data_6EZG
# 
_entry.id   6EZG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6EZG         
WWPDB D_1200007514 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 1ea5 unspecified 
PDB . 2w75 unspecified 
PDB . 1eve unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6EZG 
_pdbx_database_status.recvd_initial_deposition_date   2017-11-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Santoni, G.'    1  ? 
'Lalut, J.'      2  ? 
'Karila, D.'     3  ? 
'Lecoutey, C.'   4  ? 
'Davis, A.'      5  ? 
'Nachon, F.'     6  ? 
'Sillman, I.'    7  ? 
'Sussman, J.'    8  ? 
'Weik, M.'       9  ? 
'Maurice, T.'    10 ? 
'Dallemagne, P.' 11 ? 
'Rochais, C.'    12 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   FR 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Eur J Med Chem' 
_citation.journal_id_ASTM           EJMCA5 
_citation.journal_id_CSD            0493 
_citation.journal_id_ISSN           1768-3254 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            162 
_citation.language                  ? 
_citation.page_first                234 
_citation.page_last                 248 
_citation.title                     
;Novel multitarget-directed ligands targeting acetylcholinesterase and sigma1receptors as lead compounds for treatment of Alzheimer's disease: Synthesis, evaluation, and structural characterization of their complexes with acetylcholinesterase.
;
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.ejmech.2018.10.064 
_citation.pdbx_database_id_PubMed   30447434 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lalut, J.'      1  ? 
primary 'Santoni, G.'    2  ? 
primary 'Karila, D.'     3  ? 
primary 'Lecoutey, C.'   4  ? 
primary 'Davis, A.'      5  ? 
primary 'Nachon, F.'     6  ? 
primary 'Silman, I.'     7  ? 
primary 'Sussman, J.'    8  ? 
primary 'Weik, M.'       9  ? 
primary 'Maurice, T.'    10 ? 
primary 'Dallemagne, P.' 11 ? 
primary 'Rochais, C.'    12 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6EZG 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     91.711 
_cell.length_a_esd                 ? 
_cell.length_b                     106.996 
_cell.length_b_esd                 ? 
_cell.length_c                     150.494 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6EZG 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat Acetylcholinesterase                                                                        60736.516 2   
3.1.1.7 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                    221.208   4   ? ? ? 
? 
3 non-polymer syn '1-(7-chloranyl-4-methoxy-1~{H}-indol-5-yl)-3-[1-(phenylmethyl)piperidin-4-yl]propan-1-one' 410.936   2   ? ? ? 
? 
4 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                                                     106.120   2   ? ? ? 
? 
5 water       nat water                                                                                       18.015    564 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           1 
_entity_src_nat.pdbx_end_seq_num           537 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Tetronarce californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TETCF 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_struct_ref.pdbx_align_begin           22 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6EZG A 1 ? 537 ? P04058 22 ? 558 ? 1 537 
2 1 6EZG B 1 ? 537 ? P04058 22 ? 558 ? 1 537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                                                     ? 
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking'          y ARGININE                                                                                    ? 
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                                  ? 
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                             ? 
'C4 H7 N O4'       133.103 
C6K non-polymer                  . '1-(7-chloranyl-4-methoxy-1~{H}-indol-5-yl)-3-[1-(phenylmethyl)piperidin-4-yl]propan-1-one' ? 
'C24 H27 Cl N2 O2' 410.936 
CYS 'L-peptide linking'          y CYSTEINE                                                                                    ? 
'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                                                   ? 
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                             ? 
'C5 H9 N O4'       147.129 
GLY 'peptide linking'            y GLYCINE                                                                                     ? 
'C2 H5 N O2'       75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                                                   ? 
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer                  . WATER                                                                                       ? 
'H2 O'             18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                                  ? 
'C6 H13 N O2'      131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                     ? 
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                      ? 
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking'          y METHIONINE                                                                                  ? 
'C5 H11 N O2 S'    149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                    ? 
'C8 H15 N O6'      221.208 
PEG non-polymer                  . 'DI(HYDROXYETHYL)ETHER'                                                                     ? 
'C4 H10 O3'        106.120 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                               ? 
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                     ? 
'C5 H9 N O2'       115.130 
SER 'L-peptide linking'          y SERINE                                                                                      ? 
'C3 H7 N O3'       105.093 
THR 'L-peptide linking'          y THREONINE                                                                                   ? 
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                                  ? 
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                                    ? 
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking'          y VALINE                                                                                      ? 
'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6EZG 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.04 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.53 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;36% PEG 200
150mM MES pH 5.8
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-06-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.03 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6EZG 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.2 
_reflns.d_resolution_low                 45.420 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       73468 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.51 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.2 
_reflns_shell.d_res_low                   2.3 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6EZG 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.200 
_refine.ls_d_res_low                             45.420 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     73468 
_refine.ls_number_reflns_R_free                  3671 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.95 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1922 
_refine.ls_R_factor_R_free                       0.2371 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1898 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 29.47 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.27 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8488 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         128 
_refine_hist.number_atoms_solvent             564 
_refine_hist.number_atoms_total               9180 
_refine_hist.d_res_high                       2.200 
_refine_hist.d_res_low                        45.420 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 8876  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.998  ? 12044 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.316 ? 3218  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 1262  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 1562  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.2000 2.2289  . . 129 2617 95.00 . . . 0.3695 . 0.3172 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2289 2.2595  . . 149 2611 97.00 . . . 0.3542 . 0.2980 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2595 2.2918  . . 134 2607 95.00 . . . 0.3638 . 0.2781 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2918 2.3260  . . 143 2561 95.00 . . . 0.2908 . 0.2668 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3260 2.3623  . . 127 2633 96.00 . . . 0.2913 . 0.2491 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3623 2.4010  . . 139 2660 97.00 . . . 0.3013 . 0.2463 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4010 2.4424  . . 125 2670 98.00 . . . 0.3075 . 0.2407 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4424 2.4868  . . 134 2663 97.00 . . . 0.2974 . 0.2281 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4868 2.5347  . . 134 2677 97.00 . . . 0.3102 . 0.2309 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5347 2.5864  . . 150 2671 98.00 . . . 0.3160 . 0.2411 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5864 2.6426  . . 146 2676 97.00 . . . 0.2809 . 0.2277 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6426 2.7041  . . 148 2630 96.00 . . . 0.2991 . 0.2212 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7041 2.7717  . . 116 2683 97.00 . . . 0.2722 . 0.2138 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7717 2.8467  . . 116 2625 95.00 . . . 0.2322 . 0.2011 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8467 2.9304  . . 152 2715 98.00 . . . 0.3312 . 0.2101 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9304 3.0250  . . 144 2668 98.00 . . . 0.2611 . 0.2074 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0250 3.1331  . . 166 2701 98.00 . . . 0.2924 . 0.2148 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1331 3.2585  . . 132 2700 98.00 . . . 0.2521 . 0.2025 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2585 3.4067  . . 154 2667 97.00 . . . 0.2173 . 0.1972 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4067 3.5863  . . 144 2721 97.00 . . . 0.2149 . 0.1741 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5863 3.8108  . . 169 2670 97.00 . . . 0.2132 . 0.1671 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8108 4.1049  . . 155 2738 99.00 . . . 0.1840 . 0.1448 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1049 4.5177  . . 141 2765 99.00 . . . 0.1850 . 0.1321 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5177 5.1706  . . 148 2762 98.00 . . . 0.1538 . 0.1360 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1706 6.5113  . . 123 2811 98.00 . . . 0.2098 . 0.1574 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.5113 45.4300 . . 153 2895 97.00 . . . 0.2101 . 0.1857 . . . . . . . . . . 
# 
_struct.entry_id                     6EZG 
_struct.title                        'Torpedo californica AChE in complex with indolic multi-target directed ligand' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6EZG 
_struct_keywords.text            'Acetylcholinesterase, Multi-target inhibitor, Alzheimer desease, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  AA3 LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  AA4 GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  AA5 VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  AA6 ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  AA7 GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  AA8 SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  AA9 SER A 212 ? ASP A 217 ? SER A 212 ASP A 217 1 ? 6  
HELX_P HELX_P10 AB1 VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 AB2 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 AB3 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 AB4 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 AB5 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 AB6 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 AB7 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 AB8 ASN A 364 ? TYR A 375 ? ASN A 364 TYR A 375 1 ? 12 
HELX_P HELX_P18 AB9 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 AC1 VAL A 400 ? LYS A 413 ? VAL A 400 LYS A 413 1 ? 14 
HELX_P HELX_P20 AC2 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 AC3 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 AC4 GLY A 449 ? ASN A 457 ? GLY A 449 ASN A 457 5 ? 9  
HELX_P HELX_P23 AC5 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P24 AC6 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P25 AC7 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
HELX_P HELX_P26 AC8 VAL B 40  ? ARG B 44  ? VAL B 40  ARG B 44  5 ? 5  
HELX_P HELX_P27 AC9 PHE B 78  ? MET B 83  ? PHE B 78  MET B 83  1 ? 6  
HELX_P HELX_P28 AD1 LEU B 127 ? ASN B 131 ? LEU B 127 ASN B 131 5 ? 5  
HELX_P HELX_P29 AD2 GLY B 132 ? GLU B 140 ? GLY B 132 GLU B 140 1 ? 9  
HELX_P HELX_P30 AD3 VAL B 150 ? LEU B 156 ? VAL B 150 LEU B 156 1 ? 7  
HELX_P HELX_P31 AD4 ASN B 167 ? ILE B 184 ? ASN B 167 ILE B 184 1 ? 18 
HELX_P HELX_P32 AD5 GLN B 185 ? PHE B 187 ? GLN B 185 PHE B 187 5 ? 3  
HELX_P HELX_P33 AD6 SER B 200 ? SER B 212 ? SER B 200 SER B 212 1 ? 13 
HELX_P HELX_P34 AD7 SER B 215 ? PHE B 219 ? SER B 215 PHE B 219 5 ? 5  
HELX_P HELX_P35 AD8 VAL B 238 ? ASN B 251 ? VAL B 238 ASN B 251 1 ? 14 
HELX_P HELX_P36 AD9 SER B 258 ? GLU B 268 ? SER B 258 GLU B 268 1 ? 11 
HELX_P HELX_P37 AE1 LYS B 270 ? GLU B 278 ? LYS B 270 GLU B 278 1 ? 9  
HELX_P HELX_P38 AE2 TRP B 279 ? LEU B 282 ? TRP B 279 LEU B 282 5 ? 4  
HELX_P HELX_P39 AE3 SER B 304 ? GLY B 312 ? SER B 304 GLY B 312 1 ? 9  
HELX_P HELX_P40 AE4 GLY B 328 ? ALA B 336 ? GLY B 328 ALA B 336 1 ? 9  
HELX_P HELX_P41 AE5 SER B 348 ? VAL B 360 ? SER B 348 VAL B 360 1 ? 13 
HELX_P HELX_P42 AE6 ASN B 364 ? TYR B 375 ? ASN B 364 TYR B 375 1 ? 12 
HELX_P HELX_P43 AE7 ASN B 383 ? VAL B 400 ? ASN B 383 VAL B 400 1 ? 18 
HELX_P HELX_P44 AE8 VAL B 400 ? LYS B 413 ? VAL B 400 LYS B 413 1 ? 14 
HELX_P HELX_P45 AE9 PRO B 433 ? GLY B 437 ? PRO B 433 GLY B 437 5 ? 5  
HELX_P HELX_P46 AF1 GLU B 443 ? PHE B 448 ? GLU B 443 PHE B 448 1 ? 6  
HELX_P HELX_P47 AF2 GLY B 449 ? ASN B 457 ? GLY B 449 ASN B 457 5 ? 9  
HELX_P HELX_P48 AF3 THR B 459 ? GLY B 480 ? THR B 459 GLY B 480 1 ? 22 
HELX_P HELX_P49 AF4 ARG B 517 ? GLN B 526 ? ARG B 517 GLN B 526 1 ? 10 
HELX_P HELX_P50 AF5 GLN B 526 ? ALA B 534 ? GLN B 526 ALA B 534 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 2.061 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf4 disulf ?   ? B CYS 67  SG  ? ? ? 1_555 B CYS 94  SG ? ? B CYS 67  B CYS 94  1_555 ? ? ? ? ? ? ? 2.059 ? ?               
disulf5 disulf ?   ? B CYS 254 SG  ? ? ? 1_555 B CYS 265 SG ? ? B CYS 254 B CYS 265 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf6 disulf ?   ? B CYS 402 SG  ? ? ? 1_555 B CYS 521 SG ? ? B CYS 402 B CYS 521 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  A NAG 601 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 416 A NAG 602 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale3 covale one ? B ASN 59  ND2 ? ? ? 1_555 F NAG .   C1 ? ? B ASN 59  B NAG 601 1_555 ? ? ? ? ? ? ? 1.460 ? N-Glycosylation 
covale4 covale one ? B ASN 416 ND2 ? ? ? 1_555 G NAG .   C1 ? ? B ASN 416 B NAG 602 1_555 ? ? ? ? ? ? ? 1.413 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 1 2.07 
2 SER 103 B . ? SER 103 B PRO 104 B ? PRO 104 B 1 6.90 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
AA6 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
AA6 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA1 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA1 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AA2 1  THR A 18  ? PRO A 21  ? THR A 18  PRO A 21  
AA2 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
AA2 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AA2 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AA2 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AA2 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AA2 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AA2 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AA2 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AA2 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AA2 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AA3 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
AA3 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
AA4 1  LEU B 7   ? ASN B 9   ? LEU B 7   ASN B 9   
AA4 2  LYS B 14  ? MET B 16  ? LYS B 14  MET B 16  
AA4 3  VAL B 57  ? ASN B 59  ? VAL B 57  ASN B 59  
AA5 1  THR B 18  ? VAL B 22  ? THR B 18  VAL B 22  
AA5 2  SER B 25  ? PRO B 34  ? SER B 25  PRO B 34  
AA5 3  TYR B 96  ? VAL B 101 ? TYR B 96  VAL B 101 
AA5 4  VAL B 142 ? SER B 145 ? VAL B 142 SER B 145 
AA5 5  THR B 109 ? ILE B 115 ? THR B 109 ILE B 115 
AA5 6  GLY B 189 ? GLU B 199 ? GLY B 189 GLU B 199 
AA5 7  ARG B 221 ? GLN B 225 ? ARG B 221 GLN B 225 
AA5 8  ILE B 319 ? ASN B 324 ? ILE B 319 ASN B 324 
AA5 9  THR B 418 ? PHE B 423 ? THR B 418 PHE B 423 
AA5 10 LYS B 501 ? LEU B 505 ? LYS B 501 LEU B 505 
AA5 11 VAL B 512 ? GLN B 514 ? VAL B 512 GLN B 514 
AA6 1  VAL B 236 ? SER B 237 ? VAL B 236 SER B 237 
AA6 2  VAL B 295 ? ILE B 296 ? VAL B 295 ILE B 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 8   ? N VAL A 8   O VAL A 15  ? O VAL A 15  
AA1 2  3  N LYS A 14  ? N LYS A 14  O TRP A 58  ? O TRP A 58  
AA2 1  2  N VAL A 20  ? N VAL A 20  O ILE A 27  ? O ILE A 27  
AA2 2  3  N PHE A 30  ? N PHE A 30  O ILE A 99  ? O ILE A 99  
AA2 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AA2 4  5  O VAL A 144 ? O VAL A 144 N TRP A 114 ? N TRP A 114 
AA2 5  6  N VAL A 113 ? N VAL A 113 O THR A 195 ? O THR A 195 
AA2 6  7  N GLY A 198 ? N GLY A 198 O GLN A 225 ? O GLN A 225 
AA2 7  8  N ALA A 222 ? N ALA A 222 O LEU A 320 ? O LEU A 320 
AA2 8  9  N VAL A 323 ? N VAL A 323 O PHE A 423 ? O PHE A 423 
AA2 9  10 N PHE A 422 ? N PHE A 422 O LEU A 505 ? O LEU A 505 
AA2 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AA3 1  2  N VAL A 236 ? N VAL A 236 O ILE A 296 ? O ILE A 296 
AA4 1  2  N VAL B 8   ? N VAL B 8   O VAL B 15  ? O VAL B 15  
AA4 2  3  N MET B 16  ? N MET B 16  O TRP B 58  ? O TRP B 58  
AA5 1  2  N VAL B 22  ? N VAL B 22  O SER B 25  ? O SER B 25  
AA5 2  3  N PHE B 30  ? N PHE B 30  O ILE B 99  ? O ILE B 99  
AA5 3  4  N ASN B 98  ? N ASN B 98  O SER B 145 ? O SER B 145 
AA5 4  5  O VAL B 144 ? O VAL B 144 N TRP B 114 ? N TRP B 114 
AA5 5  6  N VAL B 111 ? N VAL B 111 O THR B 195 ? O THR B 195 
AA5 6  7  N GLY B 198 ? N GLY B 198 O GLN B 225 ? O GLN B 225 
AA5 7  8  N ALA B 222 ? N ALA B 222 O LEU B 320 ? O LEU B 320 
AA5 8  9  N VAL B 323 ? N VAL B 323 O PHE B 423 ? O PHE B 423 
AA5 9  10 N PHE B 422 ? N PHE B 422 O ILE B 503 ? O ILE B 503 
AA5 10 11 N PHE B 502 ? N PHE B 502 O HIS B 513 ? O HIS B 513 
AA6 1  2  N VAL B 236 ? N VAL B 236 O ILE B 296 ? O ILE B 296 
# 
_atom_sites.entry_id                    6EZG 
_atom_sites.fract_transf_matrix[1][1]   0.010904 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009346 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006645 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 4   ? 21.717  -10.004 84.938  1.00 64.68 ? 4   SER A N   1 
ATOM   2    C  CA  . SER A 1 4   ? 21.430  -11.354 84.462  1.00 61.37 ? 4   SER A CA  1 
ATOM   3    C  C   . SER A 1 4   ? 21.217  -11.364 82.955  1.00 59.86 ? 4   SER A C   1 
ATOM   4    O  O   . SER A 1 4   ? 21.757  -10.524 82.235  1.00 63.24 ? 4   SER A O   1 
ATOM   5    C  CB  . SER A 1 4   ? 20.194  -11.928 85.160  1.00 59.30 ? 4   SER A CB  1 
ATOM   6    O  OG  . SER A 1 4   ? 19.017  -11.269 84.722  1.00 55.56 ? 4   SER A OG  1 
ATOM   7    N  N   . GLU A 1 5   ? 20.414  -12.315 82.489  1.00 55.04 ? 5   GLU A N   1 
ATOM   8    C  CA  . GLU A 1 5   ? 20.157  -12.476 81.068  1.00 54.68 ? 5   GLU A CA  1 
ATOM   9    C  C   . GLU A 1 5   ? 19.003  -11.596 80.598  1.00 53.86 ? 5   GLU A C   1 
ATOM   10   O  O   . GLU A 1 5   ? 18.972  -11.179 79.435  1.00 51.77 ? 5   GLU A O   1 
ATOM   11   C  CB  . GLU A 1 5   ? 19.856  -13.938 80.750  1.00 54.61 ? 5   GLU A CB  1 
ATOM   12   C  CG  . GLU A 1 5   ? 19.513  -14.194 79.296  1.00 55.06 ? 5   GLU A CG  1 
ATOM   13   C  CD  . GLU A 1 5   ? 19.146  -15.643 79.038  1.00 58.10 ? 5   GLU A CD  1 
ATOM   14   O  OE1 . GLU A 1 5   ? 19.431  -16.152 77.930  1.00 55.08 ? 5   GLU A OE1 1 
ATOM   15   O  OE2 . GLU A 1 5   ? 18.570  -16.276 79.951  1.00 61.31 ? 5   GLU A OE2 1 
ATOM   16   N  N   . LEU A 1 6   ? 18.063  -11.318 81.501  1.00 46.00 ? 6   LEU A N   1 
ATOM   17   C  CA  . LEU A 1 6   ? 16.878  -10.529 81.170  1.00 45.74 ? 6   LEU A CA  1 
ATOM   18   C  C   . LEU A 1 6   ? 17.010  -9.086  81.619  1.00 46.26 ? 6   LEU A C   1 
ATOM   19   O  O   . LEU A 1 6   ? 16.153  -8.255  81.324  1.00 43.46 ? 6   LEU A O   1 
ATOM   20   C  CB  . LEU A 1 6   ? 15.625  -11.137 81.796  1.00 40.44 ? 6   LEU A CB  1 
ATOM   21   C  CG  . LEU A 1 6   ? 15.259  -12.539 81.323  1.00 45.07 ? 6   LEU A CG  1 
ATOM   22   C  CD1 . LEU A 1 6   ? 14.017  -13.030 82.034  1.00 41.16 ? 6   LEU A CD1 1 
ATOM   23   C  CD2 . LEU A 1 6   ? 15.057  -12.549 79.800  1.00 48.46 ? 6   LEU A CD2 1 
ATOM   24   N  N   . LEU A 1 7   ? 18.081  -8.797  82.347  1.00 48.25 ? 7   LEU A N   1 
ATOM   25   C  CA  . LEU A 1 7   ? 18.329  -7.447  82.832  1.00 48.27 ? 7   LEU A CA  1 
ATOM   26   C  C   . LEU A 1 7   ? 19.484  -6.848  82.055  1.00 49.21 ? 7   LEU A C   1 
ATOM   27   O  O   . LEU A 1 7   ? 20.618  -7.313  82.145  1.00 49.78 ? 7   LEU A O   1 
ATOM   28   C  CB  . LEU A 1 7   ? 18.628  -7.441  84.335  1.00 49.48 ? 7   LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 7   ? 18.872  -6.072  84.984  1.00 46.99 ? 7   LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 7   ? 17.684  -5.152  84.777  1.00 47.17 ? 7   LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 7   ? 19.180  -6.217  86.474  1.00 45.81 ? 7   LEU A CD2 1 
ATOM   32   N  N   . VAL A 1 8   ? 19.182  -5.815  81.281  1.00 44.11 ? 8   VAL A N   1 
ATOM   33   C  CA  . VAL A 1 8   ? 20.176  -5.198  80.428  1.00 42.75 ? 8   VAL A CA  1 
ATOM   34   C  C   . VAL A 1 8   ? 20.243  -3.700  80.671  1.00 41.55 ? 8   VAL A C   1 
ATOM   35   O  O   . VAL A 1 8   ? 19.221  -3.006  80.682  1.00 42.81 ? 8   VAL A O   1 
ATOM   36   C  CB  . VAL A 1 8   ? 19.877  -5.470  78.940  1.00 44.12 ? 8   VAL A CB  1 
ATOM   37   C  CG1 . VAL A 1 8   ? 20.726  -4.585  78.058  1.00 43.74 ? 8   VAL A CG1 1 
ATOM   38   C  CG2 . VAL A 1 8   ? 20.106  -6.937  78.619  1.00 46.02 ? 8   VAL A CG2 1 
ATOM   39   N  N   . ASN A 1 9   ? 21.458  -3.209  80.873  1.00 41.53 ? 9   ASN A N   1 
ATOM   40   C  CA  . ASN A 1 9   ? 21.688  -1.788  81.052  1.00 42.82 ? 9   ASN A CA  1 
ATOM   41   C  C   . ASN A 1 9   ? 22.029  -1.158  79.716  1.00 39.75 ? 9   ASN A C   1 
ATOM   42   O  O   . ASN A 1 9   ? 22.986  -1.554  79.057  1.00 40.79 ? 9   ASN A O   1 
ATOM   43   C  CB  . ASN A 1 9   ? 22.809  -1.526  82.065  1.00 40.92 ? 9   ASN A CB  1 
ATOM   44   C  CG  . ASN A 1 9   ? 22.999  -0.046  82.341  1.00 45.46 ? 9   ASN A CG  1 
ATOM   45   O  OD1 . ASN A 1 9   ? 22.027  0.714   82.357  1.00 43.85 ? 9   ASN A OD1 1 
ATOM   46   N  ND2 . ASN A 1 9   ? 24.252  0.379   82.541  1.00 46.71 ? 9   ASN A ND2 1 
ATOM   47   N  N   . THR A 1 10  ? 21.242  -0.177  79.314  1.00 39.90 ? 10  THR A N   1 
ATOM   48   C  CA  . THR A 1 10  ? 21.457  0.448   78.021  1.00 41.12 ? 10  THR A CA  1 
ATOM   49   C  C   . THR A 1 10  ? 21.915  1.870   78.271  1.00 41.91 ? 10  THR A C   1 
ATOM   50   O  O   . THR A 1 10  ? 21.877  2.339   79.405  1.00 38.46 ? 10  THR A O   1 
ATOM   51   C  CB  . THR A 1 10  ? 20.179  0.434   77.148  1.00 36.64 ? 10  THR A CB  1 
ATOM   52   O  OG1 . THR A 1 10  ? 19.313  1.502   77.547  1.00 40.36 ? 10  THR A OG1 1 
ATOM   53   C  CG2 . THR A 1 10  ? 19.431  -0.892  77.290  1.00 34.74 ? 10  THR A CG2 1 
ATOM   54   N  N   . LYS A 1 11  ? 22.333  2.561   77.219  1.00 40.47 ? 11  LYS A N   1 
ATOM   55   C  CA  . LYS A 1 11  ? 22.844  3.910   77.369  1.00 42.35 ? 11  LYS A CA  1 
ATOM   56   C  C   . LYS A 1 11  ? 21.801  4.865   77.944  1.00 43.16 ? 11  LYS A C   1 
ATOM   57   O  O   . LYS A 1 11  ? 22.139  5.961   78.382  1.00 46.02 ? 11  LYS A O   1 
ATOM   58   C  CB  . LYS A 1 11  ? 23.359  4.431   76.024  1.00 43.05 ? 11  LYS A CB  1 
ATOM   59   C  CG  . LYS A 1 11  ? 24.630  3.722   75.541  1.00 48.05 ? 11  LYS A CG  1 
ATOM   60   C  CD  . LYS A 1 11  ? 25.358  4.524   74.460  1.00 42.52 ? 11  LYS A CD  1 
ATOM   61   C  CE  . LYS A 1 11  ? 26.550  3.754   73.894  1.00 42.61 ? 11  LYS A CE  1 
ATOM   62   N  NZ  . LYS A 1 11  ? 27.614  3.490   74.915  1.00 54.96 ? 11  LYS A NZ  1 
ATOM   63   N  N   . SER A 1 12  ? 20.537  4.449   77.957  1.00 41.37 ? 12  SER A N   1 
ATOM   64   C  CA  . SER A 1 12  ? 19.465  5.320   78.430  1.00 43.38 ? 12  SER A CA  1 
ATOM   65   C  C   . SER A 1 12  ? 18.895  4.873   79.772  1.00 42.70 ? 12  SER A C   1 
ATOM   66   O  O   . SER A 1 12  ? 18.096  5.577   80.374  1.00 42.11 ? 12  SER A O   1 
ATOM   67   C  CB  . SER A 1 12  ? 18.337  5.385   77.401  1.00 42.63 ? 12  SER A CB  1 
ATOM   68   O  OG  . SER A 1 12  ? 18.861  5.461   76.086  1.00 52.79 ? 12  SER A OG  1 
ATOM   69   N  N   . GLY A 1 13  ? 19.301  3.697   80.235  1.00 40.29 ? 13  GLY A N   1 
ATOM   70   C  CA  . GLY A 1 13  ? 18.804  3.179   81.491  1.00 39.85 ? 13  GLY A CA  1 
ATOM   71   C  C   . GLY A 1 13  ? 18.620  1.680   81.440  1.00 41.53 ? 13  GLY A C   1 
ATOM   72   O  O   . GLY A 1 13  ? 18.849  1.046   80.407  1.00 38.51 ? 13  GLY A O   1 
ATOM   73   N  N   . LYS A 1 14  ? 18.199  1.113   82.565  1.00 40.51 ? 14  LYS A N   1 
ATOM   74   C  CA  . LYS A 1 14  ? 18.009  -0.322  82.661  1.00 40.20 ? 14  LYS A CA  1 
ATOM   75   C  C   . LYS A 1 14  ? 16.637  -0.753  82.150  1.00 40.31 ? 14  LYS A C   1 
ATOM   76   O  O   . LYS A 1 14  ? 15.649  -0.042  82.313  1.00 36.23 ? 14  LYS A O   1 
ATOM   77   C  CB  . LYS A 1 14  ? 18.191  -0.787  84.103  1.00 42.11 ? 14  LYS A CB  1 
ATOM   78   C  CG  . LYS A 1 14  ? 19.467  -0.291  84.767  1.00 41.74 ? 14  LYS A CG  1 
ATOM   79   C  CD  . LYS A 1 14  ? 19.591  -0.897  86.149  1.00 42.34 ? 14  LYS A CD  1 
ATOM   80   C  CE  . LYS A 1 14  ? 20.920  -0.588  86.800  1.00 40.60 ? 14  LYS A CE  1 
ATOM   81   N  NZ  . LYS A 1 14  ? 20.960  -1.258  88.120  1.00 50.08 ? 14  LYS A NZ  1 
ATOM   82   N  N   . VAL A 1 15  ? 16.606  -1.926  81.527  1.00 38.88 ? 15  VAL A N   1 
ATOM   83   C  CA  . VAL A 1 15  ? 15.381  -2.527  81.048  1.00 40.66 ? 15  VAL A CA  1 
ATOM   84   C  C   . VAL A 1 15  ? 15.378  -3.980  81.484  1.00 39.76 ? 15  VAL A C   1 
ATOM   85   O  O   . VAL A 1 15  ? 16.422  -4.637  81.500  1.00 39.88 ? 15  VAL A O   1 
ATOM   86   C  CB  . VAL A 1 15  ? 15.238  -2.451  79.492  1.00 39.78 ? 15  VAL A CB  1 
ATOM   87   C  CG1 . VAL A 1 15  ? 15.495  -1.044  78.993  1.00 35.81 ? 15  VAL A CG1 1 
ATOM   88   C  CG2 . VAL A 1 15  ? 16.196  -3.412  78.829  1.00 38.45 ? 15  VAL A CG2 1 
ATOM   89   N  N   . MET A 1 16  ? 14.199  -4.477  81.831  1.00 38.98 ? 16  MET A N   1 
ATOM   90   C  CA  . MET A 1 16  ? 14.033  -5.861  82.229  1.00 39.29 ? 16  MET A CA  1 
ATOM   91   C  C   . MET A 1 16  ? 13.128  -6.586  81.248  1.00 40.20 ? 16  MET A C   1 
ATOM   92   O  O   . MET A 1 16  ? 11.969  -6.212  81.075  1.00 41.54 ? 16  MET A O   1 
ATOM   93   C  CB  . MET A 1 16  ? 13.447  -5.947  83.637  1.00 41.13 ? 16  MET A CB  1 
ATOM   94   C  CG  . MET A 1 16  ? 12.924  -7.317  83.987  1.00 44.19 ? 16  MET A CG  1 
ATOM   95   S  SD  . MET A 1 16  ? 14.221  -8.341  84.677  1.00 61.71 ? 16  MET A SD  1 
ATOM   96   C  CE  . MET A 1 16  ? 14.301  -7.622  86.324  1.00 45.76 ? 16  MET A CE  1 
ATOM   97   N  N   . GLY A 1 17  ? 13.656  -7.620  80.605  1.00 43.36 ? 17  GLY A N   1 
ATOM   98   C  CA  . GLY A 1 17  ? 12.887  -8.384  79.641  1.00 41.02 ? 17  GLY A CA  1 
ATOM   99   C  C   . GLY A 1 17  ? 12.078  -9.471  80.321  1.00 45.74 ? 17  GLY A C   1 
ATOM   100  O  O   . GLY A 1 17  ? 11.886  -9.450  81.542  1.00 46.61 ? 17  GLY A O   1 
ATOM   101  N  N   . THR A 1 18  ? 11.615  -10.427 79.522  1.00 44.69 ? 18  THR A N   1 
ATOM   102  C  CA  . THR A 1 18  ? 10.806  -11.543 80.002  1.00 42.46 ? 18  THR A CA  1 
ATOM   103  C  C   . THR A 1 18  ? 11.133  -12.792 79.181  1.00 47.05 ? 18  THR A C   1 
ATOM   104  O  O   . THR A 1 18  ? 11.467  -12.688 78.001  1.00 48.01 ? 18  THR A O   1 
ATOM   105  C  CB  . THR A 1 18  ? 9.300   -11.232 79.904  1.00 46.37 ? 18  THR A CB  1 
ATOM   106  O  OG1 . THR A 1 18  ? 8.548   -12.415 80.193  1.00 51.33 ? 18  THR A OG1 1 
ATOM   107  C  CG2 . THR A 1 18  ? 8.940   -10.761 78.495  1.00 46.91 ? 18  THR A CG2 1 
ATOM   108  N  N   . ARG A 1 19  ? 11.042  -13.968 79.797  1.00 47.97 ? 19  ARG A N   1 
ATOM   109  C  CA  . ARG A 1 19  ? 11.374  -15.211 79.101  1.00 48.38 ? 19  ARG A CA  1 
ATOM   110  C  C   . ARG A 1 19  ? 10.157  -15.802 78.397  1.00 48.02 ? 19  ARG A C   1 
ATOM   111  O  O   . ARG A 1 19  ? 9.175   -16.174 79.036  1.00 52.29 ? 19  ARG A O   1 
ATOM   112  C  CB  . ARG A 1 19  ? 11.969  -16.236 80.074  1.00 47.93 ? 19  ARG A CB  1 
ATOM   113  C  CG  . ARG A 1 19  ? 12.510  -17.483 79.385  1.00 48.24 ? 19  ARG A CG  1 
ATOM   114  C  CD  . ARG A 1 19  ? 13.322  -18.347 80.326  1.00 49.53 ? 19  ARG A CD  1 
ATOM   115  N  NE  . ARG A 1 19  ? 14.407  -19.034 79.627  1.00 58.26 ? 19  ARG A NE  1 
ATOM   116  C  CZ  . ARG A 1 19  ? 14.496  -20.352 79.472  1.00 59.66 ? 19  ARG A CZ  1 
ATOM   117  N  NH1 . ARG A 1 19  ? 13.556  -21.147 79.977  1.00 56.52 ? 19  ARG A NH1 1 
ATOM   118  N  NH2 . ARG A 1 19  ? 15.532  -20.872 78.816  1.00 51.61 ? 19  ARG A NH2 1 
ATOM   119  N  N   . VAL A 1 20  ? 10.212  -15.892 77.074  1.00 49.78 ? 20  VAL A N   1 
ATOM   120  C  CA  . VAL A 1 20  ? 9.055   -16.393 76.340  1.00 48.91 ? 20  VAL A CA  1 
ATOM   121  C  C   . VAL A 1 20  ? 9.306   -17.773 75.754  1.00 46.99 ? 20  VAL A C   1 
ATOM   122  O  O   . VAL A 1 20  ? 10.436  -18.114 75.402  1.00 51.29 ? 20  VAL A O   1 
ATOM   123  C  CB  . VAL A 1 20  ? 8.632   -15.422 75.213  1.00 50.14 ? 20  VAL A CB  1 
ATOM   124  C  CG1 . VAL A 1 20  ? 8.379   -14.047 75.796  1.00 47.88 ? 20  VAL A CG1 1 
ATOM   125  C  CG2 . VAL A 1 20  ? 9.692   -15.352 74.106  1.00 46.92 ? 20  VAL A CG2 1 
ATOM   126  N  N   . PRO A 1 21  ? 8.250   -18.588 75.678  1.00 47.26 ? 21  PRO A N   1 
ATOM   127  C  CA  . PRO A 1 21  ? 8.350   -19.860 74.966  1.00 51.26 ? 21  PRO A CA  1 
ATOM   128  C  C   . PRO A 1 21  ? 8.336   -19.644 73.451  1.00 49.57 ? 21  PRO A C   1 
ATOM   129  O  O   . PRO A 1 21  ? 7.780   -18.664 72.943  1.00 46.98 ? 21  PRO A O   1 
ATOM   130  C  CB  . PRO A 1 21  ? 7.108   -20.615 75.425  1.00 46.29 ? 21  PRO A CB  1 
ATOM   131  C  CG  . PRO A 1 21  ? 6.128   -19.538 75.706  1.00 51.39 ? 21  PRO A CG  1 
ATOM   132  C  CD  . PRO A 1 21  ? 6.919   -18.397 76.276  1.00 47.73 ? 21  PRO A CD  1 
ATOM   133  N  N   . VAL A 1 22  ? 8.972   -20.560 72.739  1.00 49.44 ? 22  VAL A N   1 
ATOM   134  C  CA  . VAL A 1 22  ? 8.912   -20.570 71.289  1.00 49.90 ? 22  VAL A CA  1 
ATOM   135  C  C   . VAL A 1 22  ? 9.194   -21.990 70.844  1.00 49.93 ? 22  VAL A C   1 
ATOM   136  O  O   . VAL A 1 22  ? 10.302  -22.488 71.035  1.00 52.29 ? 22  VAL A O   1 
ATOM   137  C  CB  . VAL A 1 22  ? 9.920   -19.579 70.652  1.00 46.28 ? 22  VAL A CB  1 
ATOM   138  C  CG1 . VAL A 1 22  ? 11.265  -19.658 71.350  1.00 45.90 ? 22  VAL A CG1 1 
ATOM   139  C  CG2 . VAL A 1 22  ? 10.065  -19.840 69.146  1.00 44.74 ? 22  VAL A CG2 1 
ATOM   140  N  N   . LEU A 1 23  ? 8.177   -22.643 70.285  1.00 50.07 ? 23  LEU A N   1 
ATOM   141  C  CA  . LEU A 1 23  ? 8.312   -24.005 69.776  1.00 53.16 ? 23  LEU A CA  1 
ATOM   142  C  C   . LEU A 1 23  ? 9.032   -24.929 70.772  1.00 57.71 ? 23  LEU A C   1 
ATOM   143  O  O   . LEU A 1 23  ? 10.155  -25.376 70.517  1.00 57.46 ? 23  LEU A O   1 
ATOM   144  C  CB  . LEU A 1 23  ? 9.068   -24.002 68.439  1.00 53.23 ? 23  LEU A CB  1 
ATOM   145  C  CG  . LEU A 1 23  ? 8.680   -23.007 67.339  1.00 51.94 ? 23  LEU A CG  1 
ATOM   146  C  CD1 . LEU A 1 23  ? 9.693   -23.050 66.200  1.00 43.49 ? 23  LEU A CD1 1 
ATOM   147  C  CD2 . LEU A 1 23  ? 7.278   -23.267 66.817  1.00 45.85 ? 23  LEU A CD2 1 
ATOM   148  N  N   . SER A 1 24  ? 8.394   -25.196 71.906  1.00 56.77 ? 24  SER A N   1 
ATOM   149  C  CA  . SER A 1 24  ? 8.947   -26.116 72.900  1.00 64.41 ? 24  SER A CA  1 
ATOM   150  C  C   . SER A 1 24  ? 10.381  -25.757 73.306  1.00 64.39 ? 24  SER A C   1 
ATOM   151  O  O   . SER A 1 24  ? 11.221  -26.635 73.505  1.00 68.03 ? 24  SER A O   1 
ATOM   152  C  CB  . SER A 1 24  ? 8.904   -27.550 72.370  1.00 66.53 ? 24  SER A CB  1 
ATOM   153  O  OG  . SER A 1 24  ? 9.865   -27.735 71.346  1.00 67.46 ? 24  SER A OG  1 
ATOM   154  N  N   . SER A 1 25  ? 10.648  -24.458 73.404  1.00 63.30 ? 25  SER A N   1 
ATOM   155  C  CA  . SER A 1 25  ? 11.922  -23.938 73.894  1.00 56.48 ? 25  SER A CA  1 
ATOM   156  C  C   . SER A 1 25  ? 11.665  -22.526 74.410  1.00 51.92 ? 25  SER A C   1 
ATOM   157  O  O   . SER A 1 25  ? 10.522  -22.158 74.659  1.00 53.64 ? 25  SER A O   1 
ATOM   158  C  CB  . SER A 1 25  ? 12.987  -23.948 72.794  1.00 59.85 ? 25  SER A CB  1 
ATOM   159  O  OG  . SER A 1 25  ? 14.286  -23.675 73.305  1.00 55.65 ? 25  SER A OG  1 
ATOM   160  N  N   . HIS A 1 26  ? 12.713  -21.728 74.559  1.00 50.11 ? 26  HIS A N   1 
ATOM   161  C  CA  . HIS A 1 26  ? 12.548  -20.389 75.114  1.00 51.36 ? 26  HIS A CA  1 
ATOM   162  C  C   . HIS A 1 26  ? 13.566  -19.414 74.533  1.00 49.46 ? 26  HIS A C   1 
ATOM   163  O  O   . HIS A 1 26  ? 14.666  -19.811 74.153  1.00 46.11 ? 26  HIS A O   1 
ATOM   164  C  CB  . HIS A 1 26  ? 12.681  -20.418 76.651  1.00 50.07 ? 26  HIS A CB  1 
ATOM   165  C  CG  . HIS A 1 26  ? 11.617  -21.220 77.342  1.00 54.88 ? 26  HIS A CG  1 
ATOM   166  N  ND1 . HIS A 1 26  ? 11.728  -22.578 77.556  1.00 57.61 ? 26  HIS A ND1 1 
ATOM   167  C  CD2 . HIS A 1 26  ? 10.420  -20.855 77.863  1.00 52.90 ? 26  HIS A CD2 1 
ATOM   168  C  CE1 . HIS A 1 26  ? 10.645  -23.015 78.176  1.00 54.23 ? 26  HIS A CE1 1 
ATOM   169  N  NE2 . HIS A 1 26  ? 9.835   -21.990 78.373  1.00 53.35 ? 26  HIS A NE2 1 
ATOM   170  N  N   . ILE A 1 27  ? 13.196  -18.139 74.477  1.00 46.31 ? 27  ILE A N   1 
ATOM   171  C  CA  . ILE A 1 27  ? 14.160  -17.078 74.213  1.00 45.89 ? 27  ILE A CA  1 
ATOM   172  C  C   . ILE A 1 27  ? 13.780  -15.825 74.994  1.00 45.05 ? 27  ILE A C   1 
ATOM   173  O  O   . ILE A 1 27  ? 12.699  -15.751 75.572  1.00 44.62 ? 27  ILE A O   1 
ATOM   174  C  CB  . ILE A 1 27  ? 14.266  -16.727 72.705  1.00 44.92 ? 27  ILE A CB  1 
ATOM   175  C  CG1 . ILE A 1 27  ? 12.956  -16.147 72.181  1.00 42.61 ? 27  ILE A CG1 1 
ATOM   176  C  CG2 . ILE A 1 27  ? 14.711  -17.939 71.888  1.00 46.34 ? 27  ILE A CG2 1 
ATOM   177  C  CD1 . ILE A 1 27  ? 13.094  -15.615 70.766  1.00 52.78 ? 27  ILE A CD1 1 
ATOM   178  N  N   . SER A 1 28  ? 14.672  -14.840 75.000  1.00 44.01 ? 28  SER A N   1 
ATOM   179  C  CA  . SER A 1 28  ? 14.432  -13.589 75.709  1.00 45.74 ? 28  SER A CA  1 
ATOM   180  C  C   . SER A 1 28  ? 13.724  -12.569 74.826  1.00 45.24 ? 28  SER A C   1 
ATOM   181  O  O   . SER A 1 28  ? 14.003  -12.470 73.629  1.00 45.97 ? 28  SER A O   1 
ATOM   182  C  CB  . SER A 1 28  ? 15.750  -13.001 76.210  1.00 45.70 ? 28  SER A CB  1 
ATOM   183  O  OG  . SER A 1 28  ? 16.431  -13.929 77.033  1.00 53.07 ? 28  SER A OG  1 
ATOM   184  N  N   . ALA A 1 29  ? 12.823  -11.799 75.427  1.00 42.42 ? 29  ALA A N   1 
ATOM   185  C  CA  . ALA A 1 29  ? 12.117  -10.748 74.710  1.00 39.38 ? 29  ALA A CA  1 
ATOM   186  C  C   . ALA A 1 29  ? 12.085  -9.458  75.519  1.00 42.56 ? 29  ALA A C   1 
ATOM   187  O  O   . ALA A 1 29  ? 11.677  -9.463  76.680  1.00 45.94 ? 29  ALA A O   1 
ATOM   188  C  CB  . ALA A 1 29  ? 10.704  -11.198 74.375  1.00 39.93 ? 29  ALA A CB  1 
ATOM   189  N  N   . PHE A 1 30  ? 12.515  -8.356  74.912  1.00 41.07 ? 30  PHE A N   1 
ATOM   190  C  CA  . PHE A 1 30  ? 12.372  -7.047  75.540  1.00 39.80 ? 30  PHE A CA  1 
ATOM   191  C  C   . PHE A 1 30  ? 11.367  -6.214  74.763  1.00 41.69 ? 30  PHE A C   1 
ATOM   192  O  O   . PHE A 1 30  ? 11.666  -5.699  73.677  1.00 41.71 ? 30  PHE A O   1 
ATOM   193  C  CB  . PHE A 1 30  ? 13.713  -6.326  75.624  1.00 40.52 ? 30  PHE A CB  1 
ATOM   194  C  CG  . PHE A 1 30  ? 14.807  -7.161  76.210  1.00 41.69 ? 30  PHE A CG  1 
ATOM   195  C  CD1 . PHE A 1 30  ? 15.492  -8.079  75.420  1.00 42.04 ? 30  PHE A CD1 1 
ATOM   196  C  CD2 . PHE A 1 30  ? 15.153  -7.036  77.546  1.00 39.10 ? 30  PHE A CD2 1 
ATOM   197  C  CE1 . PHE A 1 30  ? 16.502  -8.857  75.957  1.00 43.00 ? 30  PHE A CE1 1 
ATOM   198  C  CE2 . PHE A 1 30  ? 16.162  -7.810  78.088  1.00 40.61 ? 30  PHE A CE2 1 
ATOM   199  C  CZ  . PHE A 1 30  ? 16.836  -8.720  77.298  1.00 40.77 ? 30  PHE A CZ  1 
ATOM   200  N  N   . LEU A 1 31  ? 10.174  -6.090  75.327  1.00 33.82 ? 31  LEU A N   1 
ATOM   201  C  CA  . LEU A 1 31  ? 9.058   -5.484  74.634  1.00 36.01 ? 31  LEU A CA  1 
ATOM   202  C  C   . LEU A 1 31  ? 8.801   -4.059  75.097  1.00 37.55 ? 31  LEU A C   1 
ATOM   203  O  O   . LEU A 1 31  ? 8.871   -3.760  76.285  1.00 37.03 ? 31  LEU A O   1 
ATOM   204  C  CB  . LEU A 1 31  ? 7.801   -6.327  74.842  1.00 38.66 ? 31  LEU A CB  1 
ATOM   205  C  CG  . LEU A 1 31  ? 7.872   -7.802  74.445  1.00 41.06 ? 31  LEU A CG  1 
ATOM   206  C  CD1 . LEU A 1 31  ? 6.530   -8.472  74.726  1.00 38.26 ? 31  LEU A CD1 1 
ATOM   207  C  CD2 . LEU A 1 31  ? 8.276   -7.962  72.964  1.00 37.77 ? 31  LEU A CD2 1 
ATOM   208  N  N   . GLY A 1 32  ? 8.483   -3.184  74.152  1.00 36.61 ? 32  GLY A N   1 
ATOM   209  C  CA  . GLY A 1 32  ? 8.078   -1.827  74.473  1.00 36.43 ? 32  GLY A CA  1 
ATOM   210  C  C   . GLY A 1 32  ? 9.176   -0.954  75.055  1.00 37.78 ? 32  GLY A C   1 
ATOM   211  O  O   . GLY A 1 32  ? 8.939   -0.218  76.009  1.00 38.96 ? 32  GLY A O   1 
ATOM   212  N  N   . ILE A 1 33  ? 10.377  -1.027  74.485  1.00 36.03 ? 33  ILE A N   1 
ATOM   213  C  CA  . ILE A 1 33  ? 11.469  -0.164  74.909  1.00 33.20 ? 33  ILE A CA  1 
ATOM   214  C  C   . ILE A 1 33  ? 11.303  1.191   74.246  1.00 34.80 ? 33  ILE A C   1 
ATOM   215  O  O   . ILE A 1 33  ? 11.150  1.272   73.026  1.00 36.70 ? 33  ILE A O   1 
ATOM   216  C  CB  . ILE A 1 33  ? 12.837  -0.758  74.544  1.00 38.03 ? 33  ILE A CB  1 
ATOM   217  C  CG1 . ILE A 1 33  ? 13.049  -2.102  75.239  1.00 37.11 ? 33  ILE A CG1 1 
ATOM   218  C  CG2 . ILE A 1 33  ? 13.967  0.207   74.899  1.00 33.17 ? 33  ILE A CG2 1 
ATOM   219  C  CD1 . ILE A 1 33  ? 14.246  -2.870  74.673  1.00 38.76 ? 33  ILE A CD1 1 
ATOM   220  N  N   . PRO A 1 34  ? 11.311  2.264   75.041  1.00 34.01 ? 34  PRO A N   1 
ATOM   221  C  CA  . PRO A 1 34  ? 11.129  3.611   74.488  1.00 29.24 ? 34  PRO A CA  1 
ATOM   222  C  C   . PRO A 1 34  ? 12.386  4.126   73.807  1.00 34.84 ? 34  PRO A C   1 
ATOM   223  O  O   . PRO A 1 34  ? 13.455  4.044   74.413  1.00 35.24 ? 34  PRO A O   1 
ATOM   224  C  CB  . PRO A 1 34  ? 10.793  4.456   75.714  1.00 32.71 ? 34  PRO A CB  1 
ATOM   225  C  CG  . PRO A 1 34  ? 11.375  3.692   76.878  1.00 36.36 ? 34  PRO A CG  1 
ATOM   226  C  CD  . PRO A 1 34  ? 11.283  2.245   76.516  1.00 36.88 ? 34  PRO A CD  1 
ATOM   227  N  N   . PHE A 1 35  ? 12.271  4.639   72.579  1.00 31.70 ? 35  PHE A N   1 
ATOM   228  C  CA  . PHE A 1 35  ? 13.455  5.127   71.876  1.00 30.62 ? 35  PHE A CA  1 
ATOM   229  C  C   . PHE A 1 35  ? 13.378  6.622   71.606  1.00 32.78 ? 35  PHE A C   1 
ATOM   230  O  O   . PHE A 1 35  ? 14.357  7.233   71.188  1.00 37.65 ? 35  PHE A O   1 
ATOM   231  C  CB  . PHE A 1 35  ? 13.693  4.337   70.574  1.00 30.55 ? 35  PHE A CB  1 
ATOM   232  C  CG  . PHE A 1 35  ? 12.680  4.585   69.483  1.00 35.08 ? 35  PHE A CG  1 
ATOM   233  C  CD1 . PHE A 1 35  ? 12.761  5.711   68.678  1.00 30.95 ? 35  PHE A CD1 1 
ATOM   234  C  CD2 . PHE A 1 35  ? 11.676  3.656   69.226  1.00 35.56 ? 35  PHE A CD2 1 
ATOM   235  C  CE1 . PHE A 1 35  ? 11.835  5.922   67.655  1.00 35.26 ? 35  PHE A CE1 1 
ATOM   236  C  CE2 . PHE A 1 35  ? 10.750  3.859   68.201  1.00 30.59 ? 35  PHE A CE2 1 
ATOM   237  C  CZ  . PHE A 1 35  ? 10.824  4.994   67.424  1.00 31.20 ? 35  PHE A CZ  1 
ATOM   238  N  N   . ALA A 1 36  ? 12.232  7.224   71.893  1.00 32.12 ? 36  ALA A N   1 
ATOM   239  C  CA  . ALA A 1 36  ? 12.076  8.663   71.724  1.00 33.16 ? 36  ALA A CA  1 
ATOM   240  C  C   . ALA A 1 36  ? 11.242  9.244   72.857  1.00 33.47 ? 36  ALA A C   1 
ATOM   241  O  O   . ALA A 1 36  ? 10.626  8.509   73.625  1.00 35.04 ? 36  ALA A O   1 
ATOM   242  C  CB  . ALA A 1 36  ? 11.421  8.974   70.366  1.00 34.44 ? 36  ALA A CB  1 
ATOM   243  N  N   . GLU A 1 37  ? 11.220  10.564  72.964  1.00 34.16 ? 37  GLU A N   1 
ATOM   244  C  CA  . GLU A 1 37  ? 10.279  11.209  73.871  1.00 36.42 ? 37  GLU A CA  1 
ATOM   245  C  C   . GLU A 1 37  ? 8.891   11.094  73.241  1.00 38.31 ? 37  GLU A C   1 
ATOM   246  O  O   . GLU A 1 37  ? 8.761   11.180  72.015  1.00 40.02 ? 37  GLU A O   1 
ATOM   247  C  CB  . GLU A 1 37  ? 10.660  12.670  74.111  1.00 35.49 ? 37  GLU A CB  1 
ATOM   248  C  CG  . GLU A 1 37  ? 11.888  12.850  75.007  1.00 36.55 ? 37  GLU A CG  1 
ATOM   249  C  CD  . GLU A 1 37  ? 11.585  12.496  76.458  1.00 40.98 ? 37  GLU A CD  1 
ATOM   250  O  OE1 . GLU A 1 37  ? 10.751  13.191  77.087  1.00 40.78 ? 37  GLU A OE1 1 
ATOM   251  O  OE2 . GLU A 1 37  ? 12.145  11.498  76.962  1.00 40.96 ? 37  GLU A OE2 1 
ATOM   252  N  N   . PRO A 1 38  ? 7.861   10.876  74.065  1.00 38.90 ? 38  PRO A N   1 
ATOM   253  C  CA  . PRO A 1 38  ? 6.489   10.848  73.547  1.00 36.27 ? 38  PRO A CA  1 
ATOM   254  C  C   . PRO A 1 38  ? 6.202   12.092  72.728  1.00 36.17 ? 38  PRO A C   1 
ATOM   255  O  O   . PRO A 1 38  ? 6.331   13.205  73.230  1.00 35.61 ? 38  PRO A O   1 
ATOM   256  C  CB  . PRO A 1 38  ? 5.630   10.803  74.812  1.00 34.93 ? 38  PRO A CB  1 
ATOM   257  C  CG  . PRO A 1 38  ? 6.535   10.153  75.841  1.00 39.58 ? 38  PRO A CG  1 
ATOM   258  C  CD  . PRO A 1 38  ? 7.913   10.669  75.525  1.00 38.17 ? 38  PRO A CD  1 
ATOM   259  N  N   . PRO A 1 39  ? 5.842   11.906  71.453  1.00 36.13 ? 39  PRO A N   1 
ATOM   260  C  CA  . PRO A 1 39  ? 5.669   13.062  70.576  1.00 34.30 ? 39  PRO A CA  1 
ATOM   261  C  C   . PRO A 1 39  ? 4.294   13.672  70.771  1.00 37.36 ? 39  PRO A C   1 
ATOM   262  O  O   . PRO A 1 39  ? 3.503   13.682  69.831  1.00 38.61 ? 39  PRO A O   1 
ATOM   263  C  CB  . PRO A 1 39  ? 5.835   12.463  69.178  1.00 35.22 ? 39  PRO A CB  1 
ATOM   264  C  CG  . PRO A 1 39  ? 5.332   11.057  69.316  1.00 35.83 ? 39  PRO A CG  1 
ATOM   265  C  CD  . PRO A 1 39  ? 5.623   10.629  70.754  1.00 35.06 ? 39  PRO A CD  1 
ATOM   266  N  N   . VAL A 1 40  ? 4.008   14.164  71.978  1.00 39.65 ? 40  VAL A N   1 
ATOM   267  C  CA  . VAL A 1 40  ? 2.651   14.593  72.315  1.00 39.37 ? 40  VAL A CA  1 
ATOM   268  C  C   . VAL A 1 40  ? 2.541   16.085  72.585  1.00 38.13 ? 40  VAL A C   1 
ATOM   269  O  O   . VAL A 1 40  ? 3.544   16.772  72.742  1.00 38.59 ? 40  VAL A O   1 
ATOM   270  C  CB  . VAL A 1 40  ? 2.115   13.838  73.546  1.00 40.11 ? 40  VAL A CB  1 
ATOM   271  C  CG1 . VAL A 1 40  ? 2.138   12.334  73.295  1.00 38.32 ? 40  VAL A CG1 1 
ATOM   272  C  CG2 . VAL A 1 40  ? 2.935   14.194  74.785  1.00 37.51 ? 40  VAL A CG2 1 
ATOM   273  N  N   . GLY A 1 41  ? 1.304   16.575  72.632  1.00 39.34 ? 41  GLY A N   1 
ATOM   274  C  CA  . GLY A 1 41  ? 1.037   17.979  72.880  1.00 38.20 ? 41  GLY A CA  1 
ATOM   275  C  C   . GLY A 1 41  ? 1.716   18.863  71.862  1.00 41.08 ? 41  GLY A C   1 
ATOM   276  O  O   . GLY A 1 41  ? 1.479   18.732  70.660  1.00 46.45 ? 41  GLY A O   1 
ATOM   277  N  N   . ASN A 1 42  ? 2.584   19.749  72.338  1.00 42.07 ? 42  ASN A N   1 
ATOM   278  C  CA  . ASN A 1 42  ? 3.320   20.654  71.455  1.00 44.03 ? 42  ASN A CA  1 
ATOM   279  C  C   . ASN A 1 42  ? 4.344   19.948  70.579  1.00 40.95 ? 42  ASN A C   1 
ATOM   280  O  O   . ASN A 1 42  ? 4.920   20.551  69.681  1.00 41.34 ? 42  ASN A O   1 
ATOM   281  C  CB  . ASN A 1 42  ? 4.011   21.745  72.274  1.00 47.00 ? 42  ASN A CB  1 
ATOM   282  C  CG  . ASN A 1 42  ? 3.025   22.758  72.823  1.00 57.81 ? 42  ASN A CG  1 
ATOM   283  O  OD1 . ASN A 1 42  ? 2.004   23.043  72.190  1.00 64.04 ? 42  ASN A OD1 1 
ATOM   284  N  ND2 . ASN A 1 42  ? 3.313   23.298  74.008  1.00 62.04 ? 42  ASN A ND2 1 
ATOM   285  N  N   . MET A 1 43  ? 4.565   18.665  70.825  1.00 37.85 ? 43  MET A N   1 
ATOM   286  C  CA  . MET A 1 43  ? 5.509   17.912  70.014  1.00 38.04 ? 43  MET A CA  1 
ATOM   287  C  C   . MET A 1 43  ? 4.807   17.142  68.893  1.00 40.15 ? 43  MET A C   1 
ATOM   288  O  O   . MET A 1 43  ? 5.447   16.428  68.121  1.00 36.53 ? 43  MET A O   1 
ATOM   289  C  CB  . MET A 1 43  ? 6.314   16.960  70.890  1.00 37.03 ? 43  MET A CB  1 
ATOM   290  C  CG  . MET A 1 43  ? 7.186   17.683  71.915  1.00 39.35 ? 43  MET A CG  1 
ATOM   291  S  SD  . MET A 1 43  ? 8.339   16.582  72.750  1.00 44.19 ? 43  MET A SD  1 
ATOM   292  C  CE  . MET A 1 43  ? 9.290   15.948  71.373  1.00 44.64 ? 43  MET A CE  1 
ATOM   293  N  N   . ARG A 1 44  ? 3.489   17.283  68.795  1.00 38.70 ? 44  ARG A N   1 
ATOM   294  C  CA  . ARG A 1 44  ? 2.797   16.685  67.663  1.00 38.93 ? 44  ARG A CA  1 
ATOM   295  C  C   . ARG A 1 44  ? 3.299   17.323  66.353  1.00 34.75 ? 44  ARG A C   1 
ATOM   296  O  O   . ARG A 1 44  ? 3.403   18.549  66.255  1.00 35.33 ? 44  ARG A O   1 
ATOM   297  C  CB  . ARG A 1 44  ? 1.280   16.839  67.803  1.00 37.95 ? 44  ARG A CB  1 
ATOM   298  C  CG  . ARG A 1 44  ? 0.510   16.271  66.616  1.00 35.72 ? 44  ARG A CG  1 
ATOM   299  C  CD  . ARG A 1 44  ? -0.967  16.526  66.760  1.00 40.01 ? 44  ARG A CD  1 
ATOM   300  N  NE  . ARG A 1 44  ? -1.573  15.709  67.807  1.00 37.94 ? 44  ARG A NE  1 
ATOM   301  C  CZ  . ARG A 1 44  ? -2.811  15.889  68.248  1.00 37.83 ? 44  ARG A CZ  1 
ATOM   302  N  NH1 . ARG A 1 44  ? -3.554  16.857  67.738  1.00 38.78 ? 44  ARG A NH1 1 
ATOM   303  N  NH2 . ARG A 1 44  ? -3.306  15.109  69.196  1.00 38.18 ? 44  ARG A NH2 1 
ATOM   304  N  N   . PHE A 1 45  ? 3.634   16.479  65.376  1.00 32.98 ? 45  PHE A N   1 
ATOM   305  C  CA  . PHE A 1 45  ? 4.092   16.894  64.032  1.00 33.42 ? 45  PHE A CA  1 
ATOM   306  C  C   . PHE A 1 45  ? 5.574   17.247  64.003  1.00 38.18 ? 45  PHE A C   1 
ATOM   307  O  O   . PHE A 1 45  ? 6.139   17.504  62.931  1.00 36.59 ? 45  PHE A O   1 
ATOM   308  C  CB  . PHE A 1 45  ? 3.293   18.096  63.493  1.00 33.71 ? 45  PHE A CB  1 
ATOM   309  C  CG  . PHE A 1 45  ? 1.806   17.879  63.457  1.00 34.89 ? 45  PHE A CG  1 
ATOM   310  C  CD1 . PHE A 1 45  ? 1.273   16.691  62.976  1.00 34.22 ? 45  PHE A CD1 1 
ATOM   311  C  CD2 . PHE A 1 45  ? 0.939   18.854  63.929  1.00 34.68 ? 45  PHE A CD2 1 
ATOM   312  C  CE1 . PHE A 1 45  ? -0.093  16.482  62.948  1.00 31.14 ? 45  PHE A CE1 1 
ATOM   313  C  CE2 . PHE A 1 45  ? -0.431  18.648  63.913  1.00 36.07 ? 45  PHE A CE2 1 
ATOM   314  C  CZ  . PHE A 1 45  ? -0.945  17.456  63.416  1.00 36.06 ? 45  PHE A CZ  1 
ATOM   315  N  N   . ARG A 1 46  ? 6.198   17.253  65.179  1.00 36.51 ? 46  ARG A N   1 
ATOM   316  C  CA  . ARG A 1 46  ? 7.582   17.683  65.321  1.00 36.98 ? 46  ARG A CA  1 
ATOM   317  C  C   . ARG A 1 46  ? 8.532   16.504  65.149  1.00 38.23 ? 46  ARG A C   1 
ATOM   318  O  O   . ARG A 1 46  ? 8.148   15.356  65.391  1.00 35.18 ? 46  ARG A O   1 
ATOM   319  C  CB  . ARG A 1 46  ? 7.788   18.336  66.696  1.00 39.27 ? 46  ARG A CB  1 
ATOM   320  C  CG  . ARG A 1 46  ? 8.656   19.589  66.704  1.00 45.28 ? 46  ARG A CG  1 
ATOM   321  C  CD  . ARG A 1 46  ? 8.861   20.129  68.128  1.00 45.89 ? 46  ARG A CD  1 
ATOM   322  N  NE  . ARG A 1 46  ? 7.900   21.180  68.453  1.00 52.10 ? 46  ARG A NE  1 
ATOM   323  C  CZ  . ARG A 1 46  ? 7.640   21.607  69.690  1.00 51.57 ? 46  ARG A CZ  1 
ATOM   324  N  NH1 . ARG A 1 46  ? 6.742   22.573  69.879  1.00 43.28 ? 46  ARG A NH1 1 
ATOM   325  N  NH2 . ARG A 1 46  ? 8.267   21.065  70.734  1.00 45.48 ? 46  ARG A NH2 1 
ATOM   326  N  N   . ARG A 1 47  ? 9.762   16.785  64.723  1.00 37.03 ? 47  ARG A N   1 
ATOM   327  C  CA  . ARG A 1 47  ? 10.822  15.782  64.727  1.00 37.98 ? 47  ARG A CA  1 
ATOM   328  C  C   . ARG A 1 47  ? 10.902  15.107  66.095  1.00 37.74 ? 47  ARG A C   1 
ATOM   329  O  O   . ARG A 1 47  ? 10.667  15.751  67.109  1.00 34.22 ? 47  ARG A O   1 
ATOM   330  C  CB  . ARG A 1 47  ? 12.168  16.418  64.388  1.00 43.36 ? 47  ARG A CB  1 
ATOM   331  C  CG  . ARG A 1 47  ? 12.271  16.920  62.954  1.00 40.01 ? 47  ARG A CG  1 
ATOM   332  C  CD  . ARG A 1 47  ? 13.683  17.381  62.610  1.00 42.51 ? 47  ARG A CD  1 
ATOM   333  N  NE  . ARG A 1 47  ? 13.796  17.607  61.170  1.00 50.73 ? 47  ARG A NE  1 
ATOM   334  C  CZ  . ARG A 1 47  ? 13.526  18.763  60.568  1.00 51.35 ? 47  ARG A CZ  1 
ATOM   335  N  NH1 . ARG A 1 47  ? 13.638  18.864  59.248  1.00 53.05 ? 47  ARG A NH1 1 
ATOM   336  N  NH2 . ARG A 1 47  ? 13.146  19.819  61.282  1.00 50.67 ? 47  ARG A NH2 1 
ATOM   337  N  N   . PRO A 1 48  ? 11.234  13.807  66.117  1.00 38.29 ? 48  PRO A N   1 
ATOM   338  C  CA  . PRO A 1 48  ? 11.367  13.073  67.379  1.00 31.93 ? 48  PRO A CA  1 
ATOM   339  C  C   . PRO A 1 48  ? 12.569  13.557  68.179  1.00 38.61 ? 48  PRO A C   1 
ATOM   340  O  O   . PRO A 1 48  ? 13.575  13.913  67.569  1.00 39.08 ? 48  PRO A O   1 
ATOM   341  C  CB  . PRO A 1 48  ? 11.569  11.626  66.930  1.00 33.13 ? 48  PRO A CB  1 
ATOM   342  C  CG  . PRO A 1 48  ? 12.228  11.756  65.568  1.00 32.25 ? 48  PRO A CG  1 
ATOM   343  C  CD  . PRO A 1 48  ? 11.632  12.996  64.947  1.00 31.11 ? 48  PRO A CD  1 
ATOM   344  N  N   . GLU A 1 49  ? 12.448  13.591  69.508  1.00 40.17 ? 49  GLU A N   1 
ATOM   345  C  CA  . GLU A 1 49  ? 13.583  13.836  70.403  1.00 41.25 ? 49  GLU A CA  1 
ATOM   346  C  C   . GLU A 1 49  ? 13.995  12.528  71.083  1.00 38.87 ? 49  GLU A C   1 
ATOM   347  O  O   . GLU A 1 49  ? 13.136  11.725  71.453  1.00 35.32 ? 49  GLU A O   1 
ATOM   348  C  CB  . GLU A 1 49  ? 13.246  14.889  71.468  1.00 42.88 ? 49  GLU A CB  1 
ATOM   349  C  CG  . GLU A 1 49  ? 12.961  16.293  70.932  1.00 46.65 ? 49  GLU A CG  1 
ATOM   350  C  CD  . GLU A 1 49  ? 14.099  16.852  70.082  1.00 54.50 ? 49  GLU A CD  1 
ATOM   351  O  OE1 . GLU A 1 49  ? 15.280  16.523  70.347  1.00 60.24 ? 49  GLU A OE1 1 
ATOM   352  O  OE2 . GLU A 1 49  ? 13.811  17.626  69.140  1.00 56.62 ? 49  GLU A OE2 1 
ATOM   353  N  N   . PRO A 1 50  ? 15.312  12.300  71.239  1.00 40.52 ? 50  PRO A N   1 
ATOM   354  C  CA  . PRO A 1 50  ? 15.745  11.053  71.872  1.00 36.25 ? 50  PRO A CA  1 
ATOM   355  C  C   . PRO A 1 50  ? 15.145  10.907  73.262  1.00 38.12 ? 50  PRO A C   1 
ATOM   356  O  O   . PRO A 1 50  ? 14.931  11.907  73.941  1.00 38.13 ? 50  PRO A O   1 
ATOM   357  C  CB  . PRO A 1 50  ? 17.263  11.186  71.932  1.00 35.64 ? 50  PRO A CB  1 
ATOM   358  C  CG  . PRO A 1 50  ? 17.559  12.615  71.580  1.00 38.65 ? 50  PRO A CG  1 
ATOM   359  C  CD  . PRO A 1 50  ? 16.444  13.108  70.759  1.00 37.77 ? 50  PRO A CD  1 
ATOM   360  N  N   . LYS A 1 51  ? 14.839  9.672   73.641  1.00 34.71 ? 51  LYS A N   1 
ATOM   361  C  CA  . LYS A 1 51  ? 14.241  9.389   74.922  1.00 38.10 ? 51  LYS A CA  1 
ATOM   362  C  C   . LYS A 1 51  ? 15.251  9.782   75.995  1.00 43.51 ? 51  LYS A C   1 
ATOM   363  O  O   . LYS A 1 51  ? 16.419  9.389   75.928  1.00 44.06 ? 51  LYS A O   1 
ATOM   364  C  CB  . LYS A 1 51  ? 13.850  7.912   75.018  1.00 37.48 ? 51  LYS A CB  1 
ATOM   365  C  CG  . LYS A 1 51  ? 13.462  7.447   76.419  1.00 35.10 ? 51  LYS A CG  1 
ATOM   366  C  CD  . LYS A 1 51  ? 12.208  8.152   76.891  1.00 35.81 ? 51  LYS A CD  1 
ATOM   367  C  CE  . LYS A 1 51  ? 11.715  7.593   78.227  1.00 33.07 ? 51  LYS A CE  1 
ATOM   368  N  NZ  . LYS A 1 51  ? 10.367  8.141   78.581  1.00 33.23 ? 51  LYS A NZ  1 
ATOM   369  N  N   . LYS A 1 52  ? 14.815  10.601  76.945  1.00 42.14 ? 52  LYS A N   1 
ATOM   370  C  CA  . LYS A 1 52  ? 15.676  10.977  78.067  1.00 44.35 ? 52  LYS A CA  1 
ATOM   371  C  C   . LYS A 1 52  ? 15.816  9.802   79.009  1.00 40.20 ? 52  LYS A C   1 
ATOM   372  O  O   . LYS A 1 52  ? 14.848  9.087   79.261  1.00 42.95 ? 52  LYS A O   1 
ATOM   373  C  CB  . LYS A 1 52  ? 15.123  12.199  78.810  1.00 43.49 ? 52  LYS A CB  1 
ATOM   374  C  CG  . LYS A 1 52  ? 15.157  13.470  77.959  1.00 49.15 ? 52  LYS A CG  1 
ATOM   375  C  CD  . LYS A 1 52  ? 14.819  14.711  78.758  1.00 49.32 ? 52  LYS A CD  1 
ATOM   376  C  CE  . LYS A 1 52  ? 13.563  14.522  79.582  1.00 53.90 ? 52  LYS A CE  1 
ATOM   377  N  NZ  . LYS A 1 52  ? 12.309  14.906  78.884  1.00 51.41 ? 52  LYS A NZ  1 
ATOM   378  N  N   . PRO A 1 53  ? 17.034  9.589   79.519  1.00 43.75 ? 53  PRO A N   1 
ATOM   379  C  CA  . PRO A 1 53  ? 17.344  8.464   80.407  1.00 44.22 ? 53  PRO A CA  1 
ATOM   380  C  C   . PRO A 1 53  ? 16.457  8.425   81.643  1.00 42.70 ? 53  PRO A C   1 
ATOM   381  O  O   . PRO A 1 53  ? 16.016  9.468   82.125  1.00 39.40 ? 53  PRO A O   1 
ATOM   382  C  CB  . PRO A 1 53  ? 18.808  8.712   80.779  1.00 44.29 ? 53  PRO A CB  1 
ATOM   383  C  CG  . PRO A 1 53  ? 19.366  9.403   79.573  1.00 47.01 ? 53  PRO A CG  1 
ATOM   384  C  CD  . PRO A 1 53  ? 18.246  10.326  79.123  1.00 45.38 ? 53  PRO A CD  1 
ATOM   385  N  N   . TRP A 1 54  ? 16.179  7.218   82.117  1.00 40.84 ? 54  TRP A N   1 
ATOM   386  C  CA  . TRP A 1 54  ? 15.333  7.015   83.282  1.00 45.55 ? 54  TRP A CA  1 
ATOM   387  C  C   . TRP A 1 54  ? 16.129  6.326   84.389  1.00 46.96 ? 54  TRP A C   1 
ATOM   388  O  O   . TRP A 1 54  ? 17.059  5.561   84.124  1.00 45.45 ? 54  TRP A O   1 
ATOM   389  C  CB  . TRP A 1 54  ? 14.107  6.178   82.919  1.00 41.46 ? 54  TRP A CB  1 
ATOM   390  C  CG  . TRP A 1 54  ? 14.483  4.862   82.324  1.00 43.43 ? 54  TRP A CG  1 
ATOM   391  C  CD1 . TRP A 1 54  ? 14.681  3.686   82.989  1.00 42.40 ? 54  TRP A CD1 1 
ATOM   392  C  CD2 . TRP A 1 54  ? 14.744  4.592   80.941  1.00 39.84 ? 54  TRP A CD2 1 
ATOM   393  N  NE1 . TRP A 1 54  ? 15.041  2.696   82.103  1.00 42.98 ? 54  TRP A NE1 1 
ATOM   394  C  CE2 . TRP A 1 54  ? 15.080  3.225   80.839  1.00 40.14 ? 54  TRP A CE2 1 
ATOM   395  C  CE3 . TRP A 1 54  ? 14.703  5.365   79.780  1.00 38.46 ? 54  TRP A CE3 1 
ATOM   396  C  CZ2 . TRP A 1 54  ? 15.390  2.618   79.620  1.00 41.89 ? 54  TRP A CZ2 1 
ATOM   397  C  CZ3 . TRP A 1 54  ? 15.010  4.761   78.565  1.00 42.86 ? 54  TRP A CZ3 1 
ATOM   398  C  CH2 . TRP A 1 54  ? 15.350  3.401   78.495  1.00 42.66 ? 54  TRP A CH2 1 
ATOM   399  N  N   . SER A 1 55  ? 15.775  6.594   85.635  1.00 48.75 ? 55  SER A N   1 
ATOM   400  C  CA  . SER A 1 55  ? 16.380  5.844   86.725  1.00 49.77 ? 55  SER A CA  1 
ATOM   401  C  C   . SER A 1 55  ? 15.521  4.610   86.951  1.00 47.07 ? 55  SER A C   1 
ATOM   402  O  O   . SER A 1 55  ? 14.372  4.567   86.527  1.00 46.56 ? 55  SER A O   1 
ATOM   403  C  CB  . SER A 1 55  ? 16.494  6.693   87.988  1.00 50.85 ? 55  SER A CB  1 
ATOM   404  O  OG  . SER A 1 55  ? 15.269  7.347   88.262  1.00 56.69 ? 55  SER A OG  1 
ATOM   405  N  N   . GLY A 1 56  ? 16.082  3.596   87.592  1.00 46.61 ? 56  GLY A N   1 
ATOM   406  C  CA  . GLY A 1 56  ? 15.344  2.370   87.817  1.00 45.84 ? 56  GLY A CA  1 
ATOM   407  C  C   . GLY A 1 56  ? 15.256  1.474   86.596  1.00 46.32 ? 56  GLY A C   1 
ATOM   408  O  O   . GLY A 1 56  ? 15.962  1.666   85.599  1.00 43.87 ? 56  GLY A O   1 
ATOM   409  N  N   . VAL A 1 57  ? 14.370  0.490   86.676  1.00 44.01 ? 57  VAL A N   1 
ATOM   410  C  CA  . VAL A 1 57  ? 14.311  -0.567  85.687  1.00 39.92 ? 57  VAL A CA  1 
ATOM   411  C  C   . VAL A 1 57  ? 13.030  -0.494  84.868  1.00 43.22 ? 57  VAL A C   1 
ATOM   412  O  O   . VAL A 1 57  ? 11.919  -0.641  85.397  1.00 41.18 ? 57  VAL A O   1 
ATOM   413  C  CB  . VAL A 1 57  ? 14.414  -1.941  86.357  1.00 44.68 ? 57  VAL A CB  1 
ATOM   414  C  CG1 . VAL A 1 57  ? 14.519  -3.034  85.314  1.00 41.46 ? 57  VAL A CG1 1 
ATOM   415  C  CG2 . VAL A 1 57  ? 15.618  -1.974  87.282  1.00 44.03 ? 57  VAL A CG2 1 
ATOM   416  N  N   . TRP A 1 58  ? 13.194  -0.258  83.569  1.00 41.53 ? 58  TRP A N   1 
ATOM   417  C  CA  . TRP A 1 58  ? 12.057  -0.223  82.653  1.00 42.04 ? 58  TRP A CA  1 
ATOM   418  C  C   . TRP A 1 58  ? 11.449  -1.616  82.536  1.00 38.98 ? 58  TRP A C   1 
ATOM   419  O  O   . TRP A 1 58  ? 12.149  -2.589  82.264  1.00 41.83 ? 58  TRP A O   1 
ATOM   420  C  CB  . TRP A 1 58  ? 12.469  0.309   81.272  1.00 40.75 ? 58  TRP A CB  1 
ATOM   421  C  CG  . TRP A 1 58  ? 11.284  0.663   80.444  1.00 40.14 ? 58  TRP A CG  1 
ATOM   422  C  CD1 . TRP A 1 58  ? 10.518  -0.189  79.706  1.00 38.10 ? 58  TRP A CD1 1 
ATOM   423  C  CD2 . TRP A 1 58  ? 10.704  1.962   80.288  1.00 39.69 ? 58  TRP A CD2 1 
ATOM   424  N  NE1 . TRP A 1 58  ? 9.498   0.500   79.094  1.00 37.02 ? 58  TRP A NE1 1 
ATOM   425  C  CE2 . TRP A 1 58  ? 9.588   1.822   79.438  1.00 36.96 ? 58  TRP A CE2 1 
ATOM   426  C  CE3 . TRP A 1 58  ? 11.024  3.232   80.776  1.00 41.15 ? 58  TRP A CE3 1 
ATOM   427  C  CZ2 . TRP A 1 58  ? 8.787   2.899   79.076  1.00 37.11 ? 58  TRP A CZ2 1 
ATOM   428  C  CZ3 . TRP A 1 58  ? 10.221  4.305   80.414  1.00 38.45 ? 58  TRP A CZ3 1 
ATOM   429  C  CH2 . TRP A 1 58  ? 9.119   4.131   79.571  1.00 37.95 ? 58  TRP A CH2 1 
ATOM   430  N  N   . ASN A 1 59  ? 10.150  -1.711  82.782  1.00 38.51 ? 59  ASN A N   1 
ATOM   431  C  CA  . ASN A 1 59  ? 9.433   -2.965  82.608  1.00 45.18 ? 59  ASN A CA  1 
ATOM   432  C  C   . ASN A 1 59  ? 9.214   -3.171  81.107  1.00 44.00 ? 59  ASN A C   1 
ATOM   433  O  O   . ASN A 1 59  ? 8.340   -2.556  80.519  1.00 40.72 ? 59  ASN A O   1 
ATOM   434  C  CB  . ASN A 1 59  ? 8.097   -2.948  83.377  1.00 45.94 ? 59  ASN A CB  1 
ATOM   435  C  CG  . ASN A 1 59  ? 7.410   -4.317  83.415  1.00 51.49 ? 59  ASN A CG  1 
ATOM   436  O  OD1 . ASN A 1 59  ? 7.833   -5.246  82.730  1.00 52.71 ? 59  ASN A OD1 1 
ATOM   437  N  ND2 . ASN A 1 59  ? 6.341   -4.438  84.219  1.00 54.96 ? 59  ASN A ND2 1 
ATOM   438  N  N   . ALA A 1 60  ? 10.052  -4.003  80.497  1.00 39.29 ? 60  ALA A N   1 
ATOM   439  C  CA  . ALA A 1 60  ? 9.968   -4.291  79.075  1.00 39.62 ? 60  ALA A CA  1 
ATOM   440  C  C   . ALA A 1 60  ? 9.360   -5.669  78.894  1.00 40.40 ? 60  ALA A C   1 
ATOM   441  O  O   . ALA A 1 60  ? 9.776   -6.442  78.040  1.00 39.46 ? 60  ALA A O   1 
ATOM   442  C  CB  . ALA A 1 60  ? 11.350  -4.213  78.421  1.00 33.01 ? 60  ALA A CB  1 
ATOM   443  N  N   . SER A 1 61  ? 8.367   -5.974  79.714  1.00 42.17 ? 61  SER A N   1 
ATOM   444  C  CA  . SER A 1 61  ? 7.753   -7.292  79.697  1.00 45.74 ? 61  SER A CA  1 
ATOM   445  C  C   . SER A 1 61  ? 6.530   -7.391  78.775  1.00 42.05 ? 61  SER A C   1 
ATOM   446  O  O   . SER A 1 61  ? 6.104   -8.493  78.444  1.00 42.92 ? 61  SER A O   1 
ATOM   447  C  CB  . SER A 1 61  ? 7.333   -7.690  81.112  1.00 42.81 ? 61  SER A CB  1 
ATOM   448  O  OG  . SER A 1 61  ? 6.007   -7.249  81.359  1.00 44.35 ? 61  SER A OG  1 
ATOM   449  N  N   . THR A 1 62  ? 5.950   -6.255  78.390  1.00 42.88 ? 62  THR A N   1 
ATOM   450  C  CA  . THR A 1 62  ? 4.744   -6.270  77.547  1.00 43.36 ? 62  THR A CA  1 
ATOM   451  C  C   . THR A 1 62  ? 4.791   -5.306  76.347  1.00 40.50 ? 62  THR A C   1 
ATOM   452  O  O   . THR A 1 62  ? 5.435   -4.261  76.404  1.00 39.11 ? 62  THR A O   1 
ATOM   453  C  CB  . THR A 1 62  ? 3.470   -5.927  78.372  1.00 44.08 ? 62  THR A CB  1 
ATOM   454  O  OG1 . THR A 1 62  ? 3.502   -4.551  78.767  1.00 44.38 ? 62  THR A OG1 1 
ATOM   455  C  CG2 . THR A 1 62  ? 3.351   -6.811  79.597  1.00 42.15 ? 62  THR A CG2 1 
ATOM   456  N  N   . TYR A 1 63  ? 4.084   -5.664  75.271  1.00 40.02 ? 63  TYR A N   1 
ATOM   457  C  CA  . TYR A 1 63  ? 3.936   -4.803  74.098  1.00 36.90 ? 63  TYR A CA  1 
ATOM   458  C  C   . TYR A 1 63  ? 3.490   -3.380  74.451  1.00 33.49 ? 63  TYR A C   1 
ATOM   459  O  O   . TYR A 1 63  ? 2.707   -3.179  75.368  1.00 36.16 ? 63  TYR A O   1 
ATOM   460  C  CB  . TYR A 1 63  ? 2.929   -5.415  73.114  1.00 38.54 ? 63  TYR A CB  1 
ATOM   461  C  CG  . TYR A 1 63  ? 3.509   -6.423  72.147  1.00 37.19 ? 63  TYR A CG  1 
ATOM   462  C  CD1 . TYR A 1 63  ? 4.810   -6.295  71.666  1.00 37.18 ? 63  TYR A CD1 1 
ATOM   463  C  CD2 . TYR A 1 63  ? 2.751   -7.498  71.706  1.00 37.63 ? 63  TYR A CD2 1 
ATOM   464  C  CE1 . TYR A 1 63  ? 5.331   -7.217  70.779  1.00 41.46 ? 63  TYR A CE1 1 
ATOM   465  C  CE2 . TYR A 1 63  ? 3.259   -8.419  70.814  1.00 39.72 ? 63  TYR A CE2 1 
ATOM   466  C  CZ  . TYR A 1 63  ? 4.549   -8.277  70.351  1.00 42.54 ? 63  TYR A CZ  1 
ATOM   467  O  OH  . TYR A 1 63  ? 5.061   -9.193  69.465  1.00 38.29 ? 63  TYR A OH  1 
ATOM   468  N  N   . PRO A 1 64  ? 3.986   -2.392  73.701  1.00 36.44 ? 64  PRO A N   1 
ATOM   469  C  CA  . PRO A 1 64  ? 3.614   -0.975  73.812  1.00 37.85 ? 64  PRO A CA  1 
ATOM   470  C  C   . PRO A 1 64  ? 2.239   -0.654  73.202  1.00 38.27 ? 64  PRO A C   1 
ATOM   471  O  O   . PRO A 1 64  ? 1.647   -1.503  72.543  1.00 37.40 ? 64  PRO A O   1 
ATOM   472  C  CB  . PRO A 1 64  ? 4.716   -0.269  73.011  1.00 32.24 ? 64  PRO A CB  1 
ATOM   473  C  CG  . PRO A 1 64  ? 5.107   -1.261  72.002  1.00 30.76 ? 64  PRO A CG  1 
ATOM   474  C  CD  . PRO A 1 64  ? 5.002   -2.609  72.651  1.00 31.67 ? 64  PRO A CD  1 
ATOM   475  N  N   . ASN A 1 65  ? 1.758   0.565   73.437  1.00 36.35 ? 65  ASN A N   1 
ATOM   476  C  CA  . ASN A 1 65  ? 0.629   1.116   72.717  1.00 34.78 ? 65  ASN A CA  1 
ATOM   477  C  C   . ASN A 1 65  ? 0.940   1.160   71.227  1.00 35.97 ? 65  ASN A C   1 
ATOM   478  O  O   . ASN A 1 65  ? 2.109   1.229   70.848  1.00 31.18 ? 65  ASN A O   1 
ATOM   479  C  CB  . ASN A 1 65  ? 0.313   2.535   73.189  1.00 35.68 ? 65  ASN A CB  1 
ATOM   480  C  CG  . ASN A 1 65  ? -0.118  2.605   74.643  1.00 38.93 ? 65  ASN A CG  1 
ATOM   481  O  OD1 . ASN A 1 65  ? -0.835  1.732   75.150  1.00 36.93 ? 65  ASN A OD1 1 
ATOM   482  N  ND2 . ASN A 1 65  ? 0.302   3.671   75.315  1.00 37.76 ? 65  ASN A ND2 1 
ATOM   483  N  N   . ASN A 1 66  ? -0.102  1.145   70.396  1.00 32.01 ? 66  ASN A N   1 
ATOM   484  C  CA  . ASN A 1 66  ? 0.047   1.395   68.959  1.00 33.75 ? 66  ASN A CA  1 
ATOM   485  C  C   . ASN A 1 66  ? -0.173  2.862   68.649  1.00 35.98 ? 66  ASN A C   1 
ATOM   486  O  O   . ASN A 1 66  ? -0.884  3.552   69.389  1.00 32.10 ? 66  ASN A O   1 
ATOM   487  C  CB  . ASN A 1 66  ? -0.932  0.548   68.152  1.00 33.73 ? 66  ASN A CB  1 
ATOM   488  C  CG  . ASN A 1 66  ? -0.682  -0.920  68.322  1.00 34.77 ? 66  ASN A CG  1 
ATOM   489  O  OD1 . ASN A 1 66  ? -1.611  -1.709  68.459  1.00 32.95 ? 66  ASN A OD1 1 
ATOM   490  N  ND2 . ASN A 1 66  ? 0.593   -1.298  68.344  1.00 31.49 ? 66  ASN A ND2 1 
ATOM   491  N  N   . CYS A 1 67  ? 0.424   3.339   67.555  1.00 33.00 ? 67  CYS A N   1 
ATOM   492  C  CA  . CYS A 1 67  ? 0.249   4.731   67.159  1.00 30.55 ? 67  CYS A CA  1 
ATOM   493  C  C   . CYS A 1 67  ? -1.203  4.989   66.728  1.00 34.87 ? 67  CYS A C   1 
ATOM   494  O  O   . CYS A 1 67  ? -1.955  4.062   66.410  1.00 32.29 ? 67  CYS A O   1 
ATOM   495  C  CB  . CYS A 1 67  ? 1.229   5.107   66.042  1.00 35.06 ? 67  CYS A CB  1 
ATOM   496  S  SG  . CYS A 1 67  ? 2.980   5.185   66.568  1.00 38.10 ? 67  CYS A SG  1 
ATOM   497  N  N   . GLN A 1 68  ? -1.602  6.256   66.767  1.00 33.71 ? 68  GLN A N   1 
ATOM   498  C  CA  . GLN A 1 68  ? -2.956  6.644   66.424  1.00 31.29 ? 68  GLN A CA  1 
ATOM   499  C  C   . GLN A 1 68  ? -3.169  6.487   64.924  1.00 34.88 ? 68  GLN A C   1 
ATOM   500  O  O   . GLN A 1 68  ? -2.376  6.999   64.113  1.00 31.55 ? 68  GLN A O   1 
ATOM   501  C  CB  . GLN A 1 68  ? -3.223  8.082   66.856  1.00 34.61 ? 68  GLN A CB  1 
ATOM   502  C  CG  . GLN A 1 68  ? -3.337  8.265   68.364  1.00 35.54 ? 68  GLN A CG  1 
ATOM   503  C  CD  . GLN A 1 68  ? -4.684  7.817   68.898  1.00 38.82 ? 68  GLN A CD  1 
ATOM   504  O  OE1 . GLN A 1 68  ? -5.514  7.304   68.151  1.00 36.30 ? 68  GLN A OE1 1 
ATOM   505  N  NE2 . GLN A 1 68  ? -4.908  8.015   70.196  1.00 39.75 ? 68  GLN A NE2 1 
ATOM   506  N  N   . GLN A 1 69  ? -4.233  5.786   64.548  1.00 28.95 ? 69  GLN A N   1 
ATOM   507  C  CA  . GLN A 1 69  ? -4.423  5.469   63.137  1.00 30.82 ? 69  GLN A CA  1 
ATOM   508  C  C   . GLN A 1 69  ? -5.873  5.121   62.788  1.00 34.72 ? 69  GLN A C   1 
ATOM   509  O  O   . GLN A 1 69  ? -6.665  4.719   63.650  1.00 30.67 ? 69  GLN A O   1 
ATOM   510  C  CB  . GLN A 1 69  ? -3.509  4.303   62.745  1.00 29.83 ? 69  GLN A CB  1 
ATOM   511  C  CG  . GLN A 1 69  ? -3.822  3.015   63.502  1.00 32.35 ? 69  GLN A CG  1 
ATOM   512  C  CD  . GLN A 1 69  ? -2.751  1.958   63.343  1.00 36.23 ? 69  GLN A CD  1 
ATOM   513  O  OE1 . GLN A 1 69  ? -2.914  1.003   62.578  1.00 33.47 ? 69  GLN A OE1 1 
ATOM   514  N  NE2 . GLN A 1 69  ? -1.644  2.113   64.080  1.00 32.32 ? 69  GLN A NE2 1 
ATOM   515  N  N   . TYR A 1 70  ? -6.206  5.289   61.511  1.00 31.53 ? 70  TYR A N   1 
ATOM   516  C  CA  . TYR A 1 70  ? -7.437  4.749   60.969  1.00 35.40 ? 70  TYR A CA  1 
ATOM   517  C  C   . TYR A 1 70  ? -7.530  3.257   61.277  1.00 35.34 ? 70  TYR A C   1 
ATOM   518  O  O   . TYR A 1 70  ? -6.556  2.518   61.112  1.00 39.17 ? 70  TYR A O   1 
ATOM   519  C  CB  . TYR A 1 70  ? -7.489  4.989   59.460  1.00 36.13 ? 70  TYR A CB  1 
ATOM   520  C  CG  . TYR A 1 70  ? -8.727  4.468   58.791  1.00 39.21 ? 70  TYR A CG  1 
ATOM   521  C  CD1 . TYR A 1 70  ? -9.869  5.252   58.698  1.00 38.69 ? 70  TYR A CD1 1 
ATOM   522  C  CD2 . TYR A 1 70  ? -8.752  3.192   58.237  1.00 40.52 ? 70  TYR A CD2 1 
ATOM   523  C  CE1 . TYR A 1 70  ? -10.999 4.775   58.077  1.00 44.50 ? 70  TYR A CE1 1 
ATOM   524  C  CE2 . TYR A 1 70  ? -9.870  2.711   57.616  1.00 38.03 ? 70  TYR A CE2 1 
ATOM   525  C  CZ  . TYR A 1 70  ? -10.989 3.506   57.533  1.00 42.74 ? 70  TYR A CZ  1 
ATOM   526  O  OH  . TYR A 1 70  ? -12.113 3.023   56.928  1.00 45.74 ? 70  TYR A OH  1 
ATOM   527  N  N   . VAL A 1 71  ? -8.693  2.821   61.743  1.00 32.93 ? 71  VAL A N   1 
ATOM   528  C  CA  . VAL A 1 71  ? -8.924  1.412   62.033  1.00 33.66 ? 71  VAL A CA  1 
ATOM   529  C  C   . VAL A 1 71  ? -9.919  0.841   61.024  1.00 39.51 ? 71  VAL A C   1 
ATOM   530  O  O   . VAL A 1 71  ? -10.946 1.453   60.741  1.00 37.54 ? 71  VAL A O   1 
ATOM   531  C  CB  . VAL A 1 71  ? -9.461  1.201   63.465  1.00 36.43 ? 71  VAL A CB  1 
ATOM   532  C  CG1 . VAL A 1 71  ? -9.790  -0.275  63.700  1.00 34.61 ? 71  VAL A CG1 1 
ATOM   533  C  CG2 . VAL A 1 71  ? -8.457  1.716   64.511  1.00 34.38 ? 71  VAL A CG2 1 
ATOM   534  N  N   . ASP A 1 72  ? -9.617  -0.331  60.477  1.00 41.37 ? 72  ASP A N   1 
ATOM   535  C  CA  . ASP A 1 72  ? -10.465 -0.914  59.434  1.00 38.97 ? 72  ASP A CA  1 
ATOM   536  C  C   . ASP A 1 72  ? -11.651 -1.690  60.008  1.00 37.58 ? 72  ASP A C   1 
ATOM   537  O  O   . ASP A 1 72  ? -11.477 -2.734  60.631  1.00 39.88 ? 72  ASP A O   1 
ATOM   538  C  CB  . ASP A 1 72  ? -9.634  -1.825  58.530  1.00 35.50 ? 72  ASP A CB  1 
ATOM   539  C  CG  . ASP A 1 72  ? -10.486 -2.581  57.513  1.00 41.12 ? 72  ASP A CG  1 
ATOM   540  O  OD1 . ASP A 1 72  ? -11.602 -2.121  57.187  1.00 36.11 ? 72  ASP A OD1 1 
ATOM   541  O  OD2 . ASP A 1 72  ? -10.035 -3.643  57.038  1.00 40.79 ? 72  ASP A OD2 1 
ATOM   542  N  N   . GLU A 1 73  ? -12.860 -1.196  59.771  1.00 37.93 ? 73  GLU A N   1 
ATOM   543  C  CA  . GLU A 1 73  ? -14.057 -1.851  60.293  1.00 40.29 ? 73  GLU A CA  1 
ATOM   544  C  C   . GLU A 1 73  ? -14.931 -2.421  59.172  1.00 38.27 ? 73  GLU A C   1 
ATOM   545  O  O   . GLU A 1 73  ? -16.117 -2.700  59.365  1.00 36.58 ? 73  GLU A O   1 
ATOM   546  C  CB  . GLU A 1 73  ? -14.875 -0.874  61.141  1.00 37.66 ? 73  GLU A CB  1 
ATOM   547  C  CG  . GLU A 1 73  ? -14.175 -0.367  62.382  1.00 44.02 ? 73  GLU A CG  1 
ATOM   548  C  CD  . GLU A 1 73  ? -14.964 0.737   63.056  1.00 46.81 ? 73  GLU A CD  1 
ATOM   549  O  OE1 . GLU A 1 73  ? -16.165 0.886   62.747  1.00 50.57 ? 73  GLU A OE1 1 
ATOM   550  O  OE2 . GLU A 1 73  ? -14.392 1.469   63.885  1.00 56.26 ? 73  GLU A OE2 1 
ATOM   551  N  N   . GLN A 1 74  ? -14.331 -2.593  58.006  1.00 37.38 ? 74  GLN A N   1 
ATOM   552  C  CA  . GLN A 1 74  ? -15.025 -3.118  56.839  1.00 36.12 ? 74  GLN A CA  1 
ATOM   553  C  C   . GLN A 1 74  ? -15.662 -4.476  57.093  1.00 33.47 ? 74  GLN A C   1 
ATOM   554  O  O   . GLN A 1 74  ? -16.817 -4.702  56.735  1.00 37.42 ? 74  GLN A O   1 
ATOM   555  C  CB  . GLN A 1 74  ? -14.050 -3.219  55.661  1.00 40.76 ? 74  GLN A CB  1 
ATOM   556  C  CG  . GLN A 1 74  ? -14.287 -2.175  54.612  1.00 46.08 ? 74  GLN A CG  1 
ATOM   557  C  CD  . GLN A 1 74  ? -15.655 -2.316  54.039  1.00 48.95 ? 74  GLN A CD  1 
ATOM   558  O  OE1 . GLN A 1 74  ? -16.171 -3.430  53.939  1.00 53.10 ? 74  GLN A OE1 1 
ATOM   559  N  NE2 . GLN A 1 74  ? -16.276 -1.195  53.681  1.00 50.47 ? 74  GLN A NE2 1 
ATOM   560  N  N   . PHE A 1 75  ? -14.902 -5.376  57.703  1.00 33.34 ? 75  PHE A N   1 
ATOM   561  C  CA  . PHE A 1 75  ? -15.350 -6.740  57.935  1.00 37.15 ? 75  PHE A CA  1 
ATOM   562  C  C   . PHE A 1 75  ? -15.172 -7.105  59.414  1.00 38.15 ? 75  PHE A C   1 
ATOM   563  O  O   . PHE A 1 75  ? -14.188 -7.746  59.795  1.00 37.92 ? 75  PHE A O   1 
ATOM   564  C  CB  . PHE A 1 75  ? -14.582 -7.723  57.040  1.00 35.31 ? 75  PHE A CB  1 
ATOM   565  C  CG  . PHE A 1 75  ? -14.655 -7.400  55.556  1.00 40.09 ? 75  PHE A CG  1 
ATOM   566  C  CD1 . PHE A 1 75  ? -15.822 -7.618  54.838  1.00 41.02 ? 75  PHE A CD1 1 
ATOM   567  C  CD2 . PHE A 1 75  ? -13.551 -6.896  54.885  1.00 39.46 ? 75  PHE A CD2 1 
ATOM   568  C  CE1 . PHE A 1 75  ? -15.889 -7.329  53.482  1.00 42.36 ? 75  PHE A CE1 1 
ATOM   569  C  CE2 . PHE A 1 75  ? -13.609 -6.605  53.535  1.00 41.45 ? 75  PHE A CE2 1 
ATOM   570  C  CZ  . PHE A 1 75  ? -14.782 -6.821  52.831  1.00 42.64 ? 75  PHE A CZ  1 
ATOM   571  N  N   . PRO A 1 76  ? -16.138 -6.705  60.252  1.00 39.43 ? 76  PRO A N   1 
ATOM   572  C  CA  . PRO A 1 76  ? -16.037 -6.862  61.711  1.00 36.49 ? 76  PRO A CA  1 
ATOM   573  C  C   . PRO A 1 76  ? -15.971 -8.330  62.117  1.00 37.01 ? 76  PRO A C   1 
ATOM   574  O  O   . PRO A 1 76  ? -16.759 -9.147  61.654  1.00 40.02 ? 76  PRO A O   1 
ATOM   575  C  CB  . PRO A 1 76  ? -17.313 -6.193  62.225  1.00 41.21 ? 76  PRO A CB  1 
ATOM   576  C  CG  . PRO A 1 76  ? -17.806 -5.334  61.058  1.00 39.90 ? 76  PRO A CG  1 
ATOM   577  C  CD  . PRO A 1 76  ? -17.406 -6.078  59.841  1.00 36.75 ? 76  PRO A CD  1 
ATOM   578  N  N   . GLY A 1 77  ? -14.998 -8.672  62.947  1.00 38.72 ? 77  GLY A N   1 
ATOM   579  C  CA  . GLY A 1 77  ? -14.817 -10.050 63.364  1.00 41.10 ? 77  GLY A CA  1 
ATOM   580  C  C   . GLY A 1 77  ? -14.057 -10.903 62.365  1.00 44.64 ? 77  GLY A C   1 
ATOM   581  O  O   . GLY A 1 77  ? -13.691 -12.044 62.666  1.00 44.05 ? 77  GLY A O   1 
ATOM   582  N  N   . PHE A 1 78  ? -13.815 -10.358 61.173  1.00 40.12 ? 78  PHE A N   1 
ATOM   583  C  CA  . PHE A 1 78  ? -13.123 -11.105 60.134  1.00 40.09 ? 78  PHE A CA  1 
ATOM   584  C  C   . PHE A 1 78  ? -11.605 -11.019 60.293  1.00 38.50 ? 78  PHE A C   1 
ATOM   585  O  O   . PHE A 1 78  ? -11.025 -9.931  60.263  1.00 35.34 ? 78  PHE A O   1 
ATOM   586  C  CB  . PHE A 1 78  ? -13.544 -10.602 58.751  1.00 40.22 ? 78  PHE A CB  1 
ATOM   587  C  CG  . PHE A 1 78  ? -12.895 -11.336 57.619  1.00 41.98 ? 78  PHE A CG  1 
ATOM   588  C  CD1 . PHE A 1 78  ? -13.022 -12.711 57.504  1.00 43.94 ? 78  PHE A CD1 1 
ATOM   589  C  CD2 . PHE A 1 78  ? -12.162 -10.651 56.653  1.00 43.63 ? 78  PHE A CD2 1 
ATOM   590  C  CE1 . PHE A 1 78  ? -12.422 -13.394 56.441  1.00 44.28 ? 78  PHE A CE1 1 
ATOM   591  C  CE2 . PHE A 1 78  ? -11.566 -11.327 55.600  1.00 40.46 ? 78  PHE A CE2 1 
ATOM   592  C  CZ  . PHE A 1 78  ? -11.695 -12.699 55.498  1.00 41.66 ? 78  PHE A CZ  1 
ATOM   593  N  N   . SER A 1 79  ? -10.968 -12.179 60.434  1.00 35.57 ? 79  SER A N   1 
ATOM   594  C  CA  . SER A 1 79  ? -9.551  -12.235 60.775  1.00 38.87 ? 79  SER A CA  1 
ATOM   595  C  C   . SER A 1 79  ? -8.635  -11.777 59.648  1.00 39.38 ? 79  SER A C   1 
ATOM   596  O  O   . SER A 1 79  ? -7.502  -11.389 59.904  1.00 38.84 ? 79  SER A O   1 
ATOM   597  C  CB  . SER A 1 79  ? -9.155  -13.650 61.196  1.00 41.89 ? 79  SER A CB  1 
ATOM   598  O  OG  . SER A 1 79  ? -9.209  -14.540 60.104  1.00 50.11 ? 79  SER A OG  1 
ATOM   599  N  N   . GLY A 1 80  ? -9.125  -11.823 58.411  1.00 38.77 ? 80  GLY A N   1 
ATOM   600  C  CA  . GLY A 1 80  ? -8.334  -11.438 57.257  1.00 39.03 ? 80  GLY A CA  1 
ATOM   601  C  C   . GLY A 1 80  ? -8.040  -9.950  57.243  1.00 40.36 ? 80  GLY A C   1 
ATOM   602  O  O   . GLY A 1 80  ? -7.006  -9.517  56.738  1.00 36.07 ? 80  GLY A O   1 
ATOM   603  N  N   . SER A 1 81  ? -8.962  -9.161  57.786  1.00 34.73 ? 81  SER A N   1 
ATOM   604  C  CA  . SER A 1 81  ? -8.754  -7.725  57.878  1.00 35.46 ? 81  SER A CA  1 
ATOM   605  C  C   . SER A 1 81  ? -8.287  -7.317  59.275  1.00 40.40 ? 81  SER A C   1 
ATOM   606  O  O   . SER A 1 81  ? -7.429  -6.447  59.418  1.00 38.30 ? 81  SER A O   1 
ATOM   607  C  CB  . SER A 1 81  ? -10.029 -6.972  57.512  1.00 38.49 ? 81  SER A CB  1 
ATOM   608  O  OG  . SER A 1 81  ? -11.166 -7.519  58.161  1.00 38.37 ? 81  SER A OG  1 
ATOM   609  N  N   . GLU A 1 82  ? -8.840  -7.957  60.301  1.00 36.77 ? 82  GLU A N   1 
ATOM   610  C  CA  . GLU A 1 82  ? -8.560  -7.539  61.671  1.00 39.86 ? 82  GLU A CA  1 
ATOM   611  C  C   . GLU A 1 82  ? -7.134  -7.896  62.119  1.00 39.42 ? 82  GLU A C   1 
ATOM   612  O  O   . GLU A 1 82  ? -6.586  -7.228  62.988  1.00 40.26 ? 82  GLU A O   1 
ATOM   613  C  CB  . GLU A 1 82  ? -9.612  -8.120  62.630  1.00 38.07 ? 82  GLU A CB  1 
ATOM   614  C  CG  . GLU A 1 82  ? -10.703 -7.086  62.940  1.00 40.24 ? 82  GLU A CG  1 
ATOM   615  C  CD  . GLU A 1 82  ? -12.034 -7.686  63.350  1.00 48.80 ? 82  GLU A CD  1 
ATOM   616  O  OE1 . GLU A 1 82  ? -12.054 -8.848  63.817  1.00 52.99 ? 82  GLU A OE1 1 
ATOM   617  O  OE2 . GLU A 1 82  ? -13.068 -6.987  63.203  1.00 45.32 ? 82  GLU A OE2 1 
ATOM   618  N  N   . MET A 1 83  ? -6.513  -8.898  61.497  1.00 38.77 ? 83  MET A N   1 
ATOM   619  C  CA  . MET A 1 83  ? -5.129  -9.247  61.825  1.00 37.52 ? 83  MET A CA  1 
ATOM   620  C  C   . MET A 1 83  ? -4.178  -8.081  61.553  1.00 38.16 ? 83  MET A C   1 
ATOM   621  O  O   . MET A 1 83  ? -3.057  -8.081  62.041  1.00 40.96 ? 83  MET A O   1 
ATOM   622  C  CB  . MET A 1 83  ? -4.662  -10.481 61.041  1.00 39.04 ? 83  MET A CB  1 
ATOM   623  C  CG  . MET A 1 83  ? -4.361  -10.222 59.568  1.00 41.36 ? 83  MET A CG  1 
ATOM   624  S  SD  . MET A 1 83  ? -3.817  -11.721 58.719  1.00 47.03 ? 83  MET A SD  1 
ATOM   625  C  CE  . MET A 1 83  ? -2.045  -11.466 58.632  1.00 43.74 ? 83  MET A CE  1 
ATOM   626  N  N   . TRP A 1 84  ? -4.631  -7.091  60.784  1.00 37.12 ? 84  TRP A N   1 
ATOM   627  C  CA  . TRP A 1 84  ? -3.810  -5.929  60.444  1.00 36.45 ? 84  TRP A CA  1 
ATOM   628  C  C   . TRP A 1 84  ? -4.115  -4.711  61.315  1.00 36.02 ? 84  TRP A C   1 
ATOM   629  O  O   . TRP A 1 84  ? -3.365  -3.740  61.291  1.00 33.57 ? 84  TRP A O   1 
ATOM   630  C  CB  . TRP A 1 84  ? -3.991  -5.548  58.960  1.00 37.07 ? 84  TRP A CB  1 
ATOM   631  C  CG  . TRP A 1 84  ? -3.693  -6.669  58.027  1.00 37.21 ? 84  TRP A CG  1 
ATOM   632  C  CD1 . TRP A 1 84  ? -4.597  -7.412  57.323  1.00 40.80 ? 84  TRP A CD1 1 
ATOM   633  C  CD2 . TRP A 1 84  ? -2.401  -7.204  57.715  1.00 37.78 ? 84  TRP A CD2 1 
ATOM   634  N  NE1 . TRP A 1 84  ? -3.944  -8.367  56.578  1.00 42.64 ? 84  TRP A NE1 1 
ATOM   635  C  CE2 . TRP A 1 84  ? -2.595  -8.263  56.809  1.00 41.12 ? 84  TRP A CE2 1 
ATOM   636  C  CE3 . TRP A 1 84  ? -1.098  -6.888  58.111  1.00 38.98 ? 84  TRP A CE3 1 
ATOM   637  C  CZ2 . TRP A 1 84  ? -1.535  -9.005  56.294  1.00 38.35 ? 84  TRP A CZ2 1 
ATOM   638  C  CZ3 . TRP A 1 84  ? -0.046  -7.626  57.594  1.00 38.26 ? 84  TRP A CZ3 1 
ATOM   639  C  CH2 . TRP A 1 84  ? -0.273  -8.671  56.698  1.00 37.94 ? 84  TRP A CH2 1 
ATOM   640  N  N   . ASN A 1 85  ? -5.222  -4.755  62.058  1.00 36.65 ? 85  ASN A N   1 
ATOM   641  C  CA  . ASN A 1 85  ? -5.605  -3.654  62.948  1.00 35.63 ? 85  ASN A CA  1 
ATOM   642  C  C   . ASN A 1 85  ? -4.785  -3.609  64.238  1.00 36.03 ? 85  ASN A C   1 
ATOM   643  O  O   . ASN A 1 85  ? -4.281  -4.630  64.687  1.00 34.35 ? 85  ASN A O   1 
ATOM   644  C  CB  . ASN A 1 85  ? -7.086  -3.749  63.329  1.00 35.11 ? 85  ASN A CB  1 
ATOM   645  C  CG  . ASN A 1 85  ? -8.017  -3.279  62.222  1.00 37.42 ? 85  ASN A CG  1 
ATOM   646  O  OD1 . ASN A 1 85  ? -7.648  -2.460  61.382  1.00 33.46 ? 85  ASN A OD1 1 
ATOM   647  N  ND2 . ASN A 1 85  ? -9.245  -3.787  62.238  1.00 37.36 ? 85  ASN A ND2 1 
ATOM   648  N  N   . PRO A 1 86  ? -4.697  -2.425  64.860  1.00 30.58 ? 86  PRO A N   1 
ATOM   649  C  CA  . PRO A 1 86  ? -3.996  -2.285  66.139  1.00 36.12 ? 86  PRO A CA  1 
ATOM   650  C  C   . PRO A 1 86  ? -4.585  -3.250  67.160  1.00 36.61 ? 86  PRO A C   1 
ATOM   651  O  O   . PRO A 1 86  ? -5.803  -3.294  67.288  1.00 38.18 ? 86  PRO A O   1 
ATOM   652  C  CB  . PRO A 1 86  ? -4.257  -0.829  66.538  1.00 36.40 ? 86  PRO A CB  1 
ATOM   653  C  CG  . PRO A 1 86  ? -4.667  -0.142  65.264  1.00 36.64 ? 86  PRO A CG  1 
ATOM   654  C  CD  . PRO A 1 86  ? -5.351  -1.177  64.437  1.00 30.15 ? 86  PRO A CD  1 
ATOM   655  N  N   . ASN A 1 87  ? -3.744  -4.043  67.816  1.00 34.39 ? 87  ASN A N   1 
ATOM   656  C  CA  . ASN A 1 87  ? -4.209  -4.997  68.815  1.00 37.31 ? 87  ASN A CA  1 
ATOM   657  C  C   . ASN A 1 87  ? -3.773  -4.561  70.214  1.00 39.78 ? 87  ASN A C   1 
ATOM   658  O  O   . ASN A 1 87  ? -3.772  -5.354  71.145  1.00 39.54 ? 87  ASN A O   1 
ATOM   659  C  CB  . ASN A 1 87  ? -3.693  -6.410  68.516  1.00 34.90 ? 87  ASN A CB  1 
