.00 34.65  ? -35 DA  J "C1'" 1 
ATOM 9888  N N9    . DA  J 6 39  ? 103.299 125.173 142.739 1.00 34.65  ? -35 DA  J N9    1 
ATOM 9889  C C8    . DA  J 6 39  ? 104.325 125.905 143.249 1.00 34.65  ? -35 DA  J C8    1 
ATOM 9890  N N7    . DA  J 6 39  ? 104.020 126.557 144.338 1.00 34.65  ? -35 DA  J N7    1 
ATOM 9891  C C5    . DA  J 6 39  ? 102.705 126.216 144.570 1.00 34.65  ? -35 DA  J C5    1 
ATOM 9892  C C6    . DA  J 6 39  ? 101.804 126.566 145.588 1.00 34.65  ? -35 DA  J C6    1 
ATOM 9893  N N6    . DA  J 6 39  ? 102.114 127.403 146.578 1.00 34.65  ? -35 DA  J N6    1 
ATOM 9894  N N1    . DA  J 6 39  ? 100.552 126.072 145.519 1.00 34.65  ? -35 DA  J N1    1 
ATOM 9895  C C2    . DA  J 6 39  ? 100.237 125.254 144.513 1.00 34.65  ? -35 DA  J C2    1 
ATOM 9896  N N3    . DA  J 6 39  ? 101.008 124.836 143.508 1.00 34.65  ? -35 DA  J N3    1 
ATOM 9897  C C4    . DA  J 6 39  ? 102.241 125.361 143.597 1.00 34.65  ? -35 DA  J C4    1 
ATOM 9898  P P     . DG  J 6 40  ? 103.982 123.701 137.486 1.00 33.66  ? -34 DG  J P     1 
ATOM 9899  O OP1   . DG  J 6 40  ? 103.922 122.656 136.448 1.00 33.66  ? -34 DG  J OP1   1 
ATOM 9900  O OP2   . DG  J 6 40  ? 104.956 124.800 137.322 1.00 33.66  ? -34 DG  J OP2   1 
ATOM 9901  O "O5'" . DG  J 6 40  ? 102.508 124.268 137.658 1.00 33.66  ? -34 DG  J "O5'" 1 
ATOM 9902  C "C5'" . DG  J 6 40  ? 101.545 123.475 138.337 1.00 33.66  ? -34 DG  J "C5'" 1 
ATOM 9903  C "C4'" . DG  J 6 40  ? 100.327 124.292 138.702 1.00 33.66  ? -34 DG  J "C4'" 1 
ATOM 9904  O "O4'" . DG  J 6 40  ? 100.522 124.934 139.994 1.00 33.66  ? -34 DG  J "O4'" 1 
ATOM 9905  C "C3'" . DG  J 6 40  ? 100.003 125.416 137.720 1.00 33.66  ? -34 DG  J "C3'" 1 
ATOM 9906  O "O3'" . DG  J 6 40  ? 98.605  125.458 137.476 1.00 33.66  ? -34 DG  J "O3'" 1 
ATOM 9907  C "C2'" . DG  J 6 40  ? 100.464 126.647 138.476 1.00 33.66  ? -34 DG  J "C2'" 1 
ATOM 9908  C "C1'" . DG  J 6 40  ? 100.083 126.253 139.884 1.00 33.66  ? -34 DG  J "C1'" 1 
ATOM 9909  N N9    . DG  J 6 40  ? 100.718 127.075 140.895 1.00 33.66  ? -34 DG  J N9    1 
ATOM 9910  C C8    . DG  J 6 40  ? 102.004 127.533 140.888 1.00 33.66  ? -34 DG  J C8    1 
ATOM 9911  N N7    . DG  J 6 40  ? 102.292 128.279 141.911 1.00 33.66  ? -34 DG  J N7    1 
ATOM 9912  C C5    . DG  J 6 40  ? 101.115 128.338 142.627 1.00 33.66  ? -34 DG  J C5    1 
ATOM 9913  C C6    . DG  J 6 40  ? 100.828 129.019 143.813 1.00 33.66  ? -34 DG  J C6    1 
ATOM 9914  O O6    . DG  J 6 40  ? 101.593 129.698 144.499 1.00 33.66  ? -34 DG  J O6    1 
ATOM 9915  N N1    . DG  J 6 40  ? 99.525  128.806 144.224 1.00 33.66  ? -34 DG  J N1    1 
ATOM 9916  C C2    . DG  J 6 40  ? 98.604  128.058 143.544 1.00 33.66  ? -34 DG  J C2    1 
ATOM 9917  N N2    . DG  J 6 40  ? 97.385  127.979 144.085 1.00 33.66  ? -34 DG  J N2    1 
ATOM 9918  N N3    . DG  J 6 40  ? 98.860  127.426 142.411 1.00 33.66  ? -34 DG  J N3    1 
ATOM 9919  C C4    . DG  J 6 40  ? 100.134 127.609 142.017 1.00 33.66  ? -34 DG  J C4    1 
ATOM 9920  P P     . DA  J 6 41  ? 98.052  125.915 136.040 1.00 33.74  ? -33 DA  J P     1 
ATOM 9921  O OP1   . DA  J 6 41  ? 97.918  124.704 135.210 1.00 33.74  ? -33 DA  J OP1   1 
ATOM 9922  O OP2   . DA  J 6 41  ? 98.883  127.045 135.584 1.00 33.74  ? -33 DA  J OP2   1 
ATOM 9923  O "O5'" . DA  J 6 41  ? 96.591  126.473 136.345 1.00 33.74  ? -33 DA  J "O5'" 1 
ATOM 9924  C "C5'" . DA  J 6 41  ? 95.523  125.568 136.568 1.00 33.74  ? -33 DA  J "C5'" 1 
ATOM 9925  C "C4'" . DA  J 6 41  ? 94.583  126.069 137.656 1.00 33.74  ? -33 DA  J "C4'" 1 
ATOM 9926  O "O4'" . DA  J 6 41  ? 95.348  126.542 138.794 1.00 33.74  ? -33 DA  J "O4'" 1 
ATOM 9927  C "C3'" . DA  J 6 41  ? 93.672  127.223 137.262 1.00 33.74  ? -33 DA  J "C3'" 1 
ATOM 9928  O "O3'" . DA  J 6 41  ? 92.430  127.095 137.939 1.00 33.74  ? -33 DA  J "O3'" 1 
ATOM 9929  C "C2'" . DA  J 6 41  ? 94.446  128.439 137.751 1.00 33.74  ? -33 DA  J "C2'" 1 
ATOM 9930  C "C1'" . DA  J 6 41  ? 95.075  127.909 139.031 1.00 33.74  ? -33 DA  J "C1'" 1 
ATOM 9931  N N9    . DA  J 6 41  ? 96.334  128.558 139.370 1.00 33.74  ? -33 DA  J N9    1 
ATOM 9932  C C8    . DA  J 6 41  ? 97.494  128.493 138.666 1.00 33.74  ? -33 DA  J C8    1 
ATOM 9933  N N7    . DA  J 6 41  ? 98.472  129.172 139.198 1.00 33.74  ? -33 DA  J N7    1 
ATOM 9934  C C5    . DA  J 6 41  ? 97.926  129.702 140.333 1.00 33.74  ? -33 DA  J C5    1 
ATOM 9935  C C6    . DA  J 6 41  ? 98.458  130.526 141.325 1.00 33.74  ? -33 DA  J C6    1 
ATOM 9936  N N6    . DA  J 6 41  ? 99.720  130.945 141.319 1.00 33.74  ? -33 DA  J N6    1 
ATOM 9937  N N1    . DA  J 6 41  ? 97.652  130.900 142.329 1.00 33.74  ? -33 DA  J N1    1 
ATOM 9938  C C2    . DA  J 6 41  ? 96.386  130.476 142.324 1.00 33.74  ? -33 DA  J C2    1 
ATOM 9939  N N3    . DA  J 6 41  ? 95.772  129.694 141.438 1.00 33.74  ? -33 DA  J N3    1 
ATOM 9940  C C4    . DA  J 6 41  ? 96.606  129.343 140.459 1.00 33.74  ? -33 DA  J C4    1 
ATOM 9941  P P     . DC  J 6 42  ? 91.155  127.944 137.463 1.00 35.15  ? -32 DC  J P     1 
ATOM 9942  O OP1   . DC  J 6 42  ? 89.938  127.287 137.982 1.00 35.15  ? -32 DC  J OP1   1 
ATOM 9943  O OP2   . DC  J 6 42  ? 91.304  128.186 136.013 1.00 35.15  ? -32 DC  J OP2   1 
ATOM 9944  O "O5'" . DC  J 6 42  ? 91.312  129.323 138.246 1.00 35.15  ? -32 DC  J "O5'" 1 
ATOM 9945  C "C5'" . DC  J 6 42  ? 91.443  129.310 139.654 1.00 35.15  ? -32 DC  J "C5'" 1 
ATOM 9946  C "C4'" . DC  J 6 42  ? 91.708  130.703 140.181 1.00 35.15  ? -32 DC  J "C4'" 1 
ATOM 9947  O "O4'" . DC  J 6 42  ? 93.131  130.937 140.301 1.00 35.15  ? -32 DC  J "O4'" 1 
ATOM 9948  C "C3'" . DC  J 6 42  ? 91.164  131.840 139.315 1.00 35.15  ? -32 DC  J "C3'" 1 
ATOM 9949  O "O3'" . DC  J 6 42  ? 90.363  132.670 140.119 1.00 35.15  ? -32 DC  J "O3'" 1 
ATOM 9950  C "C2'" . DC  J 6 42  ? 92.430  132.566 138.842 1.00 35.15  ? -32 DC  J "C2'" 1 
ATOM 9951  C "C1'" . DC  J 6 42  ? 93.374  132.280 139.987 1.00 35.15  ? -32 DC  J "C1'" 1 
ATOM 9952  N N1    . DC  J 6 42  ? 94.790  132.421 139.632 1.00 35.15  ? -32 DC  J N1    1 
ATOM 9953  C C2    . DC  J 6 42  ? 95.645  133.165 140.446 1.00 35.15  ? -32 DC  J C2    1 
ATOM 9954  O O2    . DC  J 6 42  ? 95.197  133.699 141.464 1.00 35.15  ? -32 DC  J O2    1 
ATOM 9955  N N3    . DC  J 6 42  ? 96.944  133.267 140.102 1.00 35.15  ? -32 DC  J N3    1 
ATOM 9956  C C4    . DC  J 6 42  ? 97.385  132.671 138.999 1.00 35.15  ? -32 DC  J C4    1 
ATOM 9957  N N4    . DC  J 6 42  ? 98.677  132.793 138.694 1.00 35.15  ? -32 DC  J N4    1 
ATOM 9958  C C5    . DC  J 6 42  ? 96.526  131.917 138.161 1.00 35.15  ? -32 DC  J C5    1 
ATOM 9959  C C6    . DC  J 6 42  ? 95.250  131.823 138.513 1.00 35.15  ? -32 DC  J C6    1 