ATOM   660  C  CG  . ASN A 1 87  ? -2.173  -6.494  68.533  1.00 39.97 ? 87  ASN A CG  1 
ATOM   661  O  OD1 . ASN A 1 87  ? -1.486  -5.473  68.596  1.00 38.34 ? 87  ASN A OD1 1 
ATOM   662  N  ND2 . ASN A 1 87  ? -1.642  -7.710  68.450  1.00 38.53 ? 87  ASN A ND2 1 
ATOM   663  N  N   . ARG A 1 88  ? -3.386  -3.294  70.329  1.00 34.84 ? 88  ARG A N   1 
ATOM   664  C  CA  . ARG A 1 88  ? -3.106  -2.666  71.609  1.00 41.69 ? 88  ARG A CA  1 
ATOM   665  C  C   . ARG A 1 88  ? -3.800  -1.314  71.610  1.00 40.59 ? 88  ARG A C   1 
ATOM   666  O  O   . ARG A 1 88  ? -4.266  -0.861  70.579  1.00 38.39 ? 88  ARG A O   1 
ATOM   667  C  CB  . ARG A 1 88  ? -1.593  -2.510  71.835  1.00 38.09 ? 88  ARG A CB  1 
ATOM   668  C  CG  . ARG A 1 88  ? -0.869  -3.816  72.133  1.00 35.17 ? 88  ARG A CG  1 
ATOM   669  C  CD  . ARG A 1 88  ? -1.293  -4.328  73.499  1.00 44.60 ? 88  ARG A CD  1 
ATOM   670  N  NE  . ARG A 1 88  ? -0.617  -5.556  73.910  1.00 48.54 ? 88  ARG A NE  1 
ATOM   671  C  CZ  . ARG A 1 88  ? -0.806  -6.747  73.347  1.00 50.18 ? 88  ARG A CZ  1 
ATOM   672  N  NH1 . ARG A 1 88  ? -1.639  -6.879  72.322  1.00 44.62 ? 88  ARG A NH1 1 
ATOM   673  N  NH2 . ARG A 1 88  ? -0.144  -7.807  73.803  1.00 51.60 ? 88  ARG A NH2 1 
ATOM   674  N  N   . GLU A 1 89  ? -3.865  -0.666  72.763  1.00 43.53 ? 89  GLU A N   1 
ATOM   675  C  CA  . GLU A 1 89  ? -4.458  0.662   72.847  1.00 44.81 ? 89  GLU A CA  1 
ATOM   676  C  C   . GLU A 1 89  ? -3.716  1.641   71.932  1.00 37.01 ? 89  GLU A C   1 
ATOM   677  O  O   . GLU A 1 89  ? -2.499  1.599   71.844  1.00 38.87 ? 89  GLU A O   1 
ATOM   678  C  CB  . GLU A 1 89  ? -4.430  1.160   74.296  1.00 37.74 ? 89  GLU A CB  1 
ATOM   679  C  CG  . GLU A 1 89  ? -5.728  1.773   74.763  1.00 54.98 ? 89  GLU A CG  1 
ATOM   680  C  CD  . GLU A 1 89  ? -5.641  2.323   76.186  1.00 62.87 ? 89  GLU A CD  1 
ATOM   681  O  OE1 . GLU A 1 89  ? -4.662  2.007   76.900  1.00 59.98 ? 89  GLU A OE1 1 
ATOM   682  O  OE2 . GLU A 1 89  ? -6.549  3.081   76.589  1.00 65.55 ? 89  GLU A OE2 1 
ATOM   683  N  N   . MET A 1 90  ? -4.445  2.524   71.259  1.00 38.38 ? 90  MET A N   1 
ATOM   684  C  CA  . MET A 1 90  ? -3.799  3.540   70.432  1.00 37.97 ? 90  MET A CA  1 
ATOM   685  C  C   . MET A 1 90  ? -3.464  4.762   71.271  1.00 37.04 ? 90  MET A C   1 
ATOM   686  O  O   . MET A 1 90  ? -4.229  5.162   72.131  1.00 37.20 ? 90  MET A O   1 
ATOM   687  C  CB  . MET A 1 90  ? -4.684  3.939   69.239  1.00 35.89 ? 90  MET A CB  1 
ATOM   688  C  CG  . MET A 1 90  ? -4.714  2.923   68.107  1.00 30.11 ? 90  MET A CG  1 
ATOM   689  S  SD  . MET A 1 90  ? -5.813  3.433   66.760  1.00 34.78 ? 90  MET A SD  1 
ATOM   690  C  CE  . MET A 1 90  ? -7.409  3.543   67.581  1.00 33.31 ? 90  MET A CE  1 
ATOM   691  N  N   . SER A 1 91  ? -2.311  5.352   71.007  1.00 38.25 ? 91  SER A N   1 
ATOM   692  C  CA  . SER A 1 91  ? -1.850  6.513   71.750  1.00 37.09 ? 91  SER A CA  1 
ATOM   693  C  C   . SER A 1 91  ? -0.803  7.241   70.928  1.00 35.08 ? 91  SER A C   1 
ATOM   694  O  O   . SER A 1 91  ? -0.062  6.606   70.180  1.00 35.51 ? 91  SER A O   1 
ATOM   695  C  CB  . SER A 1 91  ? -1.270  6.096   73.106  1.00 35.46 ? 91  SER A CB  1 
ATOM   696  O  OG  . SER A 1 91  ? -0.531  7.159   73.669  1.00 32.75 ? 91  SER A OG  1 
ATOM   697  N  N   . GLU A 1 92  ? -0.747  8.565   71.032  1.00 35.20 ? 92  GLU A N   1 
ATOM   698  C  CA  . GLU A 1 92  ? 0.355   9.300   70.406  1.00 34.07 ? 92  GLU A CA  1 
ATOM   699  C  C   . GLU A 1 92  ? 1.670   8.970   71.107  1.00 33.94 ? 92  GLU A C   1 
ATOM   700  O  O   . GLU A 1 92  ? 2.755   9.241   70.585  1.00 37.39 ? 92  GLU A O   1 
ATOM   701  C  CB  . GLU A 1 92  ? 0.115   10.807  70.437  1.00 35.14 ? 92  GLU A CB  1 
ATOM   702  C  CG  . GLU A 1 92  ? -0.977  11.272  69.512  1.00 34.49 ? 92  GLU A CG  1 
ATOM   703  C  CD  . GLU A 1 92  ? -1.173  12.778  69.536  1.00 38.27 ? 92  GLU A CD  1 
ATOM   704  O  OE1 . GLU A 1 92  ? -2.054  13.252  70.291  1.00 40.54 ? 92  GLU A OE1 1 
ATOM   705  O  OE2 . GLU A 1 92  ? -0.468  13.486  68.784  1.00 37.49 ? 92  GLU A OE2 1 
ATOM   706  N  N   . ASP A 1 93  ? 1.561   8.393   72.300  1.00 36.58 ? 93  ASP A N   1 
ATOM   707  C  CA  . ASP A 1 93  ? 2.714   7.911   73.059  1.00 34.67 ? 93  ASP A CA  1 
ATOM   708  C  C   . ASP A 1 93  ? 3.019   6.503   72.561  1.00 35.27 ? 93  ASP A C   1 
ATOM   709  O  O   . ASP A 1 93  ? 2.603   5.527   73.175  1.00 32.37 ? 93  ASP A O   1 
ATOM   710  C  CB  . ASP A 1 93  ? 2.399   7.930   74.560  1.00 36.56 ? 93  ASP A CB  1 
ATOM   711  C  CG  . ASP A 1 93  ? 3.592   7.566   75.430  1.00 39.12 ? 93  ASP A CG  1 
ATOM   712  O  OD1 . ASP A 1 93  ? 4.667   7.229   74.893  1.00 37.75 ? 93  ASP A OD1 1 
ATOM   713  O  OD2 . ASP A 1 93  ? 3.436   7.619   76.673  1.00 46.03 ? 93  ASP A OD2 1 
ATOM   714  N  N   . CYS A 1 94  ? 3.713   6.393   71.428  1.00 34.19 ? 94  CYS A N   1 
ATOM   715  C  CA  . CYS A 1 94  ? 3.797   5.103   70.738  1.00 36.71 ? 94  CYS A CA  1 
ATOM   716  C  C   . CYS A 1 94  ? 5.161   4.782   70.148  1.00 34.95 ? 94  CYS A C   1 
ATOM   717  O  O   . CYS A 1 94  ? 5.321   3.760   69.470  1.00 34.69 ? 94  CYS A O   1 
ATOM   718  C  CB  . CYS A 1 94  ? 2.759   5.042   69.605  1.00 31.18 ? 94  CYS A CB  1 
ATOM   719  S  SG  . CYS A 1 94  ? 3.016   6.282   68.313  1.00 33.89 ? 94  CYS A SG  1 
ATOM   720  N  N   . LEU A 1 95  ? 6.137   5.647   70.385  1.00 34.29 ? 95  LEU A N   1 
ATOM   721  C  CA  . LEU A 1 95  ? 7.473   5.423   69.846  1.00 35.50 ? 95  LEU A CA  1 
ATOM   722  C  C   . LEU A 1 95  ? 8.272   4.433   70.696  1.00 35.27 ? 95  LEU A C   1 
ATOM   723  O  O   . LEU A 1 95  ? 9.092   4.816   71.517  1.00 34.36 ? 95  LEU A O   1 
ATOM   724  C  CB  . LEU A 1 95  ? 8.215   6.747   69.712  1.00 34.56 ? 95  LEU A CB  1 
ATOM   725  C  CG  . LEU A 1 95  ? 7.599   7.627   68.620  1.00 31.90 ? 95  LEU A CG  1 
ATOM   726  C  CD1 . LEU A 1 95  ? 8.471   8.808   68.250  1.00 29.61 ? 95  LEU A CD1 1 
ATOM   727  C  CD2 . LEU A 1 95  ? 7.273   6.783   67.392  1.00 29.66 ? 95  LEU A CD2 1 
ATOM   728  N  N   . TYR A 1 96  ? 8.026   3.149   70.466  1.00 35.51 ? 96  TYR A N   1 
ATOM   729  C  CA  . TYR A 1 96  ? 8.736   2.088   71.156  1.00 33.86 ? 96  TYR A CA  1 
ATOM   730  C  C   . TYR A 1 96  ? 9.242   1.029   70.177  1.00 33.52 ? 96  TYR A C   1 
ATOM   731  O  O   . TYR A 1 96  ? 8.770   0.946   69.029  1.00 33.66 ? 96  TYR A O   1 
ATOM   732  C  CB  . TYR A 1 96  ? 7.818   1.451   72.210  1.00 35.38 ? 96  TYR A CB  1 
ATOM   733  C  CG  . TYR A 1 96  ? 7.296   2.444   73.220  1.00 33.75 ? 96  TYR A CG  1 
ATOM   734  C  CD1 . TYR A 1 96  ? 6.208   3.257   72.926  1.00 36.24 ? 96  TYR A CD1 1 
ATOM   735  C  CD2 . TYR A 1 96  ? 7.907   2.587   74.457  1.00 34.88 ? 96  TYR A CD2 1 
ATOM   736  C  CE1 . TYR A 1 96  ? 5.736   4.174   73.843  1.00 37.09 ? 96  TYR A CE1 1 
ATOM   737  C  CE2 . TYR A 1 96  ? 7.432   3.499   75.396  1.00 36.90 ? 96  TYR A CE2 1 
ATOM   738  C  CZ  . TYR A 1 96  ? 6.351   4.286   75.082  1.00 36.72 ? 96  TYR A CZ  1 
ATOM   739  O  OH  . TYR A 1 96  ? 5.893   5.197   75.996  1.00 36.35 ? 96  TYR A OH  1 
ATOM   740  N  N   . LEU A 1 97  ? 10.197  0.224   70.633  1.00 32.25 ? 97  LEU A N   1 
ATOM   741  C  CA  . LEU A 1 97  ? 10.697  -0.893  69.844  1.00 34.60 ? 97  LEU A CA  1 
ATOM   742  C  C   . LEU A 1 97  ? 10.708  -2.192  70.661  1.00 35.77 ? 97  LEU A C   1 
ATOM   743  O  O   . LEU A 1 97  ? 10.656  -2.167  71.893  1.00 36.20 ? 97  LEU A O   1 
ATOM   744  C  CB  . LEU A 1 97  ? 12.100  -0.579  69.280  1.00 33.54 ? 97  LEU A CB  1 
ATOM   745  C  CG  . LEU A 1 97  ? 13.285  -0.124  70.139  1.00 33.87 ? 97  LEU A CG  1 
ATOM   746  C  CD1 . LEU A 1 97  ? 13.989  -1.297  70.790  1.00 35.12 ? 97  LEU A CD1 1 
ATOM   747  C  CD2 . LEU A 1 97  ? 14.275  0.697   69.324  1.00 29.67 ? 97  LEU A CD2 1 
ATOM   748  N  N   . ASN A 1 98  ? 10.739  -3.324  69.963  1.00 35.28 ? 98  ASN A N   1 
ATOM   749  C  CA  . ASN A 1 98  ? 10.747  -4.638  70.595  1.00 35.52 ? 98  ASN A CA  1 
ATOM   750  C  C   . ASN A 1 98  ? 11.965  -5.441  70.143  1.00 38.51 ? 98  ASN A C   1 
ATOM   751  O  O   . ASN A 1 98  ? 12.443  -5.282  69.007  1.00 36.56 ? 98  ASN A O   1 
ATOM   752  C  CB  . ASN A 1 98  ? 9.465   -5.411  70.269  1.00 35.25 ? 98  ASN A CB  1 
ATOM   753  C  CG  . ASN A 1 98  ? 8.204   -4.556  70.400  1.00 38.79 ? 98  ASN A CG  1 
ATOM   754  O  OD1 . ASN A 1 98  ? 7.786   -4.218  71.503  1.00 33.75 ? 98  ASN A OD1 1 
ATOM   755  N  ND2 . ASN A 1 98  ? 7.585   -4.217  69.258  1.00 36.81 ? 98  ASN A ND2 1 
ATOM   756  N  N   . ILE A 1 99  ? 12.458  -6.312  71.020  1.00 37.49 ? 99  ILE A N   1 
ATOM   757  C  CA  . ILE A 1 99  ? 13.666  -7.080  70.724  1.00 39.97 ? 99  ILE A CA  1 
ATOM   758  C  C   . ILE A 1 99  ? 13.576  -8.526  71.208  1.00 40.16 ? 99  ILE A C   1 
ATOM   759  O  O   . ILE A 1 99  ? 13.316  -8.773  72.383  1.00 41.73 ? 99  ILE A O   1 
ATOM   760  C  CB  . ILE A 1 99  ? 14.921  -6.437  71.360  1.00 38.51 ? 99  ILE A CB  1 
ATOM   761  C  CG1 . ILE A 1 99  ? 14.880  -4.913  71.237  1.00 35.67 ? 99  ILE A CG1 1 
ATOM   762  C  CG2 . ILE A 1 99  ? 16.179  -6.991  70.704  1.00 38.68 ? 99  ILE A CG2 1 
ATOM   763  C  CD1 . ILE A 1 99  ? 16.157  -4.234  71.686  1.00 38.46 ? 99  ILE A CD1 1 
ATOM   764  N  N   . TRP A 1 100 ? 13.796  -9.474  70.298  1.00 37.67 ? 100 TRP A N   1 
ATOM   765  C  CA  . TRP A 1 100 ? 13.918  -10.878 70.658  1.00 37.09 ? 100 TRP A CA  1 
ATOM   766  C  C   . TRP A 1 100 ? 15.381  -11.300 70.580  1.00 42.12 ? 100 TRP A C   1 
ATOM   767  O  O   . TRP A 1 100 ? 16.035  -11.136 69.543  1.00 39.33 ? 100 TRP A O   1 
ATOM   768  C  CB  . TRP A 1 100 ? 13.060  -11.762 69.759  1.00 37.09 ? 100 TRP A CB  1 
ATOM   769  C  CG  . TRP A 1 100 ? 11.579  -11.590 69.962  1.00 39.34 ? 100 TRP A CG  1 
ATOM   770  C  CD1 . TRP A 1 100 ? 10.765  -12.348 70.762  1.00 42.07 ? 100 TRP A CD1 1 
ATOM   771  C  CD2 . TRP A 1 100 ? 10.742  -10.593 69.374  1.00 34.71 ? 100 TRP A CD2 1 
ATOM   772  N  NE1 . TRP A 1 100 ? 9.476   -11.889 70.698  1.00 38.27 ? 100 TRP A NE1 1 
ATOM   773  C  CE2 . TRP A 1 100 ? 9.431   -10.814 69.850  1.00 38.13 ? 100 TRP A CE2 1 
ATOM   774  C  CE3 . TRP A 1 100 ? 10.969  -9.538  68.485  1.00 37.11 ? 100 TRP A CE3 1 
ATOM   775  C  CZ2 . TRP A 1 100 ? 8.347   -10.022 69.462  1.00 38.33 ? 100 TRP A CZ2 1 
ATOM   776  C  CZ3 . TRP A 1 100 ? 9.884   -8.747  68.099  1.00 40.54 ? 100 TRP A CZ3 1 
ATOM   777  C  CH2 . TRP A 1 100 ? 8.592   -8.999  68.587  1.00 37.92 ? 100 TRP A CH2 1 
ATOM   778  N  N   . VAL A 1 101 ? 15.890  -11.830 71.693  1.00 42.63 ? 101 VAL A N   1 
ATOM   779  C  CA  . VAL A 1 101 ? 17.282  -12.262 71.791  1.00 41.82 ? 101 VAL A CA  1 
ATOM   780  C  C   . VAL A 1 101 ? 17.356  -13.758 72.053  1.00 45.42 ? 101 VAL A C   1 
ATOM   781  O  O   . VAL A 1 101 ? 16.760  -14.250 73.015  1.00 47.13 ? 101 VAL A O   1 
ATOM   782  C  CB  . VAL A 1 101 ? 18.028  -11.531 72.922  1.00 41.64 ? 101 VAL A CB  1 
ATOM   783  C  CG1 . VAL A 1 101 ? 19.527  -11.838 72.857  1.00 41.75 ? 101 VAL A CG1 1 
ATOM   784  C  CG2 . VAL A 1 101 ? 17.779  -10.039 72.841  1.00 41.52 ? 101 VAL A CG2 1 
ATOM   785  N  N   . PRO A 1 102 ? 18.090  -14.495 71.206  1.00 42.83 ? 102 PRO A N   1 
ATOM   786  C  CA  . PRO A 1 102 ? 18.183  -15.939 71.450  1.00 46.38 ? 102 PRO A CA  1 
ATOM   787  C  C   . PRO A 1 102 ? 18.803  -16.250 72.815  1.00 48.85 ? 102 PRO A C   1 
ATOM   788  O  O   . PRO A 1 102 ? 19.615  -15.482 73.333  1.00 48.12 ? 102 PRO A O   1 
ATOM   789  C  CB  . PRO A 1 102 ? 19.071  -16.444 70.313  1.00 44.70 ? 102 PRO A CB  1 
ATOM   790  C  CG  . PRO A 1 102 ? 19.731  -15.228 69.745  1.00 45.43 ? 102 PRO A CG  1 
ATOM   791  C  CD  . PRO A 1 102 ? 18.840  -14.067 70.015  1.00 43.75 ? 102 PRO A CD  1 
ATOM   792  N  N   . SER A 1 103 ? 18.396  -17.368 73.395  1.00 47.63 ? 103 SER A N   1 
ATOM   793  C  CA  . SER A 1 103 ? 18.900  -17.773 74.691  1.00 52.53 ? 103 SER A CA  1 
ATOM   794  C  C   . SER A 1 103 ? 19.698  -19.064 74.567  1.00 53.78 ? 103 SER A C   1 
ATOM   795  O  O   . SER A 1 103 ? 19.188  -20.062 74.059  1.00 48.71 ? 103 SER A O   1 
ATOM   796  C  CB  . SER A 1 103 ? 17.749  -17.944 75.688  1.00 46.58 ? 103 SER A CB  1 
ATOM   797  O  OG  . SER A 1 103 ? 18.246  -18.201 76.985  1.00 47.79 ? 103 SER A OG  1 
ATOM   798  N  N   . PRO A 1 104 ? 20.948  -19.056 75.065  1.00 53.94 ? 104 PRO A N   1 
ATOM   799  C  CA  . PRO A 1 104 ? 21.582  -17.921 75.752  1.00 52.55 ? 104 PRO A CA  1 
ATOM   800  C  C   . PRO A 1 104 ? 21.982  -16.784 74.807  1.00 51.50 ? 104 PRO A C   1 
ATOM   801  O  O   . PRO A 1 104 ? 21.955  -16.959 73.591  1.00 52.43 ? 104 PRO A O   1 
ATOM   802  C  CB  . PRO A 1 104 ? 22.823  -18.555 76.393  1.00 55.26 ? 104 PRO A CB  1 
ATOM   803  C  CG  . PRO A 1 104 ? 23.156  -19.701 75.498  1.00 57.22 ? 104 PRO A CG  1 
ATOM   804  C  CD  . PRO A 1 104 ? 21.823  -20.241 75.034  1.00 53.58 ? 104 PRO A CD  1 
ATOM   805  N  N   . ARG A 1 105 ? 22.362  -15.642 75.372  1.00 46.11 ? 105 ARG A N   1 
ATOM   806  C  CA  . ARG A 1 105 ? 22.659  -14.448 74.592  1.00 45.87 ? 105 ARG A CA  1 
ATOM   807  C  C   . ARG A 1 105 ? 23.930  -14.598 73.741  1.00 51.32 ? 105 ARG A C   1 
ATOM   808  O  O   . ARG A 1 105 ? 25.024  -14.815 74.272  1.00 51.41 ? 105 ARG A O   1 
ATOM   809  C  CB  . ARG A 1 105 ? 22.785  -13.248 75.529  1.00 45.07 ? 105 ARG A CB  1 
ATOM   810  C  CG  . ARG A 1 105 ? 23.084  -11.924 74.841  1.00 45.64 ? 105 ARG A CG  1 
ATOM   811  C  CD  . ARG A 1 105 ? 23.456  -10.880 75.889  1.00 48.35 ? 105 ARG A CD  1 
ATOM   812  N  NE  . ARG A 1 105 ? 22.394  -10.713 76.878  1.00 45.37 ? 105 ARG A NE  1 
ATOM   813  C  CZ  . ARG A 1 105 ? 22.483  -9.930  77.948  1.00 51.05 ? 105 ARG A CZ  1 
ATOM   814  N  NH1 . ARG A 1 105 ? 23.601  -9.251  78.172  1.00 50.17 ? 105 ARG A NH1 1 
ATOM   815  N  NH2 . ARG A 1 105 ? 21.457  -9.832  78.797  1.00 46.92 ? 105 ARG A NH2 1 
ATOM   816  N  N   . PRO A 1 106 ? 23.793  -14.476 72.411  1.00 45.87 ? 106 PRO A N   1 
ATOM   817  C  CA  . PRO A 1 106 ? 24.983  -14.647 71.580  1.00 45.44 ? 106 PRO A CA  1 
ATOM   818  C  C   . PRO A 1 106 ? 25.971  -13.495 71.754  1.00 47.57 ? 106 PRO A C   1 
ATOM   819  O  O   . PRO A 1 106 ? 25.670  -12.512 72.431  1.00 42.44 ? 106 PRO A O   1 
ATOM   820  C  CB  . PRO A 1 106 ? 24.415  -14.682 70.157  1.00 49.07 ? 106 PRO A CB  1 
ATOM   821  C  CG  . PRO A 1 106 ? 23.144  -13.911 70.241  1.00 47.98 ? 106 PRO A CG  1 
ATOM   822  C  CD  . PRO A 1 106 ? 22.592  -14.169 71.616  1.00 45.03 ? 106 PRO A CD  1 
ATOM   823  N  N   . LYS A 1 107 ? 27.147  -13.638 71.150  1.00 50.31 ? 107 LYS A N   1 
ATOM   824  C  CA  . LYS A 1 107 ? 28.117  -12.560 71.071  1.00 46.34 ? 107 LYS A CA  1 
ATOM   825  C  C   . LYS A 1 107 ? 28.111  -12.018 69.647  1.00 53.98 ? 107 LYS A C   1 
ATOM   826  O  O   . LYS A 1 107 ? 28.286  -12.779 68.687  1.00 54.29 ? 107 LYS A O   1 
ATOM   827  C  CB  . LYS A 1 107 ? 29.520  -13.052 71.454  1.00 49.27 ? 107 LYS A CB  1 
ATOM   828  C  CG  . LYS A 1 107 ? 29.575  -13.827 72.759  1.00 48.66 ? 107 LYS A CG  1 
ATOM   829  C  CD  . LYS A 1 107 ? 30.902  -14.573 72.942  1.00 55.02 ? 107 LYS A CD  1 
ATOM   830  C  CE  . LYS A 1 107 ? 32.043  -13.633 73.292  1.00 56.54 ? 107 LYS A CE  1 
ATOM   831  N  NZ  . LYS A 1 107 ? 33.071  -14.277 74.169  1.00 52.40 ? 107 LYS A NZ  1 
ATOM   832  N  N   . SER A 1 108 ? 27.893  -10.714 69.510  1.00 49.33 ? 108 SER A N   1 
ATOM   833  C  CA  . SER A 1 108 ? 27.966  -10.049 68.217  1.00 43.35 ? 108 SER A CA  1 
ATOM   834  C  C   . SER A 1 108 ? 27.318  -10.840 67.063  1.00 48.33 ? 108 SER A C   1 
ATOM   835  O  O   . SER A 1 108 ? 28.008  -11.281 66.147  1.00 52.67 ? 108 SER A O   1 
ATOM   836  C  CB  . SER A 1 108 ? 29.423  -9.751  67.885  1.00 48.84 ? 108 SER A CB  1 
ATOM   837  O  OG  . SER A 1 108 ? 29.646  -8.355  67.797  1.00 52.75 ? 108 SER A OG  1 
ATOM   838  N  N   . THR A 1 109 ? 26.001  -11.025 67.117  1.00 44.15 ? 109 THR A N   1 
ATOM   839  C  CA  . THR A 1 109 ? 25.292  -11.770 66.082  1.00 44.17 ? 109 THR A CA  1 
ATOM   840  C  C   . THR A 1 109 ? 24.605  -10.821 65.106  1.00 43.55 ? 109 THR A C   1 
ATOM   841  O  O   . THR A 1 109 ? 24.384  -9.653  65.427  1.00 42.72 ? 109 THR A O   1 
ATOM   842  C  CB  . THR A 1 109 ? 24.237  -12.710 66.685  1.00 45.65 ? 109 THR A CB  1 
ATOM   843  O  OG1 . THR A 1 109 ? 23.738  -13.590 65.670  1.00 48.86 ? 109 THR A OG1 1 
ATOM   844  C  CG2 . THR A 1 109 ? 23.073  -11.911 67.254  1.00 44.05 ? 109 THR A CG2 1 
ATOM   845  N  N   . THR A 1 110 ? 24.274  -11.320 63.914  1.00 43.74 ? 110 THR A N   1 
ATOM   846  C  CA  . THR A 1 110 ? 23.512  -10.538 62.941  1.00 38.33 ? 110 THR A CA  1 
ATOM   847  C  C   . THR A 1 110 ? 22.220  -9.963  63.544  1.00 37.94 ? 110 THR A C   1 
ATOM   848  O  O   . THR A 1 110 ? 21.516  -10.636 64.305  1.00 37.21 ? 110 THR A O   1 
ATOM   849  C  CB  . THR A 1 110 ? 23.166  -11.389 61.714  1.00 42.98 ? 110 THR A CB  1 
ATOM   850  O  OG1 . THR A 1 110 ? 24.363  -11.999 61.225  1.00 46.96 ? 110 THR A OG1 1 
ATOM   851  C  CG2 . THR A 1 110 ? 22.577  -10.529 60.614  1.00 37.27 ? 110 THR A CG2 1 
ATOM   852  N  N   . VAL A 1 111 ? 21.937  -8.703  63.230  1.00 38.78 ? 111 VAL A N   1 
ATOM   853  C  CA  . VAL A 1 111 ? 20.700  -8.055  63.662  1.00 35.85 ? 111 VAL A CA  1 
ATOM   854  C  C   . VAL A 1 111 ? 19.784  -7.772  62.473  1.00 34.50 ? 111 VAL A C   1 
ATOM   855  O  O   . VAL A 1 111 ? 20.252  -7.315  61.431  1.00 34.22 ? 111 VAL A O   1 
ATOM   856  C  CB  . VAL A 1 111 ? 20.960  -6.720  64.397  1.00 34.51 ? 111 VAL A CB  1 
ATOM   857  C  CG1 . VAL A 1 111 ? 19.640  -6.137  64.915  1.00 32.06 ? 111 VAL A CG1 1 
ATOM   858  C  CG2 . VAL A 1 111 ? 21.909  -6.926  65.568  1.00 37.48 ? 111 VAL A CG2 1 
ATOM   859  N  N   . MET A 1 112 ? 18.486  -8.035  62.650  1.00 33.75 ? 112 MET A N   1 
ATOM   860  C  CA  . MET A 1 112 ? 17.468  -7.701  61.656  1.00 36.53 ? 112 MET A CA  1 
ATOM   861  C  C   . MET A 1 112 ? 16.404  -6.785  62.279  1.00 35.30 ? 112 MET A C   1 
ATOM   862  O  O   . MET A 1 112 ? 15.825  -7.098  63.318  1.00 36.10 ? 112 MET A O   1 
ATOM   863  C  CB  . MET A 1 112 ? 16.811  -8.971  61.089  1.00 33.76 ? 112 MET A CB  1 
ATOM   864  C  CG  . MET A 1 112 ? 17.785  -9.965  60.437  1.00 33.36 ? 112 MET A CG  1 
ATOM   865  S  SD  . MET A 1 112 ? 17.006  -11.523 59.921  1.00 37.71 ? 112 MET A SD  1 
ATOM   866  C  CE  . MET A 1 112 ? 16.183  -10.997 58.421  1.00 33.45 ? 112 MET A CE  1 
ATOM   867  N  N   . VAL A 1 113 ? 16.161  -5.653  61.634  1.00 35.86 ? 113 VAL A N   1 
ATOM   868  C  CA  . VAL A 1 113 ? 15.230  -4.657  62.130  1.00 33.42 ? 113 VAL A CA  1 
ATOM   869  C  C   . VAL A 1 113 ? 14.013  -4.561  61.202  1.00 35.18 ? 113 VAL A C   1 
ATOM   870  O  O   . VAL A 1 113 ? 14.136  -4.202  60.025  1.00 31.70 ? 113 VAL A O   1 
ATOM   871  C  CB  . VAL A 1 113 ? 15.902  -3.282  62.238  1.00 33.06 ? 113 VAL A CB  1 
ATOM   872  C  CG1 . VAL A 1 113 ? 14.895  -2.222  62.651  1.00 34.26 ? 113 VAL A CG1 1 
ATOM   873  C  CG2 . VAL A 1 113 ? 17.073  -3.343  63.200  1.00 32.99 ? 113 VAL A CG2 1 
ATOM   874  N  N   . TRP A 1 114 ? 12.848  -4.895  61.741  1.00 33.40 ? 114 TRP A N   1 
ATOM   875  C  CA  . TRP A 1 114 ? 11.619  -4.915  60.967  1.00 32.46 ? 114 TRP A CA  1 
ATOM   876  C  C   . TRP A 1 114 ? 10.884  -3.579  61.025  1.00 31.58 ? 114 TRP A C   1 
ATOM   877  O  O   . TRP A 1 114 ? 10.712  -2.993  62.098  1.00 28.21 ? 114 TRP A O   1 
ATOM   878  C  CB  . TRP A 1 114 ? 10.703  -6.031  61.458  1.00 31.63 ? 114 TRP A CB  1 
ATOM   879  C  CG  . TRP A 1 114 ? 9.340   -5.990  60.830  1.00 35.39 ? 114 TRP A CG  1 
ATOM   880  C  CD1 . TRP A 1 114 ? 8.171   -5.556  61.412  1.00 33.17 ? 114 TRP A CD1 1 
ATOM   881  C  CD2 . TRP A 1 114 ? 8.999   -6.395  59.502  1.00 33.27 ? 114 TRP A CD2 1 
ATOM   882  N  NE1 . TRP A 1 114 ? 7.128   -5.664  60.517  1.00 32.57 ? 114 TRP A NE1 1 
ATOM   883  C  CE2 . TRP A 1 114 ? 7.608   -6.185  59.342  1.00 34.41 ? 114 TRP A CE2 1 
ATOM   884  C  CE3 . TRP A 1 114 ? 9.731   -6.916  58.431  1.00 34.07 ? 114 TRP A CE3 1 
ATOM   885  C  CZ2 . TRP A 1 114 ? 6.941   -6.479  58.147  1.00 34.94 ? 114 TRP A CZ2 1 
ATOM   886  C  CZ3 . TRP A 1 114 ? 9.066   -7.213  57.246  1.00 34.45 ? 114 TRP A CZ3 1 
ATOM   887  C  CH2 . TRP A 1 114 ? 7.682   -6.994  57.116  1.00 34.28 ? 114 TRP A CH2 1 
ATOM   888  N  N   . ILE A 1 115 ? 10.467  -3.108  59.856  1.00 28.63 ? 115 ILE A N   1 
ATOM   889  C  CA  . ILE A 1 115 ? 9.702   -1.877  59.731  1.00 31.68 ? 115 ILE A CA  1 
ATOM   890  C  C   . ILE A 1 115 ? 8.342   -2.193  59.117  1.00 31.72 ? 115 ILE A C   1 
ATOM   891  O  O   . ILE A 1 115 ? 8.274   -2.601  57.948  1.00 34.86 ? 115 ILE A O   1 
ATOM   892  C  CB  . ILE A 1 115 ? 10.419  -0.847  58.847  1.00 31.61 ? 115 ILE A CB  1 
ATOM   893  C  CG1 . ILE A 1 115 ? 11.834  -0.588  59.362  1.00 30.01 ? 115 ILE A CG1 1 
ATOM   894  C  CG2 . ILE A 1 115 ? 9.598   0.438   58.759  1.00 30.06 ? 115 ILE A CG2 1 
ATOM   895  C  CD1 . ILE A 1 115 ? 12.622  0.403   58.513  1.00 30.06 ? 115 ILE A CD1 1 
ATOM   896  N  N   . TYR A 1 116 ? 7.264   -2.018  59.878  1.00 29.74 ? 116 TYR A N   1 
ATOM   897  C  CA  . TYR A 1 116 ? 5.956   -2.425  59.360  1.00 33.47 ? 116 TYR A CA  1 
ATOM   898  C  C   . TYR A 1 116 ? 5.440   -1.544  58.210  1.00 30.75 ? 116 TYR A C   1 
ATOM   899  O  O   . TYR A 1 116 ? 5.815   -0.380  58.059  1.00 28.19 ? 116 TYR A O   1 
ATOM   900  C  CB  . TYR A 1 116 ? 4.898   -2.478  60.482  1.00 29.01 ? 116 TYR A CB  1 
ATOM   901  C  CG  . TYR A 1 116 ? 4.713   -1.210  61.279  1.00 32.38 ? 116 TYR A CG  1 
ATOM   902  C  CD1 . TYR A 1 116 ? 4.101   -0.089  60.723  1.00 28.81 ? 116 TYR A CD1 1 
ATOM   903  C  CD2 . TYR A 1 116 ? 5.132   -1.141  62.619  1.00 29.58 ? 116 TYR A CD2 1 
ATOM   904  C  CE1 . TYR A 1 116 ? 3.928   1.084   61.479  1.00 30.57 ? 116 TYR A CE1 1 
ATOM   905  C  CE2 . TYR A 1 116 ? 4.964   0.012   63.369  1.00 28.88 ? 116 TYR A CE2 1 
ATOM   906  C  CZ  . TYR A 1 116 ? 4.363   1.121   62.806  1.00 30.58 ? 116 TYR A CZ  1 
ATOM   907  O  OH  . TYR A 1 116 ? 4.214   2.262   63.571  1.00 27.75 ? 116 TYR A OH  1 
ATOM   908  N  N   . GLY A 1 117 ? 4.570   -2.135  57.398  1.00 29.77 ? 117 GLY A N   1 
ATOM   909  C  CA  . GLY A 1 117 ? 3.898   -1.424  56.325  1.00 32.99 ? 117 GLY A CA  1 
ATOM   910  C  C   . GLY A 1 117 ? 2.557   -0.902  56.792  1.00 31.79 ? 117 GLY A C   1 
ATOM   911  O  O   . GLY A 1 117 ? 2.283   -0.862  58.001  1.00 37.33 ? 117 GLY A O   1 
ATOM   912  N  N   . GLY A 1 118 ? 1.713   -0.505  55.851  1.00 32.43 ? 118 GLY A N   1 
ATOM   913  C  CA  . GLY A 1 118 ? 0.402   0.029   56.184  1.00 29.74 ? 118 GLY A CA  1 
ATOM   914  C  C   . GLY A 1 118 ? 0.137   1.373   55.531  1.00 31.40 ? 118 GLY A C   1 
ATOM   915  O  O   . GLY A 1 118 ? -0.602  2.199   56.072  1.00 30.14 ? 118 GLY A O   1 
ATOM   916  N  N   . GLY A 1 119 ? 0.756   1.602   54.374  1.00 29.30 ? 119 GLY A N   1 
ATOM   917  C  CA  . GLY A 1 119 ? 0.423   2.744   53.533  1.00 30.06 ? 119 GLY A CA  1 
ATOM   918  C  C   . GLY A 1 119 ? 0.863   4.072   54.112  1.00 31.12 ? 119 GLY A C   1 
ATOM   919  O  O   . GLY A 1 119 ? 0.435   5.134   53.656  1.00 29.54 ? 119 GLY A O   1 
ATOM   920  N  N   . PHE A 1 120 ? 1.731   4.001   55.117  1.00 28.04 ? 120 PHE A N   1 
ATOM   921  C  CA  . PHE A 1 120 ? 2.115   5.161   55.920  1.00 30.39 ? 120 PHE A CA  1 
ATOM   922  C  C   . PHE A 1 120 ? 0.951   5.791   56.740  1.00 31.20 ? 120 PHE A C   1 
ATOM   923  O  O   . PHE A 1 120 ? 1.146   6.815   57.395  1.00 29.59 ? 120 PHE A O   1 
ATOM   924  C  CB  . PHE A 1 120 ? 2.742   6.237   55.032  1.00 27.47 ? 120 PHE A CB  1 
ATOM   925  C  CG  . PHE A 1 120 ? 4.092   5.867   54.473  1.00 27.94 ? 120 PHE A CG  1 
ATOM   926  C  CD1 . PHE A 1 120 ? 5.189   5.721   55.303  1.00 24.95 ? 120 PHE A CD1 1 
ATOM   927  C  CD2 . PHE A 1 120 ? 4.264   5.703   53.103  1.00 29.19 ? 120 PHE A CD2 1 
ATOM   928  C  CE1 . PHE A 1 120 ? 6.424   5.395   54.799  1.00 29.64 ? 120 PHE A CE1 1 
ATOM   929  C  CE2 . PHE A 1 120 ? 5.510   5.376   52.572  1.00 28.98 ? 120 PHE A CE2 1 
ATOM   930  C  CZ  . PHE A 1 120 ? 6.596   5.225   53.411  1.00 28.17 ? 120 PHE A CZ  1 
ATOM   931  N  N   . TYR A 1 121 ? -0.242  5.194   56.702  1.00 29.59 ? 121 TYR A N   1 
ATOM   932  C  CA  . TYR A 1 121 ? -1.383  5.742   57.443  1.00 31.29 ? 121 TYR A CA  1 
ATOM   933  C  C   . TYR A 1 121 ? -1.748  4.833   58.620  1.00 30.60 ? 121 TYR A C   1 
ATOM   934  O  O   . TYR A 1 121 ? -2.626  5.155   59.423  1.00 30.09 ? 121 TYR A O   1 
ATOM   935  C  CB  . TYR A 1 121 ? -2.603  5.936   56.514  1.00 28.84 ? 121 TYR A CB  1 
ATOM   936  C  CG  . TYR A 1 121 ? -3.306  4.643   56.143  1.00 31.00 ? 121 TYR A CG  1 
ATOM   937  C  CD1 . TYR A 1 121 ? -4.289  4.117   56.967  1.00 30.97 ? 121 TYR A CD1 1 
ATOM   938  C  CD2 . TYR A 1 121 ? -2.995  3.953   54.959  1.00 31.61 ? 121 TYR A CD2 1 
ATOM   939  C  CE1 . TYR A 1 121 ? -4.932  2.942   56.659  1.00 30.85 ? 121 TYR A CE1 1 
ATOM   940  C  CE2 . TYR A 1 121 ? -3.640  2.764   54.635  1.00 33.67 ? 121 TYR A CE2 1 
ATOM   941  C  CZ  . TYR A 1 121 ? -4.616  2.268   55.498  1.00 36.51 ? 121 TYR A CZ  1 
ATOM   942  O  OH  . TYR A 1 121 ? -5.280  1.095   55.226  1.00 35.99 ? 121 TYR A OH  1 
ATOM   943  N  N   . SER A 1 122 ? -1.064  3.699   58.721  1.00 32.10 ? 122 SER A N   1 
ATOM   944  C  CA  . SER A 1 122 ? -1.408  2.687   59.707  1.00 31.13 ? 122 SER A CA  1 
ATOM   945  C  C   . SER A 1 122 ? -0.273  1.679   59.901  1.00 31.29 ? 122 SER A C   1 
ATOM   946  O  O   . SER A 1 122 ? 0.769   1.766   59.256  1.00 29.63 ? 122 SER A O   1 
ATOM   947  C  CB  . SER A 1 122 ? -2.675  1.958   59.277  1.00 31.70 ? 122 SER A CB  1 
ATOM   948  O  OG  . SER A 1 122 ? -2.422  1.159   58.130  1.00 31.39 ? 122 SER A OG  1 
ATOM   949  N  N   . GLY A 1 123 ? -0.493  0.714   60.787  1.00 31.74 ? 123 GLY A N   1 
ATOM   950  C  CA  . GLY A 1 123 ? 0.500   -0.306  61.060  1.00 30.08 ? 123 GLY A CA  1 
ATOM   951  C  C   . GLY A 1 123 ? 0.887   -0.328  62.529  1.00 33.87 ? 123 GLY A C   1 
ATOM   952  O  O   . GLY A 1 123 ? 0.889   0.706   63.184  1.00 30.65 ? 123 GLY A O   1 
ATOM   953  N  N   . SER A 1 124 ? 1.202   -1.514  63.041  1.00 32.78 ? 124 SER A N   1 
ATOM   954  C  CA  . SER A 1 124 ? 1.683   -1.669  64.402  1.00 33.83 ? 124 SER A CA  1 
ATOM   955  C  C   . SER A 1 124 ? 2.807   -2.703  64.439  1.00 37.03 ? 124 SER A C   1 
ATOM   956  O  O   . SER A 1 124 ? 2.800   -3.665  63.671  1.00 32.39 ? 124 SER A O   1 
ATOM   957  C  CB  . SER A 1 124 ? 0.547   -2.096  65.346  1.00 33.98 ? 124 SER A CB  1 
ATOM   958  O  OG  . SER A 1 124 ? -0.603  -1.287  65.170  1.00 30.99 ? 124 SER A OG  1 
ATOM   959  N  N   . SER A 1 125 ? 3.751   -2.502  65.356  1.00 33.51 ? 125 SER A N   1 
ATOM   960  C  CA  . SER A 1 125 ? 4.858   -3.427  65.563  1.00 34.68 ? 125 SER A CA  1 
ATOM   961  C  C   . SER A 1 125 ? 4.405   -4.682  66.306  1.00 39.21 ? 125 SER A C   1 
ATOM   962  O  O   . SER A 1 125 ? 5.161   -5.649  66.426  1.00 39.18 ? 125 SER A O   1 
ATOM   963  C  CB  . SER A 1 125 ? 5.965   -2.754  66.364  1.00 29.94 ? 125 SER A CB  1 
ATOM   964  O  OG  . SER A 1 125 ? 5.539   -2.611  67.717  1.00 35.95 ? 125 SER A OG  1 
ATOM   965  N  N   . THR A 1 126 ? 3.172   -4.656  66.808  1.00 37.25 ? 126 THR A N   1 
ATOM   966  C  CA  . THR A 1 126 ? 2.713   -5.635  67.795  1.00 35.66 ? 126 THR A CA  1 
ATOM   967  C  C   . THR A 1 126 ? 1.763   -6.693  67.236  1.00 36.29 ? 126 THR A C   1 
ATOM   968  O  O   . THR A 1 126 ? 1.269   -7.540  67.978  1.00 40.29 ? 126 THR A O   1 
ATOM   969  C  CB  . THR A 1 126 ? 2.012   -4.933  68.959  1.00 36.87 ? 126 THR A CB  1 
ATOM   970  O  OG1 . THR A 1 126 ? 0.927   -4.152  68.453  1.00 35.61 ? 126 THR A OG1 1 
ATOM   971  C  CG2 . THR A 1 126 ? 2.988   -4.013  69.693  1.00 34.58 ? 126 THR A CG2 1 
ATOM   972  N  N   . LEU A 1 127 ? 1.515   -6.646  65.932  1.00 35.41 ? 127 LEU A N   1 
ATOM   973  C  CA  . LEU A 1 127 ? 0.672   -7.638  65.278  1.00 37.63 ? 127 LEU A CA  1 
ATOM   974  C  C   . LEU A 1 127 ? 1.222   -9.042  65.479  1.00 37.15 ? 127 LEU A C   1 
ATOM   975  O  O   . LEU A 1 127 ? 2.429   -9.245  65.530  1.00 36.66 ? 127 LEU A O   1 
ATOM   976  C  CB  . LEU A 1 127 ? 0.549   -7.355  63.772  1.00 36.11 ? 127 LEU A CB  1 
ATOM   977  C  CG  . LEU A 1 127 ? 0.103   -5.958  63.333  1.00 36.97 ? 127 LEU A CG  1 
ATOM   978  C  CD1 . LEU A 1 127 ? -0.197  -5.920  61.829  1.00 35.09 ? 127 LEU A CD1 1 
ATOM   979  C  CD2 . LEU A 1 127 ? -1.102  -5.513  64.147  1.00 34.45 ? 127 LEU A CD2 1 
ATOM   980  N  N   . ASP A 1 128 ? 0.319   -10.008 65.555  1.00 38.94 ? 128 ASP A N   1 
ATOM   981  C  CA  . ASP A 1 128 ? 0.690   -11.412 65.644  1.00 40.39 ? 128 ASP A CA  1 
ATOM   982  C  C   . ASP A 1 128 ? 1.659   -11.865 64.529  1.00 43.29 ? 128 ASP A C   1 
ATOM   983  O  O   . ASP A 1 128 ? 2.565   -12.652 64.810  1.00 41.24 ? 128 ASP A O   1 
ATOM   984  C  CB  . ASP A 1 128 ? -0.574  -12.286 65.624  1.00 40.22 ? 128 ASP A CB  1 
ATOM   985  C  CG  . ASP A 1 128 ? -1.456  -12.097 66.867  1.00 51.09 ? 128 ASP A CG  1 
ATOM   986  O  OD1 . ASP A 1 128 ? -1.141  -11.254 67.742  1.00 48.95 ? 128 ASP A OD1 1 
ATOM   987  O  OD2 . ASP A 1 128 ? -2.487  -12.798 66.970  1.00 57.70 ? 128 ASP A OD2 1 
ATOM   988  N  N   . VAL A 1 129 ? 1.488   -11.395 63.281  1.00 38.71 ? 129 VAL A N   1 
ATOM   989  C  CA  . VAL A 1 129 ? 2.383   -11.853 62.203  1.00 41.47 ? 129 VAL A CA  1 
ATOM   990  C  C   . VAL A 1 129 ? 3.771   -11.229 62.269  1.00 39.70 ? 129 VAL A C   1 
ATOM   991  O  O   . VAL A 1 129 ? 4.669   -11.645 61.534  1.00 39.79 ? 129 VAL A O   1 
ATOM   992  C  CB  . VAL A 1 129 ? 1.832   -11.592 60.742  1.00 43.25 ? 129 VAL A CB  1 
ATOM   993  C  CG1 . VAL A 1 129 ? 0.889   -12.690 60.321  1.00 45.80 ? 129 VAL A CG1 1 
ATOM   994  C  CG2 . VAL A 1 129 ? 1.208   -10.199 60.579  1.00 38.56 ? 129 VAL A CG2 1 
ATOM   995  N  N   . TYR A 1 130 ? 3.954   -10.231 63.129  1.00 41.41 ? 130 TYR A N   1 
ATOM   996  C  CA  . TYR A 1 130 ? 5.271   -9.614  63.285  1.00 37.79 ? 130 TYR A CA  1 
ATOM   997  C  C   . TYR A 1 130 ? 5.963   -10.137 64.552  1.00 39.27 ? 130 TYR A C   1 
ATOM   998  O  O   . TYR A 1 130 ? 6.998   -9.615  64.963  1.00 36.08 ? 130 TYR A O   1 
ATOM   999  C  CB  . TYR A 1 130 ? 5.169   -8.084  63.339  1.00 35.36 ? 130 TYR A CB  1 
ATOM   1000 C  CG  . TYR A 1 130 ? 4.484   -7.409  62.160  1.00 36.90 ? 130 TYR A CG  1 
ATOM   1001 C  CD1 . TYR A 1 130 ? 4.380   -8.031  60.917  1.00 37.71 ? 130 TYR A CD1 1 
ATOM   1002 C  CD2 . TYR A 1 130 ? 3.936   -6.138  62.302  1.00 35.30 ? 130 TYR A CD2 1 
ATOM   1003 C  CE1 . TYR A 1 130 ? 3.755   -7.399  59.855  1.00 34.76 ? 130 TYR A CE1 1 
ATOM   1004 C  CE2 . TYR A 1 130 ? 3.320   -5.505  61.261  1.00 35.38 ? 130 TYR A CE2 1 
ATOM   1005 C  CZ  . TYR A 1 130 ? 3.230   -6.132  60.033  1.00 36.08 ? 130 TYR A CZ  1 
ATOM   1006 O  OH  . TYR A 1 130 ? 2.598   -5.483  59.001  1.00 30.77 ? 130 TYR A OH  1 
ATOM   1007 N  N   . ASN A 1 131 ? 5.374   -11.154 65.178  1.00 38.77 ? 131 ASN A N   1 
ATOM   1008 C  CA  . ASN A 1 131 ? 5.979   -11.790 66.351  1.00 37.50 ? 131 ASN A CA  1 
ATOM   1009 C  C   . ASN A 1 131 ? 7.397   -12.295 66.038  1.00 37.63 ? 131 ASN A C   1 
ATOM   1010 O  O   . ASN A 1 131 ? 7.581   -13.277 65.327  1.00 38.00 ? 131 ASN A O   1 
ATOM   1011 C  CB  . ASN A 1 131 ? 5.097   -12.939 66.834  1.00 33.96 ? 131 ASN A CB  1 
ATOM   1012 C  CG  . ASN A 1 131 ? 5.527   -13.491 68.184  1.00 42.82 ? 131 ASN A CG  1 
ATOM   1013 O  OD1 . ASN A 1 131 ? 6.713   -13.484 68.541  1.00 40.79 ? 131 ASN A OD1 1 
ATOM   1014 N  ND2 . ASN A 1 131 ? 4.554   -13.983 68.943  1.00 39.79 ? 131 ASN A ND2 1 
ATOM   1015 N  N   . GLY A 1 132 ? 8.402   -11.625 66.579  1.00 37.08 ? 132 GLY A N   1 
ATOM   1016 C  CA  . GLY A 1 132 ? 9.769   -11.939 66.226  1.00 35.69 ? 132 GLY A CA  1 
ATOM   1017 C  C   . GLY A 1 132 ? 10.373  -13.231 66.744  1.00 37.23 ? 132 GLY A C   1 
ATOM   1018 O  O   . GLY A 1 132 ? 11.488  -13.577 66.361  1.00 38.08 ? 132 GLY A O   1 
ATOM   1019 N  N   . LYS A 1 133 ? 9.666   -13.957 67.602  1.00 40.20 ? 133 LYS A N   1 
ATOM   1020 C  CA  . LYS A 1 133 ? 10.333  -15.027 68.347  1.00 42.07 ? 133 LYS A CA  1 
ATOM   1021 C  C   . LYS A 1 133 ? 10.777  -16.197 67.469  1.00 43.97 ? 133 LYS A C   1 
ATOM   1022 O  O   . LYS A 1 133 ? 11.855  -16.763 67.678  1.00 45.70 ? 133 LYS A O   1 
ATOM   1023 C  CB  . LYS A 1 133 ? 9.443   -15.529 69.482  1.00 40.82 ? 133 LYS A CB  1 
ATOM   1024 C  CG  . LYS A 1 133 ? 8.160   -16.226 69.099  1.00 39.91 ? 133 LYS A CG  1 
ATOM   1025 C  CD  . LYS A 1 133 ? 7.341   -16.427 70.373  1.00 42.80 ? 133 LYS A CD  1 
ATOM   1026 C  CE  . LYS A 1 133 ? 6.130   -17.313 70.188  1.00 43.72 ? 133 LYS A CE  1 
ATOM   1027 N  NZ  . LYS A 1 133 ? 5.260   -17.222 71.389  1.00 46.26 ? 133 LYS A NZ  1 
ATOM   1028 N  N   . TYR A 1 134 ? 9.965   -16.540 66.475  1.00 40.37 ? 134 TYR A N   1 
ATOM   1029 C  CA  . TYR A 1 134 ? 10.249  -17.697 65.636  1.00 41.22 ? 134 TYR A CA  1 
ATOM   1030 C  C   . TYR A 1 134 ? 11.503  -17.518 64.779  1.00 43.26 ? 134 TYR A C   1 
ATOM   1031 O  O   . TYR A 1 134 ? 12.343  -18.421 64.693  1.00 43.01 ? 134 TYR A O   1 
ATOM   1032 C  CB  . TYR A 1 134 ? 9.054   -17.996 64.736  1.00 42.01 ? 134 TYR A CB  1 
ATOM   1033 C  CG  . TYR A 1 134 ? 7.758   -18.106 65.487  1.00 40.06 ? 134 TYR A CG  1 
ATOM   1034 C  CD1 . TYR A 1 134 ? 7.490   -19.209 66.283  1.00 38.82 ? 134 TYR A CD1 1 
ATOM   1035 C  CD2 . TYR A 1 134 ? 6.801   -17.104 65.403  1.00 39.13 ? 134 TYR A CD2 1 
ATOM   1036 C  CE1 . TYR A 1 134 ? 6.300   -19.312 66.982  1.00 41.34 ? 134 TYR A CE1 1 
ATOM   1037 C  CE2 . TYR A 1 134 ? 5.607   -17.197 66.098  1.00 41.70 ? 134 TYR A CE2 1 
ATOM   1038 C  CZ  . TYR A 1 134 ? 5.364   -18.302 66.886  1.00 39.48 ? 134 TYR A CZ  1 
ATOM   1039 O  OH  . TYR A 1 134 ? 4.180   -18.396 67.572  1.00 42.59 ? 134 TYR A OH  1 
ATOM   1040 N  N   . LEU A 1 135 ? 11.616  -16.360 64.135  1.00 40.34 ? 135 LEU A N   1 
ATOM   1041 C  CA  . LEU A 1 135 ? 12.752  -16.075 63.270  1.00 41.32 ? 135 LEU A CA  1 
ATOM   1042 C  C   . LEU A 1 135 ? 14.016  -15.849 64.101  1.00 41.91 ? 135 LEU A C   1 
ATOM   1043 O  O   . LEU A 1 135 ? 15.097  -16.301 63.740  1.00 44.72 ? 135 LEU A O   1 
ATOM   1044 C  CB  . LEU A 1 135 ? 12.439  -14.867 62.381  1.00 40.07 ? 135 LEU A CB  1 
ATOM   1045 C  CG  . LEU A 1 135 ? 13.515  -14.215 61.515  1.00 39.76 ? 135 LEU A CG  1 
ATOM   1046 C  CD1 . LEU A 1 135 ? 14.196  -15.194 60.548  1.00 38.22 ? 135 LEU A CD1 1 
ATOM   1047 C  CD2 . LEU A 1 135 ? 12.896  -13.047 60.762  1.00 34.93 ? 135 LEU A CD2 1 
ATOM   1048 N  N   . ALA A 1 136 ? 13.874  -15.175 65.234  1.00 43.23 ? 136 ALA A N   1 
ATOM   1049 C  CA  . ALA A 1 136 ? 15.007  -14.942 66.132  1.00 44.53 ? 136 ALA A CA  1 
ATOM   1050 C  C   . ALA A 1 136 ? 15.553  -16.263 66.669  1.00 43.39 ? 136 ALA A C   1 
ATOM   1051 O  O   . ALA A 1 136 ? 16.767  -16.481 66.714  1.00 38.94 ? 136 ALA A O   1 
ATOM   1052 C  CB  . ALA A 1 136 ? 14.599  -14.034 67.279  1.00 37.37 ? 136 ALA A CB  1 
ATOM   1053 N  N   . TYR A 1 137 ? 14.639  -17.144 67.057  1.00 41.63 ? 137 TYR A N   1 
ATOM   1054 C  CA  . TYR A 1 137 ? 15.014  -18.457 67.553  1.00 41.87 ? 137 TYR A CA  1 
ATOM   1055 C  C   . TYR A 1 137 ? 15.602  -19.319 66.451  1.00 44.74 ? 137 TYR A C   1 
ATOM   1056 O  O   . TYR A 1 137 ? 16.729  -19.788 66.549  1.00 43.22 ? 137 TYR A O   1 
ATOM   1057 C  CB  . TYR A 1 137 ? 13.808  -19.153 68.164  1.00 46.18 ? 137 TYR A CB  1 
ATOM   1058 C  CG  . TYR A 1 137 ? 14.043  -20.603 68.527  1.00 49.46 ? 137 TYR A CG  1 
ATOM   1059 C  CD1 . TYR A 1 137 ? 14.707  -20.947 69.697  1.00 53.12 ? 137 TYR A CD1 1 
ATOM   1060 C  CD2 . TYR A 1 137 ? 13.586  -21.628 67.706  1.00 48.53 ? 137 TYR A CD2 1 
ATOM   1061 C  CE1 . TYR A 1 137 ? 14.919  -22.273 70.040  1.00 55.02 ? 137 TYR A CE1 1 
ATOM   1062 C  CE2 . TYR A 1 137 ? 13.791  -22.952 68.036  1.00 51.37 ? 137 TYR A CE2 1 
ATOM   1063 C  CZ  . TYR A 1 137 ? 14.456  -23.270 69.207  1.00 56.39 ? 137 TYR A CZ  1 
ATOM   1064 O  OH  . TYR A 1 137 ? 14.663  -24.584 69.549  1.00 57.95 ? 137 TYR A OH  1 
ATOM   1065 N  N   . THR A 1 138 ? 14.830  -19.507 65.387  1.00 46.15 ? 138 THR A N   1 
ATOM   1066 C  CA  . THR A 1 138 ? 15.195  -20.443 64.345  1.00 41.75 ? 138 THR A CA  1 
ATOM   1067 C  C   . THR A 1 138 ? 16.508  -20.082 63.681  1.00 43.33 ? 138 THR A C   1 
ATOM   1068 O  O   . THR A 1 138 ? 17.352  -20.945 63.458  1.00 46.16 ? 138 THR A O   1 
ATOM   1069 C  CB  . THR A 1 138 ? 14.100  -20.527 63.283  1.00 43.09 ? 138 THR A CB  1 
ATOM   1070 O  OG1 . THR A 1 138 ? 12.913  -21.060 63.880  1.00 43.27 ? 138 THR A OG1 1 
ATOM   1071 C  CG2 . THR A 1 138 ? 14.540  -21.428 62.146  1.00 46.08 ? 138 THR A CG2 1 
ATOM   1072 N  N   . GLU A 1 139 ? 16.689  -18.805 63.377  1.00 43.15 ? 139 GLU A N   1 
ATOM   1073 C  CA  . GLU A 1 139 ? 17.873  -18.374 62.647  1.00 40.25 ? 139 GLU A CA  1 
ATOM   1074 C  C   . GLU A 1 139 ? 18.948  -17.781 63.545  1.00 40.56 ? 139 GLU A C   1 
ATOM   1075 O  O   . GLU A 1 139 ? 19.986  -17.345 63.058  1.00 43.32 ? 139 GLU A O   1 
ATOM   1076 C  CB  . GLU A 1 139 ? 17.482  -17.364 61.574  1.00 39.75 ? 139 GLU A CB  1 
ATOM   1077 C  CG  . GLU A 1 139 ? 16.612  -17.976 60.493  1.00 44.03 ? 139 GLU A CG  1 
ATOM   1078 C  CD  . GLU A 1 139 ? 17.277  -19.178 59.848  1.00 44.50 ? 139 GLU A CD  1 
ATOM   1079 O  OE1 . GLU A 1 139 ? 18.469  -19.074 59.483  1.00 47.12 ? 139 GLU A OE1 1 
ATOM   1080 O  OE2 . GLU A 1 139 ? 16.620  -20.230 59.718  1.00 45.70 ? 139 GLU A OE2 1 
ATOM   1081 N  N   . GLU A 1 140 ? 18.694  -17.762 64.849  1.00 42.61 ? 140 GLU A N   1 
ATOM   1082 C  CA  . GLU A 1 140 ? 19.661  -17.253 65.825  1.00 47.07 ? 140 GLU A CA  1 
ATOM   1083 C  C   . GLU A 1 140 ? 20.158  -15.858 65.473  1.00 42.78 ? 140 GLU A C   1 
ATOM   1084 O  O   . GLU A 1 140 ? 21.355  -15.630 65.326  1.00 42.82 ? 140 GLU A O   1 
ATOM   1085 C  CB  . GLU A 1 140 ? 20.841  -18.215 65.958  1.00 45.27 ? 140 GLU A CB  1 
ATOM   1086 C  CG  . GLU A 1 140 ? 20.414  -19.604 66.420  1.00 54.12 ? 140 GLU A CG  1 
ATOM   1087 C  CD  . GLU A 1 140 ? 21.496  -20.343 67.186  1.00 66.32 ? 140 GLU A CD  1 
ATOM   1088 O  OE1 . GLU A 1 140 ? 21.476  -20.298 68.440  1.00 62.96 ? 140 GLU A OE1 1 
ATOM   1089 O  OE2 . GLU A 1 140 ? 22.357  -20.974 66.533  1.00 68.62 ? 140 GLU A OE2 1 
ATOM   1090 N  N   . VAL A 1 141 ? 19.213  -14.934 65.329  1.00 42.30 ? 141 VAL A N   1 
ATOM   1091 C  CA  . VAL A 1 141 ? 19.512  -13.536 65.051  1.00 41.05 ? 141 VAL A CA  1 
ATOM   1092 C  C   . VAL A 1 141 ? 18.854  -12.685 66.118  1.00 36.96 ? 141 VAL A C   1 
ATOM   1093 O  O   . VAL A 1 141 ? 17.904  -13.117 66.760  1.00 36.96 ? 141 VAL A O   1 
ATOM   1094 C  CB  . VAL A 1 141 ? 19.003  -13.078 63.648  1.00 40.10 ? 141 VAL A CB  1 
ATOM   1095 C  CG1 . VAL A 1 141 ? 19.797  -13.740 62.528  1.00 41.27 ? 141 VAL A CG1 1 
ATOM   1096 C  CG2 . VAL A 1 141 ? 17.512  -13.336 63.487  1.00 35.06 ? 141 VAL A CG2 1 
ATOM   1097 N  N   . VAL A 1 142 ? 19.353  -11.472 66.303  1.00 37.69 ? 142 VAL A N   1 
ATOM   1098 C  CA  . VAL A 1 142 ? 18.693  -10.532 67.194  1.00 39.12 ? 142 VAL A CA  1 
ATOM   1099 C  C   . VAL A 1 142 ? 17.739  -9.711  66.363  1.00 35.97 ? 142 VAL A C   1 
ATOM   1100 O  O   . VAL A 1 142 ? 18.162  -8.959  65.484  1.00 40.01 ? 142 VAL A O   1 
ATOM   1101 C  CB  . VAL A 1 142 ? 19.689  -9.610  67.933  1.00 41.57 ? 142 VAL A CB  1 
ATOM   1102 C  CG1 . VAL A 1 142 ? 18.961  -8.443  68.581  1.00 36.24 ? 142 VAL A CG1 1 
ATOM   1103 C  CG2 . VAL A 1 142 ? 20.468  -10.393 68.976  1.00 38.46 ? 142 VAL A CG2 1 
ATOM   1104 N  N   . LEU A 1 143 ? 16.451  -9.869  66.645  1.00 39.98 ? 143 LEU A N   1 
ATOM   1105 C  CA  . LEU A 1 143 ? 15.388  -9.283  65.836  1.00 38.77 ? 143 LEU A CA  1 
ATOM   1106 C  C   . LEU A 1 143 ? 14.676  -8.120  66.526  1.00 37.74 ? 143 LEU A C   1 
ATOM   1107 O  O   . LEU A 1 143 ? 14.083  -8.282  67.603  1.00 36.97 ? 143 LEU A O   1 
ATOM   1108 C  CB  . LEU A 1 143 ? 14.358  -10.350 65.481  1.00 37.34 ? 143 LEU A CB  1 
ATOM   1109 C  CG  . LEU A 1 143 ? 13.202  -9.846  64.618  1.00 36.79 ? 143 LEU A CG  1 
ATOM   1110 C  CD1 . LEU A 1 143 ? 13.607  -9.790  63.148  1.00 35.05 ? 143 LEU A CD1 1 
ATOM   1111 C  CD2 . LEU A 1 143 ? 12.028  -10.735 64.803  1.00 37.85 ? 143 LEU A CD2 1 
ATOM   1112 N  N   . VAL A 1 144 ? 14.723  -6.961  65.878  1.00 34.33 ? 144 VAL A N   1 
ATOM   1113 C  CA  . VAL A 1 144 ? 14.066  -5.753  66.362  1.00 34.07 ? 144 VAL A CA  1 
ATOM   1114 C  C   . VAL A 1 144 ? 12.896  -5.344  65.468  1.00 33.64 ? 144 VAL A C   1 
ATOM   1115 O  O   . VAL A 1 144 ? 12.997  -5.392  64.230  1.00 34.40 ? 144 VAL A O   1 
ATOM   1116 C  CB  . VAL A 1 144 ? 15.046  -4.572  66.426  1.00 37.33 ? 144 VAL A CB  1 
ATOM   1117 C  CG1 . VAL A 1 144 ? 14.325  -3.312  66.888  1.00 30.20 ? 144 VAL A CG1 1 
ATOM   1118 C  CG2 . VAL A 1 144 ? 16.246  -4.906  67.328  1.00 37.83 ? 144 VAL A CG2 1 
ATOM   1119 N  N   . SER A 1 145 ? 11.790  -4.948  66.093  1.00 30.65 ? 145 SER A N   1 
ATOM   1120 C  CA  . SER A 1 145 ? 10.690  -4.319  65.380  1.00 31.09 ? 145 SER A CA  1 
ATOM   1121 C  C   . SER A 1 145 ? 10.502  -2.922  65.946  1.00 34.76 ? 145 SER A C   1 
ATOM   1122 O  O   . SER A 1 145 ? 10.276  -2.758  67.149  1.00 33.18 ? 145 SER A O   1 
ATOM   1123 C  CB  . SER A 1 145 ? 9.404   -5.135  65.503  1.00 31.84 ? 145 SER A CB  1 
ATOM   1124 O  OG  . SER A 1 145 ? 9.050   -5.330  66.865  1.00 35.66 ? 145 SER A OG  1 
ATOM   1125 N  N   . LEU A 1 146 ? 10.606  -1.911  65.089  1.00 33.00 ? 146 LEU A N   1 
ATOM   1126 C  CA  . LEU A 1 146 ? 10.476  -0.543  65.556  1.00 30.28 ? 146 LEU A CA  1 
ATOM   1127 C  C   . LEU A 1 146 ? 9.043   -0.081  65.358  1.00 30.26 ? 146 LEU A C   1 
ATOM   1128 O  O   . LEU A 1 146 ? 8.179   -0.880  65.012  1.00 34.65 ? 146 LEU A O   1 
ATOM   1129 C  CB  . LEU A 1 146 ? 11.474  0.369   64.837  1.00 29.22 ? 146 LEU A CB  1 
ATOM   1130 C  CG  . LEU A 1 146 ? 11.529  0.405   63.304  1.00 30.49 ? 146 LEU A CG  1 
ATOM   1131 C  CD1 . LEU A 1 146 ? 10.386  1.245   62.720  1.00 28.44 ? 146 LEU A CD1 1 
ATOM   1132 C  CD2 . LEU A 1 146 ? 12.861  0.947   62.857  1.00 31.81 ? 146 LEU A CD2 1 
ATOM   1133 N  N   . SER A 1 147 ? 8.780   1.195   65.600  1.00 28.13 ? 147 SER A N   1 
ATOM   1134 C  CA  . SER A 1 147 ? 7.472   1.776   65.304  1.00 27.91 ? 147 SER A CA  1 
ATOM   1135 C  C   . SER A 1 147 ? 7.700   3.209   64.898  1.00 29.69 ? 147 SER A C   1 
ATOM   1136 O  O   . SER A 1 147 ? 8.776   3.756   65.132  1.00 30.25 ? 147 SER A O   1 
ATOM   1137 C  CB  . SER A 1 147 ? 6.522   1.711   66.502  1.00 32.40 ? 147 SER A CB  1 
ATOM   1138 O  OG  . SER A 1 147 ? 7.049   2.463   67.581  1.00 38.62 ? 147 SER A OG  1 
ATOM   1139 N  N   . TYR A 1 148 ? 6.707   3.812   64.257  1.00 29.54 ? 148 TYR A N   1 
ATOM   1140 C  CA  . TYR A 1 148 ? 6.853   5.183   63.803  1.00 29.20 ? 148 TYR A CA  1 
ATOM   1141 C  C   . TYR A 1 148 ? 5.471   5.798   63.661  1.00 31.22 ? 148 TYR A C   1 
ATOM   1142 O  O   . TYR A 1 148 ? 4.477   5.086   63.519  1.00 29.28 ? 148 TYR A O   1 
ATOM   1143 C  CB  . TYR A 1 148 ? 7.653   5.244   62.483  1.00 29.12 ? 148 TYR A CB  1 
ATOM   1144 C  CG  . TYR A 1 148 ? 7.083   4.412   61.348  1.00 27.27 ? 148 TYR A CG  1 
ATOM   1145 C  CD1 . TYR A 1 148 ? 7.231   3.032   61.328  1.00 27.81 ? 148 TYR A CD1 1 
ATOM   1146 C  CD2 . TYR A 1 148 ? 6.390   5.011   60.311  1.00 25.60 ? 148 TYR A CD2 1 
ATOM   1147 C  CE1 . TYR A 1 148 ? 6.698   2.273   60.309  1.00 28.36 ? 148 TYR A CE1 1 
ATOM   1148 C  CE2 . TYR A 1 148 ? 5.863   4.261   59.279  1.00 31.35 ? 148 TYR A CE2 1 
ATOM   1149 C  CZ  . TYR A 1 148 ? 6.015   2.891   59.284  1.00 32.75 ? 148 TYR A CZ  1 
ATOM   1150 O  OH  . TYR A 1 148 ? 5.483   2.148   58.241  1.00 31.52 ? 148 TYR A OH  1 
ATOM   1151 N  N   . ARG A 1 149 ? 5.412   7.122   63.740  1.00 33.87 ? 149 ARG A N   1 
ATOM   1152 C  CA  . ARG A 1 149 ? 4.154   7.833   63.581  1.00 28.15 ? 149 ARG A CA  1 
ATOM   1153 C  C   . ARG A 1 149 ? 3.630   7.667   62.157  1.00 35.58 ? 149 ARG A C   1 
ATOM   1154 O  O   . ARG A 1 149 ? 4.388   7.743   61.190  1.00 27.96 ? 149 ARG A O   1 
ATOM   1155 C  CB  . ARG A 1 149 ? 4.330   9.317   63.922  1.00 27.88 ? 149 ARG A CB  1 
ATOM   1156 C  CG  . ARG A 1 149 ? 4.318   9.625   65.421  1.00 30.54 ? 149 ARG A CG  1 
ATOM   1157 C  CD  . ARG A 1 149 ? 4.780   11.055  65.692  1.00 31.38 ? 149 ARG A CD  1 
ATOM   1158 N  NE  . ARG A 1 149 ? 6.230   11.205  65.534  1.00 28.40 ? 149 ARG A NE  1 
ATOM   1159 C  CZ  . ARG A 1 149 ? 6.866   12.370  65.551  1.00 29.68 ? 149 ARG A CZ  1 
ATOM   1160 N  NH1 . ARG A 1 149 ? 6.189   13.501  65.706  1.00 29.64 ? 149 ARG A NH1 1 
ATOM   1161 N  NH2 . ARG A 1 149 ? 8.185   12.406  65.404  1.00 32.96 ? 149 ARG A NH2 1 
ATOM   1162 N  N   . VAL A 1 150 ? 2.322   7.449   62.041  1.00 33.73 ? 150 VAL A N   1 
ATOM   1163 C  CA  . VAL A 1 150 ? 1.679   7.318   60.751  1.00 31.67 ? 150 VAL A CA  1 
ATOM   1164 C  C   . VAL A 1 150 ? 0.616   8.400   60.575  1.00 33.20 ? 150 VAL A C   1 
ATOM   1165 O  O   . VAL A 1 150 ? 0.320   9.149   61.517  1.00 31.41 ? 150 VAL A O   1 
ATOM   1166 C  CB  . VAL A 1 150 ? 1.049   5.940   60.605  1.00 33.87 ? 150 VAL A CB  1 
ATOM   1167 C  CG1 . VAL A 1 150 ? 2.144   4.873   60.597  1.00 32.64 ? 150 VAL A CG1 1 
ATOM   1168 C  CG2 . VAL A 1 150 ? 0.068   5.701   61.751  1.00 29.59 ? 150 VAL A CG2 1 
ATOM   1169 N  N   . GLY A 1 151 ? 0.040   8.470   59.377  1.00 28.91 ? 151 GLY A N   1 
ATOM   1170 C  CA  . GLY A 1 151 ? -0.978  9.459   59.076  1.00 29.38 ? 151 GLY A CA  1 
ATOM   1171 C  C   . GLY A 1 151 ? -0.452  10.871  59.249  1.00 30.28 ? 151 GLY A C   1 
ATOM   1172 O  O   . GLY A 1 151 ? 0.746   11.116  59.103  1.00 30.12 ? 151 GLY A O   1 
ATOM   1173 N  N   . ALA A 1 152 ? -1.336  11.805  59.582  1.00 27.85 ? 152 ALA A N   1 
ATOM   1174 C  CA  . ALA A 1 152 ? -0.929  13.194  59.764  1.00 28.93 ? 152 ALA A CA  1 
ATOM   1175 C  C   . ALA A 1 152 ? 0.141   13.346  60.876  1.00 32.00 ? 152 ALA A C   1 
ATOM   1176 O  O   . ALA A 1 152 ? 0.997   14.233  60.820  1.00 31.27 ? 152 ALA A O   1 
ATOM   1177 C  CB  . ALA A 1 152 ? -2.147  14.059  60.076  1.00 28.17 ? 152 ALA A CB  1 
ATOM   1178 N  N   . PHE A 1 153 ? 0.087   12.473  61.872  1.00 28.80 ? 153 PHE A N   1 
ATOM   1179 C  CA  . PHE A 1 153 ? 0.996   12.568  63.011  1.00 31.42 ? 153 PHE A CA  1 
ATOM   1180 C  C   . PHE A 1 153 ? 2.447   12.360  62.570  1.00 33.26 ? 153 PHE A C   1 
ATOM   1181 O  O   . PHE A 1 153 ? 3.378   12.915  63.163  1.00 31.27 ? 153 PHE A O   1 
ATOM   1182 C  CB  . PHE A 1 153 ? 0.605   11.546  64.075  1.00 27.87 ? 153 PHE A CB  1 
ATOM   1183 C  CG  . PHE A 1 153 ? -0.862  11.574  64.421  1.00 36.23 ? 153 PHE A CG  1 
ATOM   1184 C  CD1 . PHE A 1 153 ? -1.348  12.467  65.363  1.00 33.47 ? 153 PHE A CD1 1 
ATOM   1185 C  CD2 . PHE A 1 153 ? -1.756  10.723  63.786  1.00 33.13 ? 153 PHE A CD2 1 
ATOM   1186 C  CE1 . PHE A 1 153 ? -2.710  12.501  65.685  1.00 38.37 ? 153 PHE A CE1 1 
ATOM   1187 C  CE2 . PHE A 1 153 ? -3.114  10.750  64.106  1.00 38.15 ? 153 PHE A CE2 1 
ATOM   1188 C  CZ  . PHE A 1 153 ? -3.593  11.641  65.053  1.00 35.20 ? 153 PHE A CZ  1 
ATOM   1189 N  N   . GLY A 1 154 ? 2.626   11.568  61.517  1.00 32.30 ? 154 GLY A N   1 
ATOM   1190 C  CA  . GLY A 1 154 ? 3.952   11.250  61.021  1.00 29.53 ? 154 GLY A CA  1 
ATOM   1191 C  C   . GLY A 1 154 ? 4.340   11.997  59.761  1.00 30.31 ? 154 GLY A C   1 
ATOM   1192 O  O   . GLY A 1 154 ? 5.527   12.133  59.462  1.00 29.12 ? 154 GLY A O   1 
ATOM   1193 N  N   . PHE A 1 155 ? 3.363   12.495  59.009  1.00 29.17 ? 155 PHE A N   1 
ATOM   1194 C  CA  . PHE A 1 155 ? 3.717   12.954  57.675  1.00 31.81 ? 155 PHE A CA  1 
ATOM   1195 C  C   . PHE A 1 155 ? 3.050   14.231  57.196  1.00 32.83 ? 155 PHE A C   1 
ATOM   1196 O  O   . PHE A 1 155 ? 3.262   14.642  56.052  1.00 30.61 ? 155 PHE A O   1 
ATOM   1197 C  CB  . PHE A 1 155 ? 3.473   11.802  56.699  1.00 27.49 ? 155 PHE A CB  1 
ATOM   1198 C  CG  . PHE A 1 155 ? 4.369   10.635  56.975  1.00 27.45 ? 155 PHE A CG  1 
ATOM   1199 C  CD1 . PHE A 1 155 ? 5.717   10.691  56.625  1.00 28.11 ? 155 PHE A CD1 1 
ATOM   1200 C  CD2 . PHE A 1 155 ? 3.904   9.529   57.660  1.00 29.25 ? 155 PHE A CD2 1 
ATOM   1201 C  CE1 . PHE A 1 155 ? 6.570   9.646   56.907  1.00 25.63 ? 155 PHE A CE1 1 
ATOM   1202 C  CE2 . PHE A 1 155 ? 4.754   8.468   57.947  1.00 30.36 ? 155 PHE A CE2 1 
ATOM   1203 C  CZ  . PHE A 1 155 ? 6.100   8.534   57.567  1.00 27.12 ? 155 PHE A CZ  1 
ATOM   1204 N  N   . LEU A 1 156 ? 2.293   14.873  58.081  1.00 30.57 ? 156 LEU A N   1 
ATOM   1205 C  CA  . LEU A 1 156 ? 1.833   16.230  57.832  1.00 31.07 ? 156 LEU A CA  1 
ATOM   1206 C  C   . LEU A 1 156 ? 3.019   17.093  57.449  1.00 34.21 ? 156 LEU A C   1 
ATOM   1207 O  O   . LEU A 1 156 ? 3.936   17.279  58.236  1.00 33.73 ? 156 LEU A O   1 
ATOM   1208 C  CB  . LEU A 1 156 ? 1.143   16.814  59.065  1.00 36.44 ? 156 LEU A CB  1 
ATOM   1209 C  CG  . LEU A 1 156 ? 0.483   18.180  58.854  1.00 34.78 ? 156 LEU A CG  1 
ATOM   1210 C  CD1 . LEU A 1 156 ? -0.913  17.981  58.327  1.00 35.17 ? 156 LEU A CD1 1 
ATOM   1211 C  CD2 . LEU A 1 156 ? 0.452   18.985  60.142  1.00 38.25 ? 156 LEU A CD2 1 
ATOM   1212 N  N   . ALA A 1 157 ? 3.018   17.606  56.225  1.00 38.29 ? 157 ALA A N   1 
ATOM   1213 C  CA  . ALA A 1 157 ? 4.168   18.353  55.742  1.00 37.56 ? 157 ALA A CA  1 
ATOM   1214 C  C   . ALA A 1 157 ? 3.803   19.785  55.391  1.00 39.44 ? 157 ALA A C   1 
ATOM   1215 O  O   . ALA A 1 157 ? 3.017   20.033  54.482  1.00 39.90 ? 157 ALA A O   1 
ATOM   1216 C  CB  . ALA A 1 157 ? 4.787   17.652  54.544  1.00 35.92 ? 157 ALA A CB  1 
ATOM   1217 N  N   . LEU A 1 158 ? 4.382   20.715  56.142  1.00 41.06 ? 158 LEU A N   1 
ATOM   1218 C  CA  . LEU A 1 158 ? 4.295   22.137  55.854  1.00 40.98 ? 158 LEU A CA  1 
ATOM   1219 C  C   . LEU A 1 158 ? 5.723   22.624  55.671  1.00 42.11 ? 158 LEU A C   1 
ATOM   1220 O  O   . LEU A 1 158 ? 6.291   23.249  56.563  1.00 40.50 ? 158 LEU A O   1 
ATOM   1221 C  CB  . LEU A 1 158 ? 3.582   22.897  56.981  1.00 38.22 ? 158 LEU A CB  1 
ATOM   1222 C  CG  . LEU A 1 158 ? 2.064   22.697  57.062  1.00 41.76 ? 158 LEU A CG  1 
ATOM   1223 C  CD1 . LEU A 1 158 ? 1.467   23.253  58.358  1.00 38.13 ? 158 LEU A CD1 1 
ATOM   1224 C  CD2 . LEU A 1 158 ? 1.397   23.343  55.861  1.00 40.21 ? 158 LEU A CD2 1 
ATOM   1225 N  N   . HIS A 1 159 ? 6.302   22.297  54.515  1.00 42.41 ? 159 HIS A N   1 
ATOM   1226 C  CA  . HIS A 1 159 ? 7.708   22.559  54.240  1.00 43.30 ? 159 HIS A CA  1 
ATOM   1227 C  C   . HIS A 1 159 ? 8.084   24.011  54.495  1.00 44.16 ? 159 HIS A C   1 
ATOM   1228 O  O   . HIS A 1 159 ? 7.416   24.924  54.013  1.00 44.52 ? 159 HIS A O   1 
ATOM   1229 C  CB  . HIS A 1 159 ? 8.044   22.194  52.797  1.00 42.12 ? 159 HIS A CB  1 
ATOM   1230 C  CG  . HIS A 1 159 ? 9.498   22.314  52.477  1.00 45.20 ? 159 HIS A CG  1 
ATOM   1231 N  ND1 . HIS A 1 159 ? 10.462  21.575  53.131  1.00 46.40 ? 159 HIS A ND1 1 
ATOM   1232 C  CD2 . HIS A 1 159 ? 10.157  23.087  51.582  1.00 43.50 ? 159 HIS A CD2 1 
ATOM   1233 C  CE1 . HIS A 1 159 ? 11.652  21.883  52.646  1.00 44.73 ? 159 HIS A CE1 1 
ATOM   1234 N  NE2 . HIS A 1 159 ? 11.495  22.801  51.709  1.00 45.48 ? 159 HIS A NE2 1 
ATOM   1235 N  N   . GLY A 1 160 ? 9.167   24.211  55.239  1.00 41.99 ? 160 GLY A N   1 
ATOM   1236 C  CA  . GLY A 1 160 ? 9.600   25.539  55.638  1.00 43.51 ? 160 GLY A CA  1 
ATOM   1237 C  C   . GLY A 1 160 ? 9.392   25.761  57.129  1.00 45.03 ? 160 GLY A C   1 
ATOM   1238 O  O   . GLY A 1 160 ? 10.104  26.524  57.767  1.00 50.44 ? 160 GLY A O   1 
ATOM   1239 N  N   . SER A 1 161 ? 8.391   25.090  57.680  1.00 43.69 ? 161 SER A N   1 
ATOM   1240 C  CA  . SER A 1 161 ? 8.095   25.164  59.096  1.00 41.21 ? 161 SER A CA  1 
ATOM   1241 C  C   . SER A 1 161 ? 8.986   24.177  59.835  1.00 46.06 ? 161 SER A C   1 
ATOM   1242 O  O   . SER A 1 161 ? 9.231   23.072  59.353  1.00 46.03 ? 161 SER A O   1 
ATOM   1243 C  CB  . SER A 1 161 ? 6.622   24.859  59.354  1.00 36.95 ? 161 SER A CB  1 
ATOM   1244 O  OG  . SER A 1 161 ? 6.369   24.744  60.735  1.00 46.27 ? 161 SER A OG  1 
ATOM   1245 N  N   . GLN A 1 162 ? 9.490   24.566  60.996  1.00 41.78 ? 162 GLN A N   1 
ATOM   1246 C  CA  . GLN A 1 162 ? 10.263  23.621  61.781  1.00 45.18 ? 162 GLN A CA  1 
ATOM   1247 C  C   . GLN A 1 162 ? 9.342   22.894  62.740  1.00 43.66 ? 162 GLN A C   1 
ATOM   1248 O  O   . GLN A 1 162 ? 9.749   21.948  63.407  1.00 48.28 ? 162 GLN A O   1 
ATOM   1249 C  CB  . GLN A 1 162 ? 11.399  24.318  62.536  1.00 45.97 ? 162 GLN A CB  1 
ATOM   1250 C  CG  . GLN A 1 162 ? 12.521  24.832  61.622  1.00 52.35 ? 162 GLN A CG  1 
ATOM   1251 C  CD  . GLN A 1 162 ? 12.988  23.798  60.588  1.00 56.95 ? 162 GLN A CD  1 
ATOM   1252 O  OE1 . GLN A 1 162 ? 13.099  22.603  60.885  1.00 57.60 ? 162 GLN A OE1 1 
ATOM   1253 N  NE2 . GLN A 1 162 ? 13.259  24.261  59.364  1.00 54.87 ? 162 GLN A NE2 1 
ATOM   1254 N  N   . GLU A 1 163 ? 8.090   23.334  62.795  1.00 43.21 ? 163 GLU A N   1 
ATOM   1255 C  CA  . GLU A 1 163 ? 7.132   22.762  63.735  1.00 41.86 ? 163 GLU A CA  1 
ATOM   1256 C  C   . GLU A 1 163 ? 6.412   21.569  63.117  1.00 43.18 ? 163 GLU A C   1 
ATOM   1257 O  O   . GLU A 1 163 ? 6.075   20.611  63.814  1.00 38.10 ? 163 GLU A O   1 
ATOM   1258 C  CB  . GLU A 1 163 ? 6.137   23.827  64.193  1.00 40.21 ? 163 GLU A CB  1 
ATOM   1259 C  CG  . GLU A 1 163 ? 6.788   24.879  65.074  1.00 41.87 ? 163 GLU A CG  1 
ATOM   1260 C  CD  . GLU A 1 163 ? 7.406   24.266  66.322  1.00 46.41 ? 163 GLU A CD  1 
ATOM   1261 O  OE1 . GLU A 1 163 ? 6.808   23.312  66.871  1.00 45.68 ? 163 GLU A OE1 1 
ATOM   1262 O  OE2 . GLU A 1 163 ? 8.491   24.726  66.747  1.00 45.70 ? 163 GLU A OE2 1 
ATOM   1263 N  N   . ALA A 1 164 ? 6.207   21.620  61.801  1.00 38.50 ? 164 ALA A N   1 
ATOM   1264 C  CA  . ALA A 1 164 ? 5.672   20.478  61.066  1.00 37.07 ? 164 ALA A CA  1 
ATOM   1265 C  C   . ALA A 1 164 ? 6.364   20.373  59.711  1.00 39.43 ? 164 ALA A C   1 
ATOM   1266 O  O   . ALA A 1 164 ? 5.778   20.718  58.684  1.00 39.80 ? 164 ALA A O   1 
ATOM   1267 C  CB  . ALA A 1 164 ? 4.176   20.605  60.895  1.00 34.13 ? 164 ALA A CB  1 
ATOM   1268 N  N   . PRO A 1 165 ? 7.625   19.907  59.716  1.00 42.28 ? 165 PRO A N   1 
ATOM   1269 C  CA  . PRO A 1 165 ? 8.520   19.837  58.548  1.00 39.64 ? 165 PRO A CA  1 
ATOM   1270 C  C   . PRO A 1 165 ? 8.145   18.764  57.525  1.00 36.29 ? 165 PRO A C   1 
ATOM   1271 O  O   . PRO A 1 165 ? 8.506   18.877  56.361  1.00 39.80 ? 165 PRO A O   1 
ATOM   1272 C  CB  . PRO A 1 165 ? 9.882   19.512  59.177  1.00 38.67 ? 165 PRO A CB  1 
ATOM   1273 C  CG  . PRO A 1 165 ? 9.543   18.778  60.433  1.00 38.28 ? 165 PRO A CG  1 
ATOM   1274 C  CD  . PRO A 1 165 ? 8.292   19.440  60.949  1.00 38.28 ? 165 PRO A CD  1 
ATOM   1275 N  N   . GLY A 1 166 ? 7.431   17.733  57.958  1.00 39.04 ? 166 GLY A N   1 
ATOM   1276 C  CA  . GLY A 1 166 ? 7.202   16.565  57.127  1.00 38.07 ? 166 GLY A CA  1 
ATOM   1277 C  C   . GLY A 1 166 ? 8.219   15.473  57.440  1.00 35.68 ? 166 GLY A C   1 
ATOM   1278 O  O   . GLY A 1 166 ? 9.253   15.736  58.041  1.00 34.50 ? 166 GLY A O   1 
ATOM   1279 N  N   . ASN A 1 167 ? 7.905   14.242  57.056  1.00 32.08 ? 167 ASN A N   1 
ATOM   1280 C  CA  . ASN A 1 167 ? 8.829   13.119  57.179  1.00 30.09 ? 167 ASN A CA  1 
ATOM   1281 C  C   . ASN A 1 167 ? 9.191   12.715  58.601  1.00 31.93 ? 167 ASN A C   1 
ATOM   1282 O  O   . ASN A 1 167 ? 10.098  11.903  58.785  1.00 32.95 ? 167 ASN A O   1 
ATOM   1283 C  CB  . ASN A 1 167 ? 10.121  13.415  56.413  1.00 31.69 ? 167 ASN A CB  1 
ATOM   1284 C  CG  . ASN A 1 167 ? 9.910   13.437  54.910  1.00 35.22 ? 167 ASN A CG  1 
ATOM   1285 O  OD1 . ASN A 1 167 ? 9.021   12.760  54.389  1.00 32.22 ? 167 ASN A OD1 1 
ATOM   1286 N  ND2 . ASN A 1 167 ? 10.717  14.219  54.209  1.00 32.44 ? 167 ASN A ND2 1 
ATOM   1287 N  N   . VAL A 1 168 ? 8.481   13.216  59.611  1.00 32.13 ? 168 VAL A N   1 
ATOM   1288 C  CA  . VAL A 1 168 ? 8.928   12.921  60.968  1.00 30.86 ? 168 VAL A CA  1 
ATOM   1289 C  C   . VAL A 1 168 ? 8.744   11.436  61.268  1.00 32.24 ? 168 VAL A C   1 
ATOM   1290 O  O   . VAL A 1 168 ? 9.449   10.879  62.098  1.00 33.94 ? 168 VAL A O   1 
ATOM   1291 C  CB  . VAL A 1 168 ? 8.219   13.789  62.032  1.00 29.92 ? 168 VAL A CB  1 
ATOM   1292 C  CG1 . VAL A 1 168 ? 8.482   15.256  61.744  1.00 31.74 ? 168 VAL A CG1 1 
ATOM   1293 C  CG2 . VAL A 1 168 ? 6.706   13.486  62.124  1.00 29.90 ? 168 VAL A CG2 1 
ATOM   1294 N  N   . GLY A 1 169 ? 7.832   10.777  60.566  1.00 30.78 ? 169 GLY A N   1 
ATOM   1295 C  CA  . GLY A 1 169 ? 7.700   9.339   60.734  1.00 27.98 ? 169 GLY A CA  1 
ATOM   1296 C  C   . GLY A 1 169 ? 8.955   8.601   60.272  1.00 31.81 ? 169 GLY A C   1 
ATOM   1297 O  O   . GLY A 1 169 ? 9.339   7.575   60.835  1.00 30.69 ? 169 GLY A O   1 
ATOM   1298 N  N   . LEU A 1 170 ? 9.598   9.114   59.231  1.00 30.28 ? 170 LEU A N   1 
ATOM   1299 C  CA  . LEU A 1 170 ? 10.825  8.491   58.757  1.00 33.86 ? 170 LEU A CA  1 
ATOM   1300 C  C   . LEU A 1 170 ? 11.945  8.779   59.756  1.00 31.13 ? 170 LEU A C   1 
ATOM   1301 O  O   . LEU A 1 170 ? 12.758  7.908   60.052  1.00 32.06 ? 170 LEU A O   1 
ATOM   1302 C  CB  . LEU A 1 170 ? 11.187  8.979   57.347  1.00 28.52 ? 170 LEU A CB  1 
ATOM   1303 C  CG  . LEU A 1 170 ? 10.365  8.346   56.221  1.00 31.24 ? 170 LEU A CG  1 
ATOM   1304 C  CD1 . LEU A 1 170 ? 10.653  9.011   54.892  1.00 29.00 ? 170 LEU A CD1 1 
ATOM   1305 C  CD2 . LEU A 1 170 ? 10.645  6.854   56.122  1.00 33.29 ? 170 LEU A CD2 1 
ATOM   1306 N  N   . LEU A 1 171 ? 11.956  9.993   60.297  1.00 31.80 ? 171 LEU A N   1 
ATOM   1307 C  CA  . LEU A 1 171 ? 12.881  10.358  61.363  1.00 32.68 ? 171 LEU A CA  1 
ATOM   1308 C  C   . LEU A 1 171 ? 12.685  9.539   62.643  1.00 32.74 ? 171 LEU A C   1 
ATOM   1309 O  O   . LEU A 1 171 ? 13.658  9.270   63.344  1.00 31.75 ? 171 LEU A O   1 
ATOM   1310 C  CB  . LEU A 1 171 ? 12.758  11.849  61.675  1.00 33.08 ? 171 LEU A CB  1 
ATOM   1311 C  CG  . LEU A 1 171 ? 13.206  12.706  60.489  1.00 36.42 ? 171 LEU A CG  1 
ATOM   1312 C  CD1 . LEU A 1 171 ? 12.802  14.158  60.691  1.00 37.75 ? 171 LEU A CD1 1 
ATOM   1313 C  CD2 . LEU A 1 171 ? 14.724  12.577  60.285  1.00 33.40 ? 171 LEU A CD2 1 
ATOM   1314 N  N   . ASP A 1 172 ? 11.442  9.156   62.955  1.00 33.91 ? 172 ASP A N   1 
ATOM   1315 C  CA  . ASP A 1 172 ? 11.188  8.216   64.056  1.00 29.56 ? 172 ASP A CA  1 
ATOM   1316 C  C   . ASP A 1 172 ? 11.935  6.918   63.763  1.00 30.63 ? 172 ASP A C   1 
ATOM   1317 O  O   . ASP A 1 172 ? 12.659  6.403   64.606  1.00 33.15 ? 172 ASP A O   1 
ATOM   1318 C  CB  . ASP A 1 172 ? 9.684   7.911   64.238  1.00 29.65 ? 172 ASP A CB  1 
ATOM   1319 C  CG  . ASP A 1 172 ? 8.849   9.141   64.623  1.00 30.44 ? 172 ASP A CG  1 
ATOM   1320 O  OD1 . ASP A 1 172 ? 9.416   10.144  65.107  1.00 32.01 ? 172 ASP A OD1 1 
ATOM   1321 O  OD2 . ASP A 1 172 ? 7.605   9.098   64.449  1.00 29.38 ? 172 ASP A OD2 1 
ATOM   1322 N  N   . GLN A 1 173 ? 11.742  6.386   62.556  1.00 30.42 ? 173 GLN A N   1 
ATOM   1323 C  CA  . GLN A 1 173 ? 12.432  5.172   62.133  1.00 30.87 ? 173 GLN A CA  1 
ATOM   1324 C  C   . GLN A 1 173 ? 13.953  5.343   62.271  1.00 31.93 ? 173 GLN A C   1 
ATOM   1325 O  O   . GLN A 1 173 ? 14.629  4.473   62.814  1.00 30.56 ? 173 GLN A O   1 
ATOM   1326 C  CB  . GLN A 1 173 ? 12.075  4.808   60.676  1.00 30.69 ? 173 GLN A CB  1 
ATOM   1327 C  CG  . GLN A 1 173 ? 10.592  4.486   60.404  1.00 29.32 ? 173 GLN A CG  1 
ATOM   1328 C  CD  . GLN A 1 173 ? 10.339  4.097   58.940  1.00 32.66 ? 173 GLN A CD  1 
ATOM   1329 O  OE1 . GLN A 1 173 ? 11.277  3.795   58.197  1.00 29.55 ? 173 GLN A OE1 1 
ATOM   1330 N  NE2 . GLN A 1 173 ? 9.067   4.111   58.526  1.00 27.89 ? 173 GLN A NE2 1 
ATOM   1331 N  N   . ARG A 1 174 ? 14.484  6.458   61.765  1.00 30.87 ? 174 ARG A N   1 
ATOM   1332 C  CA  . ARG A 1 174 ? 15.912  6.737   61.861  1.00 31.43 ? 174 ARG A CA  1 
ATOM   1333 C  C   . ARG A 1 174 ? 16.370  6.752   63.325  1.00 35.30 ? 174 ARG A C   1 
ATOM   1334 O  O   . ARG A 1 174 ? 17.395  6.154   63.665  1.00 33.02 ? 174 ARG A O   1 
ATOM   1335 C  CB  . ARG A 1 174 ? 16.266  8.069   61.195  1.00 32.57 ? 174 ARG A CB  1 
ATOM   1336 C  CG  . ARG A 1 174 ? 17.747  8.452   61.369  1.00 34.74 ? 174 ARG A CG  1 
ATOM   1337 C  CD  . ARG A 1 174 ? 18.106  9.779   60.694  1.00 34.41 ? 174 ARG A CD  1 
ATOM   1338 N  NE  . ARG A 1 174 ? 17.917  9.763   59.238  1.00 34.28 ? 174 ARG A NE  1 
ATOM   1339 C  CZ  . ARG A 1 174 ? 17.897  10.857  58.482  1.00 34.06 ? 174 ARG A CZ  1 
ATOM   1340 N  NH1 . ARG A 1 174 ? 18.045  12.059  59.034  1.00 35.61 ? 174 ARG A NH1 1 
ATOM   1341 N  NH2 . ARG A 1 174 ? 17.720  10.758  57.177  1.00 33.13 ? 174 ARG A NH2 1 
ATOM   1342 N  N   . MET A 1 175 ? 15.605  7.416   64.190  1.00 32.47 ? 175 MET A N   1 
ATOM   1343 C  CA  . MET A 1 175 ? 15.959  7.475   65.608  1.00 32.43 ? 175 MET A CA  1 
ATOM   1344 C  C   . MET A 1 175 ? 15.970  6.089   66.245  1.00 32.69 ? 175 MET A C   1 
ATOM   1345 O  O   . MET A 1 175 ? 16.813  5.793   67.090  1.00 31.62 ? 175 MET A O   1 
ATOM   1346 C  CB  . MET A 1 175 ? 15.013  8.393   66.376  1.00 30.76 ? 175 MET A CB  1 
ATOM   1347 C  CG  . MET A 1 175 ? 15.450  8.592   67.837  1.00 38.20 ? 175 MET A CG  1 
ATOM   1348 S  SD  . MET A 1 175 ? 14.792  10.087  68.604  1.00 40.90 ? 175 MET A SD  1 
ATOM   1349 C  CE  . MET A 1 175 ? 15.792  11.328  67.774  1.00 34.66 ? 175 MET A CE  1 
ATOM   1350 N  N   . ALA A 1 176 ? 15.050  5.230   65.834  1.00 33.29 ? 176 ALA A N   1 
ATOM   1351 C  CA  . ALA A 1 176 ? 15.038  3.872   66.357  1.00 35.40 ? 176 ALA A CA  1 
ATOM   1352 C  C   . ALA A 1 176 ? 16.284  3.111   65.872  1.00 36.69 ? 176 ALA A C   1 
ATOM   1353 O  O   . ALA A 1 176 ? 16.888  2.341   66.637  1.00 36.12 ? 176 ALA A O   1 
ATOM   1354 C  CB  . ALA A 1 176 ? 13.742  3.143   65.959  1.00 29.78 ? 176 ALA A CB  1 
ATOM   1355 N  N   . LEU A 1 177 ? 16.681  3.344   64.617  1.00 31.70 ? 177 LEU A N   1 
ATOM   1356 C  CA  . LEU A 1 177 ? 17.888  2.717   64.058  1.00 32.69 ? 177 LEU A CA  1 
ATOM   1357 C  C   . LEU A 1 177 ? 19.138  3.179   64.797  1.00 33.77 ? 177 LEU A C   1 
ATOM   1358 O  O   . LEU A 1 177 ? 19.997  2.383   65.144  1.00 31.67 ? 177 LEU A O   1 
ATOM   1359 C  CB  . LEU A 1 177 ? 18.036  3.030   62.558  1.00 29.64 ? 177 LEU A CB  1 
ATOM   1360 C  CG  . LEU A 1 177 ? 16.960  2.423   61.652  1.00 30.26 ? 177 LEU A CG  1 
ATOM   1361 C  CD1 . LEU A 1 177 ? 17.161  2.830   60.197  1.00 32.09 ? 177 LEU A CD1 1 
ATOM   1362 C  CD2 . LEU A 1 177 ? 16.915  0.904   61.812  1.00 28.29 ? 177 LEU A CD2 1 
ATOM   1363 N  N   . GLN A 1 178 ? 19.224  4.486   64.997  1.00 31.64 ? 178 GLN A N   1 
ATOM   1364 C  CA  . GLN A 1 178 ? 20.284  5.088   65.756  1.00 33.69 ? 178 GLN A CA  1 
ATOM   1365 C  C   . GLN A 1 178 ? 20.356  4.484   67.157  1.00 37.20 ? 178 GLN A C   1 
ATOM   1366 O  O   . GLN A 1 178 ? 21.439  4.273   67.694  1.00 35.32 ? 178 GLN A O   1 
ATOM   1367 C  CB  . GLN A 1 178 ? 20.085  6.600   65.849  1.00 33.64 ? 178 GLN A CB  1 
ATOM   1368 C  CG  . GLN A 1 178 ? 21.137  7.264   66.744  1.00 33.21 ? 178 GLN A CG  1 
ATOM   1369 C  CD  . GLN A 1 178 ? 22.480  7.376   66.043  1.00 34.49 ? 178 GLN A CD  1 
ATOM   1370 O  OE1 . GLN A 1 178 ? 22.551  7.850   64.912  1.00 32.68 ? 178 GLN A OE1 1 
ATOM   1371 N  NE2 . GLN A 1 178 ? 23.546  6.930   66.708  1.00 31.57 ? 178 GLN A NE2 1 
ATOM   1372 N  N   . TRP A 1 179 ? 19.194  4.203   67.741  1.00 35.38 ? 179 TRP A N   1 
ATOM   1373 C  CA  . TRP A 1 179 ? 19.153  3.574   69.047  1.00 35.21 ? 179 TRP A CA  1 
ATOM   1374 C  C   . TRP A 1 179 ? 19.736  2.154   68.995  1.00 36.79 ? 179 TRP A C   1 
ATOM   1375 O  O   . TRP A 1 179 ? 20.473  1.746   69.900  1.00 35.23 ? 179 TRP A O   1 
ATOM   1376 C  CB  . TRP A 1 179 ? 17.724  3.550   69.581  1.00 34.86 ? 179 TRP A CB  1 
ATOM   1377 C  CG  . TRP A 1 179 ? 17.636  3.106   71.001  1.00 31.66 ? 179 TRP A CG  1 
ATOM   1378 C  CD1 . TRP A 1 179 ? 17.524  3.904   72.101  1.00 31.82 ? 179 TRP A CD1 1 
ATOM   1379 C  CD2 . TRP A 1 179 ? 17.645  1.756   71.483  1.00 32.63 ? 179 TRP A CD2 1 
ATOM   1380 N  NE1 . TRP A 1 179 ? 17.468  3.134   73.237  1.00 31.77 ? 179 TRP A NE1 1 
ATOM   1381 C  CE2 . TRP A 1 179 ? 17.540  1.813   72.884  1.00 31.68 ? 179 TRP A CE2 1 
ATOM   1382 C  CE3 . TRP A 1 179 ? 17.731  0.507   70.867  1.00 33.09 ? 179 TRP A CE3 1 
ATOM   1383 C  CZ2 . TRP A 1 179 ? 17.521  0.672   73.675  1.00 37.34 ? 179 TRP A CZ2 1 
ATOM   1384 C  CZ3 . TRP A 1 179 ? 17.709  -0.626  71.657  1.00 31.80 ? 179 TRP A CZ3 1 
ATOM   1385 C  CH2 . TRP A 1 179 ? 17.611  -0.536  73.042  1.00 34.55 ? 179 TRP A CH2 1 
ATOM   1386 N  N   . VAL A 1 180 ? 19.386  1.402   67.951  1.00 32.52 ? 180 VAL A N   1 
ATOM   1387 C  CA  . VAL A 1 180 ? 19.893  0.041   67.763  1.00 29.70 ? 180 VAL A CA  1 
ATOM   1388 C  C   . VAL A 1 180 ? 21.425  0.066   67.617  1.00 35.87 ? 180 VAL A C   1 
ATOM   1389 O  O   . VAL A 1 180 ? 22.136  -0.732  68.228  1.00 32.30 ? 180 VAL A O   1 
ATOM   1390 C  CB  . VAL A 1 180 ? 19.249  -0.641  66.522  1.00 35.61 ? 180 VAL A CB  1 
ATOM   1391 C  CG1 . VAL A 1 180 ? 20.074  -1.829  66.053  1.00 35.61 ? 180 VAL A CG1 1 
ATOM   1392 C  CG2 . VAL A 1 180 ? 17.813  -1.074  66.826  1.00 36.59 ? 180 VAL A CG2 1 
ATOM   1393 N  N   . HIS A 1 181 ? 21.906  0.990   66.789  1.00 35.60 ? 181 HIS A N   1 
ATOM   1394 C  CA  . HIS A 1 181 ? 23.324  1.257   66.605  1.00 35.14 ? 181 HIS A CA  1 
ATOM   1395 C  C   . HIS A 1 181 ? 24.074  1.434   67.926  1.00 35.86 ? 181 HIS A C   1 
ATOM   1396 O  O   . HIS A 1 181 ? 25.206  0.982   68.084  1.00 35.44 ? 181 HIS A O   1 
ATOM   1397 C  CB  . HIS A 1 181 ? 23.496  2.513   65.755  1.00 32.88 ? 181 HIS A CB  1 
ATOM   1398 C  CG  . HIS A 1 181 ? 24.921  2.906   65.542  1.00 40.76 ? 181 HIS A CG  1 
ATOM   1399 N  ND1 . HIS A 1 181 ? 25.720  2.311   64.588  1.00 39.28 ? 181 HIS A ND1 1 
ATOM   1400 C  CD2 . HIS A 1 181 ? 25.695  3.828   66.163  1.00 40.47 ? 181 HIS A CD2 1 
ATOM   1401 C  CE1 . HIS A 1 181 ? 26.922  2.856   64.627  1.00 40.81 ? 181 HIS A CE1 1 
ATOM   1402 N  NE2 . HIS A 1 181 ? 26.934  3.781   65.570  1.00 42.10 ? 181 HIS A NE2 1 
ATOM   1403 N  N   . ASP A 1 182 ? 23.416  2.089   68.874  1.00 37.39 ? 182 ASP A N   1 
ATOM   1404 C  CA  . ASP A 1 182 ? 24.047  2.517   70.113  1.00 33.26 ? 182 ASP A CA  1 
ATOM   1405 C  C   . ASP A 1 182 ? 23.926  1.501   71.242  1.00 38.35 ? 182 ASP A C   1 
ATOM   1406 O  O   . ASP A 1 182 ? 24.751  1.495   72.173  1.00 38.20 ? 182 ASP A O   1 
ATOM   1407 C  CB  . ASP A 1 182 ? 23.437  3.843   70.569  1.00 34.15 ? 182 ASP A CB  1 
ATOM   1408 C  CG  . ASP A 1 182 ? 23.920  5.010   69.754  1.00 33.82 ? 182 ASP A CG  1 
ATOM   1409 O  OD1 . ASP A 1 182 ? 24.933  4.845   69.055  1.00 37.24 ? 182 ASP A OD1 1 
ATOM   1410 O  OD2 . ASP A 1 182 ? 23.302  6.095   69.821  1.00 34.32 ? 182 ASP A OD2 1 
ATOM   1411 N  N   . ASN A 1 183 ? 22.901  0.655   71.180  1.00 33.18 ? 183 ASN A N   1 
ATOM   1412 C  CA  . ASN A 1 183 ? 22.582  -0.213  72.316  1.00 36.21 ? 183 ASN A CA  1 
ATOM   1413 C  C   . ASN A 1 183 ? 22.513  -1.703  72.018  1.00 35.97 ? 183 ASN A C   1 
ATOM   1414 O  O   . ASN A 1 183 ? 22.530  -2.511  72.943  1.00 39.18 ? 183 ASN A O   1 
ATOM   1415 C  CB  . ASN A 1 183 ? 21.248  0.203   72.938  1.00 32.23 ? 183 ASN A CB  1 
ATOM   1416 C  CG  . ASN A 1 183 ? 21.273  1.612   73.477  1.00 36.36 ? 183 ASN A CG  1 
ATOM   1417 O  OD1 . ASN A 1 183 ? 21.608  1.826   74.637  1.00 40.11 ? 183 ASN A OD1 1 
ATOM   1418 N  ND2 . ASN A 1 183 ? 20.920  2.585   72.640  1.00 33.69 ? 183 ASN A ND2 1 
ATOM   1419 N  N   . ILE A 1 184 ? 22.424  -2.077  70.745  1.00 32.89 ? 184 ILE A N   1 
ATOM   1420 C  CA  . ILE A 1 184 ? 22.113  -3.465  70.423  1.00 35.72 ? 184 ILE A CA  1 
ATOM   1421 C  C   . ILE A 1 184 ? 23.255  -4.389  70.833  1.00 37.06 ? 184 ILE A C   1 
ATOM   1422 O  O   . ILE A 1 184 ? 23.023  -5.568  71.101  1.00 34.41 ? 184 ILE A O   1 
ATOM   1423 C  CB  . ILE A 1 184 ? 21.774  -3.670  68.908  1.00 33.39 ? 184 ILE A CB  1 
ATOM   1424 C  CG1 . ILE A 1 184 ? 21.000  -4.986  68.711  1.00 34.83 ? 184 ILE A CG1 1 
ATOM   1425 C  CG2 . ILE A 1 184 ? 23.030  -3.639  68.020  1.00 33.48 ? 184 ILE A CG2 1 
ATOM   1426 C  CD1 . ILE A 1 184 ? 19.553  -4.955  69.220  1.00 36.89 ? 184 ILE A CD1 1 
ATOM   1427 N  N   . GLN A 1 185 ? 24.477  -3.853  70.889  1.00 36.66 ? 185 GLN A N   1 
ATOM   1428 C  CA  . GLN A 1 185 ? 25.627  -4.612  71.396  1.00 41.78 ? 185 GLN A CA  1 
ATOM   1429 C  C   . GLN A 1 185 ? 25.347  -5.197  72.771  1.00 40.20 ? 185 GLN A C   1 
ATOM   1430 O  O   . GLN A 1 185 ? 25.815  -6.289  73.083  1.00 41.38 ? 185 GLN A O   1 
ATOM   1431 C  CB  . GLN A 1 185 ? 26.893  -3.742  71.468  1.00 38.56 ? 185 GLN A CB  1 
ATOM   1432 C  CG  . GLN A 1 185 ? 26.813  -2.576  72.429  1.00 32.92 ? 185 GLN A CG  1 
ATOM   1433 C  CD  . GLN A 1 185 ? 27.852  -1.507  72.134  1.00 44.08 ? 185 GLN A CD  1 
ATOM   1434 O  OE1 . GLN A 1 185 ? 27.834  -0.874  71.068  1.00 38.41 ? 185 GLN A OE1 1 
ATOM   1435 N  NE2 . GLN A 1 185 ? 28.778  -1.306  73.076  1.00 42.86 ? 185 GLN A NE2 1 
ATOM   1436 N  N   . PHE A 1 186 ? 24.574  -4.476  73.584  1.00 39.75 ? 186 PHE A N   1 
ATOM   1437 C  CA  . PHE A 1 186 ? 24.309  -4.885  74.963  1.00 40.02 ? 186 PHE A CA  1 
ATOM   1438 C  C   . PHE A 1 186 ? 23.323  -6.043  75.002  1.00 44.08 ? 186 PHE A C   1 
ATOM   1439 O  O   . PHE A 1 186 ? 23.109  -6.663  76.049  1.00 41.47 ? 186 PHE A O   1 
ATOM   1440 C  CB  . PHE A 1 186 ? 23.769  -3.710  75.778  1.00 38.75 ? 186 PHE A CB  1 
ATOM   1441 C  CG  . PHE A 1 186 ? 24.651  -2.494  75.746  1.00 41.05 ? 186 PHE A CG  1 
ATOM   1442 C  CD1 . PHE A 1 186 ? 25.996  -2.582  76.077  1.00 39.54 ? 186 PHE A CD1 1 
ATOM   1443 C  CD2 . PHE A 1 186 ? 24.137  -1.264  75.386  1.00 39.47 ? 186 PHE A CD2 1 
ATOM   1444 C  CE1 . PHE A 1 186 ? 26.806  -1.464  76.049  1.00 37.74 ? 186 PHE A CE1 1 
ATOM   1445 C  CE2 . PHE A 1 186 ? 24.947  -0.140  75.353  1.00 42.70 ? 186 PHE A CE2 1 
ATOM   1446 C  CZ  . PHE A 1 186 ? 26.286  -0.243  75.681  1.00 38.37 ? 186 PHE A CZ  1 
ATOM   1447 N  N   . PHE A 1 187 ? 22.713  -6.321  73.853  1.00 40.90 ? 187 PHE A N   1 
ATOM   1448 C  CA  . PHE A 1 187 ? 21.722  -7.386  73.741  1.00 43.85 ? 187 PHE A CA  1 
ATOM   1449 C  C   . PHE A 1 187 ? 22.301  -8.588  73.001  1.00 44.99 ? 187 PHE A C   1 
ATOM   1450 O  O   . PHE A 1 187 ? 21.635  -9.614  72.838  1.00 48.11 ? 187 PHE A O   1 
ATOM   1451 C  CB  . PHE A 1 187 ? 20.460  -6.873  73.037  1.00 44.29 ? 187 PHE A CB  1 
ATOM   1452 C  CG  . PHE A 1 187 ? 19.696  -5.867  73.844  1.00 39.92 ? 187 PHE A CG  1 
ATOM   1453 C  CD1 . PHE A 1 187 ? 18.741  -6.280  74.756  1.00 40.41 ? 187 PHE A CD1 1 
ATOM   1454 C  CD2 . PHE A 1 187 ? 19.958  -4.512  73.717  1.00 37.80 ? 187 PHE A CD2 1 
ATOM   1455 C  CE1 . PHE A 1 187 ? 18.046  -5.365  75.515  1.00 37.31 ? 187 PHE A CE1 1 
ATOM   1456 C  CE2 . PHE A 1 187 ? 19.262  -3.585  74.473  1.00 36.08 ? 187 PHE A CE2 1 
ATOM   1457 C  CZ  . PHE A 1 187 ? 18.307  -4.014  75.374  1.00 37.50 ? 187 PHE A CZ  1 
ATOM   1458 N  N   . GLY A 1 188 ? 23.551  -8.458  72.570  1.00 43.04 ? 188 GLY A N   1 
ATOM   1459 C  CA  . GLY A 1 188 ? 24.239  -9.531  71.874  1.00 44.10 ? 188 GLY A CA  1 
ATOM   1460 C  C   . GLY A 1 188 ? 24.257  -9.318  70.372  1.00 44.48 ? 188 GLY A C   1 
ATOM   1461 O  O   . GLY A 1 188 ? 24.631  -10.214 69.617  1.00 43.81 ? 188 GLY A O   1 
ATOM   1462 N  N   . GLY A 1 189 ? 23.862  -8.122  69.944  1.00 42.13 ? 189 GLY A N   1 
ATOM   1463 C  CA  . GLY A 1 189 ? 23.796  -7.799  68.531  1.00 42.06 ? 189 GLY A CA  1 
ATOM   1464 C  C   . GLY A 1 189 ? 24.996  -7.027  68.022  1.00 44.18 ? 189 GLY A C   1 
ATOM   1465 O  O   . GLY A 1 189 ? 25.537  -6.160  68.712  1.00 44.23 ? 189 GLY A O   1 
ATOM   1466 N  N   . ASP A 1 190 ? 25.420  -7.354  66.806  1.00 42.72 ? 190 ASP A N   1 
ATOM   1467 C  CA  . ASP A 1 190 ? 26.491  -6.637  66.137  1.00 41.10 ? 190 ASP A CA  1 
ATOM   1468 C  C   . ASP A 1 190 ? 25.943  -5.408  65.412  1.00 43.09 ? 190 ASP A C   1 
ATOM   1469 O  O   . ASP A 1 190 ? 25.253  -5.533  64.405  1.00 45.22 ? 190 ASP A O   1 
ATOM   1470 C  CB  . ASP A 1 190 ? 27.205  -7.566  65.155  1.00 43.66 ? 190 ASP A CB  1 
ATOM   1471 C  CG  . ASP A 1 190 ? 28.317  -6.877  64.396  1.00 45.16 ? 190 ASP A CG  1 
ATOM   1472 O  OD1 . ASP A 1 190 ? 28.665  -5.726  64.738  1.00 46.03 ? 190 ASP A OD1 1 
ATOM   1473 O  OD2 . ASP A 1 190 ? 28.857  -7.498  63.459  1.00 46.77 ? 190 ASP A OD2 1 
ATOM   1474 N  N   . PRO A 1 191 ? 26.261  -4.211  65.920  1.00 42.60 ? 191 PRO A N   1 
ATOM   1475 C  CA  . PRO A 1 191 ? 25.791  -2.975  65.291  1.00 35.56 ? 191 PRO A CA  1 
ATOM   1476 C  C   . PRO A 1 191 ? 26.403  -2.740  63.917  1.00 40.14 ? 191 PRO A C   1 
ATOM   1477 O  O   . PRO A 1 191 ? 25.937  -1.851  63.201  1.00 39.25 ? 191 PRO A O   1 
ATOM   1478 C  CB  . PRO A 1 191 ? 26.238  -1.889  66.270  1.00 36.57 ? 191 PRO A CB  1 
ATOM   1479 C  CG  . PRO A 1 191 ? 27.398  -2.499  67.015  1.00 41.83 ? 191 PRO A CG  1 
ATOM   1480 C  CD  . PRO A 1 191 ? 27.040  -3.952  67.146  1.00 42.96 ? 191 PRO A CD  1 
ATOM   1481 N  N   . LYS A 1 192 ? 27.432  -3.506  63.564  1.00 40.31 ? 192 LYS A N   1 
ATOM   1482 C  CA  . LYS A 1 192 ? 28.034  -3.399  62.235  1.00 44.10 ? 192 LYS A CA  1 
ATOM   1483 C  C   . LYS A 1 192 ? 27.370  -4.346  61.230  1.00 40.28 ? 192 LYS A C   1 
ATOM   1484 O  O   . LYS A 1 192 ? 27.692  -4.320  60.043  1.00 45.55 ? 192 LYS A O   1 
ATOM   1485 C  CB  . LYS A 1 192 ? 29.540  -3.682  62.294  1.00 43.93 ? 192 LYS A CB  1 
ATOM   1486 C  CG  . LYS A 1 192 ? 30.307  -2.773  63.248  1.00 45.30 ? 192 LYS A CG  1 
ATOM   1487 C  CD  . LYS A 1 192 ? 31.760  -3.212  63.414  1.00 43.87 ? 192 LYS A CD  1 
ATOM   1488 C  CE  . LYS A 1 192 ? 32.709  -2.311  62.643  1.00 43.52 ? 192 LYS A CE  1 
ATOM   1489 N  NZ  . LYS A 1 192 ? 32.527  -2.398  61.174  1.00 49.86 ? 192 LYS A NZ  1 
ATOM   1490 N  N   . THR A 1 193 ? 26.455  -5.188  61.698  1.00 39.19 ? 193 THR A N   1 
ATOM   1491 C  CA  . THR A 1 193 ? 25.754  -6.092  60.793  1.00 39.78 ? 193 THR A CA  1 
ATOM   1492 C  C   . THR A 1 193 ? 24.230  -6.059  61.026  1.00 37.37 ? 193 THR A C   1 
ATOM   1493 O  O   . THR A 1 193 ? 23.602  -7.061  61.398  1.00 33.87 ? 193 THR A O   1 
ATOM   1494 C  CB  . THR A 1 193 ? 26.301  -7.531  60.923  1.00 40.88 ? 193 THR A CB  1 
ATOM   1495 O  OG1 . THR A 1 193 ? 27.733  -7.493  60.854  1.00 44.56 ? 193 THR A OG1 1 
ATOM   1496 C  CG2 . THR A 1 193 ? 25.793  -8.407  59.771  1.00 42.40 ? 193 THR A CG2 1 
ATOM   1497 N  N   . VAL A 1 194 ? 23.647  -4.882  60.813  1.00 37.42 ? 194 VAL A N   1 
ATOM   1498 C  CA  . VAL A 1 194 ? 22.197  -4.708  60.930  1.00 34.19 ? 194 VAL A CA  1 
ATOM   1499 C  C   . VAL A 1 194 ? 21.541  -4.737  59.553  1.00 35.65 ? 194 VAL A C   1 
ATOM   1500 O  O   . VAL A 1 194 ? 21.964  -4.032  58.636  1.00 31.61 ? 194 VAL A O   1 
ATOM   1501 C  CB  . VAL A 1 194 ? 21.818  -3.381  61.626  1.00 34.01 ? 194 VAL A CB  1 
ATOM   1502 C  CG1 . VAL A 1 194 ? 20.292  -3.202  61.648  1.00 32.51 ? 194 VAL A CG1 1 
ATOM   1503 C  CG2 . VAL A 1 194 ? 22.375  -3.338  63.036  1.00 36.17 ? 194 VAL A CG2 1 
ATOM   1504 N  N   . THR A 1 195 ? 20.517  -5.566  59.410  1.00 36.27 ? 195 THR A N   1 
ATOM   1505 C  CA  . THR A 1 195 ? 19.699  -5.540  58.203  1.00 35.50 ? 195 THR A CA  1 
ATOM   1506 C  C   . THR A 1 195 ? 18.354  -4.920  58.542  1.00 33.16 ? 195 THR A C   1 
ATOM   1507 O  O   . THR A 1 195 ? 17.671  -5.352  59.486  1.00 32.76 ? 195 THR A O   1 
ATOM   1508 C  CB  . THR A 1 195 ? 19.498  -6.944  57.600  1.00 33.26 ? 195 THR A CB  1 
ATOM   1509 O  OG1 . THR A 1 195 ? 20.732  -7.401  57.038  1.00 32.25 ? 195 THR A OG1 1 
ATOM   1510 C  CG2 . THR A 1 195 ? 18.456  -6.906  56.504  1.00 31.92 ? 195 THR A CG2 1 
ATOM   1511 N  N   . ILE A 1 196 ? 17.994  -3.873  57.808  1.00 31.92 ? 196 ILE A N   1 
ATOM   1512 C  CA  . ILE A 1 196 ? 16.639  -3.351  57.890  1.00 31.10 ? 196 ILE A CA  1 
ATOM   1513 C  C   . ILE A 1 196 ? 15.785  -4.050  56.838  1.00 35.75 ? 196 ILE A C   1 
ATOM   1514 O  O   . ILE A 1 196 ? 16.235  -4.299  55.696  1.00 33.51 ? 196 ILE A O   1 
ATOM   1515 C  CB  . ILE A 1 196 ? 16.567  -1.820  57.692  1.00 33.35 ? 196 ILE A CB  1 
ATOM   1516 C  CG1 . ILE A 1 196 ? 17.163  -1.396  56.354  1.00 31.54 ? 196 ILE A CG1 1 
ATOM   1517 C  CG2 . ILE A 1 196 ? 17.252  -1.089  58.835  1.00 31.24 ? 196 ILE A CG2 1 
ATOM   1518 C  CD1 . ILE A 1 196 ? 16.961  0.087   56.045  1.00 32.17 ? 196 ILE A CD1 1 
ATOM   1519 N  N   . PHE A 1 197 ? 14.570  -4.401  57.229  1.00 32.00 ? 197 PHE A N   1 
ATOM   1520 C  CA  . PHE A 1 197 ? 13.660  -5.020  56.297  1.00 31.99 ? 197 PHE A CA  1 
ATOM   1521 C  C   . PHE A 1 197 ? 12.213  -4.690  56.654  1.00 33.04 ? 197 PHE A C   1 
ATOM   1522 O  O   . PHE A 1 197 ? 11.886  -4.463  57.830  1.00 30.05 ? 197 PHE A O   1 
ATOM   1523 C  CB  . PHE A 1 197 ? 13.905  -6.532  56.239  1.00 31.67 ? 197 PHE A CB  1 
ATOM   1524 C  CG  . PHE A 1 197 ? 13.450  -7.299  57.456  1.00 33.56 ? 197 PHE A CG  1 
ATOM   1525 C  CD1 . PHE A 1 197 ? 13.996  -7.049  58.711  1.00 32.47 ? 197 PHE A CD1 1 
ATOM   1526 C  CD2 . PHE A 1 197 ? 12.530  -8.332  57.325  1.00 31.61 ? 197 PHE A CD2 1 
ATOM   1527 C  CE1 . PHE A 1 197 ? 13.608  -7.785  59.820  1.00 31.44 ? 197 PHE A CE1 1 
ATOM   1528 C  CE2 . PHE A 1 197 ? 12.124  -9.073  58.432  1.00 33.34 ? 197 PHE A CE2 1 
ATOM   1529 C  CZ  . PHE A 1 197 ? 12.667  -8.798  59.684  1.00 33.59 ? 197 PHE A CZ  1 
ATOM   1530 N  N   . GLY A 1 198 ? 11.366  -4.637  55.627  1.00 31.07 ? 198 GLY A N   1 
ATOM   1531 C  CA  . GLY A 1 198 ? 9.969   -4.275  55.796  1.00 32.47 ? 198 GLY A CA  1 
ATOM   1532 C  C   . GLY A 1 198 ? 9.119   -4.465  54.550  1.00 34.30 ? 198 GLY A C   1 
ATOM   1533 O  O   . GLY A 1 198 ? 9.622   -4.626  53.433  1.00 33.45 ? 198 GLY A O   1 
ATOM   1534 N  N   . GLU A 1 199 ? 7.811   -4.436  54.747  1.00 33.28 ? 199 GLU A N   1 
ATOM   1535 C  CA  . GLU A 1 199 ? 6.878   -4.770  53.696  1.00 33.15 ? 199 GLU A CA  1 
ATOM   1536 C  C   . GLU A 1 199 ? 6.004   -3.568  53.359  1.00 35.39 ? 199 GLU A C   1 
ATOM   1537 O  O   . GLU A 1 199 ? 5.648   -2.779  54.244  1.00 37.54 ? 199 GLU A O   1 
ATOM   1538 C  CB  . GLU A 1 199 ? 6.043   -5.972  54.127  1.00 34.83 ? 199 GLU A CB  1 
ATOM   1539 C  CG  . GLU A 1 199 ? 5.127   -6.528  53.075  1.00 34.30 ? 199 GLU A CG  1 
ATOM   1540 C  CD  . GLU A 1 199 ? 3.783   -5.823  53.067  1.00 37.47 ? 199 GLU A CD  1 
ATOM   1541 O  OE1 . GLU A 1 199 ? 3.508   -5.049  54.013  1.00 34.95 ? 199 GLU A OE1 1 
ATOM   1542 O  OE2 . GLU A 1 199 ? 3.005   -6.038  52.114  1.00 38.23 ? 199 GLU A OE2 1 
ATOM   1543 N  N   . SER A 1 200 ? 5.686   -3.428  52.075  1.00 34.46 ? 200 SER A N   1 
ATOM   1544 C  CA  . SER A 1 200 ? 4.826   -2.354  51.577  1.00 35.71 ? 200 SER A CA  1 
ATOM   1545 C  C   . SER A 1 200 ? 5.392   -0.994  51.963  1.00 33.05 ? 200 SER A C   1 
ATOM   1546 O  O   . SER A 1 200 ? 6.517   -0.676  51.607  1.00 36.63 ? 200 SER A O   1 
ATOM   1547 C  CB  . SER A 1 200 ? 3.400   -2.518  52.101  1.00 36.23 ? 200 SER A CB  1 
ATOM   1548 O  OG  . SER A 1 200 ? 2.500   -1.704  51.379  1.00 41.23 ? 200 SER A OG  1 
ATOM   1549 N  N   . ALA A 1 201 ? 4.621   -0.189  52.679  1.00 32.08 ? 201 ALA A N   1 
ATOM   1550 C  CA  . ALA A 1 201 ? 5.140   1.076   53.187  1.00 33.52 ? 201 ALA A CA  1 
ATOM   1551 C  C   . ALA A 1 201 ? 6.474   0.872   53.914  1.00 33.63 ? 201 ALA A C   1 
ATOM   1552 O  O   . ALA A 1 201 ? 7.337   1.737   53.871  1.00 32.06 ? 201 ALA A O   1 
ATOM   1553 C  CB  . ALA A 1 201 ? 4.132   1.732   54.122  1.00 33.28 ? 201 ALA A CB  1 
ATOM   1554 N  N   . GLY A 1 202 ? 6.623   -0.273  54.577  1.00 31.45 ? 202 GLY A N   1 
ATOM   1555 C  CA  . GLY A 1 202 ? 7.869   -0.619  55.241  1.00 32.69 ? 202 GLY A CA  1 
ATOM   1556 C  C   . GLY A 1 202 ? 9.007   -0.853  54.249  1.00 35.47 ? 202 GLY A C   1 
ATOM   1557 O  O   . GLY A 1 202 ? 10.152  -0.455  54.494  1.00 34.55 ? 202 GLY A O   1 
ATOM   1558 N  N   . GLY A 1 203 ? 8.695   -1.511  53.135  1.00 31.74 ? 203 GLY A N   1 
ATOM   1559 C  CA  . GLY A 1 203 ? 9.668   -1.708  52.069  1.00 33.15 ? 203 GLY A CA  1 
ATOM   1560 C  C   . GLY A 1 203 ? 10.105  -0.404  51.417  1.00 34.11 ? 203 GLY A C   1 
ATOM   1561 O  O   . GLY A 1 203 ? 11.304  -0.147  51.276  1.00 31.01 ? 203 GLY A O   1 
ATOM   1562 N  N   . ALA A 1 204 ? 9.135   0.416   51.005  1.00 31.41 ? 204 ALA A N   1 
ATOM   1563 C  CA  . ALA A 1 204 ? 9.428   1.790   50.603  1.00 29.99 ? 204 ALA A CA  1 
ATOM   1564 C  C   . ALA A 1 204 ? 10.346  2.463   51.632  1.00 34.42 ? 204 ALA A C   1 
ATOM   1565 O  O   . ALA A 1 204 ? 11.376  3.032   51.263  1.00 32.84 ? 204 ALA A O   1 
ATOM   1566 C  CB  . ALA A 1 204 ? 8.149   2.589   50.450  1.00 29.94 ? 204 ALA A CB  1 
ATOM   1567 N  N   . SER A 1 205 ? 9.968   2.379   52.915  1.00 31.01 ? 205 SER A N   1 
ATOM   1568 C  CA  . SER A 1 205 ? 10.747  2.993   53.996  1.00 32.41 ? 205 SER A CA  1 
ATOM   1569 C  C   . SER A 1 205 ? 12.209  2.547   53.943  1.00 30.90 ? 205 SER A C   1 
ATOM   1570 O  O   . SER A 1 205 ? 13.112  3.371   54.031  1.00 30.11 ? 205 SER A O   1 
ATOM   1571 C  CB  . SER A 1 205 ? 10.141  2.668   55.378  1.00 27.50 ? 205 SER A CB  1 
ATOM   1572 O  OG  . SER A 1 205 ? 8.998   3.467   55.673  1.00 27.48 ? 205 SER A OG  1 
ATOM   1573 N  N   . VAL A 1 206 ? 12.427  1.244   53.797  1.00 29.90 ? 206 VAL A N   1 
ATOM   1574 C  CA  . VAL A 1 206 ? 13.766  0.685   53.753  1.00 29.75 ? 206 VAL A CA  1 
ATOM   1575 C  C   . VAL A 1 206 ? 14.595  1.276   52.612  1.00 34.21 ? 206 VAL A C   1 
ATOM   1576 O  O   . VAL A 1 206 ? 15.787  1.578   52.783  1.00 34.16 ? 206 VAL A O   1 
ATOM   1577 C  CB  . VAL A 1 206 ? 13.736  -0.848  53.601  1.00 33.00 ? 206 VAL A CB  1 
ATOM   1578 C  CG1 . VAL A 1 206 ? 15.108  -1.367  53.105  1.00 29.66 ? 206 VAL A CG1 1 
ATOM   1579 C  CG2 . VAL A 1 206 ? 13.360  -1.497  54.921  1.00 30.68 ? 206 VAL A CG2 1 
ATOM   1580 N  N   . GLY A 1 207 ? 13.958  1.453   51.462  1.00 29.49 ? 207 GLY A N   1 
ATOM   1581 C  CA  . GLY A 1 207 ? 14.605  2.073   50.330  1.00 34.20 ? 207 GLY A CA  1 
ATOM   1582 C  C   . GLY A 1 207 ? 14.827  3.557   50.517  1.00 33.68 ? 207 GLY A C   1 
ATOM   1583 O  O   . GLY A 1 207 ? 15.781  4.118   49.999  1.00 34.37 ? 207 GLY A O   1 
ATOM   1584 N  N   . MET A 1 208 ? 13.941  4.213   51.249  1.00 34.35 ? 208 MET A N   1 
ATOM   1585 C  CA  . MET A 1 208 ? 14.146  5.630   51.515  1.00 36.29 ? 208 MET A CA  1 
ATOM   1586 C  C   . MET A 1 208 ? 15.370  5.847   52.413  1.00 34.22 ? 208 MET A C   1 
ATOM   1587 O  O   . MET A 1 208 ? 16.069  6.841   52.267  1.00 32.77 ? 208 MET A O   1 
ATOM   1588 C  CB  . MET A 1 208 ? 12.905  6.250   52.145  1.00 34.42 ? 208 MET A CB  1 
ATOM   1589 C  CG  . MET A 1 208 ? 11.787  6.442   51.143  1.00 38.24 ? 208 MET A CG  1 
ATOM   1590 S  SD  . MET A 1 208 ? 10.213  6.805   51.949  1.00 35.08 ? 208 MET A SD  1 
ATOM   1591 C  CE  . MET A 1 208 ? 9.191   7.031   50.490  1.00 30.83 ? 208 MET A CE  1 
ATOM   1592 N  N   . HIS A 1 209 ? 15.627  4.913   53.324  1.00 32.20 ? 209 HIS A N   1 
ATOM   1593 C  CA  . HIS A 1 209 ? 16.824  4.999   54.165  1.00 35.67 ? 209 HIS A CA  1 
ATOM   1594 C  C   . HIS A 1 209 ? 18.084  4.671   53.372  1.00 36.93 ? 209 HIS A C   1 
ATOM   1595 O  O   . HIS A 1 209 ? 19.178  5.083   53.745  1.00 37.89 ? 209 HIS A O   1 
ATOM   1596 C  CB  . HIS A 1 209 ? 16.725  4.073   55.374  1.00 32.11 ? 209 HIS A CB  1 
ATOM   1597 C  CG  . HIS A 1 209 ? 15.732  4.531   56.390  1.00 34.48 ? 209 HIS A CG  1 
ATOM   1598 N  ND1 . HIS A 1 209 ? 15.817  5.760   57.008  1.00 32.22 ? 209 HIS A ND1 1 
ATOM   1599 C  CD2 . HIS A 1 209 ? 14.610  3.941   56.869  1.00 29.53 ? 209 HIS A CD2 1 
ATOM   1600 C  CE1 . HIS A 1 209 ? 14.792  5.902   57.830  1.00 34.29 ? 209 HIS A CE1 1 
ATOM   1601 N  NE2 . HIS A 1 209 ? 14.044  4.816   57.758  1.00 31.35 ? 209 HIS A NE2 1 
ATOM   1602 N  N   . ILE A 1 210 ? 17.923  3.919   52.289  1.00 34.21 ? 210 ILE A N   1 
ATOM   1603 C  CA  . ILE A 1 210 ? 19.023  3.661   51.376  1.00 33.91 ? 210 ILE A CA  1 
ATOM   1604 C  C   . ILE A 1 210 ? 19.374  4.958   50.658  1.00 36.80 ? 210 ILE A C   1 
ATOM   1605 O  O   . ILE A 1 210 ? 20.539  5.275   50.461  1.00 39.42 ? 210 ILE A O   1 
ATOM   1606 C  CB  . ILE A 1 210 ? 18.668  2.548   50.370  1.00 36.29 ? 210 ILE A CB  1 
ATOM   1607 C  CG1 . ILE A 1 210 ? 18.717  1.185   51.069  1.00 36.49 ? 210 ILE A CG1 1 
ATOM   1608 C  CG2 . ILE A 1 210 ? 19.624  2.556   49.184  1.00 33.34 ? 210 ILE A CG2 1 
ATOM   1609 C  CD1 . ILE A 1 210 ? 18.084  0.057   50.279  1.00 33.77 ? 210 ILE A CD1 1 
ATOM   1610 N  N   . LEU A 1 211 ? 18.358  5.731   50.308  1.00 36.09 ? 211 LEU A N   1 
ATOM   1611 C  CA  . LEU A 1 211 ? 18.571  6.992   49.615  1.00 36.15 ? 211 LEU A CA  1 
ATOM   1612 C  C   . LEU A 1 211 ? 19.017  8.124   50.554  1.00 38.57 ? 211 LEU A C   1 
ATOM   1613 O  O   . LEU A 1 211 ? 19.839  8.953   50.179  1.00 42.30 ? 211 LEU A O   1 
ATOM   1614 C  CB  . LEU A 1 211 ? 17.295  7.391   48.869  1.00 35.49 ? 211 LEU A CB  1 
ATOM   1615 C  CG  . LEU A 1 211 ? 16.905  6.493   47.685  1.00 34.98 ? 211 LEU A CG  1 
ATOM   1616 C  CD1 . LEU A 1 211 ? 15.495  6.790   47.177  1.00 35.88 ? 211 LEU A CD1 1 
ATOM   1617 C  CD2 . LEU A 1 211 ? 17.889  6.667   46.566  1.00 38.89 ? 211 LEU A CD2 1 
ATOM   1618 N  N   . SER A 1 212 ? 18.499  8.160   51.777  1.00 35.76 ? 212 SER A N   1 
ATOM   1619 C  CA  . SER A 1 212 ? 18.767  9.303   52.649  1.00 36.26 ? 212 SER A CA  1 
ATOM   1620 C  C   . SER A 1 212 ? 20.162  9.237   53.247  1.00 38.55 ? 212 SER A C   1 
ATOM   1621 O  O   . SER A 1 212 ? 20.482  8.281   53.955  1.00 37.84 ? 212 SER A O   1 
ATOM   1622 C  CB  . SER A 1 212 ? 17.734  9.394   53.774  1.00 36.04 ? 212 SER A CB  1 
ATOM   1623 O  OG  . SER A 1 212 ? 17.857  10.631  54.459  1.00 34.85 ? 212 SER A OG  1 
ATOM   1624 N  N   . PRO A 1 213 ? 20.997  10.254  52.958  1.00 40.26 ? 213 PRO A N   1 
ATOM   1625 C  CA  . PRO A 1 213 ? 22.353  10.332  53.523  1.00 39.13 ? 213 PRO A CA  1 
ATOM   1626 C  C   . PRO A 1 213 ? 22.361  10.184  55.042  1.00 37.01 ? 213 PRO A C   1 
ATOM   1627 O  O   . PRO A 1 213 ? 23.184  9.450   55.586  1.00 38.87 ? 213 PRO A O   1 
ATOM   1628 C  CB  . PRO A 1 213 ? 22.825  11.724  53.104  1.00 39.95 ? 213 PRO A CB  1 
ATOM   1629 C  CG  . PRO A 1 213 ? 22.076  12.002  51.832  1.00 38.40 ? 213 PRO A CG  1 
ATOM   1630 C  CD  . PRO A 1 213 ? 20.717  11.370  52.032  1.00 39.48 ? 213 PRO A CD  1 
ATOM   1631 N  N   . GLY A 1 214 ? 21.423  10.846  55.713  1.00 39.66 ? 214 GLY A N   1 
ATOM   1632 C  CA  . GLY A 1 214 ? 21.321  10.777  57.161  1.00 34.71 ? 214 GLY A CA  1 
ATOM   1633 C  C   . GLY A 1 214 ? 21.027  9.404   57.746  1.00 34.85 ? 214 GLY A C   1 
ATOM   1634 O  O   . GLY A 1 214 ? 21.206  9.204   58.945  1.00 36.46 ? 214 GLY A O   1 
ATOM   1635 N  N   . SER A 1 215 ? 20.584  8.455   56.924  1.00 32.95 ? 215 SER A N   1 
ATOM   1636 C  CA  . SER A 1 215 ? 20.265  7.118   57.428  1.00 32.68 ? 215 SER A CA  1 
ATOM   1637 C  C   . SER A 1 215 ? 21.284  6.035   57.055  1.00 35.19 ? 215 SER A C   1 
ATOM   1638 O  O   . SER A 1 215 ? 21.353  4.991   57.706  1.00 36.31 ? 215 SER A O   1 
ATOM   1639 C  CB  . SER A 1 215 ? 18.885  6.682   56.935  1.00 34.08 ? 215 SER A CB  1 
ATOM   1640 O  OG  . SER A 1 215 ? 17.849  7.523   57.433  1.00 36.31 ? 215 SER A OG  1 
ATOM   1641 N  N   . ARG A 1 216 ? 22.083  6.287   56.024  1.00 36.00 ? 216 ARG A N   1 
ATOM   1642 C  CA  . ARG A 1 216 ? 22.918  5.235   55.439  1.00 37.87 ? 216 ARG A CA  1 
ATOM   1643 C  C   . ARG A 1 216 ? 23.872  4.557   56.427  1.00 34.52 ? 216 ARG A C   1 
ATOM   1644 O  O   . ARG A 1 216 ? 24.083  3.344   56.359  1.00 33.96 ? 216 ARG A O   1 
ATOM   1645 C  CB  . ARG A 1 216 ? 23.714  5.793   54.267  1.00 37.77 ? 216 ARG A CB  1 
ATOM   1646 C  CG  . ARG A 1 216 ? 22.845  6.327   53.138  1.00 38.74 ? 216 ARG A CG  1 
ATOM   1647 C  CD  . ARG A 1 216 ? 23.698  6.835   51.985  1.00 43.81 ? 216 ARG A CD  1 
ATOM   1648 N  NE  . ARG A 1 216 ? 22.933  7.685   51.072  1.00 43.15 ? 216 ARG A NE  1 
ATOM   1649 C  CZ  . ARG A 1 216 ? 23.488  8.533   50.214  1.00 40.87 ? 216 ARG A CZ  1 
ATOM   1650 N  NH1 . ARG A 1 216 ? 22.726  9.283   49.427  1.00 41.99 ? 216 ARG A NH1 1 
ATOM   1651 N  NH2 . ARG A 1 216 ? 24.810  8.635   50.152  1.00 42.96 ? 216 ARG A NH2 1 
ATOM   1652 N  N   . ASP A 1 217 ? 24.422  5.318   57.361  1.00 33.39 ? 217 ASP A N   1 
ATOM   1653 C  CA  . ASP A 1 217 ? 25.418  4.739   58.257  1.00 38.33 ? 217 ASP A CA  1 
ATOM   1654 C  C   . ASP A 1 217 ? 24.807  3.948   59.401  1.00 34.77 ? 217 ASP A C   1 
ATOM   1655 O  O   . ASP A 1 217 ? 25.528  3.393   60.217  1.00 33.35 ? 217 ASP A O   1 
ATOM   1656 C  CB  . ASP A 1 217 ? 26.334  5.833   58.791  1.00 37.79 ? 217 ASP A CB  1 
ATOM   1657 C  CG  . ASP A 1 217 ? 27.191  6.428   57.693  1.00 41.30 ? 217 ASP A CG  1 
ATOM   1658 O  OD1 . ASP A 1 217 ? 27.661  5.639   56.847  1.00 40.09 ? 217 ASP A OD1 1 
ATOM   1659 O  OD2 . ASP A 1 217 ? 27.379  7.664   57.651  1.00 48.40 ? 217 ASP A OD2 1 
ATOM   1660 N  N   . LEU A 1 218 ? 23.483  3.841   59.423  1.00 35.02 ? 218 LEU A N   1 
ATOM   1661 C  CA  . LEU A 1 218 ? 22.804  3.195   60.547  1.00 35.81 ? 218 LEU A CA  1 
ATOM   1662 C  C   . LEU A 1 218 ? 22.362  1.764   60.267  1.00 35.16 ? 218 LEU A C   1 
ATOM   1663 O  O   . LEU A 1 218 ? 21.588  1.206   61.033  1.00 33.78 ? 218 LEU A O   1 
ATOM   1664 C  CB  . LEU A 1 218 ? 21.597  4.026   60.970  1.00 32.25 ? 218 LEU A CB  1 
ATOM   1665 C  CG  . LEU A 1 218 ? 21.951  5.445   61.409  1.00 33.84 ? 218 LEU A CG  1 
ATOM   1666 C  CD1 . LEU A 1 218 ? 20.693  6.215   61.792  1.00 33.45 ? 218 LEU A CD1 1 
ATOM   1667 C  CD2 . LEU A 1 218 ? 22.936  5.386   62.578  1.00 32.54 ? 218 LEU A CD2 1 
ATOM   1668 N  N   . PHE A 1 219 ? 22.837  1.185   59.165  1.00 37.03 ? 219 PHE A N   1 
ATOM   1669 C  CA  . PHE A 1 219 ? 22.532  -0.208  58.832  1.00 34.60 ? 219 PHE A CA  1 
ATOM   1670 C  C   . PHE A 1 219 ? 23.507  -0.749  57.776  1.00 32.44 ? 219 PHE A C   1 
ATOM   1671 O  O   . PHE A 1 219 ? 24.143  0.009   57.060  1.00 29.75 ? 219 PHE A O   1 
ATOM   1672 C  CB  . PHE A 1 219 ? 21.077  -0.352  58.351  1.00 30.96 ? 219 PHE A CB  1 
ATOM   1673 C  CG  . PHE A 1 219 ? 20.785  0.371   57.071  1.00 31.24 ? 219 PHE A CG  1 
ATOM   1674 C  CD1 . PHE A 1 219 ? 20.569  1.739   57.065  1.00 31.20 ? 219 PHE A CD1 1 
ATOM   1675 C  CD2 . PHE A 1 219 ? 20.723  -0.322  55.867  1.00 32.52 ? 219 PHE A CD2 1 
ATOM   1676 C  CE1 . PHE A 1 219 ? 20.302  2.410   55.880  1.00 33.98 ? 219 PHE A CE1 1 
ATOM   1677 C  CE2 . PHE A 1 219 ? 20.466  0.337   54.673  1.00 30.97 ? 219 PHE A CE2 1 
ATOM   1678 C  CZ  . PHE A 1 219 ? 20.257  1.705   54.677  1.00 32.81 ? 219 PHE A CZ  1 
ATOM   1679 N  N   . ARG A 1 220 ? 23.602  -2.070  57.694  1.00 33.86 ? 220 ARG A N   1 
ATOM   1680 C  CA  . ARG A 1 220 ? 24.509  -2.739  56.780  1.00 32.08 ? 220 ARG A CA  1 
ATOM   1681 C  C   . ARG A 1 220 ? 23.877  -3.056  55.404  1.00 36.62 ? 220 ARG A C   1 
ATOM   1682 O  O   . ARG A 1 220 ? 24.434  -2.672  54.366  1.00 36.94 ? 220 ARG A O   1 
ATOM   1683 C  CB  . ARG A 1 220 ? 25.028  -4.020  57.435  1.00 35.94 ? 220 ARG A CB  1 
ATOM   1684 C  CG  . ARG A 1 220 ? 26.052  -4.777  56.610  1.00 38.85 ? 220 ARG A CG  1 
ATOM   1685 C  CD  . ARG A 1 220 ? 27.232  -3.892  56.256  1.00 35.71 ? 220 ARG A CD  1 
ATOM   1686 N  NE  . ARG A 1 220 ? 28.283  -4.647  55.576  1.00 42.85 ? 220 ARG A NE  1 
ATOM   1687 C  CZ  . ARG A 1 220 ? 29.047  -5.576  56.151  1.00 46.32 ? 220 ARG A CZ  1 
ATOM   1688 N  NH1 . ARG A 1 220 ? 28.882  -5.892  57.439  1.00 40.89 ? 220 ARG A NH1 1 
ATOM   1689 N  NH2 . ARG A 1 220 ? 29.980  -6.197  55.431  1.00 43.00 ? 220 ARG A NH2 1 
ATOM   1690 N  N   . ARG A 1 221 ? 22.741  -3.760  55.395  1.00 34.00 ? 221 ARG A N   1 
ATOM   1691 C  CA  . ARG A 1 221 ? 22.032  -4.076  54.149  1.00 35.23 ? 221 ARG A CA  1 
ATOM   1692 C  C   . ARG A 1 221 ? 20.520  -3.965  54.306  1.00 34.70 ? 221 ARG A C   1 
ATOM   1693 O  O   . ARG A 1 221 ? 20.019  -3.735  55.402  1.00 34.76 ? 221 ARG A O   1 
ATOM   1694 C  CB  . ARG A 1 221 ? 22.362  -5.481  53.663  1.00 35.95 ? 221 ARG A CB  1 
ATOM   1695 C  CG  . ARG A 1 221 ? 23.487  -6.125  54.401  1.00 40.19 ? 221 ARG A CG  1 
ATOM   1696 C  CD  . ARG A 1 221 ? 23.616  -7.592  54.071  1.00 37.47 ? 221 ARG A CD  1 
ATOM   1697 N  NE  . ARG A 1 221 ? 24.497  -8.206  55.054  1.00 49.06 ? 221 ARG A NE  1 
ATOM   1698 C  CZ  . ARG A 1 221 ? 25.808  -8.312  54.918  1.00 44.16 ? 221 ARG A CZ  1 
ATOM   1699 N  NH1 . ARG A 1 221 ? 26.406  -7.878  53.817  1.00 42.67 ? 221 ARG A NH1 1 
ATOM   1700 N  NH2 . ARG A 1 221 ? 26.514  -8.870  55.883  1.00 48.97 ? 221 ARG A NH2 1 
ATOM   1701 N  N   . ALA A 1 222 ? 19.804  -4.181  53.204  1.00 35.28 ? 222 ALA A N   1 
ATOM   1702 C  CA  . ALA A 1 222 ? 18.368  -3.933  53.159  1.00 32.60 ? 222 ALA A CA  1 
ATOM   1703 C  C   . ALA A 1 222 ? 17.577  -5.012  52.427  1.00 35.45 ? 222 ALA A C   1 
ATOM   1704 O  O   . ALA A 1 222 ? 17.995  -5.517  51.374  1.00 35.07 ? 222 ALA A O   1 
ATOM   1705 C  CB  . ALA A 1 222 ? 18.100  -2.583  52.518  1.00 31.04 ? 222 ALA A CB  1 
ATOM   1706 N  N   . ILE A 1 223 ? 16.419  -5.332  52.999  1.00 31.21 ? 223 ILE A N   1 
ATOM   1707 C  CA  . ILE A 1 223 ? 15.428  -6.196  52.391  1.00 27.58 ? 223 ILE A CA  1 
ATOM   1708 C  C   . ILE A 1 223 ? 14.155  -5.387  52.212  1.00 32.84 ? 223 ILE A C   1 
ATOM   1709 O  O   . ILE A 1 223 ? 13.685  -4.752  53.164  1.00 33.88 ? 223 ILE A O   1 
ATOM   1710 C  CB  . ILE A 1 223 ? 15.155  -7.426  53.256  1.00 35.50 ? 223 ILE A CB  1 
ATOM   1711 C  CG1 . ILE A 1 223 ? 16.410  -8.306  53.345  1.00 31.10 ? 223 ILE A CG1 1 
ATOM   1712 C  CG2 . ILE A 1 223 ? 13.932  -8.195  52.755  1.00 31.04 ? 223 ILE A CG2 1 
ATOM   1713 C  CD1 . ILE A 1 223 ? 16.223  -9.554  54.203  1.00 28.15 ? 223 ILE A CD1 1 
ATOM   1714 N  N   . LEU A 1 224 ? 13.626  -5.401  50.989  1.00 33.51 ? 224 LEU A N   1 
ATOM   1715 C  CA  . LEU A 1 224 ? 12.412  -4.690  50.598  1.00 33.33 ? 224 LEU A CA  1 
ATOM   1716 C  C   . LEU A 1 224 ? 11.367  -5.682  50.094  1.00 36.29 ? 224 LEU A C   1 
ATOM   1717 O  O   . LEU A 1 224 ? 11.558  -6.290  49.032  1.00 35.26 ? 224 LEU A O   1 
ATOM   1718 C  CB  . LEU A 1 224 ? 12.693  -3.670  49.480  1.00 32.42 ? 224 LEU A CB  1 
ATOM   1719 C  CG  . LEU A 1 224 ? 13.666  -2.523  49.733  1.00 36.06 ? 224 LEU A CG  1 
ATOM   1720 C  CD1 . LEU A 1 224 ? 15.097  -3.033  49.831  1.00 28.99 ? 224 LEU A CD1 1 
ATOM   1721 C  CD2 . LEU A 1 224 ? 13.538  -1.453  48.657  1.00 29.40 ? 224 LEU A CD2 1 
ATOM   1722 N  N   . GLN A 1 225 ? 10.266  -5.819  50.833  1.00 32.03 ? 225 GLN A N   1 
ATOM   1723 C  CA  . GLN A 1 225 ? 9.151   -6.687  50.448  1.00 32.07 ? 225 GLN A CA  1 
ATOM   1724 C  C   . GLN A 1 225 ? 7.959   -5.862  49.951  1.00 35.13 ? 225 GLN A C   1 
ATOM   1725 O  O   . GLN A 1 225 ? 7.327   -5.138  50.726  1.00 34.43 ? 225 GLN A O   1 
ATOM   1726 C  CB  . GLN A 1 225 ? 8.724   -7.586  51.631  1.00 32.09 ? 225 GLN A CB  1 
ATOM   1727 C  CG  . GLN A 1 225 ? 9.833   -8.534  52.116  1.00 32.86 ? 225 GLN A CG  1 
ATOM   1728 C  CD  . GLN A 1 225 ? 9.608   -9.099  53.513  1.00 36.54 ? 225 GLN A CD  1 
ATOM   1729 O  OE1 . GLN A 1 225 ? 10.569  -9.366  54.244  1.00 31.66 ? 225 GLN A OE1 1 
ATOM   1730 N  NE2 . GLN A 1 225 ? 8.341   -9.299  53.888  1.00 37.40 ? 225 GLN A NE2 1 
ATOM   1731 N  N   . SER A 1 226 ? 7.665   -5.973  48.656  1.00 28.58 ? 226 SER A N   1 
ATOM   1732 C  CA  . SER A 1 226 ? 6.450   -5.404  48.074  1.00 32.99 ? 226 SER A CA  1 
ATOM   1733 C  C   . SER A 1 226 ? 6.347   -3.908  48.284  1.00 29.95 ? 226 SER A C   1 
ATOM   1734 O  O   . SER A 1 226 ? 5.283   -3.386  48.582  1.00 29.80 ? 226 SER A O   1 
ATOM   1735 C  CB  . SER A 1 226 ? 5.205   -6.081  48.649  1.00 32.42 ? 226 SER A CB  1 
ATOM   1736 O  OG  . SER A 1 226 ? 5.225   -7.471  48.392  1.00 34.28 ? 226 SER A OG  1 
ATOM   1737 N  N   . GLY A 1 227 ? 7.465   -3.223  48.142  1.00 27.97 ? 227 GLY A N   1 
ATOM   1738 C  CA  . GLY A 1 227 ? 7.469   -1.781  48.240  1.00 29.61 ? 227 GLY A CA  1 
ATOM   1739 C  C   . GLY A 1 227 ? 8.836   -1.281  47.845  1.00 30.70 ? 227 GLY A C   1 
ATOM   1740 O  O   . GLY A 1 227 ? 9.822   -1.985  48.005  1.00 30.07 ? 227 GLY A O   1 
ATOM   1741 N  N   . SER A 1 228 ? 8.886   -0.077  47.293  1.00 32.30 ? 228 SER A N   1 
ATOM   1742 C  CA  . SER A 1 228 ? 10.143  0.574   46.981  1.00 32.54 ? 228 SER A CA  1 
ATOM   1743 C  C   . SER A 1 228 ? 9.929   2.072   47.098  1.00 32.44 ? 228 SER A C   1 
ATOM   1744 O  O   . SER A 1 228 ? 8.796   2.547   47.061  1.00 33.26 ? 228 SER A O   1 
ATOM   1745 C  CB  . SER A 1 228 ? 10.647  0.186   45.583  1.00 33.95 ? 228 SER A CB  1 
ATOM   1746 O  OG  . SER A 1 228 ? 9.599   0.202   44.642  1.00 36.27 ? 228 SER A OG  1 
ATOM   1747 N  N   . PRO A 1 229 ? 11.017  2.822   47.268  1.00 35.29 ? 229 PRO A N   1 
ATOM   1748 C  CA  . PRO A 1 229 ? 10.891  4.243   47.605  1.00 35.07 ? 229 PRO A CA  1 
ATOM   1749 C  C   . PRO A 1 229 ? 10.199  5.042   46.507  1.00 36.37 ? 229 PRO A C   1 
ATOM   1750 O  O   . PRO A 1 229 ? 9.549   6.052   46.800  1.00 34.51 ? 229 PRO A O   1 
ATOM   1751 C  CB  . PRO A 1 229 ? 12.352  4.689   47.809  1.00 31.16 ? 229 PRO A CB  1 
ATOM   1752 C  CG  . PRO A 1 229 ? 13.169  3.661   47.071  1.00 36.11 ? 229 PRO A CG  1 
ATOM   1753 C  CD  . PRO A 1 229 ? 12.419  2.374   47.215  1.00 34.18 ? 229 PRO A CD  1 
ATOM   1754 N  N   . ASN A 1 230 ? 10.305  4.577   45.264  1.00 33.27 ? 230 ASN A N   1 
ATOM   1755 C  CA  . ASN A 1 230 ? 9.707   5.281   44.136  1.00 34.49 ? 230 ASN A CA  1 
ATOM   1756 C  C   . ASN A 1 230 ? 8.243   4.919   43.819  1.00 34.52 ? 230 ASN A C   1 
ATOM   1757 O  O   . ASN A 1 230 ? 7.723   5.344   42.798  1.00 33.50 ? 230 ASN A O   1 
ATOM   1758 C  CB  . ASN A 1 230 ? 10.553  5.044   42.876  1.00 31.12 ? 230 ASN A CB  1 
ATOM   1759 C  CG  . ASN A 1 230 ? 10.685  3.576   42.545  1.00 32.81 ? 230 ASN A CG  1 
ATOM   1760 O  OD1 . ASN A 1 230 ? 11.042  2.764   43.401  1.00 33.03 ? 230 ASN A OD1 1 
ATOM   1761 N  ND2 . ASN A 1 230 ? 10.375  3.219   41.303  1.00 33.23 ? 230 ASN A ND2 1 
ATOM   1762 N  N   . CYS A 1 231 ? 7.580   4.139   44.672  1.00 34.37 ? 231 CYS A N   1 
ATOM   1763 C  CA  . CYS A 1 231 ? 6.174   3.810   44.425  1.00 30.58 ? 231 CYS A CA  1 
ATOM   1764 C  C   . CYS A 1 231 ? 5.325   5.077   44.316  1.00 33.81 ? 231 CYS A C   1 
ATOM   1765 O  O   . CYS A 1 231 ? 5.586   6.058   45.006  1.00 32.00 ? 231 CYS A O   1 
ATOM   1766 C  CB  . CYS A 1 231 ? 5.623   2.904   45.519  1.00 28.41 ? 231 CYS A CB  1 
ATOM   1767 S  SG  . CYS A 1 231 ? 6.259   1.229   45.438  1.00 32.99 ? 231 CYS A SG  1 
ATOM   1768 N  N   . PRO A 1 232 ? 4.307   5.057   43.437  1.00 30.10 ? 232 PRO A N   1 
ATOM   1769 C  CA  . PRO A 1 232 ? 3.521   6.264   43.150  1.00 31.12 ? 232 PRO A CA  1 
ATOM   1770 C  C   . PRO A 1 232 ? 2.740   6.780   44.366  1.00 34.42 ? 232 PRO A C   1 
ATOM   1771 O  O   . PRO A 1 232 ? 2.404   7.966   44.428  1.00 32.60 ? 232 PRO A O   1 
ATOM   1772 C  CB  . PRO A 1 232 ? 2.572   5.805   42.025  1.00 32.12 ? 232 PRO A CB  1 
ATOM   1773 C  CG  . PRO A 1 232 ? 2.449   4.317   42.225  1.00 31.75 ? 232 PRO A CG  1 
ATOM   1774 C  CD  . PRO A 1 232 ? 3.793   3.864   42.743  1.00 30.30 ? 232 PRO A CD  1 
ATOM   1775 N  N   . TRP A 1 233 ? 2.474   5.899   45.325  1.00 31.65 ? 233 TRP A N   1 
ATOM   1776 C  CA  . TRP A 1 233 ? 1.735   6.261   46.528  1.00 31.22 ? 233 TRP A CA  1 
ATOM   1777 C  C   . TRP A 1 233 ? 2.643   6.633   47.704  1.00 33.54 ? 233 TRP A C   1 
ATOM   1778 O  O   . TRP A 1 233 ? 2.157   7.006   48.775  1.00 32.17 ? 233 TRP A O   1 
ATOM   1779 C  CB  . TRP A 1 233 ? 0.847   5.096   46.941  1.00 31.50 ? 233 TRP A CB  1 
ATOM   1780 C  CG  . TRP A 1 233 ? 1.608   3.825   46.944  1.00 31.61 ? 233 TRP A CG  1 
ATOM   1781 C  CD1 . TRP A 1 233 ? 1.713   2.938   45.913  1.00 29.80 ? 233 TRP A CD1 1 
ATOM   1782 C  CD2 . TRP A 1 233 ? 2.434   3.315   48.003  1.00 30.92 ? 233 TRP A CD2 1 
ATOM   1783 N  NE1 . TRP A 1 233 ? 2.514   1.892   46.273  1.00 32.93 ? 233 TRP A NE1 1 
ATOM   1784 C  CE2 . TRP A 1 233 ? 2.970   2.093   47.554  1.00 27.95 ? 233 TRP A CE2 1 
ATOM   1785 C  CE3 . TRP A 1 233 ? 2.750   3.762   49.299  1.00 32.57 ? 233 TRP A CE3 1 
ATOM   1786 C  CZ2 . TRP A 1 233 ? 3.819   1.314   48.341  1.00 28.21 ? 233 TRP A CZ2 1 
ATOM   1787 C  CZ3 . TRP A 1 233 ? 3.589   2.977   50.093  1.00 28.78 ? 233 TRP A CZ3 1 
ATOM   1788 C  CH2 . TRP A 1 233 ? 4.114   1.770   49.612  1.00 32.06 ? 233 TRP A CH2 1 
ATOM   1789 N  N   . ALA A 1 234 ? 3.956   6.530   47.504  1.00 29.76 ? 234 ALA A N   1 
ATOM   1790 C  CA  . ALA A 1 234 ? 4.901   6.564   48.616  1.00 32.33 ? 234 ALA A CA  1 
ATOM   1791 C  C   . ALA A 1 234 ? 5.448   7.954   48.944  1.00 33.66 ? 234 ALA A C   1 
ATOM   1792 O  O   . ALA A 1 234 ? 6.029   8.153   50.010  1.00 30.70 ? 234 ALA A O   1 
ATOM   1793 C  CB  . ALA A 1 234 ? 6.068   5.609   48.335  1.00 32.14 ? 234 ALA A CB  1 
ATOM   1794 N  N   . SER A 1 235 ? 5.287   8.912   48.039  1.00 33.02 ? 235 SER A N   1 
ATOM   1795 C  CA  . SER A 1 235 ? 5.781   10.256  48.319  1.00 32.94 ? 235 SER A CA  1 
ATOM   1796 C  C   . SER A 1 235 ? 4.943   11.304  47.609  1.00 31.04 ? 235 SER A C   1 
ATOM   1797 O  O   . SER A 1 235 ? 4.165   10.983  46.731  1.00 34.14 ? 235 SER A O   1 
ATOM   1798 C  CB  . SER A 1 235 ? 7.267   10.386  47.931  1.00 33.13 ? 235 SER A CB  1 
ATOM   1799 O  OG  . SER A 1 235 ? 7.502   10.097  46.561  1.00 34.97 ? 235 SER A OG  1 
ATOM   1800 N  N   . VAL A 1 236 ? 5.077   12.554  48.034  1.00 35.10 ? 236 VAL A N   1 
ATOM   1801 C  CA  . VAL A 1 236 ? 4.418   13.684  47.391  1.00 33.09 ? 236 VAL A CA  1 
ATOM   1802 C  C   . VAL A 1 236 ? 5.410   14.841  47.350  1.00 35.23 ? 236 VAL A C   1 
ATOM   1803 O  O   . VAL A 1 236 ? 6.419   14.823  48.050  1.00 34.35 ? 236 VAL A O   1 
ATOM   1804 C  CB  . VAL A 1 236 ? 3.137   14.132  48.140  1.00 34.64 ? 236 VAL A CB  1 
ATOM   1805 C  CG1 . VAL A 1 236 ? 2.100   13.024  48.160  1.00 35.81 ? 236 VAL A CG1 1 
ATOM   1806 C  CG2 . VAL A 1 236 ? 3.470   14.584  49.568  1.00 37.13 ? 236 VAL A CG2 1 
ATOM   1807 N  N   . SER A 1 237 ? 5.128   15.848  46.534  1.00 36.49 ? 237 SER A N   1 
ATOM   1808 C  CA  . SER A 1 237 ? 5.965   17.046  46.498  1.00 39.96 ? 237 SER A CA  1 
ATOM   1809 C  C   . SER A 1 237 ? 5.686   17.923  47.719  1.00 38.29 ? 237 SER A C   1 
ATOM   1810 O  O   . SER A 1 237 ? 4.696   17.709  48.427  1.00 39.37 ? 237 SER A O   1 
ATOM   1811 C  CB  . SER A 1 237 ? 5.703   17.833  45.218  1.00 37.04 ? 237 SER A CB  1 
ATOM   1812 O  OG  . SER A 1 237 ? 4.345   18.242  45.184  1.00 40.10 ? 237 SER A OG  1 
ATOM   1813 N  N   . VAL A 1 238 ? 6.532   18.919  47.968  1.00 38.85 ? 238 VAL A N   1 
ATOM   1814 C  CA  . VAL A 1 238 ? 6.284   19.809  49.099  1.00 38.19 ? 238 VAL A CA  1 
ATOM   1815 C  C   . VAL A 1 238 ? 4.996   20.587  48.857  1.00 38.75 ? 238 VAL A C   1 
ATOM   1816 O  O   . VAL A 1 238 ? 4.217   20.818  49.784  1.00 39.77 ? 238 VAL A O   1 
ATOM   1817 C  CB  . VAL A 1 238 ? 7.457   20.789  49.357  1.00 41.24 ? 238 VAL A CB  1 
ATOM   1818 C  CG1 . VAL A 1 238 ? 8.713   20.026  49.761  1.00 40.50 ? 238 VAL A CG1 1 
ATOM   1819 C  CG2 . VAL A 1 238 ? 7.723   21.642  48.150  1.00 44.04 ? 238 VAL A CG2 1 
ATOM   1820 N  N   . ALA A 1 239 ? 4.758   20.965  47.606  1.00 35.83 ? 239 ALA A N   1 
ATOM   1821 C  CA  . ALA A 1 239 ? 3.534   21.683  47.248  1.00 37.99 ? 239 ALA A CA  1 
ATOM   1822 C  C   . ALA A 1 239 ? 2.268   20.877  47.555  1.00 36.67 ? 239 ALA A C   1 
ATOM   1823 O  O   . ALA A 1 239 ? 1.294   21.427  48.055  1.00 39.87 ? 239 ALA A O   1 
ATOM   1824 C  CB  . ALA A 1 239 ? 3.555   22.073  45.756  1.00 37.66 ? 239 ALA A CB  1 
ATOM   1825 N  N   . GLU A 1 240 ? 2.275   19.585  47.241  1.00 37.01 ? 240 GLU A N   1 
ATOM   1826 C  CA  . GLU A 1 240 ? 1.099   18.748  47.443  1.00 38.60 ? 240 GLU A CA  1 
ATOM   1827 C  C   . GLU A 1 240 ? 0.939   18.422  48.928  1.00 38.20 ? 240 GLU A C   1 
ATOM   1828 O  O   . GLU A 1 240 ? -0.175  18.353  49.437  1.00 36.07 ? 240 GLU A O   1 
ATOM   1829 C  CB  . GLU A 1 240 ? 1.190   17.462  46.614  1.00 35.01 ? 240 GLU A CB  1 
ATOM   1830 C  CG  . GLU A 1 240 ? 0.110   16.409  46.923  1.00 37.35 ? 240 GLU A CG  1 
ATOM   1831 C  CD  . GLU A 1 240 ? -1.319  16.838  46.543  1.00 42.00 ? 240 GLU A CD  1 
ATOM   1832 O  OE1 . GLU A 1 240 ? -1.513  17.955  46.012  1.00 40.81 ? 240 GLU A OE1 1 
ATOM   1833 O  OE2 . GLU A 1 240 ? -2.265  16.052  46.782  1.00 35.06 ? 240 GLU A OE2 1 
ATOM   1834 N  N   . GLY A 1 241 ? 2.062   18.229  49.614  1.00 37.38 ? 241 GLY A N   1 
ATOM   1835 C  CA  . GLY A 1 241 ? 2.038   18.001  51.046  1.00 36.72 ? 241 GLY A CA  1 
ATOM   1836 C  C   . GLY A 1 241 ? 1.379   19.182  51.721  1.00 36.04 ? 241 GLY A C   1 
ATOM   1837 O  O   . GLY A 1 241 ? 0.528   19.020  52.587  1.00 37.15 ? 241 GLY A O   1 
ATOM   1838 N  N   . ARG A 1 242 ? 1.765   20.379  51.300  1.00 36.46 ? 242 ARG A N   1 
ATOM   1839 C  CA  . ARG A 1 242 ? 1.222   21.592  51.881  1.00 37.14 ? 242 ARG A CA  1 
ATOM   1840 C  C   . ARG A 1 242 ? -0.251  21.725  51.560  1.00 37.54 ? 242 ARG A C   1 
ATOM   1841 O  O   . ARG A 1 242 ? -1.045  22.108  52.421  1.00 38.22 ? 242 ARG A O   1 
ATOM   1842 C  CB  . ARG A 1 242 ? 1.981   22.817  51.380  1.00 38.86 ? 242 ARG A CB  1 
ATOM   1843 C  CG  . ARG A 1 242 ? 1.315   24.134  51.730  1.00 37.81 ? 242 ARG A CG  1 
ATOM   1844 C  CD  . ARG A 1 242 ? 2.255   25.295  51.442  1.00 37.71 ? 242 ARG A CD  1 
ATOM   1845 N  NE  . ARG A 1 242 ? 3.436   25.235  52.296  1.00 42.97 ? 242 ARG A NE  1 
ATOM   1846 C  CZ  . ARG A 1 242 ? 3.488   25.748  53.521  1.00 40.50 ? 242 ARG A CZ  1 
ATOM   1847 N  NH1 . ARG A 1 242 ? 4.596   25.643  54.241  1.00 42.19 ? 242 ARG A NH1 1 
ATOM   1848 N  NH2 . ARG A 1 242 ? 2.425   26.361  54.026  1.00 35.87 ? 242 ARG A NH2 1 
ATOM   1849 N  N   . ARG A 1 243 ? -0.619  21.401  50.322  1.00 37.58 ? 243 ARG A N   1 
ATOM   1850 C  CA  . ARG A 1 243 ? -2.011  21.475  49.914  1.00 36.98 ? 243 ARG A CA  1 
ATOM   1851 C  C   . ARG A 1 243 ? -2.867  20.604  50.819  1.00 37.28 ? 243 ARG A C   1 
ATOM   1852 O  O   . ARG A 1 243 ? -3.884  21.057  51.330  1.00 39.03 ? 243 ARG A O   1 
ATOM   1853 C  CB  . ARG A 1 243 ? -2.189  21.043  48.460  1.00 41.85 ? 243 ARG A CB  1 
ATOM   1854 C  CG  . ARG A 1 243 ? -3.420  21.643  47.777  1.00 39.81 ? 243 ARG A CG  1 
ATOM   1855 C  CD  . ARG A 1 243 ? -3.973  20.738  46.661  1.00 38.09 ? 243 ARG A CD  1 
ATOM   1856 N  NE  . ARG A 1 243 ? -5.034  19.883  47.183  1.00 44.88 ? 243 ARG A NE  1 
ATOM   1857 C  CZ  . ARG A 1 243 ? -4.916  18.574  47.344  1.00 41.93 ? 243 ARG A CZ  1 
ATOM   1858 N  NH1 . ARG A 1 243 ? -3.798  17.980  46.991  1.00 40.65 ? 243 ARG A NH1 1 
ATOM   1859 N  NH2 . ARG A 1 243 ? -5.909  17.865  47.852  1.00 43.85 ? 243 ARG A NH2 1 
ATOM   1860 N  N   . ARG A 1 244 ? -2.451  19.358  51.025  1.00 36.87 ? 244 ARG A N   1 
ATOM   1861 C  CA  . ARG A 1 244 ? -3.225  18.434  51.848  1.00 33.56 ? 244 ARG A CA  1 
ATOM   1862 C  C   . ARG A 1 244 ? -3.228  18.882  53.301  1.00 36.91 ? 244 ARG A C   1 
ATOM   1863 O  O   . ARG A 1 244 ? -4.209  18.690  54.014  1.00 39.76 ? 244 ARG A O   1 
ATOM   1864 C  CB  . ARG A 1 244 ? -2.674  17.009  51.728  1.00 34.17 ? 244 ARG A CB  1 
ATOM   1865 C  CG  . ARG A 1 244 ? -2.660  16.468  50.299  1.00 34.55 ? 244 ARG A CG  1 
ATOM   1866 C  CD  . ARG A 1 244 ? -2.246  15.007  50.249  1.00 33.26 ? 244 ARG A CD  1 
ATOM   1867 N  NE  . ARG A 1 244 ? -2.207  14.504  48.882  1.00 32.12 ? 244 ARG A NE  1 
ATOM   1868 C  CZ  . ARG A 1 244 ? -1.820  13.280  48.543  1.00 34.51 ? 244 ARG A CZ  1 
ATOM   1869 N  NH1 . ARG A 1 244 ? -1.437  12.424  49.480  1.00 27.91 ? 244 ARG A NH1 1 
ATOM   1870 N  NH2 . ARG A 1 244 ? -1.811  12.914  47.259  1.00 32.93 ? 244 ARG A NH2 1 
ATOM   1871 N  N   . ALA A 1 245 ? -2.131  19.486  53.740  1.00 35.51 ? 245 ALA A N   1 
ATOM   1872 C  CA  . ALA A 1 245 ? -2.045  19.929  55.126  1.00 38.34 ? 245 ALA A CA  1 
ATOM   1873 C  C   . ALA A 1 245 ? -3.028  21.065  55.352  1.00 38.57 ? 245 ALA A C   1 
ATOM   1874 O  O   . ALA A 1 245 ? -3.752  21.089  56.340  1.00 36.95 ? 245 ALA A O   1 
ATOM   1875 C  CB  . ALA A 1 245 ? -0.623  20.368  55.475  1.00 34.91 ? 245 ALA A CB  1 
ATOM   1876 N  N   . VAL A 1 246 ? -3.043  22.010  54.423  1.00 38.97 ? 246 VAL A N   1 
ATOM   1877 C  CA  . VAL A 1 246 ? -3.976  23.119  54.495  1.00 40.49 ? 246 VAL A CA  1 
ATOM   1878 C  C   . VAL A 1 246 ? -5.414  22.610  54.419  1.00 40.42 ? 246 VAL A C   1 
ATOM   1879 O  O   . VAL A 1 246 ? -6.262  23.022  55.206  1.00 43.96 ? 246 VAL A O   1 
ATOM   1880 C  CB  . VAL A 1 246 ? -3.714  24.141  53.367  1.00 40.77 ? 246 VAL A CB  1 
ATOM   1881 C  CG1 . VAL A 1 246 ? -4.867  25.131  53.274  1.00 39.60 ? 246 VAL A CG1 1 
ATOM   1882 C  CG2 . VAL A 1 246 ? -2.393  24.866  53.612  1.00 31.38 ? 246 VAL A CG2 1 
ATOM   1883 N  N   . GLU A 1 247 ? -5.677  21.698  53.486  1.00 39.08 ? 247 GLU A N   1 
ATOM   1884 C  CA  . GLU A 1 247 ? -7.014  21.134  53.321  1.00 41.10 ? 247 GLU A CA  1 
ATOM   1885 C  C   . GLU A 1 247 ? -7.443  20.371  54.573  1.00 43.72 ? 247 GLU A C   1 
ATOM   1886 O  O   . GLU A 1 247 ? -8.627  20.316  54.898  1.00 40.45 ? 247 GLU A O   1 
ATOM   1887 C  CB  . GLU A 1 247 ? -7.063  20.214  52.100  1.00 42.39 ? 247 GLU A CB  1 
ATOM   1888 C  CG  . GLU A 1 247 ? -8.403  19.523  51.871  1.00 43.93 ? 247 GLU A CG  1 
ATOM   1889 C  CD  . GLU A 1 247 ? -9.504  20.480  51.426  1.00 50.03 ? 247 GLU A CD  1 
ATOM   1890 O  OE1 . GLU A 1 247 ? -10.695 20.109  51.541  1.00 48.34 ? 247 GLU A OE1 1 
ATOM   1891 O  OE2 . GLU A 1 247 ? -9.180  21.596  50.959  1.00 48.95 ? 247 GLU A OE2 1 
ATOM   1892 N  N   . LEU A 1 248 ? -6.482  19.780  55.278  1.00 40.35 ? 248 LEU A N   1 
ATOM   1893 C  CA  . LEU A 1 248 ? -6.809  19.115  56.535  1.00 39.86 ? 248 LEU A CA  1 
ATOM   1894 C  C   . LEU A 1 248 ? -7.333  20.152  57.530  1.00 42.72 ? 248 LEU A C   1 
ATOM   1895 O  O   . LEU A 1 248 ? -8.297  19.901  58.257  1.00 39.99 ? 248 LEU A O   1 
ATOM   1896 C  CB  . LEU A 1 248 ? -5.601  18.380  57.117  1.00 34.82 ? 248 LEU A CB  1 
ATOM   1897 C  CG  . LEU A 1 248 ? -5.969  17.510  58.328  1.00 35.94 ? 248 LEU A CG  1 
ATOM   1898 C  CD1 . LEU A 1 248 ? -6.854  16.348  57.890  1.00 35.85 ? 248 LEU A CD1 1 
ATOM   1899 C  CD2 . LEU A 1 248 ? -4.735  17.006  59.088  1.00 36.47 ? 248 LEU A CD2 1 
ATOM   1900 N  N   . GLY A 1 249 ? -6.699  21.321  57.553  1.00 41.15 ? 249 GLY A N   1 
ATOM   1901 C  CA  . GLY A 1 249 ? -7.177  22.416  58.376  1.00 41.88 ? 249 GLY A CA  1 
ATOM   1902 C  C   . GLY A 1 249 ? -8.596  22.811  57.998  1.00 45.13 ? 249 GLY A C   1 
ATOM   1903 O  O   . GLY A 1 249 ? -9.478  22.866  58.847  1.00 46.29 ? 249 GLY A O   1 
ATOM   1904 N  N   . ARG A 1 250 ? -8.814  23.082  56.715  1.00 46.10 ? 250 ARG A N   1 
ATOM   1905 C  CA  . ARG A 1 250 ? -10.118 23.511  56.231  1.00 45.21 ? 250 ARG A CA  1 
ATOM   1906 C  C   . ARG A 1 250 ? -11.207 22.569  56.720  1.00 48.44 ? 250 ARG A C   1 
ATOM   1907 O  O   . ARG A 1 250 ? -12.220 23.009  57.274  1.00 47.92 ? 250 ARG A O   1 
ATOM   1908 C  CB  . ARG A 1 250 ? -10.106 23.586  54.709  1.00 45.23 ? 250 ARG A CB  1 
ATOM   1909 C  CG  . ARG A 1 250 ? -11.433 23.902  54.044  1.00 50.02 ? 250 ARG A CG  1 
ATOM   1910 C  CD  . ARG A 1 250 ? -11.204 24.213  52.547  1.00 47.71 ? 250 ARG A CD  1 
ATOM   1911 N  NE  . ARG A 1 250 ? -10.365 25.409  52.385  1.00 53.52 ? 250 ARG A NE  1 
ATOM   1912 C  CZ  . ARG A 1 250 ? -9.086  25.419  51.996  1.00 57.10 ? 250 ARG A CZ  1 
ATOM   1913 N  NH1 . ARG A 1 250 ? -8.445  26.581  51.898  1.00 55.20 ? 250 ARG A NH1 1 
ATOM   1914 N  NH2 . ARG A 1 250 ? -8.444  24.290  51.689  1.00 51.72 ? 250 ARG A NH2 1 
ATOM   1915 N  N   . ASN A 1 251 ? -10.981 21.271  56.545  1.00 45.87 ? 251 ASN A N   1 
ATOM   1916 C  CA  . ASN A 1 251 ? -11.939 20.266  57.006  1.00 44.64 ? 251 ASN A CA  1 
ATOM   1917 C  C   . ASN A 1 251 ? -12.291 20.373  58.481  1.00 47.31 ? 251 ASN A C   1 
ATOM   1918 O  O   . ASN A 1 251 ? -13.362 19.933  58.892  1.00 53.38 ? 251 ASN A O   1 
ATOM   1919 C  CB  . ASN A 1 251 ? -11.412 18.857  56.725  1.00 40.69 ? 251 ASN A CB  1 
ATOM   1920 C  CG  . ASN A 1 251 ? -11.794 18.360  55.338  1.00 44.95 ? 251 ASN A CG  1 
ATOM   1921 O  OD1 . ASN A 1 251 ? -12.764 17.613  55.174  1.00 39.98 ? 251 ASN A OD1 1 
ATOM   1922 N  ND2 . ASN A 1 251 ? -11.038 18.781  54.332  1.00 43.27 ? 251 ASN A ND2 1 
ATOM   1923 N  N   . LEU A 1 252 ? -11.400 20.952  59.278  1.00 44.10 ? 252 LEU A N   1 
ATOM   1924 C  CA  . LEU A 1 252 ? -11.617 21.017  60.722  1.00 48.89 ? 252 LEU A CA  1 
ATOM   1925 C  C   . LEU A 1 252 ? -11.813 22.454  61.200  1.00 49.78 ? 252 LEU A C   1 
ATOM   1926 O  O   . LEU A 1 252 ? -11.670 22.745  62.385  1.00 48.89 ? 252 LEU A O   1 
ATOM   1927 C  CB  . LEU A 1 252 ? -10.446 20.372  61.460  1.00 45.41 ? 252 LEU A CB  1 
ATOM   1928 C  CG  . LEU A 1 252 ? -10.234 18.877  61.231  1.00 41.84 ? 252 LEU A CG  1 
ATOM   1929 C  CD1 . LEU A 1 252 ? -8.877  18.456  61.757  1.00 43.74 ? 252 LEU A CD1 1 
ATOM   1930 C  CD2 . LEU A 1 252 ? -11.333 18.067  61.895  1.00 39.83 ? 252 LEU A CD2 1 
ATOM   1931 N  N   . ASN A 1 253 ? -12.127 23.344  60.262  1.00 49.38 ? 253 ASN A N   1 
ATOM   1932 C  CA  . ASN A 1 253 ? -12.396 24.748  60.565  1.00 51.40 ? 253 ASN A CA  1 
ATOM   1933 C  C   . ASN A 1 253 ? -11.245 25.445  61.271  1.00 50.85 ? 253 ASN A C   1 
ATOM   1934 O  O   . ASN A 1 253 ? -11.455 26.206  62.211  1.00 50.68 ? 253 ASN A O   1 
ATOM   1935 C  CB  . ASN A 1 253 ? -13.663 24.876  61.411  1.00 54.69 ? 253 ASN A CB  1 
ATOM   1936 C  CG  . ASN A 1 253 ? -14.929 24.748  60.585  1.00 58.59 ? 253 ASN A CG  1 
ATOM   1937 O  OD1 . ASN A 1 253 ? -15.822 23.962  60.911  1.00 65.44 ? 253 ASN A OD1 1 
ATOM   1938 N  ND2 . ASN A 1 253 ? -15.010 25.520  59.504  1.00 60.18 ? 253 ASN A ND2 1 
ATOM   1939 N  N   . CYS A 1 254 ? -10.029 25.187  60.810  1.00 48.87 ? 254 CYS A N   1 
ATOM   1940 C  CA  . CYS A 1 254 ? -8.856  25.818  61.382  1.00 46.78 ? 254 CYS A CA  1 
ATOM   1941 C  C   . CYS A 1 254 ? -8.600  27.202  60.804  1.00 47.33 ? 254 CYS A C   1 
ATOM   1942 O  O   . CYS A 1 254 ? -9.079  27.543  59.728  1.00 53.75 ? 254 CYS A O   1 
ATOM   1943 C  CB  . CYS A 1 254 ? -7.627  24.933  61.173  1.00 43.74 ? 254 CYS A CB  1 
ATOM   1944 S  SG  . CYS A 1 254 ? -7.615  23.477  62.229  1.00 47.54 ? 254 CYS A SG  1 
ATOM   1945 N  N   . ASN A 1 255 ? -7.856  28.004  61.552  1.00 51.31 ? 255 ASN A N   1 
ATOM   1946 C  CA  . ASN A 1 255 ? -7.293  29.237  61.043  1.00 49.34 ? 255 ASN A CA  1 
ATOM   1947 C  C   . ASN A 1 255 ? -6.261  28.859  59.988  1.00 48.95 ? 255 ASN A C   1 
ATOM   1948 O  O   . ASN A 1 255 ? -5.448  27.963  60.214  1.00 49.15 ? 255 ASN A O   1 
ATOM   1949 C  CB  . ASN A 1 255 ? -6.667  30.042  62.186  1.00 52.07 ? 255 ASN A CB  1 
ATOM   1950 C  CG  . ASN A 1 255 ? -6.321  31.462  61.783  1.00 57.48 ? 255 ASN A CG  1 
ATOM   1951 O  OD1 . ASN A 1 255 ? -5.777  31.699  60.704  1.00 57.26 ? 255 ASN A OD1 1 
ATOM   1952 N  ND2 . ASN A 1 255 ? -6.642  32.418  62.649  1.00 56.94 ? 255 ASN A ND2 1 
ATOM   1953 N  N   . LEU A 1 256 ? -6.290  29.512  58.831  1.00 51.50 ? 256 LEU A N   1 
ATOM   1954 C  CA  . LEU A 1 256 ? -5.370  29.135  57.758  1.00 47.10 ? 256 LEU A CA  1 
ATOM   1955 C  C   . LEU A 1 256 ? -4.462  30.282  57.331  1.00 50.68 ? 256 LEU A C   1 
ATOM   1956 O  O   . LEU A 1 256 ? -3.776  30.187  56.312  1.00 54.10 ? 256 LEU A O   1 
ATOM   1957 C  CB  . LEU A 1 256 ? -6.148  28.616  56.547  1.00 47.14 ? 256 LEU A CB  1 
ATOM   1958 C  CG  . LEU A 1 256 ? -7.128  27.461  56.784  1.00 48.65 ? 256 LEU A CG  1 
ATOM   1959 C  CD1 . LEU A 1 256 ? -7.884  27.100  55.496  1.00 42.55 ? 256 LEU A CD1 1 
ATOM   1960 C  CD2 . LEU A 1 256 ? -6.423  26.244  57.360  1.00 41.19 ? 256 LEU A CD2 1 
ATOM   1961 N  N   . ASN A 1 257 ? -4.450  31.357  58.113  1.00 50.28 ? 257 ASN A N   1 
ATOM   1962 C  CA  . ASN A 1 257 ? -3.665  32.546  57.782  1.00 54.71 ? 257 ASN A CA  1 
ATOM   1963 C  C   . ASN A 1 257 ? -2.163  32.282  57.709  1.00 52.94 ? 257 ASN A C   1 
ATOM   1964 O  O   . ASN A 1 257 ? -1.453  32.916  56.928  1.00 52.63 ? 257 ASN A O   1 
ATOM   1965 C  CB  . ASN A 1 257 ? -3.923  33.658  58.803  1.00 57.95 ? 257 ASN A CB  1 
ATOM   1966 C  CG  . ASN A 1 257 ? -5.369  34.125  58.816  1.00 60.85 ? 257 ASN A CG  1 
ATOM   1967 O  OD1 . ASN A 1 257 ? -6.047  34.145  57.778  1.00 58.52 ? 257 ASN A OD1 1 
ATOM   1968 N  ND2 . ASN A 1 257 ? -5.850  34.510  60.000  1.00 62.89 ? 257 ASN A ND2 1 
ATOM   1969 N  N   . SER A 1 258 ? -1.689  31.349  58.530  1.00 47.30 ? 258 SER A N   1 
ATOM   1970 C  CA  . SER A 1 258 ? -0.269  31.014  58.589  1.00 49.15 ? 258 SER A CA  1 
ATOM   1971 C  C   . SER A 1 258 ? -0.053  29.588  59.073  1.00 47.06 ? 258 SER A C   1 
ATOM   1972 O  O   . SER A 1 258 ? -0.943  28.987  59.683  1.00 46.68 ? 258 SER A O   1 
ATOM   1973 C  CB  . SER A 1 258 ? 0.470   31.979  59.520  1.00 48.01 ? 258 SER A CB  1 
ATOM   1974 O  OG  . SER A 1 258 ? -0.054  31.890  60.834  1.00 47.94 ? 258 SER A OG  1 
ATOM   1975 N  N   . ASP A 1 259 ? 1.138   29.059  58.817  1.00 41.92 ? 259 ASP A N   1 
ATOM   1976 C  CA  . ASP A 1 259 ? 1.506   27.743  59.313  1.00 40.95 ? 259 ASP A CA  1 
ATOM   1977 C  C   . ASP A 1 259 ? 1.306   27.648  60.825  1.00 44.64 ? 259 ASP A C   1 
ATOM   1978 O  O   . ASP A 1 259 ? 0.633   26.734  61.317  1.00 42.18 ? 259 ASP A O   1 
ATOM   1979 C  CB  . ASP A 1 259 ? 2.954   27.425  58.952  1.00 42.60 ? 259 ASP A CB  1 
ATOM   1980 C  CG  . ASP A 1 259 ? 3.159   27.294  57.456  1.00 47.21 ? 259 ASP A CG  1 
ATOM   1981 O  OD1 . ASP A 1 259 ? 2.153   27.211  56.716  1.00 45.53 ? 259 ASP A OD1 1 
ATOM   1982 O  OD2 . ASP A 1 259 ? 4.327   27.268  57.020  1.00 52.02 ? 259 ASP A OD2 1 
ATOM   1983 N  N   . GLU A 1 260 ? 1.879   28.603  61.553  1.00 47.59 ? 260 GLU A N   1 
ATOM   1984 C  CA  . GLU A 1 260 ? 1.777   28.625  63.014  1.00 50.62 ? 260 GLU A CA  1 
ATOM   1985 C  C   . GLU A 1 260 ? 0.329   28.565  63.507  1.00 45.13 ? 260 GLU A C   1 
ATOM   1986 O  O   . GLU A 1 260 ? 0.016   27.813  64.426  1.00 45.32 ? 260 GLU A O   1 
ATOM   1987 C  CB  . GLU A 1 260 ? 2.478   29.866  63.576  1.00 51.38 ? 260 GLU A CB  1 
ATOM   1988 C  CG  . GLU A 1 260 ? 3.988   29.708  63.680  1.00 51.83 ? 260 GLU A CG  1 
ATOM   1989 C  CD  . GLU A 1 260 ? 4.388   28.648  64.704  1.00 55.54 ? 260 GLU A CD  1 
ATOM   1990 O  OE1 . GLU A 1 260 ? 3.642   28.456  65.690  1.00 55.57 ? 260 GLU A OE1 1 
ATOM   1991 O  OE2 . GLU A 1 260 ? 5.439   27.993  64.521  1.00 55.51 ? 260 GLU A OE2 1 
ATOM   1992 N  N   . GLU A 1 261 ? -0.556  29.335  62.883  1.00 45.53 ? 261 GLU A N   1 
ATOM   1993 C  CA  . GLU A 1 261 ? -1.967  29.321  63.265  1.00 44.62 ? 261 GLU A CA  1 
ATOM   1994 C  C   . GLU A 1 261 ? -2.620  27.997  62.894  1.00 43.21 ? 261 GLU A C   1 
ATOM   1995 O  O   . GLU A 1 261 ? -3.361  27.414  63.689  1.00 44.47 ? 261 GLU A O   1 
ATOM   1996 C  CB  . GLU A 1 261 ? -2.712  30.481  62.614  1.00 48.37 ? 261 GLU A CB  1 
ATOM   1997 C  CG  . GLU A 1 261 ? -2.704  31.754  63.438  1.00 52.77 ? 261 GLU A CG  1 
ATOM   1998 C  CD  . GLU A 1 261 ? -3.077  32.978  62.621  1.00 57.66 ? 261 GLU A CD  1 
ATOM   1999 O  OE1 . GLU A 1 261 ? -3.996  33.724  63.037  1.00 59.40 ? 261 GLU A OE1 1 
ATOM   2000 O  OE2 . GLU A 1 261 ? -2.443  33.195  61.565  1.00 55.07 ? 261 GLU A OE2 1 
ATOM   2001 N  N   . LEU A 1 262 ? -2.333  27.527  61.684  1.00 43.20 ? 262 LEU A N   1 
ATOM   2002 C  CA  . LEU A 1 262 ? -2.798  26.225  61.224  1.00 41.84 ? 262 LEU A CA  1 
ATOM   2003 C  C   . LEU A 1 262 ? -2.328  25.103  62.141  1.00 40.66 ? 262 LEU A C   1 
ATOM   2004 O  O   . LEU A 1 262 ? -3.093  24.214  62.499  1.00 40.63 ? 262 LEU A O   1 
ATOM   2005 C  CB  . LEU A 1 262 ? -2.307  25.958  59.798  1.00 35.65 ? 262 LEU A CB  1 
ATOM   2006 C  CG  . LEU A 1 262 ? -2.669  24.579  59.258  1.00 37.01 ? 262 LEU A CG  1 
ATOM   2007 C  CD1 . LEU A 1 262 ? -4.158  24.301  59.465  1.00 36.56 ? 262 LEU A CD1 1 
ATOM   2008 C  CD2 . LEU A 1 262 ? -2.313  24.475  57.776  1.00 39.00 ? 262 LEU A CD2 1 
ATOM   2009 N  N   . ILE A 1 263 ? -1.052  25.144  62.505  1.00 41.23 ? 263 ILE A N   1 
ATOM   2010 C  CA  . ILE A 1 263 ? -0.471  24.100  63.338  1.00 40.42 ? 263 ILE A CA  1 
ATOM   2011 C  C   . ILE A 1 263 ? -0.986  24.163  64.763  1.00 40.44 ? 263 ILE A C   1 
ATOM   2012 O  O   . ILE A 1 263 ? -1.272  23.125  65.370  1.00 39.90 ? 263 ILE A O   1 
ATOM   2013 C  CB  . ILE A 1 263 ? 1.052   24.185  63.353  1.00 38.14 ? 263 ILE A CB  1 
ATOM   2014 C  CG1 . ILE A 1 263 ? 1.595   23.876  61.964  1.00 35.91 ? 263 ILE A CG1 1 
ATOM   2015 C  CG2 . ILE A 1 263 ? 1.627   23.214  64.381  1.00 39.05 ? 263 ILE A CG2 1 
ATOM   2016 C  CD1 . ILE A 1 263 ? 3.087   24.046  61.836  1.00 36.66 ? 263 ILE A CD1 1 
ATOM   2017 N  N   . HIS A 1 264 ? -1.106  25.374  65.299  1.00 40.55 ? 264 HIS A N   1 
ATOM   2018 C  CA  . HIS A 1 264 ? -1.632  25.529  66.647  1.00 43.60 ? 264 HIS A CA  1 
ATOM   2019 C  C   . HIS A 1 264 ? -3.036  24.927  66.700  1.00 44.80 ? 264 HIS A C   1 
ATOM   2020 O  O   . HIS A 1 264 ? -3.362  24.169  67.617  1.00 45.11 ? 264 HIS A O   1 
ATOM   2021 C  CB  . HIS A 1 264 ? -1.646  26.999  67.079  1.00 46.59 ? 264 HIS A CB  1 
ATOM   2022 C  CG  . HIS A 1 264 ? -2.026  27.202  68.516  1.00 54.58 ? 264 HIS A CG  1 
ATOM   2023 N  ND1 . HIS A 1 264 ? -3.322  27.070  68.971  1.00 57.04 ? 264 HIS A ND1 1 
ATOM   2024 C  CD2 . HIS A 1 264 ? -1.280  27.526  69.601  1.00 53.48 ? 264 HIS A CD2 1 
ATOM   2025 C  CE1 . HIS A 1 264 ? -3.358  27.303  70.272  1.00 54.61 ? 264 HIS A CE1 1 
ATOM   2026 N  NE2 . HIS A 1 264 ? -2.132  27.583  70.678  1.00 55.16 ? 264 HIS A NE2 1 
ATOM   2027 N  N   . CYS A 1 265 ? -3.852  25.238  65.696  1.00 41.54 ? 265 CYS A N   1 
ATOM   2028 C  CA  . CYS A 1 265 ? -5.213  24.720  65.645  1.00 42.81 ? 265 CYS A CA  1 
ATOM   2029 C  C   . CYS A 1 265 ? -5.229  23.193  65.580  1.00 44.20 ? 265 CYS A C   1 
ATOM   2030 O  O   . CYS A 1 265 ? -5.919  22.544  66.371  1.00 40.53 ? 265 CYS A O   1 
ATOM   2031 C  CB  . CYS A 1 265 ? -5.969  25.310  64.450  1.00 46.58 ? 265 CYS A CB  1 
ATOM   2032 S  SG  . CYS A 1 265 ? -7.515  24.453  64.034  1.00 54.38 ? 265 CYS A SG  1 
ATOM   2033 N  N   . LEU A 1 266 ? -4.461  22.625  64.647  1.00 41.92 ? 266 LEU A N   1 
ATOM   2034 C  CA  . LEU A 1 266 ? -4.399  21.171  64.479  1.00 40.37 ? 266 LEU A CA  1 
ATOM   2035 C  C   . LEU A 1 266 ? -3.865  20.457  65.725  1.00 42.20 ? 266 LEU A C   1 
ATOM   2036 O  O   . LEU A 1 266 ? -4.213  19.304  65.986  1.00 39.73 ? 266 LEU A O   1 
ATOM   2037 C  CB  . LEU A 1 266 ? -3.538  20.810  63.265  1.00 36.56 ? 266 LEU A CB  1 
ATOM   2038 C  CG  . LEU A 1 266 ? -4.163  21.084  61.889  1.00 41.23 ? 266 LEU A CG  1 
ATOM   2039 C  CD1 . LEU A 1 266 ? -3.128  21.013  60.775  1.00 40.30 ? 266 LEU A CD1 1 
ATOM   2040 C  CD2 . LEU A 1 266 ? -5.302  20.111  61.610  1.00 36.43 ? 266 LEU A CD2 1 
ATOM   2041 N  N   . ARG A 1 267 ? -3.020  21.140  66.494  1.00 42.62 ? 267 ARG A N   1 
ATOM   2042 C  CA  . ARG A 1 267 ? -2.478  20.554  67.717  1.00 41.50 ? 267 ARG A CA  1 
ATOM   2043 C  C   . ARG A 1 267 ? -3.513  20.540  68.836  1.00 43.43 ? 267 ARG A C   1 
ATOM   2044 O  O   . ARG A 1 267 ? -3.325  19.858  69.837  1.00 44.67 ? 267 ARG A O   1 
ATOM   2045 C  CB  . ARG A 1 267 ? -1.225  21.304  68.179  1.00 41.12 ? 267 ARG A CB  1 
ATOM   2046 C  CG  . ARG A 1 267 ? 0.066   20.811  67.527  1.00 42.05 ? 267 ARG A CG  1 
ATOM   2047 C  CD  . ARG A 1 267 ? 1.237   21.739  67.840  1.00 39.67 ? 267 ARG A CD  1 
ATOM   2048 N  NE  . ARG A 1 267 ? 2.479   21.257  67.251  1.00 38.39 ? 267 ARG A NE  1 
ATOM   2049 C  CZ  . ARG A 1 267 ? 3.583   21.984  67.118  1.00 39.25 ? 267 ARG A CZ  1 
ATOM   2050 N  NH1 . ARG A 1 267 ? 3.607   23.245  67.527  1.00 38.08 ? 267 ARG A NH1 1 
ATOM   2051 N  NH2 . ARG A 1 267 ? 4.661   21.450  66.562  1.00 38.63 ? 267 ARG A NH2 1 
ATOM   2052 N  N   . GLU A 1 268 ? -4.606  21.279  68.660  1.00 43.55 ? 268 GLU A N   1 
ATOM   2053 C  CA  . GLU A 1 268 ? -5.651  21.349  69.680  1.00 45.35 ? 268 GLU A CA  1 
ATOM   2054 C  C   . GLU A 1 268 ? -6.672  20.222  69.560  1.00 47.04 ? 268 GLU A C   1 
ATOM   2055 O  O   . GLU A 1 268 ? -7.399  19.927  70.514  1.00 45.40 ? 268 GLU A O   1 
ATOM   2056 C  CB  . GLU A 1 268 ? -6.361  22.704  69.618  1.00 49.01 ? 268 GLU A CB  1 
ATOM   2057 C  CG  . GLU A 1 268 ? -5.544  23.842  70.218  1.00 54.46 ? 268 GLU A CG  1 
ATOM   2058 C  CD  . GLU A 1 268 ? -5.138  23.554  71.660  1.00 60.59 ? 268 GLU A CD  1 
ATOM   2059 O  OE1 . GLU A 1 268 ? -4.099  24.085  72.115  1.00 66.54 ? 268 GLU A OE1 1 
ATOM   2060 O  OE2 . GLU A 1 268 ? -5.860  22.789  72.337  1.00 61.67 ? 268 GLU A OE2 1 
ATOM   2061 N  N   . LYS A 1 269 ? -6.715  19.592  68.388  1.00 44.91 ? 269 LYS A N   1 
ATOM   2062 C  CA  . LYS A 1 269 ? -7.714  18.573  68.092  1.00 39.73 ? 269 LYS A CA  1 
ATOM   2063 C  C   . LYS A 1 269 ? -7.343  17.219  68.676  1.00 41.61 ? 269 LYS A C   1 
ATOM   2064 O  O   . LYS A 1 269 ? -6.169  16.845  68.704  1.00 41.92 ? 269 LYS A O   1 
ATOM   2065 C  CB  . LYS A 1 269 ? -7.900  18.450  66.578  1.00 43.98 ? 269 LYS A CB  1 
ATOM   2066 C  CG  . LYS A 1 269 ? -8.187  19.771  65.880  1.00 43.16 ? 269 LYS A CG  1 
ATOM   2067 C  CD  . LYS A 1 269 ? -9.508  20.369  66.331  1.00 46.25 ? 269 LYS A CD  1 
ATOM   2068 C  CE  . LYS A 1 269 ? -9.788  21.690  65.622  1.00 49.93 ? 269 LYS A CE  1 
ATOM   2069 N  NZ  . LYS A 1 269 ? -11.204 22.145  65.816  1.00 52.65 ? 269 LYS A NZ  1 
ATOM   2070 N  N   . LYS A 1 270 ? -8.345  16.488  69.155  1.00 40.87 ? 270 LYS A N   1 
ATOM   2071 C  CA  . LYS A 1 270 ? -8.139  15.103  69.563  1.00 39.74 ? 270 LYS A CA  1 
ATOM   2072 C  C   . LYS A 1 270 ? -7.662  14.293  68.347  1.00 41.36 ? 270 LYS A C   1 
ATOM   2073 O  O   . LYS A 1 270 ? -8.040  14.599  67.220  1.00 39.57 ? 270 LYS A O   1 
ATOM   2074 C  CB  . LYS A 1 270 ? -9.424  14.525  70.143  1.00 42.08 ? 270 LYS A CB  1 
ATOM   2075 C  CG  . LYS A 1 270 ? -10.154 15.509  71.071  1.00 46.23 ? 270 LYS A CG  1 
ATOM   2076 C  CD  . LYS A 1 270 ? -11.234 14.848  71.926  1.00 47.58 ? 270 LYS A CD  1 
ATOM   2077 C  CE  . LYS A 1 270 ? -11.762 15.836  72.981  1.00 52.54 ? 270 LYS A CE  1 
ATOM   2078 N  NZ  . LYS A 1 270 ? -12.723 15.229  73.956  1.00 63.43 ? 270 LYS A NZ  1 
ATOM   2079 N  N   . PRO A 1 271 ? -6.817  13.275  68.573  1.00 39.83 ? 271 PRO A N   1 
ATOM   2080 C  CA  . PRO A 1 271 ? -6.256  12.466  67.484  1.00 36.99 ? 271 PRO A CA  1 
ATOM   2081 C  C   . PRO A 1 271 ? -7.317  11.953  66.504  1.00 40.79 ? 271 PRO A C   1 
ATOM   2082 O  O   . PRO A 1 271 ? -7.172  12.061  65.273  1.00 34.75 ? 271 PRO A O   1 
ATOM   2083 C  CB  . PRO A 1 271 ? -5.597  11.296  68.220  1.00 35.90 ? 271 PRO A CB  1 
ATOM   2084 C  CG  . PRO A 1 271 ? -5.267  11.838  69.570  1.00 38.65 ? 271 PRO A CG  1 
ATOM   2085 C  CD  . PRO A 1 271 ? -6.348  12.830  69.900  1.00 36.14 ? 271 PRO A CD  1 
ATOM   2086 N  N   . GLN A 1 272 ? -8.393  11.408  67.054  1.00 38.20 ? 272 GLN A N   1 
ATOM   2087 C  CA  . GLN A 1 272 ? -9.414  10.790  66.226  1.00 37.90 ? 272 GLN A CA  1 
ATOM   2088 C  C   . GLN A 1 272 ? -10.124 11.822  65.339  1.00 38.76 ? 272 GLN A C   1 
ATOM   2089 O  O   . GLN A 1 272 ? -10.648 11.475  64.280  1.00 39.74 ? 272 GLN A O   1 
ATOM   2090 C  CB  . GLN A 1 272 ? -10.423 10.037  67.099  1.00 43.52 ? 272 GLN A CB  1 
ATOM   2091 C  CG  . GLN A 1 272 ? -11.160 8.933   66.357  1.00 49.38 ? 272 GLN A CG  1 
ATOM   2092 C  CD  . GLN A 1 272 ? -10.216 7.893   65.774  1.00 52.81 ? 272 GLN A CD  1 
ATOM   2093 O  OE1 . GLN A 1 272 ? -9.313  7.400   66.456  1.00 49.83 ? 272 GLN A OE1 1 
ATOM   2094 N  NE2 . GLN A 1 272 ? -10.426 7.551   64.505  1.00 48.37 ? 272 GLN A NE2 1 
ATOM   2095 N  N   . GLU A 1 273 ? -10.127 13.087  65.753  1.00 35.72 ? 273 GLU A N   1 
ATOM   2096 C  CA  . GLU A 1 273 ? -10.725 14.136  64.938  1.00 35.68 ? 273 GLU A CA  1 
ATOM   2097 C  C   . GLU A 1 273 ? -9.978  14.265  63.611  1.00 39.66 ? 273 GLU A C   1 
ATOM   2098 O  O   . GLU A 1 273 ? -10.593 14.448  62.555  1.00 37.35 ? 273 GLU A O   1 
ATOM   2099 C  CB  . GLU A 1 273 ? -10.726 15.479  65.677  1.00 35.03 ? 273 GLU A CB  1 
ATOM   2100 C  CG  . GLU A 1 273 ? -11.798 15.619  66.762  1.00 45.27 ? 273 GLU A CG  1 
ATOM   2101 C  CD  . GLU A 1 273 ? -11.762 16.978  67.443  1.00 45.98 ? 273 GLU A CD  1 
ATOM   2102 O  OE1 . GLU A 1 273 ? -12.482 17.901  67.003  1.00 50.98 ? 273 GLU A OE1 1 
ATOM   2103 O  OE2 . GLU A 1 273 ? -11.000 17.130  68.418  1.00 49.93 ? 273 GLU A OE2 1 
ATOM   2104 N  N   . LEU A 1 274 ? -8.649  14.183  63.680  1.00 39.49 ? 274 LEU A N   1 
ATOM   2105 C  CA  . LEU A 1 274 ? -7.805  14.228  62.486  1.00 36.73 ? 274 LEU A CA  1 
ATOM   2106 C  C   . LEU A 1 274 ? -8.056  13.040  61.576  1.00 34.67 ? 274 LEU A C   1 
ATOM   2107 O  O   . LEU A 1 274 ? -8.214  13.181  60.368  1.00 36.73 ? 274 LEU A O   1 
ATOM   2108 C  CB  . LEU A 1 274 ? -6.330  14.264  62.881  1.00 34.16 ? 274 LEU A CB  1 
ATOM   2109 C  CG  . LEU A 1 274 ? -5.739  15.624  63.247  1.00 37.35 ? 274 LEU A CG  1 
ATOM   2110 C  CD1 . LEU A 1 274 ? -6.723  16.467  64.031  1.00 37.47 ? 274 LEU A CD1 1 
ATOM   2111 C  CD2 . LEU A 1 274 ? -4.436  15.432  64.036  1.00 39.05 ? 274 LEU A CD2 1 
ATOM   2112 N  N   . ILE A 1 275 ? -8.070  11.860  62.173  1.00 37.84 ? 275 ILE A N   1 
ATOM   2113 C  CA  . ILE A 1 275 ? -8.266  10.626  61.436  1.00 36.19 ? 275 ILE A CA  1 
ATOM   2114 C  C   . ILE A 1 275 ? -9.602  10.584  60.695  1.00 37.91 ? 275 ILE A C   1 
ATOM   2115 O  O   . ILE A 1 275 ? -9.667  10.081  59.570  1.00 41.45 ? 275 ILE A O   1 
ATOM   2116 C  CB  . ILE A 1 275 ? -8.156  9.425   62.392  1.00 36.23 ? 275 ILE A CB  1 
ATOM   2117 C  CG1 . ILE A 1 275 ? -6.727  9.343   62.941  1.00 32.00 ? 275 ILE A CG1 1 
ATOM   2118 C  CG2 . ILE A 1 275 ? -8.544  8.139   61.695  1.00 36.77 ? 275 ILE A CG2 1 
ATOM   2119 C  CD1 . ILE A 1 275 ? -6.527  8.246   63.969  1.00 35.70 ? 275 ILE A CD1 1 
ATOM   2120 N  N   . ASP A 1 276 ? -10.658 11.126  61.307  1.00 38.89 ? 276 ASP A N   1 
ATOM   2121 C  CA  . ASP A 1 276 ? -11.999 11.091  60.708  1.00 38.04 ? 276 ASP A CA  1 
ATOM   2122 C  C   . ASP A 1 276 ? -12.035 11.788  59.355  1.00 36.71 ? 276 ASP A C   1 
ATOM   2123 O  O   . ASP A 1 276 ? -12.816 11.428  58.490  1.00 40.64 ? 276 ASP A O   1 
ATOM   2124 C  CB  . ASP A 1 276 ? -13.046 11.734  61.634  1.00 39.08 ? 276 ASP A CB  1 
ATOM   2125 C  CG  . ASP A 1 276 ? -13.456 10.824  62.796  1.00 45.85 ? 276 ASP A CG  1 
ATOM   2126 O  OD1 . ASP A 1 276 ? -13.344 9.587   62.657  1.00 49.98 ? 276 ASP A OD1 1 
ATOM   2127 O  OD2 . ASP A 1 276 ? -13.905 11.344  63.848  1.00 44.17 ? 276 ASP A OD2 1 
ATOM   2128 N  N   . VAL A 1 277 ? -11.190 12.790  59.179  1.00 36.69 ? 277 VAL A N   1 
ATOM   2129 C  CA  . VAL A 1 277 ? -11.186 13.566  57.949  1.00 37.66 ? 277 VAL A CA  1 
ATOM   2130 C  C   . VAL A 1 277 ? -9.941  13.303  57.079  1.00 37.15 ? 277 VAL A C   1 
ATOM   2131 O  O   . VAL A 1 277 ? -9.812  13.871  55.996  1.00 34.32 ? 277 VAL A O   1 
ATOM   2132 C  CB  . VAL A 1 277 ? -11.273 15.064  58.268  1.00 39.61 ? 277 VAL A CB  1 
ATOM   2133 C  CG1 . VAL A 1 277 ? -12.600 15.374  58.937  1.00 39.64 ? 277 VAL A CG1 1 
ATOM   2134 C  CG2 . VAL A 1 277 ? -10.115 15.474  59.183  1.00 35.14 ? 277 VAL A CG2 1 
ATOM   2135 N  N   . GLU A 1 278 ? -9.041  12.445  57.560  1.00 36.38 ? 278 GLU A N   1 
ATOM   2136 C  CA  . GLU A 1 278 ? -7.775  12.134  56.867  1.00 31.47 ? 278 GLU A CA  1 
ATOM   2137 C  C   . GLU A 1 278 ? -7.923  11.886  55.363  1.00 35.13 ? 278 GLU A C   1 
ATOM   2138 O  O   . GLU A 1 278 ? -7.213  12.480  54.547  1.00 31.96 ? 278 GLU A O   1 
ATOM   2139 C  CB  . GLU A 1 278 ? -7.124  10.910  57.509  1.00 33.65 ? 278 GLU A CB  1 
ATOM   2140 C  CG  . GLU A 1 278 ? -5.969  10.327  56.732  1.00 34.17 ? 278 GLU A CG  1 
ATOM   2141 C  CD  . GLU A 1 278 ? -5.305  9.172   57.459  1.00 38.25 ? 278 GLU A CD  1 
ATOM   2142 O  OE1 . GLU A 1 278 ? -5.369  9.121   58.717  1.00 34.93 ? 278 GLU A OE1 1 
ATOM   2143 O  OE2 . GLU A 1 278 ? -4.706  8.321   56.769  1.00 39.42 ? 278 GLU A OE2 1 
ATOM   2144 N  N   . TRP A 1 279 ? -8.854  11.013  54.999  1.00 35.37 ? 279 TRP A N   1 
ATOM   2145 C  CA  . TRP A 1 279 ? -9.033  10.621  53.610  1.00 32.95 ? 279 TRP A CA  1 
ATOM   2146 C  C   . TRP A 1 279 ? -9.651  11.721  52.754  1.00 35.12 ? 279 TRP A C   1 
ATOM   2147 O  O   . TRP A 1 279 ? -9.647  11.629  51.536  1.00 36.78 ? 279 TRP A O   1 
ATOM   2148 C  CB  . TRP A 1 279 ? -9.894  9.359   53.523  1.00 35.57 ? 279 TRP A CB  1 
ATOM   2149 C  CG  . TRP A 1 279 ? -9.323  8.183   54.285  1.00 38.93 ? 279 TRP A CG  1 
ATOM   2150 C  CD1 . TRP A 1 279 ? -9.676  7.766   55.543  1.00 35.64 ? 279 TRP A CD1 1 
ATOM   2151 C  CD2 . TRP A 1 279 ? -8.313  7.275   53.831  1.00 37.66 ? 279 TRP A CD2 1 
ATOM   2152 N  NE1 . TRP A 1 279 ? -8.945  6.659   55.893  1.00 40.31 ? 279 TRP A NE1 1 
ATOM   2153 C  CE2 . TRP A 1 279 ? -8.100  6.340   54.862  1.00 39.75 ? 279 TRP A CE2 1 
ATOM   2154 C  CE3 . TRP A 1 279 ? -7.569  7.160   52.650  1.00 41.41 ? 279 TRP A CE3 1 
ATOM   2155 C  CZ2 . TRP A 1 279 ? -7.174  5.306   54.750  1.00 42.80 ? 279 TRP A CZ2 1 
ATOM   2156 C  CZ3 . TRP A 1 279 ? -6.651  6.137   52.542  1.00 41.03 ? 279 TRP A CZ3 1 
ATOM   2157 C  CH2 . TRP A 1 279 ? -6.461  5.221   53.587  1.00 41.56 ? 279 TRP A CH2 1 
ATOM   2158 N  N   . ASN A 1 280 ? -10.162 12.770  53.379  1.00 36.33 ? 280 ASN A N   1 
ATOM   2159 C  CA  . ASN A 1 280 ? -10.850 13.811  52.623  1.00 37.62 ? 280 ASN A CA  1 
ATOM   2160 C  C   . ASN A 1 280 ? -9.886  14.733  51.897  1.00 36.15 ? 280 ASN A C   1 
ATOM   2161 O  O   . ASN A 1 280 ? -10.310 15.571  51.119  1.00 41.21 ? 280 ASN A O   1 
ATOM   2162 C  CB  . ASN A 1 280 ? -11.753 14.661  53.534  1.00 37.20 ? 280 ASN A CB  1 
ATOM   2163 C  CG  . ASN A 1 280 ? -12.845 13.849  54.218  1.00 38.77 ? 280 ASN A CG  1 
ATOM   2164 O  OD1 . ASN A 1 280 ? -13.087 12.692  53.879  1.00 43.44 ? 280 ASN A OD1 1 
ATOM   2165 N  ND2 . ASN A 1 280 ? -13.524 14.467  55.181  1.00 39.79 ? 280 ASN A ND2 1 
ATOM   2166 N  N   . VAL A 1 281 ? -8.591  14.609  52.159  1.00 35.00 ? 281 VAL A N   1 
ATOM   2167 C  CA  . VAL A 1 281 ? -7.639  15.537  51.555  1.00 34.68 ? 281 VAL A CA  1 
ATOM   2168 C  C   . VAL A 1 281 ? -7.019  15.017  50.251  1.00 36.89 ? 281 VAL A C   1 
ATOM   2169 O  O   . VAL A 1 281 ? -6.279  15.746  49.588  1.00 35.61 ? 281 VAL A O   1 
ATOM   2170 C  CB  . VAL A 1 281 ? -6.508  15.887  52.532  1.00 32.61 ? 281 VAL A CB  1 
ATOM   2171 C  CG1 . VAL A 1 281 ? -7.092  16.489  53.816  1.00 33.88 ? 281 VAL A CG1 1 
ATOM   2172 C  CG2 . VAL A 1 281 ? -5.656  14.654  52.823  1.00 31.55 ? 281 VAL A CG2 1 
ATOM   2173 N  N   . LEU A 1 282 ? -7.316  13.773  49.878  1.00 37.28 ? 282 LEU A N   1 
ATOM   2174 C  CA  . LEU A 1 282 ? -6.785  13.224  48.631  1.00 34.99 ? 282 LEU A CA  1 
ATOM   2175 C  C   . LEU A 1 282 ? -7.312  14.042  47.458  1.00 38.48 ? 282 LEU A C   1 
ATOM   2176 O  O   . LEU A 1 282 ? -8.463  14.479  47.483  1.00 42.00 ? 282 LEU A O   1 
ATOM   2177 C  CB  . LEU A 1 282 ? -7.167  11.757  48.464  1.00 36.42 ? 282 LEU A CB  1 
ATOM   2178 C  CG  . LEU A 1 282 ? -6.484  10.741  49.375  1.00 34.11 ? 282 LEU A CG  1 
ATOM   2179 C  CD1 . LEU A 1 282 ? -7.126  9.370   49.195  1.00 30.90 ? 282 LEU A CD1 1 
ATOM   2180 C  CD2 . LEU A 1 282 ? -4.980  10.690  49.078  1.00 31.12 ? 282 LEU A CD2 1 
ATOM   2181 N  N   . PRO A 1 283 ? -6.465  14.271  46.442  1.00 36.86 ? 283 PRO A N   1 
ATOM   2182 C  CA  . PRO A 1 283 ? -6.868  15.054  45.271  1.00 40.33 ? 283 PRO A CA  1 
ATOM   2183 C  C   . PRO A 1 283 ? -7.861  14.328  44.366  1.00 41.17 ? 283 PRO A C   1 
ATOM   2184 O  O   . PRO A 1 283 ? -8.546  14.997  43.609  1.00 37.39 ? 283 PRO A O   1 
ATOM   2185 C  CB  . PRO A 1 283 ? -5.545  15.286  44.530  1.00 36.82 ? 283 PRO A CB  1 
ATOM   2186 C  CG  . PRO A 1 283 ? -4.712  14.108  44.893  1.00 39.36 ? 283 PRO A CG  1 
ATOM   2187 C  CD  . PRO A 1 283 ? -5.061  13.836  46.347  1.00 37.31 ? 283 PRO A CD  1 
ATOM   2188 N  N   . PHE A 1 284 ? -7.932  13.001  44.449  1.00 37.24 ? 284 PHE A N   1 
ATOM   2189 C  CA  . PHE A 1 284 ? -8.768  12.220  43.547  1.00 38.47 ? 284 PHE A CA  1 
ATOM   2190 C  C   . PHE A 1 284 ? -9.506  11.108  44.265  1.00 40.69 ? 284 PHE A C   1 
ATOM   2191 O  O   . PHE A 1 284 ? -9.053  10.621  45.301  1.00 41.95 ? 284 PHE A O   1 
ATOM   2192 C  CB  . PHE A 1 284 ? -7.944  11.554  42.433  1.00 39.26 ? 284 PHE A CB  1 
ATOM   2193 C  CG  . PHE A 1 284 ? -7.030  12.474  41.677  1.00 40.63 ? 284 PHE A CG  1 
ATOM   2194 C  CD1 . PHE A 1 284 ? -7.537  13.407  40.785  1.00 46.57 ? 284 PHE A CD1 1 
ATOM   2195 C  CD2 . PHE A 1 284 ? -5.656  12.351  41.800  1.00 41.49 ? 284 PHE A CD2 1 
ATOM   2196 C  CE1 . PHE A 1 284 ? -6.682  14.238  40.054  1.00 44.71 ? 284 PHE A CE1 1 
ATOM   2197 C  CE2 . PHE A 1 284 ? -4.794  13.170  41.079  1.00 45.30 ? 284 PHE A CE2 1 
ATOM   2198 C  CZ  . PHE A 1 284 ? -5.305  14.118  40.205  1.00 45.49 ? 284 PHE A CZ  1 
ATOM   2199 N  N   . ASP A 1 285 ? -10.626 10.682  43.685  1.00 40.07 ? 285 ASP A N   1 
ATOM   2200 C  CA  . ASP A 1 285 ? -11.187 9.367   43.967  1.00 39.23 ? 285 ASP A CA  1 
ATOM   2201 C  C   . ASP A 1 285 ? -10.152 8.355   43.526  1.00 40.23 ? 285 ASP A C   1 
ATOM   2202 O  O   . ASP A 1 285 ? -9.738  8.366   42.367  1.00 38.81 ? 285 ASP A O   1 
ATOM   2203 C  CB  . ASP A 1 285 ? -12.507 9.137   43.212  1.00 42.29 ? 285 ASP A CB  1 
ATOM   2204 C  CG  . ASP A 1 285 ? -13.703 9.763   43.910  1.00 45.63 ? 285 ASP A CG  1 
ATOM   2205 O  OD1 . ASP A 1 285 ? -13.675 9.930   45.146  1.00 57.24 ? 285 ASP A OD1 1 
ATOM   2206 O  OD2 . ASP A 1 285 ? -14.685 10.088  43.223  1.00 55.79 ? 285 ASP A OD2 1 
ATOM   2207 N  N   . SER A 1 286 ? -9.724  7.477   44.422  1.00 38.26 ? 286 SER A N   1 
ATOM   2208 C  CA  . SER A 1 286 ? -8.611  6.612   44.068  1.00 37.72 ? 286 SER A CA  1 
ATOM   2209 C  C   . SER A 1 286 ? -8.503  5.378   44.922  1.00 34.70 ? 286 SER A C   1 
ATOM   2210 O  O   . SER A 1 286 ? -9.073  5.297   45.999  1.00 37.71 ? 286 SER A O   1 
ATOM   2211 C  CB  . SER A 1 286 ? -7.298  7.392   44.153  1.00 37.83 ? 286 SER A CB  1 
ATOM   2212 O  OG  . SER A 1 286 ? -7.187  8.056   45.400  1.00 38.26 ? 286 SER A OG  1 
ATOM   2213 N  N   . ILE A 1 287 ? -7.758  4.401   44.432  1.00 34.74 ? 287 ILE A N   1 
ATOM   2214 C  CA  . ILE A 1 287 ? -7.338  3.323   45.302  1.00 35.26 ? 287 ILE A CA  1 
ATOM   2215 C  C   . ILE A 1 287 ? -5.818  3.227   45.302  1.00 34.60 ? 287 ILE A C   1 
ATOM   2216 O  O   . ILE A 1 287 ? -5.148  3.632   44.335  1.00 32.58 ? 287 ILE A O   1 
ATOM   2217 C  CB  . ILE A 1 287 ? -7.962  1.988   44.912  1.00 32.74 ? 287 ILE A CB  1 
ATOM   2218 C  CG1 . ILE A 1 287 ? -7.647  1.641   43.460  1.00 30.98 ? 287 ILE A CG1 1 
ATOM   2219 C  CG2 . ILE A 1 287 ? -9.478  2.028   45.160  1.00 37.82 ? 287 ILE A CG2 1 
ATOM   2220 C  CD1 . ILE A 1 287 ? -7.914  0.184   43.136  1.00 32.13 ? 287 ILE A CD1 1 
ATOM   2221 N  N   . PHE A 1 288 ? -5.283  2.718   46.406  1.00 29.24 ? 288 PHE A N   1 
ATOM   2222 C  CA  . PHE A 1 288 ? -3.836  2.656   46.612  1.00 34.91 ? 288 PHE A CA  1 
ATOM   2223 C  C   . PHE A 1 288 ? -3.239  4.059   46.618  1.00 33.94 ? 288 PHE A C   1 
ATOM   2224 O  O   . PHE A 1 288 ? -2.162  4.295   46.059  1.00 33.08 ? 288 PHE A O   1 
ATOM   2225 C  CB  . PHE A 1 288 ? -3.158  1.796   45.537  1.00 28.70 ? 288 PHE A CB  1 
ATOM   2226 C  CG  . PHE A 1 288 ? -2.082  0.905   46.081  1.00 33.34 ? 288 PHE A CG  1 
ATOM   2227 C  CD1 . PHE A 1 288 ? -1.182  1.394   47.027  1.00 30.31 ? 288 PHE A CD1 1 
ATOM   2228 C  CD2 . PHE A 1 288 ? -1.988  -0.421  45.690  1.00 28.83 ? 288 PHE A CD2 1 
ATOM   2229 C  CE1 . PHE A 1 288 ? -0.189  0.592   47.542  1.00 30.97 ? 288 PHE A CE1 1 
ATOM   2230 C  CE2 . PHE A 1 288 ? -1.003  -1.235  46.210  1.00 30.60 ? 288 PHE A CE2 1 
ATOM   2231 C  CZ  . PHE A 1 288 ? -0.101  -0.725  47.146  1.00 31.35 ? 288 PHE A CZ  1 
ATOM   2232 N  N   . ARG A 1 289 ? -3.973  4.991   47.218  1.00 33.13 ? 289 ARG A N   1 
ATOM   2233 C  CA  . ARG A 1 289 ? -3.476  6.334   47.475  1.00 32.19 ? 289 ARG A CA  1 
ATOM   2234 C  C   . ARG A 1 289 ? -3.739  6.689   48.938  1.00 33.33 ? 289 ARG A C   1 
ATOM   2235 O  O   . ARG A 1 289 ? -4.813  6.412   49.453  1.00 31.81 ? 289 ARG A O   1 
ATOM   2236 C  CB  . ARG A 1 289 ? -4.134  7.352   46.547  1.00 31.03 ? 289 ARG A CB  1 
ATOM   2237 C  CG  . ARG A 1 289 ? -3.749  7.204   45.079  1.00 35.38 ? 289 ARG A CG  1 
ATOM   2238 C  CD  . ARG A 1 289 ? -2.254  7.408   44.875  1.00 37.74 ? 289 ARG A CD  1 
ATOM   2239 N  NE  . ARG A 1 289 ? -1.910  7.502   43.456  1.00 38.30 ? 289 ARG A NE  1 
ATOM   2240 C  CZ  . ARG A 1 289 ? -1.559  6.463   42.702  1.00 37.27 ? 289 ARG A CZ  1 
ATOM   2241 N  NH1 . ARG A 1 289 ? -1.505  5.244   43.232  1.00 33.57 ? 289 ARG A NH1 1 
ATOM   2242 N  NH2 . ARG A 1 289 ? -1.264  6.642   41.418  1.00 32.83 ? 289 ARG A NH2 1 
ATOM   2243 N  N   . PHE A 1 290 ? -2.757  7.311   49.589  1.00 34.49 ? 290 PHE A N   1 
ATOM   2244 C  CA  . PHE A 1 290 ? -2.831  7.601   51.023  1.00 33.16 ? 290 PHE A CA  1 
ATOM   2245 C  C   . PHE A 1 290 ? -2.492  9.071   51.296  1.00 33.54 ? 290 PHE A C   1 
ATOM   2246 O  O   . PHE A 1 290 ? -1.672  9.672   50.605  1.00 35.56 ? 290 PHE A O   1 
ATOM   2247 C  CB  . PHE A 1 290 ? -1.911  6.658   51.785  1.00 30.06 ? 290 PHE A CB  1 
ATOM   2248 C  CG  . PHE A 1 290 ? -1.998  5.234   51.315  1.00 30.49 ? 290 PHE A CG  1 
ATOM   2249 C  CD1 . PHE A 1 290 ? -3.173  4.511   51.454  1.00 35.86 ? 290 PHE A CD1 1 
ATOM   2250 C  CD2 . PHE A 1 290 ? -0.911  4.616   50.716  1.00 35.52 ? 290 PHE A CD2 1 
ATOM   2251 C  CE1 . PHE A 1 290 ? -3.264  3.199   51.014  1.00 34.14 ? 290 PHE A CE1 1 
ATOM   2252 C  CE2 . PHE A 1 290 ? -1.001  3.297   50.268  1.00 34.78 ? 290 PHE A CE2 1 
ATOM   2253 C  CZ  . PHE A 1 290 ? -2.185  2.589   50.425  1.00 30.89 ? 290 PHE A CZ  1 
ATOM   2254 N  N   . SER A 1 291 ? -3.152  9.664   52.279  1.00 31.75 ? 291 SER A N   1 
ATOM   2255 C  CA  . SER A 1 291 ? -3.108  11.115  52.433  1.00 32.55 ? 291 SER A CA  1 
ATOM   2256 C  C   . SER A 1 291 ? -1.749  11.664  52.874  1.00 32.09 ? 291 SER A C   1 
ATOM   2257 O  O   . SER A 1 291 ? -1.189  12.551  52.227  1.00 32.57 ? 291 SER A O   1 
ATOM   2258 C  CB  . SER A 1 291 ? -4.186  11.560  53.427  1.00 30.82 ? 291 SER A CB  1 
ATOM   2259 O  OG  . SER A 1 291 ? -5.452  11.600  52.794  1.00 34.27 ? 291 SER A OG  1 
ATOM   2260 N  N   . PHE A 1 292 ? -1.224  11.152  53.981  1.00 30.47 ? 292 PHE A N   1 
ATOM   2261 C  CA  . PHE A 1 292 ? 0.005   11.711  54.539  1.00 32.28 ? 292 PHE A CA  1 
ATOM   2262 C  C   . PHE A 1 292 ? 1.145   10.719  54.431  1.00 29.30 ? 292 PHE A C   1 
ATOM   2263 O  O   . PHE A 1 292 ? 1.157   9.666   55.056  1.00 28.66 ? 292 PHE A O   1 
ATOM   2264 C  CB  . PHE A 1 292 ? -0.236  12.182  55.986  1.00 29.92 ? 292 PHE A CB  1 
ATOM   2265 C  CG  . PHE A 1 292 ? -1.339  13.193  56.071  1.00 30.49 ? 292 PHE A CG  1 
ATOM   2266 C  CD1 . PHE A 1 292 ? -1.132  14.499  55.625  1.00 30.56 ? 292 PHE A CD1 1 
ATOM   2267 C  CD2 . PHE A 1 292 ? -2.609  12.825  56.494  1.00 30.79 ? 292 PHE A CD2 1 
ATOM   2268 C  CE1 . PHE A 1 292 ? -2.169  15.434  55.639  1.00 31.51 ? 292 PHE A CE1 1 
ATOM   2269 C  CE2 . PHE A 1 292 ? -3.653  13.752  56.505  1.00 30.38 ? 292 PHE A CE2 1 
ATOM   2270 C  CZ  . PHE A 1 292 ? -3.432  15.057  56.078  1.00 30.21 ? 292 PHE A CZ  1 
ATOM   2271 N  N   . VAL A 1 293 ? 2.102   11.096  53.595  1.00 30.25 ? 293 VAL A N   1 
ATOM   2272 C  CA  . VAL A 1 293 ? 3.186   10.233  53.170  1.00 29.37 ? 293 VAL A CA  1 
ATOM   2273 C  C   . VAL A 1 293 ? 4.431   11.103  53.081  1.00 30.84 ? 293 VAL A C   1 
ATOM   2274 O  O   . VAL A 1 293 ? 4.322   12.332  53.095  1.00 31.45 ? 293 VAL A O   1 
ATOM   2275 C  CB  . VAL A 1 293 ? 2.881   9.572   51.795  1.00 29.91 ? 293 VAL A CB  1 
ATOM   2276 C  CG1 . VAL A 1 293 ? 1.563   8.804   51.841  1.00 26.19 ? 293 VAL A CG1 1 
ATOM   2277 C  CG2 . VAL A 1 293 ? 2.827   10.618  50.701  1.00 28.96 ? 293 VAL A CG2 1 
ATOM   2278 N  N   . PRO A 1 294 ? 5.615   10.479  52.995  1.00 30.63 ? 294 PRO A N   1 
ATOM   2279 C  CA  . PRO A 1 294 ? 6.874   11.224  52.884  1.00 29.15 ? 294 PRO A CA  1 
ATOM   2280 C  C   . PRO A 1 294 ? 6.847   12.333  51.833  1.00 30.83 ? 294 PRO A C   1 
ATOM   2281 O  O   . PRO A 1 294 ? 6.191   12.199  50.789  1.00 30.91 ? 294 PRO A O   1 
ATOM   2282 C  CB  . PRO A 1 294 ? 7.874   10.139  52.509  1.00 28.04 ? 294 PRO A CB  1 
ATOM   2283 C  CG  . PRO A 1 294 ? 7.346   8.928   53.194  1.00 27.24 ? 294 PRO A CG  1 
ATOM   2284 C  CD  . PRO A 1 294 ? 5.845   9.031   53.145  1.00 26.94 ? 294 PRO A CD  1 
ATOM   2285 N  N   . VAL A 1 295 ? 7.522   13.441  52.126  1.00 31.61 ? 295 VAL A N   1 
ATOM   2286 C  CA  . VAL A 1 295 ? 7.652   14.528  51.155  1.00 36.28 ? 295 VAL A CA  1 
ATOM   2287 C  C   . VAL A 1 295 ? 9.069   14.599  50.618  1.00 36.35 ? 295 VAL A C   1 
ATOM   2288 O  O   . VAL A 1 295 ? 10.024  14.432  51.371  1.00 35.80 ? 295 VAL A O   1 
ATOM   2289 C  CB  . VAL A 1 295 ? 7.303   15.913  51.749  1.00 32.51 ? 295 VAL A CB  1 
ATOM   2290 C  CG1 . VAL A 1 295 ? 5.829   16.182  51.641  1.00 41.32 ? 295 VAL A CG1 1 
ATOM   2291 C  CG2 . VAL A 1 295 ? 7.782   16.016  53.181  1.00 31.18 ? 295 VAL A CG2 1 
ATOM   2292 N  N   . ILE A 1 296 ? 9.196   14.849  49.317  1.00 35.90 ? 296 ILE A N   1 
ATOM   2293 C  CA  . ILE A 1 296 ? 10.495  15.117  48.706  1.00 35.46 ? 296 ILE A CA  1 
ATOM   2294 C  C   . ILE A 1 296 ? 10.885  16.545  49.059  1.00 39.93 ? 296 ILE A C   1 
ATOM   2295 O  O   . ILE A 1 296 ? 10.491  17.487  48.362  1.00 40.47 ? 296 ILE A O   1 
ATOM   2296 C  CB  . ILE A 1 296 ? 10.457  14.927  47.177  1.00 40.84 ? 296 ILE A CB  1 
ATOM   2297 C  CG1 . ILE A 1 296 ? 9.793   13.589  46.846  1.00 34.94 ? 296 ILE A CG1 1 
ATOM   2298 C  CG2 . ILE A 1 296 ? 11.865  14.999  46.593  1.00 40.53 ? 296 ILE A CG2 1 
ATOM   2299 C  CD1 . ILE A 1 296 ? 10.381  12.439  47.646  1.00 33.42 ? 296 ILE A CD1 1 
ATOM   2300 N  N   . ASP A 1 297 ? 11.655  16.691  50.142  1.00 37.26 ? 297 ASP A N   1 
ATOM   2301 C  CA  . ASP A 1 297 ? 11.813  17.970  50.844  1.00 39.23 ? 297 ASP A CA  1 
ATOM   2302 C  C   . ASP A 1 297 ? 13.143  18.672  50.618  1.00 44.12 ? 297 ASP A C   1 
ATOM   2303 O  O   . ASP A 1 297 ? 13.304  19.830  50.992  1.00 47.05 ? 297 ASP A O   1 
ATOM   2304 C  CB  . ASP A 1 297 ? 11.640  17.756  52.353  1.00 40.33 ? 297 ASP A CB  1 
ATOM   2305 C  CG  . ASP A 1 297 ? 12.667  16.805  52.920  1.00 40.36 ? 297 ASP A CG  1 
ATOM   2306 O  OD1 . ASP A 1 297 ? 13.293  16.053  52.143  1.00 39.92 ? 297 ASP A OD1 1 
ATOM   2307 O  OD2 . ASP A 1 297 ? 12.854  16.802  54.150  1.00 48.66 ? 297 ASP A OD2 1 
ATOM   2308 N  N   . GLY A 1 298 ? 14.099  17.973  50.023  1.00 40.22 ? 298 GLY A N   1 
ATOM   2309 C  CA  . GLY A 1 298 ? 15.402  18.553  49.794  1.00 43.73 ? 298 GLY A CA  1 
ATOM   2310 C  C   . GLY A 1 298 ? 16.291  18.438  51.020  1.00 45.26 ? 298 GLY A C   1 
ATOM   2311 O  O   . GLY A 1 298 ? 17.346  19.063  51.083  1.00 50.10 ? 298 GLY A O   1 
ATOM   2312 N  N   . GLU A 1 299 ? 15.875  17.638  51.996  1.00 43.89 ? 299 GLU A N   1 
ATOM   2313 C  CA  . GLU A 1 299 ? 16.645  17.509  53.230  1.00 45.58 ? 299 GLU A CA  1 
ATOM   2314 C  C   . GLU A 1 299 ? 16.803  16.060  53.686  1.00 42.78 ? 299 GLU A C   1 
ATOM   2315 O  O   . GLU A 1 299 ? 17.921  15.583  53.867  1.00 44.26 ? 299 GLU A O   1 
ATOM   2316 C  CB  . GLU A 1 299 ? 16.005  18.333  54.343  1.00 47.10 ? 299 GLU A CB  1 
ATOM   2317 C  CG  . GLU A 1 299 ? 16.903  18.494  55.547  1.00 55.92 ? 299 GLU A CG  1 
ATOM   2318 C  CD  . GLU A 1 299 ? 16.172  19.057  56.754  1.00 63.53 ? 299 GLU A CD  1 
ATOM   2319 O  OE1 . GLU A 1 299 ? 14.984  19.446  56.610  1.00 63.79 ? 299 GLU A OE1 1 
ATOM   2320 O  OE2 . GLU A 1 299 ? 16.787  19.108  57.844  1.00 64.28 ? 299 GLU A OE2 1 
ATOM   2321 N  N   . PHE A 1 300 ? 15.690  15.370  53.904  1.00 39.59 ? 300 PHE A N   1 
ATOM   2322 C  CA  . PHE A 1 300 ? 15.746  13.926  54.100  1.00 39.10 ? 300 PHE A CA  1 
ATOM   2323 C  C   . PHE A 1 300 ? 16.103  13.303  52.741  1.00 40.29 ? 300 PHE A C   1 
ATOM   2324 O  O   . PHE A 1 300 ? 16.910  12.378  52.648  1.00 40.83 ? 300 PHE A O   1 
ATOM   2325 C  CB  . PHE A 1 300 ? 14.414  13.377  54.636  1.00 38.18 ? 300 PHE A CB  1 
ATOM   2326 C  CG  . PHE A 1 300 ? 14.472  11.928  55.023  1.00 33.94 ? 300 PHE A CG  1 
ATOM   2327 C  CD1 . PHE A 1 300 ? 14.372  10.931  54.067  1.00 34.14 ? 300 PHE A CD1 1 
ATOM   2328 C  CD2 . PHE A 1 300 ? 14.631  11.562  56.345  1.00 34.89 ? 300 PHE A CD2 1 
ATOM   2329 C  CE1 . PHE A 1 300 ? 14.438  9.595   54.430  1.00 33.60 ? 300 PHE A CE1 1 
ATOM   2330 C  CE2 . PHE A 1 300 ? 14.702  10.226  56.716  1.00 35.32 ? 300 PHE A CE2 1 
ATOM   2331 C  CZ  . PHE A 1 300 ? 14.601  9.244   55.760  1.00 33.58 ? 300 PHE A CZ  1 
ATOM   2332 N  N   . PHE A 1 301 ? 15.484  13.824  51.689  1.00 35.66 ? 301 PHE A N   1 
ATOM   2333 C  CA  . PHE A 1 301 ? 15.890  13.509  50.325  1.00 39.75 ? 301 PHE A CA  1 
ATOM   2334 C  C   . PHE A 1 301 ? 16.529  14.747  49.711  1.00 41.76 ? 301 PHE A C   1 
ATOM   2335 O  O   . PHE A 1 301 ? 15.844  15.742  49.482  1.00 41.22 ? 301 PHE A O   1 
ATOM   2336 C  CB  . PHE A 1 301 ? 14.701  13.058  49.464  1.00 37.15 ? 301 PHE A CB  1 
ATOM   2337 C  CG  . PHE A 1 301 ? 13.851  12.003  50.106  1.00 39.06 ? 301 PHE A CG  1 
ATOM   2338 C  CD1 . PHE A 1 301 ? 14.230  10.668  50.073  1.00 38.27 ? 301 PHE A CD1 1 
ATOM   2339 C  CD2 . PHE A 1 301 ? 12.662  12.344  50.744  1.00 35.55 ? 301 PHE A CD2 1 
ATOM   2340 C  CE1 . PHE A 1 301 ? 13.440  9.696   50.671  1.00 35.11 ? 301 PHE A CE1 1 
ATOM   2341 C  CE2 . PHE A 1 301 ? 11.879  11.379  51.338  1.00 29.99 ? 301 PHE A CE2 1 
ATOM   2342 C  CZ  . PHE A 1 301 ? 12.265  10.055  51.301  1.00 33.30 ? 301 PHE A CZ  1 
ATOM   2343 N  N   . PRO A 1 302 ? 17.845  14.692  49.454  1.00 40.46 ? 302 PRO A N   1 
ATOM   2344 C  CA  . PRO A 1 302 ? 18.600  15.778  48.814  1.00 41.65 ? 302 PRO A CA  1 
ATOM   2345 C  C   . PRO A 1 302 ? 17.940  16.287  47.527  1.00 44.10 ? 302 PRO A C   1 
ATOM   2346 O  O   . PRO A 1 302 ? 17.740  17.490  47.370  1.00 48.04 ? 302 PRO A O   1 
ATOM   2347 C  CB  . PRO A 1 302 ? 19.949  15.127  48.504  1.00 42.60 ? 302 PRO A CB  1 
ATOM   2348 C  CG  . PRO A 1 302 ? 20.076  14.044  49.514  1.00 46.22 ? 302 PRO A CG  1 
ATOM   2349 C  CD  . PRO A 1 302 ? 18.695  13.531  49.766  1.00 38.80 ? 302 PRO A CD  1 
ATOM   2350 N  N   . THR A 1 303 ? 17.612  15.384  46.611  1.00 41.49 ? 303 THR A N   1 
ATOM   2351 C  CA  . THR A 1 303 ? 16.929  15.782  45.389  1.00 38.85 ? 303 THR A CA  1 
ATOM   2352 C  C   . THR A 1 303 ? 15.810  14.792  45.084  1.00 41.78 ? 303 THR A C   1 
ATOM   2353 O  O   . THR A 1 303 ? 15.411  14.015  45.959  1.00 38.61 ? 303 THR A O   1 
ATOM   2354 C  CB  . THR A 1 303 ? 17.903  15.878  44.192  1.00 42.36 ? 303 THR A CB  1 
ATOM   2355 O  OG1 . THR A 1 303 ? 18.457  14.587  43.907  1.00 42.13 ? 303 THR A OG1 1 
ATOM   2356 C  CG2 . THR A 1 303 ? 19.035  16.856  44.506  1.00 41.73 ? 303 THR A CG2 1 
ATOM   2357 N  N   . SER A 1 304 ? 15.290  14.826  43.859  1.00 37.11 ? 304 SER A N   1 
ATOM   2358 C  CA  . SER A 1 304 ? 14.228  13.901  43.470  1.00 41.35 ? 304 SER A CA  1 
ATOM   2359 C  C   . SER A 1 304 ? 14.743  12.472  43.566  1.00 37.29 ? 304 SER A C   1 
ATOM   2360 O  O   . SER A 1 304 ? 15.931  12.229  43.391  1.00 36.60 ? 304 SER A O   1 
ATOM   2361 C  CB  . SER A 1 304 ? 13.737  14.185  42.046  1.00 39.97 ? 304 SER A CB  1 
ATOM   2362 O  OG  . SER A 1 304 ? 14.623  13.618  41.093  1.00 40.75 ? 304 SER A OG  1 
ATOM   2363 N  N   . LEU A 1 305 ? 13.849  11.529  43.835  1.00 37.15 ? 305 LEU A N   1 
ATOM   2364 C  CA  . LEU A 1 305 ? 14.254  10.133  43.937  1.00 36.56 ? 305 LEU A CA  1 
ATOM   2365 C  C   . LEU A 1 305 ? 14.884  9.621   42.642  1.00 36.33 ? 305 LEU A C   1 
ATOM   2366 O  O   . LEU A 1 305 ? 15.833  8.839   42.675  1.00 36.54 ? 305 LEU A O   1 
ATOM   2367 C  CB  . LEU A 1 305 ? 13.065  9.254   44.311  1.00 32.51 ? 305 LEU A CB  1 
ATOM   2368 C  CG  . LEU A 1 305 ? 12.334  9.621   45.600  1.00 35.87 ? 305 LEU A CG  1 
ATOM   2369 C  CD1 . LEU A 1 305 ? 11.151  8.685   45.809  1.00 32.95 ? 305 LEU A CD1 1 
ATOM   2370 C  CD2 . LEU A 1 305 ? 13.287  9.568   46.781  1.00 33.13 ? 305 LEU A CD2 1 
ATOM   2371 N  N   . GLU A 1 306 ? 14.344  10.052  41.508  1.00 36.45 ? 306 GLU A N   1 
ATOM   2372 C  CA  . GLU A 1 306 ? 14.802  9.563   40.215  1.00 37.98 ? 306 GLU A CA  1 
ATOM   2373 C  C   . GLU A 1 306 ? 16.250  9.976   39.953  1.00 36.94 ? 306 GLU A C   1 
ATOM   2374 O  O   . GLU A 1 306 ? 17.091  9.133   39.656  1.00 38.28 ? 306 GLU A O   1 
ATOM   2375 C  CB  . GLU A 1 306 ? 13.882  10.063  39.090  1.00 38.62 ? 306 GLU A CB  1 
ATOM   2376 C  CG  . GLU A 1 306 ? 14.272  9.570   37.705  1.00 40.14 ? 306 GLU A CG  1 
ATOM   2377 C  CD  . GLU A 1 306 ? 14.133  8.065   37.539  1.00 41.15 ? 306 GLU A CD  1 
ATOM   2378 O  OE1 . GLU A 1 306 ? 13.835  7.363   38.521  1.00 40.39 ? 306 GLU A OE1 1 
ATOM   2379 O  OE2 . GLU A 1 306 ? 14.316  7.575   36.408  1.00 50.35 ? 306 GLU A OE2 1 
ATOM   2380 N  N   . SER A 1 307 ? 16.545  11.264  40.087  1.00 36.36 ? 307 SER A N   1 
ATOM   2381 C  CA  . SER A 1 307 ? 17.912  11.750  39.931  1.00 37.08 ? 307 SER A CA  1 
ATOM   2382 C  C   . SER A 1 307 ? 18.887  11.099  40.921  1.00 41.08 ? 307 SER A C   1 
ATOM   2383 O  O   . SER A 1 307 ? 20.044  10.853  40.580  1.00 41.04 ? 307 SER A O   1 
ATOM   2384 C  CB  . SER A 1 307 ? 17.962  13.270  40.087  1.00 36.22 ? 307 SER A CB  1 
ATOM   2385 O  OG  . SER A 1 307 ? 17.538  13.653  41.382  1.00 46.68 ? 307 SER A OG  1 
ATOM   2386 N  N   . MET A 1 308 ? 18.435  10.815  42.140  1.00 36.06 ? 308 MET A N   1 
ATOM   2387 C  CA  . MET A 1 308 ? 19.315  10.159  43.100  1.00 37.42 ? 308 MET A CA  1 
ATOM   2388 C  C   . MET A 1 308 ? 19.616  8.747   42.629  1.00 39.31 ? 308 MET A C   1 
ATOM   2389 O  O   . MET A 1 308 ? 20.735  8.259   42.778  1.00 39.98 ? 308 MET A O   1 
ATOM   2390 C  CB  . MET A 1 308 ? 18.702  10.118  44.510  1.00 41.20 ? 308 MET A CB  1 
ATOM   2391 C  CG  . MET A 1 308 ? 18.538  11.472  45.195  1.00 41.49 ? 308 MET A CG  1 
ATOM   2392 S  SD  . MET A 1 308 ? 17.828  11.317  46.855  1.00 42.52 ? 308 MET A SD  1 
ATOM   2393 C  CE  . MET A 1 308 ? 19.225  10.578  47.706  1.00 41.91 ? 308 MET A CE  1 
ATOM   2394 N  N   . LEU A 1 309 ? 18.609  8.074   42.085  1.00 33.88 ? 309 LEU A N   1 
ATOM   2395 C  CA  . LEU A 1 309 ? 18.834  6.731   41.569  1.00 38.41 ? 309 LEU A CA  1 
ATOM   2396 C  C   . LEU A 1 309 ? 19.746  6.803   40.328  1.00 40.45 ? 309 LEU A C   1 
ATOM   2397 O  O   . LEU A 1 309 ? 20.617  5.956   40.132  1.00 42.02 ? 309 LEU A O   1 
ATOM   2398 C  CB  . LEU A 1 309 ? 17.505  6.045   41.236  1.00 39.63 ? 309 LEU A CB  1 
ATOM   2399 C  CG  . LEU A 1 309 ? 16.586  5.640   42.390  1.00 34.75 ? 309 LEU A CG  1 
ATOM   2400 C  CD1 . LEU A 1 309 ? 15.210  5.289   41.875  1.00 33.16 ? 309 LEU A CD1 1 
ATOM   2401 C  CD2 . LEU A 1 309 ? 17.168  4.462   43.140  1.00 33.58 ? 309 LEU A CD2 1 
ATOM   2402 N  N   . ASN A 1 310 ? 19.553  7.836   39.513  1.00 40.37 ? 310 ASN A N   1 
ATOM   2403 C  CA  . ASN A 1 310 ? 20.327  8.016   38.287  1.00 43.48 ? 310 ASN A CA  1 
ATOM   2404 C  C   . ASN A 1 310 ? 21.782  8.323   38.540  1.00 42.55 ? 310 ASN A C   1 
ATOM   2405 O  O   . ASN A 1 310 ? 22.654  7.774   37.892  1.00 47.90 ? 310 ASN A O   1 
ATOM   2406 C  CB  . ASN A 1 310 ? 19.730  9.136   37.440  1.00 46.85 ? 310 ASN A CB  1 
ATOM   2407 C  CG  . ASN A 1 310 ? 18.549  8.678   36.636  1.00 46.30 ? 310 ASN A CG  1 
ATOM   2408 O  OD1 . ASN A 1 310 ? 18.388  7.482   36.379  1.00 48.73 ? 310 ASN A OD1 1 
ATOM   2409 N  ND2 . ASN A 1 310 ? 17.707  9.624   36.229  1.00 46.33 ? 310 ASN A ND2 1 
ATOM   2410 N  N   . SER A 1 311 ? 22.035  9.203   39.500  1.00 46.51 ? 311 SER A N   1 
ATOM   2411 C  CA  . SER A 1 311 ? 23.387  9.642   39.806  1.00 42.79 ? 311 SER A CA  1 
ATOM   2412 C  C   . SER A 1 311 ? 24.103  8.681   40.756  1.00 43.95 ? 311 SER A C   1 
ATOM   2413 O  O   . SER A 1 311 ? 25.291  8.844   41.020  1.00 45.14 ? 311 SER A O   1 
ATOM   2414 C  CB  . SER A 1 311 ? 23.359  11.047  40.412  1.00 43.54 ? 311 SER A CB  1 
ATOM   2415 O  OG  . SER A 1 311 ? 22.785  11.026  41.709  1.00 45.13 ? 311 SER A OG  1 
ATOM   2416 N  N   . GLY A 1 312 ? 23.390  7.681   41.266  1.00 42.23 ? 312 GLY A N   1 
ATOM   2417 C  CA  . GLY A 1 312 ? 24.003  6.692   42.133  1.00 38.77 ? 312 GLY A CA  1 
ATOM   2418 C  C   . GLY A 1 312 ? 24.186  7.238   43.537  1.00 41.31 ? 312 GLY A C   1 