ATOM 9960  P P     . DA  J 6 43  ? 89.269  133.647 139.473 1.00 37.32  ? -31 DA  J P     1 
ATOM 9961  O OP1   . DA  J 6 43  ? 87.948  133.119 139.873 1.00 37.32  ? -31 DA  J OP1   1 
ATOM 9962  O OP2   . DA  J 6 43  ? 89.571  133.869 138.043 1.00 37.32  ? -31 DA  J OP2   1 
ATOM 9963  O "O5'" . DA  J 6 43  ? 89.535  135.020 140.236 1.00 37.32  ? -31 DA  J "O5'" 1 
ATOM 9964  C "C5'" . DA  J 6 43  ? 90.771  135.214 140.889 1.00 37.32  ? -31 DA  J "C5'" 1 
ATOM 9965  C "C4'" . DA  J 6 43  ? 90.826  136.575 141.537 1.00 37.32  ? -31 DA  J "C4'" 1 
ATOM 9966  O "O4'" . DA  J 6 43  ? 92.205  136.962 141.723 1.00 37.32  ? -31 DA  J "O4'" 1 
ATOM 9967  C "C3'" . DA  J 6 43  ? 90.237  137.690 140.716 1.00 37.32  ? -31 DA  J "C3'" 1 
ATOM 9968  O "O3'" . DA  J 6 43  ? 89.924  138.768 141.573 1.00 37.32  ? -31 DA  J "O3'" 1 
ATOM 9969  C "C2'" . DA  J 6 43  ? 91.394  138.024 139.771 1.00 37.32  ? -31 DA  J "C2'" 1 
ATOM 9970  C "C1'" . DA  J 6 43  ? 92.619  137.797 140.657 1.00 37.32  ? -31 DA  J "C1'" 1 
ATOM 9971  N N9    . DA  J 6 43  ? 93.725  137.128 139.982 1.00 37.32  ? -31 DA  J N9    1 
ATOM 9972  C C8    . DA  J 6 43  ? 93.643  136.071 139.126 1.00 37.32  ? -31 DA  J C8    1 
ATOM 9973  N N7    . DA  J 6 43  ? 94.803  135.653 138.690 1.00 37.32  ? -31 DA  J N7    1 
ATOM 9974  C C5    . DA  J 6 43  ? 95.709  136.489 139.308 1.00 37.32  ? -31 DA  J C5    1 
ATOM 9975  C C6    . DA  J 6 43  ? 97.111  136.557 139.268 1.00 37.32  ? -31 DA  J C6    1 
ATOM 9976  N N6    . DA  J 6 43  ? 97.857  135.750 138.523 1.00 37.32  ? -31 DA  J N6    1 
ATOM 9977  N N1    . DA  J 6 43  ? 97.721  137.515 140.001 1.00 37.32  ? -31 DA  J N1    1 
ATOM 9978  C C2    . DA  J 6 43  ? 96.966  138.330 140.739 1.00 37.32  ? -31 DA  J C2    1 
ATOM 9979  N N3    . DA  J 6 43  ? 95.637  138.357 140.856 1.00 37.32  ? -31 DA  J N3    1 
ATOM 9980  C C4    . DA  J 6 43  ? 95.066  137.397 140.116 1.00 37.32  ? -31 DA  J C4    1 
ATOM 9981  P P     . DG  J 6 44  ? 89.219  140.088 141.001 1.00 40.50  ? -30 DG  J P     1 
ATOM 9982  O OP1   . DG  J 6 44  ? 88.408  140.661 142.095 1.00 40.50  ? -30 DG  J OP1   1 
ATOM 9983  O OP2   . DG  J 6 44  ? 88.575  139.740 139.717 1.00 40.50  ? -30 DG  J OP2   1 
ATOM 9984  O "O5'" . DG  J 6 44  ? 90.446  141.070 140.728 1.00 40.50  ? -30 DG  J "O5'" 1 
ATOM 9985  C "C5'" . DG  J 6 44  ? 91.256  141.473 141.810 1.00 40.50  ? -30 DG  J "C5'" 1 
ATOM 9986  C "C4'" . DG  J 6 44  ? 92.484  142.218 141.332 1.00 40.50  ? -30 DG  J "C4'" 1 
ATOM 9987  O "O4'" . DG  J 6 44  ? 93.435  141.289 140.762 1.00 40.50  ? -30 DG  J "O4'" 1 
ATOM 9988  C "C3'" . DG  J 6 44  ? 92.241  143.282 140.254 1.00 40.50  ? -30 DG  J "C3'" 1 
ATOM 9989  O "O3'" . DG  J 6 44  ? 92.949  144.463 140.602 1.00 40.50  ? -30 DG  J "O3'" 1 
ATOM 9990  C "C2'" . DG  J 6 44  ? 92.831  142.636 139.004 1.00 40.50  ? -30 DG  J "C2'" 1 
ATOM 9991  C "C1'" . DG  J 6 44  ? 93.986  141.886 139.623 1.00 40.50  ? -30 DG  J "C1'" 1 
ATOM 9992  N N9    . DG  J 6 44  ? 94.551  140.847 138.783 1.00 40.50  ? -30 DG  J N9    1 
ATOM 9993  C C8    . DG  J 6 44  ? 93.878  139.872 138.102 1.00 40.50  ? -30 DG  J C8    1 
ATOM 9994  N N7    . DG  J 6 44  ? 94.661  139.069 137.445 1.00 40.50  ? -30 DG  J N7    1 
ATOM 9995  C C5    . DG  J 6 44  ? 95.932  139.540 137.717 1.00 40.50  ? -30 DG  J C5    1 
ATOM 9996  C C6    . DG  J 6 44  ? 97.181  139.085 137.262 1.00 40.50  ? -30 DG  J C6    1 
ATOM 9997  O O6    . DG  J 6 44  ? 97.424  138.121 136.533 1.00 40.50  ? -30 DG  J O6    1 
ATOM 9998  N N1    . DG  J 6 44  ? 98.222  139.841 137.773 1.00 40.50  ? -30 DG  J N1    1 
ATOM 9999  C C2    . DG  J 6 44  ? 98.070  140.923 138.597 1.00 40.50  ? -30 DG  J C2    1 
ATOM 10000 N N2    . DG  J 6 44  ? 99.194  141.539 138.982 1.00 40.50  ? -30 DG  J N2    1 
ATOM 10001 N N3    . DG  J 6 44  ? 96.898  141.373 139.019 1.00 40.50  ? -30 DG  J N3    1 
ATOM 10002 C C4    . DG  J 6 44  ? 95.879  140.633 138.538 1.00 40.50  ? -30 DG  J C4    1 
ATOM 10003 P P     . DC  J 6 45  ? 92.496  145.896 140.037 1.00 43.35  ? -29 DC  J P     1 
ATOM 10004 O OP1   . DC  J 6 45  ? 92.081  146.713 141.200 1.00 43.35  ? -29 DC  J OP1   1 
ATOM 10005 O OP2   . DC  J 6 45  ? 91.573  145.686 138.904 1.00 43.35  ? -29 DC  J OP2   1 
ATOM 10006 O "O5'" . DC  J 6 45  ? 93.848  146.512 139.455 1.00 43.35  ? -29 DC  J "O5'" 1 
ATOM 10007 C "C5'" . DC  J 6 45  ? 94.900  146.836 140.342 1.00 43.35  ? -29 DC  J "C5'" 1 
ATOM 10008 C "C4'" . DC  J 6 45  ? 96.251  146.816 139.643 1.00 43.35  ? -29 DC  J "C4'" 1 
ATOM 10009 O "O4'" . DC  J 6 45  ? 96.496  145.518 139.045 1.00 43.35  ? -29 DC  J "O4'" 1 
ATOM 10010 C "C3'" . DC  J 6 45  ? 96.432  147.828 138.518 1.00 43.35  ? -29 DC  J "C3'" 1 
ATOM 10011 O "O3'" . DC  J 6 45  ? 97.739  148.322 138.581 1.00 43.35  ? -29 DC  J "O3'" 1 
ATOM 10012 C "C2'" . DC  J 6 45  ? 96.235  146.973 137.268 1.00 43.35  ? -29 DC  J "C2'" 1 
ATOM 10013 C "C1'" . DC  J 6 45  ? 96.922  145.704 137.714 1.00 43.35  ? -29 DC  J "C1'" 1 
ATOM 10014 N N1    . DC  J 6 45  ? 96.568  144.483 136.959 1.00 43.35  ? -29 DC  J N1    1 
ATOM 10015 C C2    . DC  J 6 45  ? 97.585  143.646 136.509 1.00 43.35  ? -29 DC  J C2    1 
ATOM 10016 O O2    . DC  J 6 45  ? 98.755  143.966 136.704 1.00 43.35  ? -29 DC  J O2    1 
ATOM 10017 N N3    . DC  J 6 45  ? 97.266  142.515 135.857 1.00 43.35  ? -29 DC  J N3    1 
ATOM 10018 C C4    . DC  J 6 45  ? 95.995  142.202 135.660 1.00 43.35  ? -29 DC  J C4    1 
ATOM 10019 N N4    . DC  J 6 45  ? 95.731  141.073 135.006 1.00 43.35  ? -29 DC  J N4    1 
ATOM 10020 C C5    . DC  J 6 45  ? 94.937  143.032 136.123 1.00 43.35  ? -29 DC  J C5    1 
ATOM 10021 C C6    . DC  J 6 45  ? 95.266  144.150 136.770 1.00 43.35  ? -29 DC  J C6    1 
ATOM 10022 P P     . DT  J 6 46  ? 98.057  149.838 138.181 1.00 47.25  ? -28 DT  J P     1 
ATOM 10023 O OP1   . DT  J 6 46  ? 97.894  150.674 139.390 1.00 47.25  ? -28 DT  J OP1   1 
ATOM 10024 O OP2   . DT  J 6 46  ? 97.283  150.140 136.959 1.00 47.25  ? -28 DT  J OP2   1 
ATOM 10025 O "O5'" . DT  J 6 46  ? 99.606  149.788 137.808 1.00 47.25  ? -28 DT  J "O5'" 1 
ATOM 10026 C "C5'" . DT  J 6 46  ? 100.194 148.549 137.444 1.00 47.25  ? -28 DT  J "C5'" 1 
ATOM 10027 C "C4'" . DT  J 6 46  ? 100.891 148.669 136.109 1.00 47.25  ? -28 DT  J "C4'" 1 
ATOM 10028 O "O4'" . DT  J 6 46  ? 100.624 147.484 135.316 1.00 47.25  ? -28 DT  J "O4'" 1 
ATOM 10029 C "C3'" . DT  J 6 46  ? 100.416 149.834 135.250 1.00 47.25  ? -28 DT  J "C3'" 1 
ATOM 10030 O "O3'" . DT  J 6 46  ? 101.434 150.191 134.346 1.00 47.25  ? -28 DT  J "O3'" 1 
ATOM 10031 C "C2'" . DT  J 6 46  ? 99.260  149.190 134.506 1.00 47.25  ? -28 DT  J "C2'" 1 