ATOM   2419 O  O   . GLY A 1 312 ? 24.889  6.665   44.372  1.00 39.08 ? 312 GLY A O   1 
ATOM   2420 N  N   . ASN A 1 313 ? 23.541  8.368   43.785  1.00 42.45 ? 313 ASN A N   1 
ATOM   2421 C  CA  . ASN A 1 313 ? 23.517  8.999   45.093  1.00 38.96 ? 313 ASN A CA  1 
ATOM   2422 C  C   . ASN A 1 313 ? 22.707  8.204   46.129  1.00 40.82 ? 313 ASN A C   1 
ATOM   2423 O  O   . ASN A 1 313 ? 21.570  8.560   46.438  1.00 42.64 ? 313 ASN A O   1 
ATOM   2424 C  CB  . ASN A 1 313 ? 22.946  10.407  44.946  1.00 40.13 ? 313 ASN A CB  1 
ATOM   2425 C  CG  . ASN A 1 313 ? 23.086  11.229  46.200  1.00 48.56 ? 313 ASN A CG  1 
ATOM   2426 O  OD1 . ASN A 1 313 ? 23.717  10.807  47.179  1.00 46.41 ? 313 ASN A OD1 1 
ATOM   2427 N  ND2 . ASN A 1 313 ? 22.505  12.428  46.177  1.00 50.09 ? 313 ASN A ND2 1 
ATOM   2428 N  N   . PHE A 1 314 ? 23.291  7.134   46.665  1.00 36.19 ? 314 PHE A N   1 
ATOM   2429 C  CA  . PHE A 1 314 ? 22.593  6.295   47.632  1.00 39.19 ? 314 PHE A CA  1 
ATOM   2430 C  C   . PHE A 1 314 ? 23.531  5.237   48.187  1.00 40.91 ? 314 PHE A C   1 
ATOM   2431 O  O   . PHE A 1 314 ? 24.626  5.043   47.663  1.00 39.98 ? 314 PHE A O   1 
ATOM   2432 C  CB  . PHE A 1 314 ? 21.346  5.642   47.006  1.00 36.42 ? 314 PHE A CB  1 
ATOM   2433 C  CG  . PHE A 1 314 ? 21.610  4.885   45.727  1.00 38.92 ? 314 PHE A CG  1 
ATOM   2434 C  CD1 . PHE A 1 314 ? 22.105  3.590   45.754  1.00 38.33 ? 314 PHE A CD1 1 
ATOM   2435 C  CD2 . PHE A 1 314 ? 21.324  5.460   44.488  1.00 42.10 ? 314 PHE A CD2 1 
ATOM   2436 C  CE1 . PHE A 1 314 ? 22.331  2.887   44.561  1.00 36.66 ? 314 PHE A CE1 1 
ATOM   2437 C  CE2 . PHE A 1 314 ? 21.553  4.766   43.299  1.00 37.12 ? 314 PHE A CE2 1 
ATOM   2438 C  CZ  . PHE A 1 314 ? 22.052  3.482   43.335  1.00 35.40 ? 314 PHE A CZ  1 
ATOM   2439 N  N   . LYS A 1 315 ? 23.108  4.563   49.251  1.00 37.45 ? 315 LYS A N   1 
ATOM   2440 C  CA  . LYS A 1 315 ? 23.967  3.585   49.920  1.00 39.30 ? 315 LYS A CA  1 
ATOM   2441 C  C   . LYS A 1 315 ? 24.254  2.408   49.005  1.00 39.03 ? 315 LYS A C   1 
ATOM   2442 O  O   . LYS A 1 315 ? 23.344  1.831   48.405  1.00 38.86 ? 315 LYS A O   1 
ATOM   2443 C  CB  . LYS A 1 315 ? 23.333  3.094   51.228  1.00 36.57 ? 315 LYS A CB  1 
ATOM   2444 C  CG  . LYS A 1 315 ? 24.158  2.048   51.975  1.00 38.48 ? 315 LYS A CG  1 
ATOM   2445 C  CD  . LYS A 1 315 ? 23.493  1.648   53.291  1.00 33.40 ? 315 LYS A CD  1 
ATOM   2446 C  CE  . LYS A 1 315 ? 24.281  0.585   54.047  1.00 34.75 ? 315 LYS A CE  1 
ATOM   2447 N  NZ  . LYS A 1 315 ? 25.482  1.147   54.763  1.00 35.71 ? 315 LYS A NZ  1 
ATOM   2448 N  N   . LYS A 1 316 ? 25.528  2.056   48.896  1.00 38.26 ? 316 LYS A N   1 
ATOM   2449 C  CA  . LYS A 1 316 ? 25.940  0.961   48.030  1.00 36.98 ? 316 LYS A CA  1 
ATOM   2450 C  C   . LYS A 1 316 ? 26.206  -0.281  48.852  1.00 36.65 ? 316 LYS A C   1 
ATOM   2451 O  O   . LYS A 1 316 ? 27.126  -0.305  49.669  1.00 43.11 ? 316 LYS A O   1 
ATOM   2452 C  CB  . LYS A 1 316 ? 27.159  1.387   47.221  1.00 36.48 ? 316 LYS A CB  1 
ATOM   2453 C  CG  . LYS A 1 316 ? 26.789  2.548   46.318  1.00 41.70 ? 316 LYS A CG  1 
ATOM   2454 C  CD  . LYS A 1 316 ? 27.949  3.091   45.526  1.00 50.83 ? 316 LYS A CD  1 
ATOM   2455 C  CE  . LYS A 1 316 ? 27.489  4.320   44.754  1.00 48.25 ? 316 LYS A CE  1 
ATOM   2456 N  NZ  . LYS A 1 316 ? 26.827  5.283   45.684  1.00 47.14 ? 316 LYS A NZ  1 
ATOM   2457 N  N   . THR A 1 317 ? 25.369  -1.299  48.675  1.00 36.13 ? 317 THR A N   1 
ATOM   2458 C  CA  . THR A 1 317 ? 25.432  -2.487  49.524  1.00 36.49 ? 317 THR A CA  1 
ATOM   2459 C  C   . THR A 1 317 ? 24.655  -3.609  48.845  1.00 33.89 ? 317 THR A C   1 
ATOM   2460 O  O   . THR A 1 317 ? 24.340  -3.506  47.672  1.00 36.77 ? 317 THR A O   1 
ATOM   2461 C  CB  . THR A 1 317 ? 24.884  -2.194  50.968  1.00 36.69 ? 317 THR A CB  1 
ATOM   2462 O  OG1 . THR A 1 317 ? 24.989  -3.365  51.783  1.00 37.59 ? 317 THR A OG1 1 
ATOM   2463 C  CG2 . THR A 1 317 ? 23.420  -1.743  50.945  1.00 33.46 ? 317 THR A CG2 1 
ATOM   2464 N  N   . GLN A 1 318 ? 24.374  -4.687  49.563  1.00 35.76 ? 318 GLN A N   1 
ATOM   2465 C  CA  . GLN A 1 318 ? 23.547  -5.757  49.025  1.00 35.54 ? 318 GLN A CA  1 
ATOM   2466 C  C   . GLN A 1 318 ? 22.075  -5.505  49.370  1.00 36.72 ? 318 GLN A C   1 
ATOM   2467 O  O   . GLN A 1 318 ? 21.757  -5.110  50.497  1.00 36.01 ? 318 GLN A O   1 
ATOM   2468 C  CB  . GLN A 1 318 ? 23.982  -7.121  49.566  1.00 33.80 ? 318 GLN A CB  1 
ATOM   2469 C  CG  . GLN A 1 318 ? 25.457  -7.467  49.325  1.00 42.63 ? 318 GLN A CG  1 
ATOM   2470 C  CD  . GLN A 1 318 ? 26.414  -6.762  50.281  1.00 42.43 ? 318 GLN A CD  1 
ATOM   2471 O  OE1 . GLN A 1 318 ? 26.159  -6.666  51.480  1.00 43.53 ? 318 GLN A OE1 1 
ATOM   2472 N  NE2 . GLN A 1 318 ? 27.524  -6.265  49.746  1.00 46.73 ? 318 GLN A NE2 1 
ATOM   2473 N  N   . ILE A 1 319 ? 21.186  -5.725  48.399  1.00 30.90 ? 319 ILE A N   1 
ATOM   2474 C  CA  . ILE A 1 319 ? 19.751  -5.715  48.655  1.00 30.54 ? 319 ILE A CA  1 
ATOM   2475 C  C   . ILE A 1 319 ? 19.110  -7.036  48.242  1.00 33.44 ? 319 ILE A C   1 
ATOM   2476 O  O   . ILE A 1 319 ? 19.577  -7.719  47.330  1.00 33.75 ? 319 ILE A O   1 
ATOM   2477 C  CB  . ILE A 1 319 ? 19.035  -4.575  47.919  1.00 31.59 ? 319 ILE A CB  1 
ATOM   2478 C  CG1 . ILE A 1 319 ? 19.100  -4.793  46.405  1.00 31.27 ? 319 ILE A CG1 1 
ATOM   2479 C  CG2 . ILE A 1 319 ? 19.641  -3.241  48.289  1.00 33.11 ? 319 ILE A CG2 1 
ATOM   2480 C  CD1 . ILE A 1 319 ? 18.485  -3.669  45.630  1.00 37.56 ? 319 ILE A CD1 1 
ATOM   2481 N  N   . LEU A 1 320 ? 18.039  -7.391  48.937  1.00 32.78 ? 320 LEU A N   1 
ATOM   2482 C  CA  . LEU A 1 320 ? 17.249  -8.561  48.605  1.00 33.81 ? 320 LEU A CA  1 
ATOM   2483 C  C   . LEU A 1 320 ? 15.787  -8.139  48.656  1.00 37.46 ? 320 LEU A C   1 
ATOM   2484 O  O   . LEU A 1 320 ? 15.322  -7.615  49.668  1.00 35.29 ? 320 LEU A O   1 
ATOM   2485 C  CB  . LEU A 1 320 ? 17.540  -9.719  49.559  1.00 32.35 ? 320 LEU A CB  1 
ATOM   2486 C  CG  . LEU A 1 320 ? 16.753  -11.013 49.320  1.00 37.17 ? 320 LEU A CG  1 
ATOM   2487 C  CD1 . LEU A 1 320 ? 17.486  -12.221 49.903  1.00 36.91 ? 320 LEU A CD1 1 
ATOM   2488 C  CD2 . LEU A 1 320 ? 15.321  -10.925 49.879  1.00 34.51 ? 320 LEU A CD2 1 
ATOM   2489 N  N   . LEU A 1 321 ? 15.067  -8.341  47.556  1.00 34.94 ? 321 LEU A N   1 
ATOM   2490 C  CA  . LEU A 1 321 ? 13.755  -7.743  47.418  1.00 32.64 ? 321 LEU A CA  1 
ATOM   2491 C  C   . LEU A 1 321 ? 12.873  -8.537  46.461  1.00 36.65 ? 321 LEU A C   1 
ATOM   2492 O  O   . LEU A 1 321 ? 13.369  -9.340  45.663  1.00 34.73 ? 321 LEU A O   1 
ATOM   2493 C  CB  . LEU A 1 321 ? 13.883  -6.296  46.940  1.00 29.34 ? 321 LEU A CB  1 
ATOM   2494 C  CG  . LEU A 1 321 ? 14.355  -6.055  45.504  1.00 35.05 ? 321 LEU A CG  1 
ATOM   2495 C  CD1 . LEU A 1 321 ? 14.300  -4.563  45.165  1.00 33.03 ? 321 LEU A CD1 1 
ATOM   2496 C  CD2 . LEU A 1 321 ? 15.763  -6.602  45.262  1.00 32.43 ? 321 LEU A CD2 1 
ATOM   2497 N  N   . GLY A 1 322 ? 11.567  -8.304  46.551  1.00 33.66 ? 322 GLY A N   1 
ATOM   2498 C  CA  . GLY A 1 322 ? 10.598  -9.040  45.760  1.00 36.04 ? 322 GLY A CA  1 
ATOM   2499 C  C   . GLY A 1 322 ? 9.152   -8.599  45.939  1.00 37.48 ? 322 GLY A C   1 
ATOM   2500 O  O   . GLY A 1 322 ? 8.851   -7.697  46.721  1.00 33.98 ? 322 GLY A O   1 
ATOM   2501 N  N   . VAL A 1 323 ? 8.263   -9.255  45.197  1.00 36.89 ? 323 VAL A N   1 
ATOM   2502 C  CA  . VAL A 1 323 ? 6.849   -8.921  45.153  1.00 33.55 ? 323 VAL A CA  1 
ATOM   2503 C  C   . VAL A 1 323 ? 6.025   -10.203 45.269  1.00 36.80 ? 323 VAL A C   1 
ATOM   2504 O  O   . VAL A 1 323 ? 6.559   -11.302 45.100  1.00 35.10 ? 323 VAL A O   1 
ATOM   2505 C  CB  . VAL A 1 323 ? 6.481   -8.193  43.835  1.00 35.99 ? 323 VAL A CB  1 
ATOM   2506 C  CG1 . VAL A 1 323 ? 7.330   -6.946  43.639  1.00 31.36 ? 323 VAL A CG1 1 
ATOM   2507 C  CG2 . VAL A 1 323 ? 6.638   -9.134  42.654  1.00 33.45 ? 323 VAL A CG2 1 
ATOM   2508 N  N   . ASN A 1 324 ? 4.734   -10.065 45.566  1.00 31.11 ? 324 ASN A N   1 
ATOM   2509 C  CA  . ASN A 1 324 ? 3.809   -11.194 45.510  1.00 33.82 ? 324 ASN A CA  1 
ATOM   2510 C  C   . ASN A 1 324 ? 3.048   -11.205 44.183  1.00 36.16 ? 324 ASN A C   1 
ATOM   2511 O  O   . ASN A 1 324 ? 2.992   -10.189 43.490  1.00 34.47 ? 324 ASN A O   1 
ATOM   2512 C  CB  . ASN A 1 324 ? 2.818   -11.144 46.667  1.00 36.19 ? 324 ASN A CB  1 
ATOM   2513 C  CG  . ASN A 1 324 ? 3.487   -11.311 48.013  1.00 37.39 ? 324 ASN A CG  1 
ATOM   2514 O  OD1 . ASN A 1 324 ? 4.710   -11.428 48.100  1.00 37.86 ? 324 ASN A OD1 1 
ATOM   2515 N  ND2 . ASN A 1 324 ? 2.686   -11.313 49.076  1.00 35.22 ? 324 ASN A ND2 1 
ATOM   2516 N  N   . LYS A 1 325 ? 2.446   -12.340 43.837  1.00 37.21 ? 325 LYS A N   1 
ATOM   2517 C  CA  . LYS A 1 325 ? 1.806   -12.472 42.527  1.00 37.81 ? 325 LYS A CA  1 
ATOM   2518 C  C   . LYS A 1 325 ? 0.613   -11.535 42.341  1.00 38.89 ? 325 LYS A C   1 
ATOM   2519 O  O   . LYS A 1 325 ? 0.441   -10.956 41.274  1.00 39.13 ? 325 LYS A O   1 
ATOM   2520 C  CB  . LYS A 1 325 ? 1.355   -13.916 42.274  1.00 38.03 ? 325 LYS A CB  1 
ATOM   2521 C  CG  . LYS A 1 325 ? 0.761   -14.099 40.882  1.00 39.79 ? 325 LYS A CG  1 
ATOM   2522 C  CD  . LYS A 1 325 ? -0.062  -15.364 40.757  1.00 44.21 ? 325 LYS A CD  1 
ATOM   2523 C  CE  . LYS A 1 325 ? -0.902  -15.308 39.470  1.00 54.13 ? 325 LYS A CE  1 
ATOM   2524 N  NZ  . LYS A 1 325 ? -1.859  -16.443 39.334  1.00 57.81 ? 325 LYS A NZ  1 
ATOM   2525 N  N   . ASP A 1 326 ? -0.212  -11.384 43.368  1.00 36.50 ? 326 ASP A N   1 
ATOM   2526 C  CA  . ASP A 1 326 ? -1.420  -10.576 43.215  1.00 39.88 ? 326 ASP A CA  1 
ATOM   2527 C  C   . ASP A 1 326 ? -1.482  -9.418  44.195  1.00 40.09 ? 326 ASP A C   1 
ATOM   2528 O  O   . ASP A 1 326 ? -2.386  -9.350  45.032  1.00 36.30 ? 326 ASP A O   1 
ATOM   2529 C  CB  . ASP A 1 326 ? -2.658  -11.448 43.375  1.00 37.62 ? 326 ASP A CB  1 
ATOM   2530 C  CG  . ASP A 1 326 ? -2.654  -12.620 42.423  1.00 40.69 ? 326 ASP A CG  1 
ATOM   2531 O  OD1 . ASP A 1 326 ? -2.962  -12.407 41.229  1.00 45.64 ? 326 ASP A OD1 1 
ATOM   2532 O  OD2 . ASP A 1 326 ? -2.333  -13.744 42.864  1.00 38.85 ? 326 ASP A OD2 1 
ATOM   2533 N  N   . GLU A 1 327 ? -0.528  -8.504  44.064  1.00 35.45 ? 327 GLU A N   1 
ATOM   2534 C  CA  . GLU A 1 327 ? -0.404  -7.361  44.956  1.00 38.06 ? 327 GLU A CA  1 
ATOM   2535 C  C   . GLU A 1 327 ? -1.684  -6.513  45.005  1.00 35.61 ? 327 GLU A C   1 
ATOM   2536 O  O   . GLU A 1 327 ? -2.021  -5.947  46.045  1.00 34.10 ? 327 GLU A O   1 
ATOM   2537 C  CB  . GLU A 1 327 ? 0.780   -6.485  44.519  1.00 33.96 ? 327 GLU A CB  1 
ATOM   2538 C  CG  . GLU A 1 327 ? 2.152   -7.172  44.551  1.00 32.51 ? 327 GLU A CG  1 
ATOM   2539 C  CD  . GLU A 1 327 ? 2.692   -7.348  45.963  1.00 38.49 ? 327 GLU A CD  1 
ATOM   2540 O  OE1 . GLU A 1 327 ? 1.970   -7.028  46.931  1.00 37.10 ? 327 GLU A OE1 1 
ATOM   2541 O  OE2 . GLU A 1 327 ? 3.850   -7.804  46.108  1.00 38.30 ? 327 GLU A OE2 1 
ATOM   2542 N  N   . GLY A 1 328 ? -2.397  -6.445  43.885  1.00 32.62 ? 328 GLY A N   1 
ATOM   2543 C  CA  . GLY A 1 328 ? -3.487  -5.496  43.730  1.00 34.33 ? 328 GLY A CA  1 
ATOM   2544 C  C   . GLY A 1 328 ? -4.847  -5.828  44.338  1.00 32.92 ? 328 GLY A C   1 
ATOM   2545 O  O   . GLY A 1 328 ? -5.633  -4.928  44.600  1.00 29.93 ? 328 GLY A O   1 
ATOM   2546 N  N   . SER A 1 329 ? -5.125  -7.107  44.565  1.00 33.14 ? 329 SER A N   1 
ATOM   2547 C  CA  . SER A 1 329 ? -6.491  -7.553  44.841  1.00 36.05 ? 329 SER A CA  1 
ATOM   2548 C  C   . SER A 1 329 ? -7.096  -6.955  46.117  1.00 34.36 ? 329 SER A C   1 
ATOM   2549 O  O   . SER A 1 329 ? -8.274  -6.590  46.137  1.00 30.97 ? 329 SER A O   1 
ATOM   2550 C  CB  . SER A 1 329 ? -6.539  -9.084  44.917  1.00 36.66 ? 329 SER A CB  1 
ATOM   2551 O  OG  . SER A 1 329 ? -5.694  -9.569  45.942  1.00 32.80 ? 329 SER A OG  1 
ATOM   2552 N  N   . PHE A 1 330 ? -6.285  -6.842  47.162  1.00 33.81 ? 330 PHE A N   1 
ATOM   2553 C  CA  . PHE A 1 330 ? -6.719  -6.243  48.417  1.00 33.16 ? 330 PHE A CA  1 
ATOM   2554 C  C   . PHE A 1 330 ? -7.361  -4.875  48.211  1.00 32.47 ? 330 PHE A C   1 
ATOM   2555 O  O   . PHE A 1 330 ? -8.393  -4.567  48.812  1.00 32.39 ? 330 PHE A O   1 
ATOM   2556 C  CB  . PHE A 1 330 ? -5.524  -6.121  49.371  1.00 36.05 ? 330 PHE A CB  1 
ATOM   2557 C  CG  . PHE A 1 330 ? -5.846  -6.424  50.807  1.00 36.04 ? 330 PHE A CG  1 
ATOM   2558 C  CD1 . PHE A 1 330 ? -7.001  -5.941  51.396  1.00 36.42 ? 330 PHE A CD1 1 
ATOM   2559 C  CD2 . PHE A 1 330 ? -4.970  -7.186  51.576  1.00 45.66 ? 330 PHE A CD2 1 
ATOM   2560 C  CE1 . PHE A 1 330 ? -7.291  -6.215  52.717  1.00 41.30 ? 330 PHE A CE1 1 
ATOM   2561 C  CE2 . PHE A 1 330 ? -5.244  -7.466  52.903  1.00 40.41 ? 330 PHE A CE2 1 
ATOM   2562 C  CZ  . PHE A 1 330 ? -6.415  -6.980  53.474  1.00 44.24 ? 330 PHE A CZ  1 
ATOM   2563 N  N   . PHE A 1 331 ? -6.759  -4.064  47.350  1.00 29.74 ? 331 PHE A N   1 
ATOM   2564 C  CA  . PHE A 1 331 ? -7.199  -2.687  47.173  1.00 33.15 ? 331 PHE A CA  1 
ATOM   2565 C  C   . PHE A 1 331 ? -8.427  -2.558  46.267  1.00 36.13 ? 331 PHE A C   1 
ATOM   2566 O  O   . PHE A 1 331 ? -9.195  -1.607  46.401  1.00 37.67 ? 331 PHE A O   1 
ATOM   2567 C  CB  . PHE A 1 331 ? -6.042  -1.836  46.640  1.00 32.99 ? 331 PHE A CB  1 
ATOM   2568 C  CG  . PHE A 1 331 ? -4.830  -1.858  47.540  1.00 34.32 ? 331 PHE A CG  1 
ATOM   2569 C  CD1 . PHE A 1 331 ? -3.891  -2.876  47.440  1.00 31.10 ? 331 PHE A CD1 1 
ATOM   2570 C  CD2 . PHE A 1 331 ? -4.656  -0.881  48.518  1.00 35.36 ? 331 PHE A CD2 1 
ATOM   2571 C  CE1 . PHE A 1 331 ? -2.785  -2.908  48.303  1.00 36.17 ? 331 PHE A CE1 1 
ATOM   2572 C  CE2 . PHE A 1 331 ? -3.560  -0.904  49.369  1.00 37.13 ? 331 PHE A CE2 1 
ATOM   2573 C  CZ  . PHE A 1 331 ? -2.623  -1.916  49.263  1.00 34.36 ? 331 PHE A CZ  1 
ATOM   2574 N  N   . LEU A 1 332 ? -8.618  -3.510  45.356  1.00 34.02 ? 332 LEU A N   1 
ATOM   2575 C  CA  . LEU A 1 332 ? -9.828  -3.551  44.534  1.00 32.98 ? 332 LEU A CA  1 
ATOM   2576 C  C   . LEU A 1 332 ? -11.033 -3.900  45.411  1.00 36.99 ? 332 LEU A C   1 
ATOM   2577 O  O   . LEU A 1 332 ? -12.121 -3.334  45.265  1.00 35.07 ? 332 LEU A O   1 
ATOM   2578 C  CB  . LEU A 1 332 ? -9.675  -4.570  43.395  1.00 32.66 ? 332 LEU A CB  1 
ATOM   2579 C  CG  . LEU A 1 332 ? -8.655  -4.141  42.339  1.00 33.33 ? 332 LEU A CG  1 
ATOM   2580 C  CD1 . LEU A 1 332 ? -8.244  -5.308  41.451  1.00 28.59 ? 332 LEU A CD1 1 
ATOM   2581 C  CD2 . LEU A 1 332 ? -9.244  -2.997  41.530  1.00 29.26 ? 332 LEU A CD2 1 
ATOM   2582 N  N   . LEU A 1 333 ? -10.807 -4.834  46.327  1.00 33.62 ? 333 LEU A N   1 
ATOM   2583 C  CA  . LEU A 1 333 ? -11.811 -5.241  47.291  1.00 37.70 ? 333 LEU A CA  1 
ATOM   2584 C  C   . LEU A 1 333 ? -12.374 -4.051  48.057  1.00 38.30 ? 333 LEU A C   1 
ATOM   2585 O  O   . LEU A 1 333 ? -13.569 -3.982  48.290  1.00 39.07 ? 333 LEU A O   1 
ATOM   2586 C  CB  . LEU A 1 333 ? -11.219 -6.253  48.267  1.00 37.30 ? 333 LEU A CB  1 
ATOM   2587 C  CG  . LEU A 1 333 ? -12.242 -6.815  49.237  1.00 38.91 ? 333 LEU A CG  1 
ATOM   2588 C  CD1 . LEU A 1 333 ? -13.338 -7.472  48.423  1.00 38.33 ? 333 LEU A CD1 1 
ATOM   2589 C  CD2 . LEU A 1 333 ? -11.590 -7.815  50.167  1.00 33.16 ? 333 LEU A CD2 1 
ATOM   2590 N  N   . TYR A 1 334 ? -11.512 -3.100  48.408  1.00 37.19 ? 334 TYR A N   1 
ATOM   2591 C  CA  . TYR A 1 334 ? -11.908 -2.000  49.286  1.00 39.77 ? 334 TYR A CA  1 
ATOM   2592 C  C   . TYR A 1 334 ? -12.426 -0.763  48.567  1.00 40.38 ? 334 TYR A C   1 
ATOM   2593 O  O   . TYR A 1 334 ? -13.190 0.012   49.139  1.00 47.59 ? 334 TYR A O   1 
ATOM   2594 C  CB  . TYR A 1 334 ? -10.735 -1.598  50.189  1.00 39.62 ? 334 TYR A CB  1 
ATOM   2595 C  CG  . TYR A 1 334 ? -10.654 -2.436  51.434  1.00 39.03 ? 334 TYR A CG  1 
ATOM   2596 C  CD1 . TYR A 1 334 ? -10.362 -3.790  51.357  1.00 38.53 ? 334 TYR A CD1 1 
ATOM   2597 C  CD2 . TYR A 1 334 ? -10.888 -1.882  52.686  1.00 41.27 ? 334 TYR A CD2 1 
ATOM   2598 C  CE1 . TYR A 1 334 ? -10.293 -4.570  52.488  1.00 38.94 ? 334 TYR A CE1 1 
ATOM   2599 C  CE2 . TYR A 1 334 ? -10.827 -2.661  53.828  1.00 37.75 ? 334 TYR A CE2 1 
ATOM   2600 C  CZ  . TYR A 1 334 ? -10.528 -4.002  53.719  1.00 37.99 ? 334 TYR A CZ  1 
ATOM   2601 O  OH  . TYR A 1 334 ? -10.459 -4.798  54.832  1.00 37.21 ? 334 TYR A OH  1 
ATOM   2602 N  N   . GLY A 1 335 ? -12.024 -0.556  47.328  1.00 36.54 ? 335 GLY A N   1 
ATOM   2603 C  CA  . GLY A 1 335 ? -12.420 0.667   46.667  1.00 39.96 ? 335 GLY A CA  1 
ATOM   2604 C  C   . GLY A 1 335 ? -12.992 0.598   45.261  1.00 37.74 ? 335 GLY A C   1 
ATOM   2605 O  O   . GLY A 1 335 ? -13.366 1.634   44.742  1.00 42.46 ? 335 GLY A O   1 
ATOM   2606 N  N   . ALA A 1 336 ? -13.061 -0.576  44.633  1.00 34.46 ? 336 ALA A N   1 
ATOM   2607 C  CA  . ALA A 1 336 ? -13.523 -0.633  43.227  1.00 37.86 ? 336 ALA A CA  1 
ATOM   2608 C  C   . ALA A 1 336 ? -14.852 -1.378  43.053  1.00 33.85 ? 336 ALA A C   1 
ATOM   2609 O  O   . ALA A 1 336 ? -15.108 -2.381  43.713  1.00 37.84 ? 336 ALA A O   1 
ATOM   2610 C  CB  . ALA A 1 336 ? -12.445 -1.265  42.326  1.00 28.51 ? 336 ALA A CB  1 
ATOM   2611 N  N   . PRO A 1 337 ? -15.706 -0.886  42.151  1.00 37.47 ? 337 PRO A N   1 
ATOM   2612 C  CA  . PRO A 1 337 ? -17.031 -1.491  41.955  1.00 34.47 ? 337 PRO A CA  1 
ATOM   2613 C  C   . PRO A 1 337 ? -16.964 -2.925  41.432  1.00 35.77 ? 337 PRO A C   1 
ATOM   2614 O  O   . PRO A 1 337 ? -16.095 -3.244  40.624  1.00 35.54 ? 337 PRO A O   1 
ATOM   2615 C  CB  . PRO A 1 337 ? -17.676 -0.570  40.921  1.00 39.13 ? 337 PRO A CB  1 
ATOM   2616 C  CG  . PRO A 1 337 ? -16.515 0.036   40.188  1.00 37.37 ? 337 PRO A CG  1 
ATOM   2617 C  CD  . PRO A 1 337 ? -15.473 0.242   41.233  1.00 35.00 ? 337 PRO A CD  1 
ATOM   2618 N  N   . GLY A 1 338 ? -17.878 -3.772  41.892  1.00 34.76 ? 338 GLY A N   1 
ATOM   2619 C  CA  . GLY A 1 338 ? -18.003 -5.136  41.403  1.00 32.00 ? 338 GLY A CA  1 
ATOM   2620 C  C   . GLY A 1 338 ? -17.248 -6.161  42.227  1.00 36.47 ? 338 GLY A C   1 
ATOM   2621 O  O   . GLY A 1 338 ? -17.426 -7.369  42.067  1.00 36.16 ? 338 GLY A O   1 
ATOM   2622 N  N   . PHE A 1 339 ? -16.386 -5.684  43.117  1.00 37.56 ? 339 PHE A N   1 
ATOM   2623 C  CA  . PHE A 1 339 ? -15.582 -6.593  43.930  1.00 38.27 ? 339 PHE A CA  1 
ATOM   2624 C  C   . PHE A 1 339 ? -16.232 -6.862  45.271  1.00 41.12 ? 339 PHE A C   1 
ATOM   2625 O  O   . PHE A 1 339 ? -16.793 -5.961  45.901  1.00 43.14 ? 339 PHE A O   1 
ATOM   2626 C  CB  . PHE A 1 339 ? -14.175 -6.040  44.137  1.00 35.36 ? 339 PHE A CB  1 
ATOM   2627 C  CG  . PHE A 1 339 ? -13.358 -6.007  42.880  1.00 34.40 ? 339 PHE A CG  1 
ATOM   2628 C  CD1 . PHE A 1 339 ? -12.624 -7.108  42.488  1.00 33.10 ? 339 PHE A CD1 1 
ATOM   2629 C  CD2 . PHE A 1 339 ? -13.346 -4.883  42.080  1.00 34.41 ? 339 PHE A CD2 1 
ATOM   2630 C  CE1 . PHE A 1 339 ? -11.883 -7.082  41.333  1.00 31.19 ? 339 PHE A CE1 1 
ATOM   2631 C  CE2 . PHE A 1 339 ? -12.601 -4.855  40.920  1.00 34.04 ? 339 PHE A CE2 1 
ATOM   2632 C  CZ  . PHE A 1 339 ? -11.870 -5.957  40.552  1.00 34.94 ? 339 PHE A CZ  1 
ATOM   2633 N  N   . SER A 1 340 ? -16.142 -8.115  45.698  1.00 38.24 ? 340 SER A N   1 
ATOM   2634 C  CA  . SER A 1 340 ? -16.716 -8.544  46.948  1.00 36.33 ? 340 SER A CA  1 
ATOM   2635 C  C   . SER A 1 340 ? -15.911 -9.690  47.523  1.00 42.13 ? 340 SER A C   1 
ATOM   2636 O  O   . SER A 1 340 ? -15.425 -10.554 46.792  1.00 39.21 ? 340 SER A O   1 
ATOM   2637 C  CB  . SER A 1 340 ? -18.168 -8.966  46.761  1.00 39.51 ? 340 SER A CB  1 
ATOM   2638 O  OG  . SER A 1 340 ? -18.503 -10.006 47.661  1.00 43.63 ? 340 SER A OG  1 
ATOM   2639 N  N   . LYS A 1 341 ? -15.794 -9.685  48.849  1.00 40.26 ? 341 LYS A N   1 
ATOM   2640 C  CA  . LYS A 1 341 ? -15.050 -10.692 49.578  1.00 42.24 ? 341 LYS A CA  1 
ATOM   2641 C  C   . LYS A 1 341 ? -15.730 -12.042 49.457  1.00 40.75 ? 341 LYS A C   1 
ATOM   2642 O  O   . LYS A 1 341 ? -15.086 -13.082 49.581  1.00 41.27 ? 341 LYS A O   1 
ATOM   2643 C  CB  . LYS A 1 341 ? -14.919 -10.270 51.054  1.00 42.45 ? 341 LYS A CB  1 
ATOM   2644 C  CG  . LYS A 1 341 ? -14.631 -11.389 52.028  1.00 43.56 ? 341 LYS A CG  1 
ATOM   2645 C  CD  . LYS A 1 341 ? -14.328 -10.840 53.421  1.00 43.04 ? 341 LYS A CD  1 
ATOM   2646 C  CE  . LYS A 1 341 ? -15.463 -11.125 54.375  1.00 43.59 ? 341 LYS A CE  1 
ATOM   2647 N  NZ  . LYS A 1 341 ? -15.816 -12.570 54.329  1.00 46.66 ? 341 LYS A NZ  1 
ATOM   2648 N  N   . ASP A 1 342 ? -17.034 -12.012 49.199  1.00 40.86 ? 342 ASP A N   1 
ATOM   2649 C  CA  . ASP A 1 342 ? -17.875 -13.203 49.268  1.00 42.60 ? 342 ASP A CA  1 
ATOM   2650 C  C   . ASP A 1 342 ? -18.354 -13.726 47.904  1.00 47.85 ? 342 ASP A C   1 
ATOM   2651 O  O   . ASP A 1 342 ? -19.268 -14.552 47.838  1.00 46.65 ? 342 ASP A O   1 
ATOM   2652 C  CB  . ASP A 1 342 ? -19.090 -12.907 50.153  1.00 48.35 ? 342 ASP A CB  1 
ATOM   2653 C  CG  . ASP A 1 342 ? -18.694 -12.409 51.536  1.00 47.54 ? 342 ASP A CG  1 
ATOM   2654 O  OD1 . ASP A 1 342 ? -17.874 -13.087 52.193  1.00 47.50 ? 342 ASP A OD1 1 
ATOM   2655 O  OD2 . ASP A 1 342 ? -19.175 -11.330 51.958  1.00 43.94 ? 342 ASP A OD2 1 
ATOM   2656 N  N   . SER A 1 343 ? -17.754 -13.245 46.821  1.00 43.91 ? 343 SER A N   1 
ATOM   2657 C  CA  . SER A 1 343 ? -18.093 -13.749 45.491  1.00 46.25 ? 343 SER A CA  1 
ATOM   2658 C  C   . SER A 1 343 ? -16.868 -13.786 44.599  1.00 43.56 ? 343 SER A C   1 
ATOM   2659 O  O   . SER A 1 343 ? -15.813 -13.247 44.943  1.00 44.67 ? 343 SER A O   1 
ATOM   2660 C  CB  . SER A 1 343 ? -19.182 -12.897 44.834  1.00 44.39 ? 343 SER A CB  1 
ATOM   2661 O  OG  . SER A 1 343 ? -18.624 -11.755 44.213  1.00 44.26 ? 343 SER A OG  1 
ATOM   2662 N  N   . GLU A 1 344 ? -17.017 -14.429 43.448  1.00 45.13 ? 344 GLU A N   1 
ATOM   2663 C  CA  . GLU A 1 344 ? -15.942 -14.512 42.471  1.00 38.94 ? 344 GLU A CA  1 
ATOM   2664 C  C   . GLU A 1 344 ? -15.539 -13.154 41.952  1.00 38.22 ? 344 GLU A C   1 
ATOM   2665 O  O   . GLU A 1 344 ? -14.414 -12.978 41.497  1.00 43.49 ? 344 GLU A O   1 
ATOM   2666 C  CB  . GLU A 1 344 ? -16.349 -15.383 41.301  1.00 48.51 ? 344 GLU A CB  1 
ATOM   2667 C  CG  . GLU A 1 344 ? -16.134 -16.848 41.530  1.00 51.90 ? 344 GLU A CG  1 
ATOM   2668 C  CD  . GLU A 1 344 ? -16.637 -17.645 40.366  1.00 59.65 ? 344 GLU A CD  1 
ATOM   2669 O  OE1 . GLU A 1 344 ? -15.922 -18.569 39.922  1.00 66.19 ? 344 GLU A OE1 1 
ATOM   2670 O  OE2 . GLU A 1 344 ? -17.748 -17.328 39.883  1.00 61.52 ? 344 GLU A OE2 1 
ATOM   2671 N  N   . SER A 1 345 ? -16.457 -12.201 42.008  1.00 36.12 ? 345 SER A N   1 
ATOM   2672 C  CA  . SER A 1 345 ? -16.152 -10.838 41.611  1.00 37.59 ? 345 SER A CA  1 
ATOM   2673 C  C   . SER A 1 345 ? -15.822 -10.789 40.124  1.00 39.32 ? 345 SER A C   1 
ATOM   2674 O  O   . SER A 1 345 ? -14.808 -10.211 39.715  1.00 35.72 ? 345 SER A O   1 
ATOM   2675 C  CB  . SER A 1 345 ? -14.987 -10.274 42.427  1.00 37.40 ? 345 SER A CB  1 
ATOM   2676 O  OG  . SER A 1 345 ? -15.267 -10.299 43.817  1.00 40.77 ? 345 SER A OG  1 
ATOM   2677 N  N   . LYS A 1 346 ? -16.680 -11.414 39.323  1.00 37.74 ? 346 LYS A N   1 
ATOM   2678 C  CA  . LYS A 1 346 ? -16.626 -11.244 37.883  1.00 36.17 ? 346 LYS A CA  1 
ATOM   2679 C  C   . LYS A 1 346 ? -16.951 -9.795  37.626  1.00 36.40 ? 346 LYS A C   1 
ATOM   2680 O  O   . LYS A 1 346 ? -17.901 -9.249  38.196  1.00 42.86 ? 346 LYS A O   1 
ATOM   2681 C  CB  . LYS A 1 346 ? -17.592 -12.188 37.183  1.00 40.18 ? 346 LYS A CB  1 
ATOM   2682 C  CG  . LYS A 1 346 ? -17.227 -13.647 37.395  1.00 44.09 ? 346 LYS A CG  1 
ATOM   2683 C  CD  . LYS A 1 346 ? -18.382 -14.568 37.083  1.00 53.46 ? 346 LYS A CD  1 
ATOM   2684 C  CE  . LYS A 1 346 ? -17.895 -15.990 36.852  1.00 53.89 ? 346 LYS A CE  1 
ATOM   2685 N  NZ  . LYS A 1 346 ? -18.250 -16.431 35.469  1.00 64.08 ? 346 LYS A NZ  1 
ATOM   2686 N  N   . ILE A 1 347 ? -16.123 -9.164  36.813  1.00 34.63 ? 347 ILE A N   1 
ATOM   2687 C  CA  . ILE A 1 347 ? -16.167 -7.730  36.612  1.00 36.60 ? 347 ILE A CA  1 
ATOM   2688 C  C   . ILE A 1 347 ? -16.728 -7.380  35.227  1.00 39.04 ? 347 ILE A C   1 
ATOM   2689 O  O   . ILE A 1 347 ? -16.169 -7.764  34.195  1.00 36.85 ? 347 ILE A O   1 
ATOM   2690 C  CB  . ILE A 1 347 ? -14.753 -7.124  36.790  1.00 34.35 ? 347 ILE A CB  1 
ATOM   2691 C  CG1 . ILE A 1 347 ? -14.280 -7.326  38.232  1.00 37.93 ? 347 ILE A CG1 1 
ATOM   2692 C  CG2 . ILE A 1 347 ? -14.739 -5.651  36.476  1.00 34.75 ? 347 ILE A CG2 1 
ATOM   2693 C  CD1 . ILE A 1 347 ? -15.144 -6.603  39.239  1.00 35.21 ? 347 ILE A CD1 1 
ATOM   2694 N  N   . SER A 1 348 ? -17.845 -6.656  35.223  1.00 39.76 ? 348 SER A N   1 
ATOM   2695 C  CA  . SER A 1 348 ? -18.457 -6.188  33.992  1.00 37.58 ? 348 SER A CA  1 
ATOM   2696 C  C   . SER A 1 348 ? -17.500 -5.242  33.293  1.00 39.42 ? 348 SER A C   1 
ATOM   2697 O  O   . SER A 1 348 ? -16.510 -4.801  33.882  1.00 37.65 ? 348 SER A O   1 
ATOM   2698 C  CB  . SER A 1 348 ? -19.785 -5.479  34.263  1.00 37.73 ? 348 SER A CB  1 
ATOM   2699 O  OG  . SER A 1 348 ? -19.560 -4.183  34.802  1.00 40.28 ? 348 SER A OG  1 
ATOM   2700 N  N   . ARG A 1 349 ? -17.801 -4.928  32.041  1.00 38.32 ? 349 ARG A N   1 
ATOM   2701 C  CA  . ARG A 1 349 ? -16.974 -4.011  31.276  1.00 41.29 ? 349 ARG A CA  1 
ATOM   2702 C  C   . ARG A 1 349 ? -17.045 -2.597  31.849  1.00 36.57 ? 349 ARG A C   1 
ATOM   2703 O  O   . ARG A 1 349 ? -16.049 -1.888  31.907  1.00 36.96 ? 349 ARG A O   1 
ATOM   2704 C  CB  . ARG A 1 349 ? -17.400 -4.006  29.806  1.00 35.03 ? 349 ARG A CB  1 
ATOM   2705 C  CG  . ARG A 1 349 ? -16.472 -3.239  28.948  1.00 38.58 ? 349 ARG A CG  1 
ATOM   2706 C  CD  . ARG A 1 349 ? -15.236 -4.064  28.691  1.00 42.70 ? 349 ARG A CD  1 
ATOM   2707 N  NE  . ARG A 1 349 ? -14.111 -3.218  28.342  1.00 46.43 ? 349 ARG A NE  1 
ATOM   2708 C  CZ  . ARG A 1 349 ? -12.846 -3.578  28.503  1.00 44.10 ? 349 ARG A CZ  1 
ATOM   2709 N  NH1 . ARG A 1 349 ? -12.554 -4.772  29.006  1.00 40.77 ? 349 ARG A NH1 1 
ATOM   2710 N  NH2 . ARG A 1 349 ? -11.880 -2.745  28.157  1.00 42.39 ? 349 ARG A NH2 1 
ATOM   2711 N  N   . GLU A 1 350 ? -18.237 -2.196  32.263  1.00 41.03 ? 350 GLU A N   1 
ATOM   2712 C  CA  . GLU A 1 350 ? -18.452 -0.891  32.871  1.00 41.26 ? 350 GLU A CA  1 
ATOM   2713 C  C   . GLU A 1 350 ? -17.622 -0.750  34.149  1.00 35.33 ? 350 GLU A C   1 
ATOM   2714 O  O   . GLU A 1 350 ? -16.983 0.276   34.366  1.00 33.52 ? 350 GLU A O   1 
ATOM   2715 C  CB  . GLU A 1 350 ? -19.945 -0.685  33.163  1.00 42.57 ? 350 GLU A CB  1 
ATOM   2716 C  CG  . GLU A 1 350 ? -20.322 0.725   33.621  1.00 46.89 ? 350 GLU A CG  1 
ATOM   2717 C  CD  . GLU A 1 350 ? -21.824 0.882   33.843  1.00 52.41 ? 350 GLU A CD  1 
ATOM   2718 O  OE1 . GLU A 1 350 ? -22.600 0.599   32.909  1.00 57.55 ? 350 GLU A OE1 1 
ATOM   2719 O  OE2 . GLU A 1 350 ? -22.228 1.279   34.958  1.00 57.64 ? 350 GLU A OE2 1 
ATOM   2720 N  N   . ASP A 1 351 ? -17.609 -1.790  34.977  1.00 36.40 ? 351 ASP A N   1 
ATOM   2721 C  CA  . ASP A 1 351 ? -16.904 -1.715  36.261  1.00 38.86 ? 351 ASP A CA  1 
ATOM   2722 C  C   . ASP A 1 351 ? -15.392 -1.749  36.042  1.00 39.11 ? 351 ASP A C   1 
ATOM   2723 O  O   . ASP A 1 351 ? -14.626 -1.194  36.832  1.00 36.07 ? 351 ASP A O   1 
ATOM   2724 C  CB  . ASP A 1 351 ? -17.339 -2.841  37.198  1.00 34.35 ? 351 ASP A CB  1 
ATOM   2725 C  CG  . ASP A 1 351 ? -18.703 -2.585  37.833  1.00 38.92 ? 351 ASP A CG  1 
ATOM   2726 O  OD1 . ASP A 1 351 ? -19.197 -1.432  37.792  1.00 34.16 ? 351 ASP A OD1 1 
ATOM   2727 O  OD2 . ASP A 1 351 ? -19.276 -3.551  38.381  1.00 35.13 ? 351 ASP A OD2 1 
ATOM   2728 N  N   . PHE A 1 352 ? -14.973 -2.381  34.949  1.00 40.79 ? 352 PHE A N   1 
ATOM   2729 C  CA  . PHE A 1 352 ? -13.565 -2.376  34.565  1.00 37.08 ? 352 PHE A CA  1 
ATOM   2730 C  C   . PHE A 1 352 ? -13.128 -0.961  34.228  1.00 35.77 ? 352 PHE A C   1 
ATOM   2731 O  O   . PHE A 1 352 ? -12.109 -0.487  34.718  1.00 34.96 ? 352 PHE A O   1 
ATOM   2732 C  CB  . PHE A 1 352 ? -13.313 -3.306  33.381  1.00 35.95 ? 352 PHE A CB  1 
ATOM   2733 C  CG  . PHE A 1 352 ? -11.865 -3.398  32.981  1.00 39.32 ? 352 PHE A CG  1 
ATOM   2734 C  CD1 . PHE A 1 352 ? -11.019 -4.316  33.591  1.00 37.24 ? 352 PHE A CD1 1 
ATOM   2735 C  CD2 . PHE A 1 352 ? -11.346 -2.565  32.002  1.00 38.83 ? 352 PHE A CD2 1 
ATOM   2736 C  CE1 . PHE A 1 352 ? -9.676  -4.410  33.232  1.00 35.22 ? 352 PHE A CE1 1 
ATOM   2737 C  CE2 . PHE A 1 352 ? -10.001 -2.647  31.636  1.00 37.06 ? 352 PHE A CE2 1 
ATOM   2738 C  CZ  . PHE A 1 352 ? -9.165  -3.577  32.258  1.00 34.63 ? 352 PHE A CZ  1 
ATOM   2739 N  N   . MET A 1 353 ? -13.901 -0.280  33.396  1.00 36.00 ? 353 MET A N   1 
ATOM   2740 C  CA  . MET A 1 353 ? -13.554 1.091   33.031  1.00 38.71 ? 353 MET A CA  1 
ATOM   2741 C  C   . MET A 1 353 ? -13.425 1.956   34.272  1.00 35.71 ? 353 MET A C   1 
ATOM   2742 O  O   . MET A 1 353 ? -12.490 2.747   34.382  1.00 34.11 ? 353 MET A O   1 
ATOM   2743 C  CB  . MET A 1 353 ? -14.596 1.695   32.105  1.00 38.19 ? 353 MET A CB  1 
ATOM   2744 C  CG  . MET A 1 353 ? -15.195 0.708   31.126  1.00 50.27 ? 353 MET A CG  1 
ATOM   2745 S  SD  . MET A 1 353 ? -14.883 1.179   29.419  1.00 62.70 ? 353 MET A SD  1 
ATOM   2746 C  CE  . MET A 1 353 ? -15.494 2.865   29.411  1.00 46.98 ? 353 MET A CE  1 
ATOM   2747 N  N   . SER A 1 354 ? -14.391 1.806   35.183  1.00 33.44 ? 354 SER A N   1 
ATOM   2748 C  CA  . SER A 1 354 ? -14.410 2.544   36.453  1.00 36.57 ? 354 SER A CA  1 
ATOM   2749 C  C   . SER A 1 354 ? -13.184 2.213   37.280  1.00 34.66 ? 354 SER A C   1 
ATOM   2750 O  O   . SER A 1 354 ? -12.525 3.112   37.782  1.00 39.00 ? 354 SER A O   1 
ATOM   2751 C  CB  . SER A 1 354 ? -15.685 2.244   37.254  1.00 34.08 ? 354 SER A CB  1 
ATOM   2752 O  OG  . SER A 1 354 ? -16.801 2.927   36.693  1.00 34.29 ? 354 SER A OG  1 
ATOM   2753 N  N   . GLY A 1 355 ? -12.888 0.922   37.407  1.00 33.30 ? 355 GLY A N   1 
ATOM   2754 C  CA  . GLY A 1 355 ? -11.666 0.455   38.033  1.00 34.02 ? 355 GLY A CA  1 
ATOM   2755 C  C   . GLY A 1 355 ? -10.359 1.089   37.550  1.00 37.67 ? 355 GLY A C   1 
ATOM   2756 O  O   . GLY A 1 355 ? -9.582  1.564   38.376  1.00 32.13 ? 355 GLY A O   1 
ATOM   2757 N  N   . VAL A 1 356 ? -10.093 1.114   36.239  1.00 31.75 ? 356 VAL A N   1 
ATOM   2758 C  CA  . VAL A 1 356 ? -8.793  1.633   35.796  1.00 35.88 ? 356 VAL A CA  1 
ATOM   2759 C  C   . VAL A 1 356 ? -8.699  3.126   36.088  1.00 34.38 ? 356 VAL A C   1 
ATOM   2760 O  O   . VAL A 1 356 ? -7.619  3.644   36.379  1.00 33.33 ? 356 VAL A O   1 
ATOM   2761 C  CB  . VAL A 1 356 ? -8.493  1.375   34.272  1.00 33.89 ? 356 VAL A CB  1 
ATOM   2762 C  CG1 . VAL A 1 356 ? -9.453  0.374   33.688  1.00 33.22 ? 356 VAL A CG1 1 
ATOM   2763 C  CG2 . VAL A 1 356 ? -8.471  2.675   33.481  1.00 31.57 ? 356 VAL A CG2 1 
ATOM   2764 N  N   . LYS A 1 357 ? -9.833  3.811   36.027  1.00 31.13 ? 357 LYS A N   1 
ATOM   2765 C  CA  . LYS A 1 357 ? -9.882  5.222   36.382  1.00 33.22 ? 357 LYS A CA  1 
ATOM   2766 C  C   . LYS A 1 357 ? -9.519  5.424   37.871  1.00 39.24 ? 357 LYS A C   1 
ATOM   2767 O  O   . LYS A 1 357 ? -8.779  6.346   38.215  1.00 39.11 ? 357 LYS A O   1 
ATOM   2768 C  CB  . LYS A 1 357 ? -11.270 5.778   36.058  1.00 39.08 ? 357 LYS A CB  1 
ATOM   2769 C  CG  . LYS A 1 357 ? -11.570 7.166   36.598  1.00 42.67 ? 357 LYS A CG  1 
ATOM   2770 C  CD  . LYS A 1 357 ? -10.701 8.220   35.958  1.00 41.49 ? 357 LYS A CD  1 
ATOM   2771 C  CE  . LYS A 1 357 ? -11.392 9.581   35.975  1.00 43.70 ? 357 LYS A CE  1 
ATOM   2772 N  NZ  . LYS A 1 357 ? -10.478 10.580  35.344  1.00 53.15 ? 357 LYS A NZ  1 
ATOM   2773 N  N   . LEU A 1 358 ? -10.017 4.553   38.746  1.00 34.46 ? 358 LEU A N   1 
ATOM   2774 C  CA  . LEU A 1 358 ? -9.663  4.646   40.165  1.00 39.60 ? 358 LEU A CA  1 
ATOM   2775 C  C   . LEU A 1 358 ? -8.196  4.290   40.384  1.00 37.52 ? 358 LEU A C   1 
ATOM   2776 O  O   . LEU A 1 358 ? -7.544  4.836   41.274  1.00 39.19 ? 358 LEU A O   1 
ATOM   2777 C  CB  . LEU A 1 358 ? -10.546 3.725   41.028  1.00 34.61 ? 358 LEU A CB  1 
ATOM   2778 C  CG  . LEU A 1 358 ? -12.037 4.023   41.126  1.00 36.71 ? 358 LEU A CG  1 
ATOM   2779 C  CD1 . LEU A 1 358 ? -12.765 2.919   41.883  1.00 33.80 ? 358 LEU A CD1 1 
ATOM   2780 C  CD2 . LEU A 1 358 ? -12.244 5.361   41.797  1.00 41.89 ? 358 LEU A CD2 1 
ATOM   2781 N  N   . SER A 1 359 ? -7.683  3.374   39.566  1.00 34.76 ? 359 SER A N   1 
ATOM   2782 C  CA  . SER A 1 359 ? -6.359  2.803   39.776  1.00 33.78 ? 359 SER A CA  1 
ATOM   2783 C  C   . SER A 1 359 ? -5.254  3.742   39.326  1.00 32.75 ? 359 SER A C   1 
ATOM   2784 O  O   . SER A 1 359 ? -4.178  3.770   39.912  1.00 34.61 ? 359 SER A O   1 
ATOM   2785 C  CB  . SER A 1 359 ? -6.244  1.469   39.046  1.00 33.22 ? 359 SER A CB  1 
ATOM   2786 O  OG  . SER A 1 359 ? -7.212  0.557   39.547  1.00 35.68 ? 359 SER A OG  1 
ATOM   2787 N  N   . VAL A 1 360 ? -5.544  4.524   38.301  1.00 30.41 ? 360 VAL A N   1 
ATOM   2788 C  CA  . VAL A 1 360 ? -4.579  5.423   37.694  1.00 35.67 ? 360 VAL A CA  1 
ATOM   2789 C  C   . VAL A 1 360 ? -5.161  6.825   37.694  1.00 38.06 ? 360 VAL A C   1 
ATOM   2790 O  O   . VAL A 1 360 ? -5.396  7.412   36.622  1.00 36.48 ? 360 VAL A O   1 
ATOM   2791 C  CB  . VAL A 1 360 ? -4.228  5.000   36.244  1.00 34.77 ? 360 VAL A CB  1 
ATOM   2792 C  CG1 . VAL A 1 360 ? -2.956  5.683   35.795  1.00 32.34 ? 360 VAL A CG1 1 
ATOM   2793 C  CG2 . VAL A 1 360 ? -4.083  3.489   36.160  1.00 31.58 ? 360 VAL A CG2 1 
ATOM   2794 N  N   . PRO A 1 361 ? -5.376  7.368   38.900  1.00 34.28 ? 361 PRO A N   1 
ATOM   2795 C  CA  . PRO A 1 361 ? -6.183  8.570   39.132  1.00 39.61 ? 361 PRO A CA  1 
ATOM   2796 C  C   . PRO A 1 361 ? -5.639  9.775   38.398  1.00 40.66 ? 361 PRO A C   1 
ATOM   2797 O  O   . PRO A 1 361 ? -6.388  10.671  38.010  1.00 44.56 ? 361 PRO A O   1 
ATOM   2798 C  CB  . PRO A 1 361 ? -6.093  8.773   40.648  1.00 40.78 ? 361 PRO A CB  1 
ATOM   2799 C  CG  . PRO A 1 361 ? -4.859  8.033   41.077  1.00 35.05 ? 361 PRO A CG  1 
ATOM   2800 C  CD  . PRO A 1 361 ? -4.758  6.861   40.141  1.00 36.97 ? 361 PRO A CD  1 
ATOM   2801 N  N   . HIS A 1 362 ? -4.334  9.775   38.197  1.00 38.34 ? 362 HIS A N   1 
ATOM   2802 C  CA  . HIS A 1 362 ? -3.635  10.934  37.673  1.00 41.39 ? 362 HIS A CA  1 
ATOM   2803 C  C   . HIS A 1 362 ? -3.545  10.986  36.141  1.00 43.40 ? 362 HIS A C   1 
ATOM   2804 O  O   . HIS A 1 362 ? -3.045  11.966  35.590  1.00 43.90 ? 362 HIS A O   1 
ATOM   2805 C  CB  . HIS A 1 362 ? -2.233  10.951  38.258  1.00 40.06 ? 362 HIS A CB  1 
ATOM   2806 C  CG  . HIS A 1 362 ? -1.458  9.709   37.953  1.00 42.35 ? 362 HIS A CG  1 
ATOM   2807 N  ND1 . HIS A 1 362 ? -1.688  8.513   38.598  1.00 40.03 ? 362 HIS A ND1 1 
ATOM   2808 C  CD2 . HIS A 1 362 ? -0.477  9.468   37.048  1.00 40.56 ? 362 HIS A CD2 1 
ATOM   2809 C  CE1 . HIS A 1 362 ? -0.867  7.593   38.120  1.00 40.81 ? 362 HIS A CE1 1 
ATOM   2810 N  NE2 . HIS A 1 362 ? -0.125  8.147   37.175  1.00 42.72 ? 362 HIS A NE2 1 
ATOM   2811 N  N   . ALA A 1 363 ? -4.008  9.941   35.454  1.00 41.04 ? 363 ALA A N   1 
ATOM   2812 C  CA  . ALA A 1 363 ? -3.907  9.894   33.987  1.00 40.80 ? 363 ALA A CA  1 
ATOM   2813 C  C   . ALA A 1 363 ? -4.979  10.724  33.300  1.00 43.43 ? 363 ALA A C   1 
ATOM   2814 O  O   . ALA A 1 363 ? -6.118  10.785  33.767  1.00 42.24 ? 363 ALA A O   1 
ATOM   2815 C  CB  . ALA A 1 363 ? -3.987  8.452   33.493  1.00 36.21 ? 363 ALA A CB  1 
ATOM   2816 N  N   . ASN A 1 364 ? -4.626  11.352  32.179  1.00 40.77 ? 364 ASN A N   1 
ATOM   2817 C  CA  . ASN A 1 364 ? -5.646  11.934  31.321  1.00 40.31 ? 364 ASN A CA  1 
ATOM   2818 C  C   . ASN A 1 364 ? -6.411  10.815  30.624  1.00 40.85 ? 364 ASN A C   1 
ATOM   2819 O  O   . ASN A 1 364 ? -6.142  9.631   30.853  1.00 36.78 ? 364 ASN A O   1 
ATOM   2820 C  CB  . ASN A 1 364 ? -5.050  12.915  30.297  1.00 44.05 ? 364 ASN A CB  1 
ATOM   2821 C  CG  . ASN A 1 364 ? -3.850  12.348  29.540  1.00 45.49 ? 364 ASN A CG  1 
ATOM   2822 O  OD1 . ASN A 1 364 ? -3.614  11.140  29.514  1.00 43.07 ? 364 ASN A OD1 1 
ATOM   2823 N  ND2 . ASN A 1 364 ? -3.083  13.238  28.920  1.00 47.91 ? 364 ASN A ND2 1 
ATOM   2824 N  N   . ASP A 1 365 ? -7.374  11.190  29.787  1.00 43.24 ? 365 ASP A N   1 
ATOM   2825 C  CA  . ASP A 1 365 ? -8.176  10.212  29.058  1.00 42.48 ? 365 ASP A CA  1 
ATOM   2826 C  C   . ASP A 1 365 ? -7.310  9.337   28.151  1.00 41.75 ? 365 ASP A C   1 
ATOM   2827 O  O   . ASP A 1 365 ? -7.542  8.134   28.027  1.00 40.72 ? 365 ASP A O   1 
ATOM   2828 C  CB  . ASP A 1 365 ? -9.256  10.914  28.229  1.00 46.52 ? 365 ASP A CB  1 
ATOM   2829 C  CG  . ASP A 1 365 ? -10.274 11.646  29.087  1.00 56.25 ? 365 ASP A CG  1 
ATOM   2830 O  OD1 . ASP A 1 365 ? -10.322 11.409  30.318  1.00 56.40 ? 365 ASP A OD1 1 
ATOM   2831 O  OD2 . ASP A 1 365 ? -11.036 12.459  28.523  1.00 64.63 ? 365 ASP A OD2 1 
ATOM   2832 N  N   . LEU A 1 366 ? -6.309  9.937   27.522  1.00 38.53 ? 366 LEU A N   1 
ATOM   2833 C  CA  . LEU A 1 366 ? -5.449  9.175   26.629  1.00 44.57 ? 366 LEU A CA  1 
ATOM   2834 C  C   . LEU A 1 366 ? -4.687  8.122   27.426  1.00 39.69 ? 366 LEU A C   1 
ATOM   2835 O  O   . LEU A 1 366 ? -4.562  6.974   26.998  1.00 38.25 ? 366 LEU A O   1 
ATOM   2836 C  CB  . LEU A 1 366 ? -4.477  10.089  25.882  1.00 42.74 ? 366 LEU A CB  1 
ATOM   2837 C  CG  . LEU A 1 366 ? -3.635  9.343   24.850  1.00 43.20 ? 366 LEU A CG  1 
ATOM   2838 C  CD1 . LEU A 1 366 ? -4.537  8.771   23.779  1.00 38.13 ? 366 LEU A CD1 1 
ATOM   2839 C  CD2 . LEU A 1 366 ? -2.590  10.255  24.252  1.00 42.77 ? 366 LEU A CD2 1 
ATOM   2840 N  N   . GLY A 1 367 ? -4.195  8.521   28.592  1.00 36.91 ? 367 GLY A N   1 
ATOM   2841 C  CA  . GLY A 1 367 ? -3.518  7.601   29.487  1.00 37.33 ? 367 GLY A CA  1 
ATOM   2842 C  C   . GLY A 1 367 ? -4.414  6.448   29.908  1.00 39.07 ? 367 GLY A C   1 
ATOM   2843 O  O   . GLY A 1 367 ? -3.988  5.292   29.898  1.00 37.94 ? 367 GLY A O   1 
ATOM   2844 N  N   . LEU A 1 368 ? -5.658  6.753   30.272  1.00 35.25 ? 368 LEU A N   1 
ATOM   2845 C  CA  . LEU A 1 368 ? -6.607  5.710   30.637  1.00 38.14 ? 368 LEU A CA  1 
ATOM   2846 C  C   . LEU A 1 368 ? -6.876  4.753   29.468  1.00 35.13 ? 368 LEU A C   1 
ATOM   2847 O  O   . LEU A 1 368 ? -6.955  3.542   29.656  1.00 34.61 ? 368 LEU A O   1 
ATOM   2848 C  CB  . LEU A 1 368 ? -7.917  6.332   31.129  1.00 41.41 ? 368 LEU A CB  1 
ATOM   2849 C  CG  . LEU A 1 368 ? -7.822  7.046   32.481  1.00 38.53 ? 368 LEU A CG  1 
ATOM   2850 C  CD1 . LEU A 1 368 ? -9.126  7.752   32.812  1.00 43.80 ? 368 LEU A CD1 1 
ATOM   2851 C  CD2 . LEU A 1 368 ? -7.465  6.056   33.563  1.00 36.98 ? 368 LEU A CD2 1 
ATOM   2852 N  N   . ASP A 1 369 ? -7.003  5.294   28.262  1.00 35.38 ? 369 ASP A N   1 
ATOM   2853 C  CA  . ASP A 1 369 ? -7.148  4.456   27.067  1.00 37.77 ? 369 ASP A CA  1 
ATOM   2854 C  C   . ASP A 1 369 ? -5.925  3.550   26.856  1.00 36.58 ? 369 ASP A C   1 
ATOM   2855 O  O   . ASP A 1 369 ? -6.069  2.380   26.478  1.00 34.11 ? 369 ASP A O   1 
ATOM   2856 C  CB  . ASP A 1 369 ? -7.377  5.318   25.809  1.00 35.69 ? 369 ASP A CB  1 
ATOM   2857 C  CG  . ASP A 1 369 ? -8.712  6.056   25.838  1.00 42.79 ? 369 ASP A CG  1 
ATOM   2858 O  OD1 . ASP A 1 369 ? -9.650  5.570   26.512  1.00 41.94 ? 369 ASP A OD1 1 
ATOM   2859 O  OD2 . ASP A 1 369 ? -8.826  7.121   25.188  1.00 44.53 ? 369 ASP A OD2 1 
ATOM   2860 N  N   . ALA A 1 370 ? -4.732  4.092   27.101  1.00 31.51 ? 370 ALA A N   1 
ATOM   2861 C  CA  . ALA A 1 370 ? -3.497  3.327   26.953  1.00 30.40 ? 370 ALA A CA  1 
ATOM   2862 C  C   . ALA A 1 370 ? -3.477  2.145   27.896  1.00 31.99 ? 370 ALA A C   1 
ATOM   2863 O  O   . ALA A 1 370 ? -3.139  1.029   27.503  1.00 29.74 ? 370 ALA A O   1 
ATOM   2864 C  CB  . ALA A 1 370 ? -2.279  4.215   27.185  1.00 31.83 ? 370 ALA A CB  1 
ATOM   2865 N  N   . VAL A 1 371 ? -3.855  2.394   29.147  1.00 29.71 ? 371 VAL A N   1 
ATOM   2866 C  CA  . VAL A 1 371 ? -3.884  1.346   30.155  1.00 30.59 ? 371 VAL A CA  1 
ATOM   2867 C  C   . VAL A 1 371 ? -4.937  0.296   29.805  1.00 31.94 ? 371 VAL A C   1 
ATOM   2868 O  O   . VAL A 1 371 ? -4.695  -0.909  29.887  1.00 32.30 ? 371 VAL A O   1 
ATOM   2869 C  CB  . VAL A 1 371 ? -4.175  1.935   31.572  1.00 34.02 ? 371 VAL A CB  1 
ATOM   2870 C  CG1 . VAL A 1 371 ? -4.470  0.832   32.560  1.00 28.06 ? 371 VAL A CG1 1 
ATOM   2871 C  CG2 . VAL A 1 371 ? -3.015  2.797   32.033  1.00 31.70 ? 371 VAL A CG2 1 
ATOM   2872 N  N   . THR A 1 372 ? -6.115  0.767   29.418  1.00 33.98 ? 372 THR A N   1 
ATOM   2873 C  CA  . THR A 1 372 ? -7.208  -0.125  29.051  1.00 33.99 ? 372 THR A CA  1 
ATOM   2874 C  C   . THR A 1 372 ? -6.809  -1.052  27.910  1.00 31.82 ? 372 THR A C   1 
ATOM   2875 O  O   . THR A 1 372 ? -7.050  -2.257  27.970  1.00 30.32 ? 372 THR A O   1 
ATOM   2876 C  CB  . THR A 1 372 ? -8.460  0.670   28.661  1.00 35.40 ? 372 THR A CB  1 
ATOM   2877 O  OG1 . THR A 1 372 ? -8.874  1.457   29.780  1.00 35.24 ? 372 THR A OG1 1 
ATOM   2878 C  CG2 . THR A 1 372 ? -9.592  -0.273  28.257  1.00 33.61 ? 372 THR A CG2 1 
ATOM   2879 N  N   . LEU A 1 373 ? -6.180  -0.484  26.885  1.00 32.96 ? 373 LEU A N   1 
ATOM   2880 C  CA  . LEU A 1 373 ? -5.755  -1.258  25.718  1.00 32.90 ? 373 LEU A CA  1 
ATOM   2881 C  C   . LEU A 1 373 ? -4.768  -2.327  26.152  1.00 34.20 ? 373 LEU A C   1 
ATOM   2882 O  O   . LEU A 1 373 ? -4.845  -3.482  25.740  1.00 31.93 ? 373 LEU A O   1 
ATOM   2883 C  CB  . LEU A 1 373 ? -5.115  -0.351  24.657  1.00 33.02 ? 373 LEU A CB  1 
ATOM   2884 C  CG  . LEU A 1 373 ? -4.711  -1.058  23.355  1.00 39.52 ? 373 LEU A CG  1 
ATOM   2885 C  CD1 . LEU A 1 373 ? -5.833  -1.966  22.858  1.00 33.90 ? 373 LEU A CD1 1 
ATOM   2886 C  CD2 . LEU A 1 373 ? -4.326  -0.057  22.273  1.00 37.39 ? 373 LEU A CD2 1 
ATOM   2887 N  N   . GLN A 1 374 ? -3.853  -1.925  27.028  1.00 32.65 ? 374 GLN A N   1 
ATOM   2888 C  CA  . GLN A 1 374 ? -2.759  -2.773  27.428  1.00 29.58 ? 374 GLN A CA  1 
ATOM   2889 C  C   . GLN A 1 374 ? -3.227  -3.984  28.216  1.00 32.15 ? 374 GLN A C   1 
ATOM   2890 O  O   . GLN A 1 374 ? -2.531  -4.987  28.273  1.00 32.15 ? 374 GLN A O   1 
ATOM   2891 C  CB  . GLN A 1 374 ? -1.769  -1.963  28.255  1.00 35.31 ? 374 GLN A CB  1 
ATOM   2892 C  CG  . GLN A 1 374 ? -0.499  -2.698  28.598  1.00 38.02 ? 374 GLN A CG  1 
ATOM   2893 C  CD  . GLN A 1 374 ? 0.470   -2.783  27.438  1.00 39.49 ? 374 GLN A CD  1 
ATOM   2894 O  OE1 . GLN A 1 374 ? 1.510   -3.424  27.557  1.00 44.24 ? 374 GLN A OE1 1 
ATOM   2895 N  NE2 . GLN A 1 374 ? 0.141   -2.136  26.313  1.00 35.27 ? 374 GLN A NE2 1 
ATOM   2896 N  N   . TYR A 1 375 ? -4.403  -3.900  28.827  1.00 28.02 ? 375 TYR A N   1 
ATOM   2897 C  CA  . TYR A 1 375 ? -4.859  -4.987  29.683  1.00 33.49 ? 375 TYR A CA  1 
ATOM   2898 C  C   . TYR A 1 375 ? -6.218  -5.570  29.284  1.00 35.51 ? 375 TYR A C   1 
ATOM   2899 O  O   . TYR A 1 375 ? -6.865  -6.255  30.092  1.00 35.01 ? 375 TYR A O   1 
ATOM   2900 C  CB  . TYR A 1 375 ? -4.916  -4.514  31.147  1.00 31.11 ? 375 TYR A CB  1 
ATOM   2901 C  CG  . TYR A 1 375 ? -3.557  -4.353  31.822  1.00 33.04 ? 375 TYR A CG  1 
ATOM   2902 C  CD1 . TYR A 1 375 ? -2.852  -3.155  31.750  1.00 29.76 ? 375 TYR A CD1 1 
ATOM   2903 C  CD2 . TYR A 1 375 ? -2.992  -5.396  32.544  1.00 32.94 ? 375 TYR A CD2 1 
ATOM   2904 C  CE1 . TYR A 1 375 ? -1.624  -3.007  32.392  1.00 32.16 ? 375 TYR A CE1 1 
ATOM   2905 C  CE2 . TYR A 1 375 ? -1.755  -5.259  33.173  1.00 30.48 ? 375 TYR A CE2 1 
ATOM   2906 C  CZ  . TYR A 1 375 ? -1.085  -4.065  33.098  1.00 29.51 ? 375 TYR A CZ  1 
ATOM   2907 O  OH  . TYR A 1 375 ? 0.134   -3.938  33.715  1.00 32.41 ? 375 TYR A OH  1 
ATOM   2908 N  N   . THR A 1 376 ? -6.650  -5.300  28.055  1.00 31.45 ? 376 THR A N   1 
ATOM   2909 C  CA  . THR A 1 376 ? -7.925  -5.821  27.563  1.00 34.36 ? 376 THR A CA  1 
ATOM   2910 C  C   . THR A 1 376 ? -7.720  -6.786  26.417  1.00 32.63 ? 376 THR A C   1 
ATOM   2911 O  O   . THR A 1 376 ? -7.070  -6.451  25.429  1.00 34.50 ? 376 THR A O   1 
ATOM   2912 C  CB  . THR A 1 376 ? -8.855  -4.703  27.085  1.00 36.74 ? 376 THR A CB  1 
ATOM   2913 O  OG1 . THR A 1 376 ? -9.130  -3.811  28.170  1.00 35.48 ? 376 THR A OG1 1 
ATOM   2914 C  CG2 . THR A 1 376 ? -10.173 -5.283  26.541  1.00 37.50 ? 376 THR A CG2 1 
ATOM   2915 N  N   . ASP A 1 377 ? -8.267  -7.987  26.558  1.00 34.33 ? 377 ASP A N   1 
ATOM   2916 C  CA  . ASP A 1 377 ? -8.279  -8.964  25.477  1.00 35.00 ? 377 ASP A CA  1 
ATOM   2917 C  C   . ASP A 1 377 ? -9.526  -8.722  24.628  1.00 38.78 ? 377 ASP A C   1 
ATOM   2918 O  O   . ASP A 1 377 ? -10.643 -9.015  25.066  1.00 36.98 ? 377 ASP A O   1 
ATOM   2919 C  CB  . ASP A 1 377 ? -8.248  -10.388 26.040  1.00 37.46 ? 377 ASP A CB  1 
ATOM   2920 C  CG  . ASP A 1 377 ? -8.502  -11.462 24.982  1.00 39.94 ? 377 ASP A CG  1 
ATOM   2921 O  OD1 . ASP A 1 377 ? -8.669  -11.141 23.781  1.00 33.45 ? 377 ASP A OD1 1 
ATOM   2922 O  OD2 . ASP A 1 377 ? -8.522  -12.652 25.365  1.00 42.29 ? 377 ASP A OD2 1 
ATOM   2923 N  N   . TRP A 1 378 ? -9.325  -8.196  23.416  1.00 34.58 ? 378 TRP A N   1 
ATOM   2924 C  CA  . TRP A 1 378 ? -10.441 -7.750  22.579  1.00 38.92 ? 378 TRP A CA  1 
ATOM   2925 C  C   . TRP A 1 378 ? -11.081 -8.846  21.753  1.00 36.80 ? 378 TRP A C   1 
ATOM   2926 O  O   . TRP A 1 378 ? -12.048 -8.596  21.037  1.00 37.34 ? 378 TRP A O   1 
ATOM   2927 C  CB  . TRP A 1 378 ? -10.007 -6.609  21.666  1.00 34.04 ? 378 TRP A CB  1 
ATOM   2928 C  CG  . TRP A 1 378 ? -10.069 -5.308  22.387  1.00 40.18 ? 378 TRP A CG  1 
ATOM   2929 C  CD1 . TRP A 1 378 ? -9.018  -4.546  22.806  1.00 38.42 ? 378 TRP A CD1 1 
ATOM   2930 C  CD2 . TRP A 1 378 ? -11.254 -4.637  22.833  1.00 42.80 ? 378 TRP A CD2 1 
ATOM   2931 N  NE1 . TRP A 1 378 ? -9.474  -3.425  23.453  1.00 36.80 ? 378 TRP A NE1 1 
ATOM   2932 C  CE2 . TRP A 1 378 ? -10.844 -3.458  23.488  1.00 42.23 ? 378 TRP A CE2 1 
ATOM   2933 C  CE3 . TRP A 1 378 ? -12.622 -4.912  22.729  1.00 43.02 ? 378 TRP A CE3 1 
ATOM   2934 C  CZ2 . TRP A 1 378 ? -11.752 -2.554  24.034  1.00 47.84 ? 378 TRP A CZ2 1 
ATOM   2935 C  CZ3 . TRP A 1 378 ? -13.525 -4.013  23.272  1.00 48.99 ? 378 TRP A CZ3 1 
ATOM   2936 C  CH2 . TRP A 1 378 ? -13.087 -2.849  23.920  1.00 50.11 ? 378 TRP A CH2 1 
ATOM   2937 N  N   . MET A 1 379 ? -10.567 -10.061 21.874  1.00 36.50 ? 379 MET A N   1 
ATOM   2938 C  CA  . MET A 1 379 ? -11.288 -11.216 21.366  1.00 36.54 ? 379 MET A CA  1 
ATOM   2939 C  C   . MET A 1 379 ? -12.355 -11.677 22.358  1.00 40.06 ? 379 MET A C   1 
ATOM   2940 O  O   . MET A 1 379 ? -13.149 -12.561 22.045  1.00 40.45 ? 379 MET A O   1 
ATOM   2941 C  CB  . MET A 1 379 ? -10.331 -12.366 21.080  1.00 35.92 ? 379 MET A CB  1 
ATOM   2942 C  CG  . MET A 1 379 ? -9.252  -12.044 20.063  1.00 40.99 ? 379 MET A CG  1 
ATOM   2943 S  SD  . MET A 1 379 ? -8.148  -13.445 19.849  1.00 54.02 ? 379 MET A SD  1 
ATOM   2944 C  CE  . MET A 1 379 ? -9.288  -14.667 19.216  1.00 47.24 ? 379 MET A CE  1 
ATOM   2945 N  N   . ASP A 1 380 ? -12.371 -11.072 23.549  1.00 40.46 ? 380 ASP A N   1 
ATOM   2946 C  CA  . ASP A 1 380 ? -13.107 -11.624 24.688  1.00 38.70 ? 380 ASP A CA  1 
ATOM   2947 C  C   . ASP A 1 380 ? -13.298 -10.570 25.778  1.00 41.30 ? 380 ASP A C   1 
ATOM   2948 O  O   . ASP A 1 380 ? -12.988 -10.812 26.937  1.00 41.72 ? 380 ASP A O   1 
ATOM   2949 C  CB  . ASP A 1 380 ? -12.333 -12.835 25.232  1.00 45.32 ? 380 ASP A CB  1 
ATOM   2950 C  CG  . ASP A 1 380 ? -13.154 -13.719 26.163  1.00 42.05 ? 380 ASP A CG  1 
ATOM   2951 O  OD1 . ASP A 1 380 ? -14.394 -13.607 26.194  1.00 40.04 ? 380 ASP A OD1 1 
ATOM   2952 O  OD2 . ASP A 1 380 ? -12.535 -14.566 26.846  1.00 45.28 ? 380 ASP A OD2 1 
ATOM   2953 N  N   . ASP A 1 381 ? -13.797 -9.394  25.403  1.00 42.83 ? 381 ASP A N   1 
ATOM   2954 C  CA  . ASP A 1 381 ? -13.767 -8.244  26.305  1.00 42.72 ? 381 ASP A CA  1 
ATOM   2955 C  C   . ASP A 1 381 ? -14.876 -8.266  27.359  1.00 47.45 ? 381 ASP A C   1 
ATOM   2956 O  O   . ASP A 1 381 ? -14.866 -7.454  28.286  1.00 45.74 ? 381 ASP A O   1 
ATOM   2957 C  CB  . ASP A 1 381 ? -13.837 -6.936  25.505  1.00 42.68 ? 381 ASP A CB  1 
ATOM   2958 C  CG  . ASP A 1 381 ? -15.040 -6.876  24.566  1.00 47.47 ? 381 ASP A CG  1 
ATOM   2959 O  OD1 . ASP A 1 381 ? -15.148 -7.723  23.651  1.00 46.18 ? 381 ASP A OD1 1 
ATOM   2960 O  OD2 . ASP A 1 381 ? -15.871 -5.962  24.730  1.00 50.03 ? 381 ASP A OD2 1 
ATOM   2961 N  N   . ASN A 1 382 ? -15.820 -9.192  27.230  1.00 44.92 ? 382 ASN A N   1 
ATOM   2962 C  CA  . ASN A 1 382 ? -16.901 -9.285  28.206  1.00 46.36 ? 382 ASN A CA  1 
ATOM   2963 C  C   . ASN A 1 382 ? -16.717 -10.482 29.130  1.00 44.23 ? 382 ASN A C   1 
ATOM   2964 O  O   . ASN A 1 382 ? -17.664 -10.976 29.743  1.00 44.35 ? 382 ASN A O   1 
ATOM   2965 C  CB  . ASN A 1 382 ? -18.254 -9.338  27.494  1.00 43.03 ? 382 ASN A CB  1 
ATOM   2966 C  CG  . ASN A 1 382 ? -18.684 -7.979  26.998  1.00 45.46 ? 382 ASN A CG  1 
ATOM   2967 O  OD1 . ASN A 1 382 ? -18.595 -6.988  27.730  1.00 44.42 ? 382 ASN A OD1 1 
ATOM   2968 N  ND2 . ASN A 1 382 ? -19.137 -7.912  25.749  1.00 46.71 ? 382 ASN A ND2 1 
ATOM   2969 N  N   . ASN A 1 383 ? -15.477 -10.943 29.217  1.00 43.71 ? 383 ASN A N   1 
ATOM   2970 C  CA  . ASN A 1 383 ? -15.123 -12.018 30.127  1.00 41.13 ? 383 ASN A CA  1 
ATOM   2971 C  C   . ASN A 1 383 ? -14.898 -11.432 31.521  1.00 39.07 ? 383 ASN A C   1 
ATOM   2972 O  O   . ASN A 1 383 ? -13.891 -10.768 31.758  1.00 37.33 ? 383 ASN A O   1 
ATOM   2973 C  CB  . ASN A 1 383 ? -13.880 -12.749 29.610  1.00 39.45 ? 383 ASN A CB  1 
ATOM   2974 C  CG  . ASN A 1 383 ? -13.541 -13.980 30.425  1.00 44.73 ? 383 ASN A CG  1 
ATOM   2975 O  OD1 . ASN A 1 383 ? -13.692 -13.996 31.653  1.00 39.44 ? 383 ASN A OD1 1 
ATOM   2976 N  ND2 . ASN A 1 383 ? -13.068 -15.023 29.745  1.00 44.22 ? 383 ASN A ND2 1 
ATOM   2977 N  N   . GLY A 1 384 ? -15.850 -11.663 32.426  1.00 36.70 ? 384 GLY A N   1 
ATOM   2978 C  CA  . GLY A 1 384 ? -15.822 -11.061 33.747  1.00 33.15 ? 384 GLY A CA  1 
ATOM   2979 C  C   . GLY A 1 384 ? -14.569 -11.425 34.528  1.00 39.01 ? 384 GLY A C   1 
ATOM   2980 O  O   . GLY A 1 384 ? -14.001 -10.587 35.219  1.00 37.91 ? 384 GLY A O   1 
ATOM   2981 N  N   . ILE A 1 385 ? -14.137 -12.678 34.408  1.00 35.37 ? 385 ILE A N   1 
ATOM   2982 C  CA  . ILE A 1 385 ? -12.902 -13.134 35.020  1.00 35.17 ? 385 ILE A CA  1 
ATOM   2983 C  C   . ILE A 1 385 ? -11.660 -12.416 34.493  1.00 40.24 ? 385 ILE A C   1 
ATOM   2984 O  O   . ILE A 1 385 ? -10.845 -11.934 35.293  1.00 38.14 ? 385 ILE A O   1 
ATOM   2985 C  CB  . ILE A 1 385 ? -12.701 -14.633 34.821  1.00 36.30 ? 385 ILE A CB  1 
ATOM   2986 C  CG1 . ILE A 1 385 ? -13.712 -15.411 35.661  1.00 40.86 ? 385 ILE A CG1 1 
ATOM   2987 C  CG2 . ILE A 1 385 ? -11.286 -15.025 35.207  1.00 41.90 ? 385 ILE A CG2 1 
ATOM   2988 C  CD1 . ILE A 1 385 ? -13.411 -16.881 35.761  1.00 43.62 ? 385 ILE A CD1 1 
ATOM   2989 N  N   . LYS A 1 386 ? -11.503 -12.361 33.167  1.00 37.03 ? 386 LYS A N   1 
ATOM   2990 C  CA  . LYS A 1 386 ? -10.343 -11.698 32.569  1.00 39.79 ? 386 LYS A CA  1 
ATOM   2991 C  C   . LYS A 1 386 ? -10.332 -10.231 32.938  1.00 36.42 ? 386 LYS A C   1 
ATOM   2992 O  O   . LYS A 1 386 ? -9.275  -9.640  33.133  1.00 40.05 ? 386 LYS A O   1 
ATOM   2993 C  CB  . LYS A 1 386 ? -10.327 -11.836 31.041  1.00 37.74 ? 386 LYS A CB  1 
ATOM   2994 C  CG  . LYS A 1 386 ? -9.752  -13.153 30.528  1.00 39.53 ? 386 LYS A CG  1 
ATOM   2995 C  CD  . LYS A 1 386 ? -9.910  -13.262 29.009  1.00 43.54 ? 386 LYS A CD  1 
ATOM   2996 C  CE  . LYS A 1 386 ? -9.195  -14.489 28.479  1.00 45.38 ? 386 LYS A CE  1 
ATOM   2997 N  NZ  . LYS A 1 386 ? -9.571  -14.771 27.069  1.00 52.52 ? 386 LYS A NZ  1 
ATOM   2998 N  N   . ASN A 1 387 ? -11.516 -9.646  33.025  1.00 34.89 ? 387 ASN A N   1 
ATOM   2999 C  CA  . ASN A 1 387 ? -11.637 -8.264  33.449  1.00 38.25 ? 387 ASN A CA  1 
ATOM   3000 C  C   . ASN A 1 387 ? -11.194 -8.067  34.900  1.00 36.45 ? 387 ASN A C   1 
ATOM   3001 O  O   . ASN A 1 387 ? -10.575 -7.058  35.219  1.00 36.59 ? 387 ASN A O   1 
ATOM   3002 C  CB  . ASN A 1 387 ? -13.073 -7.776  33.261  1.00 35.37 ? 387 ASN A CB  1 
ATOM   3003 C  CG  . ASN A 1 387 ? -13.390 -7.471  31.812  1.00 38.79 ? 387 ASN A CG  1 
ATOM   3004 O  OD1 . ASN A 1 387 ? -12.498 -7.140  31.042  1.00 36.75 ? 387 ASN A OD1 1 
ATOM   3005 N  ND2 . ASN A 1 387 ? -14.664 -7.581  31.433  1.00 36.87 ? 387 ASN A ND2 1 
ATOM   3006 N  N   . ARG A 1 388 ? -11.521 -9.031  35.761  1.00 34.19 ? 388 ARG A N   1 
ATOM   3007 C  CA  . ARG A 1 388 ? -11.144 -8.990  37.173  1.00 37.28 ? 388 ARG A CA  1 
ATOM   3008 C  C   . ARG A 1 388 ? -9.627  -9.059  37.321  1.00 37.90 ? 388 ARG A C   1 
ATOM   3009 O  O   . ARG A 1 388 ? -9.004  -8.220  37.978  1.00 34.24 ? 388 ARG A O   1 
ATOM   3010 C  CB  . ARG A 1 388 ? -11.788 -10.151 37.943  1.00 35.81 ? 388 ARG A CB  1 
ATOM   3011 C  CG  . ARG A 1 388 ? -11.512 -10.145 39.459  1.00 38.66 ? 388 ARG A CG  1 
ATOM   3012 C  CD  . ARG A 1 388 ? -11.859 -11.492 40.090  1.00 33.48 ? 388 ARG A CD  1 
ATOM   3013 N  NE  . ARG A 1 388 ? -11.001 -12.558 39.572  1.00 40.67 ? 388 ARG A NE  1 
ATOM   3014 C  CZ  . ARG A 1 388 ? -11.374 -13.824 39.399  1.00 39.36 ? 388 ARG A CZ  1 
ATOM   3015 N  NH1 . ARG A 1 388 ? -10.507 -14.708 38.922  1.00 36.92 ? 388 ARG A NH1 1 
ATOM   3016 N  NH2 . ARG A 1 388 ? -12.611 -14.208 39.691  1.00 38.86 ? 388 ARG A NH2 1 
ATOM   3017 N  N   . ASP A 1 389 ? -9.052  -10.079 36.692  1.00 35.97 ? 389 ASP A N   1 
ATOM   3018 C  CA  . ASP A 1 389 ? -7.635  -10.352 36.800  1.00 35.90 ? 389 ASP A CA  1 
ATOM   3019 C  C   . ASP A 1 389 ? -6.814  -9.240  36.160  1.00 36.20 ? 389 ASP A C   1 
ATOM   3020 O  O   . ASP A 1 389 ? -5.701  -8.948  36.608  1.00 35.55 ? 389 ASP A O   1 
ATOM   3021 C  CB  . ASP A 1 389 ? -7.307  -11.697 36.151  1.00 36.43 ? 389 ASP A CB  1 
ATOM   3022 C  CG  . ASP A 1 389 ? -7.947  -12.862 36.880  1.00 41.49 ? 389 ASP A CG  1 
ATOM   3023 O  OD1 . ASP A 1 389 ? -8.491  -12.670 37.998  1.00 38.95 ? 389 ASP A OD1 1 
ATOM   3024 O  OD2 . ASP A 1 389 ? -7.886  -13.983 36.338  1.00 45.78 ? 389 ASP A OD2 1 
ATOM   3025 N  N   . GLY A 1 390 ? -7.363  -8.634  35.109  1.00 32.76 ? 390 GLY A N   1 
ATOM   3026 C  CA  . GLY A 1 390 ? -6.716  -7.515  34.455  1.00 31.96 ? 390 GLY A CA  1 
ATOM   3027 C  C   . GLY A 1 390 ? -6.607  -6.298  35.355  1.00 33.90 ? 390 GLY A C   1 
ATOM   3028 O  O   . GLY A 1 390 ? -5.567  -5.640  35.399  1.00 31.22 ? 390 GLY A O   1 
ATOM   3029 N  N   . LEU A 1 391 ? -7.695  -5.990  36.056  1.00 31.74 ? 391 LEU A N   1 
ATOM   3030 C  CA  . LEU A 1 391 ? -7.713  -4.907  37.026  1.00 32.88 ? 391 LEU A CA  1 
ATOM   3031 C  C   . LEU A 1 391 ? -6.743  -5.223  38.169  1.00 32.14 ? 391 LEU A C   1 
ATOM   3032 O  O   . LEU A 1 391 ? -5.989  -4.370  38.619  1.00 29.03 ? 391 LEU A O   1 
ATOM   3033 C  CB  . LEU A 1 391 ? -9.128  -4.704  37.559  1.00 35.93 ? 391 LEU A CB  1 
ATOM   3034 C  CG  . LEU A 1 391 ? -9.684  -3.281  37.632  1.00 38.45 ? 391 LEU A CG  1 
ATOM   3035 C  CD1 . LEU A 1 391 ? -9.385  -2.519  36.383  1.00 36.67 ? 391 LEU A CD1 1 
ATOM   3036 C  CD2 . LEU A 1 391 ? -11.191 -3.320  37.856  1.00 37.64 ? 391 LEU A CD2 1 
ATOM   3037 N  N   . ASP A 1 392 ? -6.771  -6.470  38.616  1.00 32.42 ? 392 ASP A N   1 
ATOM   3038 C  CA  . ASP A 1 392 ? -5.845  -6.961  39.614  1.00 30.88 ? 392 ASP A CA  1 
ATOM   3039 C  C   . ASP A 1 392 ? -4.397  -6.742  39.174  1.00 34.87 ? 392 ASP A C   1 
ATOM   3040 O  O   . ASP A 1 392 ? -3.570  -6.245  39.945  1.00 34.23 ? 392 ASP A O   1 
ATOM   3041 C  CB  . ASP A 1 392 ? -6.105  -8.441  39.867  1.00 33.38 ? 392 ASP A CB  1 
ATOM   3042 C  CG  . ASP A 1 392 ? -5.500  -8.921  41.159  1.00 43.72 ? 392 ASP A CG  1 
ATOM   3043 O  OD1 . ASP A 1 392 ? -4.988  -8.077  41.933  1.00 42.06 ? 392 ASP A OD1 1 
ATOM   3044 O  OD2 . ASP A 1 392 ? -5.552  -10.146 41.413  1.00 50.00 ? 392 ASP A OD2 1 
ATOM   3045 N  N   . ASP A 1 393 ? -4.094  -7.104  37.929  1.00 32.30 ? 393 ASP A N   1 
ATOM   3046 C  CA  . ASP A 1 393 ? -2.745  -6.943  37.412  1.00 32.59 ? 393 ASP A CA  1 
ATOM   3047 C  C   . ASP A 1 393 ? -2.392  -5.467  37.310  1.00 30.76 ? 393 ASP A C   1 
ATOM   3048 O  O   . ASP A 1 393 ? -1.281  -5.074  37.639  1.00 31.08 ? 393 ASP A O   1 
ATOM   3049 C  CB  . ASP A 1 393 ? -2.593  -7.634  36.050  1.00 31.36 ? 393 ASP A CB  1 
ATOM   3050 C  CG  . ASP A 1 393 ? -2.484  -9.144  36.180  1.00 37.60 ? 393 ASP A CG  1 
ATOM   3051 O  OD1 . ASP A 1 393 ? -2.073  -9.607  37.263  1.00 40.63 ? 393 ASP A OD1 1 
ATOM   3052 O  OD2 . ASP A 1 393 ? -2.797  -9.871  35.214  1.00 41.95 ? 393 ASP A OD2 1 
ATOM   3053 N  N   . ILE A 1 394 ? -3.347  -4.653  36.874  1.00 31.12 ? 394 ILE A N   1 
ATOM   3054 C  CA  . ILE A 1 394 ? -3.117  -3.223  36.731  1.00 29.14 ? 394 ILE A CA  1 
ATOM   3055 C  C   . ILE A 1 394 ? -2.728  -2.584  38.057  1.00 31.64 ? 394 ILE A C   1 
ATOM   3056 O  O   . ILE A 1 394 ? -1.761  -1.814  38.121  1.00 29.91 ? 394 ILE A O   1 
ATOM   3057 C  CB  . ILE A 1 394 ? -4.358  -2.490  36.188  1.00 30.57 ? 394 ILE A CB  1 
ATOM   3058 C  CG1 . ILE A 1 394 ? -4.565  -2.790  34.698  1.00 32.59 ? 394 ILE A CG1 1 
ATOM   3059 C  CG2 . ILE A 1 394 ? -4.195  -0.995  36.389  1.00 28.50 ? 394 ILE A CG2 1 
ATOM   3060 C  CD1 . ILE A 1 394 ? -5.923  -2.354  34.174  1.00 30.17 ? 394 ILE A CD1 1 
ATOM   3061 N  N   . VAL A 1 395 ? -3.476  -2.902  39.111  1.00 28.87 ? 395 VAL A N   1 
ATOM   3062 C  CA  . VAL A 1 395 ? -3.230  -2.275  40.399  1.00 28.86 ? 395 VAL A CA  1 
ATOM   3063 C  C   . VAL A 1 395 ? -1.871  -2.735  40.913  1.00 29.18 ? 395 VAL A C   1 
ATOM   3064 O  O   . VAL A 1 395 ? -1.058  -1.913  41.292  1.00 27.88 ? 395 VAL A O   1 
ATOM   3065 C  CB  . VAL A 1 395 ? -4.342  -2.589  41.434  1.00 29.10 ? 395 VAL A CB  1 
ATOM   3066 C  CG1 . VAL A 1 395 ? -3.948  -2.064  42.850  1.00 28.94 ? 395 VAL A CG1 1 
ATOM   3067 C  CG2 . VAL A 1 395 ? -5.667  -1.976  40.978  1.00 28.20 ? 395 VAL A CG2 1 
ATOM   3068 N  N   . GLY A 1 396 ? -1.629  -4.041  40.872  1.00 27.01 ? 396 GLY A N   1 
ATOM   3069 C  CA  . GLY A 1 396 ? -0.363  -4.622  41.271  1.00 25.80 ? 396 GLY A CA  1 
ATOM   3070 C  C   . GLY A 1 396 ? 0.853   -4.127  40.503  1.00 30.86 ? 396 GLY A C   1 
ATOM   3071 O  O   . GLY A 1 396 ? 1.869   -3.780  41.113  1.00 27.83 ? 396 GLY A O   1 
ATOM   3072 N  N   . ASP A 1 397 ? 0.764   -4.120  39.169  1.00 30.14 ? 397 ASP A N   1 
ATOM   3073 C  CA  . ASP A 1 397 ? 1.885   -3.739  38.316  1.00 30.12 ? 397 ASP A CA  1 
ATOM   3074 C  C   . ASP A 1 397 ? 2.280   -2.278  38.534  1.00 31.74 ? 397 ASP A C   1 
ATOM   3075 O  O   . ASP A 1 397 ? 3.468   -1.947  38.615  1.00 30.54 ? 397 ASP A O   1 
ATOM   3076 C  CB  . ASP A 1 397 ? 1.556   -3.951  36.825  1.00 31.54 ? 397 ASP A CB  1 
ATOM   3077 C  CG  . ASP A 1 397 ? 1.410   -5.429  36.444  1.00 32.57 ? 397 ASP A CG  1 
ATOM   3078 O  OD1 . ASP A 1 397 ? 1.919   -6.313  37.161  1.00 34.18 ? 397 ASP A OD1 1 
ATOM   3079 O  OD2 . ASP A 1 397 ? 0.776   -5.714  35.409  1.00 34.77 ? 397 ASP A OD2 1 
ATOM   3080 N  N   . HIS A 1 398 ? 1.277   -1.407  38.604  1.00 30.66 ? 398 HIS A N   1 
ATOM   3081 C  CA  . HIS A 1 398 ? 1.495   0.037   38.670  1.00 31.14 ? 398 HIS A CA  1 
ATOM   3082 C  C   . HIS A 1 398 ? 1.953   0.535   40.052  1.00 30.65 ? 398 HIS A C   1 
ATOM   3083 O  O   . HIS A 1 398 ? 2.739   1.480   40.150  1.00 27.96 ? 398 HIS A O   1 
ATOM   3084 C  CB  . HIS A 1 398 ? 0.212   0.766   38.274  1.00 31.07 ? 398 HIS A CB  1 
ATOM   3085 C  CG  . HIS A 1 398 ? 0.200   2.221   38.631  1.00 31.29 ? 398 HIS A CG  1 
ATOM   3086 N  ND1 . HIS A 1 398 ? 1.039   3.142   38.039  1.00 31.88 ? 398 HIS A ND1 1 
ATOM   3087 C  CD2 . HIS A 1 398 ? -0.560  2.918   39.508  1.00 30.49 ? 398 HIS A CD2 1 
ATOM   3088 C  CE1 . HIS A 1 398 ? 0.798   4.341   38.540  1.00 30.51 ? 398 HIS A CE1 1 
ATOM   3089 N  NE2 . HIS A 1 398 ? -0.172  4.234   39.428  1.00 32.40 ? 398 HIS A NE2 1 
ATOM   3090 N  N   . ASN A 1 399 ? 1.442   -0.092  41.106  1.00 27.88 ? 399 ASN A N   1 
ATOM   3091 C  CA  . ASN A 1 399 ? 1.695   0.381   42.464  1.00 31.20 ? 399 ASN A CA  1 
ATOM   3092 C  C   . ASN A 1 399 ? 2.857   -0.324  43.148  1.00 32.76 ? 399 ASN A C   1 
ATOM   3093 O  O   . ASN A 1 399 ? 3.542   0.269   43.974  1.00 35.25 ? 399 ASN A O   1 
ATOM   3094 C  CB  . ASN A 1 399 ? 0.428   0.237   43.320  1.00 27.83 ? 399 ASN A CB  1 
ATOM   3095 C  CG  . ASN A 1 399 ? -0.600  1.298   43.001  1.00 30.96 ? 399 ASN A CG  1 
ATOM   3096 O  OD1 . ASN A 1 399 ? -0.313  2.496   43.072  1.00 34.20 ? 399 ASN A OD1 1 
ATOM   3097 N  ND2 . ASN A 1 399 ? -1.791  0.872   42.614  1.00 29.02 ? 399 ASN A ND2 1 
ATOM   3098 N  N   . VAL A 1 400 ? 3.066   -1.595  42.825  1.00 32.01 ? 400 VAL A N   1 
ATOM   3099 C  CA  . VAL A 1 400 ? 4.115   -2.356  43.476  1.00 29.09 ? 400 VAL A CA  1 
ATOM   3100 C  C   . VAL A 1 400 ? 5.162   -2.918  42.508  1.00 32.08 ? 400 VAL A C   1 
ATOM   3101 O  O   . VAL A 1 400 ? 6.338   -2.588  42.607  1.00 32.65 ? 400 VAL A O   1 
ATOM   3102 C  CB  . VAL A 1 400 ? 3.524   -3.509  44.287  1.00 33.00 ? 400 VAL A CB  1 
ATOM   3103 C  CG1 . VAL A 1 400 ? 4.648   -4.320  44.929  1.00 33.42 ? 400 VAL A CG1 1 
ATOM   3104 C  CG2 . VAL A 1 400 ? 2.574   -2.961  45.398  1.00 29.32 ? 400 VAL A CG2 1 
ATOM   3105 N  N   . ILE A 1 401 ? 4.742   -3.751  41.563  1.00 31.83 ? 401 ILE A N   1 
ATOM   3106 C  CA  . ILE A 1 401 ? 5.709   -4.574  40.849  1.00 33.70 ? 401 ILE A CA  1 
ATOM   3107 C  C   . ILE A 1 401 ? 6.625   -3.778  39.915  1.00 31.95 ? 401 ILE A C   1 
ATOM   3108 O  O   . ILE A 1 401 ? 7.834   -3.920  39.989  1.00 33.88 ? 401 ILE A O   1 
ATOM   3109 C  CB  . ILE A 1 401 ? 5.016   -5.681  40.059  1.00 34.94 ? 401 ILE A CB  1 
ATOM   3110 C  CG1 . ILE A 1 401 ? 4.324   -6.642  41.039  1.00 31.24 ? 401 ILE A CG1 1 
ATOM   3111 C  CG2 . ILE A 1 401 ? 6.029   -6.412  39.179  1.00 31.26 ? 401 ILE A CG2 1 
ATOM   3112 C  CD1 . ILE A 1 401 ? 3.781   -7.910  40.393  1.00 30.04 ? 401 ILE A CD1 1 
ATOM   3113 N  N   . CYS A 1 402 ? 6.072   -2.920  39.070  1.00 32.33 ? 402 CYS A N   1 
ATOM   3114 C  CA  . CYS A 1 402 ? 6.917   -2.162  38.153  1.00 33.72 ? 402 CYS A CA  1 
ATOM   3115 C  C   . CYS A 1 402 ? 7.704   -1.036  38.837  1.00 34.71 ? 402 CYS A C   1 
ATOM   3116 O  O   . CYS A 1 402 ? 8.811   -0.725  38.419  1.00 31.56 ? 402 CYS A O   1 
ATOM   3117 C  CB  . CYS A 1 402 ? 6.074   -1.607  36.996  1.00 33.85 ? 402 CYS A CB  1 
ATOM   3118 S  SG  . CYS A 1 402 ? 5.358   -2.944  35.971  1.00 34.36 ? 402 CYS A SG  1 
ATOM   3119 N  N   . PRO A 1 403 ? 7.141   -0.412  39.888  1.00 35.07 ? 403 PRO A N   1 
ATOM   3120 C  CA  . PRO A 1 403 ? 8.003   0.537   40.602  1.00 32.78 ? 403 PRO A CA  1 
ATOM   3121 C  C   . PRO A 1 403 ? 9.193   -0.169  41.227  1.00 35.41 ? 403 PRO A C   1 
ATOM   3122 O  O   . PRO A 1 403 ? 10.317  0.349   41.199  1.00 32.12 ? 403 PRO A O   1 
ATOM   3123 C  CB  . PRO A 1 403 ? 7.081   1.115   41.672  1.00 32.91 ? 403 PRO A CB  1 
ATOM   3124 C  CG  . PRO A 1 403 ? 5.716   1.007   41.058  1.00 32.54 ? 403 PRO A CG  1 
ATOM   3125 C  CD  . PRO A 1 403 ? 5.732   -0.288  40.299  1.00 32.53 ? 403 PRO A CD  1 
ATOM   3126 N  N   . LEU A 1 404 ? 8.952   -1.351  41.777  1.00 31.48 ? 404 LEU A N   1 
ATOM   3127 C  CA  . LEU A 1 404 ? 10.045  -2.118  42.335  1.00 32.79 ? 404 LEU A CA  1 
ATOM   3128 C  C   . LEU A 1 404 ? 11.060  -2.520  41.252  1.00 34.38 ? 404 LEU A C   1 
ATOM   3129 O  O   . LEU A 1 404 ? 12.274  -2.454  41.485  1.00 33.80 ? 404 LEU A O   1 
ATOM   3130 C  CB  . LEU A 1 404 ? 9.523   -3.355  43.078  1.00 30.88 ? 404 LEU A CB  1 
ATOM   3131 C  CG  . LEU A 1 404 ? 10.594  -4.127  43.864  1.00 33.68 ? 404 LEU A CG  1 
ATOM   3132 C  CD1 . LEU A 1 404 ? 10.068  -4.700  45.180  1.00 30.37 ? 404 LEU A CD1 1 
ATOM   3133 C  CD2 . LEU A 1 404 ? 11.220  -5.236  43.015  1.00 32.07 ? 404 LEU A CD2 1 
ATOM   3134 N  N   . MET A 1 405 ? 10.580  -2.924  40.074  1.00 33.48 ? 405 MET A N   1 
ATOM   3135 C  CA  . MET A 1 405 ? 11.497  -3.347  39.017  1.00 34.72 ? 405 MET A CA  1 
ATOM   3136 C  C   . MET A 1 405 ? 12.301  -2.148  38.531  1.00 34.13 ? 405 MET A C   1 
ATOM   3137 O  O   . MET A 1 405 ? 13.458  -2.282  38.176  1.00 33.47 ? 405 MET A O   1 
ATOM   3138 C  CB  . MET A 1 405 ? 10.752  -4.014  37.857  1.00 37.34 ? 405 MET A CB  1 
ATOM   3139 C  CG  . MET A 1 405 ? 10.095  -5.348  38.212  1.00 32.59 ? 405 MET A CG  1 
ATOM   3140 S  SD  . MET A 1 405 ? 11.253  -6.512  38.955  1.00 37.79 ? 405 MET A SD  1 
ATOM   3141 C  CE  . MET A 1 405 ? 12.589  -6.464  37.754  1.00 34.16 ? 405 MET A CE  1 
ATOM   3142 N  N   . HIS A 1 406 ? 11.701  -0.962  38.545  1.00 35.01 ? 406 HIS A N   1 
ATOM   3143 C  CA  . HIS A 1 406 ? 12.449  0.234   38.171  1.00 35.03 ? 406 HIS A CA  1 
ATOM   3144 C  C   . HIS A 1 406 ? 13.585  0.466   39.154  1.00 36.65 ? 406 HIS A C   1 
ATOM   3145 O  O   . HIS A 1 406 ? 14.690  0.850   38.768  1.00 35.96 ? 406 HIS A O   1 
ATOM   3146 C  CB  . HIS A 1 406 ? 11.557  1.472   38.133  1.00 33.00 ? 406 HIS A CB  1 
ATOM   3147 C  CG  . HIS A 1 406 ? 12.264  2.703   37.653  1.00 39.29 ? 406 HIS A CG  1 
ATOM   3148 N  ND1 . HIS A 1 406 ? 12.669  2.867   36.341  1.00 36.70 ? 406 HIS A ND1 1 
ATOM   3149 C  CD2 . HIS A 1 406 ? 12.642  3.827   38.308  1.00 35.76 ? 406 HIS A CD2 1 
ATOM   3150 C  CE1 . HIS A 1 406 ? 13.260  4.043   36.211  1.00 37.32 ? 406 HIS A CE1 1 
ATOM   3151 N  NE2 . HIS A 1 406 ? 13.261  4.643   37.390  1.00 42.84 ? 406 HIS A NE2 1 
ATOM   3152 N  N   . PHE A 1 407 ? 13.302  0.219   40.429  1.00 33.71 ? 407 PHE A N   1 
ATOM   3153 C  CA  . PHE A 1 407 ? 14.277  0.445   41.487  1.00 33.54 ? 407 PHE A CA  1 
ATOM   3154 C  C   . PHE A 1 407 ? 15.429  -0.534  41.356  1.00 30.74 ? 407 PHE A C   1 
ATOM   3155 O  O   . PHE A 1 407 ? 16.586  -0.154  41.399  1.00 29.92 ? 407 PHE A O   1 
ATOM   3156 C  CB  . PHE A 1 407 ? 13.604  0.317   42.862  1.00 28.35 ? 407 PHE A CB  1 
ATOM   3157 C  CG  . PHE A 1 407 ? 14.564  0.374   44.020  1.00 29.54 ? 407 PHE A CG  1 
ATOM   3158 C  CD1 . PHE A 1 407 ? 15.094  1.584   44.433  1.00 26.96 ? 407 PHE A CD1 1 
ATOM   3159 C  CD2 . PHE A 1 407 ? 14.927  -0.779  44.691  1.00 29.18 ? 407 PHE A CD2 1 
ATOM   3160 C  CE1 . PHE A 1 407 ? 15.966  1.649   45.494  1.00 32.01 ? 407 PHE A CE1 1 
ATOM   3161 C  CE2 . PHE A 1 407 ? 15.806  -0.729  45.767  1.00 29.22 ? 407 PHE A CE2 1 
ATOM   3162 C  CZ  . PHE A 1 407 ? 16.329  0.489   46.169  1.00 31.01 ? 407 PHE A CZ  1 
ATOM   3163 N  N   . VAL A 1 408 ? 15.089  -1.800  41.171  1.00 33.41 ? 408 VAL A N   1 
ATOM   3164 C  CA  . VAL A 1 408 ? 16.070  -2.869  41.118  1.00 34.13 ? 408 VAL A CA  1 
ATOM   3165 C  C   . VAL A 1 408 ? 17.040  -2.675  39.950  1.00 40.02 ? 408 VAL A C   1 
ATOM   3166 O  O   . VAL A 1 408 ? 18.242  -2.936  40.070  1.00 38.90 ? 408 VAL A O   1 
ATOM   3167 C  CB  . VAL A 1 408 ? 15.367  -4.236  41.011  1.00 35.38 ? 408 VAL A CB  1 
ATOM   3168 C  CG1 . VAL A 1 408 ? 15.643  -4.864  39.682  1.00 39.77 ? 408 VAL A CG1 1 
ATOM   3169 C  CG2 . VAL A 1 408 ? 15.834  -5.162  42.133  1.00 40.34 ? 408 VAL A CG2 1 
ATOM   3170 N  N   . ASN A 1 409 ? 16.521  -2.197  38.823  1.00 38.09 ? 409 ASN A N   1 
ATOM   3171 C  CA  . ASN A 1 409 ? 17.365  -1.973  37.664  1.00 36.60 ? 409 ASN A CA  1 
ATOM   3172 C  C   . ASN A 1 409 ? 18.268  -0.766  37.887  1.00 36.96 ? 409 ASN A C   1 
ATOM   3173 O  O   . ASN A 1 409 ? 19.446  -0.794  37.545  1.00 38.95 ? 409 ASN A O   1 
ATOM   3174 C  CB  . ASN A 1 409 ? 16.521  -1.805  36.396  1.00 35.25 ? 409 ASN A CB  1 
ATOM   3175 C  CG  . ASN A 1 409 ? 16.122  -3.146  35.780  1.00 45.50 ? 409 ASN A CG  1 
ATOM   3176 O  OD1 . ASN A 1 409 ? 16.961  -3.847  35.203  1.00 43.73 ? 409 ASN A OD1 1 
ATOM   3177 N  ND2 . ASN A 1 409 ? 14.838  -3.503  35.889  1.00 41.36 ? 409 ASN A ND2 1 
ATOM   3178 N  N   . LYS A 1 410 ? 17.733  0.296   38.474  1.00 37.35 ? 410 LYS A N   1 
ATOM   3179 C  CA  . LYS A 1 410 ? 18.584  1.446   38.771  1.00 38.37 ? 410 LYS A CA  1 
ATOM   3180 C  C   . LYS A 1 410 ? 19.604  1.113   39.864  1.00 35.12 ? 410 LYS A C   1 
ATOM   3181 O  O   . LYS A 1 410 ? 20.750  1.546   39.798  1.00 36.17 ? 410 LYS A O   1 
ATOM   3182 C  CB  . LYS A 1 410 ? 17.749  2.650   39.188  1.00 38.04 ? 410 LYS A CB  1 
ATOM   3183 C  CG  . LYS A 1 410 ? 16.868  3.189   38.086  1.00 35.22 ? 410 LYS A CG  1 
ATOM   3184 C  CD  . LYS A 1 410 ? 17.690  3.973   37.066  1.00 43.51 ? 410 LYS A CD  1 
ATOM   3185 C  CE  . LYS A 1 410 ? 16.898  4.222   35.774  1.00 43.62 ? 410 LYS A CE  1 
ATOM   3186 N  NZ  . LYS A 1 410 ? 17.528  5.280   34.942  1.00 47.39 ? 410 LYS A NZ  1 
ATOM   3187 N  N   . TYR A 1 411 ? 19.197  0.334   40.857  1.00 34.90 ? 411 TYR A N   1 
ATOM   3188 C  CA  . TYR A 1 411 ? 20.069  0.107   42.010  1.00 37.01 ? 411 TYR A CA  1 
ATOM   3189 C  C   . TYR A 1 411 ? 21.253  -0.778  41.639  1.00 36.28 ? 411 TYR A C   1 
ATOM   3190 O  O   . TYR A 1 411 ? 22.378  -0.535  42.046  1.00 33.38 ? 411 TYR A O   1 
ATOM   3191 C  CB  . TYR A 1 411 ? 19.307  -0.519  43.183  1.00 31.80 ? 411 TYR A CB  1 
ATOM   3192 C  CG  . TYR A 1 411 ? 20.176  -0.611  44.412  1.00 35.17 ? 411 TYR A CG  1 
ATOM   3193 C  CD1 . TYR A 1 411 ? 20.250  0.449   45.308  1.00 32.95 ? 411 TYR A CD1 1 
ATOM   3194 C  CD2 . TYR A 1 411 ? 20.966  -1.734  44.649  1.00 35.75 ? 411 TYR A CD2 1 
ATOM   3195 C  CE1 . TYR A 1 411 ? 21.075  0.388   46.425  1.00 35.26 ? 411 TYR A CE1 1 
ATOM   3196 C  CE2 . TYR A 1 411 ? 21.800  -1.804  45.756  1.00 35.03 ? 411 TYR A CE2 1 
ATOM   3197 C  CZ  . TYR A 1 411 ? 21.846  -0.739  46.642  1.00 37.70 ? 411 TYR A CZ  1 
ATOM   3198 O  OH  . TYR A 1 411 ? 22.659  -0.795  47.751  1.00 36.55 ? 411 TYR A OH  1 
ATOM   3199 N  N   . THR A 1 412 ? 20.969  -1.799  40.844  1.00 39.16 ? 412 THR A N   1 
ATOM   3200 C  CA  . THR A 1 412 ? 21.943  -2.798  40.452  1.00 37.19 ? 412 THR A CA  1 
ATOM   3201 C  C   . THR A 1 412 ? 23.138  -2.221  39.681  1.00 39.49 ? 412 THR A C   1 
ATOM   3202 O  O   . THR A 1 412 ? 24.239  -2.772  39.743  1.00 36.86 ? 412 THR A O   1 
ATOM   3203 C  CB  . THR A 1 412 ? 21.259  -3.881  39.616  1.00 40.70 ? 412 THR A CB  1 
ATOM   3204 O  OG1 . THR A 1 412 ? 20.299  -4.551  40.441  1.00 42.51 ? 412 THR A OG1 1 
ATOM   3205 C  CG2 . THR A 1 412 ? 22.270  -4.894  39.086  1.00 39.69 ? 412 THR A CG2 1 
ATOM   3206 N  N   . LYS A 1 413 ? 22.926  -1.112  38.972  1.00 38.49 ? 413 LYS A N   1 
ATOM   3207 C  CA  . LYS A 1 413 ? 24.026  -0.425  38.284  1.00 36.96 ? 413 LYS A CA  1 
ATOM   3208 C  C   . LYS A 1 413 ? 25.153  -0.009  39.230  1.00 39.47 ? 413 LYS A C   1 
ATOM   3209 O  O   . LYS A 1 413 ? 26.310  0.052   38.829  1.00 40.53 ? 413 LYS A O   1 
ATOM   3210 C  CB  . LYS A 1 413 ? 23.525  0.820   37.570  1.00 36.41 ? 413 LYS A CB  1 
ATOM   3211 C  CG  . LYS A 1 413 ? 22.589  0.551   36.425  1.00 45.10 ? 413 LYS A CG  1 
ATOM   3212 C  CD  . LYS A 1 413 ? 22.334  1.825   35.662  1.00 46.28 ? 413 LYS A CD  1 
ATOM   3213 C  CE  . LYS A 1 413 ? 21.256  1.606   34.617  1.00 54.32 ? 413 LYS A CE  1 
ATOM   3214 N  NZ  . LYS A 1 413 ? 21.529  0.378   33.804  1.00 58.82 ? 413 LYS A NZ  1 
ATOM   3215 N  N   . PHE A 1 414 ? 24.797  0.300   40.475  1.00 38.10 ? 414 PHE A N   1 
ATOM   3216 C  CA  . PHE A 1 414 ? 25.737  0.880   41.437  1.00 39.05 ? 414 PHE A CA  1 
ATOM   3217 C  C   . PHE A 1 414 ? 25.934  0.008   42.668  1.00 35.10 ? 414 PHE A C   1 
ATOM   3218 O  O   . PHE A 1 414 ? 26.933  0.129   43.355  1.00 38.59 ? 414 PHE A O   1 
ATOM   3219 C  CB  . PHE A 1 414 ? 25.269  2.269   41.878  1.00 36.22 ? 414 PHE A CB  1 
ATOM   3220 C  CG  . PHE A 1 414 ? 25.411  3.335   40.813  1.00 41.06 ? 414 PHE A CG  1 
ATOM   3221 C  CD1 . PHE A 1 414 ? 26.618  4.005   40.642  1.00 41.14 ? 414 PHE A CD1 1 
ATOM   3222 C  CD2 . PHE A 1 414 ? 24.338  3.676   39.997  1.00 40.84 ? 414 PHE A CD2 1 
ATOM   3223 C  CE1 . PHE A 1 414 ? 26.753  4.989   39.684  1.00 38.44 ? 414 PHE A CE1 1 
ATOM   3224 C  CE2 . PHE A 1 414 ? 24.464  4.659   39.021  1.00 41.97 ? 414 PHE A CE2 1 
ATOM   3225 C  CZ  . PHE A 1 414 ? 25.676  5.317   38.864  1.00 44.54 ? 414 PHE A CZ  1 
ATOM   3226 N  N   . GLY A 1 415 ? 24.986  -0.877  42.945  1.00 36.93 ? 415 GLY A N   1 
ATOM   3227 C  CA  . GLY A 1 415 ? 25.017  -1.655  44.176  1.00 35.04 ? 415 GLY A CA  1 
ATOM   3228 C  C   . GLY A 1 415 ? 26.076  -2.738  44.193  1.00 38.87 ? 415 GLY A C   1 
ATOM   3229 O  O   . GLY A 1 415 ? 26.815  -2.899  43.222  1.00 41.11 ? 415 GLY A O   1 
ATOM   3230 N  N   . ASN A 1 416 ? 26.142  -3.489  45.290  1.00 38.08 ? 416 ASN A N   1 
ATOM   3231 C  CA  . ASN A 1 416 ? 27.152  -4.532  45.440  1.00 43.54 ? 416 ASN A CA  1 
ATOM   3232 C  C   . ASN A 1 416 ? 26.519  -5.920  45.543  1.00 41.46 ? 416 ASN A C   1 
ATOM   3233 O  O   . ASN A 1 416 ? 27.108  -6.852  46.088  1.00 43.76 ? 416 ASN A O   1 
ATOM   3234 C  CB  . ASN A 1 416 ? 28.039  -4.246  46.665  1.00 41.68 ? 416 ASN A CB  1 
ATOM   3235 C  CG  . ASN A 1 416 ? 29.208  -5.244  46.812  1.00 45.49 ? 416 ASN A CG  1 
ATOM   3236 O  OD1 . ASN A 1 416 ? 29.240  -5.997  47.786  1.00 43.98 ? 416 ASN A OD1 1 
ATOM   3237 N  ND2 . ASN A 1 416 ? 30.155  -5.250  45.840  1.00 47.56 ? 416 ASN A ND2 1 
ATOM   3238 N  N   . GLY A 1 417 ? 25.323  -6.063  44.989  1.00 37.39 ? 417 GLY A N   1 
ATOM   3239 C  CA  . GLY A 1 417 ? 24.640  -7.347  44.987  1.00 41.68 ? 417 GLY A CA  1 
ATOM   3240 C  C   . GLY A 1 417 ? 23.125  -7.250  45.127  1.00 39.97 ? 417 GLY A C   1 
ATOM   3241 O  O   . GLY A 1 417 ? 22.618  -6.643  46.069  1.00 39.51 ? 417 GLY A O   1 
ATOM   3242 N  N   . THR A 1 418 ? 22.407  -7.866  44.193  1.00 38.67 ? 418 THR A N   1 
ATOM   3243 C  CA  . THR A 1 418 ? 20.947  -7.812  44.167  1.00 32.07 ? 418 THR A CA  1 
ATOM   3244 C  C   . THR A 1 418 ? 20.351  -9.209  44.075  1.00 36.02 ? 418 THR A C   1 
ATOM   3245 O  O   . THR A 1 418 ? 20.728  -9.996  43.209  1.00 41.59 ? 418 THR A O   1 
ATOM   3246 C  CB  . THR A 1 418 ? 20.450  -6.966  42.980  1.00 36.66 ? 418 THR A CB  1 
ATOM   3247 O  OG1 . THR A 1 418 ? 20.859  -5.613  43.169  1.00 36.79 ? 418 THR A OG1 1 
ATOM   3248 C  CG2 . THR A 1 418 ? 18.916  -7.014  42.851  1.00 35.54 ? 418 THR A CG2 1 
ATOM   3249 N  N   . TYR A 1 419 ? 19.418  -9.518  44.965  1.00 34.87 ? 419 TYR A N   1 
ATOM   3250 C  CA  . TYR A 1 419 ? 18.657  -10.759 44.869  1.00 37.12 ? 419 TYR A CA  1 
ATOM   3251 C  C   . TYR A 1 419 ? 17.160  -10.471 44.794  1.00 36.53 ? 419 TYR A C   1 
ATOM   3252 O  O   . TYR A 1 419 ? 16.589  -9.806  45.665  1.00 38.11 ? 419 TYR A O   1 
ATOM   3253 C  CB  . TYR A 1 419 ? 18.964  -11.678 46.049  1.00 37.26 ? 419 TYR A CB  1 
ATOM   3254 C  CG  . TYR A 1 419 ? 20.409  -12.107 46.084  1.00 43.20 ? 419 TYR A CG  1 
ATOM   3255 C  CD1 . TYR A 1 419 ? 21.364  -11.342 46.753  1.00 39.96 ? 419 TYR A CD1 1 
ATOM   3256 C  CD2 . TYR A 1 419 ? 20.828  -13.264 45.432  1.00 41.06 ? 419 TYR A CD2 1 
ATOM   3257 C  CE1 . TYR A 1 419 ? 22.688  -11.720 46.777  1.00 39.72 ? 419 TYR A CE1 1 
ATOM   3258 C  CE2 . TYR A 1 419 ? 22.150  -13.654 45.461  1.00 41.61 ? 419 TYR A CE2 1 
ATOM   3259 C  CZ  . TYR A 1 419 ? 23.077  -12.876 46.136  1.00 41.21 ? 419 TYR A CZ  1 
ATOM   3260 O  OH  . TYR A 1 419 ? 24.400  -13.249 46.161  1.00 44.36 ? 419 TYR A OH  1 
ATOM   3261 N  N   . LEU A 1 420 ? 16.533  -10.999 43.753  1.00 34.77 ? 420 LEU A N   1 
ATOM   3262 C  CA  . LEU A 1 420 ? 15.157  -10.679 43.414  1.00 33.68 ? 420 LEU A CA  1 
ATOM   3263 C  C   . LEU A 1 420 ? 14.285  -11.923 43.516  1.00 37.97 ? 420 LEU A C   1 
ATOM   3264 O  O   . LEU A 1 420 ? 14.692  -12.996 43.089  1.00 39.64 ? 420 LEU A O   1 
ATOM   3265 C  CB  . LEU A 1 420 ? 15.089  -10.089 42.003  1.00 36.08 ? 420 LEU A CB  1 
ATOM   3266 C  CG  . LEU A 1 420 ? 13.711  -9.665  41.501  1.00 38.27 ? 420 LEU A CG  1 
ATOM   3267 C  CD1 . LEU A 1 420 ? 13.146  -8.529  42.355  1.00 36.89 ? 420 LEU A CD1 1 
ATOM   3268 C  CD2 . LEU A 1 420 ? 13.788  -9.254  40.053  1.00 36.46 ? 420 LEU A CD2 1 
ATOM   3269 N  N   . TYR A 1 421 ? 13.090  -11.789 44.083  1.00 35.30 ? 421 TYR A N   1 
ATOM   3270 C  CA  . TYR A 1 421 ? 12.190  -12.929 44.185  1.00 36.99 ? 421 TYR A CA  1 
ATOM   3271 C  C   . TYR A 1 421 ? 10.773  -12.583 43.716  1.00 36.46 ? 421 TYR A C   1 
ATOM   3272 O  O   . TYR A 1 421 ? 10.395  -11.415 43.635  1.00 35.40 ? 421 TYR A O   1 
ATOM   3273 C  CB  . TYR A 1 421 ? 12.149  -13.464 45.630  1.00 36.28 ? 421 TYR A CB  1 
ATOM   3274 C  CG  . TYR A 1 421 ? 11.399  -12.580 46.609  1.00 38.40 ? 421 TYR A CG  1 
ATOM   3275 C  CD1 . TYR A 1 421 ? 10.006  -12.555 46.628  1.00 35.66 ? 421 TYR A CD1 1 
ATOM   3276 C  CD2 . TYR A 1 421 ? 12.082  -11.777 47.526  1.00 37.07 ? 421 TYR A CD2 1 
ATOM   3277 C  CE1 . TYR A 1 421 ? 9.309   -11.749 47.519  1.00 37.15 ? 421 TYR A CE1 1 
ATOM   3278 C  CE2 . TYR A 1 421 ? 11.387  -10.966 48.428  1.00 37.30 ? 421 TYR A CE2 1 
ATOM   3279 C  CZ  . TYR A 1 421 ? 10.000  -10.963 48.418  1.00 36.83 ? 421 TYR A CZ  1 
ATOM   3280 O  OH  . TYR A 1 421 ? 9.297   -10.170 49.292  1.00 33.49 ? 421 TYR A OH  1 
ATOM   3281 N  N   . PHE A 1 422 ? 9.996   -13.623 43.434  1.00 35.80 ? 422 PHE A N   1 
ATOM   3282 C  CA  . PHE A 1 422 ? 8.594   -13.512 43.045  1.00 36.59 ? 422 PHE A CA  1 
ATOM   3283 C  C   . PHE A 1 422 ? 7.851   -14.531 43.879  1.00 37.82 ? 422 PHE A C   1 
ATOM   3284 O  O   . PHE A 1 422 ? 7.962   -15.733 43.639  1.00 40.46 ? 422 PHE A O   1 
ATOM   3285 C  CB  . PHE A 1 422 ? 8.404   -13.773 41.541  1.00 36.37 ? 422 PHE A CB  1 
ATOM   3286 C  CG  . PHE A 1 422 ? 6.979   -13.613 41.045  1.00 35.81 ? 422 PHE A CG  1 
ATOM   3287 C  CD1 . PHE A 1 422 ? 6.476   -12.364 40.715  1.00 36.16 ? 422 PHE A CD1 1 
ATOM   3288 C  CD2 . PHE A 1 422 ? 6.165   -14.721 40.851  1.00 37.64 ? 422 PHE A CD2 1 
ATOM   3289 C  CE1 . PHE A 1 422 ? 5.167   -12.220 40.227  1.00 37.05 ? 422 PHE A CE1 1 
ATOM   3290 C  CE2 . PHE A 1 422 ? 4.857   -14.587 40.356  1.00 38.00 ? 422 PHE A CE2 1 
ATOM   3291 C  CZ  . PHE A 1 422 ? 4.356   -13.337 40.051  1.00 32.37 ? 422 PHE A CZ  1 
ATOM   3292 N  N   . PHE A 1 423 ? 7.126   -14.049 44.880  1.00 35.25 ? 423 PHE A N   1 
ATOM   3293 C  CA  . PHE A 1 423 ? 6.420   -14.918 45.808  1.00 36.72 ? 423 PHE A CA  1 
ATOM   3294 C  C   . PHE A 1 423 ? 5.025   -15.202 45.277  1.00 36.59 ? 423 PHE A C   1 
ATOM   3295 O  O   . PHE A 1 423 ? 4.210   -14.289 45.140  1.00 34.27 ? 423 PHE A O   1 
ATOM   3296 C  CB  . PHE A 1 423 ? 6.342   -14.275 47.201  1.00 31.52 ? 423 PHE A CB  1 
ATOM   3297 C  CG  . PHE A 1 423 ? 5.682   -15.147 48.244  1.00 35.83 ? 423 PHE A CG  1 
ATOM   3298 C  CD1 . PHE A 1 423 ? 6.434   -16.017 49.021  1.00 37.10 ? 423 PHE A CD1 1 
ATOM   3299 C  CD2 . PHE A 1 423 ? 4.321   -15.079 48.462  1.00 37.53 ? 423 PHE A CD2 1 
ATOM   3300 C  CE1 . PHE A 1 423 ? 5.838   -16.811 49.980  1.00 36.87 ? 423 PHE A CE1 1 
ATOM   3301 C  CE2 . PHE A 1 423 ? 3.714   -15.875 49.422  1.00 38.79 ? 423 PHE A CE2 1 
ATOM   3302 C  CZ  . PHE A 1 423 ? 4.477   -16.741 50.186  1.00 39.19 ? 423 PHE A CZ  1 
ATOM   3303 N  N   . ASN A 1 424 ? 4.756   -16.468 44.984  1.00 36.93 ? 424 ASN A N   1 
ATOM   3304 C  CA  . ASN A 1 424 ? 3.480   -16.847 44.397  1.00 39.81 ? 424 ASN A CA  1 
ATOM   3305 C  C   . ASN A 1 424 ? 2.894   -18.117 44.998  1.00 41.82 ? 424 ASN A C   1 
ATOM   3306 O  O   . ASN A 1 424 ? 2.190   -18.863 44.325  1.00 43.85 ? 424 ASN A O   1 
ATOM   3307 C  CB  . ASN A 1 424 ? 3.618   -16.997 42.870  1.00 42.99 ? 424 ASN A CB  1 
ATOM   3308 C  CG  . ASN A 1 424 ? 4.615   -18.084 42.455  1.00 40.39 ? 424 ASN A CG  1 
ATOM   3309 O  OD1 . ASN A 1 424 ? 5.376   -18.607 43.266  1.00 43.82 ? 424 ASN A OD1 1 
ATOM   3310 N  ND2 . ASN A 1 424 ? 4.612   -18.411 41.177  1.00 43.23 ? 424 ASN A ND2 1 
ATOM   3311 N  N   . HIS A 1 425 ? 3.187   -18.372 46.263  1.00 40.47 ? 425 HIS A N   1 
ATOM   3312 C  CA  . HIS A 1 425 ? 2.493   -19.442 46.960  1.00 45.84 ? 425 HIS A CA  1 
ATOM   3313 C  C   . HIS A 1 425 ? 1.187   -18.940 47.558  1.00 47.52 ? 425 HIS A C   1 
ATOM   3314 O  O   . HIS A 1 425 ? 1.164   -17.944 48.277  1.00 47.29 ? 425 HIS A O   1 
ATOM   3315 C  CB  . HIS A 1 425 ? 3.347   -20.049 48.065  1.00 39.80 ? 425 HIS A CB  1 
ATOM   3316 C  CG  . HIS A 1 425 ? 2.626   -21.095 48.847  1.00 47.79 ? 425 HIS A CG  1 
ATOM   3317 N  ND1 . HIS A 1 425 ? 2.243   -22.298 48.297  1.00 49.22 ? 425 HIS A ND1 1 
ATOM   3318 C  CD2 . HIS A 1 425 ? 2.173   -21.103 50.124  1.00 45.76 ? 425 HIS A CD2 1 
ATOM   3319 C  CE1 . HIS A 1 425 ? 1.606   -23.012 49.207  1.00 49.33 ? 425 HIS A CE1 1 
ATOM   3320 N  NE2 . HIS A 1 425 ? 1.549   -22.308 50.324  1.00 48.94 ? 425 HIS A NE2 1 
ATOM   3321 N  N   . ARG A 1 426 ? 0.101   -19.634 47.250  1.00 50.37 ? 426 ARG A N   1 
ATOM   3322 C  CA  . ARG A 1 426 ? -1.188  -19.362 47.872  1.00 50.30 ? 426 ARG A CA  1 
ATOM   3323 C  C   . ARG A 1 426 ? -1.364  -20.259 49.101  1.00 51.24 ? 426 ARG A C   1 
ATOM   3324 O  O   . ARG A 1 426 ? -1.506  -21.481 48.967  1.00 50.82 ? 426 ARG A O   1 
ATOM   3325 C  CB  . ARG A 1 426 ? -2.325  -19.580 46.865  1.00 47.99 ? 426 ARG A CB  1 
ATOM   3326 C  CG  . ARG A 1 426 ? -3.682  -19.838 47.503  1.00 52.21 ? 426 ARG A CG  1 
ATOM   3327 C  CD  . ARG A 1 426 ? -4.574  -18.609 47.484  1.00 50.39 ? 426 ARG A CD  1 
ATOM   3328 N  NE  . ARG A 1 426 ? -5.826  -18.862 48.193  1.00 48.52 ? 426 ARG A NE  1 
ATOM   3329 C  CZ  . ARG A 1 426 ? -6.767  -17.948 48.409  1.00 46.99 ? 426 ARG A CZ  1 
ATOM   3330 N  NH1 . ARG A 1 426 ? -7.871  -18.281 49.067  1.00 45.96 ? 426 ARG A NH1 1 
ATOM   3331 N  NH2 . ARG A 1 426 ? -6.611  -16.705 47.965  1.00 44.52 ? 426 ARG A NH2 1 
ATOM   3332 N  N   . ALA A 1 427 ? -1.344  -19.656 50.289  1.00 48.31 ? 427 ALA A N   1 
ATOM   3333 C  CA  . ALA A 1 427 ? -1.445  -20.411 51.541  1.00 50.52 ? 427 ALA A CA  1 
ATOM   3334 C  C   . ALA A 1 427 ? -2.724  -21.237 51.597  1.00 50.92 ? 427 ALA A C   1 
ATOM   3335 O  O   . ALA A 1 427 ? -3.786  -20.786 51.175  1.00 49.29 ? 427 ALA A O   1 
ATOM   3336 C  CB  . ALA A 1 427 ? -1.369  -19.473 52.745  1.00 45.93 ? 427 ALA A CB  1 
ATOM   3337 N  N   . SER A 1 428 ? -2.608  -22.449 52.128  1.00 51.92 ? 428 SER A N   1 
ATOM   3338 C  CA  . SER A 1 428 ? -3.719  -23.398 52.166  1.00 52.52 ? 428 SER A CA  1 
ATOM   3339 C  C   . SER A 1 428 ? -4.807  -22.998 53.155  1.00 51.31 ? 428 SER A C   1 
ATOM   3340 O  O   . SER A 1 428 ? -5.947  -23.432 53.038  1.00 57.33 ? 428 SER A O   1 
ATOM   3341 C  CB  . SER A 1 428 ? -3.202  -24.792 52.521  1.00 54.92 ? 428 SER A CB  1 
ATOM   3342 O  OG  . SER A 1 428 ? -2.512  -24.758 53.761  1.00 56.01 ? 428 SER A OG  1 
ATOM   3343 N  N   . ASN A 1 429 ? -4.448  -22.171 54.131  1.00 51.85 ? 429 ASN A N   1 
ATOM   3344 C  CA  . ASN A 1 429 ? -5.373  -21.773 55.188  1.00 48.41 ? 429 ASN A CA  1 
ATOM   3345 C  C   . ASN A 1 429 ? -5.894  -20.349 55.052  1.00 47.68 ? 429 ASN A C   1 
ATOM   3346 O  O   . ASN A 1 429 ? -6.411  -19.788 56.012  1.00 44.38 ? 429 ASN A O   1 
ATOM   3347 C  CB  . ASN A 1 429 ? -4.697  -21.924 56.554  1.00 51.35 ? 429 ASN A CB  1 
ATOM   3348 C  CG  . ASN A 1 429 ? -3.352  -21.215 56.623  1.00 51.39 ? 429 ASN A CG  1 
ATOM   3349 O  OD1 . ASN A 1 429 ? -2.989  -20.433 55.729  1.00 51.38 ? 429 ASN A OD1 1 
ATOM   3350 N  ND2 . ASN A 1 429 ? -2.600  -21.491 57.681  1.00 45.19 ? 429 ASN A ND2 1 
ATOM   3351 N  N   . LEU A 1 430 ? -5.749  -19.759 53.870  1.00 49.87 ? 430 LEU A N   1 
ATOM   3352 C  CA  . LEU A 1 430 ? -6.170  -18.377 53.659  1.00 48.20 ? 430 LEU A CA  1 
ATOM   3353 C  C   . LEU A 1 430 ? -7.680  -18.226 53.858  1.00 45.56 ? 430 LEU A C   1 
ATOM   3354 O  O   . LEU A 1 430 ? -8.461  -19.097 53.474  1.00 46.14 ? 430 LEU A O   1 
ATOM   3355 C  CB  . LEU A 1 430 ? -5.771  -17.894 52.260  1.00 49.55 ? 430 LEU A CB  1 
ATOM   3356 C  CG  . LEU A 1 430 ? -5.360  -16.419 52.163  1.00 49.37 ? 430 LEU A CG  1 
ATOM   3357 C  CD1 . LEU A 1 430 ? -4.142  -16.138 53.033  1.00 44.96 ? 430 LEU A CD1 1 
ATOM   3358 C  CD2 . LEU A 1 430 ? -5.076  -16.023 50.732  1.00 51.79 ? 430 LEU A CD2 1 
ATOM   3359 N  N   . VAL A 1 431 ? -8.085  -17.115 54.461  1.00 44.45 ? 431 VAL A N   1 
ATOM   3360 C  CA  . VAL A 1 431 ? -9.493  -16.875 54.743  1.00 44.27 ? 431 VAL A CA  1 
ATOM   3361 C  C   . VAL A 1 431 ? -10.121 -15.987 53.684  1.00 42.43 ? 431 VAL A C   1 
ATOM   3362 O  O   . VAL A 1 431 ? -11.339 -15.853 53.609  1.00 43.87 ? 431 VAL A O   1 
ATOM   3363 C  CB  . VAL A 1 431 ? -9.684  -16.222 56.122  1.00 47.42 ? 431 VAL A CB  1 
ATOM   3364 C  CG1 . VAL A 1 431 ? -9.277  -17.188 57.217  1.00 46.58 ? 431 VAL A CG1 1 
ATOM   3365 C  CG2 . VAL A 1 431 ? -8.883  -14.930 56.204  1.00 46.32 ? 431 VAL A CG2 1 
ATOM   3366 N  N   . TRP A 1 432 ? -9.274  -15.365 52.877  1.00 43.72 ? 432 TRP A N   1 
ATOM   3367 C  CA  . TRP A 1 432 ? -9.728  -14.588 51.742  1.00 43.06 ? 432 TRP A CA  1 
ATOM   3368 C  C   . TRP A 1 432 ? -10.121 -15.519 50.592  1.00 43.53 ? 432 TRP A C   1 
ATOM   3369 O  O   . TRP A 1 432 ? -9.621  -16.643 50.501  1.00 43.36 ? 432 TRP A O   1 
ATOM   3370 C  CB  . TRP A 1 432 ? -8.636  -13.617 51.297  1.00 43.05 ? 432 TRP A CB  1 
ATOM   3371 C  CG  . TRP A 1 432 ? -8.290  -12.574 52.321  1.00 43.56 ? 432 TRP A CG  1 
ATOM   3372 C  CD1 . TRP A 1 432 ? -7.182  -12.540 53.122  1.00 41.88 ? 432 TRP A CD1 1 
ATOM   3373 C  CD2 . TRP A 1 432 ? -9.056  -11.408 52.644  1.00 38.21 ? 432 TRP A CD2 1 
ATOM   3374 N  NE1 . TRP A 1 432 ? -7.215  -11.420 53.921  1.00 39.85 ? 432 TRP A NE1 1 
ATOM   3375 C  CE2 . TRP A 1 432 ? -8.356  -10.710 53.644  1.00 40.94 ? 432 TRP A CE2 1 
ATOM   3376 C  CE3 . TRP A 1 432 ? -10.271 -10.890 52.186  1.00 40.22 ? 432 TRP A CE3 1 
ATOM   3377 C  CZ2 . TRP A 1 432 ? -8.829  -9.520  54.192  1.00 41.12 ? 432 TRP A CZ2 1 
ATOM   3378 C  CZ3 . TRP A 1 432 ? -10.740 -9.709  52.731  1.00 37.59 ? 432 TRP A CZ3 1 
ATOM   3379 C  CH2 . TRP A 1 432 ? -10.016 -9.035  53.719  1.00 39.18 ? 432 TRP A CH2 1 
ATOM   3380 N  N   . PRO A 1 433 ? -11.025 -15.056 49.718  1.00 39.75 ? 433 PRO A N   1 
ATOM   3381 C  CA  . PRO A 1 433 ? -11.481 -15.843 48.565  1.00 41.28 ? 433 PRO A CA  1 
ATOM   3382 C  C   . PRO A 1 433 ? -10.367 -16.112 47.561  1.00 43.62 ? 433 PRO A C   1 
ATOM   3383 O  O   . PRO A 1 433 ? -9.406  -15.344 47.479  1.00 40.28 ? 433 PRO A O   1 
ATOM   3384 C  CB  . PRO A 1 433 ? -12.557 -14.957 47.935  1.00 37.53 ? 433 PRO A CB  1 
ATOM   3385 C  CG  . PRO A 1 433 ? -12.206 -13.579 48.352  1.00 40.30 ? 433 PRO A CG  1 
ATOM   3386 C  CD  . PRO A 1 433 ? -11.634 -13.717 49.746  1.00 40.96 ? 433 PRO A CD  1 
ATOM   3387 N  N   . GLU A 1 434 ? -10.519 -17.188 46.795  1.00 45.83 ? 434 GLU A N   1 
ATOM   3388 C  CA  . GLU A 1 434 ? -9.534  -17.579 45.785  1.00 48.25 ? 434 GLU A CA  1 
ATOM   3389 C  C   . GLU A 1 434 ? -9.177  -16.483 44.783  1.00 41.61 ? 434 GLU A C   1 
ATOM   3390 O  O   . GLU A 1 434 ? -8.017  -16.354 44.404  1.00 41.09 ? 434 GLU A O   1 
ATOM   3391 C  CB  . GLU A 1 434 ? -10.025 -18.804 45.019  1.00 48.02 ? 434 GLU A CB  1 
ATOM   3392 C  CG  . GLU A 1 434 ? -9.871  -20.108 45.784  1.00 54.15 ? 434 GLU A CG  1 
ATOM   3393 C  CD  . GLU A 1 434 ? -10.006 -21.336 44.894  1.00 67.39 ? 434 GLU A CD  1 
ATOM   3394 O  OE1 . GLU A 1 434 ? -10.034 -21.182 43.648  1.00 69.55 ? 434 GLU A OE1 1 
ATOM   3395 O  OE2 . GLU A 1 434 ? -10.081 -22.459 45.441  1.00 67.24 ? 434 GLU A OE2 1 
ATOM   3396 N  N   . TRP A 1 435 ? -10.150 -15.686 44.358  1.00 39.72 ? 435 TRP A N   1 
ATOM   3397 C  CA  . TRP A 1 435 ? -9.879  -14.740 43.272  1.00 40.97 ? 435 TRP A CA  1 
ATOM   3398 C  C   . TRP A 1 435 ? -8.805  -13.731 43.656  1.00 38.73 ? 435 TRP A C   1 
ATOM   3399 O  O   . TRP A 1 435 ? -8.159  -13.140 42.789  1.00 39.15 ? 435 TRP A O   1 
ATOM   3400 C  CB  . TRP A 1 435 ? -11.155 -14.006 42.831  1.00 38.25 ? 435 TRP A CB  1 
ATOM   3401 C  CG  . TRP A 1 435 ? -11.679 -12.950 43.782  1.00 40.51 ? 435 TRP A CG  1 
ATOM   3402 C  CD1 . TRP A 1 435 ? -12.731 -13.080 44.659  1.00 37.94 ? 435 TRP A CD1 1 
ATOM   3403 C  CD2 . TRP A 1 435 ? -11.208 -11.600 43.928  1.00 38.38 ? 435 TRP A CD2 1 
ATOM   3404 N  NE1 . TRP A 1 435 ? -12.932 -11.904 45.337  1.00 37.46 ? 435 TRP A NE1 1 
ATOM   3405 C  CE2 . TRP A 1 435 ? -12.010 -10.982 44.915  1.00 38.29 ? 435 TRP A CE2 1 
ATOM   3406 C  CE3 . TRP A 1 435 ? -10.183 -10.858 43.330  1.00 36.64 ? 435 TRP A CE3 1 
ATOM   3407 C  CZ2 . TRP A 1 435 ? -11.821 -9.659  45.308  1.00 36.24 ? 435 TRP A CZ2 1 
ATOM   3408 C  CZ3 . TRP A 1 435 ? -9.998  -9.542  43.726  1.00 38.14 ? 435 TRP A CZ3 1 
ATOM   3409 C  CH2 . TRP A 1 435 ? -10.807 -8.960  44.715  1.00 33.80 ? 435 TRP A CH2 1 
ATOM   3410 N  N   . MET A 1 436 ? -8.609  -13.546 44.955  1.00 39.63 ? 436 MET A N   1 
ATOM   3411 C  CA  . MET A 1 436 ? -7.661  -12.553 45.441  1.00 37.35 ? 436 MET A CA  1 
ATOM   3412 C  C   . MET A 1 436 ? -6.229  -13.052 45.298  1.00 35.38 ? 436 MET A C   1 
ATOM   3413 O  O   . MET A 1 436 ? -5.297  -12.260 45.306  1.00 33.19 ? 436 MET A O   1 
ATOM   3414 C  CB  . MET A 1 436 ? -7.971  -12.178 46.893  1.00 37.81 ? 436 MET A CB  1 
ATOM   3415 C  CG  . MET A 1 436 ? -9.285  -11.401 47.041  1.00 38.26 ? 436 MET A CG  1 
ATOM   3416 S  SD  . MET A 1 436 ? -9.639  -10.888 48.731  1.00 38.49 ? 436 MET A SD  1 
ATOM   3417 C  CE  . MET A 1 436 ? -8.438  -9.592  49.006  1.00 35.03 ? 436 MET A CE  1 
ATOM   3418 N  N   . GLY A 1 437 ? -6.073  -14.365 45.151  1.00 34.18 ? 437 GLY A N   1 
ATOM   3419 C  CA  . GLY A 1 437 ? -4.785  -14.971 44.871  1.00 36.46 ? 437 GLY A CA  1 
ATOM   3420 C  C   . GLY A 1 437 ? -3.767  -14.850 45.994  1.00 39.91 ? 437 GLY A C   1 
ATOM   3421 O  O   . GLY A 1 437 ? -4.095  -15.031 47.174  1.00 39.32 ? 437 GLY A O   1 
ATOM   3422 N  N   . VAL A 1 438 ? -2.526  -14.561 45.608  1.00 36.46 ? 438 VAL A N   1 
ATOM   3423 C  CA  . VAL A 1 438 ? -1.412  -14.371 46.528  1.00 36.37 ? 438 VAL A CA  1 
ATOM   3424 C  C   . VAL A 1 438 ? -1.378  -12.917 46.949  1.00 36.55 ? 438 VAL A C   1 
ATOM   3425 O  O   . VAL A 1 438 ? -0.807  -12.072 46.264  1.00 38.55 ? 438 VAL A O   1 
ATOM   3426 C  CB  . VAL A 1 438 ? -0.058  -14.740 45.891  1.00 41.00 ? 438 VAL A CB  1 
ATOM   3427 C  CG1 . VAL A 1 438 ? 1.056   -14.702 46.942  1.00 35.86 ? 438 VAL A CG1 1 
ATOM   3428 C  CG2 . VAL A 1 438 ? -0.138  -16.106 45.220  1.00 39.69 ? 438 VAL A CG2 1 
ATOM   3429 N  N   . ILE A 1 439 ? -1.971  -12.637 48.096  1.00 33.72 ? 439 ILE A N   1 
ATOM   3430 C  CA  . ILE A 1 439 ? -2.354  -11.283 48.443  1.00 36.76 ? 439 ILE A CA  1 
ATOM   3431 C  C   . ILE A 1 439 ? -1.202  -10.440 48.954  1.00 33.39 ? 439 ILE A C   1 
ATOM   3432 O  O   . ILE A 1 439 ? -0.206  -10.962 49.444  1.00 33.35 ? 439 ILE A O   1 
ATOM   3433 C  CB  . ILE A 1 439 ? -3.491  -11.328 49.483  1.00 36.17 ? 439 ILE A CB  1 
ATOM   3434 C  CG1 . ILE A 1 439 ? -4.693  -12.047 48.860  1.00 34.93 ? 439 ILE A CG1 1 
ATOM   3435 C  CG2 . ILE A 1 439 ? -3.878  -9.926  49.955  1.00 36.56 ? 439 ILE A CG2 1 
ATOM   3436 C  CD1 . ILE A 1 439 ? -5.823  -12.282 49.824  1.00 39.95 ? 439 ILE A CD1 1 
ATOM   3437 N  N   . HIS A 1 440 ? -1.342  -9.131  48.786  1.00 32.39 ? 440 HIS A N   1 
ATOM   3438 C  CA  . HIS A 1 440 ? -0.455  -8.144  49.382  1.00 32.95 ? 440 HIS A CA  1 
ATOM   3439 C  C   . HIS A 1 440 ? -0.344  -8.380  50.898  1.00 40.27 ? 440 HIS A C   1 
ATOM   3440 O  O   . HIS A 1 440 ? -1.343  -8.271  51.625  1.00 32.67 ? 440 HIS A O   1 
ATOM   3441 C  CB  . HIS A 1 440 ? -0.999  -6.748  49.088  1.00 36.82 ? 440 HIS A CB  1 
ATOM   3442 C  CG  . HIS A 1 440 ? -0.091  -5.625  49.487  1.00 37.50 ? 440 HIS A CG  1 
ATOM   3443 N  ND1 . HIS A 1 440 ? 1.119   -5.387  48.871  1.00 38.49 ? 440 HIS A ND1 1 
ATOM   3444 C  CD2 . HIS A 1 440 ? -0.242  -4.645  50.410  1.00 36.42 ? 440 HIS A CD2 1 
ATOM   3445 C  CE1 . HIS A 1 440 ? 1.684   -4.320  49.408  1.00 36.93 ? 440 HIS A CE1 1 
ATOM   3446 N  NE2 . HIS A 1 440 ? 0.877   -3.850  50.343  1.00 40.35 ? 440 HIS A NE2 1 
ATOM   3447 N  N   . GLY A 1 441 ? 0.859   -8.737  51.354  1.00 34.03 ? 441 GLY A N   1 
ATOM   3448 C  CA  . GLY A 1 441 ? 1.140   -8.879  52.775  1.00 36.47 ? 441 GLY A CA  1 
ATOM   3449 C  C   . GLY A 1 441 ? 1.269   -10.313 53.256  1.00 35.28 ? 441 GLY A C   1 
ATOM   3450 O  O   . GLY A 1 441 ? 1.675   -10.574 54.393  1.00 32.25 ? 441 GLY A O   1 
ATOM   3451 N  N   . TYR A 1 442 ? 0.937   -11.264 52.392  1.00 34.88 ? 442 TYR A N   1 
ATOM   3452 C  CA  . TYR A 1 442 ? 0.767   -12.617 52.885  1.00 35.69 ? 442 TYR A CA  1 
ATOM   3453 C  C   . TYR A 1 442 ? 1.989   -13.502 52.687  1.00 34.64 ? 442 TYR A C   1 
ATOM   3454 O  O   . TYR A 1 442 ? 1.938   -14.703 52.932  1.00 36.09 ? 442 TYR A O   1 
ATOM   3455 C  CB  . TYR A 1 442 ? -0.508  -13.216 52.270  1.00 35.02 ? 442 TYR A CB  1 
ATOM   3456 C  CG  . TYR A 1 442 ? -1.707  -12.744 53.076  1.00 37.98 ? 442 TYR A CG  1 
ATOM   3457 C  CD1 . TYR A 1 442 ? -2.344  -11.544 52.778  1.00 35.35 ? 442 TYR A CD1 1 
ATOM   3458 C  CD2 . TYR A 1 442 ? -2.138  -13.456 54.199  1.00 39.72 ? 442 TYR A CD2 1 
ATOM   3459 C  CE1 . TYR A 1 442 ? -3.404  -11.095 53.536  1.00 35.29 ? 442 TYR A CE1 1 
ATOM   3460 C  CE2 . TYR A 1 442 ? -3.200  -13.014 54.965  1.00 34.92 ? 442 TYR A CE2 1 
ATOM   3461 C  CZ  . TYR A 1 442 ? -3.827  -11.833 54.632  1.00 39.75 ? 442 TYR A CZ  1 
ATOM   3462 O  OH  . TYR A 1 442 ? -4.882  -11.383 55.394  1.00 38.81 ? 442 TYR A OH  1 
ATOM   3463 N  N   . GLU A 1 443 ? 3.102   -12.897 52.283  1.00 32.34 ? 443 GLU A N   1 
ATOM   3464 C  CA  . GLU A 1 443 ? 4.388   -13.571 52.383  1.00 31.91 ? 443 GLU A CA  1 
ATOM   3465 C  C   . GLU A 1 443 ? 4.959   -13.345 53.802  1.00 36.17 ? 443 GLU A C   1 
ATOM   3466 O  O   . GLU A 1 443 ? 5.821   -14.094 54.271  1.00 33.26 ? 443 GLU A O   1 
ATOM   3467 C  CB  . GLU A 1 443 ? 5.366   -13.070 51.306  1.00 32.27 ? 443 GLU A CB  1 
ATOM   3468 C  CG  . GLU A 1 443 ? 6.181   -11.825 51.685  1.00 34.28 ? 443 GLU A CG  1 
ATOM   3469 C  CD  . GLU A 1 443 ? 5.333   -10.562 51.841  1.00 39.71 ? 443 GLU A CD  1 
ATOM   3470 O  OE1 . GLU A 1 443 ? 4.157   -10.557 51.390  1.00 37.64 ? 443 GLU A OE1 1 
ATOM   3471 O  OE2 . GLU A 1 443 ? 5.847   -9.576  52.419  1.00 37.36 ? 443 GLU A OE2 1 
ATOM   3472 N  N   . ILE A 1 444 ? 4.455   -12.315 54.481  1.00 32.99 ? 444 ILE A N   1 
ATOM   3473 C  CA  . ILE A 1 444 ? 4.964   -11.954 55.802  1.00 35.91 ? 444 ILE A CA  1 
ATOM   3474 C  C   . ILE A 1 444 ? 4.873   -13.110 56.797  1.00 36.26 ? 444 ILE A C   1 
ATOM   3475 O  O   . ILE A 1 444 ? 5.842   -13.382 57.502  1.00 38.13 ? 444 ILE A O   1 
ATOM   3476 C  CB  . ILE A 1 444 ? 4.236   -10.737 56.389  1.00 35.53 ? 444 ILE A CB  1 
ATOM   3477 C  CG1 . ILE A 1 444 ? 4.446   -9.520  55.489  1.00 30.50 ? 444 ILE A CG1 1 
ATOM   3478 C  CG2 . ILE A 1 444 ? 4.758   -10.437 57.794  1.00 30.89 ? 444 ILE A CG2 1 
ATOM   3479 C  CD1 . ILE A 1 444 ? 3.697   -8.291  55.920  1.00 32.83 ? 444 ILE A CD1 1 
ATOM   3480 N  N   . GLU A 1 445 ? 3.743   -13.812 56.839  1.00 32.47 ? 445 GLU A N   1 
ATOM   3481 C  CA  . GLU A 1 445 ? 3.619   -14.927 57.776  1.00 38.78 ? 445 GLU A CA  1 
ATOM   3482 C  C   . GLU A 1 445 ? 4.684   -16.017 57.548  1.00 38.65 ? 445 GLU A C   1 
ATOM   3483 O  O   . GLU A 1 445 ? 5.039   -16.747 58.471  1.00 39.88 ? 445 GLU A O   1 
ATOM   3484 C  CB  . GLU A 1 445 ? 2.208   -15.524 57.714  1.00 37.94 ? 445 GLU A CB  1 
ATOM   3485 C  CG  . GLU A 1 445 ? 1.684   -15.792 56.318  1.00 42.24 ? 445 GLU A CG  1 
ATOM   3486 C  CD  . GLU A 1 445 ? 0.155   -15.832 56.269  1.00 45.69 ? 445 GLU A CD  1 
ATOM   3487 O  OE1 . GLU A 1 445 ? -0.485  -14.800 56.567  1.00 42.12 ? 445 GLU A OE1 1 
ATOM   3488 O  OE2 . GLU A 1 445 ? -0.412  -16.899 55.940  1.00 49.35 ? 445 GLU A OE2 1 
ATOM   3489 N  N   . PHE A 1 446 ? 5.212   -16.110 56.333  1.00 37.51 ? 446 PHE A N   1 
ATOM   3490 C  CA  . PHE A 1 446 ? 6.233   -17.110 56.025  1.00 36.78 ? 446 PHE A CA  1 
ATOM   3491 C  C   . PHE A 1 446 ? 7.623   -16.627 56.444  1.00 38.52 ? 446 PHE A C   1 
ATOM   3492 O  O   . PHE A 1 446 ? 8.452   -17.414 56.912  1.00 39.09 ? 446 PHE A O   1 
ATOM   3493 C  CB  . PHE A 1 446 ? 6.210   -17.466 54.526  1.00 38.78 ? 446 PHE A CB  1 
ATOM   3494 C  CG  . PHE A 1 446 ? 5.098   -18.407 54.157  1.00 40.81 ? 446 PHE A CG  1 
ATOM   3495 C  CD1 . PHE A 1 446 ? 3.838   -17.926 53.835  1.00 38.23 ? 446 PHE A CD1 1 
ATOM   3496 C  CD2 . PHE A 1 446 ? 5.295   -19.775 54.185  1.00 39.52 ? 446 PHE A CD2 1 
ATOM   3497 C  CE1 . PHE A 1 446 ? 2.809   -18.789 53.527  1.00 39.18 ? 446 PHE A CE1 1 
ATOM   3498 C  CE2 . PHE A 1 446 ? 4.265   -20.640 53.881  1.00 40.65 ? 446 PHE A CE2 1 
ATOM   3499 C  CZ  . PHE A 1 446 ? 3.022   -20.146 53.550  1.00 40.11 ? 446 PHE A CZ  1 
ATOM   3500 N  N   . VAL A 1 447 ? 7.871   -15.332 56.278  1.00 34.80 ? 447 VAL A N   1 
ATOM   3501 C  CA  . VAL A 1 447 ? 9.133   -14.729 56.682  1.00 34.97 ? 447 VAL A CA  1 
ATOM   3502 C  C   . VAL A 1 447 ? 9.314   -14.769 58.214  1.00 38.67 ? 447 VAL A C   1 
ATOM   3503 O  O   . VAL A 1 447 ? 10.442  -14.892 58.707  1.00 38.70 ? 447 VAL A O   1 
ATOM   3504 C  CB  . VAL A 1 447 ? 9.233   -13.276 56.167  1.00 35.79 ? 447 VAL A CB  1 
ATOM   3505 C  CG1 . VAL A 1 447 ? 10.402  -12.549 56.812  1.00 35.38 ? 447 VAL A CG1 1 
ATOM   3506 C  CG2 . VAL A 1 447 ? 9.361   -13.250 54.629  1.00 31.62 ? 447 VAL A CG2 1 
ATOM   3507 N  N   . PHE A 1 448 ? 8.211   -14.689 58.958  1.00 33.99 ? 448 PHE A N   1 
ATOM   3508 C  CA  . PHE A 1 448 ? 8.286   -14.748 60.417  1.00 40.99 ? 448 PHE A CA  1 
ATOM   3509 C  C   . PHE A 1 448 ? 8.047   -16.152 60.962  1.00 40.50 ? 448 PHE A C   1 
ATOM   3510 O  O   . PHE A 1 448 ? 7.972   -16.341 62.165  1.00 38.71 ? 448 PHE A O   1 
ATOM   3511 C  CB  . PHE A 1 448 ? 7.303   -13.758 61.057  1.00 40.13 ? 448 PHE A CB  1 
ATOM   3512 C  CG  . PHE A 1 448 ? 7.801   -12.344 61.054  1.00 40.35 ? 448 PHE A CG  1 
ATOM   3513 C  CD1 . PHE A 1 448 ? 7.748   -11.581 59.897  1.00 37.54 ? 448 PHE A CD1 1 
ATOM   3514 C  CD2 . PHE A 1 448 ? 8.343   -11.783 62.199  1.00 38.97 ? 448 PHE A CD2 1 
ATOM   3515 C  CE1 . PHE A 1 448 ? 8.217   -10.282 59.886  1.00 37.69 ? 448 PHE A CE1 1 
ATOM   3516 C  CE2 . PHE A 1 448 ? 8.813   -10.484 62.193  1.00 41.08 ? 448 PHE A CE2 1 
ATOM   3517 C  CZ  . PHE A 1 448 ? 8.753   -9.733  61.024  1.00 38.48 ? 448 PHE A CZ  1 
ATOM   3518 N  N   . GLY A 1 449 ? 7.934   -17.135 60.075  1.00 39.37 ? 449 GLY A N   1 
ATOM   3519 C  CA  . GLY A 1 449 ? 7.950   -18.519 60.509  1.00 41.20 ? 449 GLY A CA  1 
ATOM   3520 C  C   . GLY A 1 449 ? 6.687   -18.996 61.200  1.00 42.44 ? 449 GLY A C   1 
ATOM   3521 O  O   . GLY A 1 449 ? 6.699   -20.008 61.893  1.00 43.88 ? 449 GLY A O   1 
ATOM   3522 N  N   . LEU A 1 450 ? 5.599   -18.263 61.004  1.00 40.71 ? 450 LEU A N   1 
ATOM   3523 C  CA  . LEU A 1 450 ? 4.286   -18.656 61.496  1.00 43.57 ? 450 LEU A CA  1 
ATOM   3524 C  C   . LEU A 1 450 ? 3.876   -20.080 61.093  1.00 46.29 ? 450 LEU A C   1 
ATOM   3525 O  O   . LEU A 1 450 ? 3.246   -20.781 61.884  1.00 47.70 ? 450 LEU A O   1 
ATOM   3526 C  CB  . LEU A 1 450 ? 3.234   -17.659 61.004  1.00 42.65 ? 450 LEU A CB  1 
ATOM   3527 C  CG  . LEU A 1 450 ? 3.030   -16.377 61.818  1.00 45.20 ? 450 LEU A CG  1 
ATOM   3528 C  CD1 . LEU A 1 450 ? 2.234   -16.707 63.043  1.00 44.56 ? 450 LEU A CD1 1 
ATOM   3529 C  CD2 . LEU A 1 450 ? 4.361   -15.724 62.200  1.00 41.44 ? 450 LEU A CD2 1 
ATOM   3530 N  N   . PRO A 1 451 ? 4.206   -20.506 59.857  1.00 45.05 ? 451 PRO A N   1 
ATOM   3531 C  CA  . PRO A 1 451 ? 3.933   -21.898 59.470  1.00 47.98 ? 451 PRO A CA  1 
ATOM   3532 C  C   . PRO A 1 451 ? 4.624   -22.942 60.360  1.00 50.40 ? 451 PRO A C   1 
ATOM   3533 O  O   . PRO A 1 451 ? 4.194   -24.098 60.339  1.00 52.35 ? 451 PRO A O   1 
ATOM   3534 C  CB  . PRO A 1 451 ? 4.472   -21.972 58.031  1.00 43.30 ? 451 PRO A CB  1 
ATOM   3535 C  CG  . PRO A 1 451 ? 4.315   -20.593 57.523  1.00 42.89 ? 451 PRO A CG  1 
ATOM   3536 C  CD  . PRO A 1 451 ? 4.634   -19.699 58.697  1.00 42.31 ? 451 PRO A CD  1 
ATOM   3537 N  N   . LEU A 1 452 ? 5.656   -22.555 61.114  1.00 44.77 ? 452 LEU A N   1 
ATOM   3538 C  CA  . LEU A 1 452 ? 6.320   -23.482 62.034  1.00 46.35 ? 452 LEU A CA  1 
ATOM   3539 C  C   . LEU A 1 452 ? 5.450   -23.841 63.241  1.00 47.61 ? 452 LEU A C   1 
ATOM   3540 O  O   . LEU A 1 452 ? 5.810   -24.722 64.030  1.00 50.37 ? 452 LEU A O   1 
ATOM   3541 C  CB  . LEU A 1 452 ? 7.650   -22.905 62.542  1.00 44.70 ? 452 LEU A CB  1 
ATOM   3542 C  CG  . LEU A 1 452 ? 8.799   -22.590 61.578  1.00 45.36 ? 452 LEU A CG  1 
ATOM   3543 C  CD1 . LEU A 1 452 ? 10.121  -22.992 62.208  1.00 44.75 ? 452 LEU A CD1 1 
ATOM   3544 C  CD2 . LEU A 1 452 ? 8.621   -23.244 60.215  1.00 47.37 ? 452 LEU A CD2 1 
ATOM   3545 N  N   . VAL A 1 453 ? 4.323   -23.151 63.389  1.00 44.65 ? 453 VAL A N   1 
ATOM   3546 C  CA  . VAL A 1 453 ? 3.442   -23.338 64.538  1.00 45.07 ? 453 VAL A CA  1 
ATOM   3547 C  C   . VAL A 1 453 ? 2.321   -24.329 64.236  1.00 54.55 ? 453 VAL A C   1 
ATOM   3548 O  O   . VAL A 1 453 ? 1.417   -24.036 63.446  1.00 53.84 ? 453 VAL A O   1 
ATOM   3549 C  CB  . VAL A 1 453 ? 2.811   -22.007 64.986  1.00 46.52 ? 453 VAL A CB  1 
ATOM   3550 C  CG1 . VAL A 1 453 ? 1.887   -22.233 66.169  1.00 50.61 ? 453 VAL A CG1 1 
ATOM   3551 C  CG2 . VAL A 1 453 ? 3.887   -20.987 65.333  1.00 43.66 ? 453 VAL A CG2 1 
ATOM   3552 N  N   . LYS A 1 454 ? 2.384   -25.492 64.880  1.00 56.41 ? 454 LYS A N   1 
ATOM   3553 C  CA  . LYS A 1 454 ? 1.440   -26.586 64.647  1.00 53.79 ? 454 LYS A CA  1 
ATOM   3554 C  C   . LYS A 1 454 ? -0.018  -26.135 64.621  1.00 53.07 ? 454 LYS A C   1 
ATOM   3555 O  O   . LYS A 1 454 ? -0.743  -26.421 63.666  1.00 53.78 ? 454 LYS A O   1 
ATOM   3556 C  CB  . LYS A 1 454 ? 1.627   -27.663 65.718  1.00 56.49 ? 454 LYS A CB  1 
ATOM   3557 C  CG  . LYS A 1 454 ? 3.089   -27.962 66.022  1.00 63.75 ? 454 LYS A CG  1 
ATOM   3558 C  CD  . LYS A 1 454 ? 3.286   -28.606 67.392  1.00 72.11 ? 454 LYS A CD  1 
ATOM   3559 C  CE  . LYS A 1 454 ? 4.766   -28.652 67.757  1.00 69.45 ? 454 LYS A CE  1 
ATOM   3560 N  NZ  . LYS A 1 454 ? 5.022   -29.351 69.046  1.00 70.07 ? 454 LYS A NZ  1 
ATOM   3561 N  N   . GLU A 1 455 ? -0.444  -25.414 65.655  1.00 53.52 ? 455 GLU A N   1 
ATOM   3562 C  CA  . GLU A 1 455 ? -1.855  -25.047 65.788  1.00 54.18 ? 455 GLU A CA  1 
ATOM   3563 C  C   . GLU A 1 455 ? -2.317  -24.055 64.722  1.00 55.14 ? 455 GLU A C   1 
ATOM   3564 O  O   . GLU A 1 455 ? -3.503  -23.759 64.632  1.00 55.38 ? 455 GLU A O   1 
ATOM   3565 C  CB  . GLU A 1 455 ? -2.144  -24.460 67.177  1.00 56.15 ? 455 GLU A CB  1 
ATOM   3566 C  CG  . GLU A 1 455 ? -1.515  -25.223 68.338  1.00 63.07 ? 455 GLU A CG  1 
ATOM   3567 C  CD  . GLU A 1 455 ? -0.153  -24.672 68.720  1.00 66.28 ? 455 GLU A CD  1 
ATOM   3568 O  OE1 . GLU A 1 455 ? -0.056  -23.447 68.954  1.00 70.58 ? 455 GLU A OE1 1 
ATOM   3569 O  OE2 . GLU A 1 455 ? 0.821   -25.458 68.779  1.00 66.85 ? 455 GLU A OE2 1 
ATOM   3570 N  N   . LEU A 1 456 ? -1.398  -23.536 63.912  1.00 53.29 ? 456 LEU A N   1 
ATOM   3571 C  CA  . LEU A 1 456 ? -1.809  -22.591 62.882  1.00 50.82 ? 456 LEU A CA  1 
ATOM   3572 C  C   . LEU A 1 456 ? -2.248  -23.329 61.624  1.00 50.83 ? 456 LEU A C   1 
ATOM   3573 O  O   . LEU A 1 456 ? -2.758  -22.722 60.687  1.00 53.06 ? 456 LEU A O   1 
ATOM   3574 C  CB  . LEU A 1 456 ? -0.694  -21.599 62.574  1.00 51.17 ? 456 LEU A CB  1 
ATOM   3575 C  CG  . LEU A 1 456 ? -0.344  -20.685 63.750  1.00 48.95 ? 456 LEU A CG  1 
ATOM   3576 C  CD1 . LEU A 1 456 ? 0.390   -19.435 63.275  1.00 48.28 ? 456 LEU A CD1 1 
ATOM   3577 C  CD2 . LEU A 1 456 ? -1.590  -20.325 64.536  1.00 46.69 ? 456 LEU A CD2 1 
ATOM   3578 N  N   . ASN A 1 457 ? -2.060  -24.644 61.614  1.00 50.76 ? 457 ASN A N   1 
ATOM   3579 C  CA  . ASN A 1 457 ? -2.671  -25.499 60.600  1.00 49.59 ? 457 ASN A CA  1 
ATOM   3580 C  C   . ASN A 1 457 ? -2.187  -25.198 59.172  1.00 56.83 ? 457 ASN A C   1 
ATOM   3581 O  O   . ASN A 1 457 ? -2.980  -25.213 58.221  1.00 56.52 ? 457 ASN A O   1 
ATOM   3582 C  CB  . ASN A 1 457 ? -4.213  -25.392 60.682  1.00 51.90 ? 457 ASN A CB  1 
ATOM   3583 C  CG  . ASN A 1 457 ? -4.780  -25.975 61.987  1.00 57.22 ? 457 ASN A CG  1 
ATOM   3584 O  OD1 . ASN A 1 457 ? -4.116  -26.760 62.661  1.00 61.29 ? 457 ASN A OD1 1 
ATOM   3585 N  ND2 . ASN A 1 457 ? -6.005  -25.592 62.341  1.00 57.07 ? 457 ASN A ND2 1 
ATOM   3586 N  N   . TYR A 1 458 ? -0.891  -24.914 59.029  1.00 52.54 ? 458 TYR A N   1 
ATOM   3587 C  CA  . TYR A 1 458 ? -0.260  -24.859 57.715  1.00 49.57 ? 458 TYR A CA  1 
ATOM   3588 C  C   . TYR A 1 458 ? 0.115   -26.272 57.304  1.00 53.65 ? 458 TYR A C   1 
ATOM   3589 O  O   . TYR A 1 458 ? 0.101   -27.185 58.127  1.00 55.68 ? 458 TYR A O   1 
ATOM   3590 C  CB  . TYR A 1 458 ? 0.991   -23.975 57.713  1.00 47.87 ? 458 TYR A CB  1 
ATOM   3591 C  CG  . TYR A 1 458 ? 0.738   -22.491 57.830  1.00 48.10 ? 458 TYR A CG  1 
ATOM   3592 C  CD1 . TYR A 1 458 ? 0.615   -21.886 59.078  1.00 45.19 ? 458 TYR A CD1 1 
ATOM   3593 C  CD2 . TYR A 1 458 ? 0.633   -21.688 56.694  1.00 44.04 ? 458 TYR A CD2 1 
ATOM   3594 C  CE1 . TYR A 1 458 ? 0.388   -20.530 59.200  1.00 42.02 ? 458 TYR A CE1 1 
ATOM   3595 C  CE2 . TYR A 1 458 ? 0.407   -20.325 56.801  1.00 43.75 ? 458 TYR A CE2 1 
ATOM   3596 C  CZ  . TYR A 1 458 ? 0.290   -19.751 58.066  1.00 49.18 ? 458 TYR A CZ  1 
ATOM   3597 O  OH  . TYR A 1 458 ? 0.069   -18.399 58.208  1.00 47.51 ? 458 TYR A OH  1 
ATOM   3598 N  N   . THR A 1 459 ? 0.452   -26.454 56.032  1.00 52.34 ? 459 THR A N   1 
ATOM   3599 C  CA  . THR A 1 459 ? 0.885   -27.757 55.551  1.00 50.78 ? 459 THR A CA  1 
ATOM   3600 C  C   . THR A 1 459 ? 2.350   -27.982 55.866  1.00 51.31 ? 459 THR A C   1 
ATOM   3601 O  O   . THR A 1 459 ? 3.095   -27.032 56.119  1.00 51.84 ? 459 THR A O   1 
ATOM   3602 C  CB  . THR A 1 459 ? 0.707   -27.908 54.032  1.00 51.60 ? 459 THR A CB  1 
ATOM   3603 O  OG1 . THR A 1 459 ? 1.765   -27.205 53.364  1.00 54.10 ? 459 THR A OG1 1 
ATOM   3604 C  CG2 . THR A 1 459 ? -0.637  -27.370 53.580  1.00 48.45 ? 459 THR A CG2 1 
ATOM   3605 N  N   . ALA A 1 460 ? 2.771   -29.240 55.804  1.00 50.57 ? 460 ALA A N   1 
ATOM   3606 C  CA  . ALA A 1 460 ? 4.158   -29.595 56.065  1.00 50.73 ? 460 ALA A CA  1 
ATOM   3607 C  C   . ALA A 1 460 ? 5.100   -28.916 55.081  1.00 51.17 ? 460 ALA A C   1 
ATOM   3608 O  O   . ALA A 1 460 ? 6.221   -28.528 55.434  1.00 52.12 ? 460 ALA A O   1 
ATOM   3609 C  CB  . ALA A 1 460 ? 4.333   -31.098 56.009  1.00 51.37 ? 460 ALA A CB  1 
ATOM   3610 N  N   . GLU A 1 461 ? 4.641   -28.772 53.844  1.00 51.92 ? 461 GLU A N   1 
ATOM   3611 C  CA  . GLU A 1 461 ? 5.463   -28.177 52.800  1.00 52.74 ? 461 GLU A CA  1 
ATOM   3612 C  C   . GLU A 1 461 ? 5.473   -26.658 52.931  1.00 51.15 ? 461 GLU A C   1 
ATOM   3613 O  O   . GLU A 1 461 ? 6.397   -25.990 52.468  1.00 49.26 ? 461 GLU A O   1 
ATOM   3614 C  CB  . GLU A 1 461 ? 4.973   -28.610 51.413  1.00 56.46 ? 461 GLU A CB  1 
ATOM   3615 C  CG  . GLU A 1 461 ? 3.527   -28.253 51.103  1.00 64.35 ? 461 GLU A CG  1 
ATOM   3616 C  CD  . GLU A 1 461 ? 2.994   -28.995 49.884  1.00 73.77 ? 461 GLU A CD  1 
ATOM   3617 O  OE1 . GLU A 1 461 ? 2.596   -28.330 48.900  1.00 78.81 ? 461 GLU A OE1 1 
ATOM   3618 O  OE2 . GLU A 1 461 ? 2.974   -30.245 49.910  1.00 79.66 ? 461 GLU A OE2 1 
ATOM   3619 N  N   . GLU A 1 462 ? 4.453   -26.110 53.584  1.00 52.37 ? 462 GLU A N   1 
ATOM   3620 C  CA  . GLU A 1 462 ? 4.436   -24.678 53.855  1.00 50.34 ? 462 GLU A CA  1 
ATOM   3621 C  C   . GLU A 1 462 ? 5.456   -24.339 54.950  1.00 48.45 ? 462 GLU A C   1 
ATOM   3622 O  O   . GLU A 1 462 ? 6.203   -23.359 54.829  1.00 44.39 ? 462 GLU A O   1 
ATOM   3623 C  CB  . GLU A 1 462 ? 3.020   -24.221 54.213  1.00 48.41 ? 462 GLU A CB  1 
ATOM   3624 C  CG  . GLU A 1 462 ? 2.156   -24.112 52.954  1.00 50.01 ? 462 GLU A CG  1 
ATOM   3625 C  CD  . GLU A 1 462 ? 0.693   -23.820 53.214  1.00 51.44 ? 462 GLU A CD  1 
ATOM   3626 O  OE1 . GLU A 1 462 ? 0.135   -24.336 54.207  1.00 50.23 ? 462 GLU A OE1 1 
ATOM   3627 O  OE2 . GLU A 1 462 ? 0.097   -23.079 52.399  1.00 52.14 ? 462 GLU A OE2 1 
ATOM   3628 N  N   . GLU A 1 463 ? 5.524   -25.178 55.983  1.00 49.32 ? 463 GLU A N   1 
ATOM   3629 C  CA  . GLU A 1 463 ? 6.562   -25.056 57.010  1.00 46.32 ? 463 GLU A CA  1 
ATOM   3630 C  C   . GLU A 1 463 ? 7.974   -25.116 56.428  1.00 46.05 ? 463 GLU A C   1 
ATOM   3631 O  O   . GLU A 1 463 ? 8.853   -24.344 56.814  1.00 45.69 ? 463 GLU A O   1 
ATOM   3632 C  CB  . GLU A 1 463 ? 6.408   -26.150 58.056  1.00 44.97 ? 463 GLU A CB  1 
ATOM   3633 C  CG  . GLU A 1 463 ? 7.616   -26.278 58.962  1.00 49.06 ? 463 GLU A CG  1 
ATOM   3634 C  CD  . GLU A 1 463 ? 7.428   -27.341 60.017  1.00 50.65 ? 463 GLU A CD  1 
ATOM   3635 O  OE1 . GLU A 1 463 ? 6.259   -27.663 60.326  1.00 51.91 ? 463 GLU A OE1 1 
ATOM   3636 O  OE2 . GLU A 1 463 ? 8.442   -27.859 60.530  1.00 53.32 ? 463 GLU A OE2 1 
ATOM   3637 N  N   . ALA A 1 464 ? 8.197   -26.035 55.496  1.00 46.55 ? 464 ALA A N   1 
ATOM   3638 C  CA  . ALA A 1 464 ? 9.495   -26.133 54.843  1.00 42.79 ? 464 ALA A CA  1 
ATOM   3639 C  C   . ALA A 1 464 ? 9.816   -24.862 54.056  1.00 47.44 ? 464 ALA A C   1 
ATOM   3640 O  O   . ALA A 1 464 ? 10.970  -24.413 54.033  1.00 46.10 ? 464 ALA A O   1 
ATOM   3641 C  CB  . ALA A 1 464 ? 9.541   -27.350 53.932  1.00 41.59 ? 464 ALA A CB  1 
ATOM   3642 N  N   . LEU A 1 465 ? 8.797   -24.288 53.414  1.00 45.21 ? 465 LEU A N   1 
ATOM   3643 C  CA  . LEU A 1 465 ? 8.970   -23.060 52.632  1.00 45.67 ? 465 LEU A CA  1 
ATOM   3644 C  C   . LEU A 1 465 ? 9.359   -21.899 53.542  1.00 43.10 ? 465 LEU A C   1 
ATOM   3645 O  O   . LEU A 1 465 ? 10.319  -21.179 53.258  1.00 45.91 ? 465 LEU A O   1 
ATOM   3646 C  CB  . LEU A 1 465 ? 7.690   -22.712 51.857  1.00 42.58 ? 465 LEU A CB  1 
ATOM   3647 C  CG  . LEU A 1 465 ? 7.615   -21.330 51.194  1.00 42.49 ? 465 LEU A CG  1 
ATOM   3648 C  CD1 . LEU A 1 465 ? 8.592   -21.199 50.025  1.00 39.68 ? 465 LEU A CD1 1 
ATOM   3649 C  CD2 . LEU A 1 465 ? 6.192   -21.017 50.738  1.00 42.83 ? 465 LEU A CD2 1 
ATOM   3650 N  N   . SER A 1 466 ? 8.599   -21.723 54.623  1.00 41.49 ? 466 SER A N   1 
ATOM   3651 C  CA  . SER A 1 466 ? 8.899   -20.726 55.651  1.00 42.20 ? 466 SER A CA  1 
ATOM   3652 C  C   . SER A 1 466 ? 10.339  -20.847 56.152  1.00 43.08 ? 466 SER A C   1 
ATOM   3653 O  O   . SER A 1 466 ? 11.082  -19.858 56.210  1.00 43.74 ? 466 SER A O   1 
ATOM   3654 C  CB  . SER A 1 466 ? 7.928   -20.867 56.825  1.00 43.94 ? 466 SER A CB  1 
ATOM   3655 O  OG  . SER A 1 466 ? 8.151   -19.854 57.789  1.00 41.45 ? 466 SER A OG  1 
ATOM   3656 N  N   . ARG A 1 467 ? 10.747  -22.067 56.483  1.00 42.75 ? 467 ARG A N   1 
ATOM   3657 C  CA  . ARG A 1 467 ? 12.121  -22.295 56.926  1.00 42.12 ? 467 ARG A CA  1 
ATOM   3658 C  C   . ARG A 1 467 ? 13.129  -21.904 55.855  1.00 44.34 ? 467 ARG A C   1 
ATOM   3659 O  O   . ARG A 1 467 ? 14.143  -21.270 56.146  1.00 43.09 ? 467 ARG A O   1 
ATOM   3660 C  CB  . ARG A 1 467 ? 12.317  -23.756 57.335  1.00 43.38 ? 467 ARG A CB  1 
ATOM   3661 C  CG  . ARG A 1 467 ? 11.518  -24.163 58.581  1.00 45.57 ? 467 ARG A CG  1 
ATOM   3662 C  CD  . ARG A 1 467 ? 11.857  -25.583 59.000  1.00 46.13 ? 467 ARG A CD  1 
ATOM   3663 N  NE  . ARG A 1 467 ? 11.097  -25.989 60.169  1.00 47.31 ? 467 ARG A NE  1 
ATOM   3664 C  CZ  . ARG A 1 467 ? 11.494  -25.778 61.421  1.00 51.55 ? 467 ARG A CZ  1 
ATOM   3665 N  NH1 . ARG A 1 467 ? 12.651  -25.165 61.659  1.00 44.47 ? 467 ARG A NH1 1 
ATOM   3666 N  NH2 . ARG A 1 467 ? 10.731  -26.173 62.432  1.00 45.83 ? 467 ARG A NH2 1 
ATOM   3667 N  N   . ARG A 1 468 ? 12.850  -22.273 54.609  1.00 46.09 ? 468 ARG A N   1 
ATOM   3668 C  CA  . ARG A 1 468 ? 13.773  -21.953 53.535  1.00 44.97 ? 468 ARG A CA  1 
ATOM   3669 C  C   . ARG A 1 468 ? 13.832  -20.438 53.360  1.00 42.94 ? 468 ARG A C   1 
ATOM   3670 O  O   . ARG A 1 468 ? 14.903  -19.869 53.174  1.00 42.67 ? 468 ARG A O   1 
ATOM   3671 C  CB  . ARG A 1 468 ? 13.361  -22.647 52.232  1.00 47.09 ? 468 ARG A CB  1 
ATOM   3672 C  CG  . ARG A 1 468 ? 14.285  -22.355 51.049  1.00 52.48 ? 468 ARG A CG  1 
ATOM   3673 C  CD  . ARG A 1 468 ? 14.092  -23.368 49.913  1.00 54.15 ? 468 ARG A CD  1 
ATOM   3674 N  NE  . ARG A 1 468 ? 12.693  -23.769 49.783  1.00 50.35 ? 468 ARG A NE  1 
ATOM   3675 C  CZ  . ARG A 1 468 ? 11.856  -23.293 48.866  1.00 57.98 ? 468 ARG A CZ  1 
ATOM   3676 N  NH1 . ARG A 1 468 ? 12.272  -22.399 47.975  1.00 51.02 ? 468 ARG A NH1 1 
ATOM   3677 N  NH2 . ARG A 1 468 ? 10.598  -23.717 48.840  1.00 60.40 ? 468 ARG A NH2 1 
ATOM   3678 N  N   . ILE A 1 469 ? 12.675  -19.785 53.454  1.00 42.64 ? 469 ILE A N   1 
ATOM   3679 C  CA  . ILE A 1 469 ? 12.610  -18.333 53.329  1.00 39.18 ? 469 ILE A CA  1 
ATOM   3680 C  C   . ILE A 1 469 ? 13.334  -17.651 54.503  1.00 41.60 ? 469 ILE A C   1 
ATOM   3681 O  O   . ILE A 1 469 ? 14.133  -16.738 54.285  1.00 41.30 ? 469 ILE A O   1 
ATOM   3682 C  CB  . ILE A 1 469 ? 11.148  -17.840 53.244  1.00 37.71 ? 469 ILE A CB  1 
ATOM   3683 C  CG1 . ILE A 1 469 ? 10.599  -17.999 51.821  1.00 38.58 ? 469 ILE A CG1 1 
ATOM   3684 C  CG2 . ILE A 1 469 ? 11.043  -16.381 53.655  1.00 36.97 ? 469 ILE A CG2 1 
ATOM   3685 C  CD1 . ILE A 1 469 ? 9.070   -17.796 51.717  1.00 35.14 ? 469 ILE A CD1 1 
ATOM   3686 N  N   . MET A 1 470 ? 13.065  -18.092 55.735  1.00 36.50 ? 470 MET A N   1 
ATOM   3687 C  CA  . MET A 1 470 ? 13.764  -17.547 56.900  1.00 40.11 ? 470 MET A CA  1 
ATOM   3688 C  C   . MET A 1 470 ? 15.281  -17.699 56.756  1.00 42.33 ? 470 MET A C   1 
ATOM   3689 O  O   . MET A 1 470 ? 16.045  -16.769 57.038  1.00 39.00 ? 470 MET A O   1 
ATOM   3690 C  CB  . MET A 1 470 ? 13.294  -18.225 58.195  1.00 41.97 ? 470 MET A CB  1 
ATOM   3691 C  CG  . MET A 1 470 ? 11.878  -17.840 58.636  1.00 38.83 ? 470 MET A CG  1 
ATOM   3692 S  SD  . MET A 1 470 ? 11.538  -18.312 60.351  1.00 46.33 ? 470 MET A SD  1 
ATOM   3693 C  CE  . MET A 1 470 ? 11.671  -20.092 60.262  1.00 45.30 ? 470 MET A CE  1 
ATOM   3694 N  N   . HIS A 1 471 ? 15.717  -18.871 56.306  1.00 42.33 ? 471 HIS A N   1 
ATOM   3695 C  CA  . HIS A 1 471 ? 17.143  -19.099 56.133  1.00 42.61 ? 471 HIS A CA  1 
ATOM   3696 C  C   . HIS A 1 471 ? 17.719  -18.190 55.055  1.00 43.21 ? 471 HIS A C   1 
ATOM   3697 O  O   . HIS A 1 471 ? 18.798  -17.634 55.231  1.00 43.09 ? 471 HIS A O   1 
ATOM   3698 C  CB  . HIS A 1 471 ? 17.438  -20.555 55.796  1.00 44.09 ? 471 HIS A CB  1 
ATOM   3699 C  CG  . HIS A 1 471 ? 18.824  -20.972 56.172  1.00 50.19 ? 471 HIS A CG  1 
ATOM   3700 N  ND1 . HIS A 1 471 ? 19.357  -20.712 57.416  1.00 50.19 ? 471 HIS A ND1 1 
ATOM   3701 C  CD2 . HIS A 1 471 ? 19.791  -21.607 55.473  1.00 49.78 ? 471 HIS A CD2 1 
ATOM   3702 C  CE1 . HIS A 1 471 ? 20.593  -21.174 57.467  1.00 49.94 ? 471 HIS A CE1 1 
ATOM   3703 N  NE2 . HIS A 1 471 ? 20.880  -21.726 56.305  1.00 50.79 ? 471 HIS A NE2 1 
ATOM   3704 N  N   . TYR A 1 472 ? 16.996  -18.028 53.951  1.00 39.71 ? 472 TYR A N   1 
ATOM   3705 C  CA  . TYR A 1 472 ? 17.388  -17.064 52.930  1.00 42.67 ? 472 TYR A CA  1 
ATOM   3706 C  C   . TYR A 1 472 ? 17.558  -15.667 53.519  1.00 39.73 ? 472 TYR A C   1 
ATOM   3707 O  O   . TYR A 1 472 ? 18.573  -15.006 53.291  1.00 40.27 ? 472 TYR A O   1 
ATOM   3708 C  CB  . TYR A 1 472 ? 16.351  -16.999 51.807  1.00 42.53 ? 472 TYR A CB  1 
ATOM   3709 C  CG  . TYR A 1 472 ? 16.345  -18.156 50.824  1.00 44.63 ? 472 TYR A CG  1 
ATOM   3710 C  CD1 . TYR A 1 472 ? 17.516  -18.814 50.461  1.00 43.92 ? 472 TYR A CD1 1 
ATOM   3711 C  CD2 . TYR A 1 472 ? 15.156  -18.569 50.243  1.00 43.89 ? 472 TYR A CD2 1 
ATOM   3712 C  CE1 . TYR A 1 472 ? 17.490  -19.862 49.549  1.00 46.95 ? 472 TYR A CE1 1 
ATOM   3713 C  CE2 . TYR A 1 472 ? 15.118  -19.602 49.337  1.00 48.65 ? 472 TYR A CE2 1 
ATOM   3714 C  CZ  . TYR A 1 472 ? 16.278  -20.250 48.988  1.00 54.06 ? 472 TYR A CZ  1 
ATOM   3715 O  OH  . TYR A 1 472 ? 16.205  -21.283 48.074  1.00 51.37 ? 472 TYR A OH  1 
ATOM   3716 N  N   . TRP A 1 473 ? 16.537  -15.213 54.248  1.00 35.36 ? 473 TRP A N   1 
ATOM   3717 C  CA  . TRP A 1 473 ? 16.536  -13.876 54.829  1.00 35.23 ? 473 TRP A CA  1 
ATOM   3718 C  C   . TRP A 1 473 ? 17.684  -13.735 55.853  1.00 37.49 ? 473 TRP A C   1 
ATOM   3719 O  O   . TRP A 1 473 ? 18.492  -12.808 55.768  1.00 35.43 ? 473 TRP A O   1 
ATOM   3720 C  CB  . TRP A 1 473 ? 15.182  -13.586 55.490  1.00 32.96 ? 473 TRP A CB  1 
ATOM   3721 C  CG  . TRP A 1 473 ? 14.153  -12.861 54.634  1.00 38.91 ? 473 TRP A CG  1 
ATOM   3722 C  CD1 . TRP A 1 473 ? 13.471  -11.721 54.969  1.00 36.03 ? 473 TRP A CD1 1 
ATOM   3723 C  CD2 . TRP A 1 473 ? 13.681  -13.236 53.320  1.00 33.30 ? 473 TRP A CD2 1 
ATOM   3724 N  NE1 . TRP A 1 473 ? 12.620  -11.356 53.943  1.00 33.87 ? 473 TRP A NE1 1 
ATOM   3725 C  CE2 . TRP A 1 473 ? 12.729  -12.270 52.925  1.00 36.01 ? 473 TRP A CE2 1 
ATOM   3726 C  CE3 . TRP A 1 473 ? 13.980  -14.283 52.442  1.00 36.84 ? 473 TRP A CE3 1 
ATOM   3727 C  CZ2 . TRP A 1 473 ? 12.058  -12.332 51.684  1.00 34.00 ? 473 TRP A CZ2 1 
ATOM   3728 C  CZ3 . TRP A 1 473 ? 13.316  -14.343 51.212  1.00 35.09 ? 473 TRP A CZ3 1 
ATOM   3729 C  CH2 . TRP A 1 473 ? 12.369  -13.372 50.849  1.00 34.04 ? 473 TRP A CH2 1 
ATOM   3730 N  N   . ALA A 1 474 ? 17.758  -14.664 56.804  1.00 35.89 ? 474 ALA A N   1 
ATOM   3731 C  CA  . ALA A 1 474 ? 18.762  -14.581 57.867  1.00 39.94 ? 474 ALA A CA  1 
ATOM   3732 C  C   . ALA A 1 474 ? 20.161  -14.736 57.301  1.00 44.53 ? 474 ALA A C   1 
ATOM   3733 O  O   . ALA A 1 474 ? 21.073  -13.998 57.677  1.00 44.45 ? 474 ALA A O   1 
ATOM   3734 C  CB  . ALA A 1 474 ? 18.509  -15.630 58.931  1.00 37.82 ? 474 ALA A CB  1 
ATOM   3735 N  N   . THR A 1 475 ? 20.325  -15.683 56.381  1.00 43.57 ? 475 THR A N   1 
ATOM   3736 C  CA  . THR A 1 475 ? 21.636  -15.931 55.796  1.00 39.28 ? 475 THR A CA  1 
ATOM   3737 C  C   . THR A 1 475 ? 22.074  -14.708 55.004  1.00 41.71 ? 475 THR A C   1 
ATOM   3738 O  O   . THR A 1 475 ? 23.230  -14.289 55.090  1.00 39.01 ? 475 THR A O   1 
ATOM   3739 C  CB  . THR A 1 475 ? 21.631  -17.177 54.904  1.00 41.38 ? 475 THR A CB  1 
ATOM   3740 O  OG1 . THR A 1 475 ? 21.261  -18.319 55.689  1.00 44.24 ? 475 THR A OG1 1 
ATOM   3741 C  CG2 . THR A 1 475 ? 22.995  -17.404 54.276  1.00 42.82 ? 475 THR A CG2 1 
ATOM   3742 N  N   . PHE A 1 476 ? 21.143  -14.118 54.253  1.00 42.06 ? 476 PHE A N   1 
ATOM   3743 C  CA  . PHE A 1 476 ? 21.439  -12.888 53.526  1.00 37.68 ? 476 PHE A CA  1 
ATOM   3744 C  C   . PHE A 1 476 ? 21.867  -11.770 54.483  1.00 38.47 ? 476 PHE A C   1 
ATOM   3745 O  O   . PHE A 1 476 ? 22.843  -11.061 54.228  1.00 38.66 ? 476 PHE A O   1 
ATOM   3746 C  CB  . PHE A 1 476 ? 20.236  -12.416 52.704  1.00 37.13 ? 476 PHE A CB  1 
ATOM   3747 C  CG  . PHE A 1 476 ? 20.387  -11.012 52.199  1.00 33.84 ? 476 PHE A CG  1 
ATOM   3748 C  CD1 . PHE A 1 476 ? 21.107  -10.748 51.046  1.00 37.15 ? 476 PHE A CD1 1 
ATOM   3749 C  CD2 . PHE A 1 476 ? 19.860  -9.954  52.900  1.00 29.62 ? 476 PHE A CD2 1 
ATOM   3750 C  CE1 . PHE A 1 476 ? 21.263  -9.440  50.588  1.00 38.61 ? 476 PHE A CE1 1 
ATOM   3751 C  CE2 . PHE A 1 476 ? 20.016  -8.658  52.463  1.00 30.69 ? 476 PHE A CE2 1 
ATOM   3752 C  CZ  . PHE A 1 476 ? 20.717  -8.390  51.309  1.00 31.75 ? 476 PHE A CZ  1 
ATOM   3753 N  N   . ALA A 1 477 ? 21.126  -11.609 55.576  1.00 37.60 ? 477 ALA A N   1 
ATOM   3754 C  CA  . ALA A 1 477 ? 21.440  -10.581 56.570  1.00 36.67 ? 477 ALA A CA  1 
ATOM   3755 C  C   . ALA A 1 477 ? 22.860  -10.755 57.116  1.00 38.44 ? 477 ALA A C   1 
ATOM   3756 O  O   . ALA A 1 477 ? 23.579  -9.778  57.313  1.00 39.53 ? 477 ALA A O   1 
ATOM   3757 C  CB  . ALA A 1 477 ? 20.408  -10.605 57.721  1.00 32.22 ? 477 ALA A CB  1 
ATOM   3758 N  N   . LYS A 1 478 ? 23.267  -12.001 57.338  1.00 37.87 ? 478 LYS A N   1 
ATOM   3759 C  CA  . LYS A 1 478 ? 24.591  -12.298 57.887  1.00 37.17 ? 478 LYS A CA  1 
ATOM   3760 C  C   . LYS A 1 478 ? 25.752  -12.058 56.894  1.00 44.51 ? 478 LYS A C   1 
ATOM   3761 O  O   . LYS A 1 478 ? 26.822  -11.587 57.272  1.00 42.62 ? 478 LYS A O   1 
ATOM   3762 C  CB  . LYS A 1 478 ? 24.627  -13.749 58.370  1.00 38.20 ? 478 LYS A CB  1 
ATOM   3763 C  CG  . LYS A 1 478 ? 23.564  -14.081 59.428  1.00 49.76 ? 478 LYS A CG  1 
ATOM   3764 C  CD  . LYS A 1 478 ? 23.541  -15.570 59.799  1.00 54.99 ? 478 LYS A CD  1 
ATOM   3765 C  CE  . LYS A 1 478 ? 22.595  -15.851 60.966  1.00 52.96 ? 478 LYS A CE  1 
ATOM   3766 N  NZ  . LYS A 1 478 ? 22.582  -17.300 61.349  1.00 56.04 ? 478 LYS A NZ  1 
ATOM   3767 N  N   . THR A 1 479 ? 25.539  -12.374 55.623  1.00 40.64 ? 479 THR A N   1 
ATOM   3768 C  CA  . THR A 1 479 ? 26.655  -12.439 54.680  1.00 40.57 ? 479 THR A CA  1 
ATOM   3769 C  C   . THR A 1 479 ? 26.488  -11.586 53.424  1.00 38.94 ? 479 THR A C   1 
ATOM   3770 O  O   . THR A 1 479 ? 27.465  -11.299 52.739  1.00 40.49 ? 479 THR A O   1 
ATOM   3771 C  CB  . THR A 1 479 ? 26.887  -13.882 54.245  1.00 39.46 ? 479 THR A CB  1 
ATOM   3772 O  OG1 . THR A 1 479 ? 25.766  -14.316 53.461  1.00 38.11 ? 479 THR A OG1 1 
ATOM   3773 C  CG2 . THR A 1 479 ? 27.023  -14.774 55.479  1.00 33.86 ? 479 THR A CG2 1 
ATOM   3774 N  N   . GLY A 1 480 ? 25.257  -11.184 53.121  1.00 39.96 ? 480 GLY A N   1 
ATOM   3775 C  CA  . GLY A 1 480 ? 24.983  -10.435 51.905  1.00 39.27 ? 480 GLY A CA  1 
ATOM   3776 C  C   . GLY A 1 480 ? 24.627  -11.365 50.751  1.00 37.85 ? 480 GLY A C   1 
ATOM   3777 O  O   . GLY A 1 480 ? 24.524  -10.936 49.603  1.00 36.85 ? 480 GLY A O   1 
ATOM   3778 N  N   . ASN A 1 481 ? 24.433  -12.642 51.078  1.00 37.38 ? 481 ASN A N   1 
ATOM   3779 C  CA  . ASN A 1 481 ? 24.132  -13.692 50.115  1.00 38.85 ? 481 ASN A CA  1 
ATOM   3780 C  C   . ASN A 1 481 ? 23.156  -14.682 50.732  1.00 42.11 ? 481 ASN A C   1 
ATOM   3781 O  O   . ASN A 1 481 ? 23.489  -15.314 51.736  1.00 42.65 ? 481 ASN A O   1 
ATOM   3782 C  CB  . ASN A 1 481 ? 25.420  -14.408 49.684  1.00 43.05 ? 481 ASN A CB  1 
ATOM   3783 C  CG  . ASN A 1 481 ? 25.221  -15.341 48.488  1.00 44.01 ? 481 ASN A CG  1 
ATOM   3784 O  OD1 . ASN A 1 481 ? 24.157  -15.939 48.301  1.00 43.61 ? 481 ASN A OD1 1 
ATOM   3785 N  ND2 . ASN A 1 481 ? 26.270  -15.481 47.682  1.00 40.27 ? 481 ASN A ND2 1 
ATOM   3786 N  N   . PRO A 1 482 ? 21.950  -14.826 50.138  1.00 40.45 ? 482 PRO A N   1 
ATOM   3787 C  CA  . PRO A 1 482 ? 20.921  -15.716 50.692  1.00 39.47 ? 482 PRO A CA  1 
ATOM   3788 C  C   . PRO A 1 482 ? 21.344  -17.181 50.648  1.00 41.59 ? 482 PRO A C   1 
ATOM   3789 O  O   . PRO A 1 482 ? 20.767  -18.003 51.363  1.00 40.35 ? 482 PRO A O   1 
ATOM   3790 C  CB  . PRO A 1 482 ? 19.714  -15.473 49.776  1.00 40.15 ? 482 PRO A CB  1 
ATOM   3791 C  CG  . PRO A 1 482 ? 20.310  -15.060 48.478  1.00 38.45 ? 482 PRO A CG  1 
ATOM   3792 C  CD  . PRO A 1 482 ? 21.549  -14.270 48.832  1.00 40.01 ? 482 PRO A CD  1 
ATOM   3793 N  N   . ASN A 1 483 ? 22.330  -17.487 49.806  1.00 39.15 ? 483 ASN A N   1 
ATOM   3794 C  CA  . ASN A 1 483 ? 22.838  -18.847 49.645  1.00 44.93 ? 483 ASN A CA  1 
ATOM   3795 C  C   . ASN A 1 483 ? 23.957  -19.201 50.625  1.00 52.27 ? 483 ASN A C   1 
ATOM   3796 O  O   . ASN A 1 483 ? 24.903  -18.435 50.803  1.00 46.84 ? 483 ASN A O   1 
ATOM   3797 C  CB  . ASN A 1 483 ? 23.362  -19.052 48.223  1.00 44.18 ? 483 ASN A CB  1 
ATOM   3798 C  CG  . ASN A 1 483 ? 22.312  -18.795 47.174  1.00 43.24 ? 483 ASN A CG  1 
ATOM   3799 O  OD1 . ASN A 1 483 ? 21.335  -19.534 47.072  1.00 44.05 ? 483 ASN A OD1 1 
ATOM   3800 N  ND2 . ASN A 1 483 ? 22.509  -17.752 46.380  1.00 39.19 ? 483 ASN A ND2 1 
ATOM   3801 N  N   . GLU A 1 484 ? 23.857  -20.372 51.244  1.00 59.64 ? 484 GLU A N   1 
ATOM   3802 C  CA  . GLU A 1 484 ? 24.941  -20.889 52.067  1.00 64.02 ? 484 GLU A CA  1 
ATOM   3803 C  C   . GLU A 1 484 ? 26.070  -21.358 51.156  1.00 71.89 ? 484 GLU A C   1 
ATOM   3804 O  O   . GLU A 1 484 ? 25.831  -22.104 50.206  1.00 71.94 ? 484 GLU A O   1 
ATOM   3805 C  CB  . GLU A 1 484 ? 24.448  -22.025 52.960  1.00 66.85 ? 484 GLU A CB  1 
ATOM   3806 C  CG  . GLU A 1 484 ? 24.862  -21.894 54.419  1.00 68.84 ? 484 GLU A CG  1 
ATOM   3807 C  CD  . GLU A 1 484 ? 23.955  -22.684 55.346  1.00 70.96 ? 484 GLU A CD  1 
ATOM   3808 O  OE1 . GLU A 1 484 ? 23.092  -23.427 54.829  1.00 70.20 ? 484 GLU A OE1 1 
ATOM   3809 O  OE2 . GLU A 1 484 ? 24.095  -22.558 56.584  1.00 72.48 ? 484 GLU A OE2 1 
ATOM   3810 N  N   . PRO A 1 485 ? 27.309  -20.918 51.445  1.00 80.79 ? 485 PRO A N   1 
ATOM   3811 C  CA  . PRO A 1 485 ? 28.471  -21.164 50.576  1.00 80.45 ? 485 PRO A CA  1 
ATOM   3812 C  C   . PRO A 1 485 ? 28.674  -22.649 50.280  1.00 82.93 ? 485 PRO A C   1 
ATOM   3813 O  O   . PRO A 1 485 ? 29.027  -23.006 49.155  1.00 82.13 ? 485 PRO A O   1 
ATOM   3814 C  CB  . PRO A 1 485 ? 29.645  -20.597 51.387  1.00 82.45 ? 485 PRO A CB  1 
ATOM   3815 C  CG  . PRO A 1 485 ? 29.171  -20.610 52.811  1.00 79.36 ? 485 PRO A CG  1 
ATOM   3816 C  CD  . PRO A 1 485 ? 27.699  -20.322 52.737  1.00 77.11 ? 485 PRO A CD  1 
ATOM   3817 N  N   . HIS A 1 486 ? 28.452  -23.495 51.285  1.00 85.09 ? 486 HIS A N   1 
ATOM   3818 C  CA  . HIS A 1 486 ? 28.465  -24.942 51.097  1.00 84.34 ? 486 HIS A CA  1 
ATOM   3819 C  C   . HIS A 1 486 ? 27.266  -25.345 50.246  1.00 82.25 ? 486 HIS A C   1 
ATOM   3820 O  O   . HIS A 1 486 ? 27.149  -24.938 49.090  1.00 83.52 ? 486 HIS A O   1 
ATOM   3821 C  CB  . HIS A 1 486 ? 28.442  -25.683 52.447  1.00 88.23 ? 486 HIS A CB  1 
ATOM   3822 C  CG  . HIS A 1 486 ? 28.218  -24.796 53.641  1.00 89.80 ? 486 HIS A CG  1 
ATOM   3823 N  ND1 . HIS A 1 486 ? 29.166  -23.904 54.101  1.00 91.70 ? 486 HIS A ND1 1 
ATOM   3824 C  CD2 . HIS A 1 486 ? 27.169  -24.695 54.494  1.00 85.83 ? 486 HIS A CD2 1 
ATOM   3825 C  CE1 . HIS A 1 486 ? 28.703  -23.279 55.170  1.00 83.54 ? 486 HIS A CE1 1 
ATOM   3826 N  NE2 . HIS A 1 486 ? 27.494  -23.742 55.431  1.00 85.02 ? 486 HIS A NE2 1 
ATOM   3827 N  N   . SER A 1 487 ? 26.387  -26.156 50.824  1.00 83.06 ? 487 SER A N   1 
ATOM   3828 C  CA  . SER A 1 487 ? 25.058  -26.385 50.268  1.00 81.13 ? 487 SER A CA  1 
ATOM   3829 C  C   . SER A 1 487 ? 25.038  -27.181 48.964  1.00 80.72 ? 487 SER A C   1 
ATOM   3830 O  O   . SER A 1 487 ? 25.557  -26.742 47.939  1.00 79.98 ? 487 SER A O   1 
ATOM   3831 C  CB  . SER A 1 487 ? 24.354  -25.042 50.050  1.00 81.94 ? 487 SER A CB  1 
ATOM   3832 O  OG  . SER A 1 487 ? 23.053  -25.229 49.523  1.00 84.92 ? 487 SER A OG  1 
ATOM   3833 N  N   . GLN A 1 488 ? 24.417  -28.355 49.017  1.00 84.18 ? 488 GLN A N   1 
ATOM   3834 C  CA  . GLN A 1 488 ? 24.104  -29.119 47.815  1.00 82.73 ? 488 GLN A CA  1 
ATOM   3835 C  C   . GLN A 1 488 ? 22.885  -28.500 47.142  1.00 80.89 ? 488 GLN A C   1 
ATOM   3836 O  O   . GLN A 1 488 ? 22.670  -28.652 45.940  1.00 80.38 ? 488 GLN A O   1 
ATOM   3837 C  CB  . GLN A 1 488 ? 23.826  -30.587 48.153  1.00 84.50 ? 488 GLN A CB  1 
ATOM   3838 C  CG  . GLN A 1 488 ? 24.668  -31.149 49.286  1.00 83.60 ? 488 GLN A CG  1 
ATOM   3839 C  CD  . GLN A 1 488 ? 26.131  -31.240 48.922  1.00 79.55 ? 488 GLN A CD  1 
ATOM   3840 O  OE1 . GLN A 1 488 ? 26.526  -30.884 47.813  1.00 83.42 ? 488 GLN A OE1 1 
ATOM   3841 N  NE2 . GLN A 1 488 ? 26.946  -31.719 49.854  1.00 83.36 ? 488 GLN A NE2 1 
ATOM   3842 N  N   . GLU A 1 489 ? 22.088  -27.805 47.947  1.00 82.49 ? 489 GLU A N   1 
ATOM   3843 C  CA  . GLU A 1 489 ? 20.823  -27.229 47.509  1.00 79.73 ? 489 GLU A CA  1 
ATOM   3844 C  C   . GLU A 1 489 ? 21.015  -26.204 46.387  1.00 76.63 ? 489 GLU A C   1 
ATOM   3845 O  O   . GLU A 1 489 ? 22.082  -25.598 46.257  1.00 73.35 ? 489 GLU A O   1 
ATOM   3846 C  CB  . GLU A 1 489 ? 20.103  -26.587 48.703  1.00 79.64 ? 489 GLU A CB  1 
ATOM   3847 C  CG  . GLU A 1 489 ? 18.628  -26.296 48.472  1.00 82.90 ? 489 GLU A CG  1 
ATOM   3848 C  CD  . GLU A 1 489 ? 17.757  -27.539 48.572  1.00 91.30 ? 489 GLU A CD  1 
ATOM   3849 O  OE1 . GLU A 1 489 ? 17.894  -28.287 49.568  1.00 89.70 ? 489 GLU A OE1 1 
ATOM   3850 O  OE2 . GLU A 1 489 ? 16.938  -27.771 47.652  1.00 90.73 ? 489 GLU A OE2 1 
ATOM   3851 N  N   . SER A 1 490 ? 19.968  -26.024 45.583  1.00 73.93 ? 490 SER A N   1 
ATOM   3852 C  CA  . SER A 1 490 ? 19.985  -25.112 44.440  1.00 69.05 ? 490 SER A CA  1 
ATOM   3853 C  C   . SER A 1 490 ? 20.294  -23.668 44.843  1.00 64.14 ? 490 SER A C   1 
ATOM   3854 O  O   . SER A 1 490 ? 20.029  -23.264 45.970  1.00 64.92 ? 490 SER A O   1 
ATOM   3855 C  CB  . SER A 1 490 ? 18.642  -25.178 43.702  1.00 70.94 ? 490 SER A CB  1 
ATOM   3856 O  OG  . SER A 1 490 ? 17.561  -25.292 44.616  1.00 72.81 ? 490 SER A OG  1 
ATOM   3857 N  N   . LYS A 1 491 ? 20.843  -22.890 43.914  1.00 60.49 ? 491 LYS A N   1 
ATOM   3858 C  CA  . LYS A 1 491 ? 21.322  -21.554 44.257  1.00 57.37 ? 491 LYS A CA  1 
ATOM   3859 C  C   . LYS A 1 491 ? 20.478  -20.416 43.679  1.00 55.95 ? 491 LYS A C   1 
ATOM   3860 O  O   . LYS A 1 491 ? 20.087  -20.427 42.511  1.00 52.22 ? 491 LYS A O   1 
ATOM   3861 C  CB  . LYS A 1 491 ? 22.782  -21.390 43.815  1.00 57.55 ? 491 LYS A CB  1 
ATOM   3862 C  CG  . LYS A 1 491 ? 23.735  -22.375 44.488  1.00 60.22 ? 491 LYS A CG  1 
ATOM   3863 C  CD  . LYS A 1 491 ? 24.969  -21.687 45.046  1.00 60.74 ? 491 LYS A CD  1 
ATOM   3864 C  CE  . LYS A 1 491 ? 25.696  -22.603 46.022  1.00 65.91 ? 491 LYS A CE  1 
ATOM   3865 N  NZ  . LYS A 1 491 ? 24.751  -23.199 47.012  1.00 68.12 ? 491 LYS A NZ  1 
ATOM   3866 N  N   . TRP A 1 492 ? 20.212  -19.436 44.537  1.00 51.11 ? 492 TRP A N   1 
ATOM   3867 C  CA  . TRP A 1 492 ? 19.523  -18.200 44.182  1.00 47.52 ? 492 TRP A CA  1 
ATOM   3868 C  C   . TRP A 1 492 ? 20.513  -17.251 43.515  1.00 46.25 ? 492 TRP A C   1 
ATOM   3869 O  O   . TRP A 1 492 ? 21.379  -16.689 44.187  1.00 46.79 ? 492 TRP A O   1 
ATOM   3870 C  CB  . TRP A 1 492 ? 18.914  -17.579 45.448  1.00 46.80 ? 492 TRP A CB  1 
ATOM   3871 C  CG  . TRP A 1 492 ? 18.050  -16.348 45.281  1.00 43.54 ? 492 TRP A CG  1 
ATOM   3872 C  CD1 . TRP A 1 492 ? 17.957  -15.528 44.190  1.00 42.75 ? 492 TRP A CD1 1 
ATOM   3873 C  CD2 . TRP A 1 492 ? 17.158  -15.807 46.265  1.00 44.49 ? 492 TRP A CD2 1 
ATOM   3874 N  NE1 . TRP A 1 492 ? 17.061  -14.510 44.439  1.00 39.33 ? 492 TRP A NE1 1 
ATOM   3875 C  CE2 . TRP A 1 492 ? 16.554  -14.664 45.702  1.00 42.14 ? 492 TRP A CE2 1 
ATOM   3876 C  CE3 . TRP A 1 492 ? 16.820  -16.176 47.572  1.00 39.96 ? 492 TRP A CE3 1 
ATOM   3877 C  CZ2 . TRP A 1 492 ? 15.627  -13.887 46.403  1.00 38.26 ? 492 TRP A CZ2 1 
ATOM   3878 C  CZ3 . TRP A 1 492 ? 15.896  -15.409 48.263  1.00 42.95 ? 492 TRP A CZ3 1 
ATOM   3879 C  CH2 . TRP A 1 492 ? 15.313  -14.277 47.677  1.00 41.33 ? 492 TRP A CH2 1 
ATOM   3880 N  N   . PRO A 1 493 ? 20.391  -17.071 42.189  1.00 42.53 ? 493 PRO A N   1 
ATOM   3881 C  CA  . PRO A 1 493 ? 21.390  -16.306 41.447  1.00 45.00 ? 493 PRO A CA  1 
ATOM   3882 C  C   . PRO A 1 493 ? 21.306  -14.818 41.673  1.00 44.39 ? 493 PRO A C   1 
ATOM   3883 O  O   . PRO A 1 493 ? 20.229  -14.284 41.918  1.00 41.95 ? 493 PRO A O   1 
ATOM   3884 C  CB  . PRO A 1 493 ? 21.069  -16.629 39.985  1.00 43.71 ? 493 PRO A CB  1 
ATOM   3885 C  CG  . PRO A 1 493 ? 19.600  -16.919 40.003  1.00 43.15 ? 493 PRO A CG  1 
ATOM   3886 C  CD  . PRO A 1 493 ? 19.361  -17.637 41.302  1.00 44.84 ? 493 PRO A CD  1 
ATOM   3887 N  N   . LEU A 1 494 ? 22.457  -14.167 41.559  1.00 41.39 ? 494 LEU A N   1 
ATOM   3888 C  CA  . LEU A 1 494 ? 22.540  -12.721 41.535  1.00 41.98 ? 494 LEU A CA  1 
ATOM   3889 C  C   . LEU A 1 494 ? 21.665  -12.148 40.423  1.00 44.71 ? 494 LEU A C   1 
ATOM   3890 O  O   . LEU A 1 494 ? 21.658  -12.653 39.294  1.00 45.05 ? 494 LEU A O   1 
ATOM   3891 C  CB  . LEU A 1 494 ? 23.987  -12.283 41.330  1.00 43.46 ? 494 LEU A CB  1 
ATOM   3892 C  CG  . LEU A 1 494 ? 24.631  -11.228 42.224  1.00 48.95 ? 494 LEU A CG  1 
ATOM   3893 C  CD1 . LEU A 1 494 ? 24.559  -11.634 43.670  1.00 43.57 ? 494 LEU A CD1 1 
ATOM   3894 C  CD2 . LEU A 1 494 ? 26.090  -11.040 41.815  1.00 49.12 ? 494 LEU A CD2 1 
ATOM   3895 N  N   . PHE A 1 495 ? 20.919  -11.099 40.746  1.00 42.00 ? 495 PHE A N   1 
ATOM   3896 C  CA  . PHE A 1 495 ? 20.297  -10.285 39.721  1.00 39.37 ? 495 PHE A CA  1 
ATOM   3897 C  C   . PHE A 1 495 ? 21.379  -9.381  39.117  1.00 43.05 ? 495 PHE A C   1 
ATOM   3898 O  O   . PHE A 1 495 ? 22.055  -8.638  39.836  1.00 36.96 ? 495 PHE A O   1 
ATOM   3899 C  CB  . PHE A 1 495 ? 19.140  -9.459  40.296  1.00 37.61 ? 495 PHE A CB  1 
ATOM   3900 C  CG  . PHE A 1 495 ? 18.458  -8.587  39.287  1.00 37.90 ? 495 PHE A CG  1 
ATOM   3901 C  CD1 . PHE A 1 495 ? 19.001  -7.357  38.927  1.00 34.27 ? 495 PHE A CD1 1 
ATOM   3902 C  CD2 . PHE A 1 495 ? 17.266  -8.994  38.691  1.00 35.72 ? 495 PHE A CD2 1 
ATOM   3903 C  CE1 . PHE A 1 495 ? 18.372  -6.552  37.982  1.00 36.60 ? 495 PHE A CE1 1 
ATOM   3904 C  CE2 . PHE A 1 495 ? 16.631  -8.187  37.744  1.00 36.84 ? 495 PHE A CE2 1 
ATOM   3905 C  CZ  . PHE A 1 495 ? 17.183  -6.969  37.395  1.00 35.13 ? 495 PHE A CZ  1 
ATOM   3906 N  N   . THR A 1 496 ? 21.538  -9.450  37.798  1.00 37.80 ? 496 THR A N   1 
ATOM   3907 C  CA  . THR A 1 496 ? 22.530  -8.643  37.092  1.00 41.62 ? 496 THR A CA  1 
ATOM   3908 C  C   . THR A 1 496 ? 21.866  -7.799  36.005  1.00 44.25 ? 496 THR A C   1 
ATOM   3909 O  O   . THR A 1 496 ? 20.795  -8.153  35.499  1.00 37.07 ? 496 THR A O   1 
ATOM   3910 C  CB  . THR A 1 496 ? 23.608  -9.521  36.452  1.00 42.54 ? 496 THR A CB  1 
ATOM   3911 O  OG1 . THR A 1 496 ? 22.986  -10.392 35.503  1.00 42.55 ? 496 THR A OG1 1 
ATOM   3912 C  CG2 . THR A 1 496 ? 24.310  -10.358 37.518  1.00 39.07 ? 496 THR A CG2 1 
ATOM   3913 N  N   . THR A 1 497 ? 22.497  -6.681  35.658  1.00 40.86 ? 497 THR A N   1 
ATOM   3914 C  CA  . THR A 1 497 ? 21.935  -5.769  34.667  1.00 42.71 ? 497 THR A CA  1 
ATOM   3915 C  C   . THR A 1 497 ? 21.632  -6.483  33.350  1.00 44.59 ? 497 THR A C   1 
ATOM   3916 O  O   . THR A 1 497 ? 20.614  -6.216  32.707  1.00 43.93 ? 497 THR A O   1 
ATOM   3917 C  CB  . THR A 1 497 ? 22.882  -4.585  34.398  1.00 46.71 ? 497 THR A CB  1 
ATOM   3918 O  OG1 . THR A 1 497 ? 23.189  -3.933  35.636  1.00 42.56 ? 497 THR A OG1 1 
ATOM   3919 C  CG2 . THR A 1 497 ? 22.249  -3.588  33.436  1.00 34.26 ? 497 THR A CG2 1 
ATOM   3920 N  N   . LYS A 1 498 ? 22.501  -7.412  32.963  1.00 46.62 ? 498 LYS A N   1 
ATOM   3921 C  CA  . LYS A 1 498 ? 22.324  -8.102  31.693  1.00 48.32 ? 498 LYS A CA  1 
ATOM   3922 C  C   . LYS A 1 498 ? 21.310  -9.231  31.801  1.00 46.08 ? 498 LYS A C   1 
ATOM   3923 O  O   . LYS A 1 498 ? 20.336  -9.253  31.053  1.00 52.18 ? 498 LYS A O   1 
ATOM   3924 C  CB  . LYS A 1 498 ? 23.660  -8.648  31.171  1.00 52.03 ? 498 LYS A CB  1 
ATOM   3925 C  CG  . LYS A 1 498 ? 23.537  -9.995  30.454  1.00 57.49 ? 498 LYS A CG  1 
ATOM   3926 C  CD  . LYS A 1 498 ? 24.798  -10.365 29.662  1.00 58.41 ? 498 LYS A CD  1 
ATOM   3927 C  CE  . LYS A 1 498 ? 24.765  -9.775  28.259  1.00 60.70 ? 498 LYS A CE  1 
ATOM   3928 N  NZ  . LYS A 1 498 ? 25.910  -10.243 27.418  1.00 66.61 ? 498 LYS A NZ  1 
ATOM   3929 N  N   . GLU A 1 499 ? 21.522  -10.170 32.719  1.00 44.14 ? 499 GLU A N   1 
ATOM   3930 C  CA  . GLU A 1 499 ? 20.682  -11.375 32.745  1.00 47.62 ? 499 GLU A CA  1 
ATOM   3931 C  C   . GLU A 1 499 ? 19.386  -11.245 33.575  1.00 43.29 ? 499 GLU A C   1 
ATOM   3932 O  O   . GLU A 1 499 ? 18.442  -12.010 33.376  1.00 38.64 ? 499 GLU A O   1 
ATOM   3933 C  CB  . GLU A 1 499 ? 21.501  -12.572 33.246  1.00 48.03 ? 499 GLU A CB  1 
ATOM   3934 C  CG  . GLU A 1 499 ? 22.591  -13.024 32.266  1.00 58.13 ? 499 GLU A CG  1 
ATOM   3935 C  CD  . GLU A 1 499 ? 23.101  -14.439 32.541  1.00 68.09 ? 499 GLU A CD  1 
ATOM   3936 O  OE1 . GLU A 1 499 ? 23.667  -14.673 33.633  1.00 69.72 ? 499 GLU A OE1 1 
ATOM   3937 O  OE2 . GLU A 1 499 ? 22.930  -15.318 31.659  1.00 67.71 ? 499 GLU A OE2 1 
ATOM   3938 N  N   . GLN A 1 500 ? 19.356  -10.300 34.510  1.00 42.85 ? 500 GLN A N   1 
ATOM   3939 C  CA  . GLN A 1 500 ? 18.134  -9.980  35.259  1.00 42.88 ? 500 GLN A CA  1 
ATOM   3940 C  C   . GLN A 1 500 ? 17.375  -11.200 35.802  1.00 38.63 ? 500 GLN A C   1 
ATOM   3941 O  O   . GLN A 1 500 ? 16.154  -11.283 35.679  1.00 38.40 ? 500 GLN A O   1 
ATOM   3942 C  CB  . GLN A 1 500 ? 17.209  -9.150  34.367  1.00 39.76 ? 500 GLN A CB  1 
ATOM   3943 C  CG  . GLN A 1 500 ? 17.914  -7.936  33.783  1.00 41.47 ? 500 GLN A CG  1 
ATOM   3944 C  CD  . GLN A 1 500 ? 17.095  -7.224  32.728  1.00 46.37 ? 500 GLN A CD  1 
ATOM   3945 O  OE1 . GLN A 1 500 ? 15.881  -7.110  32.847  1.00 42.02 ? 500 GLN A OE1 1 
ATOM   3946 N  NE2 . GLN A 1 500 ? 17.765  -6.733  31.685  1.00 48.45 ? 500 GLN A NE2 1 
ATOM   3947 N  N   . LYS A 1 501 ? 18.105  -12.141 36.397  1.00 36.39 ? 501 LYS A N   1 
ATOM   3948 C  CA  . LYS A 1 501 ? 17.509  -13.364 36.926  1.00 36.69 ? 501 LYS A CA  1 
ATOM   3949 C  C   . LYS A 1 501 ? 16.769  -13.129 38.249  1.00 40.13 ? 501 LYS A C   1 
ATOM   3950 O  O   . LYS A 1 501 ? 17.117  -12.228 39.010  1.00 34.86 ? 501 LYS A O   1 
ATOM   3951 C  CB  . LYS A 1 501 ? 18.582  -14.437 37.124  1.00 38.03 ? 501 LYS A CB  1 
ATOM   3952 C  CG  . LYS A 1 501 ? 19.417  -14.720 35.882  1.00 46.19 ? 501 LYS A CG  1 
ATOM   3953 C  CD  . LYS A 1 501 ? 20.417  -15.851 36.107  1.00 51.50 ? 501 LYS A CD  1 
ATOM   3954 C  CE  . LYS A 1 501 ? 21.128  -16.228 34.806  1.00 56.70 ? 501 LYS A CE  1 
ATOM   3955 N  NZ  . LYS A 1 501 ? 22.132  -17.305 35.007  1.00 59.49 ? 501 LYS A NZ  1 
ATOM   3956 N  N   . PHE A 1 502 ? 15.743  -13.947 38.492  1.00 35.73 ? 502 PHE A N   1 
ATOM   3957 C  CA  . PHE A 1 502 ? 14.990  -13.940 39.740  1.00 38.53 ? 502 PHE A CA  1 
ATOM   3958 C  C   . PHE A 1 502 ? 14.470  -15.348 39.989  1.00 38.18 ? 502 PHE A C   1 
ATOM   3959 O  O   . PHE A 1 502 ? 14.522  -16.186 39.101  1.00 41.81 ? 502 PHE A O   1 
ATOM   3960 C  CB  . PHE A 1 502 ? 13.846  -12.909 39.705  1.00 34.88 ? 502 PHE A CB  1 
ATOM   3961 C  CG  . PHE A 1 502 ? 12.662  -13.302 38.839  1.00 39.45 ? 502 PHE A CG  1 
ATOM   3962 C  CD1 . PHE A 1 502 ? 12.604  -12.936 37.501  1.00 38.16 ? 502 PHE A CD1 1 
ATOM   3963 C  CD2 . PHE A 1 502 ? 11.587  -13.998 39.380  1.00 39.07 ? 502 PHE A CD2 1 
ATOM   3964 C  CE1 . PHE A 1 502 ? 11.496  -13.277 36.706  1.00 40.93 ? 502 PHE A CE1 1 
ATOM   3965 C  CE2 . PHE A 1 502 ? 10.489  -14.345 38.603  1.00 40.16 ? 502 PHE A CE2 1 
ATOM   3966 C  CZ  . PHE A 1 502 ? 10.440  -13.981 37.262  1.00 39.86 ? 502 PHE A CZ  1 
ATOM   3967 N  N   . ILE A 1 503 ? 13.995  -15.623 41.196  1.00 38.52 ? 503 ILE A N   1 
ATOM   3968 C  CA  . ILE A 1 503 ? 13.485  -16.949 41.509  1.00 38.70 ? 503 ILE A CA  1 
ATOM   3969 C  C   . ILE A 1 503 ? 12.043  -16.875 41.981  1.00 44.07 ? 503 ILE A C   1 
ATOM   3970 O  O   . ILE A 1 503 ? 11.625  -15.876 42.565  1.00 41.58 ? 503 ILE A O   1 
ATOM   3971 C  CB  . ILE A 1 503 ? 14.306  -17.661 42.617  1.00 42.61 ? 503 ILE A CB  1 
ATOM   3972 C  CG1 . ILE A 1 503 ? 14.031  -17.023 43.983  1.00 40.74 ? 503 ILE A CG1 1 
ATOM   3973 C  CG2 . ILE A 1 503 ? 15.788  -17.652 42.306  1.00 46.74 ? 503 ILE A CG2 1 
ATOM   3974 C  CD1 . ILE A 1 503 ? 14.692  -17.738 45.127  1.00 45.37 ? 503 ILE A CD1 1 
ATOM   3975 N  N   . ASP A 1 504 ? 11.286  -17.938 41.730  1.00 44.73 ? 504 ASP A N   1 
ATOM   3976 C  CA  . ASP A 1 504 ? 10.002  -18.106 42.383  1.00 44.63 ? 504 ASP A CA  1 
ATOM   3977 C  C   . ASP A 1 504 ? 10.247  -18.545 43.812  1.00 44.02 ? 504 ASP A C   1 
ATOM   3978 O  O   . ASP A 1 504 ? 11.226  -19.233 44.102  1.00 44.71 ? 504 ASP A O   1 
ATOM   3979 C  CB  . ASP A 1 504 ? 9.124   -19.135 41.663  1.00 47.47 ? 504 ASP A CB  1 
ATOM   3980 C  CG  . ASP A 1 504 ? 8.731   -18.695 40.258  1.00 52.00 ? 504 ASP A CG  1 
ATOM   3981 O  OD1 . ASP A 1 504 ? 8.647   -17.472 40.006  1.00 51.93 ? 504 ASP A OD1 1 
ATOM   3982 O  OD2 . ASP A 1 504 ? 8.501   -19.576 39.401  1.00 56.20 ? 504 ASP A OD2 1 
ATOM   3983 N  N   . LEU A 1 505 ? 9.357   -18.126 44.702  1.00 42.28 ? 505 LEU A N   1 
ATOM   3984 C  CA  . LEU A 1 505 ? 9.305   -18.661 46.046  1.00 40.63 ? 505 LEU A CA  1 
ATOM   3985 C  C   . LEU A 1 505 ? 7.966   -19.344 46.234  1.00 43.80 ? 505 LEU A C   1 
ATOM   3986 O  O   . LEU A 1 505 ? 6.930   -18.685 46.326  1.00 43.54 ? 505 LEU A O   1 
ATOM   3987 C  CB  . LEU A 1 505 ? 9.499   -17.563 47.093  1.00 40.88 ? 505 LEU A CB  1 
ATOM   3988 C  CG  . LEU A 1 505 ? 10.910  -17.004 47.270  1.00 45.19 ? 505 LEU A CG  1 
ATOM   3989 C  CD1 . LEU A 1 505 ? 10.887  -15.804 48.214  1.00 45.49 ? 505 LEU A CD1 1 
ATOM   3990 C  CD2 . LEU A 1 505 ? 11.850  -18.086 47.798  1.00 46.26 ? 505 LEU A CD2 1 
ATOM   3991 N  N   . ASN A 1 506 ? 7.985   -20.668 46.283  1.00 42.84 ? 506 ASN A N   1 
ATOM   3992 C  CA  . ASN A 1 506 ? 6.779   -21.439 46.532  1.00 43.43 ? 506 ASN A CA  1 
ATOM   3993 C  C   . ASN A 1 506 ? 7.170   -22.809 47.038  1.00 46.15 ? 506 ASN A C   1 
ATOM   3994 O  O   . ASN A 1 506 ? 8.350   -23.068 47.267  1.00 44.89 ? 506 ASN A O   1 
ATOM   3995 C  CB  . ASN A 1 506 ? 5.929   -21.555 45.268  1.00 46.76 ? 506 ASN A CB  1 
ATOM   3996 C  CG  . ASN A 1 506 ? 6.745   -21.994 44.063  1.00 50.05 ? 506 ASN A CG  1 
ATOM   3997 O  OD1 . ASN A 1 506 ? 7.331   -23.078 44.063  1.00 54.69 ? 506 ASN A OD1 1 
ATOM   3998 N  ND2 . ASN A 1 506 ? 6.797   -21.151 43.038  1.00 46.87 ? 506 ASN A ND2 1 
ATOM   3999 N  N   . THR A 1 507 ? 6.184   -23.687 47.198  1.00 49.53 ? 507 THR A N   1 
ATOM   4000 C  CA  . THR A 1 507 ? 6.420   -25.000 47.791  1.00 51.81 ? 507 THR A CA  1 
ATOM   4001 C  C   . THR A 1 507 ? 7.123   -25.970 46.849  1.00 57.04 ? 507 THR A C   1 
ATOM   4002 O  O   . THR A 1 507 ? 7.572   -27.034 47.282  1.00 59.33 ? 507 THR A O   1 
ATOM   4003 C  CB  . THR A 1 507 ? 5.106   -25.645 48.254  1.00 56.12 ? 507 THR A CB  1 
ATOM   4004 O  OG1 . THR A 1 507 ? 4.121   -25.506 47.224  1.00 52.60 ? 507 THR A OG1 1 
ATOM   4005 C  CG2 . THR A 1 507 ? 4.610   -24.984 49.542  1.00 50.33 ? 507 THR A CG2 1 
ATOM   4006 N  N   . GLU A 1 508 ? 7.216   -25.602 45.570  1.00 54.91 ? 508 GLU A N   1 
ATOM   4007 C  CA  . GLU A 1 508 ? 7.864   -26.435 44.561  1.00 56.88 ? 508 GLU A CA  1 
ATOM   4008 C  C   . GLU A 1 508 ? 9.334   -26.068 44.414  1.00 59.09 ? 508 GLU A C   1 
ATOM   4009 O  O   . GLU A 1 508 ? 9.737   -24.969 44.798  1.00 58.59 ? 508 GLU A O   1 
ATOM   4010 C  CB  . GLU A 1 508 ? 7.161   -26.293 43.207  1.00 60.72 ? 508 GLU A CB  1 
ATOM   4011 C  CG  . GLU A 1 508 ? 5.703   -26.707 43.215  1.00 65.15 ? 508 GLU A CG  1 
ATOM   4012 C  CD  . GLU A 1 508 ? 5.040   -26.574 41.853  1.00 74.33 ? 508 GLU A CD  1 
ATOM   4013 O  OE1 . GLU A 1 508 ? 5.691   -26.085 40.903  1.00 74.75 ? 508 GLU A OE1 1 
ATOM   4014 O  OE2 . GLU A 1 508 ? 3.857   -26.962 41.732  1.00 83.21 ? 508 GLU A OE2 1 
ATOM   4015 N  N   . PRO A 1 509 ? 10.135  -26.982 43.836  1.00 61.95 ? 509 PRO A N   1 
ATOM   4016 C  CA  . PRO A 1 509 ? 11.577  -26.790 43.642  1.00 60.48 ? 509 PRO A CA  1 
ATOM   4017 C  C   . PRO A 1 509 ? 11.878  -25.506 42.884  1.00 59.36 ? 509 PRO A C   1 
ATOM   4018 O  O   . PRO A 1 509 ? 11.116  -25.110 42.003  1.00 57.11 ? 509 PRO A O   1 
ATOM   4019 C  CB  . PRO A 1 509 ? 11.991  -28.017 42.829  1.00 56.27 ? 509 PRO A CB  1 
ATOM   4020 C  CG  . PRO A 1 509 ? 10.965  -29.040 43.159  1.00 62.33 ? 509 PRO A CG  1 
ATOM   4021 C  CD  . PRO A 1 509 ? 9.683   -28.273 43.292  1.00 60.09 ? 509 PRO A CD  1 
ATOM   4022 N  N   . MET A 1 510 ? 12.989  -24.871 43.233  1.00 56.73 ? 510 MET A N   1 
ATOM   4023 C  CA  . MET A 1 510 ? 13.291  -23.534 42.748  1.00 59.05 ? 510 MET A CA  1 
ATOM   4024 C  C   . MET A 1 510 ? 13.511  -23.475 41.242  1.00 62.11 ? 510 MET A C   1 
ATOM   4025 O  O   . MET A 1 510 ? 14.248  -24.281 40.676  1.00 63.71 ? 510 MET A O   1 
ATOM   4026 C  CB  . MET A 1 510 ? 14.524  -22.986 43.464  1.00 63.21 ? 510 MET A CB  1 
ATOM   4027 C  CG  . MET A 1 510 ? 15.084  -21.714 42.849  1.00 61.26 ? 510 MET A CG  1 
ATOM   4028 S  SD  . MET A 1 510 ? 16.757  -21.409 43.440  1.00 68.59 ? 510 MET A SD  1 
ATOM   4029 C  CE  . MET A 1 510 ? 16.525  -21.743 45.180  1.00 60.98 ? 510 MET A CE  1 
ATOM   4030 N  N   . LYS A 1 511 ? 12.860  -22.511 40.601  1.00 58.13 ? 511 LYS A N   1 
ATOM   4031 C  CA  . LYS A 1 511 ? 13.091  -22.233 39.192  1.00 58.93 ? 511 LYS A CA  1 
ATOM   4032 C  C   . LYS A 1 511 ? 13.668  -20.832 39.040  1.00 52.11 ? 511 LYS A C   1 
ATOM   4033 O  O   . LYS A 1 511 ? 13.360  -19.938 39.827  1.00 53.07 ? 511 LYS A O   1 
ATOM   4034 C  CB  . LYS A 1 511 ? 11.796  -22.361 38.383  1.00 59.59 ? 511 LYS A CB  1 
ATOM   4035 C  CG  . LYS A 1 511 ? 11.089  -23.704 38.512  1.00 62.08 ? 511 LYS A CG  1 
ATOM   4036 C  CD  . LYS A 1 511 ? 10.098  -23.906 37.372  1.00 63.20 ? 511 LYS A CD  1 
ATOM   4037 C  CE  . LYS A 1 511 ? 10.804  -23.804 36.022  1.00 71.66 ? 511 LYS A CE  1 
ATOM   4038 N  NZ  . LYS A 1 511 ? 9.874   -23.961 34.866  1.00 73.78 ? 511 LYS A NZ  1 
ATOM   4039 N  N   . VAL A 1 512 ? 14.505  -20.646 38.029  1.00 47.76 ? 512 VAL A N   1 
ATOM   4040 C  CA  . VAL A 1 512 ? 15.082  -19.344 37.743  1.00 43.36 ? 512 VAL A CA  1 
ATOM   4041 C  C   . VAL A 1 512 ? 14.449  -18.763 36.482  1.00 46.73 ? 512 VAL A C   1 
ATOM   4042 O  O   . VAL A 1 512 ? 14.420  -19.413 35.435  1.00 48.59 ? 512 VAL A O   1 
ATOM   4043 C  CB  . VAL A 1 512 ? 16.617  -19.437 37.567  1.00 45.59 ? 512 VAL A CB  1 
ATOM   4044 C  CG1 . VAL A 1 512 ? 17.179  -18.163 36.953  1.00 44.91 ? 512 VAL A CG1 1 
ATOM   4045 C  CG2 . VAL A 1 512 ? 17.290  -19.740 38.897  1.00 50.72 ? 512 VAL A CG2 1 
ATOM   4046 N  N   . HIS A 1 513 ? 13.935  -17.543 36.581  1.00 43.29 ? 513 HIS A N   1 
ATOM   4047 C  CA  . HIS A 1 513 ? 13.418  -16.849 35.411  1.00 39.85 ? 513 HIS A CA  1 
ATOM   4048 C  C   . HIS A 1 513 ? 14.189  -15.565 35.197  1.00 38.96 ? 513 HIS A C   1 
ATOM   4049 O  O   . HIS A 1 513 ? 15.071  -15.218 35.982  1.00 39.67 ? 513 HIS A O   1 
ATOM   4050 C  CB  . HIS A 1 513 ? 11.925  -16.540 35.558  1.00 42.26 ? 513 HIS A CB  1 
ATOM   4051 C  CG  . HIS A 1 513 ? 11.117  -17.693 36.064  1.00 45.77 ? 513 HIS A CG  1 
ATOM   4052 N  ND1 . HIS A 1 513 ? 10.780  -18.770 35.274  1.00 50.88 ? 513 HIS A ND1 1 
ATOM   4053 C  CD2 . HIS A 1 513 ? 10.578  -17.937 37.282  1.00 46.46 ? 513 HIS A CD2 1 
ATOM   4054 C  CE1 . HIS A 1 513 ? 10.068  -19.628 35.983  1.00 50.75 ? 513 HIS A CE1 1 
ATOM   4055 N  NE2 . HIS A 1 513 ? 9.931   -19.145 37.204  1.00 51.02 ? 513 HIS A NE2 1 
ATOM   4056 N  N   . GLN A 1 514 ? 13.843  -14.855 34.134  1.00 38.58 ? 514 GLN A N   1 
ATOM   4057 C  CA  . GLN A 1 514 ? 14.506  -13.611 33.807  1.00 38.58 ? 514 GLN A CA  1 
ATOM   4058 C  C   . GLN A 1 514 ? 13.468  -12.574 33.456  1.00 37.22 ? 514 GLN A C   1 
ATOM   4059 O  O   . GLN A 1 514 ? 12.407  -12.911 32.930  1.00 38.00 ? 514 GLN A O   1 
ATOM   4060 C  CB  . GLN A 1 514 ? 15.473  -13.791 32.632  1.00 40.18 ? 514 GLN A CB  1 
ATOM   4061 C  CG  . GLN A 1 514 ? 16.545  -14.853 32.848  1.00 41.80 ? 514 GLN A CG  1 
ATOM   4062 C  CD  . GLN A 1 514 ? 17.573  -14.891 31.709  1.00 51.95 ? 514 GLN A CD  1 
ATOM   4063 O  OE1 . GLN A 1 514 ? 17.695  -13.944 30.925  1.00 51.66 ? 514 GLN A OE1 1 
ATOM   4064 N  NE2 . GLN A 1 514 ? 18.317  -15.987 31.623  1.00 52.46 ? 514 GLN A NE2 1 
ATOM   4065 N  N   . ARG A 1 515 ? 13.785  -11.313 33.723  1.00 34.37 ? 515 ARG A N   1 
ATOM   4066 C  CA  . ARG A 1 515 ? 12.943  -10.205 33.290  1.00 37.48 ? 515 ARG A CA  1 
ATOM   4067 C  C   . ARG A 1 515 ? 11.525  -10.300 33.881  1.00 35.72 ? 515 ARG A C   1 
ATOM   4068 O  O   . ARG A 1 515 ? 10.553  -10.496 33.160  1.00 35.15 ? 515 ARG A O   1 
ATOM   4069 C  CB  . ARG A 1 515 ? 12.902  -10.165 31.757  1.00 35.22 ? 515 ARG A CB  1 
ATOM   4070 C  CG  . ARG A 1 515 ? 14.296  -10.137 31.126  1.00 37.34 ? 515 ARG A CG  1 
ATOM   4071 C  CD  . ARG A 1 515 ? 14.290  -9.682  29.663  1.00 39.83 ? 515 ARG A CD  1 
ATOM   4072 N  NE  . ARG A 1 515 ? 15.594  -9.147  29.275  1.00 44.38 ? 515 ARG A NE  1 
ATOM   4073 C  CZ  . ARG A 1 515 ? 15.852  -8.524  28.127  1.00 49.72 ? 515 ARG A CZ  1 
ATOM   4074 N  NH1 . ARG A 1 515 ? 17.076  -8.068  27.881  1.00 49.89 ? 515 ARG A NH1 1 
ATOM   4075 N  NH2 . ARG A 1 515 ? 14.893  -8.349  27.225  1.00 46.68 ? 515 ARG A NH2 1 
ATOM   4076 N  N   . LEU A 1 516 ? 11.420  -10.187 35.201  1.00 36.63 ? 516 LEU A N   1 
ATOM   4077 C  CA  . LEU A 1 516 ? 10.118  -10.193 35.861  1.00 34.64 ? 516 LEU A CA  1 
ATOM   4078 C  C   . LEU A 1 516 ? 9.208   -9.142  35.244  1.00 32.44 ? 516 LEU A C   1 
ATOM   4079 O  O   . LEU A 1 516 ? 9.559   -7.967  35.193  1.00 33.77 ? 516 LEU A O   1 
ATOM   4080 C  CB  . LEU A 1 516 ? 10.276  -9.956  37.372  1.00 37.03 ? 516 LEU A CB  1 
ATOM   4081 C  CG  . LEU A 1 516 ? 9.039   -9.757  38.259  1.00 33.52 ? 516 LEU A CG  1 
ATOM   4082 C  CD1 . LEU A 1 516 ? 7.954   -10.754 37.934  1.00 31.77 ? 516 LEU A CD1 1 
ATOM   4083 C  CD2 . LEU A 1 516 ? 9.466   -9.892  39.717  1.00 38.63 ? 516 LEU A CD2 1 
ATOM   4084 N  N   . ARG A 1 517 ? 8.058   -9.604  34.750  1.00 36.71 ? 517 ARG A N   1 
ATOM   4085 C  CA  . ARG A 1 517 ? 7.026   -8.804  34.074  1.00 35.22 ? 517 ARG A CA  1 
ATOM   4086 C  C   . ARG A 1 517 ? 7.552   -7.626  33.248  1.00 34.16 ? 517 ARG A C   1 
ATOM   4087 O  O   . ARG A 1 517 ? 6.990   -6.525  33.275  1.00 30.56 ? 517 ARG A O   1 
ATOM   4088 C  CB  . ARG A 1 517 ? 5.998   -8.321  35.109  1.00 38.66 ? 517 ARG A CB  1 
ATOM   4089 C  CG  . ARG A 1 517 ? 4.985   -9.433  35.438  1.00 41.63 ? 517 ARG A CG  1 
ATOM   4090 C  CD  . ARG A 1 517 ? 3.931   -9.064  36.461  1.00 37.16 ? 517 ARG A CD  1 
ATOM   4091 N  NE  . ARG A 1 517 ? 2.804   -8.369  35.852  1.00 42.04 ? 517 ARG A NE  1 
ATOM   4092 C  CZ  . ARG A 1 517 ? 1.886   -8.958  35.091  1.00 39.39 ? 517 ARG A CZ  1 
ATOM   4093 N  NH1 . ARG A 1 517 ? 1.982   -10.254 34.825  1.00 45.39 ? 517 ARG A NH1 1 
ATOM   4094 N  NH2 . ARG A 1 517 ? 0.880   -8.251  34.590  1.00 30.84 ? 517 ARG A NH2 1 
ATOM   4095 N  N   . VAL A 1 518 ? 8.614   -7.878  32.484  1.00 33.75 ? 518 VAL A N   1 
ATOM   4096 C  CA  . VAL A 1 518 ? 9.228   -6.845  31.652  1.00 32.22 ? 518 VAL A CA  1 
ATOM   4097 C  C   . VAL A 1 518 ? 8.256   -6.187  30.659  1.00 31.09 ? 518 VAL A C   1 
ATOM   4098 O  O   . VAL A 1 518 ? 8.340   -4.984  30.418  1.00 30.16 ? 518 VAL A O   1 
ATOM   4099 C  CB  . VAL A 1 518 ? 10.422  -7.407  30.864  1.00 36.37 ? 518 VAL A CB  1 
ATOM   4100 C  CG1 . VAL A 1 518 ? 9.979   -8.550  29.963  1.00 34.07 ? 518 VAL A CG1 1 
ATOM   4101 C  CG2 . VAL A 1 518 ? 11.101  -6.296  30.062  1.00 33.60 ? 518 VAL A CG2 1 
ATOM   4102 N  N   . GLN A 1 519 ? 7.325   -6.950  30.092  1.00 31.04 ? 519 GLN A N   1 
ATOM   4103 C  CA  . GLN A 1 519 ? 6.417   -6.367  29.087  1.00 33.81 ? 519 GLN A CA  1 
ATOM   4104 C  C   . GLN A 1 519 ? 5.562   -5.243  29.695  1.00 34.12 ? 519 GLN A C   1 
ATOM   4105 O  O   . GLN A 1 519 ? 5.567   -4.104  29.218  1.00 33.47 ? 519 GLN A O   1 
ATOM   4106 C  CB  . GLN A 1 519 ? 5.505   -7.427  28.471  1.00 31.66 ? 519 GLN A CB  1 
ATOM   4107 C  CG  . GLN A 1 519 ? 4.846   -6.967  27.179  1.00 36.43 ? 519 GLN A CG  1 
ATOM   4108 C  CD  . GLN A 1 519 ? 5.844   -6.901  26.020  1.00 36.92 ? 519 GLN A CD  1 
ATOM   4109 O  OE1 . GLN A 1 519 ? 6.747   -7.736  25.918  1.00 34.67 ? 519 GLN A OE1 1 
ATOM   4110 N  NE2 . GLN A 1 519 ? 5.701   -5.893  25.168  1.00 30.98 ? 519 GLN A NE2 1 
ATOM   4111 N  N   . MET A 1 520 ? 4.831   -5.567  30.752  1.00 32.26 ? 520 MET A N   1 
ATOM   4112 C  CA  . MET A 1 520 ? 3.981   -4.585  31.413  1.00 33.90 ? 520 MET A CA  1 
ATOM   4113 C  C   . MET A 1 520 ? 4.810   -3.465  32.048  1.00 31.49 ? 520 MET A C   1 
ATOM   4114 O  O   . MET A 1 520 ? 4.409   -2.300  32.039  1.00 29.45 ? 520 MET A O   1 
ATOM   4115 C  CB  . MET A 1 520 ? 3.104   -5.268  32.464  1.00 29.01 ? 520 MET A CB  1 
ATOM   4116 C  CG  . MET A 1 520 ? 2.061   -6.219  31.886  1.00 37.01 ? 520 MET A CG  1 
ATOM   4117 S  SD  . MET A 1 520 ? 0.971   -5.520  30.585  1.00 45.61 ? 520 MET A SD  1 
ATOM   4118 C  CE  . MET A 1 520 ? 1.975   -5.756  29.118  1.00 38.35 ? 520 MET A CE  1 
ATOM   4119 N  N   . CYS A 1 521 ? 5.980   -3.802  32.581  1.00 28.88 ? 521 CYS A N   1 
ATOM   4120 C  CA  . CYS A 1 521 ? 6.772   -2.783  33.251  1.00 30.96 ? 521 CYS A CA  1 
ATOM   4121 C  C   . CYS A 1 521 ? 7.455   -1.819  32.270  1.00 30.95 ? 521 CYS A C   1 
ATOM   4122 O  O   . CYS A 1 521 ? 7.721   -0.675  32.621  1.00 33.41 ? 521 CYS A O   1 
ATOM   4123 C  CB  . CYS A 1 521 ? 7.781   -3.442  34.195  1.00 31.80 ? 521 CYS A CB  1 
ATOM   4124 S  SG  . CYS A 1 521 ? 6.941   -4.196  35.632  1.00 36.84 ? 521 CYS A SG  1 
ATOM   4125 N  N   . VAL A 1 522 ? 7.706   -2.242  31.036  1.00 28.88 ? 522 VAL A N   1 
ATOM   4126 C  CA  . VAL A 1 522 ? 8.122   -1.273  30.033  1.00 30.49 ? 522 VAL A CA  1 
ATOM   4127 C  C   . VAL A 1 522 ? 6.997   -0.246  29.828  1.00 31.97 ? 522 VAL A C   1 
ATOM   4128 O  O   . VAL A 1 522 ? 7.237   0.960   29.782  1.00 33.97 ? 522 VAL A O   1 
ATOM   4129 C  CB  . VAL A 1 522 ? 8.482   -1.940  28.678  1.00 33.28 ? 522 VAL A CB  1 
ATOM   4130 C  CG1 . VAL A 1 522 ? 8.579   -0.891  27.572  1.00 30.29 ? 522 VAL A CG1 1 
ATOM   4131 C  CG2 . VAL A 1 522 ? 9.760   -2.742  28.798  1.00 29.45 ? 522 VAL A CG2 1 
ATOM   4132 N  N   . PHE A 1 523 ? 5.766   -0.728  29.704  1.00 30.15 ? 523 PHE A N   1 
ATOM   4133 C  CA  . PHE A 1 523 ? 4.605   0.161   29.613  1.00 32.60 ? 523 PHE A CA  1 
ATOM   4134 C  C   . PHE A 1 523 ? 4.526   1.149   30.795  1.00 32.33 ? 523 PHE A C   1 
ATOM   4135 O  O   . PHE A 1 523 ? 4.462   2.368   30.593  1.00 31.51 ? 523 PHE A O   1 
ATOM   4136 C  CB  . PHE A 1 523 ? 3.314   -0.666  29.534  1.00 32.87 ? 523 PHE A CB  1 
ATOM   4137 C  CG  . PHE A 1 523 ? 2.052   0.154   29.639  1.00 34.39 ? 523 PHE A CG  1 
ATOM   4138 C  CD1 . PHE A 1 523 ? 1.497   0.750   28.518  1.00 33.90 ? 523 PHE A CD1 1 
ATOM   4139 C  CD2 . PHE A 1 523 ? 1.421   0.321   30.863  1.00 32.34 ? 523 PHE A CD2 1 
ATOM   4140 C  CE1 . PHE A 1 523 ? 0.346   1.505   28.615  1.00 33.76 ? 523 PHE A CE1 1 
ATOM   4141 C  CE2 . PHE A 1 523 ? 0.272   1.069   30.966  1.00 33.85 ? 523 PHE A CE2 1 
ATOM   4142 C  CZ  . PHE A 1 523 ? -0.268  1.664   29.844  1.00 30.20 ? 523 PHE A CZ  1 
ATOM   4143 N  N   . TRP A 1 524 ? 4.535   0.622   32.018  1.00 30.11 ? 524 TRP A N   1 
ATOM   4144 C  CA  . TRP A 1 524 ? 4.376   1.458   33.211  1.00 33.80 ? 524 TRP A CA  1 
ATOM   4145 C  C   . TRP A 1 524 ? 5.573   2.359   33.470  1.00 33.96 ? 524 TRP A C   1 
ATOM   4146 O  O   . TRP A 1 524 ? 5.403   3.491   33.923  1.00 33.02 ? 524 TRP A O   1 
ATOM   4147 C  CB  . TRP A 1 524 ? 4.109   0.600   34.454  1.00 28.96 ? 524 TRP A CB  1 
ATOM   4148 C  CG  . TRP A 1 524 ? 2.739   -0.001  34.452  1.00 31.18 ? 524 TRP A CG  1 
ATOM   4149 C  CD1 . TRP A 1 524 ? 2.413   -1.311  34.229  1.00 31.35 ? 524 TRP A CD1 1 
ATOM   4150 C  CD2 . TRP A 1 524 ? 1.498   0.694   34.628  1.00 28.86 ? 524 TRP A CD2 1 
ATOM   4151 N  NE1 . TRP A 1 524 ? 1.051   -1.476  34.282  1.00 30.51 ? 524 TRP A NE1 1 
ATOM   4152 C  CE2 . TRP A 1 524 ? 0.465   -0.261  34.523  1.00 29.43 ? 524 TRP A CE2 1 
ATOM   4153 C  CE3 . TRP A 1 524 ? 1.161   2.026   34.866  1.00 26.10 ? 524 TRP A CE3 1 
ATOM   4154 C  CZ2 . TRP A 1 524 ? -0.880  0.075   34.660  1.00 31.48 ? 524 TRP A CZ2 1 
ATOM   4155 C  CZ3 . TRP A 1 524 ? -0.185  2.357   35.001  1.00 31.56 ? 524 TRP A CZ3 1 
ATOM   4156 C  CH2 . TRP A 1 524 ? -1.183  1.387   34.900  1.00 30.33 ? 524 TRP A CH2 1 
ATOM   4157 N  N   . ASN A 1 525 ? 6.773   1.880   33.154  1.00 32.84 ? 525 ASN A N   1 
ATOM   4158 C  CA  . ASN A 1 525 ? 7.981   2.620   33.511  1.00 34.53 ? 525 ASN A CA  1 
ATOM   4159 C  C   . ASN A 1 525 ? 8.516   3.523   32.408  1.00 39.84 ? 525 ASN A C   1 
ATOM   4160 O  O   . ASN A 1 525 ? 9.134   4.548   32.707  1.00 37.59 ? 525 ASN A O   1 
ATOM   4161 C  CB  . ASN A 1 525 ? 9.078   1.644   33.972  1.00 35.23 ? 525 ASN A CB  1 
ATOM   4162 C  CG  . ASN A 1 525 ? 8.712   0.956   35.280  1.00 31.53 ? 525 ASN A CG  1 
ATOM   4163 O  OD1 . ASN A 1 525 ? 7.802   1.404   35.958  1.00 38.36 ? 525 ASN A OD1 1 
ATOM   4164 N  ND2 . ASN A 1 525 ? 9.396   -0.132  35.626  1.00 33.58 ? 525 ASN A ND2 1 
ATOM   4165 N  N   . GLN A 1 526 ? 8.277   3.170   31.140  1.00 35.10 ? 526 GLN A N   1 
ATOM   4166 C  CA  . GLN A 1 526 ? 8.770   4.002   30.049  1.00 39.86 ? 526 GLN A CA  1 
ATOM   4167 C  C   . GLN A 1 526 ? 7.667   4.679   29.232  1.00 40.99 ? 526 GLN A C   1 
ATOM   4168 O  O   . GLN A 1 526 ? 7.681   5.901   29.074  1.00 40.76 ? 526 GLN A O   1 
ATOM   4169 C  CB  . GLN A 1 526 ? 9.673   3.187   29.113  1.00 40.61 ? 526 GLN A CB  1 
ATOM   4170 C  CG  . GLN A 1 526 ? 11.006  2.807   29.744  1.00 45.36 ? 526 GLN A CG  1 
ATOM   4171 C  CD  . GLN A 1 526 ? 12.110  2.614   28.709  1.00 65.74 ? 526 GLN A CD  1 
ATOM   4172 O  OE1 . GLN A 1 526 ? 11.890  2.782   27.503  1.00 67.58 ? 526 GLN A OE1 1 
ATOM   4173 N  NE2 . GLN A 1 526 ? 13.307  2.265   29.177  1.00 72.76 ? 526 GLN A NE2 1 
ATOM   4174 N  N   . PHE A 1 527 ? 6.717   3.909   28.706  1.00 35.07 ? 527 PHE A N   1 
ATOM   4175 C  CA  . PHE A 1 527 ? 5.771   4.504   27.773  1.00 36.12 ? 527 PHE A CA  1 
ATOM   4176 C  C   . PHE A 1 527 ? 4.716   5.399   28.441  1.00 36.03 ? 527 PHE A C   1 
ATOM   4177 O  O   . PHE A 1 527 ? 4.501   6.524   27.989  1.00 37.16 ? 527 PHE A O   1 
ATOM   4178 C  CB  . PHE A 1 527 ? 5.075   3.422   26.938  1.00 37.70 ? 527 PHE A CB  1 