ATOM 10032 C "C1'" . DT  J 6 46  ? 99.895  147.854 134.163 1.00 47.25  ? -28 DT  J "C1'" 1 
ATOM 10033 N N1    . DT  J 6 46  ? 98.938  146.779 133.857 1.00 47.25  ? -28 DT  J N1    1 
ATOM 10034 C C2    . DT  J 6 46  ? 99.422  145.552 133.504 1.00 47.25  ? -28 DT  J C2    1 
ATOM 10035 O O2    . DT  J 6 46  ? 100.608 145.303 133.413 1.00 47.25  ? -28 DT  J O2    1 
ATOM 10036 N N3    . DT  J 6 46  ? 98.474  144.615 133.243 1.00 47.25  ? -28 DT  J N3    1 
ATOM 10037 C C4    . DT  J 6 46  ? 97.107  144.777 133.316 1.00 47.25  ? -28 DT  J C4    1 
ATOM 10038 O O4    . DT  J 6 46  ? 96.328  143.874 133.064 1.00 47.25  ? -28 DT  J O4    1 
ATOM 10039 C C5    . DT  J 6 46  ? 96.660  146.086 133.691 1.00 47.25  ? -28 DT  J C5    1 
ATOM 10040 C C7    . DT  J 6 46  ? 95.194  146.373 133.788 1.00 47.25  ? -28 DT  J C7    1 
ATOM 10041 C C6    . DT  J 6 46  ? 97.587  147.018 133.943 1.00 47.25  ? -28 DT  J C6    1 
ATOM 10042 P P     . DC  J 6 47  ? 102.526 151.309 134.712 1.00 43.22  ? -27 DC  J P     1 
ATOM 10043 O OP1   . DC  J 6 47  ? 103.174 151.000 136.005 1.00 43.22  ? -27 DC  J OP1   1 
ATOM 10044 O OP2   . DC  J 6 47  ? 101.892 152.628 134.503 1.00 43.22  ? -27 DC  J OP2   1 
ATOM 10045 O "O5'" . DC  J 6 47  ? 103.617 151.091 133.577 1.00 43.22  ? -27 DC  J "O5'" 1 
ATOM 10046 C "C5'" . DC  J 6 47  ? 103.930 149.766 133.171 1.00 43.22  ? -27 DC  J "C5'" 1 
ATOM 10047 C "C4'" . DC  J 6 47  ? 103.502 149.515 131.738 1.00 43.22  ? -27 DC  J "C4'" 1 
ATOM 10048 O "O4'" . DC  J 6 47  ? 102.168 148.949 131.698 1.00 43.22  ? -27 DC  J "O4'" 1 
ATOM 10049 C "C3'" . DC  J 6 47  ? 103.460 150.756 130.838 1.00 43.22  ? -27 DC  J "C3'" 1 
ATOM 10050 O "O3'" . DC  J 6 47  ? 104.108 150.473 129.610 1.00 43.22  ? -27 DC  J "O3'" 1 
ATOM 10051 C "C2'" . DC  J 6 47  ? 101.964 150.963 130.632 1.00 43.22  ? -27 DC  J "C2'" 1 
ATOM 10052 C "C1'" . DC  J 6 47  ? 101.501 149.524 130.613 1.00 43.22  ? -27 DC  J "C1'" 1 
ATOM 10053 N N1    . DC  J 6 47  ? 100.036 149.329 130.784 1.00 43.22  ? -27 DC  J N1    1 
ATOM 10054 C C2    . DC  J 6 47  ? 99.494  148.060 130.589 1.00 43.22  ? -27 DC  J C2    1 
ATOM 10055 O O2    . DC  J 6 47  ? 100.227 147.135 130.253 1.00 43.22  ? -27 DC  J O2    1 
ATOM 10056 N N3    . DC  J 6 47  ? 98.169  147.877 130.733 1.00 43.22  ? -27 DC  J N3    1 
ATOM 10057 C C4    . DC  J 6 47  ? 97.393  148.896 131.076 1.00 43.22  ? -27 DC  J C4    1 
ATOM 10058 N N4    . DC  J 6 47  ? 96.088  148.659 131.215 1.00 43.22  ? -27 DC  J N4    1 
ATOM 10059 C C5    . DC  J 6 47  ? 97.920  150.203 131.286 1.00 43.22  ? -27 DC  J C5    1 
ATOM 10060 C C6    . DC  J 6 47  ? 99.237  150.373 131.128 1.00 43.22  ? -27 DC  J C6    1 
ATOM 10061 P P     . DT  J 6 48  ? 105.671 150.793 129.421 1.00 39.74  ? -26 DT  J P     1 
ATOM 10062 O OP1   . DT  J 6 48  ? 106.298 150.973 130.746 1.00 39.74  ? -26 DT  J OP1   1 
ATOM 10063 O OP2   . DT  J 6 48  ? 105.769 151.864 128.413 1.00 39.74  ? -26 DT  J OP2   1 
ATOM 10064 O "O5'" . DT  J 6 48  ? 106.256 149.466 128.756 1.00 39.74  ? -26 DT  J "O5'" 1 
ATOM 10065 C "C5'" . DT  J 6 48  ? 105.600 148.220 128.965 1.00 39.74  ? -26 DT  J "C5'" 1 
ATOM 10066 C "C4'" . DT  J 6 48  ? 105.020 147.678 127.673 1.00 39.74  ? -26 DT  J "C4'" 1 
ATOM 10067 O "O4'" . DT  J 6 48  ? 103.567 147.722 127.727 1.00 39.74  ? -26 DT  J "O4'" 1 
ATOM 10068 C "C3'" . DT  J 6 48  ? 105.397 148.454 126.415 1.00 39.74  ? -26 DT  J "C3'" 1 
ATOM 10069 O "O3'" . DT  J 6 48  ? 105.445 147.563 125.316 1.00 39.74  ? -26 DT  J "O3'" 1 
ATOM 10070 C "C2'" . DT  J 6 48  ? 104.209 149.388 126.281 1.00 39.74  ? -26 DT  J "C2'" 1 
ATOM 10071 C "C1'" . DT  J 6 48  ? 103.109 148.399 126.583 1.00 39.74  ? -26 DT  J "C1'" 1 
ATOM 10072 N N1    . DT  J 6 48  ? 101.793 148.999 126.877 1.00 39.74  ? -26 DT  J N1    1 
ATOM 10073 C C2    . DT  J 6 48  ? 100.696 148.184 126.901 1.00 39.74  ? -26 DT  J C2    1 
ATOM 10074 O O2    . DT  J 6 48  ? 100.755 146.991 126.693 1.00 39.74  ? -26 DT  J O2    1 
ATOM 10075 N N3    . DT  J 6 48  ? 99.520  148.810 127.175 1.00 39.74  ? -26 DT  J N3    1 
ATOM 10076 C C4    . DT  J 6 48  ? 99.335  150.152 127.429 1.00 39.74  ? -26 DT  J C4    1 
ATOM 10077 O O4    . DT  J 6 48  ? 98.234  150.625 127.671 1.00 39.74  ? -26 DT  J O4    1 
ATOM 10078 C C5    . DT  J 6 48  ? 100.528 150.958 127.390 1.00 39.74  ? -26 DT  J C5    1 
ATOM 10079 C C7    . DT  J 6 48  ? 100.446 152.436 127.647 1.00 39.74  ? -26 DT  J C7    1 
ATOM 10080 C C6    . DT  J 6 48  ? 101.689 150.350 127.111 1.00 39.74  ? -26 DT  J C6    1 
ATOM 10081 P P     . DA  J 6 49  ? 106.844 146.984 124.790 1.00 35.65  ? -25 DA  J P     1 
ATOM 10082 O OP1   . DA  J 6 49  ? 107.430 146.148 125.856 1.00 35.65  ? -25 DA  J OP1   1 
ATOM 10083 O OP2   . DA  J 6 49  ? 107.610 148.103 124.212 1.00 35.65  ? -25 DA  J OP2   1 
ATOM 10084 O "O5'" . DA  J 6 49  ? 106.426 146.020 123.597 1.00 35.65  ? -25 DA  J "O5'" 1 
ATOM 10085 C "C5'" . DA  J 6 49  ? 105.574 144.934 123.851 1.00 35.65  ? -25 DA  J "C5'" 1 
ATOM 10086 C "C4'" . DA  J 6 49  ? 104.300 145.043 123.039 1.00 35.65  ? -25 DA  J "C4'" 1 
ATOM 10087 O "O4'" . DA  J 6 49  ? 103.461 146.110 123.556 1.00 35.65  ? -25 DA  J "O4'" 1 
ATOM 10088 C "C3'" . DA  J 6 49  ? 104.503 145.354 121.553 1.00 35.65  ? -25 DA  J "C3'" 1 
ATOM 10089 O "O3'" . DA  J 6 49  ? 103.703 144.492 120.783 1.00 35.65  ? -25 DA  J "O3'" 1 
ATOM 10090 C "C2'" . DA  J 6 49  ? 104.013 146.795 121.433 1.00 35.65  ? -25 DA  J "C2'" 1 
ATOM 10091 C "C1'" . DA  J 6 49  ? 102.910 146.793 122.462 1.00 35.65  ? -25 DA  J "C1'" 1 
ATOM 10092 N N9    . DA  J 6 49  ? 102.511 148.117 122.889 1.00 35.65  ? -25 DA  J N9    1 
ATOM 10093 C C8    . DA  J 6 49  ? 103.301 149.216 122.990 1.00 35.65  ? -25 DA  J C8    1 
ATOM 10094 N N7    . DA  J 6 49  ? 102.668 150.281 123.415 1.00 35.65  ? -25 DA  J N7    1 
ATOM 10095 C C5    . DA  J 6 49  ? 101.373 149.844 123.588 1.00 35.65  ? -25 DA  J C5    1 
ATOM 10096 C C6    . DA  J 6 49  ? 100.203 150.493 124.012 1.00 35.65  ? -25 DA  J C6    1 
ATOM 10097 N N6    . DA  J 6 49  ? 100.162 151.780 124.348 1.00 35.65  ? -25 DA  J N6    1 
ATOM 10098 N N1    . DA  J 6 49  ? 99.068  149.769 124.068 1.00 35.65  ? -25 DA  J N1    1 
ATOM 10099 C C2    . DA  J 6 49  ? 99.116  148.483 123.719 1.00 35.65  ? -25 DA  J C2    1 
ATOM 10100 N N3    . DA  J 6 49  ? 100.156 147.767 123.305 1.00 35.65  ? -25 DA  J N3    1 
ATOM 10101 C C4    . DA  J 6 49  ? 101.261 148.514 123.263 1.00 35.65  ? -25 DA  J C4    1 
ATOM 10102 P P     . DG  J 6 50  ? 104.199 144.005 119.342 1.00 33.02  ? -24 DG  J P     1 
ATOM 10103 O OP1   . DG  J 6 50  ? 105.017 142.799 119.573 1.00 33.02  ? -24 DG  J OP1   1 