ATOM   4179 C  CG  . PHE A 1 527 ? 4.091   3.978   25.956  1.00 36.62 ? 527 PHE A CG  1 
ATOM   4180 C  CD1 . PHE A 1 527 ? 4.525   4.552   24.776  1.00 35.79 ? 527 PHE A CD1 1 
ATOM   4181 C  CD2 . PHE A 1 527 ? 2.733   3.945   26.225  1.00 33.50 ? 527 PHE A CD2 1 
ATOM   4182 C  CE1 . PHE A 1 527 ? 3.623   5.075   23.877  1.00 37.19 ? 527 PHE A CE1 1 
ATOM   4183 C  CE2 . PHE A 1 527 ? 1.822   4.465   25.341  1.00 32.70 ? 527 PHE A CE2 1 
ATOM   4184 C  CZ  . PHE A 1 527 ? 2.258   5.031   24.163  1.00 41.20 ? 527 PHE A CZ  1 
ATOM   4185 N  N   . LEU A 1 528 ? 4.058   4.931   29.501  1.00 35.89 ? 528 LEU A N   1 
ATOM   4186 C  CA  . LEU A 1 528 ? 2.980   5.732   30.082  1.00 33.41 ? 528 LEU A CA  1 
ATOM   4187 C  C   . LEU A 1 528 ? 3.506   7.065   30.586  1.00 34.85 ? 528 LEU A C   1 
ATOM   4188 O  O   . LEU A 1 528 ? 2.941   8.112   30.267  1.00 37.17 ? 528 LEU A O   1 
ATOM   4189 C  CB  . LEU A 1 528 ? 2.263   4.989   31.209  1.00 33.81 ? 528 LEU A CB  1 
ATOM   4190 C  CG  . LEU A 1 528 ? 0.997   5.668   31.775  1.00 34.87 ? 528 LEU A CG  1 
ATOM   4191 C  CD1 . LEU A 1 528 ? -0.042  5.956   30.703  1.00 36.36 ? 528 LEU A CD1 1 
ATOM   4192 C  CD2 . LEU A 1 528 ? 0.382   4.812   32.848  1.00 33.86 ? 528 LEU A CD2 1 
ATOM   4193 N  N   . PRO A 1 529 ? 4.603   7.039   31.360  1.00 37.10 ? 529 PRO A N   1 
ATOM   4194 C  CA  . PRO A 1 529 ? 5.187   8.280   31.874  1.00 37.31 ? 529 PRO A CA  1 
ATOM   4195 C  C   . PRO A 1 529 ? 5.508   9.265   30.761  1.00 38.20 ? 529 PRO A C   1 
ATOM   4196 O  O   . PRO A 1 529 ? 5.226   10.455  30.883  1.00 42.85 ? 529 PRO A O   1 
ATOM   4197 C  CB  . PRO A 1 529 ? 6.453   7.797   32.577  1.00 37.82 ? 529 PRO A CB  1 
ATOM   4198 C  CG  . PRO A 1 529 ? 6.124   6.416   32.999  1.00 35.11 ? 529 PRO A CG  1 
ATOM   4199 C  CD  . PRO A 1 529 ? 5.294   5.852   31.893  1.00 35.34 ? 529 PRO A CD  1 
ATOM   4200 N  N   . LYS A 1 530 ? 6.058   8.769   29.662  1.00 42.49 ? 530 LYS A N   1 
ATOM   4201 C  CA  . LYS A 1 530 ? 6.313   9.627   28.514  1.00 40.55 ? 530 LYS A CA  1 
ATOM   4202 C  C   . LYS A 1 530 ? 5.014   10.163  27.896  1.00 39.84 ? 530 LYS A C   1 
ATOM   4203 O  O   . LYS A 1 530 ? 4.934   11.339  27.547  1.00 44.78 ? 530 LYS A O   1 
ATOM   4204 C  CB  . LYS A 1 530 ? 7.140   8.884   27.473  1.00 42.91 ? 530 LYS A CB  1 
ATOM   4205 C  CG  . LYS A 1 530 ? 7.538   9.756   26.294  1.00 48.33 ? 530 LYS A CG  1 
ATOM   4206 C  CD  . LYS A 1 530 ? 8.601   9.090   25.442  1.00 53.32 ? 530 LYS A CD  1 
ATOM   4207 C  CE  . LYS A 1 530 ? 8.622   9.692   24.037  1.00 56.42 ? 530 LYS A CE  1 
ATOM   4208 N  NZ  . LYS A 1 530 ? 9.848   9.300   23.282  1.00 54.81 ? 530 LYS A NZ  1 
ATOM   4209 N  N   . LEU A 1 531 ? 3.995   9.315   27.779  1.00 38.26 ? 531 LEU A N   1 
ATOM   4210 C  CA  . LEU A 1 531 ? 2.677   9.750   27.292  1.00 38.73 ? 531 LEU A CA  1 
ATOM   4211 C  C   . LEU A 1 531 ? 2.054   10.873  28.131  1.00 44.53 ? 531 LEU A C   1 
ATOM   4212 O  O   . LEU A 1 531 ? 1.611   11.888  27.587  1.00 46.76 ? 531 LEU A O   1 
ATOM   4213 C  CB  . LEU A 1 531 ? 1.710   8.566   27.245  1.00 36.80 ? 531 LEU A CB  1 
ATOM   4214 C  CG  . LEU A 1 531 ? 0.305   8.778   26.664  1.00 39.33 ? 531 LEU A CG  1 
ATOM   4215 C  CD1 . LEU A 1 531 ? -0.263  7.448   26.218  1.00 38.38 ? 531 LEU A CD1 1 
ATOM   4216 C  CD2 . LEU A 1 531 ? -0.656  9.437   27.653  1.00 38.32 ? 531 LEU A CD2 1 
ATOM   4217 N  N   . LEU A 1 532 ? 2.000   10.683  29.448  1.00 40.45 ? 532 LEU A N   1 
ATOM   4218 C  CA  . LEU A 1 532 ? 1.425   11.692  30.339  1.00 45.87 ? 532 LEU A CA  1 
ATOM   4219 C  C   . LEU A 1 532 ? 2.190   13.016  30.280  1.00 47.53 ? 532 LEU A C   1 
ATOM   4220 O  O   . LEU A 1 532 ? 1.583   14.089  30.262  1.00 50.31 ? 532 LEU A O   1 
ATOM   4221 C  CB  . LEU A 1 532 ? 1.390   11.174  31.778  1.00 43.21 ? 532 LEU A CB  1 
ATOM   4222 C  CG  . LEU A 1 532 ? 0.528   9.922   31.941  1.00 41.51 ? 532 LEU A CG  1 
ATOM   4223 C  CD1 . LEU A 1 532 ? 0.432   9.513   33.407  1.00 38.60 ? 532 LEU A CD1 1 
ATOM   4224 C  CD2 . LEU A 1 532 ? -0.854  10.153  31.333  1.00 40.14 ? 532 LEU A CD2 1 
ATOM   4225 N  N   . ASN A 1 533 ? 3.517   12.941  30.253  1.00 45.80 ? 533 ASN A N   1 
ATOM   4226 C  CA  . ASN A 1 533 ? 4.335   14.142  30.137  1.00 51.84 ? 533 ASN A CA  1 
ATOM   4227 C  C   . ASN A 1 533 ? 4.176   14.868  28.805  1.00 53.09 ? 533 ASN A C   1 
ATOM   4228 O  O   . ASN A 1 533 ? 4.338   16.086  28.734  1.00 54.55 ? 533 ASN A O   1 
ATOM   4229 C  CB  . ASN A 1 533 ? 5.807   13.810  30.338  1.00 53.52 ? 533 ASN A CB  1 
ATOM   4230 C  CG  . ASN A 1 533 ? 6.689   15.045  30.289  1.00 61.03 ? 533 ASN A CG  1 
ATOM   4231 O  OD1 . ASN A 1 533 ? 7.316   15.335  29.270  1.00 64.79 ? 533 ASN A OD1 1 
ATOM   4232 N  ND2 . ASN A 1 533 ? 6.728   15.790  31.393  1.00 62.43 ? 533 ASN A ND2 1 
ATOM   4233 N  N   . ALA A 1 534 ? 3.873   14.119  27.750  1.00 51.98 ? 534 ALA A N   1 
ATOM   4234 C  CA  . ALA A 1 534 ? 3.698   14.710  26.424  1.00 54.24 ? 534 ALA A CA  1 
ATOM   4235 C  C   . ALA A 1 534 ? 2.285   15.232  26.226  1.00 53.17 ? 534 ALA A C   1 
ATOM   4236 O  O   . ALA A 1 534 ? 2.040   16.056  25.348  1.00 57.85 ? 534 ALA A O   1 
ATOM   4237 C  CB  . ALA A 1 534 ? 4.035   13.697  25.341  1.00 52.01 ? 534 ALA A CB  1 
ATOM   4238 N  N   . THR A 1 535 ? 1.355   14.749  27.040  1.00 49.41 ? 535 THR A N   1 
ATOM   4239 C  CA  . THR A 1 535 ? -0.045  15.109  26.877  1.00 55.21 ? 535 THR A CA  1 
ATOM   4240 C  C   . THR A 1 535 ? -0.751  15.270  28.221  1.00 55.14 ? 535 THR A C   1 
ATOM   4241 O  O   . THR A 1 535 ? -1.916  15.666  28.274  1.00 60.67 ? 535 THR A O   1 
ATOM   4242 C  CB  . THR A 1 535 ? -0.792  14.054  26.034  1.00 58.10 ? 535 THR A CB  1 
ATOM   4243 O  OG1 . THR A 1 535 ? -0.835  12.811  26.747  1.00 54.03 ? 535 THR A OG1 1 
ATOM   4244 C  CG2 . THR A 1 535 ? -0.094  13.843  24.686  1.00 51.35 ? 535 THR A CG2 1 
ATOM   4245 N  N   . SER B 1 4   ? -22.806 -12.666 -36.355 1.00 65.42 ? 4   SER B N   1 
ATOM   4246 C  CA  . SER B 1 4   ? -21.461 -13.176 -36.114 1.00 59.02 ? 4   SER B CA  1 
ATOM   4247 C  C   . SER B 1 4   ? -21.071 -13.015 -34.648 1.00 54.42 ? 4   SER B C   1 
ATOM   4248 O  O   . SER B 1 4   ? -21.300 -11.973 -34.029 1.00 54.75 ? 4   SER B O   1 
ATOM   4249 C  CB  . SER B 1 4   ? -20.439 -12.471 -37.012 1.00 60.96 ? 4   SER B CB  1 
ATOM   4250 O  OG  . SER B 1 4   ? -19.139 -13.018 -36.838 1.00 58.00 ? 4   SER B OG  1 
ATOM   4251 N  N   . GLU B 1 5   ? -20.472 -14.061 -34.099 1.00 50.69 ? 5   GLU B N   1 
ATOM   4252 C  CA  . GLU B 1 5   ? -20.127 -14.091 -32.692 1.00 48.38 ? 5   GLU B CA  1 
ATOM   4253 C  C   . GLU B 1 5   ? -19.049 -13.061 -32.319 1.00 47.21 ? 5   GLU B C   1 
ATOM   4254 O  O   . GLU B 1 5   ? -19.088 -12.471 -31.234 1.00 43.27 ? 5   GLU B O   1 
ATOM   4255 C  CB  . GLU B 1 5   ? -19.668 -15.498 -32.315 1.00 49.19 ? 5   GLU B CB  1 
ATOM   4256 C  CG  . GLU B 1 5   ? -19.523 -15.727 -30.828 1.00 45.93 ? 5   GLU B CG  1 
ATOM   4257 C  CD  . GLU B 1 5   ? -19.397 -17.195 -30.487 1.00 48.80 ? 5   GLU B CD  1 
ATOM   4258 O  OE1 . GLU B 1 5   ? -19.207 -18.011 -31.412 1.00 52.94 ? 5   GLU B OE1 1 
ATOM   4259 O  OE2 . GLU B 1 5   ? -19.495 -17.538 -29.293 1.00 47.81 ? 5   GLU B OE2 1 
ATOM   4260 N  N   . LEU B 1 6   ? -18.095 -12.842 -33.218 1.00 43.59 ? 6   LEU B N   1 
ATOM   4261 C  CA  . LEU B 1 6   ? -16.948 -11.990 -32.913 1.00 42.86 ? 6   LEU B CA  1 
ATOM   4262 C  C   . LEU B 1 6   ? -17.147 -10.558 -33.365 1.00 41.93 ? 6   LEU B C   1 
ATOM   4263 O  O   . LEU B 1 6   ? -16.292 -9.706  -33.143 1.00 37.14 ? 6   LEU B O   1 
ATOM   4264 C  CB  . LEU B 1 6   ? -15.683 -12.545 -33.554 1.00 40.56 ? 6   LEU B CB  1 
ATOM   4265 C  CG  . LEU B 1 6   ? -15.300 -13.961 -33.137 1.00 45.11 ? 6   LEU B CG  1 
ATOM   4266 C  CD1 . LEU B 1 6   ? -14.025 -14.393 -33.850 1.00 43.37 ? 6   LEU B CD1 1 
ATOM   4267 C  CD2 . LEU B 1 6   ? -15.128 -14.025 -31.625 1.00 43.74 ? 6   LEU B CD2 1 
ATOM   4268 N  N   . LEU B 1 7   ? -18.276 -10.294 -34.005 1.00 44.04 ? 7   LEU B N   1 
ATOM   4269 C  CA  . LEU B 1 7   ? -18.514 -8.983  -34.584 1.00 45.29 ? 7   LEU B CA  1 
ATOM   4270 C  C   . LEU B 1 7   ? -19.654 -8.318  -33.859 1.00 44.46 ? 7   LEU B C   1 
ATOM   4271 O  O   . LEU B 1 7   ? -20.776 -8.830  -33.854 1.00 47.52 ? 7   LEU B O   1 
ATOM   4272 C  CB  . LEU B 1 7   ? -18.824 -9.092  -36.077 1.00 48.09 ? 7   LEU B CB  1 
ATOM   4273 C  CG  . LEU B 1 7   ? -19.127 -7.766  -36.774 1.00 50.55 ? 7   LEU B CG  1 
ATOM   4274 C  CD1 . LEU B 1 7   ? -17.978 -6.782  -36.572 1.00 48.37 ? 7   LEU B CD1 1 
ATOM   4275 C  CD2 . LEU B 1 7   ? -19.402 -7.995  -38.260 1.00 47.05 ? 7   LEU B CD2 1 
ATOM   4276 N  N   . VAL B 1 8   ? -19.368 -7.177  -33.243 1.00 38.94 ? 8   VAL B N   1 
ATOM   4277 C  CA  . VAL B 1 8   ? -20.334 -6.553  -32.356 1.00 42.24 ? 8   VAL B CA  1 
ATOM   4278 C  C   . VAL B 1 8   ? -20.375 -5.057  -32.566 1.00 38.66 ? 8   VAL B C   1 
ATOM   4279 O  O   . VAL B 1 8   ? -19.343 -4.404  -32.612 1.00 41.79 ? 8   VAL B O   1 
ATOM   4280 C  CB  . VAL B 1 8   ? -20.012 -6.842  -30.866 1.00 39.53 ? 8   VAL B CB  1 
ATOM   4281 C  CG1 . VAL B 1 8   ? -21.053 -6.210  -29.974 1.00 36.89 ? 8   VAL B CG1 1 
ATOM   4282 C  CG2 . VAL B 1 8   ? -19.924 -8.343  -30.617 1.00 41.01 ? 8   VAL B CG2 1 
ATOM   4283 N  N   . ASN B 1 9   ? -21.577 -4.517  -32.673 1.00 37.87 ? 9   ASN B N   1 
ATOM   4284 C  CA  . ASN B 1 9   ? -21.732 -3.097  -32.905 1.00 41.37 ? 9   ASN B CA  1 
ATOM   4285 C  C   . ASN B 1 9   ? -22.058 -2.387  -31.615 1.00 41.50 ? 9   ASN B C   1 
ATOM   4286 O  O   . ASN B 1 9   ? -23.096 -2.637  -31.008 1.00 42.31 ? 9   ASN B O   1 
ATOM   4287 C  CB  . ASN B 1 9   ? -22.828 -2.830  -33.940 1.00 43.54 ? 9   ASN B CB  1 
ATOM   4288 C  CG  . ASN B 1 9   ? -22.946 -1.356  -34.291 1.00 48.86 ? 9   ASN B CG  1 
ATOM   4289 O  OD1 . ASN B 1 9   ? -21.939 -0.647  -34.394 1.00 45.99 ? 9   ASN B OD1 1 
ATOM   4290 N  ND2 . ASN B 1 9   ? -24.181 -0.882  -34.464 1.00 49.63 ? 9   ASN B ND2 1 
ATOM   4291 N  N   . THR B 1 10  ? -21.176 -1.491  -31.200 1.00 40.23 ? 10  THR B N   1 
ATOM   4292 C  CA  . THR B 1 10  ? -21.370 -0.790  -29.939 1.00 39.73 ? 10  THR B CA  1 
ATOM   4293 C  C   . THR B 1 10  ? -21.885 0.607   -30.241 1.00 42.75 ? 10  THR B C   1 
ATOM   4294 O  O   . THR B 1 10  ? -22.021 0.975   -31.405 1.00 38.99 ? 10  THR B O   1 
ATOM   4295 C  CB  . THR B 1 10  ? -20.064 -0.710  -29.111 1.00 38.90 ? 10  THR B CB  1 
ATOM   4296 O  OG1 . THR B 1 10  ? -19.264 0.388   -29.564 1.00 36.03 ? 10  THR B OG1 1 
ATOM   4297 C  CG2 . THR B 1 10  ? -19.267 -2.004  -29.226 1.00 35.62 ? 10  THR B CG2 1 
ATOM   4298 N  N   . LYS B 1 11  ? -22.173 1.378   -29.197 1.00 41.12 ? 11  LYS B N   1 
ATOM   4299 C  CA  . LYS B 1 11  ? -22.646 2.746   -29.373 1.00 42.11 ? 11  LYS B CA  1 
ATOM   4300 C  C   . LYS B 1 11  ? -21.553 3.649   -29.928 1.00 42.50 ? 11  LYS B C   1 
ATOM   4301 O  O   . LYS B 1 11  ? -21.835 4.723   -30.451 1.00 44.73 ? 11  LYS B O   1 
ATOM   4302 C  CB  . LYS B 1 11  ? -23.162 3.315   -28.055 1.00 39.41 ? 11  LYS B CB  1 
ATOM   4303 C  CG  . LYS B 1 11  ? -24.673 3.350   -27.942 1.00 48.75 ? 11  LYS B CG  1 
ATOM   4304 C  CD  . LYS B 1 11  ? -25.237 2.070   -27.354 1.00 49.52 ? 11  LYS B CD  1 
ATOM   4305 C  CE  . LYS B 1 11  ? -26.178 2.373   -26.198 1.00 47.36 ? 11  LYS B CE  1 
ATOM   4306 N  NZ  . LYS B 1 11  ? -27.396 3.118   -26.630 1.00 56.75 ? 11  LYS B NZ  1 
ATOM   4307 N  N   . SER B 1 12  ? -20.305 3.216   -29.801 1.00 40.47 ? 12  SER B N   1 
ATOM   4308 C  CA  . SER B 1 12  ? -19.175 4.015   -30.263 1.00 42.35 ? 12  SER B CA  1 
ATOM   4309 C  C   . SER B 1 12  ? -18.721 3.569   -31.662 1.00 44.11 ? 12  SER B C   1 
ATOM   4310 O  O   . SER B 1 12  ? -17.944 4.260   -32.328 1.00 43.79 ? 12  SER B O   1 
ATOM   4311 C  CB  . SER B 1 12  ? -18.000 3.919   -29.273 1.00 46.28 ? 12  SER B CB  1 
ATOM   4312 O  OG  . SER B 1 12  ? -18.375 4.213   -27.928 1.00 45.26 ? 12  SER B OG  1 
ATOM   4313 N  N   . GLY B 1 13  ? -19.202 2.410   -32.102 1.00 40.02 ? 13  GLY B N   1 
ATOM   4314 C  CA  . GLY B 1 13  ? -18.781 1.861   -33.373 1.00 40.27 ? 13  GLY B CA  1 
ATOM   4315 C  C   . GLY B 1 13  ? -18.623 0.356   -33.360 1.00 41.40 ? 13  GLY B C   1 
ATOM   4316 O  O   . GLY B 1 13  ? -18.767 -0.288  -32.320 1.00 39.67 ? 13  GLY B O   1 
ATOM   4317 N  N   . LYS B 1 14  ? -18.323 -0.205  -34.528 1.00 43.32 ? 14  LYS B N   1 
ATOM   4318 C  CA  . LYS B 1 14  ? -18.176 -1.648  -34.673 1.00 43.47 ? 14  LYS B CA  1 
ATOM   4319 C  C   . LYS B 1 14  ? -16.840 -2.155  -34.142 1.00 41.79 ? 14  LYS B C   1 
ATOM   4320 O  O   . LYS B 1 14  ? -15.831 -1.448  -34.177 1.00 42.14 ? 14  LYS B O   1 
ATOM   4321 C  CB  . LYS B 1 14  ? -18.320 -2.062  -36.135 1.00 41.96 ? 14  LYS B CB  1 
ATOM   4322 C  CG  . LYS B 1 14  ? -19.686 -1.798  -36.745 1.00 48.76 ? 14  LYS B CG  1 
ATOM   4323 C  CD  . LYS B 1 14  ? -19.842 -2.586  -38.051 1.00 43.71 ? 14  LYS B CD  1 
ATOM   4324 C  CE  . LYS B 1 14  ? -21.024 -2.100  -38.854 1.00 48.83 ? 14  LYS B CE  1 
ATOM   4325 N  NZ  . LYS B 1 14  ? -20.618 -0.963  -39.726 1.00 58.50 ? 14  LYS B NZ  1 
ATOM   4326 N  N   . VAL B 1 15  ? -16.841 -3.412  -33.714 1.00 36.87 ? 15  VAL B N   1 
ATOM   4327 C  CA  . VAL B 1 15  ? -15.719 -4.003  -33.012 1.00 39.88 ? 15  VAL B CA  1 
ATOM   4328 C  C   . VAL B 1 15  ? -15.596 -5.478  -33.414 1.00 38.93 ? 15  VAL B C   1 
ATOM   4329 O  O   . VAL B 1 15  ? -16.596 -6.189  -33.486 1.00 40.51 ? 15  VAL B O   1 
ATOM   4330 C  CB  . VAL B 1 15  ? -15.907 -3.828  -31.462 1.00 42.08 ? 15  VAL B CB  1 
ATOM   4331 C  CG1 . VAL B 1 15  ? -15.987 -5.165  -30.734 1.00 38.17 ? 15  VAL B CG1 1 
ATOM   4332 C  CG2 . VAL B 1 15  ? -14.833 -2.946  -30.891 1.00 35.92 ? 15  VAL B CG2 1 
ATOM   4333 N  N   . MET B 1 16  ? -14.381 -5.934  -33.704 1.00 38.88 ? 16  MET B N   1 
ATOM   4334 C  CA  . MET B 1 16  ? -14.179 -7.330  -34.093 1.00 41.35 ? 16  MET B CA  1 
ATOM   4335 C  C   . MET B 1 16  ? -13.233 -8.043  -33.121 1.00 42.73 ? 16  MET B C   1 
ATOM   4336 O  O   . MET B 1 16  ? -12.080 -7.632  -32.929 1.00 40.70 ? 16  MET B O   1 
ATOM   4337 C  CB  . MET B 1 16  ? -13.651 -7.423  -35.534 1.00 40.37 ? 16  MET B CB  1 
ATOM   4338 C  CG  . MET B 1 16  ? -13.251 -8.833  -35.985 1.00 41.07 ? 16  MET B CG  1 
ATOM   4339 S  SD  . MET B 1 16  ? -14.627 -9.959  -36.351 1.00 63.34 ? 16  MET B SD  1 
ATOM   4340 C  CE  . MET B 1 16  ? -13.732 -11.288 -37.173 1.00 53.45 ? 16  MET B CE  1 
ATOM   4341 N  N   . GLY B 1 17  ? -13.737 -9.110  -32.507 1.00 42.10 ? 17  GLY B N   1 
ATOM   4342 C  CA  . GLY B 1 17  ? -12.992 -9.846  -31.504 1.00 39.89 ? 17  GLY B CA  1 
ATOM   4343 C  C   . GLY B 1 17  ? -12.178 -10.983 -32.091 1.00 45.69 ? 17  GLY B C   1 
ATOM   4344 O  O   . GLY B 1 17  ? -12.098 -11.150 -33.311 1.00 45.64 ? 17  GLY B O   1 
ATOM   4345 N  N   . THR B 1 18  ? -11.565 -11.767 -31.211 1.00 42.70 ? 18  THR B N   1 
ATOM   4346 C  CA  . THR B 1 18  ? -10.785 -12.926 -31.621 1.00 39.72 ? 18  THR B CA  1 
ATOM   4347 C  C   . THR B 1 18  ? -11.239 -14.156 -30.836 1.00 44.11 ? 18  THR B C   1 
ATOM   4348 O  O   . THR B 1 18  ? -11.709 -14.039 -29.699 1.00 39.68 ? 18  THR B O   1 
ATOM   4349 C  CB  . THR B 1 18  ? -9.270  -12.691 -31.404 1.00 42.39 ? 18  THR B CB  1 
ATOM   4350 O  OG1 . THR B 1 18  ? -8.527  -13.820 -31.879 1.00 43.28 ? 18  THR B OG1 1 
ATOM   4351 C  CG2 . THR B 1 18  ? -8.956  -12.470 -29.907 1.00 42.42 ? 18  THR B CG2 1 
ATOM   4352 N  N   . ARG B 1 19  ? -11.105 -15.328 -31.446 1.00 42.13 ? 19  ARG B N   1 
ATOM   4353 C  CA  . ARG B 1 19  ? -11.444 -16.583 -30.793 1.00 39.25 ? 19  ARG B CA  1 
ATOM   4354 C  C   . ARG B 1 19  ? -10.224 -17.182 -30.102 1.00 46.03 ? 19  ARG B C   1 
ATOM   4355 O  O   . ARG B 1 19  ? -9.286  -17.637 -30.772 1.00 42.76 ? 19  ARG B O   1 
ATOM   4356 C  CB  . ARG B 1 19  ? -12.005 -17.565 -31.809 1.00 44.84 ? 19  ARG B CB  1 
ATOM   4357 C  CG  . ARG B 1 19  ? -12.624 -18.796 -31.210 1.00 45.12 ? 19  ARG B CG  1 
ATOM   4358 C  CD  . ARG B 1 19  ? -13.614 -19.409 -32.180 1.00 48.21 ? 19  ARG B CD  1 
ATOM   4359 N  NE  . ARG B 1 19  ? -14.613 -20.184 -31.462 1.00 55.80 ? 19  ARG B NE  1 
ATOM   4360 C  CZ  . ARG B 1 19  ? -14.473 -21.468 -31.162 1.00 56.93 ? 19  ARG B CZ  1 
ATOM   4361 N  NH1 . ARG B 1 19  ? -15.428 -22.101 -30.482 1.00 52.19 ? 19  ARG B NH1 1 
ATOM   4362 N  NH2 . ARG B 1 19  ? -13.372 -22.108 -31.543 1.00 51.36 ? 19  ARG B NH2 1 
ATOM   4363 N  N   . VAL B 1 20  ? -10.234 -17.184 -28.764 1.00 42.71 ? 20  VAL B N   1 
ATOM   4364 C  CA  . VAL B 1 20  ? -9.088  -17.675 -28.003 1.00 43.90 ? 20  VAL B CA  1 
ATOM   4365 C  C   . VAL B 1 20  ? -9.379  -19.018 -27.349 1.00 42.61 ? 20  VAL B C   1 
ATOM   4366 O  O   . VAL B 1 20  ? -10.478 -19.252 -26.847 1.00 44.43 ? 20  VAL B O   1 
ATOM   4367 C  CB  . VAL B 1 20  ? -8.647  -16.673 -26.911 1.00 44.72 ? 20  VAL B CB  1 
ATOM   4368 C  CG1 . VAL B 1 20  ? -8.358  -15.314 -27.527 1.00 43.15 ? 20  VAL B CG1 1 
ATOM   4369 C  CG2 . VAL B 1 20  ? -9.708  -16.552 -25.836 1.00 42.80 ? 20  VAL B CG2 1 
ATOM   4370 N  N   . PRO B 1 21  ? -8.386  -19.913 -27.359 1.00 39.02 ? 21  PRO B N   1 
ATOM   4371 C  CA  . PRO B 1 21  ? -8.548  -21.195 -26.684 1.00 42.70 ? 21  PRO B CA  1 
ATOM   4372 C  C   . PRO B 1 21  ? -8.497  -21.010 -25.170 1.00 45.04 ? 21  PRO B C   1 
ATOM   4373 O  O   . PRO B 1 21  ? -7.806  -20.121 -24.659 1.00 45.94 ? 21  PRO B O   1 
ATOM   4374 C  CB  . PRO B 1 21  ? -7.347  -22.000 -27.173 1.00 38.66 ? 21  PRO B CB  1 
ATOM   4375 C  CG  . PRO B 1 21  ? -6.299  -20.967 -27.362 1.00 39.95 ? 21  PRO B CG  1 
ATOM   4376 C  CD  . PRO B 1 21  ? -7.023  -19.744 -27.888 1.00 38.27 ? 21  PRO B CD  1 
ATOM   4377 N  N   . VAL B 1 22  ? -9.224  -21.856 -24.460 1.00 42.15 ? 22  VAL B N   1 
ATOM   4378 C  CA  . VAL B 1 22  ? -9.171  -21.860 -23.015 1.00 40.71 ? 22  VAL B CA  1 
ATOM   4379 C  C   . VAL B 1 22  ? -9.455  -23.265 -22.549 1.00 47.05 ? 22  VAL B C   1 
ATOM   4380 O  O   . VAL B 1 22  ? -10.565 -23.764 -22.753 1.00 49.43 ? 22  VAL B O   1 
ATOM   4381 C  CB  . VAL B 1 22  ? -10.188 -20.888 -22.399 1.00 42.52 ? 22  VAL B CB  1 
ATOM   4382 C  CG1 . VAL B 1 22  ? -11.529 -21.001 -23.117 1.00 39.78 ? 22  VAL B CG1 1 
ATOM   4383 C  CG2 . VAL B 1 22  ? -10.330 -21.141 -20.882 1.00 41.77 ? 22  VAL B CG2 1 
ATOM   4384 N  N   . LEU B 1 23  ? -8.453  -23.908 -21.951 1.00 45.49 ? 23  LEU B N   1 
ATOM   4385 C  CA  . LEU B 1 23  ? -8.655  -25.201 -21.300 1.00 48.28 ? 23  LEU B CA  1 
ATOM   4386 C  C   . LEU B 1 23  ? -9.412  -26.207 -22.175 1.00 52.13 ? 23  LEU B C   1 
ATOM   4387 O  O   . LEU B 1 23  ? -10.470 -26.710 -21.774 1.00 50.45 ? 23  LEU B O   1 
ATOM   4388 C  CB  . LEU B 1 23  ? -9.420  -25.014 -19.983 1.00 44.66 ? 23  LEU B CB  1 
ATOM   4389 C  CG  . LEU B 1 23  ? -8.856  -24.107 -18.888 1.00 42.24 ? 23  LEU B CG  1 
ATOM   4390 C  CD1 . LEU B 1 23  ? -9.868  -23.968 -17.750 1.00 36.79 ? 23  LEU B CD1 1 
ATOM   4391 C  CD2 . LEU B 1 23  ? -7.544  -24.662 -18.372 1.00 46.41 ? 23  LEU B CD2 1 
ATOM   4392 N  N   . SER B 1 24  ? -8.895  -26.480 -23.370 1.00 49.63 ? 24  SER B N   1 
ATOM   4393 C  CA  . SER B 1 24  ? -9.527  -27.461 -24.256 1.00 54.76 ? 24  SER B CA  1 
ATOM   4394 C  C   . SER B 1 24  ? -10.924 -27.047 -24.720 1.00 53.49 ? 24  SER B C   1 
ATOM   4395 O  O   . SER B 1 24  ? -11.739 -27.892 -25.091 1.00 62.68 ? 24  SER B O   1 
ATOM   4396 C  CB  . SER B 1 24  ? -9.600  -28.828 -23.570 1.00 59.38 ? 24  SER B CB  1 
ATOM   4397 O  OG  . SER B 1 24  ? -8.310  -29.411 -23.487 1.00 66.34 ? 24  SER B OG  1 
ATOM   4398 N  N   . SER B 1 25  ? -11.196 -25.749 -24.688 1.00 52.34 ? 25  SER B N   1 
ATOM   4399 C  CA  . SER B 1 25  ? -12.402 -25.190 -25.294 1.00 48.39 ? 25  SER B CA  1 
ATOM   4400 C  C   . SER B 1 25  ? -12.049 -23.817 -25.843 1.00 47.25 ? 25  SER B C   1 
ATOM   4401 O  O   . SER B 1 25  ? -10.873 -23.505 -26.002 1.00 46.85 ? 25  SER B O   1 
ATOM   4402 C  CB  . SER B 1 25  ? -13.543 -25.103 -24.285 1.00 47.27 ? 25  SER B CB  1 
ATOM   4403 O  OG  . SER B 1 25  ? -14.698 -24.521 -24.864 1.00 49.49 ? 25  SER B OG  1 
ATOM   4404 N  N   . HIS B 1 26  ? -13.049 -22.989 -26.119 1.00 44.47 ? 26  HIS B N   1 
ATOM   4405 C  CA  . HIS B 1 26  ? -12.774 -21.656 -26.650 1.00 45.96 ? 26  HIS B CA  1 
ATOM   4406 C  C   . HIS B 1 26  ? -13.764 -20.637 -26.117 1.00 43.23 ? 26  HIS B C   1 
ATOM   4407 O  O   . HIS B 1 26  ? -14.851 -21.002 -25.681 1.00 43.08 ? 26  HIS B O   1 
ATOM   4408 C  CB  . HIS B 1 26  ? -12.809 -21.668 -28.186 1.00 49.04 ? 26  HIS B CB  1 
ATOM   4409 C  CG  . HIS B 1 26  ? -11.828 -22.622 -28.800 1.00 53.73 ? 26  HIS B CG  1 
ATOM   4410 N  ND1 . HIS B 1 26  ? -12.151 -23.928 -29.109 1.00 53.95 ? 26  HIS B ND1 1 
ATOM   4411 C  CD2 . HIS B 1 26  ? -10.523 -22.468 -29.135 1.00 50.19 ? 26  HIS B CD2 1 
ATOM   4412 C  CE1 . HIS B 1 26  ? -11.089 -24.534 -29.612 1.00 56.06 ? 26  HIS B CE1 1 
ATOM   4413 N  NE2 . HIS B 1 26  ? -10.089 -23.669 -29.642 1.00 53.55 ? 26  HIS B NE2 1 
ATOM   4414 N  N   . ILE B 1 27  ? -13.377 -19.363 -26.139 1.00 41.33 ? 27  ILE B N   1 
ATOM   4415 C  CA  . ILE B 1 27  ? -14.316 -18.273 -25.885 1.00 42.18 ? 27  ILE B CA  1 
ATOM   4416 C  C   . ILE B 1 27  ? -13.926 -17.020 -26.664 1.00 39.00 ? 27  ILE B C   1 
ATOM   4417 O  O   . ILE B 1 27  ? -12.849 -16.954 -27.246 1.00 40.18 ? 27  ILE B O   1 
ATOM   4418 C  CB  . ILE B 1 27  ? -14.425 -17.913 -24.380 1.00 41.05 ? 27  ILE B CB  1 
ATOM   4419 C  CG1 . ILE B 1 27  ? -13.135 -17.296 -23.843 1.00 41.68 ? 27  ILE B CG1 1 
ATOM   4420 C  CG2 . ILE B 1 27  ? -14.841 -19.125 -23.548 1.00 47.83 ? 27  ILE B CG2 1 
ATOM   4421 C  CD1 . ILE B 1 27  ? -13.324 -16.787 -22.381 1.00 46.96 ? 27  ILE B CD1 1 
ATOM   4422 N  N   . SER B 1 28  ? -14.815 -16.032 -26.673 1.00 37.75 ? 28  SER B N   1 
ATOM   4423 C  CA  . SER B 1 28  ? -14.586 -14.791 -27.407 1.00 38.24 ? 28  SER B CA  1 
ATOM   4424 C  C   . SER B 1 28  ? -13.835 -13.768 -26.563 1.00 41.51 ? 28  SER B C   1 
ATOM   4425 O  O   . SER B 1 28  ? -14.160 -13.536 -25.395 1.00 39.70 ? 28  SER B O   1 
ATOM   4426 C  CB  . SER B 1 28  ? -15.914 -14.184 -27.875 1.00 41.72 ? 28  SER B CB  1 
ATOM   4427 O  OG  . SER B 1 28  ? -16.745 -15.154 -28.494 1.00 42.57 ? 28  SER B OG  1 
ATOM   4428 N  N   . ALA B 1 29  ? -12.832 -13.146 -27.170 1.00 40.73 ? 29  ALA B N   1 
ATOM   4429 C  CA  . ALA B 1 29  ? -12.099 -12.079 -26.528 1.00 38.11 ? 29  ALA B CA  1 
ATOM   4430 C  C   . ALA B 1 29  ? -12.207 -10.797 -27.344 1.00 41.48 ? 29  ALA B C   1 
ATOM   4431 O  O   . ALA B 1 29  ? -11.982 -10.802 -28.548 1.00 42.54 ? 29  ALA B O   1 
ATOM   4432 C  CB  . ALA B 1 29  ? -10.645 -12.476 -26.342 1.00 38.34 ? 29  ALA B CB  1 
ATOM   4433 N  N   . PHE B 1 30  ? -12.554 -9.697  -26.689 1.00 40.74 ? 30  PHE B N   1 
ATOM   4434 C  CA  . PHE B 1 30  ? -12.458 -8.389  -27.320 1.00 38.20 ? 30  PHE B CA  1 
ATOM   4435 C  C   . PHE B 1 30  ? -11.417 -7.554  -26.563 1.00 40.77 ? 30  PHE B C   1 
ATOM   4436 O  O   . PHE B 1 30  ? -11.677 -7.058  -25.459 1.00 36.78 ? 30  PHE B O   1 
ATOM   4437 C  CB  . PHE B 1 30  ? -13.823 -7.707  -27.348 1.00 38.82 ? 30  PHE B CB  1 
ATOM   4438 C  CG  . PHE B 1 30  ? -14.902 -8.557  -27.958 1.00 39.88 ? 30  PHE B CG  1 
ATOM   4439 C  CD1 . PHE B 1 30  ? -15.563 -9.514  -27.195 1.00 36.43 ? 30  PHE B CD1 1 
ATOM   4440 C  CD2 . PHE B 1 30  ? -15.248 -8.410  -29.297 1.00 34.06 ? 30  PHE B CD2 1 
ATOM   4441 C  CE1 . PHE B 1 30  ? -16.556 -10.308 -27.747 1.00 38.33 ? 30  PHE B CE1 1 
ATOM   4442 C  CE2 . PHE B 1 30  ? -16.235 -9.207  -29.868 1.00 34.68 ? 30  PHE B CE2 1 
ATOM   4443 C  CZ  . PHE B 1 30  ? -16.896 -10.153 -29.098 1.00 40.43 ? 30  PHE B CZ  1 
ATOM   4444 N  N   . LEU B 1 31  ? -10.239 -7.407  -27.167 1.00 34.86 ? 31  LEU B N   1 
ATOM   4445 C  CA  . LEU B 1 31  ? -9.089  -6.826  -26.491 1.00 37.12 ? 31  LEU B CA  1 
ATOM   4446 C  C   . LEU B 1 31  ? -8.785  -5.407  -26.954 1.00 37.25 ? 31  LEU B C   1 
ATOM   4447 O  O   . LEU B 1 31  ? -8.745  -5.125  -28.136 1.00 40.60 ? 31  LEU B O   1 
ATOM   4448 C  CB  . LEU B 1 31  ? -7.863  -7.723  -26.697 1.00 35.51 ? 31  LEU B CB  1 
ATOM   4449 C  CG  . LEU B 1 31  ? -8.093  -9.199  -26.323 1.00 39.26 ? 31  LEU B CG  1 
ATOM   4450 C  CD1 . LEU B 1 31  ? -6.877  -10.062 -26.649 1.00 37.37 ? 31  LEU B CD1 1 
ATOM   4451 C  CD2 . LEU B 1 31  ? -8.504  -9.369  -24.845 1.00 34.51 ? 31  LEU B CD2 1 
ATOM   4452 N  N   . GLY B 1 32  ? -8.583  -4.505  -26.003 1.00 39.81 ? 32  GLY B N   1 
ATOM   4453 C  CA  . GLY B 1 32  ? -8.107  -3.174  -26.324 1.00 37.53 ? 32  GLY B CA  1 
ATOM   4454 C  C   . GLY B 1 32  ? -9.146  -2.312  -27.002 1.00 37.85 ? 32  GLY B C   1 
ATOM   4455 O  O   . GLY B 1 32  ? -8.846  -1.615  -27.962 1.00 35.83 ? 32  GLY B O   1 
ATOM   4456 N  N   . ILE B 1 33  ? -10.372 -2.355  -26.490 1.00 36.64 ? 33  ILE B N   1 
ATOM   4457 C  CA  . ILE B 1 33  ? -11.426 -1.455  -26.940 1.00 34.11 ? 33  ILE B CA  1 
ATOM   4458 C  C   . ILE B 1 33  ? -11.261 -0.093  -26.288 1.00 33.74 ? 33  ILE B C   1 
ATOM   4459 O  O   . ILE B 1 33  ? -11.096 -0.008  -25.076 1.00 38.91 ? 33  ILE B O   1 
ATOM   4460 C  CB  . ILE B 1 33  ? -12.806 -2.017  -26.609 1.00 34.65 ? 33  ILE B CB  1 
ATOM   4461 C  CG1 . ILE B 1 33  ? -13.007 -3.356  -27.320 1.00 37.38 ? 33  ILE B CG1 1 
ATOM   4462 C  CG2 . ILE B 1 33  ? -13.901 -1.023  -26.982 1.00 33.95 ? 33  ILE B CG2 1 
ATOM   4463 C  CD1 . ILE B 1 33  ? -14.275 -4.050  -26.929 1.00 36.78 ? 33  ILE B CD1 1 
ATOM   4464 N  N   . PRO B 1 34  ? -11.302 0.980   -27.084 1.00 35.40 ? 34  PRO B N   1 
ATOM   4465 C  CA  . PRO B 1 34  ? -11.138 2.321   -26.512 1.00 32.02 ? 34  PRO B CA  1 
ATOM   4466 C  C   . PRO B 1 34  ? -12.415 2.832   -25.856 1.00 36.99 ? 34  PRO B C   1 
ATOM   4467 O  O   . PRO B 1 34  ? -13.468 2.696   -26.467 1.00 38.33 ? 34  PRO B O   1 
ATOM   4468 C  CB  . PRO B 1 34  ? -10.779 3.177   -27.719 1.00 37.46 ? 34  PRO B CB  1 
ATOM   4469 C  CG  . PRO B 1 34  ? -11.400 2.447   -28.902 1.00 38.27 ? 34  PRO B CG  1 
ATOM   4470 C  CD  . PRO B 1 34  ? -11.349 0.989   -28.563 1.00 38.26 ? 34  PRO B CD  1 
ATOM   4471 N  N   . PHE B 1 35  ? -12.328 3.401   -24.651 1.00 34.59 ? 35  PHE B N   1 
ATOM   4472 C  CA  . PHE B 1 35  ? -13.505 3.987   -24.014 1.00 32.55 ? 35  PHE B CA  1 
ATOM   4473 C  C   . PHE B 1 35  ? -13.360 5.490   -23.778 1.00 32.39 ? 35  PHE B C   1 
ATOM   4474 O  O   . PHE B 1 35  ? -14.285 6.141   -23.334 1.00 33.79 ? 35  PHE B O   1 
ATOM   4475 C  CB  . PHE B 1 35  ? -13.826 3.274   -22.694 1.00 32.69 ? 35  PHE B CB  1 
ATOM   4476 C  CG  . PHE B 1 35  ? -12.739 3.381   -21.642 1.00 32.90 ? 35  PHE B CG  1 
ATOM   4477 C  CD1 . PHE B 1 35  ? -12.626 4.509   -20.849 1.00 31.29 ? 35  PHE B CD1 1 
ATOM   4478 C  CD2 . PHE B 1 35  ? -11.855 2.335   -21.434 1.00 30.93 ? 35  PHE B CD2 1 
ATOM   4479 C  CE1 . PHE B 1 35  ? -11.626 4.595   -19.859 1.00 37.19 ? 35  PHE B CE1 1 
ATOM   4480 C  CE2 . PHE B 1 35  ? -10.868 2.416   -20.451 1.00 33.16 ? 35  PHE B CE2 1 
ATOM   4481 C  CZ  . PHE B 1 35  ? -10.751 3.548   -19.664 1.00 30.07 ? 35  PHE B CZ  1 
ATOM   4482 N  N   . ALA B 1 36  ? -12.205 6.048   -24.106 1.00 34.84 ? 36  ALA B N   1 
ATOM   4483 C  CA  . ALA B 1 36  ? -12.001 7.487   -23.972 1.00 36.01 ? 36  ALA B CA  1 
ATOM   4484 C  C   . ALA B 1 36  ? -11.129 8.013   -25.097 1.00 37.19 ? 36  ALA B C   1 
ATOM   4485 O  O   . ALA B 1 36  ? -10.479 7.241   -25.802 1.00 38.34 ? 36  ALA B O   1 
ATOM   4486 C  CB  . ALA B 1 36  ? -11.364 7.816   -22.631 1.00 34.78 ? 36  ALA B CB  1 
ATOM   4487 N  N   . GLU B 1 37  ? -11.113 9.332   -25.258 1.00 38.97 ? 37  GLU B N   1 
ATOM   4488 C  CA  . GLU B 1 37  ? -10.144 9.981   -26.135 1.00 40.93 ? 37  GLU B CA  1 
ATOM   4489 C  C   . GLU B 1 37  ? -8.759  9.837   -25.519 1.00 40.87 ? 37  GLU B C   1 
ATOM   4490 O  O   . GLU B 1 37  ? -8.610  9.913   -24.303 1.00 43.90 ? 37  GLU B O   1 
ATOM   4491 C  CB  . GLU B 1 37  ? -10.486 11.460  -26.339 1.00 40.45 ? 37  GLU B CB  1 
ATOM   4492 C  CG  . GLU B 1 37  ? -11.747 11.683  -27.161 1.00 41.81 ? 37  GLU B CG  1 
ATOM   4493 C  CD  . GLU B 1 37  ? -11.576 11.223  -28.592 1.00 41.90 ? 37  GLU B CD  1 
ATOM   4494 O  OE1 . GLU B 1 37  ? -10.830 11.887  -29.338 1.00 43.67 ? 37  GLU B OE1 1 
ATOM   4495 O  OE2 . GLU B 1 37  ? -12.155 10.181  -28.967 1.00 43.76 ? 37  GLU B OE2 1 
ATOM   4496 N  N   . PRO B 1 38  ? -7.743  9.616   -26.352 1.00 44.96 ? 38  PRO B N   1 
ATOM   4497 C  CA  . PRO B 1 38  ? -6.380  9.598   -25.817 1.00 40.08 ? 38  PRO B CA  1 
ATOM   4498 C  C   . PRO B 1 38  ? -6.093  10.836  -24.965 1.00 41.80 ? 38  PRO B C   1 
ATOM   4499 O  O   . PRO B 1 38  ? -6.165  11.956  -25.463 1.00 43.82 ? 38  PRO B O   1 
ATOM   4500 C  CB  . PRO B 1 38  ? -5.519  9.568   -27.078 1.00 41.02 ? 38  PRO B CB  1 
ATOM   4501 C  CG  . PRO B 1 38  ? -6.367  8.822   -28.071 1.00 40.35 ? 38  PRO B CG  1 
ATOM   4502 C  CD  . PRO B 1 38  ? -7.790  9.266   -27.785 1.00 41.98 ? 38  PRO B CD  1 
ATOM   4503 N  N   . PRO B 1 39  ? -5.804  10.639  -23.670 1.00 40.53 ? 39  PRO B N   1 
ATOM   4504 C  CA  . PRO B 1 39  ? -5.529  11.772  -22.777 1.00 39.35 ? 39  PRO B CA  1 
ATOM   4505 C  C   . PRO B 1 39  ? -4.149  12.371  -23.045 1.00 47.11 ? 39  PRO B C   1 
ATOM   4506 O  O   . PRO B 1 39  ? -3.341  12.520  -22.116 1.00 44.46 ? 39  PRO B O   1 
ATOM   4507 C  CB  . PRO B 1 39  ? -5.611  11.151  -21.379 1.00 39.27 ? 39  PRO B CB  1 
ATOM   4508 C  CG  . PRO B 1 39  ? -5.264  9.704   -21.589 1.00 42.65 ? 39  PRO B CG  1 
ATOM   4509 C  CD  . PRO B 1 39  ? -5.805  9.349   -22.965 1.00 40.63 ? 39  PRO B CD  1 
ATOM   4510 N  N   . VAL B 1 40  ? -3.901  12.717  -24.312 1.00 46.04 ? 40  VAL B N   1 
ATOM   4511 C  CA  . VAL B 1 40  ? -2.602  13.209  -24.763 1.00 47.44 ? 40  VAL B CA  1 
ATOM   4512 C  C   . VAL B 1 40  ? -2.587  14.716  -25.043 1.00 50.09 ? 40  VAL B C   1 
ATOM   4513 O  O   . VAL B 1 40  ? -3.630  15.370  -25.077 1.00 50.63 ? 40  VAL B O   1 
ATOM   4514 C  CB  . VAL B 1 40  ? -2.147  12.462  -26.030 1.00 43.22 ? 40  VAL B CB  1 
ATOM   4515 C  CG1 . VAL B 1 40  ? -1.891  11.001  -25.717 1.00 37.97 ? 40  VAL B CG1 1 
ATOM   4516 C  CG2 . VAL B 1 40  ? -3.206  12.590  -27.142 1.00 44.31 ? 40  VAL B CG2 1 
ATOM   4517 N  N   . GLY B 1 41  ? -1.387  15.258  -25.228 1.00 49.46 ? 41  GLY B N   1 
ATOM   4518 C  CA  . GLY B 1 41  ? -1.208  16.672  -25.504 1.00 47.99 ? 41  GLY B CA  1 
ATOM   4519 C  C   . GLY B 1 41  ? -1.733  17.596  -24.421 1.00 51.52 ? 41  GLY B C   1 
ATOM   4520 O  O   . GLY B 1 41  ? -1.319  17.529  -23.257 1.00 48.66 ? 41  GLY B O   1 
ATOM   4521 N  N   . ASN B 1 42  ? -2.648  18.475  -24.813 1.00 50.10 ? 42  ASN B N   1 
ATOM   4522 C  CA  . ASN B 1 42  ? -3.219  19.444  -23.888 1.00 50.77 ? 42  ASN B CA  1 
ATOM   4523 C  C   . ASN B 1 42  ? -4.286  18.817  -23.003 1.00 48.93 ? 42  ASN B C   1 
ATOM   4524 O  O   . ASN B 1 42  ? -4.944  19.511  -22.237 1.00 47.63 ? 42  ASN B O   1 
ATOM   4525 C  CB  . ASN B 1 42  ? -3.802  20.637  -24.655 1.00 52.95 ? 42  ASN B CB  1 
ATOM   4526 C  CG  . ASN B 1 42  ? -4.982  20.252  -25.542 1.00 60.10 ? 42  ASN B CG  1 
ATOM   4527 O  OD1 . ASN B 1 42  ? -5.146  19.089  -25.919 1.00 60.43 ? 42  ASN B OD1 1 
ATOM   4528 N  ND2 . ASN B 1 42  ? -5.805  21.236  -25.886 1.00 62.88 ? 42  ASN B ND2 1 
ATOM   4529 N  N   . MET B 1 43  ? -4.461  17.504  -23.113 1.00 48.13 ? 43  MET B N   1 
ATOM   4530 C  CA  . MET B 1 43  ? -5.405  16.799  -22.251 1.00 49.61 ? 43  MET B CA  1 
ATOM   4531 C  C   . MET B 1 43  ? -4.711  15.940  -21.190 1.00 50.38 ? 43  MET B C   1 
ATOM   4532 O  O   . MET B 1 43  ? -5.357  15.155  -20.497 1.00 50.17 ? 43  MET B O   1 
ATOM   4533 C  CB  . MET B 1 43  ? -6.342  15.927  -23.076 1.00 51.31 ? 43  MET B CB  1 
ATOM   4534 C  CG  . MET B 1 43  ? -7.370  16.702  -23.882 1.00 54.98 ? 43  MET B CG  1 
ATOM   4535 S  SD  . MET B 1 43  ? -8.456  15.584  -24.768 1.00 61.10 ? 43  MET B SD  1 
ATOM   4536 C  CE  . MET B 1 43  ? -9.252  16.743  -25.885 1.00 68.81 ? 43  MET B CE  1 
ATOM   4537 N  N   . ARG B 1 44  ? -3.398  16.083  -21.061 1.00 49.22 ? 44  ARG B N   1 
ATOM   4538 C  CA  . ARG B 1 44  ? -2.714  15.445  -19.956 1.00 46.77 ? 44  ARG B CA  1 
ATOM   4539 C  C   . ARG B 1 44  ? -3.180  16.109  -18.662 1.00 46.85 ? 44  ARG B C   1 
ATOM   4540 O  O   . ARG B 1 44  ? -3.265  17.336  -18.589 1.00 47.10 ? 44  ARG B O   1 
ATOM   4541 C  CB  . ARG B 1 44  ? -1.200  15.544  -20.104 1.00 48.58 ? 44  ARG B CB  1 
ATOM   4542 C  CG  . ARG B 1 44  ? -0.445  15.103  -18.853 1.00 43.08 ? 44  ARG B CG  1 
ATOM   4543 C  CD  . ARG B 1 44  ? 1.028   15.395  -18.998 1.00 49.13 ? 44  ARG B CD  1 
ATOM   4544 N  NE  . ARG B 1 44  ? 1.645   14.614  -20.065 1.00 44.16 ? 44  ARG B NE  1 
ATOM   4545 C  CZ  . ARG B 1 44  ? 2.903   14.770  -20.467 1.00 46.98 ? 44  ARG B CZ  1 
ATOM   4546 N  NH1 . ARG B 1 44  ? 3.677   15.690  -19.895 1.00 44.31 ? 44  ARG B NH1 1 
ATOM   4547 N  NH2 . ARG B 1 44  ? 3.385   14.011  -21.441 1.00 41.54 ? 44  ARG B NH2 1 
ATOM   4548 N  N   . PHE B 1 45  ? -3.502  15.286  -17.664 1.00 43.08 ? 45  PHE B N   1 
ATOM   4549 C  CA  . PHE B 1 45  ? -3.989  15.743  -16.354 1.00 41.47 ? 45  PHE B CA  1 
ATOM   4550 C  C   . PHE B 1 45  ? -5.474  16.111  -16.376 1.00 44.88 ? 45  PHE B C   1 
ATOM   4551 O  O   . PHE B 1 45  ? -6.073  16.333  -15.330 1.00 47.90 ? 45  PHE B O   1 
ATOM   4552 C  CB  . PHE B 1 45  ? -3.176  16.942  -15.852 1.00 43.78 ? 45  PHE B CB  1 
ATOM   4553 C  CG  . PHE B 1 45  ? -1.674  16.708  -15.825 1.00 47.59 ? 45  PHE B CG  1 
ATOM   4554 C  CD1 . PHE B 1 45  ? -1.140  15.541  -15.296 1.00 44.63 ? 45  PHE B CD1 1 
ATOM   4555 C  CD2 . PHE B 1 45  ? -0.800  17.667  -16.324 1.00 45.38 ? 45  PHE B CD2 1 
ATOM   4556 C  CE1 . PHE B 1 45  ? 0.241   15.337  -15.263 1.00 44.22 ? 45  PHE B CE1 1 
ATOM   4557 C  CE2 . PHE B 1 45  ? 0.572   17.468  -16.299 1.00 47.65 ? 45  PHE B CE2 1 
ATOM   4558 C  CZ  . PHE B 1 45  ? 1.093   16.303  -15.768 1.00 45.29 ? 45  PHE B CZ  1 
ATOM   4559 N  N   . ARG B 1 46  ? -6.070  16.177  -17.561 1.00 44.84 ? 46  ARG B N   1 
ATOM   4560 C  CA  . ARG B 1 46  ? -7.471  16.577  -17.691 1.00 46.62 ? 46  ARG B CA  1 
ATOM   4561 C  C   . ARG B 1 46  ? -8.423  15.409  -17.476 1.00 44.61 ? 46  ARG B C   1 
ATOM   4562 O  O   . ARG B 1 46  ? -8.062  14.245  -17.684 1.00 39.95 ? 46  ARG B O   1 
ATOM   4563 C  CB  . ARG B 1 46  ? -7.738  17.192  -19.077 1.00 51.43 ? 46  ARG B CB  1 
ATOM   4564 C  CG  . ARG B 1 46  ? -7.700  18.721  -19.131 1.00 53.77 ? 46  ARG B CG  1 
ATOM   4565 C  CD  . ARG B 1 46  ? -8.148  19.263  -20.498 1.00 56.01 ? 46  ARG B CD  1 
ATOM   4566 N  NE  . ARG B 1 46  ? -7.401  20.471  -20.856 1.00 60.83 ? 46  ARG B NE  1 
ATOM   4567 C  CZ  . ARG B 1 46  ? -7.488  21.104  -22.024 1.00 60.55 ? 46  ARG B CZ  1 
ATOM   4568 N  NH1 . ARG B 1 46  ? -8.306  20.658  -22.971 1.00 60.92 ? 46  ARG B NH1 1 
ATOM   4569 N  NH2 . ARG B 1 46  ? -6.751  22.188  -22.245 1.00 61.44 ? 46  ARG B NH2 1 
ATOM   4570 N  N   . ARG B 1 47  ? -9.644  15.735  -17.072 1.00 42.92 ? 47  ARG B N   1 
ATOM   4571 C  CA  . ARG B 1 47  ? -10.719 14.752  -17.012 1.00 43.51 ? 47  ARG B CA  1 
ATOM   4572 C  C   . ARG B 1 47  ? -10.833 14.045  -18.345 1.00 43.91 ? 47  ARG B C   1 
ATOM   4573 O  O   . ARG B 1 47  ? -10.651 14.665  -19.383 1.00 44.06 ? 47  ARG B O   1 
ATOM   4574 C  CB  . ARG B 1 47  ? -12.042 15.417  -16.674 1.00 41.48 ? 47  ARG B CB  1 
ATOM   4575 C  CG  . ARG B 1 47  ? -12.081 16.068  -15.306 1.00 47.91 ? 47  ARG B CG  1 
ATOM   4576 C  CD  . ARG B 1 47  ? -13.507 16.460  -14.958 1.00 46.52 ? 47  ARG B CD  1 
ATOM   4577 N  NE  . ARG B 1 47  ? -13.590 17.067  -13.636 1.00 59.64 ? 47  ARG B NE  1 
ATOM   4578 C  CZ  . ARG B 1 47  ? -13.364 18.354  -13.396 1.00 59.93 ? 47  ARG B CZ  1 
ATOM   4579 N  NH1 . ARG B 1 47  ? -13.462 18.821  -12.156 1.00 59.34 ? 47  ARG B NH1 1 
ATOM   4580 N  NH2 . ARG B 1 47  ? -13.039 19.170  -14.394 1.00 50.51 ? 47  ARG B NH2 1 
ATOM   4581 N  N   . PRO B 1 48  ? -11.148 12.745  -18.324 1.00 43.60 ? 48  PRO B N   1 
ATOM   4582 C  CA  . PRO B 1 48  ? -11.243 12.032  -19.596 1.00 39.12 ? 48  PRO B CA  1 
ATOM   4583 C  C   . PRO B 1 48  ? -12.457 12.499  -20.385 1.00 44.80 ? 48  PRO B C   1 
ATOM   4584 O  O   . PRO B 1 48  ? -13.410 13.018  -19.804 1.00 44.14 ? 48  PRO B O   1 
ATOM   4585 C  CB  . PRO B 1 48  ? -11.392 10.576  -19.174 1.00 37.98 ? 48  PRO B CB  1 
ATOM   4586 C  CG  . PRO B 1 48  ? -12.119 10.667  -17.856 1.00 35.94 ? 48  PRO B CG  1 
ATOM   4587 C  CD  . PRO B 1 48  ? -11.545 11.902  -17.184 1.00 38.61 ? 48  PRO B CD  1 
ATOM   4588 N  N   . GLU B 1 49  ? -12.395 12.330  -21.701 1.00 45.39 ? 49  GLU B N   1 
ATOM   4589 C  CA  . GLU B 1 49  ? -13.515 12.609  -22.588 1.00 43.79 ? 49  GLU B CA  1 
ATOM   4590 C  C   . GLU B 1 49  ? -13.910 11.311  -23.287 1.00 40.80 ? 49  GLU B C   1 
ATOM   4591 O  O   . GLU B 1 49  ? -13.036 10.497  -23.608 1.00 38.12 ? 49  GLU B O   1 
ATOM   4592 C  CB  . GLU B 1 49  ? -13.140 13.689  -23.604 1.00 43.99 ? 49  GLU B CB  1 
ATOM   4593 C  CG  . GLU B 1 49  ? -14.275 14.625  -23.961 1.00 54.54 ? 49  GLU B CG  1 
ATOM   4594 C  CD  . GLU B 1 49  ? -14.557 15.658  -22.886 1.00 58.01 ? 49  GLU B CD  1 
ATOM   4595 O  OE1 . GLU B 1 49  ? -15.673 16.227  -22.895 1.00 67.37 ? 49  GLU B OE1 1 
ATOM   4596 O  OE2 . GLU B 1 49  ? -13.667 15.907  -22.043 1.00 55.34 ? 49  GLU B OE2 1 
ATOM   4597 N  N   . PRO B 1 50  ? -15.224 11.103  -23.510 1.00 44.84 ? 50  PRO B N   1 
ATOM   4598 C  CA  . PRO B 1 50  ? -15.727 9.884   -24.154 1.00 42.60 ? 50  PRO B CA  1 
ATOM   4599 C  C   . PRO B 1 50  ? -15.065 9.662   -25.510 1.00 41.12 ? 50  PRO B C   1 
ATOM   4600 O  O   . PRO B 1 50  ? -14.766 10.634  -26.192 1.00 43.00 ? 50  PRO B O   1 
ATOM   4601 C  CB  . PRO B 1 50  ? -17.219 10.157  -24.319 1.00 38.84 ? 50  PRO B CB  1 
ATOM   4602 C  CG  . PRO B 1 50  ? -17.534 11.182  -23.273 1.00 45.44 ? 50  PRO B CG  1 
ATOM   4603 C  CD  . PRO B 1 50  ? -16.310 12.046  -23.196 1.00 45.20 ? 50  PRO B CD  1 
ATOM   4604 N  N   . LYS B 1 51  ? -14.836 8.407   -25.876 1.00 36.77 ? 51  LYS B N   1 
ATOM   4605 C  CA  . LYS B 1 51  ? -14.213 8.087   -27.143 1.00 43.55 ? 51  LYS B CA  1 
ATOM   4606 C  C   . LYS B 1 51  ? -15.156 8.473   -28.279 1.00 44.99 ? 51  LYS B C   1 
ATOM   4607 O  O   . LYS B 1 51  ? -16.296 8.022   -28.303 1.00 44.91 ? 51  LYS B O   1 
ATOM   4608 C  CB  . LYS B 1 51  ? -13.872 6.599   -27.215 1.00 41.33 ? 51  LYS B CB  1 
ATOM   4609 C  CG  . LYS B 1 51  ? -13.477 6.140   -28.608 1.00 37.92 ? 51  LYS B CG  1 
ATOM   4610 C  CD  . LYS B 1 51  ? -12.169 6.787   -29.039 1.00 36.00 ? 51  LYS B CD  1 
ATOM   4611 C  CE  . LYS B 1 51  ? -11.637 6.151   -30.321 1.00 41.78 ? 51  LYS B CE  1 
ATOM   4612 N  NZ  . LYS B 1 51  ? -10.304 6.703   -30.698 1.00 41.33 ? 51  LYS B NZ  1 
ATOM   4613 N  N   . LYS B 1 52  ? -14.696 9.320   -29.202 1.00 44.55 ? 52  LYS B N   1 
ATOM   4614 C  CA  . LYS B 1 52  ? -15.523 9.682   -30.357 1.00 41.20 ? 52  LYS B CA  1 
ATOM   4615 C  C   . LYS B 1 52  ? -15.786 8.456   -31.201 1.00 42.54 ? 52  LYS B C   1 
ATOM   4616 O  O   . LYS B 1 52  ? -14.879 7.655   -31.443 1.00 43.25 ? 52  LYS B O   1 
ATOM   4617 C  CB  . LYS B 1 52  ? -14.860 10.761  -31.211 1.00 43.53 ? 52  LYS B CB  1 
ATOM   4618 C  CG  . LYS B 1 52  ? -14.995 12.169  -30.659 1.00 49.10 ? 52  LYS B CG  1 
ATOM   4619 C  CD  . LYS B 1 52  ? -13.880 13.048  -31.214 1.00 52.59 ? 52  LYS B CD  1 
ATOM   4620 C  CE  . LYS B 1 52  ? -13.786 14.376  -30.476 1.00 55.35 ? 52  LYS B CE  1 
ATOM   4621 N  NZ  . LYS B 1 52  ? -12.584 15.145  -30.907 1.00 57.12 ? 52  LYS B NZ  1 
ATOM   4622 N  N   . PRO B 1 53  ? -17.030 8.308   -31.659 1.00 41.16 ? 53  PRO B N   1 
ATOM   4623 C  CA  . PRO B 1 53  ? -17.433 7.187   -32.514 1.00 45.38 ? 53  PRO B CA  1 
ATOM   4624 C  C   . PRO B 1 53  ? -16.529 7.091   -33.738 1.00 44.90 ? 53  PRO B C   1 
ATOM   4625 O  O   . PRO B 1 53  ? -16.114 8.124   -34.257 1.00 44.53 ? 53  PRO B O   1 
ATOM   4626 C  CB  . PRO B 1 53  ? -18.866 7.541   -32.913 1.00 42.05 ? 53  PRO B CB  1 
ATOM   4627 C  CG  . PRO B 1 53  ? -19.335 8.478   -31.857 1.00 42.65 ? 53  PRO B CG  1 
ATOM   4628 C  CD  . PRO B 1 53  ? -18.124 9.268   -31.459 1.00 44.30 ? 53  PRO B CD  1 
ATOM   4629 N  N   . TRP B 1 54  ? -16.222 5.869   -34.166 1.00 45.47 ? 54  TRP B N   1 
ATOM   4630 C  CA  . TRP B 1 54  ? -15.317 5.631   -35.282 1.00 47.07 ? 54  TRP B CA  1 
ATOM   4631 C  C   . TRP B 1 54  ? -16.031 4.920   -36.442 1.00 48.65 ? 54  TRP B C   1 
ATOM   4632 O  O   . TRP B 1 54  ? -17.079 4.280   -36.254 1.00 45.74 ? 54  TRP B O   1 
ATOM   4633 C  CB  . TRP B 1 54  ? -14.103 4.814   -34.813 1.00 43.09 ? 54  TRP B CB  1 
ATOM   4634 C  CG  . TRP B 1 54  ? -14.466 3.457   -34.283 1.00 42.53 ? 54  TRP B CG  1 
ATOM   4635 C  CD1 . TRP B 1 54  ? -14.629 2.311   -35.007 1.00 44.22 ? 54  TRP B CD1 1 
ATOM   4636 C  CD2 . TRP B 1 54  ? -14.723 3.111   -32.920 1.00 40.49 ? 54  TRP B CD2 1 
ATOM   4637 N  NE1 . TRP B 1 54  ? -14.972 1.272   -34.179 1.00 41.73 ? 54  TRP B NE1 1 
ATOM   4638 C  CE2 . TRP B 1 54  ? -15.032 1.735   -32.891 1.00 41.50 ? 54  TRP B CE2 1 
ATOM   4639 C  CE3 . TRP B 1 54  ? -14.715 3.828   -31.717 1.00 43.33 ? 54  TRP B CE3 1 
ATOM   4640 C  CZ2 . TRP B 1 54  ? -15.341 1.060   -31.703 1.00 41.53 ? 54  TRP B CZ2 1 
ATOM   4641 C  CZ3 . TRP B 1 54  ? -15.019 3.155   -30.534 1.00 40.63 ? 54  TRP B CZ3 1 
ATOM   4642 C  CH2 . TRP B 1 54  ? -15.327 1.787   -30.539 1.00 40.43 ? 54  TRP B CH2 1 
ATOM   4643 N  N   . SER B 1 55  ? -15.466 5.040   -37.642 1.00 44.83 ? 55  SER B N   1 
ATOM   4644 C  CA  . SER B 1 55  ? -16.001 4.335   -38.803 1.00 47.44 ? 55  SER B CA  1 
ATOM   4645 C  C   . SER B 1 55  ? -15.359 2.962   -38.906 1.00 44.81 ? 55  SER B C   1 
ATOM   4646 O  O   . SER B 1 55  ? -14.310 2.732   -38.326 1.00 49.99 ? 55  SER B O   1 
ATOM   4647 C  CB  . SER B 1 55  ? -15.755 5.129   -40.090 1.00 50.16 ? 55  SER B CB  1 
ATOM   4648 O  OG  . SER B 1 55  ? -16.456 6.360   -40.081 1.00 54.64 ? 55  SER B OG  1 
ATOM   4649 N  N   . GLY B 1 56  ? -15.983 2.049   -39.641 1.00 42.60 ? 56  GLY B N   1 
ATOM   4650 C  CA  . GLY B 1 56  ? -15.383 0.746   -39.872 1.00 40.63 ? 56  GLY B CA  1 
ATOM   4651 C  C   . GLY B 1 56  ? -15.283 -0.125  -38.630 1.00 44.58 ? 56  GLY B C   1 
ATOM   4652 O  O   . GLY B 1 56  ? -16.005 0.073   -37.652 1.00 42.54 ? 56  GLY B O   1 
ATOM   4653 N  N   . VAL B 1 57  ? -14.376 -1.092  -38.674 1.00 45.69 ? 57  VAL B N   1 
ATOM   4654 C  CA  . VAL B 1 57  ? -14.281 -2.113  -37.645 1.00 43.01 ? 57  VAL B CA  1 
ATOM   4655 C  C   . VAL B 1 57  ? -12.966 -2.036  -36.841 1.00 45.37 ? 57  VAL B C   1 
ATOM   4656 O  O   . VAL B 1 57  ? -11.865 -2.095  -37.389 1.00 41.36 ? 57  VAL B O   1 
ATOM   4657 C  CB  . VAL B 1 57  ? -14.420 -3.513  -38.266 1.00 44.07 ? 57  VAL B CB  1 
ATOM   4658 C  CG1 . VAL B 1 57  ? -14.496 -4.566  -37.183 1.00 42.58 ? 57  VAL B CG1 1 
ATOM   4659 C  CG2 . VAL B 1 57  ? -15.643 -3.573  -39.170 1.00 47.68 ? 57  VAL B CG2 1 
ATOM   4660 N  N   . TRP B 1 58  ? -13.098 -1.892  -35.529 1.00 46.68 ? 58  TRP B N   1 
ATOM   4661 C  CA  . TRP B 1 58  ? -11.941 -1.894  -34.641 1.00 41.41 ? 58  TRP B CA  1 
ATOM   4662 C  C   . TRP B 1 58  ? -11.439 -3.334  -34.463 1.00 40.84 ? 58  TRP B C   1 
ATOM   4663 O  O   . TRP B 1 58  ? -12.205 -4.194  -34.027 1.00 43.60 ? 58  TRP B O   1 
ATOM   4664 C  CB  . TRP B 1 58  ? -12.320 -1.255  -33.293 1.00 43.37 ? 58  TRP B CB  1 
ATOM   4665 C  CG  . TRP B 1 58  ? -11.140 -0.867  -32.457 1.00 38.76 ? 58  TRP B CG  1 
ATOM   4666 C  CD1 . TRP B 1 58  ? -10.363 -1.699  -31.714 1.00 40.65 ? 58  TRP B CD1 1 
ATOM   4667 C  CD2 . TRP B 1 58  ? -10.593 0.447   -32.298 1.00 40.59 ? 58  TRP B CD2 1 
ATOM   4668 N  NE1 . TRP B 1 58  ? -9.358  -0.988  -31.099 1.00 44.78 ? 58  TRP B NE1 1 
ATOM   4669 C  CE2 . TRP B 1 58  ? -9.479  0.333   -31.441 1.00 42.00 ? 58  TRP B CE2 1 
ATOM   4670 C  CE3 . TRP B 1 58  ? -10.933 1.708   -32.797 1.00 44.91 ? 58  TRP B CE3 1 
ATOM   4671 C  CZ2 . TRP B 1 58  ? -8.706  1.431   -31.069 1.00 39.29 ? 58  TRP B CZ2 1 
ATOM   4672 C  CZ3 . TRP B 1 58  ? -10.163 2.801   -32.424 1.00 46.07 ? 58  TRP B CZ3 1 
ATOM   4673 C  CH2 . TRP B 1 58  ? -9.064  2.654   -31.565 1.00 42.06 ? 58  TRP B CH2 1 
ATOM   4674 N  N   . ASN B 1 59  ? -10.191 -3.613  -34.839 1.00 39.84 ? 59  ASN B N   1 
ATOM   4675 C  CA  . ASN B 1 59  ? -9.586  -4.920  -34.577 1.00 41.50 ? 59  ASN B CA  1 
ATOM   4676 C  C   . ASN B 1 59  ? -9.334  -4.985  -33.070 1.00 43.97 ? 59  ASN B C   1 
ATOM   4677 O  O   . ASN B 1 59  ? -8.433  -4.317  -32.564 1.00 42.75 ? 59  ASN B O   1 
ATOM   4678 C  CB  . ASN B 1 59  ? -8.264  -5.123  -35.364 1.00 42.12 ? 59  ASN B CB  1 
ATOM   4679 C  CG  . ASN B 1 59  ? -7.782  -6.606  -35.378 1.00 51.37 ? 59  ASN B CG  1 
ATOM   4680 O  OD1 . ASN B 1 59  ? -8.228  -7.395  -34.545 1.00 51.05 ? 59  ASN B OD1 1 
ATOM   4681 N  ND2 . ASN B 1 59  ? -6.868  -6.971  -36.326 1.00 51.19 ? 59  ASN B ND2 1 
ATOM   4682 N  N   . ALA B 1 60  ? -10.161 -5.735  -32.351 1.00 41.33 ? 60  ALA B N   1 
ATOM   4683 C  CA  . ALA B 1 60  ? -9.969  -5.911  -30.913 1.00 43.55 ? 60  ALA B CA  1 
ATOM   4684 C  C   . ALA B 1 60  ? -9.414  -7.298  -30.651 1.00 41.29 ? 60  ALA B C   1 
ATOM   4685 O  O   . ALA B 1 60  ? -9.919  -8.035  -29.809 1.00 38.04 ? 60  ALA B O   1 
ATOM   4686 C  CB  . ALA B 1 60  ? -11.274 -5.707  -30.158 1.00 35.10 ? 60  ALA B CB  1 
ATOM   4687 N  N   . SER B 1 61  ? -8.377  -7.659  -31.390 1.00 39.33 ? 61  SER B N   1 
ATOM   4688 C  CA  . SER B 1 61  ? -7.814  -8.992  -31.276 1.00 40.84 ? 61  SER B CA  1 
ATOM   4689 C  C   . SER B 1 61  ? -6.496  -8.994  -30.504 1.00 39.05 ? 61  SER B C   1 
ATOM   4690 O  O   . SER B 1 61  ? -5.976  -10.060 -30.174 1.00 39.40 ? 61  SER B O   1 
ATOM   4691 C  CB  . SER B 1 61  ? -7.600  -9.598  -32.662 1.00 45.40 ? 61  SER B CB  1 
ATOM   4692 O  OG  . SER B 1 61  ? -6.561  -8.918  -33.333 1.00 47.17 ? 61  SER B OG  1 
ATOM   4693 N  N   . THR B 1 62  ? -5.949  -7.814  -30.220 1.00 38.70 ? 62  THR B N   1 
ATOM   4694 C  CA  . THR B 1 62  ? -4.725  -7.741  -29.412 1.00 41.98 ? 62  THR B CA  1 
ATOM   4695 C  C   . THR B 1 62  ? -4.820  -6.750  -28.241 1.00 37.68 ? 62  THR B C   1 
ATOM   4696 O  O   . THR B 1 62  ? -5.527  -5.747  -28.321 1.00 34.69 ? 62  THR B O   1 
ATOM   4697 C  CB  . THR B 1 62  ? -3.499  -7.344  -30.265 1.00 43.17 ? 62  THR B CB  1 
ATOM   4698 O  OG1 . THR B 1 62  ? -3.477  -5.922  -30.442 1.00 46.31 ? 62  THR B OG1 1 
ATOM   4699 C  CG2 . THR B 1 62  ? -3.534  -8.026  -31.626 1.00 44.86 ? 62  THR B CG2 1 
ATOM   4700 N  N   . TYR B 1 63  ? -4.084  -7.031  -27.163 1.00 38.29 ? 63  TYR B N   1 
ATOM   4701 C  CA  . TYR B 1 63  ? -4.019  -6.138  -26.008 1.00 37.59 ? 63  TYR B CA  1 
ATOM   4702 C  C   . TYR B 1 63  ? -3.582  -4.725  -26.403 1.00 36.46 ? 63  TYR B C   1 
ATOM   4703 O  O   . TYR B 1 63  ? -2.805  -4.547  -27.333 1.00 40.04 ? 63  TYR B O   1 
ATOM   4704 C  CB  . TYR B 1 63  ? -3.050  -6.690  -24.953 1.00 36.54 ? 63  TYR B CB  1 
ATOM   4705 C  CG  . TYR B 1 63  ? -3.629  -7.716  -24.006 1.00 36.87 ? 63  TYR B CG  1 
ATOM   4706 C  CD1 . TYR B 1 63  ? -4.945  -7.624  -23.560 1.00 40.96 ? 63  TYR B CD1 1 
ATOM   4707 C  CD2 . TYR B 1 63  ? -2.851  -8.764  -23.529 1.00 40.24 ? 63  TYR B CD2 1 
ATOM   4708 C  CE1 . TYR B 1 63  ? -5.467  -8.556  -22.670 1.00 40.13 ? 63  TYR B CE1 1 
ATOM   4709 C  CE2 . TYR B 1 63  ? -3.361  -9.699  -22.638 1.00 38.84 ? 63  TYR B CE2 1 
ATOM   4710 C  CZ  . TYR B 1 63  ? -4.668  -9.587  -22.215 1.00 39.82 ? 63  TYR B CZ  1 
ATOM   4711 O  OH  . TYR B 1 63  ? -5.176  -10.513 -21.352 1.00 37.08 ? 63  TYR B OH  1 
ATOM   4712 N  N   . PRO B 1 64  ? -4.069  -3.715  -25.680 1.00 39.52 ? 64  PRO B N   1 
ATOM   4713 C  CA  . PRO B 1 64  ? -3.651  -2.326  -25.878 1.00 34.92 ? 64  PRO B CA  1 
ATOM   4714 C  C   . PRO B 1 64  ? -2.297  -2.049  -25.243 1.00 37.65 ? 64  PRO B C   1 
ATOM   4715 O  O   . PRO B 1 64  ? -1.717  -2.943  -24.641 1.00 37.90 ? 64  PRO B O   1 
ATOM   4716 C  CB  . PRO B 1 64  ? -4.737  -1.535  -25.153 1.00 34.94 ? 64  PRO B CB  1 
ATOM   4717 C  CG  . PRO B 1 64  ? -5.121  -2.447  -24.023 1.00 35.33 ? 64  PRO B CG  1 
ATOM   4718 C  CD  . PRO B 1 64  ? -5.096  -3.835  -24.628 1.00 36.55 ? 64  PRO B CD  1 
ATOM   4719 N  N   . ASN B 1 65  ? -1.826  -0.815  -25.376 1.00 35.89 ? 65  ASN B N   1 
ATOM   4720 C  CA  . ASN B 1 65  ? -0.657  -0.344  -24.664 1.00 36.15 ? 65  ASN B CA  1 
ATOM   4721 C  C   . ASN B 1 65  ? -0.970  -0.206  -23.186 1.00 36.31 ? 65  ASN B C   1 
ATOM   4722 O  O   . ASN B 1 65  ? -2.135  -0.025  -22.814 1.00 34.03 ? 65  ASN B O   1 
ATOM   4723 C  CB  . ASN B 1 65  ? -0.194  1.003   -25.206 1.00 36.97 ? 65  ASN B CB  1 
ATOM   4724 C  CG  . ASN B 1 65  ? 0.115   0.969   -26.693 1.00 40.81 ? 65  ASN B CG  1 
ATOM   4725 O  OD1 . ASN B 1 65  ? 0.943   0.175   -27.157 1.00 37.29 ? 65  ASN B OD1 1 
ATOM   4726 N  ND2 . ASN B 1 65  ? -0.546  1.840   -27.447 1.00 39.01 ? 65  ASN B ND2 1 
ATOM   4727 N  N   . ASN B 1 66  ? 0.068   -0.276  -22.352 1.00 32.39 ? 66  ASN B N   1 
ATOM   4728 C  CA  . ASN B 1 66  ? -0.076  0.013   -20.929 1.00 37.81 ? 66  ASN B CA  1 
ATOM   4729 C  C   . ASN B 1 66  ? 0.156   1.496   -20.687 1.00 38.85 ? 66  ASN B C   1 
ATOM   4730 O  O   . ASN B 1 66  ? 0.893   2.136   -21.440 1.00 36.38 ? 66  ASN B O   1 
ATOM   4731 C  CB  . ASN B 1 66  ? 0.903   -0.816  -20.094 1.00 35.05 ? 66  ASN B CB  1 
ATOM   4732 C  CG  . ASN B 1 66  ? 0.758   -2.296  -20.341 1.00 35.12 ? 66  ASN B CG  1 
ATOM   4733 O  OD1 . ASN B 1 66  ? 1.742   -3.026  -20.378 1.00 38.77 ? 66  ASN B OD1 1 
ATOM   4734 N  ND2 . ASN B 1 66  ? -0.479  -2.750  -20.518 1.00 34.85 ? 66  ASN B ND2 1 
ATOM   4735 N  N   . CYS B 1 67  ? -0.471  2.044   -19.648 1.00 35.06 ? 67  CYS B N   1 
ATOM   4736 C  CA  . CYS B 1 67  ? -0.296  3.454   -19.315 1.00 33.69 ? 67  CYS B CA  1 
ATOM   4737 C  C   . CYS B 1 67  ? 1.163   3.724   -18.928 1.00 35.41 ? 67  CYS B C   1 
ATOM   4738 O  O   . CYS B 1 67  ? 1.922   2.796   -18.638 1.00 35.06 ? 67  CYS B O   1 
ATOM   4739 C  CB  . CYS B 1 67  ? -1.257  3.867   -18.188 1.00 34.14 ? 67  CYS B CB  1 
ATOM   4740 S  SG  . CYS B 1 67  ? -2.989  3.953   -18.706 1.00 37.82 ? 67  CYS B SG  1 
ATOM   4741 N  N   . GLN B 1 68  ? 1.564   4.989   -18.961 1.00 35.13 ? 68  GLN B N   1 
ATOM   4742 C  CA  . GLN B 1 68  ? 2.926   5.359   -18.612 1.00 34.64 ? 68  GLN B CA  1 
ATOM   4743 C  C   . GLN B 1 68  ? 3.144   5.184   -17.105 1.00 35.96 ? 68  GLN B C   1 
ATOM   4744 O  O   . GLN B 1 68  ? 2.308   5.605   -16.299 1.00 35.29 ? 68  GLN B O   1 
ATOM   4745 C  CB  . GLN B 1 68  ? 3.213   6.799   -19.029 1.00 37.92 ? 68  GLN B CB  1 
ATOM   4746 C  CG  . GLN B 1 68  ? 3.286   7.024   -20.538 1.00 39.39 ? 68  GLN B CG  1 
ATOM   4747 C  CD  . GLN B 1 68  ? 4.602   6.563   -21.151 1.00 44.00 ? 68  GLN B CD  1 
ATOM   4748 O  OE1 . GLN B 1 68  ? 5.489   6.058   -20.463 1.00 41.05 ? 68  GLN B OE1 1 
ATOM   4749 N  NE2 . GLN B 1 68  ? 4.727   6.739   -22.460 1.00 47.06 ? 68  GLN B NE2 1 
ATOM   4750 N  N   . GLN B 1 69  ? 4.255   4.566   -16.719 1.00 33.43 ? 69  GLN B N   1 
ATOM   4751 C  CA  . GLN B 1 69  ? 4.460   4.285   -15.305 1.00 36.10 ? 69  GLN B CA  1 
ATOM   4752 C  C   . GLN B 1 69  ? 5.892   3.914   -14.961 1.00 37.02 ? 69  GLN B C   1 
ATOM   4753 O  O   . GLN B 1 69  ? 6.647   3.429   -15.801 1.00 33.29 ? 69  GLN B O   1 
ATOM   4754 C  CB  . GLN B 1 69  ? 3.531   3.151   -14.853 1.00 31.08 ? 69  GLN B CB  1 
ATOM   4755 C  CG  . GLN B 1 69  ? 3.862   1.822   -15.506 1.00 33.42 ? 69  GLN B CG  1 
ATOM   4756 C  CD  . GLN B 1 69  ? 2.731   0.824   -15.423 1.00 34.30 ? 69  GLN B CD  1 
ATOM   4757 O  OE1 . GLN B 1 69  ? 2.728   -0.058  -14.568 1.00 31.39 ? 69  GLN B OE1 1 
ATOM   4758 N  NE2 . GLN B 1 69  ? 1.764   0.944   -16.339 1.00 32.84 ? 69  GLN B NE2 1 
ATOM   4759 N  N   . TYR B 1 70  ? 6.244   4.140   -13.699 1.00 35.82 ? 70  TYR B N   1 
ATOM   4760 C  CA  . TYR B 1 70  ? 7.457   3.588   -13.133 1.00 37.41 ? 70  TYR B CA  1 
ATOM   4761 C  C   . TYR B 1 70  ? 7.519   2.103   -13.461 1.00 36.66 ? 70  TYR B C   1 
ATOM   4762 O  O   . TYR B 1 70  ? 6.505   1.410   -13.400 1.00 38.74 ? 70  TYR B O   1 
ATOM   4763 C  CB  . TYR B 1 70  ? 7.484   3.814   -11.615 1.00 39.16 ? 70  TYR B CB  1 
ATOM   4764 C  CG  . TYR B 1 70  ? 8.699   3.255   -10.907 1.00 40.54 ? 70  TYR B CG  1 
ATOM   4765 C  CD1 . TYR B 1 70  ? 9.844   4.026   -10.736 1.00 40.17 ? 70  TYR B CD1 1 
ATOM   4766 C  CD2 . TYR B 1 70  ? 8.696   1.960   -10.398 1.00 40.50 ? 70  TYR B CD2 1 
ATOM   4767 C  CE1 . TYR B 1 70  ? 10.955  3.521   -10.076 1.00 45.12 ? 70  TYR B CE1 1 
ATOM   4768 C  CE2 . TYR B 1 70  ? 9.800   1.446   -9.746  1.00 39.77 ? 70  TYR B CE2 1 
ATOM   4769 C  CZ  . TYR B 1 70  ? 10.925  2.230   -9.584  1.00 43.18 ? 70  TYR B CZ  1 
ATOM   4770 O  OH  . TYR B 1 70  ? 12.023  1.715   -8.933  1.00 44.99 ? 70  TYR B OH  1 
ATOM   4771 N  N   . VAL B 1 71  ? 8.705   1.631   -13.824 1.00 34.23 ? 71  VAL B N   1 
ATOM   4772 C  CA  . VAL B 1 71  ? 8.950   0.225   -14.104 1.00 31.27 ? 71  VAL B CA  1 
ATOM   4773 C  C   . VAL B 1 71  ? 9.926   -0.314  -13.055 1.00 39.31 ? 71  VAL B C   1 
ATOM   4774 O  O   . VAL B 1 71  ? 10.979  0.274   -12.826 1.00 37.93 ? 71  VAL B O   1 
ATOM   4775 C  CB  . VAL B 1 71  ? 9.549   0.011   -15.511 1.00 33.57 ? 71  VAL B CB  1 
ATOM   4776 C  CG1 . VAL B 1 71  ? 10.018  -1.426  -15.666 1.00 34.83 ? 71  VAL B CG1 1 
ATOM   4777 C  CG2 . VAL B 1 71  ? 8.550   0.394   -16.622 1.00 33.98 ? 71  VAL B CG2 1 
ATOM   4778 N  N   . ASP B 1 72  ? 9.584   -1.429  -12.420 1.00 40.01 ? 72  ASP B N   1 
ATOM   4779 C  CA  . ASP B 1 72  ? 10.426  -1.982  -11.362 1.00 40.31 ? 72  ASP B CA  1 
ATOM   4780 C  C   . ASP B 1 72  ? 11.592  -2.784  -11.933 1.00 39.76 ? 72  ASP B C   1 
ATOM   4781 O  O   . ASP B 1 72  ? 11.391  -3.822  -12.557 1.00 39.21 ? 72  ASP B O   1 
ATOM   4782 C  CB  . ASP B 1 72  ? 9.600   -2.859  -10.423 1.00 36.98 ? 72  ASP B CB  1 
ATOM   4783 C  CG  . ASP B 1 72  ? 10.458  -3.598  -9.401  1.00 43.85 ? 72  ASP B CG  1 
ATOM   4784 O  OD1 . ASP B 1 72  ? 11.567  -3.117  -9.069  1.00 42.13 ? 72  ASP B OD1 1 
ATOM   4785 O  OD2 . ASP B 1 72  ? 10.011  -4.661  -8.921  1.00 41.36 ? 72  ASP B OD2 1 
ATOM   4786 N  N   . GLU B 1 73  ? 12.810  -2.313  -11.692 1.00 38.21 ? 73  GLU B N   1 
ATOM   4787 C  CA  . GLU B 1 73  ? 14.002  -2.993  -12.182 1.00 39.99 ? 73  GLU B CA  1 
ATOM   4788 C  C   . GLU B 1 73  ? 14.890  -3.476  -11.038 1.00 38.55 ? 73  GLU B C   1 
ATOM   4789 O  O   . GLU B 1 73  ? 16.076  -3.733  -11.224 1.00 40.85 ? 73  GLU B O   1 
ATOM   4790 C  CB  . GLU B 1 73  ? 14.788  -2.066  -13.118 1.00 38.27 ? 73  GLU B CB  1 
ATOM   4791 C  CG  . GLU B 1 73  ? 14.026  -1.757  -14.397 1.00 44.36 ? 73  GLU B CG  1 
ATOM   4792 C  CD  . GLU B 1 73  ? 14.653  -0.659  -15.233 1.00 46.59 ? 73  GLU B CD  1 
ATOM   4793 O  OE1 . GLU B 1 73  ? 14.281  -0.553  -16.416 1.00 58.83 ? 73  GLU B OE1 1 
ATOM   4794 O  OE2 . GLU B 1 73  ? 15.488  0.109   -14.719 1.00 50.05 ? 73  GLU B OE2 1 
ATOM   4795 N  N   . GLN B 1 74  ? 14.302  -3.619  -9.860  1.00 35.44 ? 74  GLN B N   1 
ATOM   4796 C  CA  . GLN B 1 74  ? 15.023  -4.104  -8.698  1.00 36.50 ? 74  GLN B CA  1 
ATOM   4797 C  C   . GLN B 1 74  ? 15.661  -5.459  -8.934  1.00 35.26 ? 74  GLN B C   1 
ATOM   4798 O  O   . GLN B 1 74  ? 16.804  -5.673  -8.545  1.00 34.89 ? 74  GLN B O   1 
ATOM   4799 C  CB  . GLN B 1 74  ? 14.090  -4.185  -7.482  1.00 42.15 ? 74  GLN B CB  1 
ATOM   4800 C  CG  . GLN B 1 74  ? 14.236  -3.020  -6.540  1.00 45.43 ? 74  GLN B CG  1 
ATOM   4801 C  CD  . GLN B 1 74  ? 15.622  -2.951  -5.966  1.00 49.29 ? 74  GLN B CD  1 
ATOM   4802 O  OE1 . GLN B 1 74  ? 16.280  -3.978  -5.803  1.00 49.77 ? 74  GLN B OE1 1 
ATOM   4803 N  NE2 . GLN B 1 74  ? 16.092  -1.737  -5.675  1.00 50.07 ? 74  GLN B NE2 1 
ATOM   4804 N  N   . PHE B 1 75  ? 14.913  -6.372  -9.544  1.00 30.24 ? 75  PHE B N   1 
ATOM   4805 C  CA  . PHE B 1 75  ? 15.390  -7.733  -9.778  1.00 32.64 ? 75  PHE B CA  1 
ATOM   4806 C  C   . PHE B 1 75  ? 15.259  -8.119  -11.261 1.00 40.40 ? 75  PHE B C   1 
ATOM   4807 O  O   . PHE B 1 75  ? 14.325  -8.839  -11.642 1.00 41.10 ? 75  PHE B O   1 
ATOM   4808 C  CB  . PHE B 1 75  ? 14.619  -8.747  -8.920  1.00 38.64 ? 75  PHE B CB  1 
ATOM   4809 C  CG  . PHE B 1 75  ? 14.685  -8.489  -7.424  1.00 37.80 ? 75  PHE B CG  1 
ATOM   4810 C  CD1 . PHE B 1 75  ? 15.825  -8.805  -6.698  1.00 39.73 ? 75  PHE B CD1 1 
ATOM   4811 C  CD2 . PHE B 1 75  ? 13.594  -7.964  -6.745  1.00 39.37 ? 75  PHE B CD2 1 
ATOM   4812 C  CE1 . PHE B 1 75  ? 15.880  -8.583  -5.319  1.00 38.09 ? 75  PHE B CE1 1 
ATOM   4813 C  CE2 . PHE B 1 75  ? 13.642  -7.746  -5.367  1.00 38.61 ? 75  PHE B CE2 1 
ATOM   4814 C  CZ  . PHE B 1 75  ? 14.792  -8.052  -4.658  1.00 39.07 ? 75  PHE B CZ  1 
ATOM   4815 N  N   . PRO B 1 76  ? 16.202  -7.654  -12.102 1.00 39.34 ? 76  PRO B N   1 
ATOM   4816 C  CA  . PRO B 1 76  ? 16.157  -7.910  -13.546 1.00 37.50 ? 76  PRO B CA  1 
ATOM   4817 C  C   . PRO B 1 76  ? 16.061  -9.398  -13.842 1.00 38.24 ? 76  PRO B C   1 
ATOM   4818 O  O   . PRO B 1 76  ? 16.831  -10.176 -13.292 1.00 42.70 ? 76  PRO B O   1 
ATOM   4819 C  CB  . PRO B 1 76  ? 17.477  -7.333  -14.045 1.00 38.43 ? 76  PRO B CB  1 
ATOM   4820 C  CG  . PRO B 1 76  ? 17.867  -6.321  -13.009 1.00 38.84 ? 76  PRO B CG  1 
ATOM   4821 C  CD  . PRO B 1 76  ? 17.416  -6.918  -11.713 1.00 38.61 ? 76  PRO B CD  1 
ATOM   4822 N  N   . GLY B 1 77  ? 15.092  -9.788  -14.662 1.00 43.10 ? 77  GLY B N   1 
ATOM   4823 C  CA  . GLY B 1 77  ? 14.924  -11.181 -15.037 1.00 43.33 ? 77  GLY B CA  1 
ATOM   4824 C  C   . GLY B 1 77  ? 14.105  -12.023 -14.075 1.00 41.93 ? 77  GLY B C   1 
ATOM   4825 O  O   . GLY B 1 77  ? 13.769  -13.169 -14.371 1.00 44.51 ? 77  GLY B O   1 
ATOM   4826 N  N   . PHE B 1 78  ? 13.772  -11.460 -12.922 1.00 42.40 ? 78  PHE B N   1 
ATOM   4827 C  CA  . PHE B 1 78  ? 13.079  -12.214 -11.889 1.00 38.60 ? 78  PHE B CA  1 
ATOM   4828 C  C   . PHE B 1 78  ? 11.574  -12.155 -12.101 1.00 37.29 ? 78  PHE B C   1 
ATOM   4829 O  O   . PHE B 1 78  ? 10.989  -11.071 -12.107 1.00 37.85 ? 78  PHE B O   1 
ATOM   4830 C  CB  . PHE B 1 78  ? 13.456  -11.667 -10.514 1.00 39.92 ? 78  PHE B CB  1 
ATOM   4831 C  CG  . PHE B 1 78  ? 12.889  -12.449 -9.361  1.00 40.65 ? 78  PHE B CG  1 
ATOM   4832 C  CD1 . PHE B 1 78  ? 13.238  -13.776 -9.162  1.00 42.43 ? 78  PHE B CD1 1 
ATOM   4833 C  CD2 . PHE B 1 78  ? 12.039  -11.843 -8.446  1.00 41.01 ? 78  PHE B CD2 1 
ATOM   4834 C  CE1 . PHE B 1 78  ? 12.733  -14.494 -8.070  1.00 45.29 ? 78  PHE B CE1 1 
ATOM   4835 C  CE2 . PHE B 1 78  ? 11.530  -12.557 -7.360  1.00 40.88 ? 78  PHE B CE2 1 
ATOM   4836 C  CZ  . PHE B 1 78  ? 11.878  -13.885 -7.174  1.00 38.06 ? 78  PHE B CZ  1 
ATOM   4837 N  N   . SER B 1 79  ? 10.948  -13.320 -12.263 1.00 35.29 ? 79  SER B N   1 
ATOM   4838 C  CA  . SER B 1 79  ? 9.525   -13.379 -12.587 1.00 38.00 ? 79  SER B CA  1 
ATOM   4839 C  C   . SER B 1 79  ? 8.664   -12.876 -11.441 1.00 38.74 ? 79  SER B C   1 
ATOM   4840 O  O   . SER B 1 79  ? 7.559   -12.400 -11.662 1.00 40.69 ? 79  SER B O   1 
ATOM   4841 C  CB  . SER B 1 79  ? 9.104   -14.800 -12.957 1.00 38.35 ? 79  SER B CB  1 
ATOM   4842 O  OG  . SER B 1 79  ? 9.318   -15.691 -11.878 1.00 45.40 ? 79  SER B OG  1 
ATOM   4843 N  N   . GLY B 1 80  ? 9.175   -12.975 -10.217 1.00 41.34 ? 80  GLY B N   1 
ATOM   4844 C  CA  . GLY B 1 80  ? 8.424   -12.583 -9.042  1.00 37.32 ? 80  GLY B CA  1 
ATOM   4845 C  C   . GLY B 1 80  ? 8.081   -11.108 -9.017  1.00 37.35 ? 80  GLY B C   1 
ATOM   4846 O  O   . GLY B 1 80  ? 7.014   -10.730 -8.549  1.00 35.52 ? 80  GLY B O   1 
ATOM   4847 N  N   . SER B 1 81  ? 8.993   -10.272 -9.500  1.00 33.31 ? 81  SER B N   1 
ATOM   4848 C  CA  . SER B 1 81  ? 8.731   -8.842  -9.619  1.00 32.78 ? 81  SER B CA  1 
ATOM   4849 C  C   . SER B 1 81  ? 8.280   -8.438  -11.034 1.00 37.27 ? 81  SER B C   1 
ATOM   4850 O  O   . SER B 1 81  ? 7.478   -7.522  -11.214 1.00 35.68 ? 81  SER B O   1 
ATOM   4851 C  CB  . SER B 1 81  ? 9.979   -8.051  -9.235  1.00 38.63 ? 81  SER B CB  1 
ATOM   4852 O  OG  . SER B 1 81  ? 11.090  -8.407  -10.048 1.00 39.29 ? 81  SER B OG  1 
ATOM   4853 N  N   . GLU B 1 82  ? 8.796   -9.122  -12.043 1.00 36.45 ? 82  GLU B N   1 
ATOM   4854 C  CA  . GLU B 1 82  ? 8.536   -8.697  -13.411 1.00 39.90 ? 82  GLU B CA  1 
ATOM   4855 C  C   . GLU B 1 82  ? 7.118   -9.037  -13.876 1.00 39.33 ? 82  GLU B C   1 
ATOM   4856 O  O   . GLU B 1 82  ? 6.580   -8.354  -14.743 1.00 38.44 ? 82  GLU B O   1 
ATOM   4857 C  CB  . GLU B 1 82  ? 9.582   -9.290  -14.371 1.00 38.36 ? 82  GLU B CB  1 
ATOM   4858 C  CG  . GLU B 1 82  ? 10.659  -8.264  -14.754 1.00 40.15 ? 82  GLU B CG  1 
ATOM   4859 C  CD  . GLU B 1 82  ? 11.943  -8.896  -15.260 1.00 47.09 ? 82  GLU B CD  1 
ATOM   4860 O  OE1 . GLU B 1 82  ? 11.910  -10.072 -15.676 1.00 51.88 ? 82  GLU B OE1 1 
ATOM   4861 O  OE2 . GLU B 1 82  ? 12.998  -8.225  -15.230 1.00 46.32 ? 82  GLU B OE2 1 
ATOM   4862 N  N   . MET B 1 83  ? 6.496   -10.050 -13.276 1.00 38.72 ? 83  MET B N   1 
ATOM   4863 C  CA  . MET B 1 83  ? 5.125   -10.404 -13.637 1.00 35.01 ? 83  MET B CA  1 
ATOM   4864 C  C   . MET B 1 83  ? 4.170   -9.226  -13.438 1.00 36.49 ? 83  MET B C   1 
ATOM   4865 O  O   . MET B 1 83  ? 3.043   -9.244  -13.935 1.00 39.21 ? 83  MET B O   1 
ATOM   4866 C  CB  . MET B 1 83  ? 4.641   -11.609 -12.828 1.00 35.20 ? 83  MET B CB  1 
ATOM   4867 C  CG  . MET B 1 83  ? 4.407   -11.329 -11.351 1.00 41.23 ? 83  MET B CG  1 
ATOM   4868 S  SD  . MET B 1 83  ? 3.763   -12.794 -10.533 1.00 48.62 ? 83  MET B SD  1 
ATOM   4869 C  CE  . MET B 1 83  ? 2.040   -12.696 -10.976 1.00 46.43 ? 83  MET B CE  1 
ATOM   4870 N  N   . TRP B 1 84  ? 4.628   -8.202  -12.723 1.00 36.11 ? 84  TRP B N   1 
ATOM   4871 C  CA  . TRP B 1 84  ? 3.802   -7.046  -12.386 1.00 36.24 ? 84  TRP B CA  1 
ATOM   4872 C  C   . TRP B 1 84  ? 4.112   -5.822  -13.259 1.00 34.07 ? 84  TRP B C   1 
ATOM   4873 O  O   . TRP B 1 84  ? 3.340   -4.866  -13.276 1.00 34.02 ? 84  TRP B O   1 
ATOM   4874 C  CB  . TRP B 1 84  ? 3.974   -6.677  -10.899 1.00 33.97 ? 84  TRP B CB  1 
ATOM   4875 C  CG  . TRP B 1 84  ? 3.684   -7.800  -9.957  1.00 36.26 ? 84  TRP B CG  1 
ATOM   4876 C  CD1 . TRP B 1 84  ? 4.593   -8.535  -9.244  1.00 40.35 ? 84  TRP B CD1 1 
ATOM   4877 C  CD2 . TRP B 1 84  ? 2.391   -8.321  -9.614  1.00 38.30 ? 84  TRP B CD2 1 
ATOM   4878 N  NE1 . TRP B 1 84  ? 3.940   -9.477  -8.472  1.00 40.89 ? 84  TRP B NE1 1 
ATOM   4879 C  CE2 . TRP B 1 84  ? 2.591   -9.369  -8.693  1.00 38.95 ? 84  TRP B CE2 1 
ATOM   4880 C  CE3 . TRP B 1 84  ? 1.083   -8.003  -10.001 1.00 38.47 ? 84  TRP B CE3 1 
ATOM   4881 C  CZ2 . TRP B 1 84  ? 1.532   -10.100 -8.159  1.00 38.60 ? 84  TRP B CZ2 1 
ATOM   4882 C  CZ3 . TRP B 1 84  ? 0.041   -8.728  -9.474  1.00 35.75 ? 84  TRP B CZ3 1 
ATOM   4883 C  CH2 . TRP B 1 84  ? 0.268   -9.764  -8.562  1.00 36.10 ? 84  TRP B CH2 1 
ATOM   4884 N  N   . ASN B 1 85  ? 5.247   -5.833  -13.956 1.00 35.01 ? 85  ASN B N   1 
ATOM   4885 C  CA  . ASN B 1 85  ? 5.580   -4.741  -14.877 1.00 35.03 ? 85  ASN B CA  1 
ATOM   4886 C  C   . ASN B 1 85  ? 4.777   -4.818  -16.174 1.00 34.29 ? 85  ASN B C   1 
ATOM   4887 O  O   . ASN B 1 85  ? 4.315   -5.894  -16.555 1.00 32.48 ? 85  ASN B O   1 
ATOM   4888 C  CB  . ASN B 1 85  ? 7.072   -4.743  -15.232 1.00 37.92 ? 85  ASN B CB  1 
ATOM   4889 C  CG  . ASN B 1 85  ? 7.968   -4.338  -14.070 1.00 38.32 ? 85  ASN B CG  1 
ATOM   4890 O  OD1 . ASN B 1 85  ? 7.569   -3.582  -13.191 1.00 37.95 ? 85  ASN B OD1 1 
ATOM   4891 N  ND2 . ASN B 1 85  ? 9.199   -4.828  -14.085 1.00 38.65 ? 85  ASN B ND2 1 
ATOM   4892 N  N   . PRO B 1 86  ? 4.640   -3.676  -16.863 1.00 31.57 ? 86  PRO B N   1 
ATOM   4893 C  CA  . PRO B 1 86  ? 4.029   -3.591  -18.193 1.00 35.43 ? 86  PRO B CA  1 
ATOM   4894 C  C   . PRO B 1 86  ? 4.583   -4.657  -19.125 1.00 35.35 ? 86  PRO B C   1 
ATOM   4895 O  O   . PRO B 1 86  ? 5.797   -4.786  -19.236 1.00 35.44 ? 86  PRO B O   1 
ATOM   4896 C  CB  . PRO B 1 86  ? 4.426   -2.197  -18.682 1.00 34.30 ? 86  PRO B CB  1 
ATOM   4897 C  CG  . PRO B 1 86  ? 4.661   -1.413  -17.446 1.00 33.21 ? 86  PRO B CG  1 
ATOM   4898 C  CD  . PRO B 1 86  ? 5.185   -2.381  -16.423 1.00 33.33 ? 86  PRO B CD  1 
ATOM   4899 N  N   . ASN B 1 87  ? 3.707   -5.435  -19.748 1.00 34.85 ? 87  ASN B N   1 
ATOM   4900 C  CA  . ASN B 1 87  ? 4.140   -6.423  -20.721 1.00 35.93 ? 87  ASN B CA  1 
ATOM   4901 C  C   . ASN B 1 87  ? 3.751   -5.956  -22.124 1.00 38.85 ? 87  ASN B C   1 
ATOM   4902 O  O   . ASN B 1 87  ? 3.767   -6.726  -23.077 1.00 39.92 ? 87  ASN B O   1 
ATOM   4903 C  CB  . ASN B 1 87  ? 3.556   -7.806  -20.409 1.00 31.52 ? 87  ASN B CB  1 
ATOM   4904 C  CG  . ASN B 1 87  ? 2.025   -7.822  -20.406 1.00 40.50 ? 87  ASN B CG  1 
ATOM   4905 O  OD1 . ASN B 1 87  ? 1.372   -6.776  -20.376 1.00 39.89 ? 87  ASN B OD1 1 
ATOM   4906 N  ND2 . ASN B 1 87  ? 1.452   -9.021  -20.418 1.00 37.01 ? 87  ASN B ND2 1 
ATOM   4907 N  N   . ARG B 1 88  ? 3.393   -4.682  -22.223 1.00 34.36 ? 88  ARG B N   1 
ATOM   4908 C  CA  . ARG B 1 88  ? 3.099   -4.051  -23.496 1.00 42.67 ? 88  ARG B CA  1 
ATOM   4909 C  C   . ARG B 1 88  ? 3.821   -2.712  -23.528 1.00 43.03 ? 88  ARG B C   1 
ATOM   4910 O  O   . ARG B 1 88  ? 4.176   -2.172  -22.485 1.00 38.21 ? 88  ARG B O   1 
ATOM   4911 C  CB  . ARG B 1 88  ? 1.585   -3.861  -23.700 1.00 40.03 ? 88  ARG B CB  1 
ATOM   4912 C  CG  . ARG B 1 88  ? 0.846   -5.137  -24.050 1.00 38.15 ? 88  ARG B CG  1 
ATOM   4913 C  CD  . ARG B 1 88  ? 1.402   -5.699  -25.344 1.00 48.15 ? 88  ARG B CD  1 
ATOM   4914 N  NE  . ARG B 1 88  ? 0.762   -6.951  -25.740 1.00 50.09 ? 88  ARG B NE  1 
ATOM   4915 C  CZ  . ARG B 1 88  ? 0.949   -8.108  -25.111 1.00 52.35 ? 88  ARG B CZ  1 
ATOM   4916 N  NH1 . ARG B 1 88  ? 0.335   -9.207  -25.533 1.00 54.74 ? 88  ARG B NH1 1 
ATOM   4917 N  NH2 . ARG B 1 88  ? 1.752   -8.166  -24.054 1.00 46.74 ? 88  ARG B NH2 1 
ATOM   4918 N  N   . GLU B 1 89  ? 4.052   -2.188  -24.726 1.00 41.49 ? 89  GLU B N   1 
ATOM   4919 C  CA  . GLU B 1 89  ? 4.590   -0.846  -24.862 1.00 42.45 ? 89  GLU B CA  1 
ATOM   4920 C  C   . GLU B 1 89  ? 3.766   0.150   -24.039 1.00 39.10 ? 89  GLU B C   1 
ATOM   4921 O  O   . GLU B 1 89  ? 2.541   0.101   -24.041 1.00 41.42 ? 89  GLU B O   1 
ATOM   4922 C  CB  . GLU B 1 89  ? 4.607   -0.437  -26.333 1.00 43.77 ? 89  GLU B CB  1 
ATOM   4923 C  CG  . GLU B 1 89  ? 5.069   0.984   -26.595 1.00 50.73 ? 89  GLU B CG  1 
ATOM   4924 C  CD  . GLU B 1 89  ? 5.309   1.247   -28.081 1.00 63.90 ? 89  GLU B CD  1 
ATOM   4925 O  OE1 . GLU B 1 89  ? 4.527   2.009   -28.699 1.00 63.26 ? 89  GLU B OE1 1 
ATOM   4926 O  OE2 . GLU B 1 89  ? 6.279   0.682   -28.637 1.00 68.46 ? 89  GLU B OE2 1 
ATOM   4927 N  N   . MET B 1 90  ? 4.452   1.041   -23.334 1.00 38.91 ? 90  MET B N   1 
ATOM   4928 C  CA  . MET B 1 90  ? 3.814   2.119   -22.593 1.00 37.20 ? 90  MET B CA  1 
ATOM   4929 C  C   . MET B 1 90  ? 3.487   3.315   -23.477 1.00 37.54 ? 90  MET B C   1 
ATOM   4930 O  O   . MET B 1 90  ? 4.259   3.677   -24.347 1.00 42.73 ? 90  MET B O   1 
ATOM   4931 C  CB  . MET B 1 90  ? 4.714   2.571   -21.442 1.00 35.04 ? 90  MET B CB  1 
ATOM   4932 C  CG  . MET B 1 90  ? 4.866   1.538   -20.344 1.00 37.77 ? 90  MET B CG  1 
ATOM   4933 S  SD  . MET B 1 90  ? 5.801   2.139   -18.919 1.00 36.35 ? 90  MET B SD  1 
ATOM   4934 C  CE  . MET B 1 90  ? 7.385   2.597   -19.657 1.00 34.48 ? 90  MET B CE  1 
ATOM   4935 N  N   . SER B 1 91  ? 2.341   3.933   -23.226 1.00 42.03 ? 91  SER B N   1 
ATOM   4936 C  CA  . SER B 1 91  ? 1.900   5.125   -23.943 1.00 39.25 ? 91  SER B CA  1 
ATOM   4937 C  C   . SER B 1 91  ? 0.855   5.867   -23.127 1.00 40.13 ? 91  SER B C   1 
ATOM   4938 O  O   . SER B 1 91  ? 0.121   5.249   -22.361 1.00 43.60 ? 91  SER B O   1 
ATOM   4939 C  CB  . SER B 1 91  ? 1.322   4.756   -25.303 1.00 39.37 ? 91  SER B CB  1 
ATOM   4940 O  OG  . SER B 1 91  ? 0.585   5.840   -25.833 1.00 39.57 ? 91  SER B OG  1 
ATOM   4941 N  N   . GLU B 1 92  ? 0.784   7.186   -23.271 1.00 39.98 ? 92  GLU B N   1 
ATOM   4942 C  CA  . GLU B 1 92  ? -0.296  7.932   -22.635 1.00 38.90 ? 92  GLU B CA  1 
ATOM   4943 C  C   . GLU B 1 92  ? -1.629  7.587   -23.308 1.00 39.80 ? 92  GLU B C   1 
ATOM   4944 O  O   . GLU B 1 92  ? -2.704  7.771   -22.732 1.00 42.87 ? 92  GLU B O   1 
ATOM   4945 C  CB  . GLU B 1 92  ? -0.036  9.435   -22.691 1.00 40.01 ? 92  GLU B CB  1 
ATOM   4946 C  CG  . GLU B 1 92  ? 1.075   9.902   -21.760 1.00 41.56 ? 92  GLU B CG  1 
ATOM   4947 C  CD  . GLU B 1 92  ? 1.264   11.412  -21.774 1.00 44.23 ? 92  GLU B CD  1 
ATOM   4948 O  OE1 . GLU B 1 92  ? 2.205   11.894  -22.440 1.00 47.88 ? 92  GLU B OE1 1 
ATOM   4949 O  OE2 . GLU B 1 92  ? 0.475   12.121  -21.118 1.00 42.14 ? 92  GLU B OE2 1 
ATOM   4950 N  N   . ASP B 1 93  ? -1.549  7.076   -24.529 1.00 39.00 ? 93  ASP B N   1 
ATOM   4951 C  CA  . ASP B 1 93  ? -2.719  6.579   -25.241 1.00 40.19 ? 93  ASP B CA  1 
ATOM   4952 C  C   . ASP B 1 93  ? -2.975  5.178   -24.713 1.00 39.33 ? 93  ASP B C   1 
ATOM   4953 O  O   . ASP B 1 93  ? -2.515  4.200   -25.295 1.00 38.01 ? 93  ASP B O   1 
ATOM   4954 C  CB  . ASP B 1 93  ? -2.467  6.593   -26.757 1.00 38.23 ? 93  ASP B CB  1 
ATOM   4955 C  CG  . ASP B 1 93  ? -3.622  6.007   -27.574 1.00 42.56 ? 93  ASP B CG  1 
ATOM   4956 O  OD1 . ASP B 1 93  ? -4.788  6.027   -27.124 1.00 45.88 ? 93  ASP B OD1 1 
ATOM   4957 O  OD2 . ASP B 1 93  ? -3.354  5.533   -28.696 1.00 45.10 ? 93  ASP B OD2 1 
ATOM   4958 N  N   . CYS B 1 94  ? -3.674  5.080   -23.580 1.00 42.42 ? 94  CYS B N   1 
ATOM   4959 C  CA  . CYS B 1 94  ? -3.784  3.795   -22.886 1.00 36.43 ? 94  CYS B CA  1 
ATOM   4960 C  C   . CYS B 1 94  ? -5.147  3.492   -22.284 1.00 37.29 ? 94  CYS B C   1 
ATOM   4961 O  O   . CYS B 1 94  ? -5.278  2.500   -21.563 1.00 38.22 ? 94  CYS B O   1 
ATOM   4962 C  CB  . CYS B 1 94  ? -2.737  3.718   -21.766 1.00 34.15 ? 94  CYS B CB  1 
ATOM   4963 S  SG  . CYS B 1 94  ? -2.939  4.970   -20.496 1.00 37.83 ? 94  CYS B SG  1 
ATOM   4964 N  N   . LEU B 1 95  ? -6.150  4.327   -22.558 1.00 32.01 ? 95  LEU B N   1 
ATOM   4965 C  CA  . LEU B 1 95  ? -7.473  4.104   -21.982 1.00 34.37 ? 95  LEU B CA  1 
ATOM   4966 C  C   . LEU B 1 95  ? -8.319  3.109   -22.791 1.00 37.12 ? 95  LEU B C   1 
ATOM   4967 O  O   . LEU B 1 95  ? -9.200  3.488   -23.574 1.00 38.02 ? 95  LEU B O   1 
ATOM   4968 C  CB  . LEU B 1 95  ? -8.206  5.432   -21.819 1.00 33.78 ? 95  LEU B CB  1 
ATOM   4969 C  CG  . LEU B 1 95  ? -7.558  6.371   -20.799 1.00 35.03 ? 95  LEU B CG  1 
ATOM   4970 C  CD1 . LEU B 1 95  ? -8.397  7.602   -20.542 1.00 32.46 ? 95  LEU B CD1 1 
ATOM   4971 C  CD2 . LEU B 1 95  ? -7.246  5.635   -19.496 1.00 29.51 ? 95  LEU B CD2 1 
ATOM   4972 N  N   . TYR B 1 96  ? -8.053  1.825   -22.576 1.00 34.97 ? 96  TYR B N   1 
ATOM   4973 C  CA  . TYR B 1 96  ? -8.769  0.758   -23.262 1.00 34.47 ? 96  TYR B CA  1 
ATOM   4974 C  C   . TYR B 1 96  ? -9.311  -0.258  -22.259 1.00 34.67 ? 96  TYR B C   1 
ATOM   4975 O  O   . TYR B 1 96  ? -8.910  -0.267  -21.086 1.00 31.71 ? 96  TYR B O   1 
ATOM   4976 C  CB  . TYR B 1 96  ? -7.839  0.085   -24.289 1.00 36.55 ? 96  TYR B CB  1 
ATOM   4977 C  CG  . TYR B 1 96  ? -7.280  1.065   -25.299 1.00 36.23 ? 96  TYR B CG  1 
ATOM   4978 C  CD1 . TYR B 1 96  ? -6.210  1.892   -24.969 1.00 36.34 ? 96  TYR B CD1 1 
ATOM   4979 C  CD2 . TYR B 1 96  ? -7.839  1.182   -26.573 1.00 41.37 ? 96  TYR B CD2 1 
ATOM   4980 C  CE1 . TYR B 1 96  ? -5.705  2.800   -25.870 1.00 36.28 ? 96  TYR B CE1 1 
ATOM   4981 C  CE2 . TYR B 1 96  ? -7.332  2.092   -27.498 1.00 38.25 ? 96  TYR B CE2 1 
ATOM   4982 C  CZ  . TYR B 1 96  ? -6.266  2.899   -27.136 1.00 41.14 ? 96  TYR B CZ  1 
ATOM   4983 O  OH  . TYR B 1 96  ? -5.745  3.815   -28.025 1.00 37.23 ? 96  TYR B OH  1 
ATOM   4984 N  N   . LEU B 1 97  ? -10.236 -1.097  -22.712 1.00 32.52 ? 97  LEU B N   1 
ATOM   4985 C  CA  . LEU B 1 97  ? -10.766 -2.155  -21.868 1.00 29.42 ? 97  LEU B CA  1 
ATOM   4986 C  C   . LEU B 1 97  ? -10.808 -3.454  -22.643 1.00 32.65 ? 97  LEU B C   1 
ATOM   4987 O  O   . LEU B 1 97  ? -10.861 -3.451  -23.875 1.00 34.74 ? 97  LEU B O   1 
ATOM   4988 C  CB  . LEU B 1 97  ? -12.158 -1.791  -21.321 1.00 30.54 ? 97  LEU B CB  1 
ATOM   4989 C  CG  . LEU B 1 97  ? -13.302 -1.341  -22.234 1.00 31.83 ? 97  LEU B CG  1 
ATOM   4990 C  CD1 . LEU B 1 97  ? -14.090 -2.512  -22.775 1.00 29.98 ? 97  LEU B CD1 1 
ATOM   4991 C  CD2 . LEU B 1 97  ? -14.209 -0.398  -21.484 1.00 30.86 ? 97  LEU B CD2 1 
ATOM   4992 N  N   . ASN B 1 98  ? -10.762 -4.563  -21.918 1.00 31.95 ? 98  ASN B N   1 
ATOM   4993 C  CA  . ASN B 1 98  ? -10.834 -5.883  -22.519 1.00 30.92 ? 98  ASN B CA  1 
ATOM   4994 C  C   . ASN B 1 98  ? -12.062 -6.636  -22.046 1.00 37.04 ? 98  ASN B C   1 
ATOM   4995 O  O   . ASN B 1 98  ? -12.551 -6.401  -20.927 1.00 36.07 ? 98  ASN B O   1 
ATOM   4996 C  CB  . ASN B 1 98  ? -9.580  -6.670  -22.188 1.00 34.16 ? 98  ASN B CB  1 
ATOM   4997 C  CG  . ASN B 1 98  ? -8.320  -5.856  -22.392 1.00 37.71 ? 98  ASN B CG  1 
ATOM   4998 O  OD1 . ASN B 1 98  ? -7.891  -5.637  -23.518 1.00 38.82 ? 98  ASN B OD1 1 
ATOM   4999 N  ND2 . ASN B 1 98  ? -7.718  -5.402  -21.296 1.00 38.41 ? 98  ASN B ND2 1 
ATOM   5000 N  N   . ILE B 1 99  ? -12.574 -7.532  -22.890 1.00 36.74 ? 99  ILE B N   1 
ATOM   5001 C  CA  . ILE B 1 99  ? -13.762 -8.307  -22.532 1.00 36.09 ? 99  ILE B CA  1 
ATOM   5002 C  C   . ILE B 1 99  ? -13.638 -9.763  -22.966 1.00 36.95 ? 99  ILE B C   1 
ATOM   5003 O  O   . ILE B 1 99  ? -13.288 -10.050 -24.116 1.00 35.65 ? 99  ILE B O   1 
ATOM   5004 C  CB  . ILE B 1 99  ? -15.049 -7.725  -23.166 1.00 37.56 ? 99  ILE B CB  1 
ATOM   5005 C  CG1 . ILE B 1 99  ? -15.112 -6.209  -23.004 1.00 33.56 ? 99  ILE B CG1 1 
ATOM   5006 C  CG2 . ILE B 1 99  ? -16.292 -8.383  -22.566 1.00 31.36 ? 99  ILE B CG2 1 
ATOM   5007 C  CD1 . ILE B 1 99  ? -16.317 -5.603  -23.668 1.00 36.18 ? 99  ILE B CD1 1 
ATOM   5008 N  N   . TRP B 1 100 ? -13.941 -10.674 -22.045 1.00 34.64 ? 100 TRP B N   1 
ATOM   5009 C  CA  . TRP B 1 100 ? -14.027 -12.095 -22.357 1.00 37.15 ? 100 TRP B CA  1 
ATOM   5010 C  C   . TRP B 1 100 ? -15.478 -12.544 -22.286 1.00 35.55 ? 100 TRP B C   1 
ATOM   5011 O  O   . TRP B 1 100 ? -16.155 -12.326 -21.281 1.00 38.08 ? 100 TRP B O   1 
ATOM   5012 C  CB  . TRP B 1 100 ? -13.167 -12.928 -21.409 1.00 32.21 ? 100 TRP B CB  1 
ATOM   5013 C  CG  . TRP B 1 100 ? -11.700 -12.762 -21.643 1.00 33.47 ? 100 TRP B CG  1 
ATOM   5014 C  CD1 . TRP B 1 100 ? -10.905 -13.561 -22.399 1.00 37.74 ? 100 TRP B CD1 1 
ATOM   5015 C  CD2 . TRP B 1 100 ? -10.854 -11.727 -21.126 1.00 33.35 ? 100 TRP B CD2 1 
ATOM   5016 N  NE1 . TRP B 1 100 ? -9.616  -13.100 -22.382 1.00 37.19 ? 100 TRP B NE1 1 
ATOM   5017 C  CE2 . TRP B 1 100 ? -9.556  -11.972 -21.608 1.00 35.94 ? 100 TRP B CE2 1 
ATOM   5018 C  CE3 . TRP B 1 100 ? -11.065 -10.628 -20.286 1.00 38.70 ? 100 TRP B CE3 1 
ATOM   5019 C  CZ2 . TRP B 1 100 ? -8.468  -11.154 -21.291 1.00 34.59 ? 100 TRP B CZ2 1 
ATOM   5020 C  CZ3 . TRP B 1 100 ? -9.976  -9.812  -19.968 1.00 38.90 ? 100 TRP B CZ3 1 
ATOM   5021 C  CH2 . TRP B 1 100 ? -8.698  -10.082 -20.475 1.00 33.98 ? 100 TRP B CH2 1 
ATOM   5022 N  N   . VAL B 1 101 ? -15.955 -13.168 -23.360 1.00 36.12 ? 101 VAL B N   1 
ATOM   5023 C  CA  . VAL B 1 101 ? -17.361 -13.542 -23.459 1.00 36.96 ? 101 VAL B CA  1 
ATOM   5024 C  C   . VAL B 1 101 ? -17.513 -15.024 -23.726 1.00 37.88 ? 101 VAL B C   1 
ATOM   5025 O  O   . VAL B 1 101 ? -16.968 -15.535 -24.702 1.00 40.33 ? 101 VAL B O   1 
ATOM   5026 C  CB  . VAL B 1 101 ? -18.075 -12.765 -24.582 1.00 40.02 ? 101 VAL B CB  1 
ATOM   5027 C  CG1 . VAL B 1 101 ? -19.598 -13.025 -24.542 1.00 36.21 ? 101 VAL B CG1 1 
ATOM   5028 C  CG2 . VAL B 1 101 ? -17.772 -11.284 -24.473 1.00 36.98 ? 101 VAL B CG2 1 
ATOM   5029 N  N   . PRO B 1 102 ? -18.269 -15.718 -22.868 1.00 38.05 ? 102 PRO B N   1 
ATOM   5030 C  CA  . PRO B 1 102 ? -18.587 -17.137 -23.071 1.00 40.05 ? 102 PRO B CA  1 
ATOM   5031 C  C   . PRO B 1 102 ? -19.117 -17.416 -24.480 1.00 42.14 ? 102 PRO B C   1 
ATOM   5032 O  O   . PRO B 1 102 ? -19.834 -16.601 -25.053 1.00 39.21 ? 102 PRO B O   1 
ATOM   5033 C  CB  . PRO B 1 102 ? -19.669 -17.407 -22.027 1.00 35.12 ? 102 PRO B CB  1 
ATOM   5034 C  CG  . PRO B 1 102 ? -19.406 -16.390 -20.952 1.00 39.64 ? 102 PRO B CG  1 
ATOM   5035 C  CD  . PRO B 1 102 ? -18.969 -15.158 -21.700 1.00 37.49 ? 102 PRO B CD  1 
ATOM   5036 N  N   . SER B 1 103 ? -18.752 -18.570 -25.020 1.00 47.13 ? 103 SER B N   1 
ATOM   5037 C  CA  . SER B 1 103 ? -19.148 -18.972 -26.358 1.00 43.93 ? 103 SER B CA  1 
ATOM   5038 C  C   . SER B 1 103 ? -19.913 -20.283 -26.280 1.00 46.56 ? 103 SER B C   1 
ATOM   5039 O  O   . SER B 1 103 ? -19.359 -21.306 -25.867 1.00 43.23 ? 103 SER B O   1 
ATOM   5040 C  CB  . SER B 1 103 ? -17.923 -19.116 -27.270 1.00 43.08 ? 103 SER B CB  1 
ATOM   5041 O  OG  . SER B 1 103 ? -18.281 -19.613 -28.550 1.00 48.25 ? 103 SER B OG  1 
ATOM   5042 N  N   . PRO B 1 104 ? -21.180 -20.270 -26.724 1.00 49.39 ? 104 PRO B N   1 
ATOM   5043 C  CA  . PRO B 1 104 ? -21.849 -19.151 -27.406 1.00 46.40 ? 104 PRO B CA  1 
ATOM   5044 C  C   . PRO B 1 104 ? -22.242 -17.984 -26.498 1.00 44.73 ? 104 PRO B C   1 
ATOM   5045 O  O   . PRO B 1 104 ? -22.346 -18.143 -25.288 1.00 46.76 ? 104 PRO B O   1 
ATOM   5046 C  CB  . PRO B 1 104 ? -23.102 -19.807 -27.992 1.00 47.01 ? 104 PRO B CB  1 
ATOM   5047 C  CG  . PRO B 1 104 ? -23.376 -20.949 -27.093 1.00 48.77 ? 104 PRO B CG  1 
ATOM   5048 C  CD  . PRO B 1 104 ? -22.037 -21.465 -26.661 1.00 46.89 ? 104 PRO B CD  1 
ATOM   5049 N  N   . ARG B 1 105 ? -22.474 -16.822 -27.101 1.00 43.25 ? 105 ARG B N   1 
ATOM   5050 C  CA  . ARG B 1 105 ? -22.751 -15.599 -26.356 1.00 43.20 ? 105 ARG B CA  1 
ATOM   5051 C  C   . ARG B 1 105 ? -23.969 -15.732 -25.438 1.00 45.93 ? 105 ARG B C   1 
ATOM   5052 O  O   . ARG B 1 105 ? -25.072 -16.024 -25.905 1.00 48.50 ? 105 ARG B O   1 
ATOM   5053 C  CB  . ARG B 1 105 ? -22.948 -14.433 -27.332 1.00 40.11 ? 105 ARG B CB  1 
ATOM   5054 C  CG  . ARG B 1 105 ? -23.241 -13.091 -26.670 1.00 41.72 ? 105 ARG B CG  1 
ATOM   5055 C  CD  . ARG B 1 105 ? -23.553 -12.014 -27.697 1.00 40.78 ? 105 ARG B CD  1 
ATOM   5056 N  NE  . ARG B 1 105 ? -22.504 -11.919 -28.706 1.00 42.64 ? 105 ARG B NE  1 
ATOM   5057 C  CZ  . ARG B 1 105 ? -22.614 -11.241 -29.844 1.00 42.10 ? 105 ARG B CZ  1 
ATOM   5058 N  NH1 . ARG B 1 105 ? -23.736 -10.594 -30.124 1.00 43.48 ? 105 ARG B NH1 1 
ATOM   5059 N  NH2 . ARG B 1 105 ? -21.599 -11.214 -30.704 1.00 43.29 ? 105 ARG B NH2 1 
ATOM   5060 N  N   . PRO B 1 106 ? -23.765 -15.524 -24.124 1.00 44.97 ? 106 PRO B N   1 
ATOM   5061 C  CA  . PRO B 1 106 ? -24.848 -15.476 -23.143 1.00 43.16 ? 106 PRO B CA  1 
ATOM   5062 C  C   . PRO B 1 106 ? -25.925 -14.478 -23.552 1.00 46.82 ? 106 PRO B C   1 
ATOM   5063 O  O   . PRO B 1 106 ? -25.617 -13.516 -24.257 1.00 40.09 ? 106 PRO B O   1 
ATOM   5064 C  CB  . PRO B 1 106 ? -24.148 -15.005 -21.866 1.00 42.02 ? 106 PRO B CB  1 
ATOM   5065 C  CG  . PRO B 1 106 ? -22.739 -15.430 -22.033 1.00 43.10 ? 106 PRO B CG  1 
ATOM   5066 C  CD  . PRO B 1 106 ? -22.445 -15.331 -23.498 1.00 41.79 ? 106 PRO B CD  1 
ATOM   5067 N  N   . LYS B 1 107 ? -27.159 -14.676 -23.097 1.00 45.95 ? 107 LYS B N   1 
ATOM   5068 C  CA  . LYS B 1 107 ? -28.206 -13.732 -23.454 1.00 49.46 ? 107 LYS B CA  1 
ATOM   5069 C  C   . LYS B 1 107 ? -28.093 -12.493 -22.583 1.00 48.98 ? 107 LYS B C   1 
ATOM   5070 O  O   . LYS B 1 107 ? -27.996 -11.373 -23.097 1.00 47.69 ? 107 LYS B O   1 
ATOM   5071 C  CB  . LYS B 1 107 ? -29.599 -14.359 -23.340 1.00 45.38 ? 107 LYS B CB  1 
ATOM   5072 C  CG  . LYS B 1 107 ? -30.249 -14.575 -24.713 1.00 49.34 ? 107 LYS B CG  1 
ATOM   5073 C  CD  . LYS B 1 107 ? -31.683 -15.079 -24.612 1.00 44.83 ? 107 LYS B CD  1 
ATOM   5074 C  CE  . LYS B 1 107 ? -32.269 -15.374 -25.991 1.00 53.94 ? 107 LYS B CE  1 
ATOM   5075 N  NZ  . LYS B 1 107 ? -32.559 -14.145 -26.794 1.00 58.26 ? 107 LYS B NZ  1 
ATOM   5076 N  N   . SER B 1 108 ? -28.074 -12.695 -21.270 1.00 42.49 ? 108 SER B N   1 
ATOM   5077 C  CA  . SER B 1 108 ? -28.000 -11.582 -20.345 1.00 39.99 ? 108 SER B CA  1 
ATOM   5078 C  C   . SER B 1 108 ? -27.407 -12.065 -19.025 1.00 45.15 ? 108 SER B C   1 
ATOM   5079 O  O   . SER B 1 108 ? -28.132 -12.299 -18.056 1.00 49.08 ? 108 SER B O   1 
ATOM   5080 C  CB  . SER B 1 108 ? -29.386 -10.974 -20.140 1.00 47.08 ? 108 SER B CB  1 
ATOM   5081 O  OG  . SER B 1 108 ? -29.348 -9.834  -19.302 1.00 51.72 ? 108 SER B OG  1 
ATOM   5082 N  N   . THR B 1 109 ? -26.085 -12.208 -18.994 1.00 41.22 ? 109 THR B N   1 
ATOM   5083 C  CA  . THR B 1 109 ? -25.421 -12.878 -17.891 1.00 44.61 ? 109 THR B CA  1 
ATOM   5084 C  C   . THR B 1 109 ? -24.640 -11.911 -16.991 1.00 41.54 ? 109 THR B C   1 
ATOM   5085 O  O   . THR B 1 109 ? -24.373 -10.764 -17.366 1.00 41.56 ? 109 THR B O   1 
ATOM   5086 C  CB  . THR B 1 109 ? -24.467 -13.968 -18.418 1.00 43.96 ? 109 THR B CB  1 
ATOM   5087 O  OG1 . THR B 1 109 ? -24.081 -14.833 -17.336 1.00 51.26 ? 109 THR B OG1 1 
ATOM   5088 C  CG2 . THR B 1 109 ? -23.233 -13.338 -19.010 1.00 39.38 ? 109 THR B CG2 1 
ATOM   5089 N  N   . THR B 1 110 ? -24.272 -12.398 -15.813 1.00 36.70 ? 110 THR B N   1 
ATOM   5090 C  CA  . THR B 1 110 ? -23.508 -11.625 -14.828 1.00 35.28 ? 110 THR B CA  1 
ATOM   5091 C  C   . THR B 1 110 ? -22.216 -11.052 -15.413 1.00 32.83 ? 110 THR B C   1 
ATOM   5092 O  O   . THR B 1 110 ? -21.511 -11.723 -16.160 1.00 30.26 ? 110 THR B O   1 
ATOM   5093 C  CB  . THR B 1 110 ? -23.179 -12.502 -13.598 1.00 40.44 ? 110 THR B CB  1 
ATOM   5094 O  OG1 . THR B 1 110 ? -24.402 -12.995 -13.039 1.00 43.19 ? 110 THR B OG1 1 
ATOM   5095 C  CG2 . THR B 1 110 ? -22.418 -11.710 -12.530 1.00 34.63 ? 110 THR B CG2 1 
ATOM   5096 N  N   . VAL B 1 111 ? -21.942 -9.789  -15.092 1.00 30.83 ? 111 VAL B N   1 
ATOM   5097 C  CA  . VAL B 1 111 ? -20.721 -9.117  -15.514 1.00 28.34 ? 111 VAL B CA  1 
ATOM   5098 C  C   . VAL B 1 111 ? -19.793 -8.790  -14.326 1.00 32.20 ? 111 VAL B C   1 
ATOM   5099 O  O   . VAL B 1 111 ? -20.250 -8.295  -13.296 1.00 29.16 ? 111 VAL B O   1 
ATOM   5100 C  CB  . VAL B 1 111 ? -21.026 -7.808  -16.255 1.00 31.18 ? 111 VAL B CB  1 
ATOM   5101 C  CG1 . VAL B 1 111 ? -19.719 -7.130  -16.691 1.00 31.66 ? 111 VAL B CG1 1 
ATOM   5102 C  CG2 . VAL B 1 111 ? -21.901 -8.085  -17.481 1.00 33.85 ? 111 VAL B CG2 1 
ATOM   5103 N  N   . MET B 1 112 ? -18.498 -9.067  -14.485 1.00 30.46 ? 112 MET B N   1 
ATOM   5104 C  CA  . MET B 1 112 ? -17.501 -8.674  -13.491 1.00 33.83 ? 112 MET B CA  1 
ATOM   5105 C  C   . MET B 1 112 ? -16.459 -7.782  -14.157 1.00 34.09 ? 112 MET B C   1 
ATOM   5106 O  O   . MET B 1 112 ? -15.968 -8.081  -15.244 1.00 32.73 ? 112 MET B O   1 
ATOM   5107 C  CB  . MET B 1 112 ? -16.828 -9.892  -12.855 1.00 29.43 ? 112 MET B CB  1 
ATOM   5108 C  CG  . MET B 1 112 ? -17.792 -10.875 -12.209 1.00 30.11 ? 112 MET B CG  1 
ATOM   5109 S  SD  . MET B 1 112 ? -17.012 -12.420 -11.694 1.00 36.10 ? 112 MET B SD  1 
ATOM   5110 C  CE  . MET B 1 112 ? -16.155 -11.890 -10.207 1.00 26.60 ? 112 MET B CE  1 
ATOM   5111 N  N   . VAL B 1 113 ? -16.130 -6.682  -13.497 1.00 34.50 ? 113 VAL B N   1 
ATOM   5112 C  CA  . VAL B 1 113 ? -15.212 -5.711  -14.057 1.00 30.02 ? 113 VAL B CA  1 
ATOM   5113 C  C   . VAL B 1 113 ? -14.024 -5.547  -13.122 1.00 33.04 ? 113 VAL B C   1 
ATOM   5114 O  O   . VAL B 1 113 ? -14.176 -5.125  -11.961 1.00 32.40 ? 113 VAL B O   1 
ATOM   5115 C  CB  . VAL B 1 113 ? -15.911 -4.366  -14.285 1.00 28.48 ? 113 VAL B CB  1 
ATOM   5116 C  CG1 . VAL B 1 113 ? -14.935 -3.339  -14.808 1.00 30.37 ? 113 VAL B CG1 1 
ATOM   5117 C  CG2 . VAL B 1 113 ? -17.097 -4.546  -15.234 1.00 30.19 ? 113 VAL B CG2 1 
ATOM   5118 N  N   . TRP B 1 114 ? -12.854 -5.894  -13.648 1.00 32.57 ? 114 TRP B N   1 
ATOM   5119 C  CA  . TRP B 1 114 ? -11.596 -5.900  -12.914 1.00 29.42 ? 114 TRP B CA  1 
ATOM   5120 C  C   . TRP B 1 114 ? -10.847 -4.568  -12.998 1.00 30.83 ? 114 TRP B C   1 
ATOM   5121 O  O   . TRP B 1 114 ? -10.624 -4.022  -14.088 1.00 30.74 ? 114 TRP B O   1 
ATOM   5122 C  CB  . TRP B 1 114 ? -10.700 -7.035  -13.431 1.00 31.07 ? 114 TRP B CB  1 
ATOM   5123 C  CG  . TRP B 1 114 ? -9.333  -7.069  -12.767 1.00 32.77 ? 114 TRP B CG  1 
ATOM   5124 C  CD1 . TRP B 1 114 ? -8.124  -6.764  -13.341 1.00 30.32 ? 114 TRP B CD1 1 
ATOM   5125 C  CD2 . TRP B 1 114 ? -9.053  -7.415  -11.405 1.00 32.09 ? 114 TRP B CD2 1 
ATOM   5126 N  NE1 . TRP B 1 114 ? -7.108  -6.897  -12.412 1.00 33.74 ? 114 TRP B NE1 1 
ATOM   5127 C  CE2 . TRP B 1 114 ? -7.653  -7.302  -11.219 1.00 34.35 ? 114 TRP B CE2 1 
ATOM   5128 C  CE3 . TRP B 1 114 ? -9.842  -7.817  -10.332 1.00 30.91 ? 114 TRP B CE3 1 
ATOM   5129 C  CZ2 . TRP B 1 114 ? -7.035  -7.579  -9.995  1.00 32.42 ? 114 TRP B CZ2 1 
ATOM   5130 C  CZ3 . TRP B 1 114 ? -9.221  -8.088  -9.107  1.00 35.42 ? 114 TRP B CZ3 1 
ATOM   5131 C  CH2 . TRP B 1 114 ? -7.832  -7.969  -8.953  1.00 31.16 ? 114 TRP B CH2 1 
ATOM   5132 N  N   . ILE B 1 115 ? -10.482 -4.056  -11.828 1.00 28.53 ? 115 ILE B N   1 
ATOM   5133 C  CA  . ILE B 1 115 ? -9.706  -2.835  -11.683 1.00 29.59 ? 115 ILE B CA  1 
ATOM   5134 C  C   . ILE B 1 115 ? -8.342  -3.182  -11.074 1.00 31.79 ? 115 ILE B C   1 
ATOM   5135 O  O   . ILE B 1 115 ? -8.275  -3.603  -9.909  1.00 32.31 ? 115 ILE B O   1 
ATOM   5136 C  CB  . ILE B 1 115 ? -10.436 -1.826  -10.780 1.00 30.02 ? 115 ILE B CB  1 
ATOM   5137 C  CG1 . ILE B 1 115 ? -11.861 -1.599  -11.279 1.00 27.40 ? 115 ILE B CG1 1 
ATOM   5138 C  CG2 . ILE B 1 115 ? -9.663  -0.518  -10.693 1.00 30.65 ? 115 ILE B CG2 1 
ATOM   5139 C  CD1 . ILE B 1 115 ? -12.613 -0.535  -10.525 1.00 26.20 ? 115 ILE B CD1 1 
ATOM   5140 N  N   . TYR B 1 116 ? -7.260  -3.027  -11.841 1.00 31.43 ? 116 TYR B N   1 
ATOM   5141 C  CA  . TYR B 1 116 ? -5.946  -3.455  -11.347 1.00 31.13 ? 116 TYR B CA  1 
ATOM   5142 C  C   . TYR B 1 116 ? -5.394  -2.568  -10.231 1.00 28.77 ? 116 TYR B C   1 
ATOM   5143 O  O   . TYR B 1 116 ? -5.738  -1.388  -10.109 1.00 27.68 ? 116 TYR B O   1 
ATOM   5144 C  CB  . TYR B 1 116 ? -4.917  -3.545  -12.490 1.00 30.30 ? 116 TYR B CB  1 
ATOM   5145 C  CG  . TYR B 1 116 ? -4.733  -2.291  -13.315 1.00 30.84 ? 116 TYR B CG  1 
ATOM   5146 C  CD1 . TYR B 1 116 ? -4.097  -1.172  -12.792 1.00 29.64 ? 116 TYR B CD1 1 
ATOM   5147 C  CD2 . TYR B 1 116 ? -5.170  -2.240  -14.642 1.00 28.84 ? 116 TYR B CD2 1 
ATOM   5148 C  CE1 . TYR B 1 116 ? -3.923  -0.024  -13.555 1.00 31.74 ? 116 TYR B CE1 1 
ATOM   5149 C  CE2 . TYR B 1 116 ? -5.002  -1.113  -15.406 1.00 28.14 ? 116 TYR B CE2 1 
ATOM   5150 C  CZ  . TYR B 1 116 ? -4.379  -0.001  -14.874 1.00 31.43 ? 116 TYR B CZ  1 
ATOM   5151 O  OH  . TYR B 1 116 ? -4.215  1.125   -15.667 1.00 28.36 ? 116 TYR B OH  1 
ATOM   5152 N  N   . GLY B 1 117 ? -4.532  -3.163  -9.413  1.00 30.84 ? 117 GLY B N   1 
ATOM   5153 C  CA  . GLY B 1 117 ? -3.841  -2.441  -8.352  1.00 33.20 ? 117 GLY B CA  1 
ATOM   5154 C  C   . GLY B 1 117 ? -2.487  -1.931  -8.824  1.00 32.04 ? 117 GLY B C   1 
ATOM   5155 O  O   . GLY B 1 117 ? -2.195  -1.933  -10.025 1.00 32.56 ? 117 GLY B O   1 
ATOM   5156 N  N   . GLY B 1 118 ? -1.657  -1.485  -7.891  1.00 32.01 ? 118 GLY B N   1 
ATOM   5157 C  CA  . GLY B 1 118 ? -0.341  -0.974  -8.237  1.00 29.15 ? 118 GLY B CA  1 
ATOM   5158 C  C   . GLY B 1 118 ? -0.102  0.383   -7.608  1.00 29.95 ? 118 GLY B C   1 
ATOM   5159 O  O   . GLY B 1 118 ? 0.596   1.224   -8.166  1.00 33.05 ? 118 GLY B O   1 
ATOM   5160 N  N   . GLY B 1 119 ? -0.708  0.599   -6.446  1.00 32.65 ? 119 GLY B N   1 
ATOM   5161 C  CA  . GLY B 1 119 ? -0.420  1.757   -5.610  1.00 29.90 ? 119 GLY B CA  1 
ATOM   5162 C  C   . GLY B 1 119 ? -0.777  3.097   -6.225  1.00 33.12 ? 119 GLY B C   1 
ATOM   5163 O  O   . GLY B 1 119 ? -0.305  4.142   -5.765  1.00 30.81 ? 119 GLY B O   1 
ATOM   5164 N  N   . PHE B 1 120 ? -1.628  3.052   -7.252  1.00 31.72 ? 120 PHE B N   1 
ATOM   5165 C  CA  . PHE B 1 120 ? -2.011  4.218   -8.058  1.00 33.15 ? 120 PHE B CA  1 
ATOM   5166 C  C   . PHE B 1 120 ? -0.848  4.816   -8.877  1.00 34.05 ? 120 PHE B C   1 
ATOM   5167 O  O   . PHE B 1 120 ? -1.002  5.881   -9.483  1.00 33.58 ? 120 PHE B O   1 
ATOM   5168 C  CB  . PHE B 1 120 ? -2.630  5.313   -7.174  1.00 30.89 ? 120 PHE B CB  1 
ATOM   5169 C  CG  . PHE B 1 120 ? -3.986  4.956   -6.601  1.00 31.09 ? 120 PHE B CG  1 
ATOM   5170 C  CD1 . PHE B 1 120 ? -5.077  4.770   -7.427  1.00 30.14 ? 120 PHE B CD1 1 
ATOM   5171 C  CD2 . PHE B 1 120 ? -4.159  4.808   -5.227  1.00 33.04 ? 120 PHE B CD2 1 
ATOM   5172 C  CE1 . PHE B 1 120 ? -6.334  4.441   -6.896  1.00 35.68 ? 120 PHE B CE1 1 
ATOM   5173 C  CE2 . PHE B 1 120 ? -5.413  4.485   -4.679  1.00 34.33 ? 120 PHE B CE2 1 
ATOM   5174 C  CZ  . PHE B 1 120 ? -6.505  4.298   -5.513  1.00 30.21 ? 120 PHE B CZ  1 
ATOM   5175 N  N   . TYR B 1 121 ? 0.301   4.142   -8.906  1.00 31.28 ? 121 TYR B N   1 
ATOM   5176 C  CA  . TYR B 1 121 ? 1.455   4.666   -9.645  1.00 33.71 ? 121 TYR B CA  1 
ATOM   5177 C  C   . TYR B 1 121 ? 1.854   3.747   -10.793 1.00 32.85 ? 121 TYR B C   1 
ATOM   5178 O  O   . TYR B 1 121 ? 2.705   4.088   -11.611 1.00 34.99 ? 121 TYR B O   1 
ATOM   5179 C  CB  . TYR B 1 121 ? 2.660   4.876   -8.713  1.00 34.13 ? 121 TYR B CB  1 
ATOM   5180 C  CG  . TYR B 1 121 ? 3.369   3.596   -8.305  1.00 35.65 ? 121 TYR B CG  1 
ATOM   5181 C  CD1 . TYR B 1 121 ? 4.383   3.055   -9.094  1.00 34.30 ? 121 TYR B CD1 1 
ATOM   5182 C  CD2 . TYR B 1 121 ? 3.036   2.938   -7.119  1.00 34.47 ? 121 TYR B CD2 1 
ATOM   5183 C  CE1 . TYR B 1 121 ? 5.032   1.886   -8.729  1.00 34.05 ? 121 TYR B CE1 1 
ATOM   5184 C  CE2 . TYR B 1 121 ? 3.693   1.765   -6.739  1.00 35.89 ? 121 TYR B CE2 1 
ATOM   5185 C  CZ  . TYR B 1 121 ? 4.690   1.247   -7.551  1.00 37.93 ? 121 TYR B CZ  1 
ATOM   5186 O  OH  . TYR B 1 121 ? 5.345   0.084   -7.191  1.00 39.45 ? 121 TYR B OH  1 
ATOM   5187 N  N   . SER B 1 122 ? 1.224   2.585   -10.858 1.00 34.74 ? 122 SER B N   1 
ATOM   5188 C  CA  . SER B 1 122 ? 1.581   1.557   -11.824 1.00 32.11 ? 122 SER B CA  1 
ATOM   5189 C  C   . SER B 1 122 ? 0.403   0.615   -12.057 1.00 32.88 ? 122 SER B C   1 
ATOM   5190 O  O   . SER B 1 122 ? -0.645  0.758   -11.423 1.00 31.37 ? 122 SER B O   1 
ATOM   5191 C  CB  . SER B 1 122 ? 2.778   0.760   -11.316 1.00 31.31 ? 122 SER B CB  1 
ATOM   5192 O  OG  . SER B 1 122 ? 2.420   0.022   -10.151 1.00 30.89 ? 122 SER B OG  1 
ATOM   5193 N  N   . GLY B 1 123 ? 0.586   -0.369  -12.932 1.00 30.99 ? 123 GLY B N   1 
ATOM   5194 C  CA  . GLY B 1 123 ? -0.462  -1.338  -13.194 1.00 30.61 ? 123 GLY B CA  1 
ATOM   5195 C  C   . GLY B 1 123 ? -0.816  -1.455  -14.673 1.00 34.82 ? 123 GLY B C   1 
ATOM   5196 O  O   . GLY B 1 123 ? -0.621  -0.518  -15.442 1.00 33.28 ? 123 GLY B O   1 
ATOM   5197 N  N   . SER B 1 124 ? -1.335  -2.619  -15.056 1.00 29.86 ? 124 SER B N   1 
ATOM   5198 C  CA  . SER B 1 124 ? -1.712  -2.900  -16.424 1.00 36.60 ? 124 SER B CA  1 
ATOM   5199 C  C   . SER B 1 124 ? -2.873  -3.875  -16.424 1.00 35.54 ? 124 SER B C   1 
ATOM   5200 O  O   . SER B 1 124 ? -2.941  -4.758  -15.568 1.00 32.28 ? 124 SER B O   1 
ATOM   5201 C  CB  . SER B 1 124 ? -0.539  -3.483  -17.219 1.00 32.46 ? 124 SER B CB  1 
ATOM   5202 O  OG  . SER B 1 124 ? 0.541   -2.569  -17.233 1.00 36.02 ? 124 SER B OG  1 
ATOM   5203 N  N   . SER B 1 125 ? -3.765  -3.730  -17.402 1.00 33.44 ? 125 SER B N   1 
ATOM   5204 C  CA  . SER B 1 125 ? -4.892  -4.642  -17.538 1.00 34.16 ? 125 SER B CA  1 
ATOM   5205 C  C   . SER B 1 125 ? -4.439  -5.918  -18.234 1.00 34.50 ? 125 SER B C   1 
ATOM   5206 O  O   . SER B 1 125 ? -5.157  -6.920  -18.261 1.00 36.52 ? 125 SER B O   1 
ATOM   5207 C  CB  . SER B 1 125 ? -6.030  -3.987  -18.318 1.00 29.66 ? 125 SER B CB  1 
ATOM   5208 O  OG  . SER B 1 125 ? -5.664  -3.793  -19.680 1.00 38.53 ? 125 SER B OG  1 
ATOM   5209 N  N   . THR B 1 126 ? -3.226  -5.891  -18.769 1.00 33.75 ? 126 THR B N   1 
ATOM   5210 C  CA  . THR B 1 126 ? -2.787  -6.935  -19.693 1.00 36.77 ? 126 THR B CA  1 
ATOM   5211 C  C   . THR B 1 126 ? -1.844  -7.974  -19.085 1.00 38.15 ? 126 THR B C   1 
ATOM   5212 O  O   . THR B 1 126 ? -1.376  -8.874  -19.790 1.00 35.59 ? 126 THR B O   1 
ATOM   5213 C  CB  . THR B 1 126 ? -2.104  -6.311  -20.898 1.00 35.48 ? 126 THR B CB  1 
ATOM   5214 O  OG1 . THR B 1 126 ? -1.034  -5.489  -20.434 1.00 35.51 ? 126 THR B OG1 1 
ATOM   5215 C  CG2 . THR B 1 126 ? -3.097  -5.439  -21.654 1.00 33.44 ? 126 THR B CG2 1 
ATOM   5216 N  N   . LEU B 1 127 ? -1.592  -7.867  -17.781 1.00 33.40 ? 127 LEU B N   1 
ATOM   5217 C  CA  . LEU B 1 127 ? -0.753  -8.832  -17.092 1.00 35.34 ? 127 LEU B CA  1 
ATOM   5218 C  C   . LEU B 1 127 ? -1.281  -10.242 -17.294 1.00 36.42 ? 127 LEU B C   1 
ATOM   5219 O  O   . LEU B 1 127 ? -2.495  -10.450 -17.348 1.00 35.41 ? 127 LEU B O   1 
ATOM   5220 C  CB  . LEU B 1 127 ? -0.675  -8.521  -15.594 1.00 32.46 ? 127 LEU B CB  1 
ATOM   5221 C  CG  . LEU B 1 127 ? -0.119  -7.156  -15.201 1.00 34.51 ? 127 LEU B CG  1 
ATOM   5222 C  CD1 . LEU B 1 127 ? 0.108   -7.092  -13.703 1.00 34.87 ? 127 LEU B CD1 1 
ATOM   5223 C  CD2 . LEU B 1 127 ? 1.172   -6.879  -15.953 1.00 36.21 ? 127 LEU B CD2 1 
ATOM   5224 N  N   . ASP B 1 128 ? -0.359  -11.195 -17.408 1.00 38.59 ? 128 ASP B N   1 
ATOM   5225 C  CA  . ASP B 1 128 ? -0.674  -12.622 -17.438 1.00 38.73 ? 128 ASP B CA  1 
ATOM   5226 C  C   . ASP B 1 128 ? -1.626  -13.047 -16.323 1.00 37.61 ? 128 ASP B C   1 
ATOM   5227 O  O   . ASP B 1 128 ? -2.532  -13.845 -16.549 1.00 38.85 ? 128 ASP B O   1 
ATOM   5228 C  CB  . ASP B 1 128 ? 0.606   -13.457 -17.320 1.00 40.49 ? 128 ASP B CB  1 
ATOM   5229 C  CG  . ASP B 1 128 ? 1.449   -13.423 -18.568 1.00 45.82 ? 128 ASP B CG  1 
ATOM   5230 O  OD1 . ASP B 1 128 ? 1.084   -12.707 -19.526 1.00 44.87 ? 128 ASP B OD1 1 
ATOM   5231 O  OD2 . ASP B 1 128 ? 2.487   -14.119 -18.582 1.00 49.96 ? 128 ASP B OD2 1 
ATOM   5232 N  N   . VAL B 1 129 ? -1.406  -12.537 -15.113 1.00 35.88 ? 129 VAL B N   1 
ATOM   5233 C  CA  . VAL B 1 129 ? -2.208  -12.976 -13.966 1.00 35.51 ? 129 VAL B CA  1 
ATOM   5234 C  C   . VAL B 1 129 ? -3.616  -12.368 -13.995 1.00 36.32 ? 129 VAL B C   1 
ATOM   5235 O  O   . VAL B 1 129 ? -4.495  -12.790 -13.236 1.00 38.10 ? 129 VAL B O   1 
ATOM   5236 C  CB  . VAL B 1 129 ? -1.497  -12.649 -12.611 1.00 35.42 ? 129 VAL B CB  1 
ATOM   5237 C  CG1 . VAL B 1 129 ? -1.493  -11.157 -12.322 1.00 34.53 ? 129 VAL B CG1 1 
ATOM   5238 C  CG2 . VAL B 1 129 ? -2.138  -13.407 -11.482 1.00 35.26 ? 129 VAL B CG2 1 
ATOM   5239 N  N   . TYR B 1 130 ? -3.852  -11.398 -14.881 1.00 37.52 ? 130 TYR B N   1 
ATOM   5240 C  CA  . TYR B 1 130 ? -5.202  -10.835 -15.028 1.00 33.49 ? 130 TYR B CA  1 
ATOM   5241 C  C   . TYR B 1 130 ? -5.945  -11.393 -16.248 1.00 36.19 ? 130 TYR B C   1 
ATOM   5242 O  O   . TYR B 1 130 ? -6.999  -10.877 -16.614 1.00 36.70 ? 130 TYR B O   1 
ATOM   5243 C  CB  . TYR B 1 130 ? -5.169  -9.310  -15.152 1.00 32.15 ? 130 TYR B CB  1 
ATOM   5244 C  CG  . TYR B 1 130 ? -4.501  -8.576  -14.021 1.00 34.61 ? 130 TYR B CG  1 
ATOM   5245 C  CD1 . TYR B 1 130 ? -4.436  -9.120  -12.739 1.00 29.85 ? 130 TYR B CD1 1 
ATOM   5246 C  CD2 . TYR B 1 130 ? -3.937  -7.330  -14.235 1.00 33.75 ? 130 TYR B CD2 1 
ATOM   5247 C  CE1 . TYR B 1 130 ? -3.800  -8.439  -11.713 1.00 33.60 ? 130 TYR B CE1 1 
ATOM   5248 C  CE2 . TYR B 1 130 ? -3.314  -6.637  -13.220 1.00 35.48 ? 130 TYR B CE2 1 
ATOM   5249 C  CZ  . TYR B 1 130 ? -3.244  -7.194  -11.959 1.00 34.62 ? 130 TYR B CZ  1 
ATOM   5250 O  OH  . TYR B 1 130 ? -2.614  -6.497  -10.956 1.00 32.07 ? 130 TYR B OH  1 
ATOM   5251 N  N   . ASN B 1 131 ? -5.392  -12.424 -16.881 1.00 35.81 ? 131 ASN B N   1 
ATOM   5252 C  CA  . ASN B 1 131 ? -6.018  -13.042 -18.048 1.00 35.75 ? 131 ASN B CA  1 
ATOM   5253 C  C   . ASN B 1 131 ? -7.408  -13.570 -17.729 1.00 37.15 ? 131 ASN B C   1 
ATOM   5254 O  O   . ASN B 1 131 ? -7.550  -14.512 -16.956 1.00 37.27 ? 131 ASN B O   1 
ATOM   5255 C  CB  . ASN B 1 131 ? -5.145  -14.177 -18.573 1.00 38.37 ? 131 ASN B CB  1 
ATOM   5256 C  CG  . ASN B 1 131 ? -5.587  -14.671 -19.932 1.00 39.74 ? 131 ASN B CG  1 
ATOM   5257 O  OD1 . ASN B 1 131 ? -6.699  -14.384 -20.382 1.00 37.33 ? 131 ASN B OD1 1 
ATOM   5258 N  ND2 . ASN B 1 131 ? -4.718  -15.427 -20.593 1.00 42.83 ? 131 ASN B ND2 1 
ATOM   5259 N  N   . GLY B 1 132 ? -8.427  -12.980 -18.342 1.00 34.30 ? 132 GLY B N   1 
ATOM   5260 C  CA  . GLY B 1 132 ? -9.799  -13.228 -17.926 1.00 37.79 ? 132 GLY B CA  1 
ATOM   5261 C  C   . GLY B 1 132 ? -10.469 -14.484 -18.452 1.00 36.07 ? 132 GLY B C   1 
ATOM   5262 O  O   . GLY B 1 132 ? -11.575 -14.821 -18.036 1.00 32.17 ? 132 GLY B O   1 
ATOM   5263 N  N   . LYS B 1 133 ? -9.804  -15.188 -19.358 1.00 37.90 ? 133 LYS B N   1 
ATOM   5264 C  CA  . LYS B 1 133 ? -10.469 -16.276 -20.060 1.00 37.37 ? 133 LYS B CA  1 
ATOM   5265 C  C   . LYS B 1 133 ? -10.846 -17.439 -19.134 1.00 35.44 ? 133 LYS B C   1 
ATOM   5266 O  O   . LYS B 1 133 ? -11.880 -18.063 -19.325 1.00 36.96 ? 133 LYS B O   1 
ATOM   5267 C  CB  . LYS B 1 133 ? -9.599  -16.774 -21.224 1.00 36.72 ? 133 LYS B CB  1 
ATOM   5268 C  CG  . LYS B 1 133 ? -8.371  -17.589 -20.844 1.00 36.70 ? 133 LYS B CG  1 
ATOM   5269 C  CD  . LYS B 1 133 ? -7.550  -17.903 -22.107 1.00 40.64 ? 133 LYS B CD  1 
ATOM   5270 C  CE  . LYS B 1 133 ? -6.321  -18.759 -21.813 1.00 42.91 ? 133 LYS B CE  1 
ATOM   5271 N  NZ  . LYS B 1 133 ? -5.576  -19.121 -23.051 1.00 42.42 ? 133 LYS B NZ  1 
ATOM   5272 N  N   . TYR B 1 134 ? -10.030 -17.725 -18.123 1.00 39.62 ? 134 TYR B N   1 
ATOM   5273 C  CA  . TYR B 1 134 ? -10.288 -18.888 -17.264 1.00 37.32 ? 134 TYR B CA  1 
ATOM   5274 C  C   . TYR B 1 134 ? -11.528 -18.691 -16.406 1.00 35.27 ? 134 TYR B C   1 
ATOM   5275 O  O   . TYR B 1 134 ? -12.355 -19.598 -16.260 1.00 35.58 ? 134 TYR B O   1 
ATOM   5276 C  CB  . TYR B 1 134 ? -9.082  -19.185 -16.379 1.00 36.86 ? 134 TYR B CB  1 
ATOM   5277 C  CG  . TYR B 1 134 ? -7.797  -19.338 -17.156 1.00 34.89 ? 134 TYR B CG  1 
ATOM   5278 C  CD1 . TYR B 1 134 ? -7.584  -20.439 -17.977 1.00 31.21 ? 134 TYR B CD1 1 
ATOM   5279 C  CD2 . TYR B 1 134 ? -6.792  -18.381 -17.069 1.00 39.36 ? 134 TYR B CD2 1 
ATOM   5280 C  CE1 . TYR B 1 134 ? -6.410  -20.583 -18.692 1.00 35.47 ? 134 TYR B CE1 1 
ATOM   5281 C  CE2 . TYR B 1 134 ? -5.606  -18.516 -17.790 1.00 37.26 ? 134 TYR B CE2 1 
ATOM   5282 C  CZ  . TYR B 1 134 ? -5.425  -19.619 -18.596 1.00 35.71 ? 134 TYR B CZ  1 
ATOM   5283 O  OH  . TYR B 1 134 ? -4.255  -19.756 -19.310 1.00 43.80 ? 134 TYR B OH  1 
ATOM   5284 N  N   . LEU B 1 135 ? -11.661 -17.499 -15.841 1.00 36.03 ? 135 LEU B N   1 
ATOM   5285 C  CA  . LEU B 1 135 ? -12.811 -17.183 -15.005 1.00 36.81 ? 135 LEU B CA  1 
ATOM   5286 C  C   . LEU B 1 135 ? -14.061 -17.030 -15.866 1.00 37.49 ? 135 LEU B C   1 
ATOM   5287 O  O   . LEU B 1 135 ? -15.130 -17.519 -15.522 1.00 36.54 ? 135 LEU B O   1 
ATOM   5288 C  CB  . LEU B 1 135 ? -12.530 -15.911 -14.207 1.00 37.44 ? 135 LEU B CB  1 
ATOM   5289 C  CG  . LEU B 1 135 ? -13.503 -15.291 -13.203 1.00 38.28 ? 135 LEU B CG  1 
ATOM   5290 C  CD1 . LEU B 1 135 ? -14.060 -16.307 -12.196 1.00 36.32 ? 135 LEU B CD1 1 
ATOM   5291 C  CD2 . LEU B 1 135 ? -12.743 -14.187 -12.486 1.00 34.60 ? 135 LEU B CD2 1 
ATOM   5292 N  N   . ALA B 1 136 ? -13.910 -16.368 -17.007 1.00 38.30 ? 136 ALA B N   1 
ATOM   5293 C  CA  . ALA B 1 136 ? -15.047 -16.107 -17.882 1.00 36.84 ? 136 ALA B CA  1 
ATOM   5294 C  C   . ALA B 1 136 ? -15.604 -17.426 -18.380 1.00 35.24 ? 136 ALA B C   1 
ATOM   5295 O  O   . ALA B 1 136 ? -16.815 -17.646 -18.391 1.00 34.96 ? 136 ALA B O   1 
ATOM   5296 C  CB  . ALA B 1 136 ? -14.637 -15.222 -19.033 1.00 33.32 ? 136 ALA B CB  1 
ATOM   5297 N  N   . TYR B 1 137 ? -14.700 -18.323 -18.739 1.00 34.09 ? 137 TYR B N   1 
ATOM   5298 C  CA  . TYR B 1 137 ? -15.090 -19.608 -19.281 1.00 36.78 ? 137 TYR B CA  1 
ATOM   5299 C  C   . TYR B 1 137 ? -15.679 -20.483 -18.193 1.00 39.02 ? 137 TYR B C   1 
ATOM   5300 O  O   . TYR B 1 137 ? -16.795 -20.964 -18.310 1.00 39.69 ? 137 TYR B O   1 
ATOM   5301 C  CB  . TYR B 1 137 ? -13.890 -20.286 -19.932 1.00 40.56 ? 137 TYR B CB  1 
ATOM   5302 C  CG  . TYR B 1 137 ? -14.089 -21.748 -20.236 1.00 43.69 ? 137 TYR B CG  1 
ATOM   5303 C  CD1 . TYR B 1 137 ? -14.805 -22.153 -21.351 1.00 43.97 ? 137 TYR B CD1 1 
ATOM   5304 C  CD2 . TYR B 1 137 ? -13.535 -22.727 -19.419 1.00 44.57 ? 137 TYR B CD2 1 
ATOM   5305 C  CE1 . TYR B 1 137 ? -14.983 -23.488 -21.633 1.00 45.29 ? 137 TYR B CE1 1 
ATOM   5306 C  CE2 . TYR B 1 137 ? -13.704 -24.067 -19.695 1.00 44.42 ? 137 TYR B CE2 1 
ATOM   5307 C  CZ  . TYR B 1 137 ? -14.431 -24.441 -20.802 1.00 49.69 ? 137 TYR B CZ  1 
ATOM   5308 O  OH  . TYR B 1 137 ? -14.601 -25.776 -21.079 1.00 53.13 ? 137 TYR B OH  1 
ATOM   5309 N  N   . THR B 1 138 ? -14.928 -20.659 -17.114 1.00 40.38 ? 138 THR B N   1 
ATOM   5310 C  CA  . THR B 1 138 ? -15.310 -21.572 -16.043 1.00 36.64 ? 138 THR B CA  1 
ATOM   5311 C  C   . THR B 1 138 ? -16.620 -21.203 -15.341 1.00 36.40 ? 138 THR B C   1 
ATOM   5312 O  O   . THR B 1 138 ? -17.411 -22.080 -14.999 1.00 37.18 ? 138 THR B O   1 
ATOM   5313 C  CB  . THR B 1 138 ? -14.186 -21.663 -14.985 1.00 38.63 ? 138 THR B CB  1 
ATOM   5314 O  OG1 . THR B 1 138 ? -13.006 -22.226 -15.584 1.00 35.53 ? 138 THR B OG1 1 
ATOM   5315 C  CG2 . THR B 1 138 ? -14.627 -22.534 -13.811 1.00 39.53 ? 138 THR B CG2 1 
ATOM   5316 N  N   . GLU B 1 139 ? -16.856 -19.915 -15.118 1.00 34.22 ? 139 GLU B N   1 
ATOM   5317 C  CA  . GLU B 1 139 ? -18.024 -19.509 -14.348 1.00 36.87 ? 139 GLU B CA  1 
ATOM   5318 C  C   . GLU B 1 139 ? -19.087 -18.869 -15.221 1.00 35.42 ? 139 GLU B C   1 
ATOM   5319 O  O   . GLU B 1 139 ? -20.095 -18.391 -14.715 1.00 37.10 ? 139 GLU B O   1 
ATOM   5320 C  CB  . GLU B 1 139 ? -17.620 -18.544 -13.227 1.00 36.05 ? 139 GLU B CB  1 
ATOM   5321 C  CG  . GLU B 1 139 ? -16.725 -19.172 -12.164 1.00 35.35 ? 139 GLU B CG  1 
ATOM   5322 C  CD  . GLU B 1 139 ? -17.428 -20.267 -11.382 1.00 37.35 ? 139 GLU B CD  1 
ATOM   5323 O  OE1 . GLU B 1 139 ? -18.641 -20.128 -11.121 1.00 38.81 ? 139 GLU B OE1 1 
ATOM   5324 O  OE2 . GLU B 1 139 ? -16.773 -21.269 -11.029 1.00 37.39 ? 139 GLU B OE2 1 
ATOM   5325 N  N   . GLU B 1 140 ? -18.844 -18.857 -16.528 1.00 37.47 ? 140 GLU B N   1 
ATOM   5326 C  CA  . GLU B 1 140 ? -19.792 -18.326 -17.496 1.00 37.46 ? 140 GLU B CA  1 
ATOM   5327 C  C   . GLU B 1 140 ? -20.230 -16.918 -17.141 1.00 38.30 ? 140 GLU B C   1 
ATOM   5328 O  O   . GLU B 1 140 ? -21.415 -16.653 -16.976 1.00 37.39 ? 140 GLU B O   1 
ATOM   5329 C  CB  . GLU B 1 140 ? -21.007 -19.232 -17.598 1.00 38.67 ? 140 GLU B CB  1 
ATOM   5330 C  CG  . GLU B 1 140 ? -20.669 -20.668 -17.917 1.00 45.10 ? 140 GLU B CG  1 
ATOM   5331 C  CD  . GLU B 1 140 ? -21.822 -21.380 -18.594 1.00 58.63 ? 140 GLU B CD  1 
ATOM   5332 O  OE1 . GLU B 1 140 ? -22.921 -21.410 -18.004 1.00 62.17 ? 140 GLU B OE1 1 
ATOM   5333 O  OE2 . GLU B 1 140 ? -21.633 -21.886 -19.725 1.00 61.88 ? 140 GLU B OE2 1 
ATOM   5334 N  N   . VAL B 1 141 ? -19.263 -16.022 -17.007 1.00 36.00 ? 141 VAL B N   1 
ATOM   5335 C  CA  . VAL B 1 141 ? -19.557 -14.624 -16.754 1.00 34.22 ? 141 VAL B CA  1 
ATOM   5336 C  C   . VAL B 1 141 ? -18.909 -13.799 -17.844 1.00 34.93 ? 141 VAL B C   1 
ATOM   5337 O  O   . VAL B 1 141 ? -17.932 -14.219 -18.453 1.00 35.09 ? 141 VAL B O   1 
ATOM   5338 C  CB  . VAL B 1 141 ? -19.038 -14.140 -15.363 1.00 35.08 ? 141 VAL B CB  1 
ATOM   5339 C  CG1 . VAL B 1 141 ? -19.654 -14.955 -14.239 1.00 34.47 ? 141 VAL B CG1 1 
ATOM   5340 C  CG2 . VAL B 1 141 ? -17.518 -14.201 -15.299 1.00 30.73 ? 141 VAL B CG2 1 
ATOM   5341 N  N   . VAL B 1 142 ? -19.453 -12.617 -18.084 1.00 35.01 ? 142 VAL B N   1 
ATOM   5342 C  CA  . VAL B 1 142 ? -18.807 -11.658 -18.956 1.00 37.17 ? 142 VAL B CA  1 
ATOM   5343 C  C   . VAL B 1 142 ? -17.793 -10.857 -18.161 1.00 32.84 ? 142 VAL B C   1 
ATOM   5344 O  O   . VAL B 1 142 ? -18.173 -10.034 -17.333 1.00 35.38 ? 142 VAL B O   1 
ATOM   5345 C  CB  . VAL B 1 142 ? -19.827 -10.696 -19.594 1.00 36.45 ? 142 VAL B CB  1 
ATOM   5346 C  CG1 . VAL B 1 142 ? -19.100 -9.605  -20.346 1.00 34.26 ? 142 VAL B CG1 1 
ATOM   5347 C  CG2 . VAL B 1 142 ? -20.763 -11.459 -20.511 1.00 37.11 ? 142 VAL B CG2 1 
ATOM   5348 N  N   . LEU B 1 143 ? -16.508 -11.078 -18.423 1.00 37.16 ? 143 LEU B N   1 
ATOM   5349 C  CA  . LEU B 1 143 ? -15.459 -10.427 -17.648 1.00 34.68 ? 143 LEU B CA  1 
ATOM   5350 C  C   . LEU B 1 143 ? -14.797 -9.264  -18.381 1.00 35.42 ? 143 LEU B C   1 
ATOM   5351 O  O   . LEU B 1 143 ? -14.226 -9.434  -19.460 1.00 33.05 ? 143 LEU B O   1 
ATOM   5352 C  CB  . LEU B 1 143 ? -14.394 -11.447 -17.252 1.00 36.56 ? 143 LEU B CB  1 
ATOM   5353 C  CG  . LEU B 1 143 ? -13.244 -10.943 -16.378 1.00 34.84 ? 143 LEU B CG  1 
ATOM   5354 C  CD1 . LEU B 1 143 ? -13.721 -10.614 -14.982 1.00 37.67 ? 143 LEU B CD1 1 
ATOM   5355 C  CD2 . LEU B 1 143 ? -12.189 -11.997 -16.308 1.00 41.43 ? 143 LEU B CD2 1 
ATOM   5356 N  N   . VAL B 1 144 ? -14.864 -8.087  -17.769 1.00 34.95 ? 144 VAL B N   1 
ATOM   5357 C  CA  . VAL B 1 144 ? -14.206 -6.895  -18.293 1.00 31.93 ? 144 VAL B CA  1 
ATOM   5358 C  C   . VAL B 1 144 ? -12.986 -6.516  -17.438 1.00 31.39 ? 144 VAL B C   1 
ATOM   5359 O  O   . VAL B 1 144 ? -13.034 -6.619  -16.211 1.00 29.21 ? 144 VAL B O   1 
ATOM   5360 C  CB  . VAL B 1 144 ? -15.164 -5.701  -18.327 1.00 33.81 ? 144 VAL B CB  1 
ATOM   5361 C  CG1 . VAL B 1 144 ? -14.467 -4.493  -18.897 1.00 29.93 ? 144 VAL B CG1 1 
ATOM   5362 C  CG2 . VAL B 1 144 ? -16.446 -6.039  -19.139 1.00 34.98 ? 144 VAL B CG2 1 
ATOM   5363 N  N   . SER B 1 145 ? -11.892 -6.107  -18.080 1.00 29.25 ? 145 SER B N   1 
ATOM   5364 C  CA  . SER B 1 145 ? -10.787 -5.486  -17.351 1.00 33.37 ? 145 SER B CA  1 
ATOM   5365 C  C   . SER B 1 145 ? -10.555 -4.098  -17.918 1.00 33.17 ? 145 SER B C   1 
ATOM   5366 O  O   . SER B 1 145 ? -10.337 -3.937  -19.118 1.00 34.40 ? 145 SER B O   1 
ATOM   5367 C  CB  . SER B 1 145 ? -9.503  -6.332  -17.403 1.00 32.05 ? 145 SER B CB  1 
ATOM   5368 O  OG  . SER B 1 145 ? -9.123  -6.681  -18.723 1.00 32.84 ? 145 SER B OG  1 
ATOM   5369 N  N   . LEU B 1 146 ? -10.633 -3.084  -17.063 1.00 32.62 ? 146 LEU B N   1 
ATOM   5370 C  CA  . LEU B 1 146 ? -10.477 -1.720  -17.540 1.00 29.32 ? 146 LEU B CA  1 
ATOM   5371 C  C   . LEU B 1 146 ? -9.050  -1.250  -17.320 1.00 32.11 ? 146 LEU B C   1 
ATOM   5372 O  O   . LEU B 1 146 ? -8.197  -2.021  -16.887 1.00 35.26 ? 146 LEU B O   1 
ATOM   5373 C  CB  . LEU B 1 146 ? -11.474 -0.791  -16.854 1.00 29.34 ? 146 LEU B CB  1 
ATOM   5374 C  CG  . LEU B 1 146 ? -11.512 -0.704  -15.324 1.00 31.24 ? 146 LEU B CG  1 
ATOM   5375 C  CD1 . LEU B 1 146 ? -10.323 0.091   -14.759 1.00 30.39 ? 146 LEU B CD1 1 
ATOM   5376 C  CD2 . LEU B 1 146 ? -12.828 -0.087  -14.893 1.00 29.27 ? 146 LEU B CD2 1 
ATOM   5377 N  N   . SER B 1 147 ? -8.790  0.016   -17.615 1.00 29.50 ? 147 SER B N   1 
ATOM   5378 C  CA  . SER B 1 147 ? -7.493  0.608   -17.340 1.00 26.77 ? 147 SER B CA  1 
ATOM   5379 C  C   . SER B 1 147 ? -7.733  2.037   -16.932 1.00 31.28 ? 147 SER B C   1 
ATOM   5380 O  O   . SER B 1 147 ? -8.837  2.544   -17.100 1.00 30.82 ? 147 SER B O   1 
ATOM   5381 C  CB  . SER B 1 147 ? -6.580  0.546   -18.561 1.00 32.79 ? 147 SER B CB  1 
ATOM   5382 O  OG  . SER B 1 147 ? -7.237  1.078   -19.704 1.00 35.14 ? 147 SER B OG  1 
ATOM   5383 N  N   . TYR B 1 148 ? -6.711  2.686   -16.389 1.00 30.26 ? 148 TYR B N   1 
ATOM   5384 C  CA  . TYR B 1 148 ? -6.838  4.062   -15.936 1.00 30.82 ? 148 TYR B CA  1 
ATOM   5385 C  C   . TYR B 1 148 ? -5.446  4.660   -15.788 1.00 31.05 ? 148 TYR B C   1 
ATOM   5386 O  O   . TYR B 1 148 ? -4.470  3.953   -15.524 1.00 28.47 ? 148 TYR B O   1 
ATOM   5387 C  CB  . TYR B 1 148 ? -7.627  4.153   -14.608 1.00 30.43 ? 148 TYR B CB  1 
ATOM   5388 C  CG  . TYR B 1 148 ? -7.019  3.371   -13.460 1.00 31.93 ? 148 TYR B CG  1 
ATOM   5389 C  CD1 . TYR B 1 148 ? -7.170  1.993   -13.381 1.00 30.77 ? 148 TYR B CD1 1 
ATOM   5390 C  CD2 . TYR B 1 148 ? -6.287  4.011   -12.459 1.00 31.35 ? 148 TYR B CD2 1 
ATOM   5391 C  CE1 . TYR B 1 148 ? -6.618  1.274   -12.347 1.00 31.07 ? 148 TYR B CE1 1 
ATOM   5392 C  CE2 . TYR B 1 148 ? -5.727  3.291   -11.405 1.00 32.21 ? 148 TYR B CE2 1 
ATOM   5393 C  CZ  . TYR B 1 148 ? -5.896  1.918   -11.361 1.00 32.93 ? 148 TYR B CZ  1 
ATOM   5394 O  OH  . TYR B 1 148 ? -5.352  1.182   -10.324 1.00 30.59 ? 148 TYR B OH  1 
ATOM   5395 N  N   . ARG B 1 149 ? -5.361  5.968   -15.980 1.00 32.59 ? 149 ARG B N   1 
ATOM   5396 C  CA  . ARG B 1 149 ? -4.104  6.674   -15.839 1.00 31.97 ? 149 ARG B CA  1 
ATOM   5397 C  C   . ARG B 1 149 ? -3.583  6.548   -14.411 1.00 38.17 ? 149 ARG B C   1 
ATOM   5398 O  O   . ARG B 1 149 ? -4.345  6.625   -13.437 1.00 33.89 ? 149 ARG B O   1 
ATOM   5399 C  CB  . ARG B 1 149 ? -4.276  8.143   -16.222 1.00 34.57 ? 149 ARG B CB  1 
ATOM   5400 C  CG  . ARG B 1 149 ? -4.422  8.377   -17.727 1.00 35.94 ? 149 ARG B CG  1 
ATOM   5401 C  CD  . ARG B 1 149 ? -4.800  9.819   -18.025 1.00 36.68 ? 149 ARG B CD  1 
ATOM   5402 N  NE  . ARG B 1 149 ? -6.230  10.058  -17.839 1.00 37.00 ? 149 ARG B NE  1 
ATOM   5403 C  CZ  . ARG B 1 149 ? -6.791  11.263  -17.829 1.00 41.61 ? 149 ARG B CZ  1 
ATOM   5404 N  NH1 . ARG B 1 149 ? -6.037  12.346  -17.983 1.00 39.13 ? 149 ARG B NH1 1 
ATOM   5405 N  NH2 . ARG B 1 149 ? -8.106  11.387  -17.651 1.00 40.13 ? 149 ARG B NH2 1 
ATOM   5406 N  N   . VAL B 1 150 ? -2.274  6.354   -14.291 1.00 36.14 ? 150 VAL B N   1 
ATOM   5407 C  CA  . VAL B 1 150 ? -1.653  6.206   -12.994 1.00 36.11 ? 150 VAL B CA  1 
ATOM   5408 C  C   . VAL B 1 150 ? -0.579  7.280   -12.810 1.00 37.34 ? 150 VAL B C   1 
ATOM   5409 O  O   . VAL B 1 150 ? -0.293  8.041   -13.739 1.00 37.29 ? 150 VAL B O   1 
ATOM   5410 C  CB  . VAL B 1 150 ? -1.058  4.797   -12.839 1.00 37.55 ? 150 VAL B CB  1 
ATOM   5411 C  CG1 . VAL B 1 150 ? -2.172  3.768   -12.605 1.00 31.46 ? 150 VAL B CG1 1 
ATOM   5412 C  CG2 . VAL B 1 150 ? -0.241  4.436   -14.074 1.00 33.05 ? 150 VAL B CG2 1 
ATOM   5413 N  N   . GLY B 1 151 ? 0.008   7.338   -11.616 1.00 36.37 ? 151 GLY B N   1 
ATOM   5414 C  CA  . GLY B 1 151 ? 1.015   8.335   -11.290 1.00 33.70 ? 151 GLY B CA  1 
ATOM   5415 C  C   . GLY B 1 151 ? 0.501   9.748   -11.495 1.00 39.57 ? 151 GLY B C   1 
ATOM   5416 O  O   . GLY B 1 151 ? -0.704  10.006  -11.387 1.00 38.97 ? 151 GLY B O   1 
ATOM   5417 N  N   . ALA B 1 152 ? 1.419   10.662  -11.803 1.00 39.58 ? 152 ALA B N   1 
ATOM   5418 C  CA  . ALA B 1 152 ? 1.074   12.053  -12.083 1.00 38.13 ? 152 ALA B CA  1 
ATOM   5419 C  C   . ALA B 1 152 ? 0.036   12.191  -13.200 1.00 35.92 ? 152 ALA B C   1 
ATOM   5420 O  O   . ALA B 1 152 ? -0.779  13.104  -13.183 1.00 36.00 ? 152 ALA B O   1 
ATOM   5421 C  CB  . ALA B 1 152 ? 2.323   12.838  -12.441 1.00 37.32 ? 152 ALA B CB  1 
ATOM   5422 N  N   . PHE B 1 153 ? 0.071   11.292  -14.172 1.00 36.84 ? 153 PHE B N   1 
ATOM   5423 C  CA  . PHE B 1 153 ? -0.837  11.396  -15.309 1.00 39.77 ? 153 PHE B CA  1 
ATOM   5424 C  C   . PHE B 1 153 ? -2.286  11.176  -14.864 1.00 38.87 ? 153 PHE B C   1 
ATOM   5425 O  O   . PHE B 1 153 ? -3.217  11.781  -15.400 1.00 38.40 ? 153 PHE B O   1 
ATOM   5426 C  CB  . PHE B 1 153 ? -0.416  10.404  -16.399 1.00 36.00 ? 153 PHE B CB  1 
ATOM   5427 C  CG  . PHE B 1 153 ? 1.047   10.490  -16.728 1.00 43.28 ? 153 PHE B CG  1 
ATOM   5428 C  CD1 . PHE B 1 153 ? 1.521   11.485  -17.562 1.00 40.75 ? 153 PHE B CD1 1 
ATOM   5429 C  CD2 . PHE B 1 153 ? 1.957   9.622   -16.145 1.00 39.95 ? 153 PHE B CD2 1 
ATOM   5430 C  CE1 . PHE B 1 153 ? 2.880   11.589  -17.833 1.00 43.79 ? 153 PHE B CE1 1 
ATOM   5431 C  CE2 . PHE B 1 153 ? 3.311   9.722   -16.416 1.00 40.67 ? 153 PHE B CE2 1 
ATOM   5432 C  CZ  . PHE B 1 153 ? 3.773   10.704  -17.260 1.00 38.86 ? 153 PHE B CZ  1 
ATOM   5433 N  N   . GLY B 1 154 ? -2.468  10.335  -13.856 1.00 37.67 ? 154 GLY B N   1 
ATOM   5434 C  CA  . GLY B 1 154 ? -3.800  10.040  -13.363 1.00 35.80 ? 154 GLY B CA  1 
ATOM   5435 C  C   . GLY B 1 154 ? -4.213  10.823  -12.133 1.00 34.72 ? 154 GLY B C   1 
ATOM   5436 O  O   . GLY B 1 154 ? -5.407  10.915  -11.831 1.00 37.88 ? 154 GLY B O   1 
ATOM   5437 N  N   . PHE B 1 155 ? -3.266  11.388  -11.396 1.00 34.10 ? 155 PHE B N   1 
ATOM   5438 C  CA  . PHE B 1 155 ? -3.657  11.924  -10.088 1.00 36.40 ? 155 PHE B CA  1 
ATOM   5439 C  C   . PHE B 1 155 ? -2.920  13.183  -9.633  1.00 38.12 ? 155 PHE B C   1 
ATOM   5440 O  O   . PHE B 1 155 ? -2.953  13.531  -8.445  1.00 36.33 ? 155 PHE B O   1 
ATOM   5441 C  CB  . PHE B 1 155 ? -3.510  10.818  -9.030  1.00 32.55 ? 155 PHE B CB  1 
ATOM   5442 C  CG  . PHE B 1 155 ? -4.402  9.641   -9.286  1.00 32.69 ? 155 PHE B CG  1 
ATOM   5443 C  CD1 . PHE B 1 155 ? -5.739  9.686   -8.939  1.00 33.53 ? 155 PHE B CD1 1 
ATOM   5444 C  CD2 . PHE B 1 155 ? -3.920  8.514   -9.923  1.00 33.86 ? 155 PHE B CD2 1 
ATOM   5445 C  CE1 . PHE B 1 155 ? -6.571  8.618   -9.197  1.00 33.23 ? 155 PHE B CE1 1 
ATOM   5446 C  CE2 . PHE B 1 155 ? -4.746  7.442   -10.184 1.00 34.91 ? 155 PHE B CE2 1 
ATOM   5447 C  CZ  . PHE B 1 155 ? -6.075  7.496   -9.824  1.00 32.44 ? 155 PHE B CZ  1 
ATOM   5448 N  N   . LEU B 1 156 ? -2.274  13.875  -10.568 1.00 35.18 ? 156 LEU B N   1 
ATOM   5449 C  CA  . LEU B 1 156 ? -1.766  15.209  -10.270 1.00 39.11 ? 156 LEU B CA  1 
ATOM   5450 C  C   . LEU B 1 156 ? -2.941  16.061  -9.809  1.00 37.19 ? 156 LEU B C   1 
ATOM   5451 O  O   . LEU B 1 156 ? -3.950  16.132  -10.488 1.00 33.06 ? 156 LEU B O   1 
ATOM   5452 C  CB  . LEU B 1 156 ? -1.096  15.833  -11.496 1.00 41.41 ? 156 LEU B CB  1 
ATOM   5453 C  CG  . LEU B 1 156 ? -0.461  17.210  -11.279 1.00 40.36 ? 156 LEU B CG  1 
ATOM   5454 C  CD1 . LEU B 1 156 ? 0.946   17.064  -10.744 1.00 39.05 ? 156 LEU B CD1 1 
ATOM   5455 C  CD2 . LEU B 1 156 ? -0.476  18.032  -12.563 1.00 42.27 ? 156 LEU B CD2 1 
ATOM   5456 N  N   . ALA B 1 157 ? -2.845  16.680  -8.639  1.00 40.90 ? 157 ALA B N   1 
ATOM   5457 C  CA  . ALA B 1 157 ? -3.986  17.451  -8.152  1.00 44.41 ? 157 ALA B CA  1 
ATOM   5458 C  C   . ALA B 1 157 ? -3.621  18.876  -7.764  1.00 47.28 ? 157 ALA B C   1 
ATOM   5459 O  O   . ALA B 1 157 ? -2.829  19.109  -6.849  1.00 45.20 ? 157 ALA B O   1 
ATOM   5460 C  CB  . ALA B 1 157 ? -4.646  16.738  -6.982  1.00 41.97 ? 157 ALA B CB  1 
ATOM   5461 N  N   . LEU B 1 158 ? -4.205  19.819  -8.496  1.00 47.27 ? 158 LEU B N   1 
ATOM   5462 C  CA  . LEU B 1 158 ? -4.105  21.238  -8.195  1.00 49.34 ? 158 LEU B CA  1 
ATOM   5463 C  C   . LEU B 1 158 ? -5.515  21.788  -8.002  1.00 48.51 ? 158 LEU B C   1 
ATOM   5464 O  O   . LEU B 1 158 ? -6.072  22.410  -8.903  1.00 51.57 ? 158 LEU B O   1 
ATOM   5465 C  CB  . LEU B 1 158 ? -3.373  21.979  -9.318  1.00 49.88 ? 158 LEU B CB  1 
ATOM   5466 C  CG  . LEU B 1 158 ? -1.868  21.717  -9.437  1.00 49.40 ? 158 LEU B CG  1 
ATOM   5467 C  CD1 . LEU B 1 158 ? -1.331  22.128  -10.803 1.00 42.88 ? 158 LEU B CD1 1 
ATOM   5468 C  CD2 . LEU B 1 158 ? -1.117  22.445  -8.332  1.00 46.61 ? 158 LEU B CD2 1 
ATOM   5469 N  N   . HIS B 1 159 ? -6.095  21.531  -6.832  1.00 51.58 ? 159 HIS B N   1 
ATOM   5470 C  CA  . HIS B 1 159 ? -7.499  21.845  -6.566  1.00 51.17 ? 159 HIS B CA  1 
ATOM   5471 C  C   . HIS B 1 159 ? -7.820  23.299  -6.872  1.00 51.76 ? 159 HIS B C   1 
ATOM   5472 O  O   . HIS B 1 159 ? -7.100  24.201  -6.460  1.00 53.65 ? 159 HIS B O   1 
ATOM   5473 C  CB  . HIS B 1 159 ? -7.849  21.524  -5.114  1.00 54.33 ? 159 HIS B CB  1 
ATOM   5474 C  CG  . HIS B 1 159 ? -9.297  21.708  -4.785  1.00 53.29 ? 159 HIS B CG  1 
ATOM   5475 N  ND1 . HIS B 1 159 ? -10.306 21.091  -5.492  1.00 59.14 ? 159 HIS B ND1 1 
ATOM   5476 C  CD2 . HIS B 1 159 ? -9.906  22.434  -3.818  1.00 54.21 ? 159 HIS B CD2 1 
ATOM   5477 C  CE1 . HIS B 1 159 ? -11.475 21.431  -4.977  1.00 55.48 ? 159 HIS B CE1 1 
ATOM   5478 N  NE2 . HIS B 1 159 ? -11.260 22.246  -3.961  1.00 55.81 ? 159 HIS B NE2 1 
ATOM   5479 N  N   . GLY B 1 160 ? -8.905  23.516  -7.603  1.00 53.66 ? 160 GLY B N   1 
ATOM   5480 C  CA  . GLY B 1 160 ? -9.258  24.844  -8.070  1.00 53.10 ? 160 GLY B CA  1 
ATOM   5481 C  C   . GLY B 1 160 ? -9.039  24.931  -9.565  1.00 54.77 ? 160 GLY B C   1 
ATOM   5482 O  O   . GLY B 1 160 ? -9.817  25.543  -10.291 1.00 57.89 ? 160 GLY B O   1 
ATOM   5483 N  N   . SER B 1 161 ? -7.966  24.305  -10.028 1.00 55.02 ? 161 SER B N   1 
ATOM   5484 C  CA  . SER B 1 161 ? -7.696  24.217  -11.453 1.00 52.82 ? 161 SER B CA  1 
ATOM   5485 C  C   . SER B 1 161 ? -8.656  23.249  -12.121 1.00 53.56 ? 161 SER B C   1 
ATOM   5486 O  O   . SER B 1 161 ? -8.993  22.209  -11.554 1.00 51.58 ? 161 SER B O   1 
ATOM   5487 C  CB  . SER B 1 161 ? -6.259  23.772  -11.700 1.00 49.44 ? 161 SER B CB  1 
ATOM   5488 O  OG  . SER B 1 161 ? -6.083  23.402  -13.054 1.00 55.38 ? 161 SER B OG  1 
ATOM   5489 N  N   . GLN B 1 162 ? -9.097  23.593  -13.326 1.00 56.09 ? 162 GLN B N   1 
ATOM   5490 C  CA  . GLN B 1 162 ? -9.957  22.703  -14.092 1.00 53.53 ? 162 GLN B CA  1 
ATOM   5491 C  C   . GLN B 1 162 ? -9.137  21.983  -15.148 1.00 52.09 ? 162 GLN B C   1 
ATOM   5492 O  O   . GLN B 1 162 ? -9.658  21.150  -15.891 1.00 53.82 ? 162 GLN B O   1 
ATOM   5493 C  CB  . GLN B 1 162 ? -11.108 23.474  -14.740 1.00 58.77 ? 162 GLN B CB  1 
ATOM   5494 C  CG  . GLN B 1 162 ? -12.057 24.137  -13.744 1.00 60.42 ? 162 GLN B CG  1 
ATOM   5495 C  CD  . GLN B 1 162 ? -12.815 23.134  -12.897 1.00 58.97 ? 162 GLN B CD  1 
ATOM   5496 O  OE1 . GLN B 1 162 ? -13.225 22.076  -13.378 1.00 59.86 ? 162 GLN B OE1 1 
ATOM   5497 N  NE2 . GLN B 1 162 ? -13.005 23.462  -11.622 1.00 63.90 ? 162 GLN B NE2 1 
ATOM   5498 N  N   . GLU B 1 163 ? -7.849  22.311  -15.209 1.00 51.72 ? 163 GLU B N   1 
ATOM   5499 C  CA  . GLU B 1 163 ? -6.939  21.665  -16.147 1.00 50.54 ? 163 GLU B CA  1 
ATOM   5500 C  C   . GLU B 1 163 ? -6.316  20.418  -15.519 1.00 52.38 ? 163 GLU B C   1 
ATOM   5501 O  O   . GLU B 1 163 ? -6.160  19.395  -16.188 1.00 52.50 ? 163 GLU B O   1 
ATOM   5502 C  CB  . GLU B 1 163 ? -5.856  22.642  -16.604 1.00 52.65 ? 163 GLU B CB  1 
ATOM   5503 C  CG  . GLU B 1 163 ? -6.404  23.821  -17.391 1.00 54.46 ? 163 GLU B CG  1 
ATOM   5504 C  CD  . GLU B 1 163 ? -7.125  23.391  -18.658 1.00 55.52 ? 163 GLU B CD  1 
ATOM   5505 O  OE1 . GLU B 1 163 ? -8.139  24.030  -19.010 1.00 63.49 ? 163 GLU B OE1 1 
ATOM   5506 O  OE2 . GLU B 1 163 ? -6.679  22.418  -19.304 1.00 52.54 ? 163 GLU B OE2 1 
ATOM   5507 N  N   . ALA B 1 164 ? -5.969  20.514  -14.233 1.00 49.70 ? 164 ALA B N   1 
ATOM   5508 C  CA  . ALA B 1 164 ? -5.486  19.371  -13.458 1.00 46.88 ? 164 ALA B CA  1 
ATOM   5509 C  C   . ALA B 1 164 ? -6.206  19.294  -12.107 1.00 49.59 ? 164 ALA B C   1 
ATOM   5510 O  O   . ALA B 1 164 ? -5.646  19.668  -11.076 1.00 46.95 ? 164 ALA B O   1 
ATOM   5511 C  CB  . ALA B 1 164 ? -3.992  19.461  -13.255 1.00 48.63 ? 164 ALA B CB  1 
ATOM   5512 N  N   . PRO B 1 165 ? -7.457  18.810  -12.114 1.00 47.43 ? 165 PRO B N   1 
ATOM   5513 C  CA  . PRO B 1 165 ? -8.296  18.799  -10.911 1.00 48.42 ? 165 PRO B CA  1 
ATOM   5514 C  C   . PRO B 1 165 ? -7.917  17.713  -9.899  1.00 45.06 ? 165 PRO B C   1 
ATOM   5515 O  O   . PRO B 1 165 ? -8.174  17.863  -8.702  1.00 44.68 ? 165 PRO B O   1 
ATOM   5516 C  CB  . PRO B 1 165 ? -9.696  18.541  -11.473 1.00 44.91 ? 165 PRO B CB  1 
ATOM   5517 C  CG  . PRO B 1 165 ? -9.456  17.761  -12.722 1.00 46.13 ? 165 PRO B CG  1 
ATOM   5518 C  CD  . PRO B 1 165 ? -8.177  18.302  -13.299 1.00 46.25 ? 165 PRO B CD  1 
ATOM   5519 N  N   . GLY B 1 166 ? -7.305  16.640  -10.383 1.00 43.51 ? 166 GLY B N   1 
ATOM   5520 C  CA  . GLY B 1 166 ? -7.040  15.476  -9.560  1.00 41.39 ? 166 GLY B CA  1 
ATOM   5521 C  C   . GLY B 1 166 ? -8.117  14.427  -9.755  1.00 39.58 ? 166 GLY B C   1 
ATOM   5522 O  O   . GLY B 1 166 ? -9.181  14.718  -10.292 1.00 41.46 ? 166 GLY B O   1 
ATOM   5523 N  N   . ASN B 1 167 ? -7.829  13.201  -9.338  1.00 37.66 ? 167 ASN B N   1 
ATOM   5524 C  CA  . ASN B 1 167 ? -8.774  12.098  -9.442  1.00 35.66 ? 167 ASN B CA  1 
ATOM   5525 C  C   . ASN B 1 167 ? -9.174  11.689  -10.861 1.00 38.19 ? 167 ASN B C   1 
ATOM   5526 O  O   . ASN B 1 167 ? -10.127 10.930  -11.018 1.00 35.94 ? 167 ASN B O   1 
ATOM   5527 C  CB  . ASN B 1 167 ? -10.048 12.429  -8.658  1.00 35.59 ? 167 ASN B CB  1 
ATOM   5528 C  CG  . ASN B 1 167 ? -9.812  12.472  -7.166  1.00 39.80 ? 167 ASN B CG  1 
ATOM   5529 O  OD1 . ASN B 1 167 ? -8.906  11.811  -6.653  1.00 35.93 ? 167 ASN B OD1 1 
ATOM   5530 N  ND2 . ASN B 1 167 ? -10.621 13.259  -6.456  1.00 38.43 ? 167 ASN B ND2 1 
ATOM   5531 N  N   . VAL B 1 168 ? -8.454  12.146  -11.888 1.00 37.23 ? 168 VAL B N   1 
ATOM   5532 C  CA  . VAL B 1 168 ? -8.903  11.857  -13.246 1.00 36.65 ? 168 VAL B CA  1 
ATOM   5533 C  C   . VAL B 1 168 ? -8.753  10.366  -13.558 1.00 35.40 ? 168 VAL B C   1 
ATOM   5534 O  O   . VAL B 1 168 ? -9.480  9.831   -14.391 1.00 36.50 ? 168 VAL B O   1 
ATOM   5535 C  CB  . VAL B 1 168 ? -8.166  12.724  -14.316 1.00 38.20 ? 168 VAL B CB  1 
ATOM   5536 C  CG1 . VAL B 1 168 ? -8.395  14.214  -14.043 1.00 36.50 ? 168 VAL B CG1 1 
ATOM   5537 C  CG2 . VAL B 1 168 ? -6.669  12.386  -14.406 1.00 35.13 ? 168 VAL B CG2 1 
ATOM   5538 N  N   . GLY B 1 169 ? -7.842  9.683   -12.869 1.00 34.74 ? 169 GLY B N   1 
ATOM   5539 C  CA  . GLY B 1 169 ? -7.706  8.244   -13.041 1.00 32.69 ? 169 GLY B CA  1 
ATOM   5540 C  C   . GLY B 1 169 ? -8.919  7.488   -12.508 1.00 33.41 ? 169 GLY B C   1 
ATOM   5541 O  O   . GLY B 1 169 ? -9.275  6.419   -13.002 1.00 33.82 ? 169 GLY B O   1 
ATOM   5542 N  N   . LEU B 1 170 ? -9.545  8.040   -11.476 1.00 33.99 ? 170 LEU B N   1 
ATOM   5543 C  CA  . LEU B 1 170 ? -10.771 7.466   -10.932 1.00 33.06 ? 170 LEU B CA  1 
ATOM   5544 C  C   . LEU B 1 170 ? -11.928 7.760   -11.888 1.00 34.08 ? 170 LEU B C   1 
ATOM   5545 O  O   . LEU B 1 170 ? -12.815 6.927   -12.077 1.00 33.11 ? 170 LEU B O   1 
ATOM   5546 C  CB  . LEU B 1 170 ? -11.054 8.015   -9.524  1.00 34.07 ? 170 LEU B CB  1 
ATOM   5547 C  CG  . LEU B 1 170 ? -10.257 7.425   -8.349  1.00 34.23 ? 170 LEU B CG  1 
ATOM   5548 C  CD1 . LEU B 1 170 ? -10.481 8.243   -7.100  1.00 31.57 ? 170 LEU B CD1 1 
ATOM   5549 C  CD2 . LEU B 1 170 ? -10.628 5.972   -8.083  1.00 33.10 ? 170 LEU B CD2 1 
ATOM   5550 N  N   . LEU B 1 171 ? -11.896 8.941   -12.507 1.00 34.14 ? 171 LEU B N   1 
ATOM   5551 C  CA  . LEU B 1 171 ? -12.839 9.291   -13.566 1.00 34.89 ? 171 LEU B CA  1 
ATOM   5552 C  C   . LEU B 1 171 ? -12.643 8.451   -14.829 1.00 33.88 ? 171 LEU B C   1 
ATOM   5553 O  O   . LEU B 1 171 ? -13.615 8.149   -15.514 1.00 34.21 ? 171 LEU B O   1 
ATOM   5554 C  CB  . LEU B 1 171 ? -12.728 10.773  -13.912 1.00 36.53 ? 171 LEU B CB  1 
ATOM   5555 C  CG  . LEU B 1 171 ? -13.147 11.673  -12.754 1.00 33.74 ? 171 LEU B CG  1 
ATOM   5556 C  CD1 . LEU B 1 171 ? -12.840 13.114  -13.098 1.00 37.33 ? 171 LEU B CD1 1 
ATOM   5557 C  CD2 . LEU B 1 171 ? -14.641 11.489  -12.475 1.00 33.79 ? 171 LEU B CD2 1 
ATOM   5558 N  N   . ASP B 1 172 ? -11.400 8.081   -15.144 1.00 34.43 ? 172 ASP B N   1 
ATOM   5559 C  CA  . ASP B 1 172 ? -11.166 7.125   -16.227 1.00 35.12 ? 172 ASP B CA  1 
ATOM   5560 C  C   . ASP B 1 172 ? -11.906 5.826   -15.922 1.00 33.78 ? 172 ASP B C   1 
ATOM   5561 O  O   . ASP B 1 172 ? -12.596 5.285   -16.780 1.00 34.69 ? 172 ASP B O   1 
ATOM   5562 C  CB  . ASP B 1 172 ? -9.670  6.825   -16.433 1.00 36.25 ? 172 ASP B CB  1 
ATOM   5563 C  CG  . ASP B 1 172 ? -8.850  8.062   -16.816 1.00 38.62 ? 172 ASP B CG  1 
ATOM   5564 O  OD1 . ASP B 1 172 ? -9.411  9.041   -17.355 1.00 37.40 ? 172 ASP B OD1 1 
ATOM   5565 O  OD2 . ASP B 1 172 ? -7.622  8.052   -16.567 1.00 38.18 ? 172 ASP B OD2 1 
ATOM   5566 N  N   . GLN B 1 173 ? -11.749 5.332   -14.693 1.00 33.67 ? 173 GLN B N   1 
ATOM   5567 C  CA  . GLN B 1 173 ? -12.421 4.113   -14.242 1.00 31.98 ? 173 GLN B CA  1 
ATOM   5568 C  C   . GLN B 1 173 ? -13.931 4.248   -14.421 1.00 32.01 ? 173 GLN B C   1 
ATOM   5569 O  O   . GLN B 1 173 ? -14.598 3.354   -14.939 1.00 31.42 ? 173 GLN B O   1 
ATOM   5570 C  CB  . GLN B 1 173 ? -12.109 3.825   -12.761 1.00 31.37 ? 173 GLN B CB  1 
ATOM   5571 C  CG  . GLN B 1 173 ? -10.639 3.497   -12.452 1.00 33.75 ? 173 GLN B CG  1 
ATOM   5572 C  CD  . GLN B 1 173 ? -10.409 3.216   -10.971 1.00 34.63 ? 173 GLN B CD  1 
ATOM   5573 O  OE1 . GLN B 1 173 ? -11.366 3.089   -10.193 1.00 32.32 ? 173 GLN B OE1 1 
ATOM   5574 N  NE2 . GLN B 1 173 ? -9.137  3.132   -10.570 1.00 31.81 ? 173 GLN B NE2 1 
ATOM   5575 N  N   . ARG B 1 174 ? -14.459 5.374   -13.954 1.00 33.17 ? 174 ARG B N   1 
ATOM   5576 C  CA  . ARG B 1 174 ? -15.880 5.659   -14.042 1.00 34.93 ? 174 ARG B CA  1 
ATOM   5577 C  C   . ARG B 1 174 ? -16.346 5.618   -15.494 1.00 34.95 ? 174 ARG B C   1 
ATOM   5578 O  O   . ARG B 1 174 ? -17.394 5.056   -15.790 1.00 34.78 ? 174 ARG B O   1 
ATOM   5579 C  CB  . ARG B 1 174 ? -16.198 7.022   -13.415 1.00 33.98 ? 174 ARG B CB  1 
ATOM   5580 C  CG  . ARG B 1 174 ? -17.688 7.363   -13.412 1.00 33.84 ? 174 ARG B CG  1 
ATOM   5581 C  CD  . ARG B 1 174 ? -17.924 8.775   -12.899 1.00 35.06 ? 174 ARG B CD  1 
ATOM   5582 N  NE  . ARG B 1 174 ? -17.806 8.868   -11.444 1.00 36.52 ? 174 ARG B NE  1 
ATOM   5583 C  CZ  . ARG B 1 174 ? -17.853 10.011  -10.768 1.00 36.97 ? 174 ARG B CZ  1 
ATOM   5584 N  NH1 . ARG B 1 174 ? -18.013 11.157  -11.418 1.00 36.15 ? 174 ARG B NH1 1 
ATOM   5585 N  NH2 . ARG B 1 174 ? -17.742 10.009  -9.443  1.00 36.55 ? 174 ARG B NH2 1 
ATOM   5586 N  N   . MET B 1 175 ? -15.550 6.195   -16.392 1.00 33.57 ? 175 MET B N   1 
ATOM   5587 C  CA  . MET B 1 175 ? -15.911 6.257   -17.803 1.00 34.49 ? 175 MET B CA  1 
ATOM   5588 C  C   . MET B 1 175 ? -15.927 4.863   -18.414 1.00 35.54 ? 175 MET B C   1 
ATOM   5589 O  O   . MET B 1 175 ? -16.772 4.561   -19.263 1.00 32.84 ? 175 MET B O   1 
ATOM   5590 C  CB  . MET B 1 175 ? -14.959 7.163   -18.576 1.00 32.88 ? 175 MET B CB  1 
ATOM   5591 C  CG  . MET B 1 175 ? -15.374 7.409   -20.032 1.00 40.33 ? 175 MET B CG  1 
ATOM   5592 S  SD  . MET B 1 175 ? -15.155 9.147   -20.496 1.00 42.11 ? 175 MET B SD  1 
ATOM   5593 C  CE  . MET B 1 175 ? -13.428 9.147   -20.861 1.00 38.18 ? 175 MET B CE  1 
ATOM   5594 N  N   . ALA B 1 176 ? -15.005 4.006   -17.984 1.00 34.22 ? 176 ALA B N   1 
ATOM   5595 C  CA  . ALA B 1 176 ? -15.037 2.628   -18.456 1.00 34.35 ? 176 ALA B CA  1 
ATOM   5596 C  C   . ALA B 1 176 ? -16.295 1.936   -17.896 1.00 36.07 ? 176 ALA B C   1 
ATOM   5597 O  O   . ALA B 1 176 ? -16.955 1.165   -18.611 1.00 32.73 ? 176 ALA B O   1 
ATOM   5598 C  CB  . ALA B 1 176 ? -13.763 1.882   -18.066 1.00 29.31 ? 176 ALA B CB  1 
ATOM   5599 N  N   . LEU B 1 177 ? -16.642 2.234   -16.639 1.00 30.46 ? 177 LEU B N   1 
ATOM   5600 C  CA  . LEU B 1 177 ? -17.866 1.676   -16.037 1.00 35.25 ? 177 LEU B CA  1 
ATOM   5601 C  C   . LEU B 1 177 ? -19.117 2.151   -16.774 1.00 32.48 ? 177 LEU B C   1 
ATOM   5602 O  O   . LEU B 1 177 ? -20.029 1.375   -17.040 1.00 30.42 ? 177 LEU B O   1 
ATOM   5603 C  CB  . LEU B 1 177 ? -17.980 2.044   -14.546 1.00 30.34 ? 177 LEU B CB  1 
ATOM   5604 C  CG  . LEU B 1 177 ? -16.980 1.396   -13.576 1.00 29.55 ? 177 LEU B CG  1 
ATOM   5605 C  CD1 . LEU B 1 177 ? -17.312 1.747   -12.117 1.00 30.12 ? 177 LEU B CD1 1 
ATOM   5606 C  CD2 . LEU B 1 177 ? -16.898 -0.115  -13.769 1.00 24.88 ? 177 LEU B CD2 1 
ATOM   5607 N  N   . GLN B 1 178 ? -19.155 3.439   -17.082 1.00 32.71 ? 178 GLN B N   1 
ATOM   5608 C  CA  . GLN B 1 178 ? -20.231 3.992   -17.873 1.00 32.30 ? 178 GLN B CA  1 
ATOM   5609 C  C   . GLN B 1 178 ? -20.308 3.336   -19.263 1.00 36.12 ? 178 GLN B C   1 
ATOM   5610 O  O   . GLN B 1 178 ? -21.393 3.183   -19.821 1.00 35.24 ? 178 GLN B O   1 
ATOM   5611 C  CB  . GLN B 1 178 ? -20.059 5.501   -18.017 1.00 36.02 ? 178 GLN B CB  1 
ATOM   5612 C  CG  . GLN B 1 178 ? -21.118 6.133   -18.922 1.00 36.83 ? 178 GLN B CG  1 
ATOM   5613 C  CD  . GLN B 1 178 ? -22.465 6.238   -18.224 1.00 35.64 ? 178 GLN B CD  1 
ATOM   5614 O  OE1 . GLN B 1 178 ? -22.536 6.670   -17.083 1.00 32.50 ? 178 GLN B OE1 1 
ATOM   5615 N  NE2 . GLN B 1 178 ? -23.532 5.830   -18.905 1.00 32.11 ? 178 GLN B NE2 1 
ATOM   5616 N  N   . TRP B 1 179 ? -19.161 2.950   -19.814 1.00 31.85 ? 179 TRP B N   1 
ATOM   5617 C  CA  . TRP B 1 179 ? -19.134 2.290   -21.116 1.00 36.14 ? 179 TRP B CA  1 
ATOM   5618 C  C   . TRP B 1 179 ? -19.771 0.909   -21.042 1.00 36.34 ? 179 TRP B C   1 
ATOM   5619 O  O   . TRP B 1 179 ? -20.505 0.491   -21.951 1.00 33.81 ? 179 TRP B O   1 
ATOM   5620 C  CB  . TRP B 1 179 ? -17.696 2.160   -21.640 1.00 34.58 ? 179 TRP B CB  1 
ATOM   5621 C  CG  . TRP B 1 179 ? -17.616 1.760   -23.091 1.00 34.32 ? 179 TRP B CG  1 
ATOM   5622 C  CD1 . TRP B 1 179 ? -17.474 2.594   -24.154 1.00 32.77 ? 179 TRP B CD1 1 
ATOM   5623 C  CD2 . TRP B 1 179 ? -17.654 0.424   -23.632 1.00 32.39 ? 179 TRP B CD2 1 
ATOM   5624 N  NE1 . TRP B 1 179 ? -17.434 1.869   -25.323 1.00 37.24 ? 179 TRP B NE1 1 
ATOM   5625 C  CE2 . TRP B 1 179 ? -17.547 0.537   -25.030 1.00 33.02 ? 179 TRP B CE2 1 
ATOM   5626 C  CE3 . TRP B 1 179 ? -17.777 -0.849  -23.069 1.00 35.41 ? 179 TRP B CE3 1 
ATOM   5627 C  CZ2 . TRP B 1 179 ? -17.557 -0.572  -25.878 1.00 36.40 ? 179 TRP B CZ2 1 
ATOM   5628 C  CZ3 . TRP B 1 179 ? -17.788 -1.955  -23.915 1.00 31.88 ? 179 TRP B CZ3 1 
ATOM   5629 C  CH2 . TRP B 1 179 ? -17.679 -1.806  -25.300 1.00 34.83 ? 179 TRP B CH2 1 
ATOM   5630 N  N   . VAL B 1 180 ? -19.443 0.193   -19.973 1.00 32.13 ? 180 VAL B N   1 
ATOM   5631 C  CA  . VAL B 1 180 ? -19.975 -1.141  -19.725 1.00 32.11 ? 180 VAL B CA  1 
ATOM   5632 C  C   . VAL B 1 180 ? -21.488 -1.029  -19.528 1.00 35.28 ? 180 VAL B C   1 
ATOM   5633 O  O   . VAL B 1 180 ? -22.257 -1.856  -20.028 1.00 32.21 ? 180 VAL B O   1 
ATOM   5634 C  CB  . VAL B 1 180 ? -19.297 -1.801  -18.472 1.00 34.86 ? 180 VAL B CB  1 
ATOM   5635 C  CG1 . VAL B 1 180 ? -20.013 -3.082  -18.048 1.00 31.44 ? 180 VAL B CG1 1 
ATOM   5636 C  CG2 . VAL B 1 180 ? -17.820 -2.074  -18.744 1.00 33.18 ? 180 VAL B CG2 1 
ATOM   5637 N  N   . HIS B 1 181 ? -21.897 0.001   -18.788 1.00 33.53 ? 181 HIS B N   1 
ATOM   5638 C  CA  . HIS B 1 181 ? -23.303 0.296   -18.576 1.00 36.12 ? 181 HIS B CA  1 
ATOM   5639 C  C   . HIS B 1 181 ? -24.014 0.451   -19.918 1.00 36.71 ? 181 HIS B C   1 
ATOM   5640 O  O   . HIS B 1 181 ? -25.113 -0.054  -20.097 1.00 38.83 ? 181 HIS B O   1 
ATOM   5641 C  CB  . HIS B 1 181 ? -23.471 1.565   -17.739 1.00 33.63 ? 181 HIS B CB  1 
ATOM   5642 C  CG  . HIS B 1 181 ? -24.898 1.971   -17.536 1.00 38.45 ? 181 HIS B CG  1 
ATOM   5643 N  ND1 . HIS B 1 181 ? -25.731 1.340   -16.636 1.00 37.62 ? 181 HIS B ND1 1 
ATOM   5644 C  CD2 . HIS B 1 181 ? -25.637 2.946   -18.115 1.00 38.47 ? 181 HIS B CD2 1 
ATOM   5645 C  CE1 . HIS B 1 181 ? -26.922 1.909   -16.670 1.00 35.75 ? 181 HIS B CE1 1 
ATOM   5646 N  NE2 . HIS B 1 181 ? -26.893 2.886   -17.557 1.00 40.93 ? 181 HIS B NE2 1 
ATOM   5647 N  N   . ASP B 1 182 ? -23.370 1.130   -20.865 1.00 35.60 ? 182 ASP B N   1 
ATOM   5648 C  CA  . ASP B 1 182 ? -24.018 1.446   -22.144 1.00 37.44 ? 182 ASP B CA  1 
ATOM   5649 C  C   . ASP B 1 182 ? -23.915 0.357   -23.201 1.00 37.04 ? 182 ASP B C   1 
ATOM   5650 O  O   . ASP B 1 182 ? -24.777 0.264   -24.086 1.00 39.60 ? 182 ASP B O   1 
ATOM   5651 C  CB  . ASP B 1 182 ? -23.436 2.736   -22.729 1.00 35.52 ? 182 ASP B CB  1 
ATOM   5652 C  CG  . ASP B 1 182 ? -23.759 3.954   -21.898 1.00 39.23 ? 182 ASP B CG  1 
ATOM   5653 O  OD1 . ASP B 1 182 ? -24.730 3.900   -21.105 1.00 37.07 ? 182 ASP B OD1 1 
ATOM   5654 O  OD2 . ASP B 1 182 ? -23.039 4.968   -22.060 1.00 38.36 ? 182 ASP B OD2 1 
ATOM   5655 N  N   . ASN B 1 183 ? -22.864 -0.453  -23.138 1.00 32.48 ? 183 ASN B N   1 
ATOM   5656 C  CA  . ASN B 1 183 ? -22.551 -1.308  -24.275 1.00 34.90 ? 183 ASN B CA  1 
ATOM   5657 C  C   . ASN B 1 183 ? -22.526 -2.803  -23.983 1.00 36.91 ? 183 ASN B C   1 
ATOM   5658 O  O   . ASN B 1 183 ? -22.542 -3.609  -24.915 1.00 36.10 ? 183 ASN B O   1 
ATOM   5659 C  CB  . ASN B 1 183 ? -21.199 -0.887  -24.876 1.00 34.96 ? 183 ASN B CB  1 
ATOM   5660 C  CG  . ASN B 1 183 ? -21.247 0.495   -25.508 1.00 37.01 ? 183 ASN B CG  1 
ATOM   5661 O  OD1 . ASN B 1 183 ? -21.644 0.639   -26.659 1.00 41.59 ? 183 ASN B OD1 1 
ATOM   5662 N  ND2 . ASN B 1 183 ? -20.860 1.516   -24.754 1.00 34.84 ? 183 ASN B ND2 1 
ATOM   5663 N  N   . ILE B 1 184 ? -22.500 -3.178  -22.704 1.00 33.67 ? 184 ILE B N   1 
ATOM   5664 C  CA  . ILE B 1 184 ? -22.184 -4.559  -22.348 1.00 32.98 ? 184 ILE B CA  1 
ATOM   5665 C  C   . ILE B 1 184 ? -23.314 -5.504  -22.728 1.00 33.59 ? 184 ILE B C   1 
ATOM   5666 O  O   . ILE B 1 184 ? -23.084 -6.693  -22.952 1.00 33.32 ? 184 ILE B O   1 
ATOM   5667 C  CB  . ILE B 1 184 ? -21.872 -4.723  -20.832 1.00 32.63 ? 184 ILE B CB  1 
ATOM   5668 C  CG1 . ILE B 1 184 ? -21.044 -5.993  -20.596 1.00 32.28 ? 184 ILE B CG1 1 
ATOM   5669 C  CG2 . ILE B 1 184 ? -23.160 -4.762  -20.004 1.00 32.40 ? 184 ILE B CG2 1 
ATOM   5670 C  CD1 . ILE B 1 184 ? -19.642 -5.976  -21.234 1.00 34.32 ? 184 ILE B CD1 1 
ATOM   5671 N  N   . GLN B 1 185 ? -24.531 -4.977  -22.800 1.00 31.83 ? 185 GLN B N   1 
ATOM   5672 C  CA  . GLN B 1 185 ? -25.669 -5.778  -23.250 1.00 39.09 ? 185 GLN B CA  1 
ATOM   5673 C  C   . GLN B 1 185 ? -25.445 -6.358  -24.646 1.00 39.01 ? 185 GLN B C   1 
ATOM   5674 O  O   . GLN B 1 185 ? -26.015 -7.399  -24.982 1.00 39.94 ? 185 GLN B O   1 
ATOM   5675 C  CB  . GLN B 1 185 ? -26.952 -4.946  -23.240 1.00 40.63 ? 185 GLN B CB  1 
ATOM   5676 C  CG  . GLN B 1 185 ? -26.966 -3.813  -24.261 1.00 38.40 ? 185 GLN B CG  1 
ATOM   5677 C  CD  . GLN B 1 185 ? -28.058 -2.800  -23.979 1.00 45.26 ? 185 GLN B CD  1 
ATOM   5678 O  OE1 . GLN B 1 185 ? -28.058 -2.138  -22.933 1.00 38.53 ? 185 GLN B OE1 1 
ATOM   5679 N  NE2 . GLN B 1 185 ? -29.014 -2.683  -24.911 1.00 44.08 ? 185 GLN B NE2 1 
ATOM   5680 N  N   . PHE B 1 186 ? -24.616 -5.690  -25.453 1.00 37.33 ? 186 PHE B N   1 
ATOM   5681 C  CA  . PHE B 1 186 ? -24.347 -6.132  -26.828 1.00 35.23 ? 186 PHE B CA  1 
ATOM   5682 C  C   . PHE B 1 186 ? -23.384 -7.303  -26.820 1.00 39.37 ? 186 PHE B C   1 
ATOM   5683 O  O   . PHE B 1 186 ? -23.152 -7.946  -27.841 1.00 36.35 ? 186 PHE B O   1 
ATOM   5684 C  CB  . PHE B 1 186 ? -23.778 -4.985  -27.669 1.00 32.69 ? 186 PHE B CB  1 
ATOM   5685 C  CG  . PHE B 1 186 ? -24.643 -3.761  -27.677 1.00 37.55 ? 186 PHE B CG  1 
ATOM   5686 C  CD1 . PHE B 1 186 ? -26.000 -3.852  -27.975 1.00 42.63 ? 186 PHE B CD1 1 
ATOM   5687 C  CD2 . PHE B 1 186 ? -24.115 -2.522  -27.369 1.00 38.60 ? 186 PHE B CD2 1 
ATOM   5688 C  CE1 . PHE B 1 186 ? -26.806 -2.724  -27.966 1.00 42.81 ? 186 PHE B CE1 1 
ATOM   5689 C  CE2 . PHE B 1 186 ? -24.911 -1.392  -27.359 1.00 39.65 ? 186 PHE B CE2 1 
ATOM   5690 C  CZ  . PHE B 1 186 ? -26.260 -1.490  -27.652 1.00 43.39 ? 186 PHE B CZ  1 
ATOM   5691 N  N   . PHE B 1 187 ? -22.825 -7.584  -25.646 1.00 39.28 ? 187 PHE B N   1 
ATOM   5692 C  CA  . PHE B 1 187 ? -21.841 -8.651  -25.517 1.00 39.81 ? 187 PHE B CA  1 
ATOM   5693 C  C   . PHE B 1 187 ? -22.416 -9.844  -24.769 1.00 38.78 ? 187 PHE B C   1 
ATOM   5694 O  O   . PHE B 1 187 ? -21.722 -10.836 -24.534 1.00 44.34 ? 187 PHE B O   1 
ATOM   5695 C  CB  . PHE B 1 187 ? -20.584 -8.133  -24.816 1.00 35.56 ? 187 PHE B CB  1 
ATOM   5696 C  CG  . PHE B 1 187 ? -19.802 -7.145  -25.636 1.00 34.87 ? 187 PHE B CG  1 
ATOM   5697 C  CD1 . PHE B 1 187 ? -18.814 -7.579  -26.505 1.00 35.23 ? 187 PHE B CD1 1 
ATOM   5698 C  CD2 . PHE B 1 187 ? -20.059 -5.788  -25.539 1.00 33.30 ? 187 PHE B CD2 1 
ATOM   5699 C  CE1 . PHE B 1 187 ? -18.084 -6.678  -27.264 1.00 37.65 ? 187 PHE B CE1 1 
ATOM   5700 C  CE2 . PHE B 1 187 ? -19.335 -4.875  -26.296 1.00 33.32 ? 187 PHE B CE2 1 
ATOM   5701 C  CZ  . PHE B 1 187 ? -18.343 -5.321  -27.159 1.00 35.53 ? 187 PHE B CZ  1 
ATOM   5702 N  N   . GLY B 1 188 ? -23.690 -9.746  -24.412 1.00 39.07 ? 188 GLY B N   1 
ATOM   5703 C  CA  . GLY B 1 188 ? -24.353 -10.806 -23.679 1.00 41.63 ? 188 GLY B CA  1 
ATOM   5704 C  C   . GLY B 1 188 ? -24.390 -10.549 -22.180 1.00 41.89 ? 188 GLY B C   1 
ATOM   5705 O  O   . GLY B 1 188 ? -24.767 -11.426 -21.405 1.00 39.01 ? 188 GLY B O   1 
ATOM   5706 N  N   . GLY B 1 189 ? -24.026 -9.336  -21.775 1.00 38.82 ? 189 GLY B N   1 
ATOM   5707 C  CA  . GLY B 1 189 ? -23.990 -8.984  -20.363 1.00 37.91 ? 189 GLY B CA  1 
ATOM   5708 C  C   . GLY B 1 189 ? -25.172 -8.166  -19.876 1.00 41.58 ? 189 GLY B C   1 
ATOM   5709 O  O   . GLY B 1 189 ? -25.738 -7.371  -20.624 1.00 39.57 ? 189 GLY B O   1 
ATOM   5710 N  N   . ASP B 1 190 ? -25.541 -8.365  -18.610 1.00 42.34 ? 190 ASP B N   1 
ATOM   5711 C  CA  . ASP B 1 190 ? -26.590 -7.587  -17.961 1.00 38.80 ? 190 ASP B CA  1 
ATOM   5712 C  C   . ASP B 1 190 ? -25.995 -6.380  -17.243 1.00 40.31 ? 190 ASP B C   1 
ATOM   5713 O  O   . ASP B 1 190 ? -25.341 -6.525  -16.205 1.00 43.29 ? 190 ASP B O   1 
ATOM   5714 C  CB  . ASP B 1 190 ? -27.373 -8.470  -16.974 1.00 39.35 ? 190 ASP B CB  1 
ATOM   5715 C  CG  . ASP B 1 190 ? -28.421 -7.700  -16.184 1.00 41.27 ? 190 ASP B CG  1 
ATOM   5716 O  OD1 . ASP B 1 190 ? -28.688 -6.520  -16.503 1.00 43.82 ? 190 ASP B OD1 1 
ATOM   5717 O  OD2 . ASP B 1 190 ? -28.998 -8.287  -15.240 1.00 41.81 ? 190 ASP B OD2 1 
ATOM   5718 N  N   . PRO B 1 191 ? -26.232 -5.178  -17.779 1.00 36.62 ? 191 PRO B N   1 
ATOM   5719 C  CA  . PRO B 1 191 ? -25.737 -3.958  -17.135 1.00 34.27 ? 191 PRO B CA  1 
ATOM   5720 C  C   . PRO B 1 191 ? -26.365 -3.714  -15.764 1.00 35.61 ? 191 PRO B C   1 
ATOM   5721 O  O   . PRO B 1 191 ? -25.951 -2.791  -15.062 1.00 37.26 ? 191 PRO B O   1 
ATOM   5722 C  CB  . PRO B 1 191 ? -26.136 -2.856  -18.120 1.00 37.03 ? 191 PRO B CB  1 
ATOM   5723 C  CG  . PRO B 1 191 ? -27.294 -3.437  -18.886 1.00 37.47 ? 191 PRO B CG  1 
ATOM   5724 C  CD  . PRO B 1 191 ? -26.954 -4.890  -19.028 1.00 39.14 ? 191 PRO B CD  1 
ATOM   5725 N  N   . LYS B 1 192 ? -27.355 -4.518  -15.394 1.00 37.32 ? 192 LYS B N   1 
ATOM   5726 C  CA  . LYS B 1 192 ? -27.995 -4.383  -14.087 1.00 40.77 ? 192 LYS B CA  1 
ATOM   5727 C  C   . LYS B 1 192 ? -27.328 -5.287  -13.048 1.00 38.26 ? 192 LYS B C   1 
ATOM   5728 O  O   . LYS B 1 192 ? -27.578 -5.164  -11.850 1.00 40.18 ? 192 LYS B O   1 
ATOM   5729 C  CB  . LYS B 1 192 ? -29.491 -4.707  -14.184 1.00 40.99 ? 192 LYS B CB  1 
ATOM   5730 C  CG  . LYS B 1 192 ? -30.292 -3.717  -15.019 1.00 42.97 ? 192 LYS B CG  1 
ATOM   5731 C  CD  . LYS B 1 192 ? -31.646 -4.295  -15.426 1.00 44.73 ? 192 LYS B CD  1 
ATOM   5732 C  CE  . LYS B 1 192 ? -32.787 -3.530  -14.786 1.00 44.76 ? 192 LYS B CE  1 
ATOM   5733 N  NZ  . LYS B 1 192 ? -32.720 -3.555  -13.299 1.00 47.10 ? 192 LYS B NZ  1 
ATOM   5734 N  N   . THR B 1 193 ? -26.480 -6.197  -13.511 1.00 37.35 ? 193 THR B N   1 
ATOM   5735 C  CA  . THR B 1 193 ? -25.784 -7.096  -12.607 1.00 37.66 ? 193 THR B CA  1 
ATOM   5736 C  C   . THR B 1 193 ? -24.271 -7.064  -12.862 1.00 31.70 ? 193 THR B C   1 
ATOM   5737 O  O   . THR B 1 193 ? -23.655 -8.062  -13.252 1.00 31.56 ? 193 THR B O   1 
ATOM   5738 C  CB  . THR B 1 193 ? -26.327 -8.527  -12.728 1.00 38.02 ? 193 THR B CB  1 
ATOM   5739 O  OG1 . THR B 1 193 ? -27.756 -8.482  -12.688 1.00 37.66 ? 193 THR B OG1 1 
ATOM   5740 C  CG2 . THR B 1 193 ? -25.838 -9.376  -11.555 1.00 38.50 ? 193 THR B CG2 1 
ATOM   5741 N  N   . VAL B 1 194 ? -23.691 -5.889  -12.645 1.00 29.53 ? 194 VAL B N   1 
ATOM   5742 C  CA  . VAL B 1 194 ? -22.255 -5.701  -12.789 1.00 31.14 ? 194 VAL B CA  1 
ATOM   5743 C  C   . VAL B 1 194 ? -21.578 -5.672  -11.420 1.00 33.94 ? 194 VAL B C   1 
ATOM   5744 O  O   . VAL B 1 194 ? -21.940 -4.885  -10.538 1.00 29.69 ? 194 VAL B O   1 
ATOM   5745 C  CB  . VAL B 1 194 ? -21.915 -4.401  -13.555 1.00 33.68 ? 194 VAL B CB  1 
ATOM   5746 C  CG1 . VAL B 1 194 ? -20.400 -4.169  -13.561 1.00 29.25 ? 194 VAL B CG1 1 
ATOM   5747 C  CG2 . VAL B 1 194 ? -22.472 -4.464  -14.998 1.00 32.84 ? 194 VAL B CG2 1 
ATOM   5748 N  N   . THR B 1 195 ? -20.609 -6.561  -11.250 1.00 33.04 ? 195 THR B N   1 
ATOM   5749 C  CA  . THR B 1 195 ? -19.755 -6.533  -10.069 1.00 32.42 ? 195 THR B CA  1 
ATOM   5750 C  C   . THR B 1 195 ? -18.415 -5.920  -10.424 1.00 30.68 ? 195 THR B C   1 
ATOM   5751 O  O   . THR B 1 195 ? -17.749 -6.360  -11.374 1.00 31.17 ? 195 THR B O   1 
ATOM   5752 C  CB  . THR B 1 195 ? -19.527 -7.928  -9.494  1.00 34.38 ? 195 THR B CB  1 
ATOM   5753 O  OG1 . THR B 1 195 ? -20.770 -8.444  -8.985  1.00 34.67 ? 195 THR B OG1 1 
ATOM   5754 C  CG2 . THR B 1 195 ? -18.489 -7.865  -8.371  1.00 31.01 ? 195 THR B CG2 1 
ATOM   5755 N  N   . ILE B 1 196 ? -18.040 -4.874  -9.704  1.00 30.29 ? 196 ILE B N   1 
ATOM   5756 C  CA  . ILE B 1 196 ? -16.677 -4.369  -9.807  1.00 31.60 ? 196 ILE B CA  1 
ATOM   5757 C  C   . ILE B 1 196 ? -15.803 -5.035  -8.750  1.00 34.82 ? 196 ILE B C   1 
ATOM   5758 O  O   . ILE B 1 196 ? -16.193 -5.143  -7.565  1.00 31.45 ? 196 ILE B O   1 
ATOM   5759 C  CB  . ILE B 1 196 ? -16.599 -2.833  -9.652  1.00 31.41 ? 196 ILE B CB  1 
ATOM   5760 C  CG1 . ILE B 1 196 ? -17.223 -2.363  -8.344  1.00 26.57 ? 196 ILE B CG1 1 
ATOM   5761 C  CG2 . ILE B 1 196 ? -17.277 -2.144  -10.815 1.00 27.70 ? 196 ILE B CG2 1 
ATOM   5762 C  CD1 . ILE B 1 196 ? -17.074 -0.870  -8.140  1.00 27.42 ? 196 ILE B CD1 1 
ATOM   5763 N  N   . PHE B 1 197 ? -14.639 -5.516  -9.179  1.00 32.44 ? 197 PHE B N   1 
ATOM   5764 C  CA  . PHE B 1 197 ? -13.672 -6.056  -8.228  1.00 33.16 ? 197 PHE B CA  1 
ATOM   5765 C  C   . PHE B 1 197 ? -12.230 -5.658  -8.587  1.00 33.54 ? 197 PHE B C   1 
ATOM   5766 O  O   . PHE B 1 197 ? -11.902 -5.443  -9.757  1.00 31.05 ? 197 PHE B O   1 
ATOM   5767 C  CB  . PHE B 1 197 ? -13.819 -7.583  -8.112  1.00 32.48 ? 197 PHE B CB  1 
ATOM   5768 C  CG  . PHE B 1 197 ? -13.431 -8.362  -9.350  1.00 32.57 ? 197 PHE B CG  1 
ATOM   5769 C  CD1 . PHE B 1 197 ? -13.963 -8.049  -10.604 1.00 32.36 ? 197 PHE B CD1 1 
ATOM   5770 C  CD2 . PHE B 1 197 ? -12.560 -9.441  -9.246  1.00 28.87 ? 197 PHE B CD2 1 
ATOM   5771 C  CE1 . PHE B 1 197 ? -13.621 -8.790  -11.735 1.00 29.50 ? 197 PHE B CE1 1 
ATOM   5772 C  CE2 . PHE B 1 197 ? -12.198 -10.185 -10.368 1.00 34.45 ? 197 PHE B CE2 1 
ATOM   5773 C  CZ  . PHE B 1 197 ? -12.731 -9.857  -11.626 1.00 29.43 ? 197 PHE B CZ  1 
ATOM   5774 N  N   . GLY B 1 198 ? -11.390 -5.529  -7.562  1.00 29.00 ? 198 GLY B N   1 
ATOM   5775 C  CA  . GLY B 1 198 ? -10.015 -5.091  -7.724  1.00 30.10 ? 198 GLY B CA  1 
ATOM   5776 C  C   . GLY B 1 198 ? -9.178  -5.331  -6.471  1.00 34.36 ? 198 GLY B C   1 
ATOM   5777 O  O   . GLY B 1 198 ? -9.704  -5.470  -5.355  1.00 31.53 ? 198 GLY B O   1 
ATOM   5778 N  N   . GLU B 1 199 ? -7.868  -5.387  -6.654  1.00 31.58 ? 199 GLU B N   1 
ATOM   5779 C  CA  . GLU B 1 199 ? -6.955  -5.703  -5.565  1.00 33.49 ? 199 GLU B CA  1 
ATOM   5780 C  C   . GLU B 1 199 ? -6.047  -4.522  -5.289  1.00 34.11 ? 199 GLU B C   1 
ATOM   5781 O  O   . GLU B 1 199 ? -5.650  -3.808  -6.214  1.00 35.95 ? 199 GLU B O   1 
ATOM   5782 C  CB  . GLU B 1 199 ? -6.137  -6.948  -5.904  1.00 30.85 ? 199 GLU B CB  1 
ATOM   5783 C  CG  . GLU B 1 199 ? -5.210  -7.408  -4.814  1.00 31.72 ? 199 GLU B CG  1 
ATOM   5784 C  CD  . GLU B 1 199 ? -3.835  -6.749  -4.894  1.00 37.46 ? 199 GLU B CD  1 
ATOM   5785 O  OE1 . GLU B 1 199 ? -3.552  -6.041  -5.895  1.00 36.00 ? 199 GLU B OE1 1 
ATOM   5786 O  OE2 . GLU B 1 199 ? -3.038  -6.940  -3.947  1.00 35.35 ? 199 GLU B OE2 1 
ATOM   5787 N  N   . SER B 1 200 ? -5.738  -4.324  -4.012  1.00 33.58 ? 200 SER B N   1 
ATOM   5788 C  CA  . SER B 1 200 ? -4.874  -3.237  -3.548  1.00 36.00 ? 200 SER B CA  1 
ATOM   5789 C  C   . SER B 1 200 ? -5.455  -1.890  -3.963  1.00 33.26 ? 200 SER B C   1 
ATOM   5790 O  O   . SER B 1 200 ? -6.564  -1.548  -3.575  1.00 35.27 ? 200 SER B O   1 
ATOM   5791 C  CB  . SER B 1 200 ? -3.443  -3.404  -4.087  1.00 35.24 ? 200 SER B CB  1 
ATOM   5792 O  OG  . SER B 1 200 ? -2.506  -2.805  -3.209  1.00 39.76 ? 200 SER B OG  1 
ATOM   5793 N  N   . ALA B 1 201 ? -4.695  -1.129  -4.745  1.00 36.15 ? 201 ALA B N   1 
ATOM   5794 C  CA  . ALA B 1 201 ? -5.182  0.123   -5.318  1.00 34.61 ? 201 ALA B CA  1 
ATOM   5795 C  C   . ALA B 1 201 ? -6.527  -0.075  -6.013  1.00 31.34 ? 201 ALA B C   1 
ATOM   5796 O  O   . ALA B 1 201 ? -7.396  0.786   -5.939  1.00 32.19 ? 201 ALA B O   1 
ATOM   5797 C  CB  . ALA B 1 201 ? -4.163  0.689   -6.301  1.00 30.35 ? 201 ALA B CB  1 
ATOM   5798 N  N   . GLY B 1 202 ? -6.680  -1.218  -6.678  1.00 30.93 ? 202 GLY B N   1 
ATOM   5799 C  CA  . GLY B 1 202 ? -7.921  -1.583  -7.340  1.00 32.82 ? 202 GLY B CA  1 
ATOM   5800 C  C   . GLY B 1 202 ? -9.053  -1.783  -6.342  1.00 33.22 ? 202 GLY B C   1 
ATOM   5801 O  O   . GLY B 1 202 ? -10.183 -1.383  -6.600  1.00 33.16 ? 202 GLY B O   1 
ATOM   5802 N  N   . GLY B 1 203 ? -8.742  -2.397  -5.202  1.00 31.00 ? 203 GLY B N   1 
ATOM   5803 C  CA  . GLY B 1 203 ? -9.698  -2.559  -4.113  1.00 31.28 ? 203 GLY B CA  1 
ATOM   5804 C  C   . GLY B 1 203 ? -10.073 -1.248  -3.439  1.00 31.62 ? 203 GLY B C   1 
ATOM   5805 O  O   . GLY B 1 203 ? -11.241 -1.013  -3.119  1.00 33.29 ? 203 GLY B O   1 
ATOM   5806 N  N   . ALA B 1 204 ? -9.089  -0.388  -3.215  1.00 29.19 ? 204 ALA B N   1 
ATOM   5807 C  CA  . ALA B 1 204 ? -9.378  0.953   -2.718  1.00 29.66 ? 204 ALA B CA  1 
ATOM   5808 C  C   . ALA B 1 204 ? -10.288 1.689   -3.689  1.00 32.48 ? 204 ALA B C   1 
ATOM   5809 O  O   . ALA B 1 204 ? -11.264 2.320   -3.269  1.00 32.44 ? 204 ALA B O   1 
ATOM   5810 C  CB  . ALA B 1 204 ? -8.094  1.741   -2.498  1.00 31.04 ? 204 ALA B CB  1 
ATOM   5811 N  N   . SER B 1 205 ? -9.952  1.601   -4.984  1.00 31.19 ? 205 SER B N   1 
ATOM   5812 C  CA  . SER B 1 205 ? -10.759 2.166   -6.072  1.00 29.77 ? 205 SER B CA  1 
ATOM   5813 C  C   . SER B 1 205 ? -12.214 1.760   -5.962  1.00 31.07 ? 205 SER B C   1 
ATOM   5814 O  O   . SER B 1 205 ? -13.109 2.614   -5.965  1.00 30.50 ? 205 SER B O   1 
ATOM   5815 C  CB  . SER B 1 205 ? -10.222 1.721   -7.448  1.00 25.51 ? 205 SER B CB  1 
ATOM   5816 O  OG  . SER B 1 205 ? -9.030  2.413   -7.778  1.00 29.33 ? 205 SER B OG  1 
ATOM   5817 N  N   . VAL B 1 206 ? -12.437 0.448   -5.893  1.00 31.11 ? 206 VAL B N   1 
ATOM   5818 C  CA  . VAL B 1 206 ? -13.780 -0.101  -5.794  1.00 31.75 ? 206 VAL B CA  1 
ATOM   5819 C  C   . VAL B 1 206 ? -14.530 0.561   -4.648  1.00 33.87 ? 206 VAL B C   1 
ATOM   5820 O  O   . VAL B 1 206 ? -15.647 1.042   -4.824  1.00 33.04 ? 206 VAL B O   1 
ATOM   5821 C  CB  . VAL B 1 206 ? -13.765 -1.620  -5.582  1.00 29.73 ? 206 VAL B CB  1 
ATOM   5822 C  CG1 . VAL B 1 206 ? -15.098 -2.079  -4.995  1.00 26.19 ? 206 VAL B CG1 1 
ATOM   5823 C  CG2 . VAL B 1 206 ? -13.474 -2.335  -6.898  1.00 29.42 ? 206 VAL B CG2 1 
ATOM   5824 N  N   . GLY B 1 207 ? -13.897 0.605   -3.479  1.00 32.55 ? 207 GLY B N   1 
ATOM   5825 C  CA  . GLY B 1 207 ? -14.501 1.250   -2.329  1.00 31.74 ? 207 GLY B CA  1 
ATOM   5826 C  C   . GLY B 1 207 ? -14.754 2.723   -2.562  1.00 30.54 ? 207 GLY B C   1 
ATOM   5827 O  O   . GLY B 1 207 ? -15.708 3.287   -2.062  1.00 34.03 ? 207 GLY B O   1 
ATOM   5828 N  N   . MET B 1 208 ? -13.889 3.362   -3.331  1.00 36.36 ? 208 MET B N   1 
ATOM   5829 C  CA  . MET B 1 208 ? -14.089 4.771   -3.653  1.00 35.65 ? 208 MET B CA  1 
ATOM   5830 C  C   . MET B 1 208 ? -15.293 4.985   -4.579  1.00 35.50 ? 208 MET B C   1 
ATOM   5831 O  O   . MET B 1 208 ? -15.903 6.048   -4.569  1.00 37.60 ? 208 MET B O   1 
ATOM   5832 C  CB  . MET B 1 208 ? -12.828 5.345   -4.285  1.00 34.68 ? 208 MET B CB  1 
ATOM   5833 C  CG  . MET B 1 208 ? -11.686 5.424   -3.302  1.00 34.74 ? 208 MET B CG  1 
ATOM   5834 S  SD  . MET B 1 208 ? -10.152 5.993   -4.038  1.00 33.86 ? 208 MET B SD  1 
ATOM   5835 C  CE  . MET B 1 208 ? -9.143  6.134   -2.551  1.00 32.29 ? 208 MET B CE  1 
ATOM   5836 N  N   . HIS B 1 209 ? -15.637 3.975   -5.368  1.00 31.24 ? 209 HIS B N   1 
ATOM   5837 C  CA  . HIS B 1 209 ? -16.809 4.082   -6.234  1.00 35.85 ? 209 HIS B CA  1 
ATOM   5838 C  C   . HIS B 1 209 ? -18.069 3.806   -5.433  1.00 36.84 ? 209 HIS B C   1 
ATOM   5839 O  O   . HIS B 1 209 ? -19.126 4.350   -5.723  1.00 37.65 ? 209 HIS B O   1 
ATOM   5840 C  CB  . HIS B 1 209 ? -16.717 3.127   -7.426  1.00 31.07 ? 209 HIS B CB  1 
ATOM   5841 C  CG  . HIS B 1 209 ? -15.689 3.529   -8.431  1.00 35.87 ? 209 HIS B CG  1 
ATOM   5842 N  ND1 . HIS B 1 209 ? -15.785 4.691   -9.169  1.00 36.11 ? 209 HIS B ND1 1 
ATOM   5843 C  CD2 . HIS B 1 209 ? -14.527 2.939   -8.806  1.00 36.11 ? 209 HIS B CD2 1 
ATOM   5844 C  CE1 . HIS B 1 209 ? -14.727 4.796   -9.955  1.00 35.38 ? 209 HIS B CE1 1 
ATOM   5845 N  NE2 . HIS B 1 209 ? -13.948 3.749   -9.752  1.00 33.00 ? 209 HIS B NE2 1 
ATOM   5846 N  N   . ILE B 1 210 ? -17.939 2.964   -4.414  1.00 36.91 ? 210 ILE B N   1 
ATOM   5847 C  CA  . ILE B 1 210 ? -19.025 2.721   -3.482  1.00 32.27 ? 210 ILE B CA  1 
ATOM   5848 C  C   . ILE B 1 210 ? -19.398 4.026   -2.798  1.00 39.18 ? 210 ILE B C   1 
ATOM   5849 O  O   . ILE B 1 210 ? -20.583 4.327   -2.611  1.00 42.79 ? 210 ILE B O   1 
ATOM   5850 C  CB  . ILE B 1 210 ? -18.637 1.651   -2.459  1.00 30.76 ? 210 ILE B CB  1 
ATOM   5851 C  CG1 . ILE B 1 210 ? -18.734 0.276   -3.115  1.00 31.69 ? 210 ILE B CG1 1 
ATOM   5852 C  CG2 . ILE B 1 210 ? -19.529 1.731   -1.189  1.00 32.22 ? 210 ILE B CG2 1 
ATOM   5853 C  CD1 . ILE B 1 210 ? -18.073 -0.835  -2.347  1.00 35.06 ? 210 ILE B CD1 1 
ATOM   5854 N  N   . LEU B 1 211 ? -18.383 4.815   -2.469  1.00 37.09 ? 211 LEU B N   1 
ATOM   5855 C  CA  . LEU B 1 211 ? -18.570 6.076   -1.758  1.00 36.96 ? 211 LEU B CA  1 
ATOM   5856 C  C   . LEU B 1 211 ? -19.022 7.227   -2.665  1.00 37.39 ? 211 LEU B C   1 
ATOM   5857 O  O   . LEU B 1 211 ? -19.884 8.019   -2.287  1.00 43.11 ? 211 LEU B O   1 
ATOM   5858 C  CB  . LEU B 1 211 ? -17.271 6.470   -1.053  1.00 36.35 ? 211 LEU B CB  1 
ATOM   5859 C  CG  . LEU B 1 211 ? -16.873 5.780   0.252   1.00 37.98 ? 211 LEU B CG  1 
ATOM   5860 C  CD1 . LEU B 1 211 ? -15.351 5.827   0.435   1.00 37.11 ? 211 LEU B CD1 1 
ATOM   5861 C  CD2 . LEU B 1 211 ? -17.545 6.466   1.406   1.00 37.97 ? 211 LEU B CD2 1 
ATOM   5862 N  N   . SER B 1 212 ? -18.440 7.329   -3.850  1.00 34.03 ? 212 SER B N   1 
ATOM   5863 C  CA  . SER B 1 212 ? -18.661 8.503   -4.696  1.00 38.26 ? 212 SER B CA  1 
ATOM   5864 C  C   . SER B 1 212 ? -20.013 8.466   -5.398  1.00 38.22 ? 212 SER B C   1 
ATOM   5865 O  O   . SER B 1 212 ? -20.282 7.540   -6.155  1.00 40.09 ? 212 SER B O   1 
ATOM   5866 C  CB  . SER B 1 212 ? -17.551 8.630   -5.740  1.00 37.37 ? 212 SER B CB  1 
ATOM   5867 O  OG  . SER B 1 212 ? -17.732 9.802   -6.512  1.00 38.17 ? 212 SER B OG  1 
ATOM   5868 N  N   . PRO B 1 213 ? -20.867 9.473   -5.140  1.00 38.66 ? 213 PRO B N   1 
ATOM   5869 C  CA  . PRO B 1 213 ? -22.215 9.552   -5.727  1.00 39.10 ? 213 PRO B CA  1 
ATOM   5870 C  C   . PRO B 1 213 ? -22.217 9.368   -7.243  1.00 40.19 ? 213 PRO B C   1 
ATOM   5871 O  O   . PRO B 1 213 ? -23.093 8.689   -7.767  1.00 41.16 ? 213 PRO B O   1 
ATOM   5872 C  CB  . PRO B 1 213 ? -22.674 10.959  -5.344  1.00 39.30 ? 213 PRO B CB  1 
ATOM   5873 C  CG  . PRO B 1 213 ? -21.970 11.220  -4.036  1.00 38.17 ? 213 PRO B CG  1 
ATOM   5874 C  CD  . PRO B 1 213 ? -20.607 10.586  -4.204  1.00 38.06 ? 213 PRO B CD  1 
ATOM   5875 N  N   . GLY B 1 214 ? -21.224 9.942   -7.920  1.00 40.09 ? 214 GLY B N   1 
ATOM   5876 C  CA  . GLY B 1 214 ? -21.099 9.839   -9.362  1.00 34.95 ? 214 GLY B CA  1 
ATOM   5877 C  C   . GLY B 1 214 ? -20.875 8.434   -9.884  1.00 37.14 ? 214 GLY B C   1 
ATOM   5878 O  O   . GLY B 1 214 ? -21.071 8.185   -11.062 1.00 37.11 ? 214 GLY B O   1 
ATOM   5879 N  N   . SER B 1 215 ? -20.488 7.498   -9.022  1.00 36.33 ? 215 SER B N   1 
ATOM   5880 C  CA  . SER B 1 215 ? -20.192 6.146   -9.500  1.00 35.57 ? 215 SER B CA  1 
ATOM   5881 C  C   . SER B 1 215 ? -21.257 5.100   -9.170  1.00 38.62 ? 215 SER B C   1 
ATOM   5882 O  O   . SER B 1 215 ? -21.388 4.093   -9.873  1.00 37.57 ? 215 SER B O   1 
ATOM   5883 C  CB  . SER B 1 215 ? -18.856 5.678   -8.931  1.00 35.17 ? 215 SER B CB  1 
ATOM   5884 O  OG  . SER B 1 215 ? -17.785 6.460   -9.427  1.00 38.80 ? 215 SER B OG  1 
ATOM   5885 N  N   . ARG B 1 216 ? -22.005 5.337   -8.098  1.00 37.94 ? 216 ARG B N   1 
ATOM   5886 C  CA  . ARG B 1 216 ? -22.829 4.292   -7.481  1.00 42.17 ? 216 ARG B CA  1 
ATOM   5887 C  C   . ARG B 1 216 ? -23.771 3.566   -8.444  1.00 38.94 ? 216 ARG B C   1 
ATOM   5888 O  O   . ARG B 1 216 ? -23.951 2.348   -8.358  1.00 37.63 ? 216 ARG B O   1 
ATOM   5889 C  CB  . ARG B 1 216 ? -23.650 4.882   -6.336  1.00 37.84 ? 216 ARG B CB  1 
ATOM   5890 C  CG  . ARG B 1 216 ? -22.802 5.467   -5.241  1.00 39.53 ? 216 ARG B CG  1 
ATOM   5891 C  CD  . ARG B 1 216 ? -23.653 6.050   -4.142  1.00 39.11 ? 216 ARG B CD  1 
ATOM   5892 N  NE  . ARG B 1 216 ? -22.858 6.856   -3.228  1.00 39.37 ? 216 ARG B NE  1 
ATOM   5893 C  CZ  . ARG B 1 216 ? -23.373 7.704   -2.349  1.00 40.03 ? 216 ARG B CZ  1 
ATOM   5894 N  NH1 . ARG B 1 216 ? -22.574 8.407   -1.563  1.00 40.08 ? 216 ARG B NH1 1 
ATOM   5895 N  NH2 . ARG B 1 216 ? -24.690 7.855   -2.268  1.00 44.56 ? 216 ARG B NH2 1 
ATOM   5896 N  N   . ASP B 1 217 ? -24.375 4.304   -9.357  1.00 35.83 ? 217 ASP B N   1 
ATOM   5897 C  CA  . ASP B 1 217 ? -25.389 3.697   -10.198 1.00 40.16 ? 217 ASP B CA  1 
ATOM   5898 C  C   . ASP B 1 217 ? -24.803 2.966   -11.399 1.00 34.45 ? 217 ASP B C   1 
ATOM   5899 O  O   . ASP B 1 217 ? -25.542 2.424   -12.215 1.00 36.41 ? 217 ASP B O   1 
ATOM   5900 C  CB  . ASP B 1 217 ? -26.390 4.764   -10.645 1.00 45.82 ? 217 ASP B CB  1 
ATOM   5901 C  CG  . ASP B 1 217 ? -27.136 5.375   -9.467  1.00 47.59 ? 217 ASP B CG  1 
ATOM   5902 O  OD1 . ASP B 1 217 ? -27.505 4.611   -8.550  1.00 51.43 ? 217 ASP B OD1 1 
ATOM   5903 O  OD2 . ASP B 1 217 ? -27.341 6.610   -9.443  1.00 51.06 ? 217 ASP B OD2 1 
ATOM   5904 N  N   . LEU B 1 218 ? -23.478 2.911   -11.487 1.00 35.90 ? 218 LEU B N   1 
ATOM   5905 C  CA  . LEU B 1 218 ? -22.832 2.238   -12.615 1.00 33.89 ? 218 LEU B CA  1 
ATOM   5906 C  C   . LEU B 1 218 ? -22.378 0.824   -12.274 1.00 35.41 ? 218 LEU B C   1 
ATOM   5907 O  O   . LEU B 1 218 ? -21.616 0.223   -13.025 1.00 32.68 ? 218 LEU B O   1 
ATOM   5908 C  CB  . LEU B 1 218 ? -21.646 3.054   -13.114 1.00 33.26 ? 218 LEU B CB  1 
ATOM   5909 C  CG  . LEU B 1 218 ? -21.993 4.483   -13.529 1.00 35.17 ? 218 LEU B CG  1 
ATOM   5910 C  CD1 . LEU B 1 218 ? -20.744 5.289   -13.834 1.00 36.15 ? 218 LEU B CD1 1 
ATOM   5911 C  CD2 . LEU B 1 218 ? -22.897 4.445   -14.728 1.00 35.15 ? 218 LEU B CD2 1 
ATOM   5912 N  N   . PHE B 1 219 ? -22.832 0.299   -11.135 1.00 33.97 ? 219 PHE B N   1 
ATOM   5913 C  CA  . PHE B 1 219 ? -22.570 -1.099  -10.794 1.00 32.76 ? 219 PHE B CA  1 
ATOM   5914 C  C   . PHE B 1 219 ? -23.532 -1.589  -9.721  1.00 32.97 ? 219 PHE B C   1 
ATOM   5915 O  O   . PHE B 1 219 ? -24.141 -0.798  -9.008  1.00 30.24 ? 219 PHE B O   1 
ATOM   5916 C  CB  . PHE B 1 219 ? -21.114 -1.297  -10.331 1.00 30.62 ? 219 PHE B CB  1 
ATOM   5917 C  CG  . PHE B 1 219 ? -20.787 -0.594  -9.034  1.00 32.22 ? 219 PHE B CG  1 
ATOM   5918 C  CD1 . PHE B 1 219 ? -20.519 0.764   -9.017  1.00 31.76 ? 219 PHE B CD1 1 
ATOM   5919 C  CD2 . PHE B 1 219 ? -20.756 -1.296  -7.834  1.00 31.91 ? 219 PHE B CD2 1 
ATOM   5920 C  CE1 . PHE B 1 219 ? -20.234 1.416   -7.832  1.00 34.42 ? 219 PHE B CE1 1 
ATOM   5921 C  CE2 . PHE B 1 219 ? -20.466 -0.654  -6.642  1.00 34.50 ? 219 PHE B CE2 1 
ATOM   5922 C  CZ  . PHE B 1 219 ? -20.208 0.706   -6.638  1.00 33.67 ? 219 PHE B CZ  1 
ATOM   5923 N  N   . ARG B 1 220 ? -23.640 -2.909  -9.621  1.00 32.79 ? 220 ARG B N   1 
ATOM   5924 C  CA  . ARG B 1 220 ? -24.545 -3.574  -8.700  1.00 34.61 ? 220 ARG B CA  1 
ATOM   5925 C  C   . ARG B 1 220 ? -23.906 -3.886  -7.331  1.00 37.47 ? 220 ARG B C   1 
ATOM   5926 O  O   . ARG B 1 220 ? -24.460 -3.544  -6.290  1.00 35.71 ? 220 ARG B O   1 
ATOM   5927 C  CB  . ARG B 1 220 ? -25.047 -4.868  -9.332  1.00 35.67 ? 220 ARG B CB  1 
ATOM   5928 C  CG  . ARG B 1 220 ? -26.006 -5.639  -8.446  1.00 38.70 ? 220 ARG B CG  1 
ATOM   5929 C  CD  . ARG B 1 220 ? -27.257 -4.833  -8.223  1.00 39.31 ? 220 ARG B CD  1 
ATOM   5930 N  NE  . ARG B 1 220 ? -28.268 -5.630  -7.544  1.00 45.47 ? 220 ARG B NE  1 
ATOM   5931 C  CZ  . ARG B 1 220 ? -29.053 -6.507  -8.160  1.00 48.84 ? 220 ARG B CZ  1 
ATOM   5932 N  NH1 . ARG B 1 220 ? -28.938 -6.692  -9.479  1.00 43.14 ? 220 ARG B NH1 1 
ATOM   5933 N  NH2 . ARG B 1 220 ? -29.951 -7.197  -7.461  1.00 41.72 ? 220 ARG B NH2 1 
ATOM   5934 N  N   . ARG B 1 221 ? -22.740 -4.532  -7.355  1.00 35.91 ? 221 ARG B N   1 
ATOM   5935 C  CA  . ARG B 1 221 ? -22.076 -5.025  -6.156  1.00 32.70 ? 221 ARG B CA  1 
ATOM   5936 C  C   . ARG B 1 221 ? -20.562 -4.869  -6.276  1.00 36.26 ? 221 ARG B C   1 
ATOM   5937 O  O   . ARG B 1 221 ? -20.047 -4.521  -7.343  1.00 34.68 ? 221 ARG B O   1 