ATOM 10104 O OP2   . DG  J 6 50  ? 104.759 145.169 118.629 1.00 33.02  ? -24 DG  J OP2   1 
ATOM 10105 O "O5'" . DG  J 6 50  ? 102.848 143.587 118.602 1.00 33.02  ? -24 DG  J "O5'" 1 
ATOM 10106 C "C5'" . DG  J 6 50  ? 101.955 142.694 119.237 1.00 33.02  ? -24 DG  J "C5'" 1 
ATOM 10107 C "C4'" . DG  J 6 50  ? 100.520 143.122 119.020 1.00 33.02  ? -24 DG  J "C4'" 1 
ATOM 10108 O "O4'" . DG  J 6 50  ? 100.261 144.342 119.757 1.00 33.02  ? -24 DG  J "O4'" 1 
ATOM 10109 C "C3'" . DG  J 6 50  ? 100.156 143.411 117.572 1.00 33.02  ? -24 DG  J "C3'" 1 
ATOM 10110 O "O3'" . DG  J 6 50  ? 98.942  142.773 117.240 1.00 33.02  ? -24 DG  J "O3'" 1 
ATOM 10111 C "C2'" . DG  J 6 50  ? 100.032 144.928 117.523 1.00 33.02  ? -24 DG  J "C2'" 1 
ATOM 10112 C "C1'" . DG  J 6 50  ? 99.595  145.266 118.931 1.00 33.02  ? -24 DG  J "C1'" 1 
ATOM 10113 N N9    . DG  J 6 50  ? 99.986  146.615 119.347 1.00 33.02  ? -24 DG  J N9    1 
ATOM 10114 C C8    . DG  J 6 50  ? 101.247 147.146 119.313 1.00 33.02  ? -24 DG  J C8    1 
ATOM 10115 N N7    . DG  J 6 50  ? 101.311 148.366 119.758 1.00 33.02  ? -24 DG  J N7    1 
ATOM 10116 C C5    . DG  J 6 50  ? 100.009 148.668 120.113 1.00 33.02  ? -24 DG  J C5    1 
ATOM 10117 C C6    . DG  J 6 50  ? 99.468  149.855 120.647 1.00 33.02  ? -24 DG  J C6    1 
ATOM 10118 O O6    . DG  J 6 50  ? 100.053 150.901 120.931 1.00 33.02  ? -24 DG  J O6    1 
ATOM 10119 N N1    . DG  J 6 50  ? 98.105  149.753 120.860 1.00 33.02  ? -24 DG  J N1    1 
ATOM 10120 C C2    . DG  J 6 50  ? 97.357  148.644 120.589 1.00 33.02  ? -24 DG  J C2    1 
ATOM 10121 N N2    . DG  J 6 50  ? 96.050  148.737 120.858 1.00 33.02  ? -24 DG  J N2    1 
ATOM 10122 N N3    . DG  J 6 50  ? 97.847  147.524 120.073 1.00 33.02  ? -24 DG  J N3    1 
ATOM 10123 C C4    . DG  J 6 50  ? 99.177  147.608 119.861 1.00 33.02  ? -24 DG  J C4    1 
ATOM 10124 P P     . DC  J 6 51  ? 98.476  142.664 115.708 1.00 36.27  ? -23 DC  J P     1 
ATOM 10125 O OP1   . DC  J 6 51  ? 97.930  141.315 115.492 1.00 36.27  ? -23 DC  J OP1   1 
ATOM 10126 O OP2   . DC  J 6 51  ? 99.558  143.151 114.833 1.00 36.27  ? -23 DC  J OP2   1 
ATOM 10127 O "O5'" . DC  J 6 51  ? 97.271  143.688 115.616 1.00 36.27  ? -23 DC  J "O5'" 1 
ATOM 10128 C "C5'" . DC  J 6 51  ? 96.143  143.500 116.431 1.00 36.27  ? -23 DC  J "C5'" 1 
ATOM 10129 C "C4'" . DC  J 6 51  ? 95.277  144.739 116.433 1.00 36.27  ? -23 DC  J "C4'" 1 
ATOM 10130 O "O4'" . DC  J 6 51  ? 95.993  145.825 117.065 1.00 36.27  ? -23 DC  J "O4'" 1 
ATOM 10131 C "C3'" . DC  J 6 51  ? 94.880  145.246 115.050 1.00 36.27  ? -23 DC  J "C3'" 1 
ATOM 10132 O "O3'" . DC  J 6 51  ? 93.512  145.594 115.047 1.00 36.27  ? -23 DC  J "O3'" 1 
ATOM 10133 C "C2'" . DC  J 6 51  ? 95.765  146.472 114.862 1.00 36.27  ? -23 DC  J "C2'" 1 
ATOM 10134 C "C1'" . DC  J 6 51  ? 95.850  146.977 116.283 1.00 36.27  ? -23 DC  J "C1'" 1 
ATOM 10135 N N1    . DC  J 6 51  ? 97.002  147.845 116.537 1.00 36.27  ? -23 DC  J N1    1 
ATOM 10136 C C2    . DC  J 6 51  ? 96.847  148.973 117.332 1.00 36.27  ? -23 DC  J C2    1 
ATOM 10137 O O2    . DC  J 6 51  ? 95.737  149.248 117.782 1.00 36.27  ? -23 DC  J O2    1 
ATOM 10138 N N3    . DC  J 6 51  ? 97.909  149.771 117.558 1.00 36.27  ? -23 DC  J N3    1 
ATOM 10139 C C4    . DC  J 6 51  ? 99.091  149.459 117.045 1.00 36.27  ? -23 DC  J C4    1 
ATOM 10140 N N4    . DC  J 6 51  ? 100.112 150.273 117.306 1.00 36.27  ? -23 DC  J N4    1 
ATOM 10141 C C5    . DC  J 6 51  ? 99.276  148.300 116.242 1.00 36.27  ? -23 DC  J C5    1 
ATOM 10142 C C6    . DC  J 6 51  ? 98.208  147.534 116.010 1.00 36.27  ? -23 DC  J C6    1 
ATOM 10143 P P     . DA  J 6 52  ? 92.704  145.655 113.664 1.00 41.33  ? -22 DA  J P     1 
ATOM 10144 O OP1   . DA  J 6 52  ? 91.424  144.947 113.865 1.00 41.33  ? -22 DA  J OP1   1 
ATOM 10145 O OP2   . DA  J 6 52  ? 93.629  145.232 112.593 1.00 41.33  ? -22 DA  J OP2   1 
ATOM 10146 O "O5'" . DA  J 6 52  ? 92.395  147.209 113.465 1.00 41.33  ? -22 DA  J "O5'" 1 
ATOM 10147 C "C5'" . DA  J 6 52  ? 91.450  147.854 114.308 1.00 41.33  ? -22 DA  J "C5'" 1 
ATOM 10148 C "C4'" . DA  J 6 52  ? 91.509  149.364 114.144 1.00 41.33  ? -22 DA  J "C4'" 1 
ATOM 10149 O "O4'" . DA  J 6 52  ? 92.726  149.875 114.746 1.00 41.33  ? -22 DA  J "O4'" 1 
ATOM 10150 C "C3'" . DA  J 6 52  ? 91.512  149.864 112.696 1.00 41.33  ? -22 DA  J "C3'" 1 
ATOM 10151 O "O3'" . DA  J 6 52  ? 90.617  150.954 112.562 1.00 41.33  ? -22 DA  J "O3'" 1 
ATOM 10152 C "C2'" . DA  J 6 52  ? 92.953  150.310 112.490 1.00 41.33  ? -22 DA  J "C2'" 1 
ATOM 10153 C "C1'" . DA  J 6 52  ? 93.297  150.813 113.874 1.00 41.33  ? -22 DA  J "C1'" 1 
ATOM 10154 N N9    . DA  J 6 52  ? 94.726  150.879 114.123 1.00 41.33  ? -22 DA  J N9    1 
ATOM 10155 C C8    . DA  J 6 52  ? 95.606  149.843 114.138 1.00 41.33  ? -22 DA  J C8    1 
ATOM 10156 N N7    . DA  J 6 52  ? 96.839  150.198 114.386 1.00 41.33  ? -22 DA  J N7    1 
ATOM 10157 C C5    . DA  J 6 52  ? 96.758  151.564 114.540 1.00 41.33  ? -22 DA  J C5    1 
ATOM 10158 C C6    . DA  J 6 52  ? 97.721  152.544 114.810 1.00 41.33  ? -22 DA  J C6    1 
ATOM 10159 N N6    . DA  J 6 52  ? 99.011  152.272 115.005 1.00 41.33  ? -22 DA  J N6    1 
ATOM 10160 N N1    . DA  J 6 52  ? 97.300  153.822 114.910 1.00 41.33  ? -22 DA  J N1    1 
ATOM 10161 C C2    . DA  J 6 52  ? 96.008  154.091 114.732 1.00 41.33  ? -22 DA  J C2    1 
ATOM 10162 N N3    . DA  J 6 52  ? 95.017  153.256 114.460 1.00 41.33  ? -22 DA  J N3    1 
ATOM 10163 C C4    . DA  J 6 52  ? 95.459  151.996 114.404 1.00 41.33  ? -22 DA  J C4    1 
ATOM 10164 P P     . DC  J 6 53  ? 89.886  151.241 111.160 1.00 46.28  ? -21 DC  J P     1 
ATOM 10165 O OP1   . DC  J 6 53  ? 88.495  150.752 111.273 1.00 46.28  ? -21 DC  J OP1   1 
ATOM 10166 O OP2   . DC  J 6 53  ? 90.754  150.750 110.069 1.00 46.28  ? -21 DC  J OP2   1 
ATOM 10167 O "O5'" . DC  J 6 53  ? 89.860  152.834 111.068 1.00 46.28  ? -21 DC  J "O5'" 1 
ATOM 10168 C "C5'" . DC  J 6 53  ? 90.395  153.606 112.129 1.00 46.28  ? -21 DC  J "C5'" 1 
ATOM 10169 C "C4'" . DC  J 6 53  ? 91.024  154.881 111.605 1.00 46.28  ? -21 DC  J "C4'" 1 
ATOM 10170 O "O4'" . DC  J 6 53  ? 92.413  154.942 112.031 1.00 46.28  ? -21 DC  J "O4'" 1 
ATOM 10171 C "C3'" . DC  J 6 53  ? 91.057  155.000 110.084 1.00 46.28  ? -21 DC  J "C3'" 1 
ATOM 10172 O "O3'" . DC  J 6 53  ? 90.948  156.357 109.712 1.00 46.28  ? -21 DC  J "O3'" 1 
ATOM 10173 C "C2'" . DC  J 6 53  ? 92.437  154.466 109.765 1.00 46.28  ? -21 DC  J "C2'" 1 
ATOM 10174 C "C1'" . DC  J 6 53  ? 93.226  155.091 110.895 1.00 46.28  ? -21 DC  J "C1'" 1 
ATOM 10175 N N1    . DC  J 6 53  ? 94.527  154.430 111.129 1.00 46.28  ? -21 DC  J N1    1 
ATOM 10176 C C2    . DC  J 6 53  ? 95.655  155.201 111.400 1.00 46.28  ? -21 DC  J C2    1 
ATOM 10177 O O2    . DC  J 6 53  ? 95.544  156.428 111.440 1.00 46.28  ? -21 DC  J O2    1 
ATOM 10178 N N3    . DC  J 6 53  ? 96.839  154.583 111.576 1.00 46.28  ? -21 DC  J N3    1 
ATOM 10179 C C4    . DC  J 6 53  ? 96.910  153.257 111.511 1.00 46.28  ? -21 DC  J C4    1 
ATOM 10180 N N4    . DC  J 6 53  ? 98.102  152.689 111.700 1.00 46.28  ? -21 DC  J N4    1 
ATOM 10181 C C5    . DC  J 6 53  ? 95.775  152.456 111.214 1.00 46.28  ? -21 DC  J C5    1 
ATOM 10182 C C6    . DC  J 6 53  ? 94.614  153.079 111.049 1.00 46.28  ? -21 DC  J C6    1 
ATOM 10183 P P     . DC  J 6 54  ? 90.421  156.763 108.250 1.00 51.81  ? -20 DC  J P     1 
ATOM 10184 O OP1   . DC  J 6 54  ? 88.976  156.458 108.190 1.00 51.81  ? -20 DC  J OP1   1 
ATOM 10185 O OP2   . DC  J 6 54  ? 91.333  156.195 107.239 1.00 51.81  ? -20 DC  J OP2   1 
ATOM 10186 O "O5'" . DC  J 6 54  ? 90.607  158.344 108.217 1.00 51.81  ? -20 DC  J "O5'" 1 
ATOM 10187 C "C5'" . DC  J 6 54  ? 91.506  158.959 109.121 1.00 51.81  ? -20 DC  J "C5'" 1 
ATOM 10188 C "C4'" . DC  J 6 54  ? 92.564  159.747 108.379 1.00 51.81  ? -20 DC  J "C4'" 1 
ATOM 10189 O "O4'" . DC  J 6 54  ? 93.879  159.228 108.715 1.00 51.81  ? -20 DC  J "O4'" 1 
ATOM 10190 C "C3'" . DC  J 6 54  ? 92.466  159.682 106.858 1.00 51.81  ? -20 DC  J "C3'" 1 
ATOM 10191 O "O3'" . DC  J 6 54  ? 92.865  160.917 106.306 1.00 51.81  ? -20 DC  J "O3'" 1 
ATOM 10192 C "C2'" . DC  J 6 54  ? 93.458  158.582 106.514 1.00 51.81  ? -20 DC  J "C2'" 1 
ATOM 10193 C "C1'" . DC  J 6 54  ? 94.548  158.844 107.535 1.00 51.81  ? -20 DC  J "C1'" 1 
ATOM 10194 N N1    . DC  J 6 54  ? 95.372  157.649 107.827 1.00 51.81  ? -20 DC  J N1    1 
ATOM 10195 C C2    . DC  J 6 54  ? 96.738  157.793 108.080 1.00 51.81  ? -20 DC  J C2    1 
ATOM 10196 O O2    . DC  J 6 54  ? 97.245  158.921 108.050 1.00 51.81  ? -20 DC  J O2    1 
ATOM 10197 N N3    . DC  J 6 54  ? 97.470  156.688 108.341 1.00 51.81  ? -20 DC  J N3    1 
ATOM 10198 C C4    . DC  J 6 54  ? 96.889  155.492 108.356 1.00 51.81  ? -20 DC  J C4    1 
ATOM 10199 N N4    . DC  J 6 54  ? 97.652  154.435 108.624 1.00 51.81  ? -20 DC  J N4    1 
ATOM 10200 C C5    . DC  J 6 54  ? 95.504  155.325 108.090 1.00 51.81  ? -20 DC  J C5    1 
ATOM 10201 C C6    . DC  J 6 54  ? 94.789  156.420 107.844 1.00 51.81  ? -20 DC  J C6    1 
ATOM 10202 P P     . DG  J 6 55  ? 92.371  161.364 104.844 1.00 54.24  ? -19 DG  J P     1 
ATOM 10203 O OP1   . DG  J 6 55  ? 91.335  162.399 105.038 1.00 54.24  ? -19 DG  J OP1   1 
ATOM 10204 O OP2   . DG  J 6 55  ? 92.065  160.169 104.030 1.00 54.24  ? -19 DG  J OP2   1 
ATOM 10205 O "O5'" . DG  J 6 55  ? 93.668  162.047 104.218 1.00 54.24  ? -19 DG  J "O5'" 1 
ATOM 10206 C "C5'" . DG  J 6 55  ? 94.356  163.041 104.955 1.00 54.24  ? -19 DG  J "C5'" 1 
ATOM 10207 C "C4'" . DG  J 6 55  ? 95.815  163.101 104.554 1.00 54.24  ? -19 DG  J "C4'" 1 
ATOM 10208 O "O4'" . DG  J 6 55  ? 96.528  161.978 105.127 1.00 54.24  ? -19 DG  J "O4'" 1 
ATOM 10209 C "C3'" . DG  J 6 55  ? 96.076  163.057 103.054 1.00 54.24  ? -19 DG  J "C3'" 1 
ATOM 10210 O "O3'" . DG  J 6 55  ? 97.051  164.027 102.729 1.00 54.24  ? -19 DG  J "O3'" 1 
ATOM 10211 C "C2'" . DG  J 6 55  ? 96.592  161.632 102.826 1.00 54.24  ? -19 DG  J "C2'" 1 
ATOM 10212 C "C1'" . DG  J 6 55  ? 97.299  161.345 104.135 1.00 54.24  ? -19 DG  J "C1'" 1 
ATOM 10213 N N9    . DG  J 6 55  ? 97.369  159.927 104.466 1.00 54.24  ? -19 DG  J N9    1 
ATOM 10214 C C8    . DG  J 6 55  ? 96.325  159.046 104.534 1.00 54.24  ? -19 DG  J C8    1 
ATOM 10215 N N7    . DG  J 6 55  ? 96.680  157.843 104.878 1.00 54.24  ? -19 DG  J N7    1 
ATOM 10216 C C5    . DG  J 6 55  ? 98.049  157.935 105.051 1.00 54.24  ? -19 DG  J C5    1 
ATOM 10217 C C6    . DG  J 6 55  ? 98.984  156.950 105.421 1.00 54.24  ? -19 DG  J C6    1 
ATOM 10218 O O6    . DG  J 6 55  ? 98.783  155.762 105.676 1.00 54.24  ? -19 DG  J O6    1 
ATOM 10219 N N1    . DG  J 6 55  ? 100.276 157.455 105.465 1.00 54.24  ? -19 DG  J N1    1 
ATOM 10220 C C2    . DG  J 6 55  ? 100.621 158.752 105.206 1.00 54.24  ? -19 DG  J C2    1 
ATOM 10221 N N2    . DG  J 6 55  ? 101.921 159.051 105.314 1.00 54.24  ? -19 DG  J N2    1 
ATOM 10222 N N3    . DG  J 6 55  ? 99.755  159.690 104.856 1.00 54.24  ? -19 DG  J N3    1 
ATOM 10223 C C4    . DG  J 6 55  ? 98.490  159.210 104.799 1.00 54.24  ? -19 DG  J C4    1 
ATOM 10224 P P     . DC  J 6 56  ? 97.221  164.563 101.223 1.00 53.81  ? -18 DC  J P     1 
ATOM 10225 O OP1   . DC  J 6 56  ? 96.904  166.006 101.227 1.00 53.81  ? -18 DC  J OP1   1 
ATOM 10226 O OP2   . DC  J 6 56  ? 96.509  163.671 100.285 1.00 53.81  ? -18 DC  J OP2   1 
ATOM 10227 O "O5'" . DC  J 6 56  ? 98.782  164.396 100.965 1.00 53.81  ? -18 DC  J "O5'" 1 
ATOM 10228 C "C5'" . DC  J 6 56  ? 99.571  163.651 101.889 1.00 53.81  ? -18 DC  J "C5'" 1 
ATOM 10229 C "C4'" . DC  J 6 56  ? 100.997 163.555 101.406 1.00 53.81  ? -18 DC  J "C4'" 1 
ATOM 10230 O "O4'" . DC  J 6 56  ? 101.537 162.260 101.767 1.00 53.81  ? -18 DC  J "O4'" 1 
ATOM 10231 C "C3'" . DC  J 6 56  ? 101.146 163.621 99.905  1.00 53.81  ? -18 DC  J "C3'" 1 
ATOM 10232 O "O3'" . DC  J 6 56  ? 102.491 163.961 99.585  1.00 53.81  ? -18 DC  J "O3'" 1 
ATOM 10233 C "C2'" . DC  J 6 56  ? 100.809 162.182 99.523  1.00 53.81  ? -18 DC  J "C2'" 1 
ATOM 10234 C "C1'" . DC  J 6 56  ? 101.484 161.394 100.646 1.00 53.81  ? -18 DC  J "C1'" 1 
ATOM 10235 N N1    . DC  J 6 56  ? 100.750 160.170 101.057 1.00 53.81  ? -18 DC  J N1    1 
ATOM 10236 C C2    . DC  J 6 56  ? 101.448 159.118 101.658 1.00 53.81  ? -18 DC  J C2    1 
ATOM 10237 O O2    . DC  J 6 56  ? 102.669 159.201 101.800 1.00 53.81  ? -18 DC  J O2    1 
ATOM 10238 N N3    . DC  J 6 56  ? 100.775 158.016 102.036 1.00 53.81  ? -18 DC  J N3    1 
ATOM 10239 C C4    . DC  J 6 56  ? 99.458  157.953 101.866 1.00 53.81  ? -18 DC  J C4    1 
ATOM 10240 N N4    . DC  J 6 56  ? 98.841  156.840 102.254 1.00 53.81  ? -18 DC  J N4    1 
ATOM 10241 C C5    . DC  J 6 56  ? 98.721  159.015 101.267 1.00 53.81  ? -18 DC  J C5    1 
ATOM 10242 C C6    . DC  J 6 56  ? 99.401  160.097 100.884 1.00 53.81  ? -18 DC  J C6    1 
ATOM 10243 P P     . DT  J 6 57  ? 102.906 164.483 98.121  1.00 47.61  ? -17 DT  J P     1 
ATOM 10244 O OP1   . DT  J 6 57  ? 103.295 165.899 98.256  1.00 47.61  ? -17 DT  J OP1   1 
ATOM 10245 O OP2   . DT  J 6 57  ? 101.862 164.126 97.140  1.00 47.61  ? -17 DT  J OP2   1 
ATOM 10246 O "O5'" . DT  J 6 57  ? 104.202 163.609 97.804  1.00 47.61  ? -17 DT  J "O5'" 1 
ATOM 10247 C "C5'" . DT  J 6 57  ? 104.336 162.364 98.447  1.00 47.61  ? -17 DT  J "C5'" 1 
ATOM 10248 C "C4'" . DT  J 6 57  ? 105.647 161.699 98.132  1.00 47.61  ? -17 DT  J "C4'" 1 
ATOM 10249 O "O4'" . DT  J 6 57  ? 105.575 160.323 98.560  1.00 47.61  ? -17 DT  J "O4'" 1 
ATOM 10250 C "C3'" . DT  J 6 57  ? 105.973 161.597 96.669  1.00 47.61  ? -17 DT  J "C3'" 1 
ATOM 10251 O "O3'" . DT  J 6 57  ? 107.346 161.303 96.539  1.00 47.61  ? -17 DT  J "O3'" 1 
ATOM 10252 C "C2'" . DT  J 6 57  ? 105.093 160.419 96.245  1.00 47.61  ? -17 DT  J "C2'" 1 
ATOM 10253 C "C1'" . DT  J 6 57  ? 105.139 159.517 97.479  1.00 47.61  ? -17 DT  J "C1'" 1 
ATOM 10254 N N1    . DT  J 6 57  ? 103.822 158.909 97.854  1.00 47.61  ? -17 DT  J N1    1 
ATOM 10255 C C2    . DT  J 6 57  ? 103.811 157.849 98.720  1.00 47.61  ? -17 DT  J C2    1 
ATOM 10256 O O2    . DT  J 6 57  ? 104.822 157.373 99.188  1.00 47.61  ? -17 DT  J O2    1 
ATOM 10257 N N3    . DT  J 6 57  ? 102.570 157.357 99.023  1.00 47.61  ? -17 DT  J N3    1 
ATOM 10258 C C4    . DT  J 6 57  ? 101.363 157.828 98.561  1.00 47.61  ? -17 DT  J C4    1 
ATOM 10259 O O4    . DT  J 6 57  ? 100.299 157.328 98.894  1.00 47.61  ? -17 DT  J O4    1 
ATOM 10260 C C5    . DT  J 6 57  ? 101.443 158.947 97.649  1.00 47.61  ? -17 DT  J C5    1 
ATOM 10261 C C7    . DT  J 6 57  ? 100.194 159.537 97.072  1.00 47.61  ? -17 DT  J C7    1 
ATOM 10262 C C6    . DT  J 6 57  ? 102.654 159.426 97.343  1.00 47.61  ? -17 DT  J C6    1 
ATOM 10263 P P     . DT  J 6 58  ? 108.013 161.117 95.095  1.00 43.32  ? -16 DT  J P     1 
ATOM 10264 O OP1   . DT  J 6 58  ? 109.437 161.491 95.227  1.00 43.32  ? -16 DT  J OP1   1 
ATOM 10265 O OP2   . DT  J 6 58  ? 107.164 161.787 94.088  1.00 43.32  ? -16 DT  J OP2   1 
ATOM 10266 O "O5'" . DT  J 6 58  ? 107.926 159.549 94.849  1.00 43.32  ? -16 DT  J "O5'" 1 
ATOM 10267 C "C5'" . DT  J 6 58  ? 108.516 158.668 95.773  1.00 43.32  ? -16 DT  J "C5'" 1 
ATOM 10268 C "C4'" . DT  J 6 58  ? 108.103 157.250 95.474  1.00 43.32  ? -16 DT  J "C4'" 1 
ATOM 10269 O "O4'" . DT  J 6 58  ? 106.690 157.109 95.728  1.00 43.32  ? -16 DT  J "O4'" 1 
ATOM 10270 C "C3'" . DT  J 6 58  ? 108.328 156.819 94.026  1.00 43.32  ? -16 DT  J "C3'" 1 
ATOM 10271 O "O3'" . DT  J 6 58  ? 109.025 155.604 93.998  1.00 43.32  ? -16 DT  J "O3'" 1 
ATOM 10272 C "C2'" . DT  J 6 58  ? 106.918 156.678 93.454  1.00 43.32  ? -16 DT  J "C2'" 1 
ATOM 10273 C "C1'" . DT  J 6 58  ? 106.103 156.372 94.695  1.00 43.32  ? -16 DT  J "C1'" 1 
ATOM 10274 N N1    . DT  J 6 58  ? 104.698 156.784 94.590  1.00 43.32  ? -16 DT  J N1    1 
ATOM 10275 C C2    . DT  J 6 58  ? 103.762 156.124 95.332  1.00 43.32  ? -16 DT  J C2    1 
ATOM 10276 O O2    . DT  J 6 58  ? 104.033 155.195 96.063  1.00 43.32  ? -16 DT  J O2    1 
ATOM 10277 N N3    . DT  J 6 58  ? 102.482 156.560 95.164  1.00 43.32  ? -16 DT  J N3    1 
ATOM 10278 C C4    . DT  J 6 58  ? 102.063 157.606 94.369  1.00 43.32  ? -16 DT  J C4    1 
ATOM 10279 O O4    . DT  J 6 58  ? 100.890 157.934 94.288  1.00 43.32  ? -16 DT  J O4    1 
ATOM 10280 C C5    . DT  J 6 58  ? 103.100 158.265 93.620  1.00 43.32  ? -16 DT  J C5    1 
ATOM 10281 C C7    . DT  J 6 58  ? 102.761 159.406 92.711  1.00 43.32  ? -16 DT  J C7    1 
ATOM 10282 C C6    . DT  J 6 58  ? 104.356 157.829 93.767  1.00 43.32  ? -16 DT  J C6    1 
ATOM 10283 P P     . DA  J 6 59  ? 110.526 155.561 93.441  1.00 41.08  ? -15 DA  J P     1 
ATOM 10284 O OP1   . DA  J 6 59  ? 111.329 156.539 94.199  1.00 41.08  ? -15 DA  J OP1   1 
ATOM 10285 O OP2   . DA  J 6 59  ? 110.440 155.679 91.975  1.00 41.08  ? -15 DA  J OP2   1 
ATOM 10286 O "O5'" . DA  J 6 59  ? 111.011 154.078 93.777  1.00 41.08  ? -15 DA  J "O5'" 1 
ATOM 10287 C "C5'" . DA  J 6 59  ? 110.971 153.599 95.120  1.00 41.08  ? -15 DA  J "C5'" 1 
ATOM 10288 C "C4'" . DA  J 6 59  ? 110.317 152.222 95.214  1.00 41.08  ? -15 DA  J "C4'" 1 
ATOM 10289 O "O4'" . DA  J 6 59  ? 108.904 152.313 94.914  1.00 41.08  ? -15 DA  J "O4'" 1 
ATOM 10290 C "C3'" . DA  J 6 59  ? 110.884 151.147 94.300  1.00 41.08  ? -15 DA  J "C3'" 1 
ATOM 10291 O "O3'" . DA  J 6 59  ? 110.933 149.915 95.009  1.00 41.08  ? -15 DA  J "O3'" 1 
ATOM 10292 C "C2'" . DA  J 6 59  ? 109.897 151.110 93.130  1.00 41.08  ? -15 DA  J "C2'" 1 
ATOM 10293 C "C1'" . DA  J 6 59  ? 108.585 151.580 93.746  1.00 41.08  ? -15 DA  J "C1'" 1 
ATOM 10294 N N9    . DA  J 6 59  ? 107.835 152.469 92.871  1.00 41.08  ? -15 DA  J N9    1 
ATOM 10295 C C8    . DA  J 6 59  ? 108.354 153.350 91.977  1.00 41.08  ? -15 DA  J C8    1 
ATOM 10296 N N7    . DA  J 6 59  ? 107.458 154.044 91.338  1.00 41.08  ? -15 DA  J N7    1 
ATOM 10297 C C5    . DA  J 6 59  ? 106.264 153.588 91.850  1.00 41.08  ? -15 DA  J C5    1 
ATOM 10298 C C6    . DA  J 6 59  ? 104.939 153.932 91.580  1.00 41.08  ? -15 DA  J C6    1 
ATOM 10299 N N6    . DA  J 6 59  ? 104.599 154.851 90.681  1.00 41.08  ? -15 DA  J N6    1 
ATOM 10300 N N1    . DA  J 6 59  ? 103.975 153.290 92.259  1.00 41.08  ? -15 DA  J N1    1 
ATOM 10301 C C2    . DA  J 6 59  ? 104.324 152.363 93.151  1.00 41.08  ? -15 DA  J C2    1 
ATOM 10302 N N3    . DA  J 6 59  ? 105.544 151.959 93.494  1.00 41.08  ? -15 DA  J N3    1 
ATOM 10303 C C4    . DA  J 6 59  ? 106.475 152.616 92.796  1.00 41.08  ? -15 DA  J C4    1 
ATOM 10304 P P     . DA  J 6 60  ? 111.285 148.526 94.278  1.00 40.20  ? -14 DA  J P     1 
ATOM 10305 O OP1   . DA  J 6 60  ? 111.920 147.681 95.308  1.00 40.20  ? -14 DA  J OP1   1 
ATOM 10306 O OP2   . DA  J 6 60  ? 112.007 148.729 93.001  1.00 40.20  ? -14 DA  J OP2   1 
ATOM 10307 O "O5'" . DA  J 6 60  ? 109.850 147.916 93.968  1.00 40.20  ? -14 DA  J "O5'" 1 
ATOM 10308 C "C5'" . DA  J 6 60  ? 108.834 148.011 94.950  1.00 40.20  ? -14 DA  J "C5'" 1 
ATOM 10309 C "C4'" . DA  J 6 60  ? 107.493 147.614 94.376  1.00 40.20  ? -14 DA  J "C4'" 1 
ATOM 10310 O "O4'" . DA  J 6 60  ? 106.936 148.713 93.606  1.00 40.20  ? -14 DA  J "O4'" 1 
ATOM 10311 C "C3'" . DA  J 6 60  ? 107.536 146.417 93.438  1.00 40.20  ? -14 DA  J "C3'" 1 
ATOM 10312 O "O3'" . DA  J 6 60  ? 106.484 145.548 93.753  1.00 40.20  ? -14 DA  J "O3'" 1 
ATOM 10313 C "C2'" . DA  J 6 60  ? 107.347 147.049 92.059  1.00 40.20  ? -14 DA  J "C2'" 1 
ATOM 10314 C "C1'" . DA  J 6 60  ? 106.445 148.217 92.389  1.00 40.20  ? -14 DA  J "C1'" 1 
ATOM 10315 N N9    . DA  J 6 60  ? 106.497 149.280 91.395  1.00 40.20  ? -14 DA  J N9    1 
ATOM 10316 C C8    . DA  J 6 60  ? 107.613 149.816 90.838  1.00 40.20  ? -14 DA  J C8    1 
ATOM 10317 N N7    . DA  J 6 60  ? 107.368 150.761 89.968  1.00 40.20  ? -14 DA  J N7    1 
ATOM 10318 C C5    . DA  J 6 60  ? 105.995 150.840 89.945  1.00 40.20  ? -14 DA  J C5    1 
ATOM 10319 C C6    . DA  J 6 60  ? 105.108 151.648 89.221  1.00 40.20  ? -14 DA  J C6    1 
ATOM 10320 N N6    . DA  J 6 60  ? 105.506 152.566 88.343  1.00 40.20  ? -14 DA  J N6    1 
ATOM 10321 N N1    . DA  J 6 60  ? 103.794 151.479 89.431  1.00 40.20  ? -14 DA  J N1    1 
ATOM 10322 C C2    . DA  J 6 60  ? 103.398 150.564 90.313  1.00 40.20  ? -14 DA  J C2    1 
ATOM 10323 N N3    . DA  J 6 60  ? 104.141 149.741 91.050  1.00 40.20  ? -14 DA  J N3    1 
ATOM 10324 C C4    . DA  J 6 60  ? 105.440 149.939 90.822  1.00 40.20  ? -14 DA  J C4    1 
ATOM 10325 P P     . DA  J 6 61  ? 106.547 144.003 93.330  1.00 38.53  ? -13 DA  J P     1 
ATOM 10326 O OP1   . DA  J 6 61  ? 106.706 143.231 94.577  1.00 38.53  ? -13 DA  J OP1   1 
ATOM 10327 O OP2   . DA  J 6 61  ? 107.515 143.813 92.228  1.00 38.53  ? -13 DA  J OP2   1 
ATOM 10328 O "O5'" . DA  J 6 61  ? 105.098 143.745 92.726  1.00 38.53  ? -13 DA  J "O5'" 1 
ATOM 10329 C "C5'" . DA  J 6 61  ? 103.975 144.327 93.345  1.00 38.53  ? -13 DA  J "C5'" 1 
ATOM 10330 C "C4'" . DA  J 6 61  ? 102.941 144.711 92.313  1.00 38.53  ? -13 DA  J "C4'" 1 
ATOM 10331 O "O4'" . DA  J 6 61  ? 103.349 145.919 91.634  1.00 38.53  ? -13 DA  J "O4'" 1 
ATOM 10332 C "C3'" . DA  J 6 61  ? 102.709 143.672 91.218  1.00 38.53  ? -13 DA  J "C3'" 1 
ATOM 10333 O "O3'" . DA  J 6 61  ? 101.350 143.310 91.195  1.00 38.53  ? -13 DA  J "O3'" 1 
ATOM 10334 C "C2'" . DA  J 6 61  ? 103.127 144.391 89.933  1.00 38.53  ? -13 DA  J "C2'" 1 
ATOM 10335 C "C1'" . DA  J 6 61  ? 102.925 145.837 90.304  1.00 38.53  ? -13 DA  J "C1'" 1 
ATOM 10336 N N9    . DA  J 6 61  ? 103.736 146.727 89.503  1.00 38.53  ? -13 DA  J N9    1 
ATOM 10337 C C8    . DA  J 6 61  ? 105.087 146.765 89.463  1.00 38.53  ? -13 DA  J C8    1 
ATOM 10338 N N7    . DA  J 6 61  ? 105.570 147.651 88.637  1.00 38.53  ? -13 DA  J N7    1 
ATOM 10339 C C5    . DA  J 6 61  ? 104.452 148.227 88.088  1.00 38.53  ? -13 DA  J C5    1 
ATOM 10340 C C6    . DA  J 6 61  ? 104.286 149.234 87.131  1.00 38.53  ? -13 DA  J C6    1 
ATOM 10341 N N6    . DA  J 6 61  ? 105.307 149.860 86.553  1.00 38.53  ? -13 DA  J N6    1 
ATOM 10342 N N1    . DA  J 6 61  ? 103.032 149.581 86.795  1.00 38.53  ? -13 DA  J N1    1 
ATOM 10343 C C2    . DA  J 6 61  ? 102.012 148.948 87.379  1.00 38.53  ? -13 DA  J C2    1 
ATOM 10344 N N3    . DA  J 6 61  ? 102.046 147.978 88.291  1.00 38.53  ? -13 DA  J N3    1 
ATOM 10345 C C4    . DA  J 6 61  ? 103.308 147.665 88.605  1.00 38.53  ? -13 DA  J C4    1 
ATOM 10346 P P     . DC  J 6 62  ? 100.794 142.247 90.129  1.00 37.33  ? -12 DC  J P     1 
ATOM 10347 O OP1   . DC  J 6 62  ? 99.645  141.584 90.776  1.00 37.33  ? -12 DC  J OP1   1 
ATOM 10348 O OP2   . DC  J 6 62  ? 101.902 141.416 89.614  1.00 37.33  ? -12 DC  J OP2   1 
ATOM 10349 O "O5'" . DC  J 6 62  ? 100.256 143.163 88.942  1.00 37.33  ? -12 DC  J "O5'" 1 
ATOM 10350 C "C5'" . DC  J 6 62  ? 99.529  144.344 89.247  1.00 37.33  ? -12 DC  J "C5'" 1 
ATOM 10351 C "C4'" . DC  J 6 62  ? 98.996  144.981 87.988  1.00 37.33  ? -12 DC  J "C4'" 1 
ATOM 10352 O "O4'" . DC  J 6 62  ? 99.988  145.881 87.428  1.00 37.33  ? -12 DC  J "O4'" 1 
ATOM 10353 C "C3'" . DC  J 6 62  ? 98.650  143.988 86.889  1.00 37.33  ? -12 DC  J "C3'" 1 
ATOM 10354 O "O3'" . DC  J 6 62  ? 97.384  144.286 86.353  1.00 37.33  ? -12 DC  J "O3'" 1 
ATOM 10355 C "C2'" . DC  J 6 62  ? 99.761  144.189 85.863  1.00 37.33  ? -12 DC  J "C2'" 1 
ATOM 10356 C "C1'" . DC  J 6 62  ? 100.095 145.658 86.043  1.00 37.33  ? -12 DC  J "C1'" 1 
ATOM 10357 N N1    . DC  J 6 62  ? 101.490 146.022 85.618  1.00 37.33  ? -12 DC  J N1    1 
ATOM 10358 C C2    . DC  J 6 62  ? 101.707 146.979 84.614  1.00 37.33  ? -12 DC  J C2    1 
ATOM 10359 O O2    . DC  J 6 62  ? 100.743 147.510 84.063  1.00 37.33  ? -12 DC  J O2    1 
ATOM 10360 N N3    . DC  J 6 62  ? 102.979 147.288 84.270  1.00 37.33  ? -12 DC  J N3    1 
ATOM 10361 C C4    . DC  J 6 62  ? 103.991 146.691 84.875  1.00 37.33  ? -12 DC  J C4    1 
ATOM 10362 N N4    . DC  J 6 62  ? 105.226 147.018 84.502  1.00 37.33  ? -12 DC  J N4    1 
ATOM 10363 C C5    . DC  J 6 62  ? 103.792 145.722 85.891  1.00 37.33  ? -12 DC  J C5    1 
ATOM 10364 C C6    . DC  J 6 62  ? 102.540 145.425 86.229  1.00 37.33  ? -12 DC  J C6    1 
ATOM 10365 P P     . DG  J 6 63  ? 96.661  143.234 85.381  1.00 38.66  ? -11 DG  J P     1 
ATOM 10366 O OP1   . DG  J 6 63  ? 95.209  143.334 85.641  1.00 38.66  ? -11 DG  J OP1   1 
ATOM 10367 O OP2   . DG  J 6 63  ? 97.340  141.932 85.549  1.00 38.66  ? -11 DG  J OP2   1 
ATOM 10368 O "O5'" . DG  J 6 63  ? 96.990  143.780 83.910  1.00 38.66  ? -11 DG  J "O5'" 1 
ATOM 10369 C "C5'" . DG  J 6 63  ? 96.539  145.072 83.519  1.00 38.66  ? -11 DG  J "C5'" 1 
ATOM 10370 C "C4'" . DG  J 6 63  ? 97.133  145.493 82.185  1.00 38.66  ? -11 DG  J "C4'" 1 
ATOM 10371 O "O4'" . DG  J 6 63  ? 98.528  145.850 82.352  1.00 38.66  ? -11 DG  J "O4'" 1 
ATOM 10372 C "C3'" . DG  J 6 63  ? 97.101  144.435 81.079  1.00 38.66  ? -11 DG  J "C3'" 1 
ATOM 10373 O "O3'" . DG  J 6 63  ? 96.685  145.045 79.872  1.00 38.66  ? -11 DG  J "O3'" 1 
ATOM 10374 C "C2'" . DG  J 6 63  ? 98.557  143.997 80.993  1.00 38.66  ? -11 DG  J "C2'" 1 
ATOM 10375 C "C1'" . DG  J 6 63  ? 99.256  145.300 81.288  1.00 38.66  ? -11 DG  J "C1'" 1 
ATOM 10376 N N9    . DG  J 6 63  ? 100.631 145.134 81.712  1.00 38.66  ? -11 DG  J N9    1 
ATOM 10377 C C8    . DG  J 6 63  ? 101.084 144.349 82.733  1.00 38.66  ? -11 DG  J C8    1 
ATOM 10378 N N7    . DG  J 6 63  ? 102.370 144.400 82.901  1.00 38.66  ? -11 DG  J N7    1 
ATOM 10379 C C5    . DG  J 6 63  ? 102.800 145.260 81.908  1.00 38.66  ? -11 DG  J C5    1 
ATOM 10380 C C6    . DG  J 6 63  ? 104.098 145.696 81.594  1.00 38.66  ? -11 DG  J C6    1 
ATOM 10381 O O6    . DG  J 6 63  ? 105.154 145.398 82.153  1.00 38.66  ? -11 DG  J O6    1 
ATOM 10382 N N1    . DG  J 6 63  ? 104.103 146.570 80.509  1.00 38.66  ? -11 DG  J N1    1 
ATOM 10383 C C2    . DG  J 6 63  ? 102.983 146.976 79.824  1.00 38.66  ? -11 DG  J C2    1 
ATOM 10384 N N2    . DG  J 6 63  ? 103.183 147.828 78.810  1.00 38.66  ? -11 DG  J N2    1 
ATOM 10385 N N3    . DG  J 6 63  ? 101.753 146.573 80.114  1.00 38.66  ? -11 DG  J N3    1 
ATOM 10386 C C4    . DG  J 6 63  ? 101.739 145.731 81.175  1.00 38.66  ? -11 DG  J C4    1 
ATOM 10387 P P     . DC  J 6 64  ? 96.170  144.164 78.631  1.00 39.20  ? -10 DC  J P     1 
ATOM 10388 O OP1   . DC  J 6 64  ? 94.776  144.583 78.377  1.00 39.20  ? -10 DC  J OP1   1 
ATOM 10389 O OP2   . DC  J 6 64  ? 96.452  142.735 78.875  1.00 39.20  ? -10 DC  J OP2   1 
ATOM 10390 O "O5'" . DC  J 6 64  ? 97.087  144.654 77.414  1.00 39.20  ? -10 DC  J "O5'" 1 
ATOM 10391 C "C5'" . DC  J 6 64  ? 97.002  146.003 76.963  1.00 39.20  ? -10 DC  J "C5'" 1 
ATOM 10392 C "C4'" . DC  J 6 64  ? 98.056  146.312 75.909  1.00 39.20  ? -10 DC  J "C4'" 1 
ATOM 10393 O "O4'" . DC  J 6 64  ? 99.369  146.376 76.524  1.00 39.20  ? -10 DC  J "O4'" 1 
ATOM 10394 C "C3'" . DC  J 6 64  ? 98.158  145.304 74.770  1.00 39.20  ? -10 DC  J "C3'" 1 
ATOM 10395 O "O3'" . DC  J 6 64  ? 98.281  145.984 73.532  1.00 39.20  ? -10 DC  J "O3'" 1 
ATOM 10396 C "C2'" . DC  J 6 64  ? 99.420  144.515 75.104  1.00 39.20  ? -10 DC  J "C2'" 1 
ATOM 10397 C "C1'" . DC  J 6 64  ? 100.272 145.535 75.843  1.00 39.20  ? -10 DC  J "C1'" 1 
ATOM 10398 N N1    . DC  J 6 64  ? 101.134 144.902 76.853  1.00 39.20  ? -10 DC  J N1    1 
ATOM 10399 C C2    . DC  J 6 64  ? 102.526 145.081 76.832  1.00 39.20  ? -10 DC  J C2    1 
ATOM 10400 O O2    . DC  J 6 64  ? 103.049 145.749 75.940  1.00 39.20  ? -10 DC  J O2    1 
ATOM 10401 N N3    . DC  J 6 64  ? 103.273 144.454 77.768  1.00 39.20  ? -10 DC  J N3    1 
ATOM 10402 C C4    . DC  J 6 64  ? 102.683 143.723 78.707  1.00 39.20  ? -10 DC  J C4    1 
ATOM 10403 N N4    . DC  J 6 64  ? 103.449 143.138 79.625  1.00 39.20  ? -10 DC  J N4    1 
ATOM 10404 C C5    . DC  J 6 64  ? 101.277 143.539 78.743  1.00 39.20  ? -10 DC  J C5    1 
ATOM 10405 C C6    . DC  J 6 64  ? 100.550 144.149 77.817  1.00 39.20  ? -10 DC  J C6    1 
ATOM 10406 P P     . DA  J 6 65  ? 98.345  145.164 72.151  1.00 38.22  ? -9  DA  J P     1 
ATOM 10407 O OP1   . DA  J 6 65  ? 97.735  146.023 71.117  1.00 38.22  ? -9  DA  J OP1   1 
ATOM 10408 O OP2   . DA  J 6 65  ? 97.809  143.804 72.361  1.00 38.22  ? -9  DA  J OP2   1 
ATOM 10409 O "O5'" . DA  J 6 65  ? 99.909  145.054 71.839  1.00 38.22  ? -9  DA  J "O5'" 1 
ATOM 10410 C "C5'" . DA  J 6 65  ? 100.547 146.087 71.103  1.00 38.22  ? -9  DA  J "C5'" 1 
ATOM 10411 C "C4'" . DA  J 6 65  ? 102.028 145.808 70.909  1.00 38.22  ? -9  DA  J "C4'" 1 
ATOM 10412 O "O4'" . DA  J 6 65  ? 102.642 145.472 72.179  1.00 38.22  ? -9  DA  J "O4'" 1 
ATOM 10413 C "C3'" . DA  J 6 65  ? 102.372 144.649 69.969  1.00 38.22  ? -9  DA  J "C3'" 1 
ATOM 10414 O "O3'" . DA  J 6 65  ? 103.542 144.986 69.253  1.00 38.22  ? -9  DA  J "O3'" 1 
ATOM 10415 C "C2'" . DA  J 6 65  ? 102.652 143.520 70.948  1.00 38.22  ? -9  DA  J "C2'" 1 
ATOM 10416 C "C1'" . DA  J 6 65  ? 103.394 144.293 72.009  1.00 38.22  ? -9  DA  J "C1'" 1 
ATOM 10417 N N9    . DA  J 6 65  ? 103.467 143.613 73.279  1.00 38.22  ? -9  DA  J N9    1 
ATOM 10418 C C8    . DA  J 6 65  ? 102.424 143.180 74.033  1.00 38.22  ? -9  DA  J C8    1 
ATOM 10419 N N7    . DA  J 6 65  ? 102.783 142.587 75.136  1.00 38.22  ? -9  DA  J N7    1 
ATOM 10420 C C5    . DA  J 6 65  ? 104.156 142.676 75.121  1.00 38.22  ? -9  DA  J C5    1 
ATOM 10421 C C6    . DA  J 6 65  ? 105.128 142.233 76.013  1.00 38.22  ? -9  DA  J C6    1 
ATOM 10422 N N6    . DA  J 6 65  ? 104.834 141.620 77.155  1.00 38.22  ? -9  DA  J N6    1 
ATOM 10423 N N1    . DA  J 6 65  ? 106.419 142.439 75.686  1.00 38.22  ? -9  DA  J N1    1 
ATOM 10424 C C2    . DA  J 6 65  ? 106.706 143.057 74.537  1.00 38.22  ? -9  DA  J C2    1 
ATOM 10425 N N3    . DA  J 6 65  ? 105.870 143.515 73.612  1.00 38.22  ? -9  DA  J N3    1 
ATOM 10426 C C4    . DA  J 6 65  ? 104.598 143.286 73.972  1.00 38.22  ? -9  DA  J C4    1 
ATOM 10427 P P     . DC  J 6 66  ? 103.932 144.241 67.887  1.00 39.22  ? -8  DC  J P     1 
ATOM 10428 O OP1   . DC  J 6 66  ? 103.497 145.123 66.786  1.00 39.22  ? -8  DC  J OP1   1 
ATOM 10429 O OP2   . DC  J 6 66  ? 103.478 142.836 67.915  1.00 39.22  ? -8  DC  J OP2   1 
ATOM 10430 O "O5'" . DC  J 6 66  ? 105.525 144.232 67.926  1.00 39.22  ? -8  DC  J "O5'" 1 
ATOM 10431 C "C5'" . DC  J 6 66  ? 106.192 144.025 69.156  1.00 39.22  ? -8  DC  J "C5'" 1 
ATOM 10432 C "C4'" . DC  J 6 66  ? 107.301 143.016 68.987  1.00 39.22  ? -8  DC  J "C4'" 1 
ATOM 10433 O "O4'" . DC  J 6 66  ? 107.446 142.262 70.214  1.00 39.22  ? -8  DC  J "O4'" 1 
ATOM 10434 C "C3'" . DC  J 6 66  ? 107.024 141.960 67.941  1.00 39.22  ? -8  DC  J "C3'" 1 
ATOM 10435 O "O3'" . DC  J 6 66  ? 108.229 141.306 67.620  1.00 39.22  ? -8  DC  J "O3'" 1 
ATOM 10436 C "C2'" . DC  J 6 66  ? 106.122 141.035 68.730  1.00 39.22  ? -8  DC  J "C2'" 1 
ATOM 10437 C "C1'" . DC  J 6 66  ? 106.926 140.960 70.016  1.00 39.22  ? -8  DC  J "C1'" 1 
ATOM 10438 N N1    . DC  J 6 66  ? 106.149 140.588 71.207  1.00 39.22  ? -8  DC  J N1    1 
ATOM 10439 C C2    . DC  J 6 66  ? 106.833 140.294 72.375  1.00 39.22  ? -8  DC  J C2    1 
ATOM 10440 O O2    . DC  J 6 66  ? 108.063 140.342 72.361  1.00 39.22  ? -8  DC  J O2    1 
ATOM 10441 N N3    . DC  J 6 66  ? 106.135 139.961 73.476  1.00 39.22  ? -8  DC  J N3    1 
ATOM 10442 C C4    . DC  J 6 66  ? 104.810 139.918 73.434  1.00 39.22  ? -8  DC  J C4    1 
ATOM 10443 N N4    . DC  J 6 66  ? 104.164 139.579 74.548  1.00 39.22  ? -8  DC  J N4    1 
ATOM 10444 C C5    . DC  J 6 66  ? 104.086 140.223 72.248  1.00 39.22  ? -8  DC  J C5    1 
ATOM 10445 C C6    . DC  J 6 66  ? 104.791 140.551 71.166  1.00 39.22  ? -8  DC  J C6    1 
ATOM 10446 P P     . DG  J 6 67  ? 109.063 141.716 66.316  1.00 36.59  ? -7  DG  J P     1 
ATOM 10447 O OP1   . DG  J 6 67  ? 109.595 143.079 66.522  1.00 36.59  ? -7  DG  J OP1   1 
ATOM 10448 O OP2   . DG  J 6 67  ? 108.205 141.431 65.150  1.00 36.59  ? -7  DG  J OP2   1 
ATOM 10449 O "O5'" . DG  J 6 67  ? 110.288 140.691 66.323  1.00 36.59  ? -7  DG  J "O5'" 1 
ATOM 10450 C "C5'" . DG  J 6 67  ? 111.242 140.747 67.372  1.00 36.59  ? -7  DG  J "C5'" 1 
ATOM 10451 C "C4'" . DG  J 6 67  ? 111.459 139.377 67.988  1.00 36.59  ? -7  DG  J "C4'" 1 
ATOM 10452 O "O4'" . DG  J 6 67  ? 110.417 139.089 68.961  1.00 36.59  ? -7  DG  J "O4'" 1 
ATOM 10453 C "C3'" . DG  J 6 67  ? 111.458 138.212 66.997  1.00 36.59  ? -7  DG  J "C3'" 1 
ATOM 10454 O "O3'" . DG  J 6 67  ? 112.560 137.370 67.259  1.00 36.59  ? -7  DG  J "O3'" 1 
ATOM 10455 C "C2'" . DG  J 6 67  ? 110.141 137.499 67.305  1.00 36.59  ? -7  DG  J "C2'" 1 
ATOM 10456 C "C1'" . DG  J 6 67  ? 109.998 137.760 68.796  1.00 36.59  ? -7  DG  J "C1'" 1 
ATOM 10457 N N9    . DG  J 6 67  ? 108.626 137.647 69.281  1.00 36.59  ? -7  DG  J N9    1 
ATOM 10458 C C8    . DG  J 6 67  ? 107.480 137.807 68.548  1.00 36.59  ? -7  DG  J C8    1 
ATOM 10459 N N7    . DG  J 6 67  ? 106.388 137.656 69.242  1.00 36.59  ? -7  DG  J N7    1 
ATOM 10460 C C5    . DG  J 6 67  ? 106.837 137.378 70.520  1.00 36.59  ? -7  DG  J C5    1 
ATOM 10461 C C6    . DG  J 6 67  ? 106.108 137.117 71.702  1.00 36.59  ? -7  DG  J C6    1 
ATOM 10462 O O6    . DG  J 6 67  ? 104.881 137.077 71.862  1.00 36.59  ? -7  DG  J O6    1 
ATOM 10463 N N1    . DG  J 6 67  ? 106.949 136.878 72.778  1.00 36.59  ? -7  DG  J N1    1 
ATOM 10464 C C2    . DG  J 6 67  ? 108.320 136.900 72.722  1.00 36.59  ? -7  DG  J C2    1 
ATOM 10465 N N2    . DG  J 6 67  ? 108.950 136.619