ATOM   5938 C  CB  . ARG B 1 221 ? -22.424 -6.487  -5.927  1.00 33.79 ? 221 ARG B CB  1 
ATOM   5939 C  CG  . ARG B 1 221 ? -23.860 -6.715  -5.541  1.00 40.53 ? 221 ARG B CG  1 
ATOM   5940 C  CD  . ARG B 1 221 ? -24.097 -8.180  -5.261  1.00 41.95 ? 221 ARG B CD  1 
ATOM   5941 N  NE  . ARG B 1 221 ? -24.550 -8.885  -6.443  1.00 47.36 ? 221 ARG B NE  1 
ATOM   5942 C  CZ  . ARG B 1 221 ? -25.828 -9.127  -6.712  1.00 43.24 ? 221 ARG B CZ  1 
ATOM   5943 N  NH1 . ARG B 1 221 ? -26.780 -8.722  -5.871  1.00 38.98 ? 221 ARG B NH1 1 
ATOM   5944 N  NH2 . ARG B 1 221 ? -26.144 -9.782  -7.818  1.00 38.91 ? 221 ARG B NH2 1 
ATOM   5945 N  N   . ALA B 1 222 ? -19.849 -5.156  -5.192  1.00 33.39 ? 222 ALA B N   1 
ATOM   5946 C  CA  . ALA B 1 222 ? -18.422 -4.875  -5.130  1.00 29.32 ? 222 ALA B CA  1 
ATOM   5947 C  C   . ALA B 1 222 ? -17.614 -5.912  -4.346  1.00 33.69 ? 222 ALA B C   1 
ATOM   5948 O  O   . ALA B 1 222 ? -18.033 -6.366  -3.265  1.00 30.20 ? 222 ALA B O   1 
ATOM   5949 C  CB  . ALA B 1 222 ? -18.203 -3.503  -4.532  1.00 29.17 ? 222 ALA B CB  1 
ATOM   5950 N  N   . ILE B 1 223 ? -16.447 -6.255  -4.902  1.00 31.54 ? 223 ILE B N   1 
ATOM   5951 C  CA  . ILE B 1 223 ? -15.458 -7.105  -4.250  1.00 30.75 ? 223 ILE B CA  1 
ATOM   5952 C  C   . ILE B 1 223 ? -14.155 -6.338  -4.044  1.00 32.65 ? 223 ILE B C   1 
ATOM   5953 O  O   . ILE B 1 223 ? -13.589 -5.814  -4.995  1.00 32.10 ? 223 ILE B O   1 
ATOM   5954 C  CB  . ILE B 1 223 ? -15.164 -8.364  -5.070  1.00 35.92 ? 223 ILE B CB  1 
ATOM   5955 C  CG1 . ILE B 1 223 ? -16.439 -9.187  -5.287  1.00 31.47 ? 223 ILE B CG1 1 
ATOM   5956 C  CG2 . ILE B 1 223 ? -14.038 -9.193  -4.420  1.00 28.84 ? 223 ILE B CG2 1 
ATOM   5957 C  CD1 . ILE B 1 223 ? -16.198 -10.472 -6.064  1.00 28.72 ? 223 ILE B CD1 1 
ATOM   5958 N  N   . LEU B 1 224 ? -13.688 -6.270  -2.800  1.00 34.57 ? 224 LEU B N   1 
ATOM   5959 C  CA  . LEU B 1 224 ? -12.458 -5.564  -2.456  1.00 28.87 ? 224 LEU B CA  1 
ATOM   5960 C  C   . LEU B 1 224 ? -11.389 -6.535  -1.951  1.00 33.19 ? 224 LEU B C   1 
ATOM   5961 O  O   . LEU B 1 224 ? -11.569 -7.153  -0.909  1.00 31.40 ? 224 LEU B O   1 
ATOM   5962 C  CB  . LEU B 1 224 ? -12.721 -4.502  -1.377  1.00 30.36 ? 224 LEU B CB  1 
ATOM   5963 C  CG  . LEU B 1 224 ? -13.611 -3.312  -1.725  1.00 30.95 ? 224 LEU B CG  1 
ATOM   5964 C  CD1 . LEU B 1 224 ? -15.084 -3.703  -1.703  1.00 30.06 ? 224 LEU B CD1 1 
ATOM   5965 C  CD2 . LEU B 1 224 ? -13.350 -2.170  -0.763  1.00 30.69 ? 224 LEU B CD2 1 
ATOM   5966 N  N   . GLN B 1 225 ? -10.274 -6.648  -2.671  1.00 30.73 ? 225 GLN B N   1 
ATOM   5967 C  CA  . GLN B 1 225 ? -9.180  -7.532  -2.270  1.00 30.37 ? 225 GLN B CA  1 
ATOM   5968 C  C   . GLN B 1 225 ? -7.975  -6.719  -1.774  1.00 32.12 ? 225 GLN B C   1 
ATOM   5969 O  O   . GLN B 1 225 ? -7.409  -5.930  -2.526  1.00 32.91 ? 225 GLN B O   1 
ATOM   5970 C  CB  . GLN B 1 225 ? -8.776  -8.446  -3.446  1.00 29.14 ? 225 GLN B CB  1 
ATOM   5971 C  CG  . GLN B 1 225 ? -9.927  -9.317  -3.995  1.00 28.78 ? 225 GLN B CG  1 
ATOM   5972 C  CD  . GLN B 1 225 ? -9.636  -9.937  -5.383  1.00 32.65 ? 225 GLN B CD  1 
ATOM   5973 O  OE1 . GLN B 1 225 ? -10.557 -10.292 -6.116  1.00 28.10 ? 225 GLN B OE1 1 
ATOM   5974 N  NE2 . GLN B 1 225 ? -8.360  -10.088 -5.721  1.00 29.62 ? 225 GLN B NE2 1 
ATOM   5975 N  N   . SER B 1 226 ? -7.595  -6.906  -0.508  1.00 28.56 ? 226 SER B N   1 
ATOM   5976 C  CA  . SER B 1 226 ? -6.390  -6.273  0.060   1.00 29.54 ? 226 SER B CA  1 
ATOM   5977 C  C   . SER B 1 226 ? -6.289  -4.771  -0.196  1.00 31.17 ? 226 SER B C   1 
ATOM   5978 O  O   . SER B 1 226 ? -5.231  -4.285  -0.562  1.00 31.22 ? 226 SER B O   1 
ATOM   5979 C  CB  . SER B 1 226 ? -5.111  -6.926  -0.481  1.00 29.02 ? 226 SER B CB  1 
ATOM   5980 O  OG  . SER B 1 226 ? -5.072  -8.323  -0.262  1.00 29.83 ? 226 SER B OG  1 
ATOM   5981 N  N   . GLY B 1 227 ? -7.385  -4.045  -0.026  1.00 28.90 ? 227 GLY B N   1 
ATOM   5982 C  CA  . GLY B 1 227 ? -7.369  -2.608  -0.199  1.00 27.11 ? 227 GLY B CA  1 
ATOM   5983 C  C   . GLY B 1 227 ? -8.736  -2.050  0.141   1.00 30.23 ? 227 GLY B C   1 
ATOM   5984 O  O   . GLY B 1 227 ? -9.748  -2.726  -0.013  1.00 29.95 ? 227 GLY B O   1 
ATOM   5985 N  N   . SER B 1 228 ? -8.776  -0.828  0.644   1.00 28.28 ? 228 SER B N   1 
ATOM   5986 C  CA  . SER B 1 228 ? -10.049 -0.197  0.929   1.00 33.22 ? 228 SER B CA  1 
ATOM   5987 C  C   . SER B 1 228 ? -9.853  1.300   0.807   1.00 33.36 ? 228 SER B C   1 
ATOM   5988 O  O   . SER B 1 228 ? -8.717  1.786   0.844   1.00 33.25 ? 228 SER B O   1 
ATOM   5989 C  CB  . SER B 1 228 ? -10.589 -0.590  2.319   1.00 34.15 ? 228 SER B CB  1 
ATOM   5990 O  OG  . SER B 1 228 ? -9.742  -0.131  3.357   1.00 34.59 ? 228 SER B OG  1 
ATOM   5991 N  N   . PRO B 1 229 ? -10.956 2.034   0.639   1.00 33.50 ? 229 PRO B N   1 
ATOM   5992 C  CA  . PRO B 1 229 ? -10.886 3.447   0.258   1.00 34.15 ? 229 PRO B CA  1 
ATOM   5993 C  C   . PRO B 1 229 ? -10.173 4.287   1.299   1.00 37.03 ? 229 PRO B C   1 
ATOM   5994 O  O   . PRO B 1 229 ? -9.542  5.284   0.941   1.00 34.21 ? 229 PRO B O   1 
ATOM   5995 C  CB  . PRO B 1 229 ? -12.363 3.848   0.126   1.00 33.53 ? 229 PRO B CB  1 
ATOM   5996 C  CG  . PRO B 1 229 ? -13.111 2.833   0.972   1.00 34.57 ? 229 PRO B CG  1 
ATOM   5997 C  CD  . PRO B 1 229 ? -12.345 1.559   0.773   1.00 34.56 ? 229 PRO B CD  1 
ATOM   5998 N  N   . ASN B 1 230 ? -10.243 3.857   2.558   1.00 34.05 ? 230 ASN B N   1 
ATOM   5999 C  CA  . ASN B 1 230 ? -9.716  4.614   3.679   1.00 35.66 ? 230 ASN B CA  1 
ATOM   6000 C  C   . ASN B 1 230 ? -8.253  4.313   4.028   1.00 35.18 ? 230 ASN B C   1 
ATOM   6001 O  O   . ASN B 1 230 ? -7.760  4.791   5.046   1.00 33.78 ? 230 ASN B O   1 
ATOM   6002 C  CB  . ASN B 1 230 ? -10.591 4.361   4.930   1.00 31.67 ? 230 ASN B CB  1 
ATOM   6003 C  CG  . ASN B 1 230 ? -10.687 2.884   5.285   1.00 32.94 ? 230 ASN B CG  1 
ATOM   6004 O  OD1 . ASN B 1 230 ? -11.019 2.053   4.441   1.00 31.76 ? 230 ASN B OD1 1 
ATOM   6005 N  ND2 . ASN B 1 230 ? -10.373 2.547   6.536   1.00 33.03 ? 230 ASN B ND2 1 
ATOM   6006 N  N   . CYS B 1 231 ? -7.573  3.510   3.213   1.00 33.24 ? 231 CYS B N   1 
ATOM   6007 C  CA  . CYS B 1 231 ? -6.158  3.204   3.468   1.00 31.99 ? 231 CYS B CA  1 
ATOM   6008 C  C   . CYS B 1 231 ? -5.311  4.474   3.547   1.00 33.24 ? 231 CYS B C   1 
ATOM   6009 O  O   . CYS B 1 231 ? -5.567  5.436   2.821   1.00 32.76 ? 231 CYS B O   1 
ATOM   6010 C  CB  . CYS B 1 231 ? -5.592  2.272   2.397   1.00 28.09 ? 231 CYS B CB  1 
ATOM   6011 S  SG  . CYS B 1 231 ? -6.143  0.557   2.558   1.00 33.18 ? 231 CYS B SG  1 
ATOM   6012 N  N   . PRO B 1 232 ? -4.297  4.473   4.435   1.00 27.98 ? 232 PRO B N   1 
ATOM   6013 C  CA  . PRO B 1 232 ? -3.463  5.661   4.662   1.00 31.57 ? 232 PRO B CA  1 
ATOM   6014 C  C   . PRO B 1 232 ? -2.637  6.066   3.435   1.00 32.63 ? 232 PRO B C   1 
ATOM   6015 O  O   . PRO B 1 232 ? -2.259  7.228   3.335   1.00 36.83 ? 232 PRO B O   1 
ATOM   6016 C  CB  . PRO B 1 232 ? -2.547  5.242   5.829   1.00 27.15 ? 232 PRO B CB  1 
ATOM   6017 C  CG  . PRO B 1 232 ? -2.504  3.754   5.769   1.00 28.92 ? 232 PRO B CG  1 
ATOM   6018 C  CD  . PRO B 1 232 ? -3.833  3.300   5.199   1.00 28.47 ? 232 PRO B CD  1 
ATOM   6019 N  N   . TRP B 1 233 ? -2.370  5.137   2.521   1.00 30.42 ? 233 TRP B N   1 
ATOM   6020 C  CA  . TRP B 1 233 ? -1.624  5.448   1.305   1.00 31.44 ? 233 TRP B CA  1 
ATOM   6021 C  C   . TRP B 1 233 ? -2.535  5.810   0.157   1.00 34.31 ? 233 TRP B C   1 
ATOM   6022 O  O   . TRP B 1 233 ? -2.071  6.294   -0.873  1.00 32.00 ? 233 TRP B O   1 
ATOM   6023 C  CB  . TRP B 1 233 ? -0.776  4.259   0.881   1.00 30.86 ? 233 TRP B CB  1 
ATOM   6024 C  CG  . TRP B 1 233 ? -1.560  2.998   0.925   1.00 32.89 ? 233 TRP B CG  1 
ATOM   6025 C  CD1 . TRP B 1 233 ? -1.685  2.151   1.995   1.00 29.52 ? 233 TRP B CD1 1 
ATOM   6026 C  CD2 . TRP B 1 233 ? -2.372  2.449   -0.119  1.00 31.81 ? 233 TRP B CD2 1 
ATOM   6027 N  NE1 . TRP B 1 233 ? -2.493  1.096   1.668   1.00 32.43 ? 233 TRP B NE1 1 
ATOM   6028 C  CE2 . TRP B 1 233 ? -2.935  1.256   0.378   1.00 30.54 ? 233 TRP B CE2 1 
ATOM   6029 C  CE3 . TRP B 1 233 ? -2.665  2.842   -1.434  1.00 34.17 ? 233 TRP B CE3 1 
ATOM   6030 C  CZ2 . TRP B 1 233 ? -3.779  0.452   -0.387  1.00 28.05 ? 233 TRP B CZ2 1 
ATOM   6031 C  CZ3 . TRP B 1 233 ? -3.502  2.037   -2.198  1.00 31.45 ? 233 TRP B CZ3 1 
ATOM   6032 C  CH2 . TRP B 1 233 ? -4.047  0.854   -1.669  1.00 34.96 ? 233 TRP B CH2 1 
ATOM   6033 N  N   . ALA B 1 234 ? -3.833  5.573   0.330   1.00 32.60 ? 234 ALA B N   1 
ATOM   6034 C  CA  . ALA B 1 234 ? -4.751  5.583   -0.797  1.00 29.85 ? 234 ALA B CA  1 
ATOM   6035 C  C   . ALA B 1 234 ? -5.341  6.960   -1.124  1.00 35.64 ? 234 ALA B C   1 
ATOM   6036 O  O   . ALA B 1 234 ? -6.028  7.112   -2.143  1.00 32.57 ? 234 ALA B O   1 
ATOM   6037 C  CB  . ALA B 1 234 ? -5.867  4.580   -0.548  1.00 32.23 ? 234 ALA B CB  1 
ATOM   6038 N  N   . SER B 1 235 ? -5.088  7.959   -0.281  1.00 34.25 ? 235 SER B N   1 
ATOM   6039 C  CA  . SER B 1 235 ? -5.497  9.325   -0.622  1.00 35.38 ? 235 SER B CA  1 
ATOM   6040 C  C   . SER B 1 235 ? -4.726  10.412  0.128   1.00 34.59 ? 235 SER B C   1 
ATOM   6041 O  O   . SER B 1 235 ? -3.974  10.136  1.059   1.00 36.44 ? 235 SER B O   1 
ATOM   6042 C  CB  . SER B 1 235 ? -7.003  9.512   -0.390  1.00 33.80 ? 235 SER B CB  1 
ATOM   6043 O  OG  . SER B 1 235 ? -7.361  9.330   0.967   1.00 39.50 ? 235 SER B OG  1 
ATOM   6044 N  N   . VAL B 1 236 ? -4.927  11.651  -0.304  1.00 36.29 ? 236 VAL B N   1 
ATOM   6045 C  CA  . VAL B 1 236 ? -4.267  12.816  0.264   1.00 37.99 ? 236 VAL B CA  1 
ATOM   6046 C  C   . VAL B 1 236 ? -5.239  13.990  0.300   1.00 40.38 ? 236 VAL B C   1 
ATOM   6047 O  O   . VAL B 1 236 ? -6.255  13.985  -0.394  1.00 42.24 ? 236 VAL B O   1 
ATOM   6048 C  CB  . VAL B 1 236 ? -3.007  13.223  -0.543  1.00 35.36 ? 236 VAL B CB  1 
ATOM   6049 C  CG1 . VAL B 1 236 ? -1.924  12.168  -0.419  1.00 37.81 ? 236 VAL B CG1 1 
ATOM   6050 C  CG2 . VAL B 1 236 ? -3.353  13.450  -2.017  1.00 39.50 ? 236 VAL B CG2 1 
ATOM   6051 N  N   . SER B 1 237 ? -4.923  15.002  1.101   1.00 41.00 ? 237 SER B N   1 
ATOM   6052 C  CA  . SER B 1 237 ? -5.718  16.223  1.133   1.00 43.00 ? 237 SER B CA  1 
ATOM   6053 C  C   . SER B 1 237 ? -5.409  17.098  -0.079  1.00 45.93 ? 237 SER B C   1 
ATOM   6054 O  O   . SER B 1 237 ? -4.381  16.910  -0.734  1.00 46.57 ? 237 SER B O   1 
ATOM   6055 C  CB  . SER B 1 237 ? -5.440  16.999  2.411   1.00 44.77 ? 237 SER B CB  1 
ATOM   6056 O  OG  . SER B 1 237 ? -4.102  17.466  2.406   1.00 46.45 ? 237 SER B OG  1 
ATOM   6057 N  N   . VAL B 1 238 ? -6.285  18.055  -0.374  1.00 46.47 ? 238 VAL B N   1 
ATOM   6058 C  CA  . VAL B 1 238 ? -6.042  18.970  -1.487  1.00 47.69 ? 238 VAL B CA  1 
ATOM   6059 C  C   . VAL B 1 238 ? -4.759  19.757  -1.233  1.00 49.28 ? 238 VAL B C   1 
ATOM   6060 O  O   . VAL B 1 238 ? -4.001  20.040  -2.164  1.00 49.25 ? 238 VAL B O   1 
ATOM   6061 C  CB  . VAL B 1 238 ? -7.214  19.947  -1.710  1.00 48.57 ? 238 VAL B CB  1 
ATOM   6062 C  CG1 . VAL B 1 238 ? -8.424  19.213  -2.264  1.00 45.67 ? 238 VAL B CG1 1 
ATOM   6063 C  CG2 . VAL B 1 238 ? -7.562  20.671  -0.416  1.00 51.42 ? 238 VAL B CG2 1 
ATOM   6064 N  N   . ALA B 1 239 ? -4.508  20.087  0.034   1.00 46.47 ? 239 ALA B N   1 
ATOM   6065 C  CA  . ALA B 1 239 ? -3.313  20.840  0.407   1.00 46.47 ? 239 ALA B CA  1 
ATOM   6066 C  C   . ALA B 1 239 ? -2.035  20.055  0.109   1.00 49.24 ? 239 ALA B C   1 
ATOM   6067 O  O   . ALA B 1 239 ? -1.113  20.573  -0.525  1.00 50.91 ? 239 ALA B O   1 
ATOM   6068 C  CB  . ALA B 1 239 ? -3.364  21.221  1.881   1.00 45.09 ? 239 ALA B CB  1 
ATOM   6069 N  N   . GLU B 1 240 ? -1.982  18.809  0.573   1.00 46.11 ? 240 GLU B N   1 
ATOM   6070 C  CA  . GLU B 1 240 ? -0.834  17.945  0.317   1.00 49.17 ? 240 GLU B CA  1 
ATOM   6071 C  C   . GLU B 1 240 ? -0.682  17.616  -1.178  1.00 45.78 ? 240 GLU B C   1 
ATOM   6072 O  O   . GLU B 1 240 ? 0.422   17.639  -1.715  1.00 48.47 ? 240 GLU B O   1 
ATOM   6073 C  CB  . GLU B 1 240 ? -0.946  16.658  1.140   1.00 45.15 ? 240 GLU B CB  1 
ATOM   6074 C  CG  . GLU B 1 240 ? 0.093   15.589  0.792   1.00 44.30 ? 240 GLU B CG  1 
ATOM   6075 C  CD  . GLU B 1 240 ? 1.512   15.983  1.166   1.00 45.03 ? 240 GLU B CD  1 
ATOM   6076 O  OE1 . GLU B 1 240 ? 1.712   17.083  1.718   1.00 44.80 ? 240 GLU B OE1 1 
ATOM   6077 O  OE2 . GLU B 1 240 ? 2.433   15.184  0.906   1.00 44.39 ? 240 GLU B OE2 1 
ATOM   6078 N  N   . GLY B 1 241 ? -1.793  17.313  -1.844  1.00 48.13 ? 241 GLY B N   1 
ATOM   6079 C  CA  . GLY B 1 241 ? -1.779  17.024  -3.269  1.00 43.84 ? 241 GLY B CA  1 
ATOM   6080 C  C   . GLY B 1 241 ? -1.237  18.195  -4.066  1.00 45.62 ? 241 GLY B C   1 
ATOM   6081 O  O   . GLY B 1 241 ? -0.545  18.018  -5.064  1.00 45.17 ? 241 GLY B O   1 
ATOM   6082 N  N   . ARG B 1 242 ? -1.554  19.404  -3.619  1.00 47.64 ? 242 ARG B N   1 
ATOM   6083 C  CA  . ARG B 1 242 ? -1.019  20.608  -4.239  1.00 47.62 ? 242 ARG B CA  1 
ATOM   6084 C  C   . ARG B 1 242 ? 0.486   20.704  -4.020  1.00 47.32 ? 242 ARG B C   1 
ATOM   6085 O  O   . ARG B 1 242 ? 1.243   20.966  -4.957  1.00 47.28 ? 242 ARG B O   1 
ATOM   6086 C  CB  . ARG B 1 242 ? -1.705  21.857  -3.680  1.00 49.90 ? 242 ARG B CB  1 
ATOM   6087 C  CG  . ARG B 1 242 ? -1.074  23.156  -4.170  1.00 54.25 ? 242 ARG B CG  1 
ATOM   6088 C  CD  . ARG B 1 242 ? -1.978  24.355  -3.946  1.00 51.57 ? 242 ARG B CD  1 
ATOM   6089 N  NE  . ARG B 1 242 ? -3.155  24.313  -4.806  1.00 48.68 ? 242 ARG B NE  1 
ATOM   6090 C  CZ  . ARG B 1 242 ? -3.207  24.832  -6.027  1.00 51.68 ? 242 ARG B CZ  1 
ATOM   6091 N  NH1 . ARG B 1 242 ? -4.319  24.744  -6.737  1.00 51.88 ? 242 ARG B NH1 1 
ATOM   6092 N  NH2 . ARG B 1 242 ? -2.146  25.432  -6.542  1.00 56.48 ? 242 ARG B NH2 1 
ATOM   6093 N  N   . ARG B 1 243 ? 0.911   20.498  -2.775  1.00 46.94 ? 243 ARG B N   1 
ATOM   6094 C  CA  . ARG B 1 243 ? 2.319   20.586  -2.428  1.00 47.37 ? 243 ARG B CA  1 
ATOM   6095 C  C   . ARG B 1 243 ? 3.130   19.639  -3.300  1.00 47.35 ? 243 ARG B C   1 
ATOM   6096 O  O   . ARG B 1 243 ? 4.177   20.012  -3.818  1.00 47.69 ? 243 ARG B O   1 
ATOM   6097 C  CB  . ARG B 1 243 ? 2.543   20.269  -0.946  1.00 48.96 ? 243 ARG B CB  1 
ATOM   6098 C  CG  . ARG B 1 243 ? 3.972   20.543  -0.450  1.00 45.78 ? 243 ARG B CG  1 
ATOM   6099 C  CD  . ARG B 1 243 ? 4.255   19.840  0.888   1.00 45.06 ? 243 ARG B CD  1 
ATOM   6100 N  NE  . ARG B 1 243 ? 4.254   18.384  0.738   1.00 46.99 ? 243 ARG B NE  1 
ATOM   6101 C  CZ  . ARG B 1 243 ? 5.226   17.701  0.134   1.00 46.65 ? 243 ARG B CZ  1 
ATOM   6102 N  NH1 . ARG B 1 243 ? 6.275   18.345  -0.360  1.00 42.67 ? 243 ARG B NH1 1 
ATOM   6103 N  NH2 . ARG B 1 243 ? 5.158   16.380  0.027   1.00 41.01 ? 243 ARG B NH2 1 
ATOM   6104 N  N   . ARG B 1 244 ? 2.639   18.418  -3.478  1.00 43.84 ? 244 ARG B N   1 
ATOM   6105 C  CA  . ARG B 1 244 ? 3.363   17.446  -4.286  1.00 43.63 ? 244 ARG B CA  1 
ATOM   6106 C  C   . ARG B 1 244 ? 3.370   17.818  -5.774  1.00 47.91 ? 244 ARG B C   1 
ATOM   6107 O  O   . ARG B 1 244 ? 4.351   17.565  -6.477  1.00 46.77 ? 244 ARG B O   1 
ATOM   6108 C  CB  . ARG B 1 244 ? 2.773   16.050  -4.095  1.00 43.25 ? 244 ARG B CB  1 
ATOM   6109 C  CG  . ARG B 1 244 ? 2.836   15.546  -2.667  1.00 41.74 ? 244 ARG B CG  1 
ATOM   6110 C  CD  . ARG B 1 244 ? 2.291   14.136  -2.558  1.00 38.80 ? 244 ARG B CD  1 
ATOM   6111 N  NE  . ARG B 1 244 ? 2.254   13.688  -1.170  1.00 42.27 ? 244 ARG B NE  1 
ATOM   6112 C  CZ  . ARG B 1 244 ? 1.900   12.467  -0.787  1.00 38.35 ? 244 ARG B CZ  1 
ATOM   6113 N  NH1 . ARG B 1 244 ? 1.547   11.563  -1.692  1.00 35.85 ? 244 ARG B NH1 1 
ATOM   6114 N  NH2 . ARG B 1 244 ? 1.902   12.151  0.504   1.00 35.02 ? 244 ARG B NH2 1 
ATOM   6115 N  N   . ALA B 1 245 ? 2.284   18.413  -6.257  1.00 46.86 ? 245 ALA B N   1 
ATOM   6116 C  CA  . ALA B 1 245 ? 2.219   18.826  -7.656  1.00 44.29 ? 245 ALA B CA  1 
ATOM   6117 C  C   . ALA B 1 245 ? 3.218   19.948  -7.903  1.00 46.64 ? 245 ALA B C   1 
ATOM   6118 O  O   . ALA B 1 245 ? 3.950   19.948  -8.890  1.00 48.38 ? 245 ALA B O   1 
ATOM   6119 C  CB  . ALA B 1 245 ? 0.819   19.269  -8.018  1.00 40.97 ? 245 ALA B CB  1 
ATOM   6120 N  N   . VAL B 1 246 ? 3.247   20.903  -6.982  1.00 48.81 ? 246 VAL B N   1 
ATOM   6121 C  CA  . VAL B 1 246 ? 4.173   22.023  -7.066  1.00 48.67 ? 246 VAL B CA  1 
ATOM   6122 C  C   . VAL B 1 246 ? 5.614   21.556  -6.911  1.00 48.84 ? 246 VAL B C   1 
ATOM   6123 O  O   . VAL B 1 246 ? 6.523   22.065  -7.571  1.00 48.86 ? 246 VAL B O   1 
ATOM   6124 C  CB  . VAL B 1 246 ? 3.867   23.081  -5.990  1.00 50.39 ? 246 VAL B CB  1 
ATOM   6125 C  CG1 . VAL B 1 246 ? 4.933   24.157  -6.004  1.00 50.02 ? 246 VAL B CG1 1 
ATOM   6126 C  CG2 . VAL B 1 246 ? 2.480   23.678  -6.212  1.00 46.16 ? 246 VAL B CG2 1 
ATOM   6127 N  N   . GLU B 1 247 ? 5.825   20.585  -6.031  1.00 46.99 ? 247 GLU B N   1 
ATOM   6128 C  CA  . GLU B 1 247 ? 7.158   20.039  -5.834  1.00 50.40 ? 247 GLU B CA  1 
ATOM   6129 C  C   . GLU B 1 247 ? 7.615   19.283  -7.085  1.00 49.53 ? 247 GLU B C   1 
ATOM   6130 O  O   . GLU B 1 247 ? 8.811   19.199  -7.365  1.00 48.26 ? 247 GLU B O   1 
ATOM   6131 C  CB  . GLU B 1 247 ? 7.188   19.128  -4.609  1.00 48.20 ? 247 GLU B CB  1 
ATOM   6132 C  CG  . GLU B 1 247 ? 8.541   18.473  -4.339  1.00 51.02 ? 247 GLU B CG  1 
ATOM   6133 C  CD  . GLU B 1 247 ? 9.576   19.428  -3.753  1.00 58.03 ? 247 GLU B CD  1 
ATOM   6134 O  OE1 . GLU B 1 247 ? 10.744  19.005  -3.604  1.00 59.29 ? 247 GLU B OE1 1 
ATOM   6135 O  OE2 . GLU B 1 247 ? 9.228   20.587  -3.433  1.00 59.83 ? 247 GLU B OE2 1 
ATOM   6136 N  N   . LEU B 1 248 ? 6.660   18.729  -7.827  1.00 45.08 ? 248 LEU B N   1 
ATOM   6137 C  CA  . LEU B 1 248 ? 6.978   18.032  -9.065  1.00 49.05 ? 248 LEU B CA  1 
ATOM   6138 C  C   . LEU B 1 248 ? 7.549   19.018  -10.079 1.00 51.90 ? 248 LEU B C   1 
ATOM   6139 O  O   . LEU B 1 248 ? 8.529   18.720  -10.764 1.00 49.16 ? 248 LEU B O   1 
ATOM   6140 C  CB  . LEU B 1 248 ? 5.747   17.334  -9.652  1.00 46.35 ? 248 LEU B CB  1 
ATOM   6141 C  CG  . LEU B 1 248 ? 6.047   16.509  -10.913 1.00 48.35 ? 248 LEU B CG  1 
ATOM   6142 C  CD1 . LEU B 1 248 ? 6.870   15.274  -10.570 1.00 44.11 ? 248 LEU B CD1 1 
ATOM   6143 C  CD2 . LEU B 1 248 ? 4.792   16.120  -11.690 1.00 42.47 ? 248 LEU B CD2 1 
ATOM   6144 N  N   . GLY B 1 249 ? 6.929   20.193  -10.168 1.00 49.84 ? 249 GLY B N   1 
ATOM   6145 C  CA  . GLY B 1 249 ? 7.407   21.239  -11.054 1.00 53.37 ? 249 GLY B CA  1 
ATOM   6146 C  C   . GLY B 1 249 ? 8.797   21.714  -10.674 1.00 51.43 ? 249 GLY B C   1 
ATOM   6147 O  O   . GLY B 1 249 ? 9.659   21.899  -11.528 1.00 56.89 ? 249 GLY B O   1 
ATOM   6148 N  N   . ARG B 1 250 ? 9.006   21.903  -9.380  1.00 52.27 ? 250 ARG B N   1 
ATOM   6149 C  CA  . ARG B 1 250 ? 10.269  22.390  -8.851  1.00 52.41 ? 250 ARG B CA  1 
ATOM   6150 C  C   . ARG B 1 250 ? 11.391  21.444  -9.216  1.00 54.43 ? 250 ARG B C   1 
ATOM   6151 O  O   . ARG B 1 250 ? 12.472  21.880  -9.604  1.00 53.32 ? 250 ARG B O   1 
ATOM   6152 C  CB  . ARG B 1 250 ? 10.180  22.557  -7.334  1.00 50.76 ? 250 ARG B CB  1 
ATOM   6153 C  CG  . ARG B 1 250 ? 11.434  23.091  -6.692  1.00 58.03 ? 250 ARG B CG  1 
ATOM   6154 C  CD  . ARG B 1 250 ? 11.242  23.242  -5.199  1.00 59.98 ? 250 ARG B CD  1 
ATOM   6155 N  NE  . ARG B 1 250 ? 12.499  23.073  -4.472  1.00 75.48 ? 250 ARG B NE  1 
ATOM   6156 C  CZ  . ARG B 1 250 ? 13.016  21.895  -4.131  1.00 77.58 ? 250 ARG B CZ  1 
ATOM   6157 N  NH1 . ARG B 1 250 ? 14.161  21.836  -3.457  1.00 79.57 ? 250 ARG B NH1 1 
ATOM   6158 N  NH2 . ARG B 1 250 ? 12.387  20.773  -4.462  1.00 71.03 ? 250 ARG B NH2 1 
ATOM   6159 N  N   . ASN B 1 251 ? 11.124  20.146  -9.100  1.00 53.59 ? 251 ASN B N   1 
ATOM   6160 C  CA  . ASN B 1 251 ? 12.077  19.121  -9.522  1.00 53.68 ? 251 ASN B CA  1 
ATOM   6161 C  C   . ASN B 1 251 ? 12.331  19.127  -11.024 1.00 52.36 ? 251 ASN B C   1 
ATOM   6162 O  O   . ASN B 1 251 ? 13.155  18.362  -11.515 1.00 57.55 ? 251 ASN B O   1 
ATOM   6163 C  CB  . ASN B 1 251 ? 11.592  17.730  -9.122  1.00 49.55 ? 251 ASN B CB  1 
ATOM   6164 C  CG  . ASN B 1 251 ? 11.991  17.349  -7.721  1.00 48.38 ? 251 ASN B CG  1 
ATOM   6165 O  OD1 . ASN B 1 251 ? 12.913  16.555  -7.524  1.00 46.88 ? 251 ASN B OD1 1 
ATOM   6166 N  ND2 . ASN B 1 251 ? 11.287  17.892  -6.734  1.00 45.79 ? 251 ASN B ND2 1 
ATOM   6167 N  N   . LEU B 1 252 ? 11.614  19.967  -11.758 1.00 54.35 ? 252 LEU B N   1 
ATOM   6168 C  CA  . LEU B 1 252 ? 11.781  20.011  -13.207 1.00 54.27 ? 252 LEU B CA  1 
ATOM   6169 C  C   . LEU B 1 252 ? 12.019  21.432  -13.714 1.00 56.47 ? 252 LEU B C   1 
ATOM   6170 O  O   . LEU B 1 252 ? 11.860  21.708  -14.904 1.00 56.43 ? 252 LEU B O   1 
ATOM   6171 C  CB  . LEU B 1 252 ? 10.560  19.400  -13.896 1.00 56.39 ? 252 LEU B CB  1 
ATOM   6172 C  CG  . LEU B 1 252 ? 10.344  17.908  -13.650 1.00 49.78 ? 252 LEU B CG  1 
ATOM   6173 C  CD1 . LEU B 1 252 ? 8.955   17.492  -14.109 1.00 45.10 ? 252 LEU B CD1 1 
ATOM   6174 C  CD2 . LEU B 1 252 ? 11.419  17.090  -14.352 1.00 51.19 ? 252 LEU B CD2 1 
ATOM   6175 N  N   . ASN B 1 253 ? 12.408  22.325  -12.808 1.00 56.53 ? 253 ASN B N   1 
ATOM   6176 C  CA  . ASN B 1 253 ? 12.696  23.710  -13.161 1.00 57.24 ? 253 ASN B CA  1 
ATOM   6177 C  C   . ASN B 1 253 ? 11.519  24.388  -13.843 1.00 55.37 ? 253 ASN B C   1 
ATOM   6178 O  O   . ASN B 1 253 ? 11.689  25.071  -14.843 1.00 56.74 ? 253 ASN B O   1 
ATOM   6179 C  CB  . ASN B 1 253 ? 13.923  23.788  -14.070 1.00 53.38 ? 253 ASN B CB  1 
ATOM   6180 C  CG  . ASN B 1 253 ? 15.185  23.337  -13.377 1.00 62.53 ? 253 ASN B CG  1 
ATOM   6181 O  OD1 . ASN B 1 253 ? 15.386  23.605  -12.188 1.00 67.45 ? 253 ASN B OD1 1 
ATOM   6182 N  ND2 . ASN B 1 253 ? 16.044  22.636  -14.111 1.00 62.13 ? 253 ASN B ND2 1 
ATOM   6183 N  N   . CYS B 1 254 ? 10.324  24.197  -13.301 1.00 57.29 ? 254 CYS B N   1 
ATOM   6184 C  CA  . CYS B 1 254 ? 9.134   24.793  -13.888 1.00 53.69 ? 254 CYS B CA  1 
ATOM   6185 C  C   . CYS B 1 254 ? 8.811   26.154  -13.290 1.00 56.60 ? 254 CYS B C   1 
ATOM   6186 O  O   . CYS B 1 254 ? 9.152   26.454  -12.148 1.00 55.75 ? 254 CYS B O   1 
ATOM   6187 C  CB  . CYS B 1 254 ? 7.929   23.870  -13.716 1.00 54.79 ? 254 CYS B CB  1 
ATOM   6188 S  SG  . CYS B 1 254 ? 7.976   22.383  -14.705 1.00 55.10 ? 254 CYS B SG  1 
ATOM   6189 N  N   . ASN B 1 255 ? 8.142   26.971  -14.087 1.00 57.92 ? 255 ASN B N   1 
ATOM   6190 C  CA  . ASN B 1 255 ? 7.559   28.208  -13.614 1.00 58.63 ? 255 ASN B CA  1 
ATOM   6191 C  C   . ASN B 1 255 ? 6.492   27.882  -12.566 1.00 60.23 ? 255 ASN B C   1 
ATOM   6192 O  O   . ASN B 1 255 ? 5.473   27.267  -12.885 1.00 63.07 ? 255 ASN B O   1 
ATOM   6193 C  CB  . ASN B 1 255 ? 6.969   28.978  -14.800 1.00 61.50 ? 255 ASN B CB  1 
ATOM   6194 C  CG  . ASN B 1 255 ? 6.765   30.444  -14.505 1.00 67.82 ? 255 ASN B CG  1 
ATOM   6195 O  OD1 . ASN B 1 255 ? 6.123   30.811  -13.519 1.00 67.68 ? 255 ASN B OD1 1 
ATOM   6196 N  ND2 . ASN B 1 255 ? 7.315   31.297  -15.360 1.00 68.76 ? 255 ASN B ND2 1 
ATOM   6197 N  N   . LEU B 1 256 ? 6.724   28.267  -11.316 1.00 58.89 ? 256 LEU B N   1 
ATOM   6198 C  CA  . LEU B 1 256 ? 5.800   27.892  -10.242 1.00 62.27 ? 256 LEU B CA  1 
ATOM   6199 C  C   . LEU B 1 256 ? 4.856   29.012  -9.821  1.00 62.95 ? 256 LEU B C   1 
ATOM   6200 O  O   . LEU B 1 256 ? 4.182   28.908  -8.791  1.00 65.91 ? 256 LEU B O   1 
ATOM   6201 C  CB  . LEU B 1 256 ? 6.571   27.420  -9.011  1.00 52.45 ? 256 LEU B CB  1 
ATOM   6202 C  CG  . LEU B 1 256 ? 7.507   26.220  -9.131  1.00 56.50 ? 256 LEU B CG  1 
ATOM   6203 C  CD1 . LEU B 1 256 ? 7.942   25.759  -7.728  1.00 46.99 ? 256 LEU B CD1 1 
ATOM   6204 C  CD2 . LEU B 1 256 ? 6.867   25.088  -9.919  1.00 50.83 ? 256 LEU B CD2 1 
ATOM   6205 N  N   . ASN B 1 257 ? 4.803   30.078  -10.610 1.00 64.38 ? 257 ASN B N   1 
ATOM   6206 C  CA  . ASN B 1 257 ? 4.080   31.276  -10.201 1.00 65.66 ? 257 ASN B CA  1 
ATOM   6207 C  C   . ASN B 1 257 ? 2.573   31.092  -10.216 1.00 66.41 ? 257 ASN B C   1 
ATOM   6208 O  O   . ASN B 1 257 ? 1.864   31.657  -9.382  1.00 70.62 ? 257 ASN B O   1 
ATOM   6209 C  CB  . ASN B 1 257 ? 4.464   32.458  -11.087 1.00 69.01 ? 257 ASN B CB  1 
ATOM   6210 C  CG  . ASN B 1 257 ? 5.953   32.744  -11.063 1.00 71.99 ? 257 ASN B CG  1 
ATOM   6211 O  OD1 . ASN B 1 257 ? 6.538   33.103  -12.085 1.00 77.16 ? 257 ASN B OD1 1 
ATOM   6212 N  ND2 . ASN B 1 257 ? 6.577   32.577  -9.896  1.00 67.88 ? 257 ASN B ND2 1 
ATOM   6213 N  N   . SER B 1 258 ? 2.084   30.299  -11.161 1.00 66.25 ? 258 SER B N   1 
ATOM   6214 C  CA  . SER B 1 258 ? 0.655   30.034  -11.256 1.00 63.26 ? 258 SER B CA  1 
ATOM   6215 C  C   . SER B 1 258 ? 0.400   28.573  -11.576 1.00 62.42 ? 258 SER B C   1 
ATOM   6216 O  O   . SER B 1 258 ? 1.313   27.854  -11.989 1.00 59.85 ? 258 SER B O   1 
ATOM   6217 C  CB  . SER B 1 258 ? 0.013   30.912  -12.329 1.00 62.69 ? 258 SER B CB  1 
ATOM   6218 O  OG  . SER B 1 258 ? 0.327   30.423  -13.621 1.00 63.06 ? 258 SER B OG  1 
ATOM   6219 N  N   . ASP B 1 259 ? -0.845  28.141  -11.390 1.00 58.33 ? 259 ASP B N   1 
ATOM   6220 C  CA  . ASP B 1 259 ? -1.243  26.799  -11.783 1.00 56.06 ? 259 ASP B CA  1 
ATOM   6221 C  C   . ASP B 1 259 ? -1.096  26.643  -13.297 1.00 58.89 ? 259 ASP B C   1 
ATOM   6222 O  O   . ASP B 1 259 ? -0.505  25.666  -13.766 1.00 56.88 ? 259 ASP B O   1 
ATOM   6223 C  CB  . ASP B 1 259 ? -2.684  26.495  -11.355 1.00 55.70 ? 259 ASP B CB  1 
ATOM   6224 C  CG  . ASP B 1 259 ? -2.840  26.361  -9.847  1.00 56.72 ? 259 ASP B CG  1 
ATOM   6225 O  OD1 . ASP B 1 259 ? -1.823  26.257  -9.131  1.00 63.37 ? 259 ASP B OD1 1 
ATOM   6226 O  OD2 . ASP B 1 259 ? -3.992  26.347  -9.369  1.00 58.08 ? 259 ASP B OD2 1 
ATOM   6227 N  N   . GLU B 1 260 ? -1.623  27.606  -14.057 1.00 60.70 ? 260 GLU B N   1 
ATOM   6228 C  CA  . GLU B 1 260 ? -1.552  27.545  -15.520 1.00 61.11 ? 260 GLU B CA  1 
ATOM   6229 C  C   . GLU B 1 260 ? -0.118  27.405  -16.026 1.00 61.49 ? 260 GLU B C   1 
ATOM   6230 O  O   . GLU B 1 260 ? 0.158   26.606  -16.924 1.00 60.05 ? 260 GLU B O   1 
ATOM   6231 C  CB  . GLU B 1 260 ? -2.192  28.776  -16.174 1.00 63.97 ? 260 GLU B CB  1 
ATOM   6232 C  CG  . GLU B 1 260 ? -1.963  28.796  -17.698 1.00 68.63 ? 260 GLU B CG  1 
ATOM   6233 C  CD  . GLU B 1 260 ? -2.813  29.810  -18.453 1.00 75.51 ? 260 GLU B CD  1 
ATOM   6234 O  OE1 . GLU B 1 260 ? -3.367  30.731  -17.814 1.00 78.46 ? 260 GLU B OE1 1 
ATOM   6235 O  OE2 . GLU B 1 260 ? -2.924  29.678  -19.697 1.00 70.37 ? 260 GLU B OE2 1 
ATOM   6236 N  N   . GLU B 1 261 ? 0.798   28.179  -15.454 1.00 66.06 ? 261 GLU B N   1 
ATOM   6237 C  CA  . GLU B 1 261 ? 2.196   28.106  -15.870 1.00 63.63 ? 261 GLU B CA  1 
ATOM   6238 C  C   . GLU B 1 261 ? 2.811   26.763  -15.500 1.00 61.74 ? 261 GLU B C   1 
ATOM   6239 O  O   . GLU B 1 261 ? 3.459   26.116  -16.334 1.00 57.69 ? 261 GLU B O   1 
ATOM   6240 C  CB  . GLU B 1 261 ? 2.997   29.241  -15.248 1.00 65.10 ? 261 GLU B CB  1 
ATOM   6241 C  CG  . GLU B 1 261 ? 2.758   30.574  -15.911 1.00 67.18 ? 261 GLU B CG  1 
ATOM   6242 C  CD  . GLU B 1 261 ? 3.389   31.708  -15.143 1.00 74.32 ? 261 GLU B CD  1 
ATOM   6243 O  OE1 . GLU B 1 261 ? 3.242   31.733  -13.900 1.00 74.32 ? 261 GLU B OE1 1 
ATOM   6244 O  OE2 . GLU B 1 261 ? 4.041   32.566  -15.777 1.00 79.41 ? 261 GLU B OE2 1 
ATOM   6245 N  N   . LEU B 1 262 ? 2.590   26.353  -14.251 1.00 54.04 ? 262 LEU B N   1 
ATOM   6246 C  CA  . LEU B 1 262 ? 3.067   25.070  -13.746 1.00 55.02 ? 262 LEU B CA  1 
ATOM   6247 C  C   . LEU B 1 262 ? 2.583   23.919  -14.619 1.00 54.35 ? 262 LEU B C   1 
ATOM   6248 O  O   . LEU B 1 262 ? 3.377   23.097  -15.093 1.00 51.98 ? 262 LEU B O   1 
ATOM   6249 C  CB  . LEU B 1 262 ? 2.605   24.862  -12.299 1.00 53.25 ? 262 LEU B CB  1 
ATOM   6250 C  CG  . LEU B 1 262 ? 2.933   23.503  -11.681 1.00 50.42 ? 262 LEU B CG  1 
ATOM   6251 C  CD1 . LEU B 1 262 ? 4.424   23.222  -11.760 1.00 49.74 ? 262 LEU B CD1 1 
ATOM   6252 C  CD2 . LEU B 1 262 ? 2.459   23.440  -10.246 1.00 49.68 ? 262 LEU B CD2 1 
ATOM   6253 N  N   . ILE B 1 263 ? 1.270   23.871  -14.826 1.00 53.81 ? 263 ILE B N   1 
ATOM   6254 C  CA  . ILE B 1 263 ? 0.652   22.854  -15.662 1.00 51.48 ? 263 ILE B CA  1 
ATOM   6255 C  C   . ILE B 1 263 ? 1.219   22.853  -17.077 1.00 53.55 ? 263 ILE B C   1 
ATOM   6256 O  O   . ILE B 1 263 ? 1.547   21.793  -17.616 1.00 54.72 ? 263 ILE B O   1 
ATOM   6257 C  CB  . ILE B 1 263 ? -0.874  23.051  -15.733 1.00 52.83 ? 263 ILE B CB  1 
ATOM   6258 C  CG1 . ILE B 1 263 ? -1.500  22.806  -14.363 1.00 51.62 ? 263 ILE B CG1 1 
ATOM   6259 C  CG2 . ILE B 1 263 ? -1.491  22.126  -16.769 1.00 48.39 ? 263 ILE B CG2 1 
ATOM   6260 C  CD1 . ILE B 1 263 ? -3.004  22.891  -14.377 1.00 53.25 ? 263 ILE B CD1 1 
ATOM   6261 N  N   . HIS B 1 264 ? 1.332   24.036  -17.677 1.00 54.48 ? 264 HIS B N   1 
ATOM   6262 C  CA  . HIS B 1 264 ? 1.830   24.147  -19.049 1.00 59.48 ? 264 HIS B CA  1 
ATOM   6263 C  C   . HIS B 1 264 ? 3.250   23.599  -19.155 1.00 56.76 ? 264 HIS B C   1 
ATOM   6264 O  O   . HIS B 1 264 ? 3.585   22.880  -20.097 1.00 55.61 ? 264 HIS B O   1 
ATOM   6265 C  CB  . HIS B 1 264 ? 1.786   25.599  -19.532 1.00 58.99 ? 264 HIS B CB  1 
ATOM   6266 C  CG  . HIS B 1 264 ? 2.280   25.780  -20.934 1.00 63.94 ? 264 HIS B CG  1 
ATOM   6267 N  ND1 . HIS B 1 264 ? 3.525   26.296  -21.227 1.00 63.51 ? 264 HIS B ND1 1 
ATOM   6268 C  CD2 . HIS B 1 264 ? 1.703   25.494  -22.125 1.00 65.11 ? 264 HIS B CD2 1 
ATOM   6269 C  CE1 . HIS B 1 264 ? 3.690   26.326  -22.537 1.00 62.93 ? 264 HIS B CE1 1 
ATOM   6270 N  NE2 . HIS B 1 264 ? 2.600   25.845  -23.105 1.00 62.95 ? 264 HIS B NE2 1 
ATOM   6271 N  N   . CYS B 1 265 ? 4.077   23.939  -18.174 1.00 53.25 ? 265 CYS B N   1 
ATOM   6272 C  CA  . CYS B 1 265 ? 5.428   23.414  -18.104 1.00 53.50 ? 265 CYS B CA  1 
ATOM   6273 C  C   . CYS B 1 265 ? 5.424   21.887  -18.044 1.00 54.28 ? 265 CYS B C   1 
ATOM   6274 O  O   . CYS B 1 265 ? 6.201   21.227  -18.736 1.00 49.30 ? 265 CYS B O   1 
ATOM   6275 C  CB  . CYS B 1 265 ? 6.152   23.997  -16.887 1.00 56.63 ? 265 CYS B CB  1 
ATOM   6276 S  SG  . CYS B 1 265 ? 7.759   23.261  -16.536 1.00 68.63 ? 265 CYS B SG  1 
ATOM   6277 N  N   . LEU B 1 266 ? 4.536   21.331  -17.220 1.00 54.45 ? 266 LEU B N   1 
ATOM   6278 C  CA  . LEU B 1 266 ? 4.484   19.887  -17.004 1.00 49.63 ? 266 LEU B CA  1 
ATOM   6279 C  C   . LEU B 1 266 ? 3.921   19.141  -18.214 1.00 51.54 ? 266 LEU B C   1 
ATOM   6280 O  O   . LEU B 1 266 ? 4.287   17.989  -18.465 1.00 49.58 ? 266 LEU B O   1 
ATOM   6281 C  CB  . LEU B 1 266 ? 3.659   19.570  -15.754 1.00 53.83 ? 266 LEU B CB  1 
ATOM   6282 C  CG  . LEU B 1 266 ? 4.283   19.933  -14.403 1.00 48.18 ? 266 LEU B CG  1 
ATOM   6283 C  CD1 . LEU B 1 266 ? 3.237   19.882  -13.314 1.00 49.58 ? 266 LEU B CD1 1 
ATOM   6284 C  CD2 . LEU B 1 266 ? 5.429   18.992  -14.080 1.00 46.54 ? 266 LEU B CD2 1 
ATOM   6285 N  N   . ARG B 1 267 ? 3.043   19.802  -18.968 1.00 53.89 ? 267 ARG B N   1 
ATOM   6286 C  CA  . ARG B 1 267 ? 2.470   19.219  -20.185 1.00 49.56 ? 267 ARG B CA  1 
ATOM   6287 C  C   . ARG B 1 267 ? 3.473   19.164  -21.324 1.00 51.37 ? 267 ARG B C   1 
ATOM   6288 O  O   . ARG B 1 267 ? 3.233   18.497  -22.331 1.00 46.88 ? 267 ARG B O   1 
ATOM   6289 C  CB  . ARG B 1 267 ? 1.237   20.003  -20.639 1.00 47.58 ? 267 ARG B CB  1 
ATOM   6290 C  CG  . ARG B 1 267 ? -0.026  19.663  -19.873 1.00 47.56 ? 267 ARG B CG  1 
ATOM   6291 C  CD  . ARG B 1 267 ? -1.230  20.457  -20.368 1.00 46.00 ? 267 ARG B CD  1 
ATOM   6292 N  NE  . ARG B 1 267 ? -2.444  20.016  -19.690 1.00 52.23 ? 267 ARG B NE  1 
ATOM   6293 C  CZ  . ARG B 1 267 ? -3.505  20.779  -19.449 1.00 51.71 ? 267 ARG B CZ  1 
ATOM   6294 N  NH1 . ARG B 1 267 ? -3.521  22.047  -19.831 1.00 51.11 ? 267 ARG B NH1 1 
ATOM   6295 N  NH2 . ARG B 1 267 ? -4.552  20.268  -18.817 1.00 52.90 ? 267 ARG B NH2 1 
ATOM   6296 N  N   . GLU B 1 268 ? 4.598   19.855  -21.159 1.00 52.76 ? 268 GLU B N   1 
ATOM   6297 C  CA  . GLU B 1 268 ? 5.606   19.937  -22.211 1.00 52.01 ? 268 GLU B CA  1 
ATOM   6298 C  C   . GLU B 1 268 ? 6.681   18.869  -22.056 1.00 52.91 ? 268 GLU B C   1 
ATOM   6299 O  O   . GLU B 1 268 ? 7.506   18.675  -22.952 1.00 55.61 ? 268 GLU B O   1 
ATOM   6300 C  CB  . GLU B 1 268 ? 6.257   21.321  -22.216 1.00 55.98 ? 268 GLU B CB  1 
ATOM   6301 C  CG  . GLU B 1 268 ? 6.699   21.799  -23.589 1.00 63.73 ? 268 GLU B CG  1 
ATOM   6302 C  CD  . GLU B 1 268 ? 5.551   22.385  -24.396 1.00 70.33 ? 268 GLU B CD  1 
ATOM   6303 O  OE1 . GLU B 1 268 ? 4.869   23.294  -23.868 1.00 69.46 ? 268 GLU B OE1 1 
ATOM   6304 O  OE2 . GLU B 1 268 ? 5.330   21.936  -25.549 1.00 73.21 ? 268 GLU B OE2 1 
ATOM   6305 N  N   . LYS B 1 269 ? 6.672   18.184  -20.916 1.00 52.00 ? 269 LYS B N   1 
ATOM   6306 C  CA  . LYS B 1 269 ? 7.693   17.188  -20.598 1.00 48.15 ? 269 LYS B CA  1 
ATOM   6307 C  C   . LYS B 1 269 ? 7.338   15.822  -21.170 1.00 50.38 ? 269 LYS B C   1 
ATOM   6308 O  O   . LYS B 1 269 ? 6.159   15.477  -21.276 1.00 47.18 ? 269 LYS B O   1 
ATOM   6309 C  CB  . LYS B 1 269 ? 7.873   17.068  -19.084 1.00 45.41 ? 269 LYS B CB  1 
ATOM   6310 C  CG  . LYS B 1 269 ? 8.155   18.380  -18.374 1.00 51.21 ? 269 LYS B CG  1 
ATOM   6311 C  CD  . LYS B 1 269 ? 9.578   18.869  -18.616 1.00 53.17 ? 269 LYS B CD  1 
ATOM   6312 C  CE  . LYS B 1 269 ? 9.822   20.197  -17.905 1.00 54.45 ? 269 LYS B CE  1 
ATOM   6313 N  NZ  . LYS B 1 269 ? 11.184  20.744  -18.154 1.00 61.91 ? 269 LYS B NZ  1 
ATOM   6314 N  N   . LYS B 1 270 ? 8.357   15.052  -21.547 1.00 48.23 ? 270 LYS B N   1 
ATOM   6315 C  CA  . LYS B 1 270 ? 8.156   13.648  -21.874 1.00 47.41 ? 270 LYS B CA  1 
ATOM   6316 C  C   . LYS B 1 270 ? 7.626   12.935  -20.629 1.00 47.80 ? 270 LYS B C   1 
ATOM   6317 O  O   . LYS B 1 270 ? 7.936   13.333  -19.506 1.00 43.54 ? 270 LYS B O   1 
ATOM   6318 C  CB  . LYS B 1 270 ? 9.452   12.992  -22.347 1.00 46.70 ? 270 LYS B CB  1 
ATOM   6319 C  CG  . LYS B 1 270 ? 10.136  13.693  -23.511 1.00 53.47 ? 270 LYS B CG  1 
ATOM   6320 C  CD  . LYS B 1 270 ? 9.629   13.192  -24.860 1.00 59.57 ? 270 LYS B CD  1 
ATOM   6321 C  CE  . LYS B 1 270 ? 10.413  13.812  -26.018 1.00 65.26 ? 270 LYS B CE  1 
ATOM   6322 N  NZ  . LYS B 1 270 ? 9.512   14.316  -27.098 1.00 63.03 ? 270 LYS B NZ  1 
ATOM   6323 N  N   . PRO B 1 271 ? 6.820   11.887  -20.831 1.00 45.01 ? 271 PRO B N   1 
ATOM   6324 C  CA  . PRO B 1 271 ? 6.272   11.091  -19.731 1.00 44.94 ? 271 PRO B CA  1 
ATOM   6325 C  C   . PRO B 1 271 ? 7.365   10.635  -18.770 1.00 43.91 ? 271 PRO B C   1 
ATOM   6326 O  O   . PRO B 1 271 ? 7.230   10.773  -17.554 1.00 41.28 ? 271 PRO B O   1 
ATOM   6327 C  CB  . PRO B 1 271 ? 5.636   9.895   -20.446 1.00 45.32 ? 271 PRO B CB  1 
ATOM   6328 C  CG  . PRO B 1 271 ? 5.300   10.414  -21.811 1.00 46.05 ? 271 PRO B CG  1 
ATOM   6329 C  CD  . PRO B 1 271 ? 6.381   11.399  -22.150 1.00 45.88 ? 271 PRO B CD  1 
ATOM   6330 N  N   . GLN B 1 272 ? 8.451   10.124  -19.336 1.00 43.89 ? 272 GLN B N   1 
ATOM   6331 C  CA  . GLN B 1 272 ? 9.519   9.518   -18.560 1.00 44.71 ? 272 GLN B CA  1 
ATOM   6332 C  C   . GLN B 1 272 ? 10.208  10.536  -17.654 1.00 46.41 ? 272 GLN B C   1 
ATOM   6333 O  O   . GLN B 1 272 ? 10.729  10.173  -16.607 1.00 45.19 ? 272 GLN B O   1 
ATOM   6334 C  CB  . GLN B 1 272 ? 10.533  8.849   -19.488 1.00 41.19 ? 272 GLN B CB  1 
ATOM   6335 C  CG  . GLN B 1 272 ? 11.255  7.664   -18.863 1.00 51.43 ? 272 GLN B CG  1 
ATOM   6336 C  CD  . GLN B 1 272 ? 10.334  6.759   -18.056 1.00 52.84 ? 272 GLN B CD  1 
ATOM   6337 O  OE1 . GLN B 1 272 ? 9.344   6.239   -18.572 1.00 52.30 ? 272 GLN B OE1 1 
ATOM   6338 N  NE2 . GLN B 1 272 ? 10.656  6.575   -16.775 1.00 51.83 ? 272 GLN B NE2 1 
ATOM   6339 N  N   . GLU B 1 273 ? 10.196  11.807  -18.047 1.00 47.53 ? 273 GLU B N   1 
ATOM   6340 C  CA  . GLU B 1 273 ? 10.779  12.856  -17.209 1.00 43.13 ? 273 GLU B CA  1 
ATOM   6341 C  C   . GLU B 1 273 ? 9.973   13.041  -15.936 1.00 41.68 ? 273 GLU B C   1 
ATOM   6342 O  O   . GLU B 1 273 ? 10.529  13.258  -14.874 1.00 44.27 ? 273 GLU B O   1 
ATOM   6343 C  CB  . GLU B 1 273 ? 10.850  14.189  -17.952 1.00 45.87 ? 273 GLU B CB  1 
ATOM   6344 C  CG  . GLU B 1 273 ? 11.677  14.180  -19.221 1.00 50.39 ? 273 GLU B CG  1 
ATOM   6345 C  CD  . GLU B 1 273 ? 11.667  15.531  -19.907 1.00 55.06 ? 273 GLU B CD  1 
ATOM   6346 O  OE1 . GLU B 1 273 ? 12.251  16.487  -19.351 1.00 60.78 ? 273 GLU B OE1 1 
ATOM   6347 O  OE2 . GLU B 1 273 ? 11.055  15.641  -20.991 1.00 55.30 ? 273 GLU B OE2 1 
ATOM   6348 N  N   . LEU B 1 274 ? 8.653   12.992  -16.058 1.00 44.58 ? 274 LEU B N   1 
ATOM   6349 C  CA  . LEU B 1 274 ? 7.790   13.054  -14.890 1.00 43.60 ? 274 LEU B CA  1 
ATOM   6350 C  C   . LEU B 1 274 ? 8.087   11.876  -13.973 1.00 40.12 ? 274 LEU B C   1 
ATOM   6351 O  O   . LEU B 1 274 ? 8.385   12.043  -12.790 1.00 36.07 ? 274 LEU B O   1 
ATOM   6352 C  CB  . LEU B 1 274 ? 6.322   13.053  -15.312 1.00 41.75 ? 274 LEU B CB  1 
ATOM   6353 C  CG  . LEU B 1 274 ? 5.652   14.417  -15.521 1.00 40.87 ? 274 LEU B CG  1 
ATOM   6354 C  CD1 . LEU B 1 274 ? 6.638   15.504  -15.937 1.00 34.15 ? 274 LEU B CD1 1 
ATOM   6355 C  CD2 . LEU B 1 274 ? 4.531   14.284  -16.533 1.00 43.62 ? 274 LEU B CD2 1 
ATOM   6356 N  N   . ILE B 1 275 ? 8.016   10.687  -14.554 1.00 40.74 ? 275 ILE B N   1 
ATOM   6357 C  CA  . ILE B 1 275 ? 8.240   9.441   -13.848 1.00 40.15 ? 275 ILE B CA  1 
ATOM   6358 C  C   . ILE B 1 275 ? 9.582   9.406   -13.116 1.00 41.64 ? 275 ILE B C   1 
ATOM   6359 O  O   . ILE B 1 275 ? 9.645   8.972   -11.970 1.00 40.51 ? 275 ILE B O   1 
ATOM   6360 C  CB  . ILE B 1 275 ? 8.149   8.258   -14.828 1.00 41.83 ? 275 ILE B CB  1 
ATOM   6361 C  CG1 . ILE B 1 275 ? 6.714   8.140   -15.357 1.00 39.03 ? 275 ILE B CG1 1 
ATOM   6362 C  CG2 . ILE B 1 275 ? 8.624   6.965   -14.178 1.00 39.80 ? 275 ILE B CG2 1 
ATOM   6363 C  CD1 . ILE B 1 275 ? 6.531   7.115   -16.440 1.00 39.02 ? 275 ILE B CD1 1 
ATOM   6364 N  N   . ASP B 1 276 ? 10.643  9.878   -13.769 1.00 43.45 ? 276 ASP B N   1 
ATOM   6365 C  CA  . ASP B 1 276 ? 11.998  9.839   -13.192 1.00 43.69 ? 276 ASP B CA  1 
ATOM   6366 C  C   . ASP B 1 276 ? 12.102  10.543  -11.840 1.00 41.63 ? 276 ASP B C   1 
ATOM   6367 O  O   . ASP B 1 276 ? 12.955  10.203  -11.020 1.00 45.66 ? 276 ASP B O   1 
ATOM   6368 C  CB  . ASP B 1 276 ? 13.020  10.465  -14.153 1.00 48.51 ? 276 ASP B CB  1 
ATOM   6369 C  CG  . ASP B 1 276 ? 13.494  9.495   -15.220 1.00 49.06 ? 276 ASP B CG  1 
ATOM   6370 O  OD1 . ASP B 1 276 ? 13.209  8.284   -15.086 1.00 54.98 ? 276 ASP B OD1 1 
ATOM   6371 O  OD2 . ASP B 1 276 ? 14.160  9.940   -16.182 1.00 45.03 ? 276 ASP B OD2 1 
ATOM   6372 N  N   . VAL B 1 277 ? 11.247  11.528  -11.604 1.00 39.11 ? 277 VAL B N   1 
ATOM   6373 C  CA  . VAL B 1 277 ? 11.318  12.284  -10.356 1.00 42.08 ? 277 VAL B CA  1 
ATOM   6374 C  C   . VAL B 1 277 ? 10.104  12.061  -9.444  1.00 42.10 ? 277 VAL B C   1 
ATOM   6375 O  O   . VAL B 1 277 ? 10.029  12.648  -8.364  1.00 37.89 ? 277 VAL B O   1 
ATOM   6376 C  CB  . VAL B 1 277 ? 11.453  13.786  -10.638 1.00 42.70 ? 277 VAL B CB  1 
ATOM   6377 C  CG1 . VAL B 1 277 ? 12.809  14.084  -11.274 1.00 42.84 ? 277 VAL B CG1 1 
ATOM   6378 C  CG2 . VAL B 1 277 ? 10.313  14.249  -11.546 1.00 41.66 ? 277 VAL B CG2 1 
ATOM   6379 N  N   . GLU B 1 278 ? 9.170   11.221  -9.900  1.00 40.77 ? 278 GLU B N   1 
ATOM   6380 C  CA  . GLU B 1 278 ? 7.925   10.912  -9.196  1.00 36.96 ? 278 GLU B CA  1 
ATOM   6381 C  C   . GLU B 1 278 ? 8.098   10.732  -7.696  1.00 41.12 ? 278 GLU B C   1 
ATOM   6382 O  O   . GLU B 1 278 ? 7.394   11.352  -6.894  1.00 41.17 ? 278 GLU B O   1 
ATOM   6383 C  CB  . GLU B 1 278 ? 7.294   9.641   -9.774  1.00 38.33 ? 278 GLU B CB  1 
ATOM   6384 C  CG  . GLU B 1 278 ? 6.067   9.145   -8.999  1.00 41.39 ? 278 GLU B CG  1 
ATOM   6385 C  CD  . GLU B 1 278 ? 5.321   8.022   -9.722  1.00 42.43 ? 278 GLU B CD  1 
ATOM   6386 O  OE1 . GLU B 1 278 ? 5.432   7.926   -10.967 1.00 35.78 ? 278 GLU B OE1 1 
ATOM   6387 O  OE2 . GLU B 1 278 ? 4.621   7.239   -9.039  1.00 42.79 ? 278 GLU B OE2 1 
ATOM   6388 N  N   . TRP B 1 279 ? 9.046   9.887   -7.316  1.00 41.96 ? 279 TRP B N   1 
ATOM   6389 C  CA  . TRP B 1 279 ? 9.208   9.523   -5.914  1.00 43.01 ? 279 TRP B CA  1 
ATOM   6390 C  C   . TRP B 1 279 ? 9.764   10.648  -5.054  1.00 39.68 ? 279 TRP B C   1 
ATOM   6391 O  O   . TRP B 1 279 ? 9.634   10.608  -3.844  1.00 42.57 ? 279 TRP B O   1 
ATOM   6392 C  CB  . TRP B 1 279 ? 10.104  8.294   -5.803  1.00 41.30 ? 279 TRP B CB  1 
ATOM   6393 C  CG  . TRP B 1 279 ? 9.515   7.115   -6.501  1.00 43.89 ? 279 TRP B CG  1 
ATOM   6394 C  CD1 . TRP B 1 279 ? 9.841   6.643   -7.746  1.00 42.67 ? 279 TRP B CD1 1 
ATOM   6395 C  CD2 . TRP B 1 279 ? 8.471   6.268   -6.008  1.00 43.01 ? 279 TRP B CD2 1 
ATOM   6396 N  NE1 . TRP B 1 279 ? 9.072   5.545   -8.046  1.00 45.57 ? 279 TRP B NE1 1 
ATOM   6397 C  CE2 . TRP B 1 279 ? 8.222   5.297   -6.995  1.00 43.12 ? 279 TRP B CE2 1 
ATOM   6398 C  CE3 . TRP B 1 279 ? 7.731   6.230   -4.820  1.00 44.21 ? 279 TRP B CE3 1 
ATOM   6399 C  CZ2 . TRP B 1 279 ? 7.265   4.302   -6.832  1.00 43.18 ? 279 TRP B CZ2 1 
ATOM   6400 C  CZ3 . TRP B 1 279 ? 6.782   5.244   -4.663  1.00 42.34 ? 279 TRP B CZ3 1 
ATOM   6401 C  CH2 . TRP B 1 279 ? 6.556   4.294   -5.664  1.00 42.00 ? 279 TRP B CH2 1 
ATOM   6402 N  N   . ASN B 1 280 ? 10.370  11.653  -5.672  1.00 41.41 ? 280 ASN B N   1 
ATOM   6403 C  CA  . ASN B 1 280 ? 11.040  12.705  -4.908  1.00 43.54 ? 280 ASN B CA  1 
ATOM   6404 C  C   . ASN B 1 280 ? 10.063  13.655  -4.221  1.00 40.66 ? 280 ASN B C   1 
ATOM   6405 O  O   . ASN B 1 280 ? 10.472  14.449  -3.377  1.00 43.28 ? 280 ASN B O   1 
ATOM   6406 C  CB  . ASN B 1 280 ? 11.988  13.535  -5.797  1.00 44.14 ? 280 ASN B CB  1 
ATOM   6407 C  CG  . ASN B 1 280 ? 13.071  12.701  -6.486  1.00 43.90 ? 280 ASN B CG  1 
ATOM   6408 O  OD1 . ASN B 1 280 ? 13.364  11.563  -6.105  1.00 44.38 ? 280 ASN B OD1 1 
ATOM   6409 N  ND2 . ASN B 1 280 ? 13.681  13.287  -7.506  1.00 42.45 ? 280 ASN B ND2 1 
ATOM   6410 N  N   . VAL B 1 281 ? 8.782   13.602  -4.577  1.00 42.84 ? 281 VAL B N   1 
ATOM   6411 C  CA  . VAL B 1 281 ? 7.815   14.529  -3.958  1.00 42.85 ? 281 VAL B CA  1 
ATOM   6412 C  C   . VAL B 1 281 ? 7.213   14.036  -2.640  1.00 43.10 ? 281 VAL B C   1 
ATOM   6413 O  O   . VAL B 1 281 ? 6.525   14.796  -1.950  1.00 44.59 ? 281 VAL B O   1 
ATOM   6414 C  CB  . VAL B 1 281 ? 6.647   14.861  -4.898  1.00 40.86 ? 281 VAL B CB  1 
ATOM   6415 C  CG1 . VAL B 1 281 ? 7.168   15.262  -6.264  1.00 43.51 ? 281 VAL B CG1 1 
ATOM   6416 C  CG2 . VAL B 1 281 ? 5.692   13.680  -5.008  1.00 40.30 ? 281 VAL B CG2 1 
ATOM   6417 N  N   . LEU B 1 282 ? 7.455   12.779  -2.285  1.00 41.19 ? 282 LEU B N   1 
ATOM   6418 C  CA  . LEU B 1 282 ? 6.932   12.257  -1.022  1.00 41.45 ? 282 LEU B CA  1 
ATOM   6419 C  C   . LEU B 1 282 ? 7.446   13.079  0.151   1.00 42.11 ? 282 LEU B C   1 
ATOM   6420 O  O   . LEU B 1 282 ? 8.564   13.590  0.103   1.00 42.17 ? 282 LEU B O   1 
ATOM   6421 C  CB  . LEU B 1 282 ? 7.309   10.793  -0.834  1.00 40.29 ? 282 LEU B CB  1 
ATOM   6422 C  CG  . LEU B 1 282 ? 6.588   9.816   -1.750  1.00 35.52 ? 282 LEU B CG  1 
ATOM   6423 C  CD1 . LEU B 1 282 ? 7.081   8.414   -1.486  1.00 36.87 ? 282 LEU B CD1 1 
ATOM   6424 C  CD2 . LEU B 1 282 ? 5.098   9.907   -1.512  1.00 37.93 ? 282 LEU B CD2 1 
ATOM   6425 N  N   . PRO B 1 283 ? 6.619   13.219  1.203   1.00 43.15 ? 283 PRO B N   1 
ATOM   6426 C  CA  . PRO B 1 283 ? 6.934   14.039  2.378   1.00 41.03 ? 283 PRO B CA  1 
ATOM   6427 C  C   . PRO B 1 283 ? 8.042   13.433  3.230   1.00 45.13 ? 283 PRO B C   1 
ATOM   6428 O  O   . PRO B 1 283 ? 8.848   14.173  3.788   1.00 49.01 ? 283 PRO B O   1 
ATOM   6429 C  CB  . PRO B 1 283 ? 5.616   14.066  3.168   1.00 39.84 ? 283 PRO B CB  1 
ATOM   6430 C  CG  . PRO B 1 283 ? 4.587   13.563  2.255   1.00 47.04 ? 283 PRO B CG  1 
ATOM   6431 C  CD  . PRO B 1 283 ? 5.271   12.639  1.292   1.00 39.74 ? 283 PRO B CD  1 
ATOM   6432 N  N   . PHE B 1 284 ? 8.071   12.110  3.347   1.00 43.66 ? 284 PHE B N   1 
ATOM   6433 C  CA  . PHE B 1 284 ? 9.060   11.452  4.194   1.00 46.13 ? 284 PHE B CA  1 
ATOM   6434 C  C   . PHE B 1 284 ? 9.674   10.247  3.498   1.00 43.76 ? 284 PHE B C   1 
ATOM   6435 O  O   . PHE B 1 284 ? 9.103   9.714   2.548   1.00 42.23 ? 284 PHE B O   1 
ATOM   6436 C  CB  . PHE B 1 284 ? 8.450   10.975  5.526   1.00 41.55 ? 284 PHE B CB  1 
ATOM   6437 C  CG  . PHE B 1 284 ? 7.364   11.867  6.087   1.00 49.68 ? 284 PHE B CG  1 
ATOM   6438 C  CD1 . PHE B 1 284 ? 7.678   13.020  6.786   1.00 51.70 ? 284 PHE B CD1 1 
ATOM   6439 C  CD2 . PHE B 1 284 ? 6.027   11.515  5.962   1.00 47.43 ? 284 PHE B CD2 1 
ATOM   6440 C  CE1 . PHE B 1 284 ? 6.681   13.819  7.314   1.00 48.76 ? 284 PHE B CE1 1 
ATOM   6441 C  CE2 . PHE B 1 284 ? 5.031   12.313  6.481   1.00 46.35 ? 284 PHE B CE2 1 
ATOM   6442 C  CZ  . PHE B 1 284 ? 5.356   13.462  7.162   1.00 51.34 ? 284 PHE B CZ  1 
ATOM   6443 N  N   . ASP B 1 285 ? 10.835  9.826   3.994   1.00 46.37 ? 285 ASP B N   1 
ATOM   6444 C  CA  . ASP B 1 285 ? 11.348  8.480   3.752   1.00 44.66 ? 285 ASP B CA  1 
ATOM   6445 C  C   . ASP B 1 285 ? 10.288  7.505   4.217   1.00 42.12 ? 285 ASP B C   1 
ATOM   6446 O  O   . ASP B 1 285 ? 9.904   7.519   5.384   1.00 43.41 ? 285 ASP B O   1 
ATOM   6447 C  CB  . ASP B 1 285 ? 12.652  8.220   4.519   1.00 48.92 ? 285 ASP B CB  1 
ATOM   6448 C  CG  . ASP B 1 285 ? 13.829  8.987   3.960   1.00 52.92 ? 285 ASP B CG  1 
ATOM   6449 O  OD1 . ASP B 1 285 ? 14.021  8.976   2.727   1.00 58.15 ? 285 ASP B OD1 1 
ATOM   6450 O  OD2 . ASP B 1 285 ? 14.564  9.602   4.759   1.00 63.81 ? 285 ASP B OD2 1 
ATOM   6451 N  N   . SER B 1 286 ? 9.821   6.645   3.331   1.00 40.73 ? 286 SER B N   1 
ATOM   6452 C  CA  . SER B 1 286 ? 8.705   5.799   3.690   1.00 40.39 ? 286 SER B CA  1 
ATOM   6453 C  C   . SER B 1 286 ? 8.636   4.564   2.829   1.00 38.53 ? 286 SER B C   1 
ATOM   6454 O  O   . SER B 1 286 ? 9.216   4.524   1.757   1.00 37.13 ? 286 SER B O   1 
ATOM   6455 C  CB  . SER B 1 286 ? 7.407   6.582   3.565   1.00 38.21 ? 286 SER B CB  1 
ATOM   6456 O  OG  . SER B 1 286 ? 7.262   7.064   2.240   1.00 41.60 ? 286 SER B OG  1 
ATOM   6457 N  N   . ILE B 1 287 ? 7.929   3.553   3.323   1.00 38.44 ? 287 ILE B N   1 
ATOM   6458 C  CA  . ILE B 1 287 ? 7.512   2.438   2.489   1.00 37.42 ? 287 ILE B CA  1 
ATOM   6459 C  C   . ILE B 1 287 ? 5.982   2.378   2.490   1.00 34.56 ? 287 ILE B C   1 
ATOM   6460 O  O   . ILE B 1 287 ? 5.337   2.871   3.423   1.00 35.95 ? 287 ILE B O   1 
ATOM   6461 C  CB  . ILE B 1 287 ? 8.096   1.105   2.969   1.00 35.15 ? 287 ILE B CB  1 
ATOM   6462 C  CG1 . ILE B 1 287 ? 7.558   0.756   4.351   1.00 31.17 ? 287 ILE B CG1 1 
ATOM   6463 C  CG2 . ILE B 1 287 ? 9.619   1.163   3.007   1.00 41.41 ? 287 ILE B CG2 1 
ATOM   6464 C  CD1 . ILE B 1 287 ? 7.949   -0.633  4.793   1.00 35.25 ? 287 ILE B CD1 1 
ATOM   6465 N  N   . PHE B 1 288 ? 5.409   1.769   1.458   1.00 29.93 ? 288 PHE B N   1 
ATOM   6466 C  CA  . PHE B 1 288 ? 3.950   1.766   1.259   1.00 33.84 ? 288 PHE B CA  1 
ATOM   6467 C  C   . PHE B 1 288 ? 3.376   3.185   1.228   1.00 33.98 ? 288 PHE B C   1 
ATOM   6468 O  O   . PHE B 1 288 ? 2.318   3.449   1.804   1.00 34.51 ? 288 PHE B O   1 
ATOM   6469 C  CB  . PHE B 1 288 ? 3.239   0.943   2.349   1.00 31.26 ? 288 PHE B CB  1 
ATOM   6470 C  CG  . PHE B 1 288 ? 2.141   0.071   1.817   1.00 33.94 ? 288 PHE B CG  1 
ATOM   6471 C  CD1 . PHE B 1 288 ? 1.253   0.560   0.864   1.00 30.73 ? 288 PHE B CD1 1 
ATOM   6472 C  CD2 . PHE B 1 288 ? 2.014   -1.244  2.231   1.00 29.61 ? 288 PHE B CD2 1 
ATOM   6473 C  CE1 . PHE B 1 288 ? 0.249   -0.231  0.352   1.00 32.45 ? 288 PHE B CE1 1 
ATOM   6474 C  CE2 . PHE B 1 288 ? 1.005   -2.043  1.711   1.00 30.44 ? 288 PHE B CE2 1 
ATOM   6475 C  CZ  . PHE B 1 288 ? 0.127   -1.533  0.767   1.00 31.73 ? 288 PHE B CZ  1 
ATOM   6476 N  N   . ARG B 1 289 ? 4.096   4.100   0.584   1.00 34.71 ? 289 ARG B N   1 
ATOM   6477 C  CA  . ARG B 1 289 ? 3.583   5.433   0.285   1.00 32.67 ? 289 ARG B CA  1 
ATOM   6478 C  C   . ARG B 1 289 ? 3.847   5.750   -1.187  1.00 35.74 ? 289 ARG B C   1 
ATOM   6479 O  O   . ARG B 1 289 ? 4.900   5.407   -1.719  1.00 34.74 ? 289 ARG B O   1 
ATOM   6480 C  CB  . ARG B 1 289 ? 4.215   6.496   1.180   1.00 33.66 ? 289 ARG B CB  1 
ATOM   6481 C  CG  . ARG B 1 289 ? 3.817   6.409   2.657   1.00 32.28 ? 289 ARG B CG  1 
ATOM   6482 C  CD  . ARG B 1 289 ? 2.332   6.659   2.829   1.00 35.29 ? 289 ARG B CD  1 
ATOM   6483 N  NE  . ARG B 1 289 ? 1.935   6.683   4.234   1.00 36.52 ? 289 ARG B NE  1 
ATOM   6484 C  CZ  . ARG B 1 289 ? 1.609   5.602   4.934   1.00 32.95 ? 289 ARG B CZ  1 
ATOM   6485 N  NH1 . ARG B 1 289 ? 1.628   4.408   4.361   1.00 32.94 ? 289 ARG B NH1 1 
ATOM   6486 N  NH2 . ARG B 1 289 ? 1.261   5.716   6.203   1.00 33.91 ? 289 ARG B NH2 1 
ATOM   6487 N  N   . PHE B 1 290 ? 2.885   6.408   -1.832  1.00 34.93 ? 290 PHE B N   1 
ATOM   6488 C  CA  . PHE B 1 290 ? 2.958   6.672   -3.265  1.00 35.51 ? 290 PHE B CA  1 
ATOM   6489 C  C   . PHE B 1 290 ? 2.641   8.135   -3.548  1.00 36.79 ? 290 PHE B C   1 
ATOM   6490 O  O   . PHE B 1 290 ? 1.859   8.759   -2.841  1.00 39.23 ? 290 PHE B O   1 
ATOM   6491 C  CB  . PHE B 1 290 ? 2.011   5.745   -4.005  1.00 31.80 ? 290 PHE B CB  1 
ATOM   6492 C  CG  . PHE B 1 290 ? 2.035   4.339   -3.485  1.00 32.69 ? 290 PHE B CG  1 
ATOM   6493 C  CD1 . PHE B 1 290 ? 3.191   3.580   -3.560  1.00 33.27 ? 290 PHE B CD1 1 
ATOM   6494 C  CD2 . PHE B 1 290 ? 0.905   3.780   -2.908  1.00 33.06 ? 290 PHE B CD2 1 
ATOM   6495 C  CE1 . PHE B 1 290 ? 3.225   2.285   -3.080  1.00 33.98 ? 290 PHE B CE1 1 
ATOM   6496 C  CE2 . PHE B 1 290 ? 0.926   2.480   -2.430  1.00 33.88 ? 290 PHE B CE2 1 
ATOM   6497 C  CZ  . PHE B 1 290 ? 2.091   1.731   -2.509  1.00 34.57 ? 290 PHE B CZ  1 
ATOM   6498 N  N   . SER B 1 291 ? 3.264   8.692   -4.576  1.00 36.49 ? 291 SER B N   1 
ATOM   6499 C  CA  . SER B 1 291 ? 3.252   10.138  -4.737  1.00 35.68 ? 291 SER B CA  1 
ATOM   6500 C  C   . SER B 1 291 ? 1.914   10.723  -5.191  1.00 36.31 ? 291 SER B C   1 
ATOM   6501 O  O   . SER B 1 291 ? 1.455   11.721  -4.643  1.00 39.10 ? 291 SER B O   1 
ATOM   6502 C  CB  . SER B 1 291 ? 4.358   10.539  -5.704  1.00 37.16 ? 291 SER B CB  1 
ATOM   6503 O  OG  . SER B 1 291 ? 5.616   10.296  -5.093  1.00 40.11 ? 291 SER B OG  1 
ATOM   6504 N  N   . PHE B 1 292 ? 1.289   10.112  -6.189  1.00 35.51 ? 292 PHE B N   1 
ATOM   6505 C  CA  . PHE B 1 292 ? 0.100   10.701  -6.780  1.00 36.96 ? 292 PHE B CA  1 
ATOM   6506 C  C   . PHE B 1 292 ? -1.074  9.749   -6.662  1.00 35.69 ? 292 PHE B C   1 
ATOM   6507 O  O   . PHE B 1 292 ? -1.112  8.696   -7.285  1.00 35.07 ? 292 PHE B O   1 
ATOM   6508 C  CB  . PHE B 1 292 ? 0.373   11.102  -8.239  1.00 35.41 ? 292 PHE B CB  1 
ATOM   6509 C  CG  . PHE B 1 292 ? 1.440   12.154  -8.359  1.00 37.90 ? 292 PHE B CG  1 
ATOM   6510 C  CD1 . PHE B 1 292 ? 1.140   13.487  -8.132  1.00 36.16 ? 292 PHE B CD1 1 
ATOM   6511 C  CD2 . PHE B 1 292 ? 2.755   11.806  -8.632  1.00 39.37 ? 292 PHE B CD2 1 
ATOM   6512 C  CE1 . PHE B 1 292 ? 2.123   14.458  -8.197  1.00 38.38 ? 292 PHE B CE1 1 
ATOM   6513 C  CE2 . PHE B 1 292 ? 3.744   12.774  -8.698  1.00 39.21 ? 292 PHE B CE2 1 
ATOM   6514 C  CZ  . PHE B 1 292 ? 3.425   14.102  -8.479  1.00 39.57 ? 292 PHE B CZ  1 
ATOM   6515 N  N   . VAL B 1 293 ? -2.020  10.145  -5.822  1.00 33.75 ? 293 VAL B N   1 
ATOM   6516 C  CA  . VAL B 1 293 ? -3.125  9.301   -5.418  1.00 31.64 ? 293 VAL B CA  1 
ATOM   6517 C  C   . VAL B 1 293 ? -4.367  10.188  -5.371  1.00 35.45 ? 293 VAL B C   1 
ATOM   6518 O  O   . VAL B 1 293 ? -4.251  11.412  -5.496  1.00 34.20 ? 293 VAL B O   1 
ATOM   6519 C  CB  . VAL B 1 293 ? -2.856  8.638   -4.032  1.00 33.44 ? 293 VAL B CB  1 
ATOM   6520 C  CG1 . VAL B 1 293 ? -1.580  7.783   -4.069  1.00 32.34 ? 293 VAL B CG1 1 
ATOM   6521 C  CG2 . VAL B 1 293 ? -2.737  9.688   -2.959  1.00 32.78 ? 293 VAL B CG2 1 
ATOM   6522 N  N   . PRO B 1 294 ? -5.554  9.582   -5.205  1.00 34.79 ? 294 PRO B N   1 
ATOM   6523 C  CA  . PRO B 1 294 ? -6.803  10.337  -5.059  1.00 33.15 ? 294 PRO B CA  1 
ATOM   6524 C  C   . PRO B 1 294 ? -6.741  11.456  -4.007  1.00 37.55 ? 294 PRO B C   1 
ATOM   6525 O  O   . PRO B 1 294 ? -6.143  11.296  -2.933  1.00 36.96 ? 294 PRO B O   1 
ATOM   6526 C  CB  . PRO B 1 294 ? -7.800  9.252   -4.663  1.00 35.51 ? 294 PRO B CB  1 
ATOM   6527 C  CG  . PRO B 1 294 ? -7.300  8.044   -5.404  1.00 31.91 ? 294 PRO B CG  1 
ATOM   6528 C  CD  . PRO B 1 294 ? -5.801  8.131   -5.307  1.00 33.59 ? 294 PRO B CD  1 
ATOM   6529 N  N   . VAL B 1 295 ? -7.328  12.601  -4.351  1.00 38.00 ? 295 VAL B N   1 
ATOM   6530 C  CA  . VAL B 1 295 ? -7.486  13.719  -3.427  1.00 40.80 ? 295 VAL B CA  1 
ATOM   6531 C  C   . VAL B 1 295 ? -8.890  13.751  -2.852  1.00 39.89 ? 295 VAL B C   1 
ATOM   6532 O  O   . VAL B 1 295 ? -9.844  13.434  -3.550  1.00 40.72 ? 295 VAL B O   1 
ATOM   6533 C  CB  . VAL B 1 295 ? -7.228  15.078  -4.102  1.00 37.33 ? 295 VAL B CB  1 
ATOM   6534 C  CG1 . VAL B 1 295 ? -5.762  15.414  -4.073  1.00 41.41 ? 295 VAL B CG1 1 
ATOM   6535 C  CG2 . VAL B 1 295 ? -7.789  15.086  -5.523  1.00 40.58 ? 295 VAL B CG2 1 
ATOM   6536 N  N   . ILE B 1 296 ? -9.009  14.131  -1.580  1.00 44.28 ? 296 ILE B N   1 
ATOM   6537 C  CA  . ILE B 1 296 ? -10.321 14.388  -0.973  1.00 44.08 ? 296 ILE B CA  1 
ATOM   6538 C  C   . ILE B 1 296 ? -10.751 15.796  -1.345  1.00 44.50 ? 296 ILE B C   1 
ATOM   6539 O  O   . ILE B 1 296 ? -10.362 16.769  -0.685  1.00 45.16 ? 296 ILE B O   1 
ATOM   6540 C  CB  . ILE B 1 296 ? -10.294 14.244  0.555   1.00 42.54 ? 296 ILE B CB  1 
ATOM   6541 C  CG1 . ILE B 1 296 ? -9.619  12.928  0.937   1.00 41.59 ? 296 ILE B CG1 1 
ATOM   6542 C  CG2 . ILE B 1 296 ? -11.703 14.307  1.099   1.00 36.53 ? 296 ILE B CG2 1 
ATOM   6543 C  CD1 . ILE B 1 296 ? -10.300 11.718  0.319   1.00 42.56 ? 296 ILE B CD1 1 
ATOM   6544 N  N   . ASP B 1 297 ? -11.556 15.889  -2.401  1.00 43.23 ? 297 ASP B N   1 
ATOM   6545 C  CA  . ASP B 1 297 ? -11.695 17.123  -3.166  1.00 48.85 ? 297 ASP B CA  1 
ATOM   6546 C  C   . ASP B 1 297 ? -13.000 17.859  -2.936  1.00 49.79 ? 297 ASP B C   1 
ATOM   6547 O  O   . ASP B 1 297 ? -13.105 19.044  -3.249  1.00 54.89 ? 297 ASP B O   1 
ATOM   6548 C  CB  . ASP B 1 297 ? -11.553 16.824  -4.665  1.00 48.27 ? 297 ASP B CB  1 
ATOM   6549 C  CG  . ASP B 1 297 ? -12.624 15.876  -5.175  1.00 48.22 ? 297 ASP B CG  1 
ATOM   6550 O  OD1 . ASP B 1 297 ? -13.328 15.265  -4.343  1.00 45.53 ? 297 ASP B OD1 1 
ATOM   6551 O  OD2 . ASP B 1 297 ? -12.753 15.732  -6.411  1.00 48.67 ? 297 ASP B OD2 1 
ATOM   6552 N  N   . GLY B 1 298 ? -13.995 17.159  -2.404  1.00 48.49 ? 298 GLY B N   1 
ATOM   6553 C  CA  . GLY B 1 298 ? -15.307 17.750  -2.223  1.00 48.50 ? 298 GLY B CA  1 
ATOM   6554 C  C   . GLY B 1 298 ? -16.185 17.583  -3.449  1.00 47.86 ? 298 GLY B C   1 
ATOM   6555 O  O   . GLY B 1 298 ? -17.307 18.088  -3.490  1.00 47.79 ? 298 GLY B O   1 
ATOM   6556 N  N   . GLU B 1 299 ? -15.678 16.876  -4.456  1.00 49.56 ? 299 GLU B N   1 
ATOM   6557 C  CA  . GLU B 1 299 ? -16.440 16.653  -5.681  1.00 49.58 ? 299 GLU B CA  1 
ATOM   6558 C  C   . GLU B 1 299 ? -16.635 15.157  -5.951  1.00 47.09 ? 299 GLU B C   1 
ATOM   6559 O  O   . GLU B 1 299 ? -17.745 14.641  -5.828  1.00 48.38 ? 299 GLU B O   1 
ATOM   6560 C  CB  . GLU B 1 299 ? -15.758 17.326  -6.871  1.00 50.52 ? 299 GLU B CB  1 
ATOM   6561 C  CG  . GLU B 1 299 ? -16.615 17.315  -8.120  1.00 59.79 ? 299 GLU B CG  1 
ATOM   6562 C  CD  . GLU B 1 299 ? -15.903 17.856  -9.345  1.00 67.53 ? 299 GLU B CD  1 
ATOM   6563 O  OE1 . GLU B 1 299 ? -14.824 18.467  -9.196  1.00 65.41 ? 299 GLU B OE1 1 
ATOM   6564 O  OE2 . GLU B 1 299 ? -16.427 17.664  -10.465 1.00 81.25 ? 299 GLU B OE2 1 
ATOM   6565 N  N   . PHE B 1 300 ? -15.565 14.457  -6.315  1.00 45.05 ? 300 PHE B N   1 
ATOM   6566 C  CA  . PHE B 1 300 ? -15.621 12.998  -6.374  1.00 41.40 ? 300 PHE B CA  1 
ATOM   6567 C  C   . PHE B 1 300 ? -15.974 12.426  -4.991  1.00 44.40 ? 300 PHE B C   1 
ATOM   6568 O  O   . PHE B 1 300 ? -16.753 11.482  -4.886  1.00 40.71 ? 300 PHE B O   1 
ATOM   6569 C  CB  . PHE B 1 300 ? -14.290 12.416  -6.868  1.00 40.55 ? 300 PHE B CB  1 
ATOM   6570 C  CG  . PHE B 1 300 ? -14.380 10.972  -7.288  1.00 37.00 ? 300 PHE B CG  1 
ATOM   6571 C  CD1 . PHE B 1 300 ? -14.281 9.951   -6.355  1.00 35.59 ? 300 PHE B CD1 1 
ATOM   6572 C  CD2 . PHE B 1 300 ? -14.571 10.639  -8.615  1.00 36.88 ? 300 PHE B CD2 1 
ATOM   6573 C  CE1 . PHE B 1 300 ? -14.376 8.628   -6.743  1.00 33.81 ? 300 PHE B CE1 1 
ATOM   6574 C  CE2 . PHE B 1 300 ? -14.663 9.316   -9.009  1.00 35.65 ? 300 PHE B CE2 1 
ATOM   6575 C  CZ  . PHE B 1 300 ? -14.572 8.311   -8.072  1.00 33.42 ? 300 PHE B CZ  1 
ATOM   6576 N  N   . PHE B 1 301 ? -15.378 12.996  -3.940  1.00 42.80 ? 301 PHE B N   1 
ATOM   6577 C  CA  . PHE B 1 301 ? -15.770 12.707  -2.559  1.00 43.72 ? 301 PHE B CA  1 
ATOM   6578 C  C   . PHE B 1 301 ? -16.352 13.966  -1.926  1.00 46.17 ? 301 PHE B C   1 
ATOM   6579 O  O   . PHE B 1 301 ? -15.615 14.907  -1.635  1.00 43.81 ? 301 PHE B O   1 
ATOM   6580 C  CB  . PHE B 1 301 ? -14.583 12.211  -1.717  1.00 42.19 ? 301 PHE B CB  1 
ATOM   6581 C  CG  . PHE B 1 301 ? -13.802 11.104  -2.360  1.00 45.59 ? 301 PHE B CG  1 
ATOM   6582 C  CD1 . PHE B 1 301 ? -14.236 9.790   -2.277  1.00 46.20 ? 301 PHE B CD1 1 
ATOM   6583 C  CD2 . PHE B 1 301 ? -12.638 11.376  -3.054  1.00 39.82 ? 301 PHE B CD2 1 
ATOM   6584 C  CE1 . PHE B 1 301 ? -13.516 8.766   -2.876  1.00 39.77 ? 301 PHE B CE1 1 
ATOM   6585 C  CE2 . PHE B 1 301 ? -11.919 10.359  -3.653  1.00 40.01 ? 301 PHE B CE2 1 
ATOM   6586 C  CZ  . PHE B 1 301 ? -12.360 9.052   -3.564  1.00 40.08 ? 301 PHE B CZ  1 
ATOM   6587 N  N   . PRO B 1 302 ? -17.676 13.976  -1.696  1.00 46.04 ? 302 PRO B N   1 
ATOM   6588 C  CA  . PRO B 1 302 ? -18.410 15.124  -1.153  1.00 44.62 ? 302 PRO B CA  1 
ATOM   6589 C  C   . PRO B 1 302 ? -17.819 15.655  0.150   1.00 45.10 ? 302 PRO B C   1 
ATOM   6590 O  O   . PRO B 1 302 ? -17.706 16.865  0.325   1.00 48.50 ? 302 PRO B O   1 
ATOM   6591 C  CB  . PRO B 1 302 ? -19.808 14.555  -0.923  1.00 46.50 ? 302 PRO B CB  1 
ATOM   6592 C  CG  . PRO B 1 302 ? -19.924 13.469  -1.937  1.00 46.42 ? 302 PRO B CG  1 
ATOM   6593 C  CD  . PRO B 1 302 ? -18.572 12.843  -1.983  1.00 43.97 ? 302 PRO B CD  1 
ATOM   6594 N  N   . THR B 1 303 ? -17.451 14.754  1.052   1.00 44.33 ? 303 THR B N   1 
ATOM   6595 C  CA  . THR B 1 303 ? -16.815 15.135  2.301   1.00 40.56 ? 303 THR B CA  1 
ATOM   6596 C  C   . THR B 1 303 ? -15.746 14.110  2.665   1.00 44.38 ? 303 THR B C   1 
ATOM   6597 O  O   . THR B 1 303 ? -15.459 13.211  1.870   1.00 42.30 ? 303 THR B O   1 
ATOM   6598 C  CB  . THR B 1 303 ? -17.836 15.238  3.447   1.00 44.29 ? 303 THR B CB  1 
ATOM   6599 O  OG1 . THR B 1 303 ? -18.356 13.937  3.740   1.00 45.84 ? 303 THR B OG1 1 
ATOM   6600 C  CG2 . THR B 1 303 ? -18.979 16.149  3.059   1.00 40.33 ? 303 THR B CG2 1 
ATOM   6601 N  N   . SER B 1 304 ? -15.175 14.240  3.866   1.00 39.87 ? 304 SER B N   1 
ATOM   6602 C  CA  . SER B 1 304 ? -14.148 13.316  4.353   1.00 39.28 ? 304 SER B CA  1 
ATOM   6603 C  C   . SER B 1 304 ? -14.625 11.872  4.295   1.00 40.15 ? 304 SER B C   1 
ATOM   6604 O  O   . SER B 1 304 ? -15.804 11.598  4.502   1.00 42.01 ? 304 SER B O   1 
ATOM   6605 C  CB  . SER B 1 304 ? -13.758 13.657  5.794   1.00 40.76 ? 304 SER B CB  1 
ATOM   6606 O  OG  . SER B 1 304 ? -14.755 13.210  6.699   1.00 42.34 ? 304 SER B OG  1 
ATOM   6607 N  N   . LEU B 1 305 ? -13.710 10.948  4.029   1.00 40.87 ? 305 LEU B N   1 
ATOM   6608 C  CA  . LEU B 1 305 ? -14.085 9.540   3.924   1.00 39.58 ? 305 LEU B CA  1 
ATOM   6609 C  C   . LEU B 1 305 ? -14.714 9.045   5.220   1.00 40.51 ? 305 LEU B C   1 
ATOM   6610 O  O   . LEU B 1 305 ? -15.706 8.314   5.195   1.00 42.10 ? 305 LEU B O   1 
ATOM   6611 C  CB  . LEU B 1 305 ? -12.871 8.675   3.563   1.00 36.51 ? 305 LEU B CB  1 
ATOM   6612 C  CG  . LEU B 1 305 ? -12.172 8.894   2.218   1.00 40.53 ? 305 LEU B CG  1 
ATOM   6613 C  CD1 . LEU B 1 305 ? -11.060 7.874   2.035   1.00 37.60 ? 305 LEU B CD1 1 
ATOM   6614 C  CD2 . LEU B 1 305 ? -13.149 8.829   1.053   1.00 36.55 ? 305 LEU B CD2 1 
ATOM   6615 N  N   . GLU B 1 306 ? -14.142 9.449   6.352   1.00 39.47 ? 306 GLU B N   1 
ATOM   6616 C  CA  . GLU B 1 306 ? -14.635 8.998   7.654   1.00 42.52 ? 306 GLU B CA  1 
ATOM   6617 C  C   . GLU B 1 306 ? -16.064 9.474   7.916   1.00 40.83 ? 306 GLU B C   1 
ATOM   6618 O  O   . GLU B 1 306 ? -16.918 8.697   8.347   1.00 40.94 ? 306 GLU B O   1 
ATOM   6619 C  CB  . GLU B 1 306 ? -13.704 9.473   8.778   1.00 42.66 ? 306 GLU B CB  1 
ATOM   6620 C  CG  . GLU B 1 306 ? -14.130 9.026   10.174  1.00 45.57 ? 306 GLU B CG  1 
ATOM   6621 C  CD  . GLU B 1 306 ? -14.048 7.520   10.364  1.00 44.22 ? 306 GLU B CD  1 
ATOM   6622 O  OE1 . GLU B 1 306 ? -13.614 6.816   9.427   1.00 42.17 ? 306 GLU B OE1 1 
ATOM   6623 O  OE2 . GLU B 1 306 ? -14.411 7.037   11.459  1.00 45.90 ? 306 GLU B OE2 1 
ATOM   6624 N  N   . SER B 1 307 ? -16.334 10.745  7.641   1.00 41.34 ? 307 SER B N   1 
ATOM   6625 C  CA  . SER B 1 307 ? -17.691 11.266  7.798   1.00 43.10 ? 307 SER B CA  1 
ATOM   6626 C  C   . SER B 1 307 ? -18.687 10.596  6.832   1.00 40.98 ? 307 SER B C   1 
ATOM   6627 O  O   . SER B 1 307 ? -19.840 10.382  7.189   1.00 43.21 ? 307 SER B O   1 
ATOM   6628 C  CB  . SER B 1 307 ? -17.713 12.783  7.606   1.00 40.90 ? 307 SER B CB  1 
ATOM   6629 O  OG  . SER B 1 307 ? -17.425 13.127  6.261   1.00 51.03 ? 307 SER B OG  1 
ATOM   6630 N  N   . MET B 1 308 ? -18.255 10.252  5.619   1.00 41.65 ? 308 MET B N   1 
ATOM   6631 C  CA  . MET B 1 308 ? -19.153 9.541   4.698   1.00 40.67 ? 308 MET B CA  1 
ATOM   6632 C  C   . MET B 1 308 ? -19.479 8.140   5.221   1.00 41.22 ? 308 MET B C   1 
ATOM   6633 O  O   . MET B 1 308 ? -20.613 7.684   5.140   1.00 41.43 ? 308 MET B O   1 
ATOM   6634 C  CB  . MET B 1 308 ? -18.551 9.433   3.295   1.00 40.90 ? 308 MET B CB  1 
ATOM   6635 C  CG  . MET B 1 308 ? -18.228 10.754  2.613   1.00 42.92 ? 308 MET B CG  1 
ATOM   6636 S  SD  . MET B 1 308 ? -17.734 10.508  0.888   1.00 45.47 ? 308 MET B SD  1 
ATOM   6637 C  CE  . MET B 1 308 ? -19.288 9.895   0.218   1.00 45.62 ? 308 MET B CE  1 
ATOM   6638 N  N   . LEU B 1 309 ? -18.472 7.457   5.754   1.00 42.60 ? 309 LEU B N   1 
ATOM   6639 C  CA  . LEU B 1 309 ? -18.663 6.120   6.306   1.00 41.32 ? 309 LEU B CA  1 
ATOM   6640 C  C   . LEU B 1 309 ? -19.564 6.170   7.536   1.00 42.86 ? 309 LEU B C   1 
ATOM   6641 O  O   . LEU B 1 309 ? -20.355 5.263   7.789   1.00 41.48 ? 309 LEU B O   1 
ATOM   6642 C  CB  . LEU B 1 309 ? -17.318 5.493   6.670   1.00 39.51 ? 309 LEU B CB  1 
ATOM   6643 C  CG  . LEU B 1 309 ? -16.419 5.019   5.533   1.00 36.95 ? 309 LEU B CG  1 
ATOM   6644 C  CD1 . LEU B 1 309 ? -15.106 4.497   6.091   1.00 39.29 ? 309 LEU B CD1 1 
ATOM   6645 C  CD2 . LEU B 1 309 ? -17.116 3.941   4.745   1.00 37.99 ? 309 LEU B CD2 1 
ATOM   6646 N  N   . ASN B 1 310 ? -19.428 7.251   8.292   1.00 46.87 ? 310 ASN B N   1 
ATOM   6647 C  CA  . ASN B 1 310 ? -20.180 7.448   9.517   1.00 44.75 ? 310 ASN B CA  1 
ATOM   6648 C  C   . ASN B 1 310 ? -21.640 7.713   9.263   1.00 44.41 ? 310 ASN B C   1 
ATOM   6649 O  O   . ASN B 1 310 ? -22.496 7.186   9.960   1.00 45.63 ? 310 ASN B O   1 
ATOM   6650 C  CB  . ASN B 1 310 ? -19.588 8.603   10.307  1.00 46.57 ? 310 ASN B CB  1 
ATOM   6651 C  CG  . ASN B 1 310 ? -18.555 8.146   11.275  1.00 51.15 ? 310 ASN B CG  1 
ATOM   6652 O  OD1 . ASN B 1 310 ? -18.576 6.991   11.692  1.00 55.90 ? 310 ASN B OD1 1 
ATOM   6653 N  ND2 . ASN B 1 310 ? -17.636 9.037   11.650  1.00 51.75 ? 310 ASN B ND2 1 
ATOM   6654 N  N   . SER B 1 311 ? -21.919 8.535   8.260   1.00 44.69 ? 311 SER B N   1 
ATOM   6655 C  CA  . SER B 1 311 ? -23.284 8.940   7.975   1.00 44.06 ? 311 SER B CA  1 
ATOM   6656 C  C   . SER B 1 311 ? -24.016 7.959   7.057   1.00 44.81 ? 311 SER B C   1 
ATOM   6657 O  O   . SER B 1 311 ? -25.195 8.131   6.784   1.00 42.14 ? 311 SER B O   1 
ATOM   6658 C  CB  . SER B 1 311 ? -23.297 10.335  7.353   1.00 45.74 ? 311 SER B CB  1 
ATOM   6659 O  OG  . SER B 1 311 ? -22.724 10.321  6.059   1.00 44.15 ? 311 SER B OG  1 
ATOM   6660 N  N   . GLY B 1 312 ? -23.327 6.926   6.588   1.00 43.81 ? 312 GLY B N   1 
ATOM   6661 C  CA  . GLY B 1 312 ? -23.951 5.970   5.693   1.00 40.50 ? 312 GLY B CA  1 
ATOM   6662 C  C   . GLY B 1 312 ? -24.084 6.565   4.303   1.00 43.79 ? 312 GLY B C   1 
ATOM   6663 O  O   . GLY B 1 312 ? -24.851 6.092   3.467   1.00 41.15 ? 312 GLY B O   1 
ATOM   6664 N  N   . ASN B 1 313 ? -23.322 7.623   4.064   1.00 45.53 ? 313 ASN B N   1 
ATOM   6665 C  CA  . ASN B 1 313 ? -23.293 8.270   2.766   1.00 42.76 ? 313 ASN B CA  1 
ATOM   6666 C  C   . ASN B 1 313 ? -22.485 7.457   1.746   1.00 45.06 ? 313 ASN B C   1 
ATOM   6667 O  O   . ASN B 1 313 ? -21.315 7.739   1.490   1.00 42.98 ? 313 ASN B O   1 
ATOM   6668 C  CB  . ASN B 1 313 ? -22.721 9.681   2.901   1.00 42.09 ? 313 ASN B CB  1 
ATOM   6669 C  CG  . ASN B 1 313 ? -22.814 10.467  1.614   1.00 48.32 ? 313 ASN B CG  1 
ATOM   6670 O  OD1 . ASN B 1 313 ? -23.524 10.078  0.684   1.00 48.01 ? 313 ASN B OD1 1 
ATOM   6671 N  ND2 . ASN B 1 313 ? -22.094 11.580  1.550   1.00 51.36 ? 313 ASN B ND2 1 
ATOM   6672 N  N   . PHE B 1 314 ? -23.125 6.447   1.166   1.00 40.81 ? 314 PHE B N   1 
ATOM   6673 C  CA  . PHE B 1 314 ? -22.467 5.568   0.217   1.00 37.70 ? 314 PHE B CA  1 
ATOM   6674 C  C   . PHE B 1 314 ? -23.460 4.544   -0.283  1.00 39.56 ? 314 PHE B C   1 
ATOM   6675 O  O   . PHE B 1 314 ? -24.560 4.423   0.246   1.00 38.66 ? 314 PHE B O   1 
ATOM   6676 C  CB  . PHE B 1 314 ? -21.247 4.874   0.842   1.00 35.50 ? 314 PHE B CB  1 
ATOM   6677 C  CG  . PHE B 1 314 ? -21.537 4.166   2.137   1.00 40.58 ? 314 PHE B CG  1 
ATOM   6678 C  CD1 . PHE B 1 314 ? -22.126 2.913   2.145   1.00 37.85 ? 314 PHE B CD1 1 
ATOM   6679 C  CD2 . PHE B 1 314 ? -21.208 4.751   3.356   1.00 40.68 ? 314 PHE B CD2 1 
ATOM   6680 C  CE1 . PHE B 1 314 ? -22.394 2.264   3.352   1.00 36.83 ? 314 PHE B CE1 1 
ATOM   6681 C  CE2 . PHE B 1 314 ? -21.468 4.105   4.557   1.00 38.97 ? 314 PHE B CE2 1 
ATOM   6682 C  CZ  . PHE B 1 314 ? -22.060 2.864   4.557   1.00 38.05 ? 314 PHE B CZ  1 
ATOM   6683 N  N   . LYS B 1 315 ? -23.067 3.804   -1.308  1.00 37.84 ? 315 LYS B N   1 
ATOM   6684 C  CA  . LYS B 1 315 ? -23.956 2.832   -1.910  1.00 39.64 ? 315 LYS B CA  1 
ATOM   6685 C  C   . LYS B 1 315 ? -24.225 1.680   -0.953  1.00 37.78 ? 315 LYS B C   1 
ATOM   6686 O  O   . LYS B 1 315 ? -23.302 1.058   -0.415  1.00 36.35 ? 315 LYS B O   1 
ATOM   6687 C  CB  . LYS B 1 315 ? -23.364 2.323   -3.224  1.00 37.66 ? 315 LYS B CB  1 
ATOM   6688 C  CG  . LYS B 1 315 ? -24.243 1.385   -4.018  1.00 35.51 ? 315 LYS B CG  1 
ATOM   6689 C  CD  . LYS B 1 315 ? -23.553 1.047   -5.345  1.00 32.66 ? 315 LYS B CD  1 
ATOM   6690 C  CE  . LYS B 1 315 ? -24.202 -0.123  -6.047  1.00 32.51 ? 315 LYS B CE  1 
ATOM   6691 N  NZ  . LYS B 1 315 ? -25.427 0.321   -6.762  1.00 35.81 ? 315 LYS B NZ  1 
ATOM   6692 N  N   . LYS B 1 316 ? -25.505 1.402   -0.749  1.00 36.48 ? 316 LYS B N   1 
ATOM   6693 C  CA  . LYS B 1 316 ? -25.929 0.295   0.089   1.00 36.70 ? 316 LYS B CA  1 
ATOM   6694 C  C   . LYS B 1 316 ? -26.192 -0.940  -0.753  1.00 34.86 ? 316 LYS B C   1 
ATOM   6695 O  O   . LYS B 1 316 ? -27.214 -1.031  -1.431  1.00 37.92 ? 316 LYS B O   1 
ATOM   6696 C  CB  . LYS B 1 316 ? -27.175 0.679   0.879   1.00 35.06 ? 316 LYS B CB  1 
ATOM   6697 C  CG  . LYS B 1 316 ? -26.862 1.529   2.083   1.00 42.25 ? 316 LYS B CG  1 
ATOM   6698 C  CD  . LYS B 1 316 ? -26.840 3.013   1.777   1.00 42.15 ? 316 LYS B CD  1 
ATOM   6699 C  CE  . LYS B 1 316 ? -27.123 3.785   3.069   1.00 43.96 ? 316 LYS B CE  1 
ATOM   6700 N  NZ  . LYS B 1 316 ? -27.244 5.252   2.846   1.00 46.99 ? 316 LYS B NZ  1 
ATOM   6701 N  N   . THR B 1 317 ? -25.264 -1.887  -0.712  1.00 34.99 ? 317 THR B N   1 
ATOM   6702 C  CA  . THR B 1 317 ? -25.369 -3.096  -1.521  1.00 34.61 ? 317 THR B CA  1 
ATOM   6703 C  C   . THR B 1 317 ? -24.661 -4.233  -0.789  1.00 33.92 ? 317 THR B C   1 
ATOM   6704 O  O   . THR B 1 317 ? -24.451 -4.147  0.425   1.00 33.74 ? 317 THR B O   1 
ATOM   6705 C  CB  . THR B 1 317 ? -24.783 -2.884  -2.952  1.00 34.61 ? 317 THR B CB  1 
ATOM   6706 O  OG1 . THR B 1 317 ? -24.900 -4.092  -3.721  1.00 35.63 ? 317 THR B OG1 1 
ATOM   6707 C  CG2 . THR B 1 317 ? -23.326 -2.457  -2.901  1.00 33.90 ? 317 THR B CG2 1 
ATOM   6708 N  N   . GLN B 1 318 ? -24.333 -5.303  -1.506  1.00 31.22 ? 318 GLN B N   1 
ATOM   6709 C  CA  . GLN B 1 318 ? -23.572 -6.401  -0.927  1.00 32.91 ? 318 GLN B CA  1 
ATOM   6710 C  C   . GLN B 1 318 ? -22.082 -6.247  -1.248  1.00 33.23 ? 318 GLN B C   1 
ATOM   6711 O  O   . GLN B 1 318 ? -21.718 -5.810  -2.341  1.00 30.27 ? 318 GLN B O   1 
ATOM   6712 C  CB  . GLN B 1 318 ? -24.085 -7.750  -1.430  1.00 30.82 ? 318 GLN B CB  1 
ATOM   6713 C  CG  . GLN B 1 318 ? -25.566 -7.993  -1.148  1.00 36.06 ? 318 GLN B CG  1 
ATOM   6714 C  CD  . GLN B 1 318 ? -26.482 -7.426  -2.240  1.00 38.91 ? 318 GLN B CD  1 
ATOM   6715 O  OE1 . GLN B 1 318 ? -26.047 -7.176  -3.356  1.00 40.76 ? 318 GLN B OE1 1 
ATOM   6716 N  NE2 . GLN B 1 318 ? -27.756 -7.228  -1.912  1.00 44.68 ? 318 GLN B NE2 1 
ATOM   6717 N  N   . ILE B 1 319 ? -21.220 -6.583  -0.291  1.00 32.24 ? 319 ILE B N   1 
ATOM   6718 C  CA  . ILE B 1 319 ? -19.792 -6.596  -0.574  1.00 31.26 ? 319 ILE B CA  1 
ATOM   6719 C  C   . ILE B 1 319 ? -19.146 -7.877  -0.106  1.00 32.00 ? 319 ILE B C   1 
ATOM   6720 O  O   . ILE B 1 319 ? -19.642 -8.544  0.807   1.00 33.41 ? 319 ILE B O   1 
ATOM   6721 C  CB  . ILE B 1 319 ? -19.067 -5.425  0.066   1.00 30.27 ? 319 ILE B CB  1 
ATOM   6722 C  CG1 . ILE B 1 319 ? -19.156 -5.500  1.590   1.00 31.88 ? 319 ILE B CG1 1 
ATOM   6723 C  CG2 . ILE B 1 319 ? -19.628 -4.116  -0.440  1.00 32.70 ? 319 ILE B CG2 1 
ATOM   6724 C  CD1 . ILE B 1 319 ? -18.406 -4.386  2.256   1.00 33.21 ? 319 ILE B CD1 1 
ATOM   6725 N  N   . LEU B 1 320 ? -18.035 -8.213  -0.750  1.00 32.77 ? 320 LEU B N   1 
ATOM   6726 C  CA  . LEU B 1 320 ? -17.229 -9.369  -0.393  1.00 30.77 ? 320 LEU B CA  1 
ATOM   6727 C  C   . LEU B 1 320 ? -15.781 -8.915  -0.458  1.00 32.90 ? 320 LEU B C   1 
ATOM   6728 O  O   . LEU B 1 320 ? -15.323 -8.453  -1.508  1.00 32.80 ? 320 LEU B O   1 
ATOM   6729 C  CB  . LEU B 1 320 ? -17.506 -10.545 -1.332  1.00 29.89 ? 320 LEU B CB  1 
ATOM   6730 C  CG  . LEU B 1 320 ? -16.753 -11.865 -1.144  1.00 30.93 ? 320 LEU B CG  1 
ATOM   6731 C  CD1 . LEU B 1 320 ? -17.536 -13.010 -1.773  1.00 29.57 ? 320 LEU B CD1 1 
ATOM   6732 C  CD2 . LEU B 1 320 ? -15.362 -11.785 -1.746  1.00 28.35 ? 320 LEU B CD2 1 
ATOM   6733 N  N   . LEU B 1 321 ? -15.072 -9.016  0.667   1.00 31.07 ? 321 LEU B N   1 
ATOM   6734 C  CA  . LEU B 1 321 ? -13.747 -8.427  0.785   1.00 27.83 ? 321 LEU B CA  1 
ATOM   6735 C  C   . LEU B 1 321 ? -12.868 -9.226  1.742   1.00 31.80 ? 321 LEU B C   1 
ATOM   6736 O  O   . LEU B 1 321 ? -13.363 -10.020 2.549   1.00 30.71 ? 321 LEU B O   1 
ATOM   6737 C  CB  . LEU B 1 321 ? -13.847 -6.967  1.248   1.00 27.39 ? 321 LEU B CB  1 
ATOM   6738 C  CG  . LEU B 1 321 ? -14.267 -6.675  2.694   1.00 32.11 ? 321 LEU B CG  1 
ATOM   6739 C  CD1 . LEU B 1 321 ? -14.219 -5.169  2.958   1.00 29.45 ? 321 LEU B CD1 1 
ATOM   6740 C  CD2 . LEU B 1 321 ? -15.663 -7.236  3.021   1.00 29.86 ? 321 LEU B CD2 1 
ATOM   6741 N  N   . GLY B 1 322 ? -11.559 -9.020  1.647   1.00 29.70 ? 322 GLY B N   1 
ATOM   6742 C  CA  . GLY B 1 322 ? -10.632 -9.749  2.490   1.00 32.30 ? 322 GLY B CA  1 
ATOM   6743 C  C   . GLY B 1 322 ? -9.193  -9.321  2.313   1.00 31.99 ? 322 GLY B C   1 
ATOM   6744 O  O   . GLY B 1 322 ? -8.893  -8.371  1.580   1.00 26.96 ? 322 GLY B O   1 
ATOM   6745 N  N   . VAL B 1 323 ? -8.303  -10.025 3.006   1.00 34.27 ? 323 VAL B N   1 
ATOM   6746 C  CA  . VAL B 1 323 ? -6.889  -9.685  3.039   1.00 29.31 ? 323 VAL B CA  1 
ATOM   6747 C  C   . VAL B 1 323 ? -6.058  -10.966 3.009   1.00 31.52 ? 323 VAL B C   1 
ATOM   6748 O  O   . VAL B 1 323 ? -6.596  -12.058 3.217   1.00 30.53 ? 323 VAL B O   1 
ATOM   6749 C  CB  . VAL B 1 323 ? -6.544  -8.839  4.284   1.00 32.43 ? 323 VAL B CB  1 
ATOM   6750 C  CG1 . VAL B 1 323 ? -7.453  -7.617  4.371   1.00 31.90 ? 323 VAL B CG1 1 
ATOM   6751 C  CG2 . VAL B 1 323 ? -6.633  -9.673  5.574   1.00 29.00 ? 323 VAL B CG2 1 
ATOM   6752 N  N   . ASN B 1 324 ? -4.773  -10.827 2.687   1.00 27.83 ? 324 ASN B N   1 
ATOM   6753 C  CA  . ASN B 1 324 ? -3.814  -11.928 2.705   1.00 31.00 ? 324 ASN B CA  1 
ATOM   6754 C  C   . ASN B 1 324 ? -3.035  -11.918 4.024   1.00 34.22 ? 324 ASN B C   1 
ATOM   6755 O  O   . ASN B 1 324 ? -2.929  -10.878 4.672   1.00 33.03 ? 324 ASN B O   1 
ATOM   6756 C  CB  . ASN B 1 324 ? -2.827  -11.822 1.532   1.00 33.66 ? 324 ASN B CB  1 
ATOM   6757 C  CG  . ASN B 1 324 ? -3.487  -12.059 0.180   1.00 36.34 ? 324 ASN B CG  1 
ATOM   6758 O  OD1 . ASN B 1 324 ? -4.693  -12.272 0.096   1.00 33.08 ? 324 ASN B OD1 1 
ATOM   6759 N  ND2 . ASN B 1 324 ? -2.686  -12.023 -0.885  1.00 34.31 ? 324 ASN B ND2 1 
ATOM   6760 N  N   . LYS B 1 325 ? -2.468  -13.058 4.408   1.00 33.27 ? 325 LYS B N   1 
ATOM   6761 C  CA  . LYS B 1 325 ? -1.814  -13.168 5.712   1.00 34.08 ? 325 LYS B CA  1 
ATOM   6762 C  C   . LYS B 1 325 ? -0.603  -12.253 5.923   1.00 34.45 ? 325 LYS B C   1 
ATOM   6763 O  O   . LYS B 1 325 ? -0.390  -11.780 7.039   1.00 35.94 ? 325 LYS B O   1 
ATOM   6764 C  CB  . LYS B 1 325 ? -1.383  -14.611 5.977   1.00 35.15 ? 325 LYS B CB  1 
ATOM   6765 C  CG  . LYS B 1 325 ? -0.663  -14.780 7.324   1.00 35.59 ? 325 LYS B CG  1 
ATOM   6766 C  CD  . LYS B 1 325 ? -0.522  -16.249 7.713   1.00 38.68 ? 325 LYS B CD  1 
ATOM   6767 C  CE  . LYS B 1 325 ? 0.898   -16.566 8.206   1.00 51.82 ? 325 LYS B CE  1 
ATOM   6768 N  NZ  . LYS B 1 325 ? 1.899   -16.581 7.066   1.00 51.03 ? 325 LYS B NZ  1 
ATOM   6769 N  N   . ASP B 1 326 ? 0.193   -12.016 4.878   1.00 35.80 ? 326 ASP B N   1 
ATOM   6770 C  CA  . ASP B 1 326 ? 1.416   -11.207 5.027   1.00 37.35 ? 326 ASP B CA  1 
ATOM   6771 C  C   . ASP B 1 326 ? 1.493   -10.068 4.017   1.00 37.60 ? 326 ASP B C   1 
ATOM   6772 O  O   . ASP B 1 326 ? 2.436   -9.982  3.222   1.00 34.64 ? 326 ASP B O   1 
ATOM   6773 C  CB  . ASP B 1 326 ? 2.665   -12.077 4.900   1.00 34.12 ? 326 ASP B CB  1 
ATOM   6774 C  CG  . ASP B 1 326 ? 2.648   -13.254 5.845   1.00 38.37 ? 326 ASP B CG  1 
ATOM   6775 O  OD1 . ASP B 1 326 ? 3.068   -13.092 7.009   1.00 42.24 ? 326 ASP B OD1 1 
ATOM   6776 O  OD2 . ASP B 1 326 ? 2.206   -14.341 5.423   1.00 39.25 ? 326 ASP B OD2 1 
ATOM   6777 N  N   . GLU B 1 327 ? 0.493   -9.196  4.067   1.00 35.56 ? 327 GLU B N   1 
ATOM   6778 C  CA  . GLU B 1 327 ? 0.414   -8.038  3.193   1.00 36.35 ? 327 GLU B CA  1 
ATOM   6779 C  C   . GLU B 1 327 ? 1.704   -7.201  3.163   1.00 33.95 ? 327 GLU B C   1 
ATOM   6780 O  O   . GLU B 1 327 ? 2.059   -6.629  2.133   1.00 34.02 ? 327 GLU B O   1 
ATOM   6781 C  CB  . GLU B 1 327 ? -0.762  -7.166  3.628   1.00 31.04 ? 327 GLU B CB  1 
ATOM   6782 C  CG  . GLU B 1 327 ? -2.105  -7.885  3.627   1.00 33.00 ? 327 GLU B CG  1 
ATOM   6783 C  CD  . GLU B 1 327 ? -2.694  -8.043  2.224   1.00 34.40 ? 327 GLU B CD  1 
ATOM   6784 O  OE1 . GLU B 1 327 ? -2.019  -7.677  1.245   1.00 31.83 ? 327 GLU B OE1 1 
ATOM   6785 O  OE2 . GLU B 1 327 ? -3.838  -8.531  2.104   1.00 34.70 ? 327 GLU B OE2 1 
ATOM   6786 N  N   . GLY B 1 328 ? 2.415   -7.140  4.282   1.00 31.45 ? 328 GLY B N   1 
ATOM   6787 C  CA  . GLY B 1 328 ? 3.510   -6.194  4.413   1.00 30.68 ? 328 GLY B CA  1 
ATOM   6788 C  C   . GLY B 1 328 ? 4.846   -6.557  3.767   1.00 32.08 ? 328 GLY B C   1 
ATOM   6789 O  O   . GLY B 1 328 ? 5.664   -5.679  3.512   1.00 26.60 ? 328 GLY B O   1 
ATOM   6790 N  N   . SER B 1 329 ? 5.061   -7.844  3.504   1.00 32.39 ? 329 SER B N   1 
ATOM   6791 C  CA  . SER B 1 329 ? 6.404   -8.365  3.269   1.00 32.52 ? 329 SER B CA  1 
ATOM   6792 C  C   . SER B 1 329 ? 7.024   -7.839  1.974   1.00 33.69 ? 329 SER B C   1 
ATOM   6793 O  O   . SER B 1 329 ? 8.209   -7.493  1.939   1.00 29.62 ? 329 SER B O   1 
ATOM   6794 C  CB  . SER B 1 329 ? 6.380   -9.898  3.273   1.00 33.52 ? 329 SER B CB  1 
ATOM   6795 O  OG  . SER B 1 329 ? 5.640   -10.404 2.178   1.00 33.64 ? 329 SER B OG  1 
ATOM   6796 N  N   . PHE B 1 330 ? 6.219   -7.759  0.922   1.00 32.28 ? 330 PHE B N   1 
ATOM   6797 C  CA  . PHE B 1 330 ? 6.680   -7.186  -0.333  1.00 34.55 ? 330 PHE B CA  1 
ATOM   6798 C  C   . PHE B 1 330 ? 7.337   -5.820  -0.136  1.00 34.69 ? 330 PHE B C   1 
ATOM   6799 O  O   . PHE B 1 330 ? 8.353   -5.516  -0.774  1.00 32.13 ? 330 PHE B O   1 
ATOM   6800 C  CB  . PHE B 1 330 ? 5.513   -7.057  -1.308  1.00 31.93 ? 330 PHE B CB  1 
ATOM   6801 C  CG  . PHE B 1 330 ? 5.846   -7.422  -2.707  1.00 35.50 ? 330 PHE B CG  1 
ATOM   6802 C  CD1 . PHE B 1 330 ? 7.094   -7.134  -3.246  1.00 36.87 ? 330 PHE B CD1 1 
ATOM   6803 C  CD2 . PHE B 1 330 ? 4.894   -8.055  -3.508  1.00 40.83 ? 330 PHE B CD2 1 
ATOM   6804 C  CE1 . PHE B 1 330 ? 7.389   -7.462  -4.559  1.00 36.41 ? 330 PHE B CE1 1 
ATOM   6805 C  CE2 . PHE B 1 330 ? 5.182   -8.393  -4.827  1.00 38.45 ? 330 PHE B CE2 1 
ATOM   6806 C  CZ  . PHE B 1 330 ? 6.433   -8.097  -5.350  1.00 38.66 ? 330 PHE B CZ  1 
ATOM   6807 N  N   . PHE B 1 331 ? 6.764   -5.006  0.749   1.00 29.94 ? 331 PHE B N   1 
ATOM   6808 C  CA  . PHE B 1 331 ? 7.204   -3.619  0.878   1.00 32.10 ? 331 PHE B CA  1 
ATOM   6809 C  C   . PHE B 1 331 ? 8.461   -3.479  1.746   1.00 33.16 ? 331 PHE B C   1 
ATOM   6810 O  O   . PHE B 1 331 ? 9.285   -2.602  1.519   1.00 34.20 ? 331 PHE B O   1 
ATOM   6811 C  CB  . PHE B 1 331 ? 6.059   -2.757  1.409   1.00 30.92 ? 331 PHE B CB  1 
ATOM   6812 C  CG  . PHE B 1 331 ? 4.830   -2.802  0.532   1.00 34.05 ? 331 PHE B CG  1 
ATOM   6813 C  CD1 . PHE B 1 331 ? 3.941   -3.867  0.609   1.00 33.63 ? 331 PHE B CD1 1 
ATOM   6814 C  CD2 . PHE B 1 331 ? 4.591   -1.809  -0.408  1.00 34.22 ? 331 PHE B CD2 1 
ATOM   6815 C  CE1 . PHE B 1 331 ? 2.820   -3.928  -0.241  1.00 35.84 ? 331 PHE B CE1 1 
ATOM   6816 C  CE2 . PHE B 1 331 ? 3.472   -1.865  -1.235  1.00 37.37 ? 331 PHE B CE2 1 
ATOM   6817 C  CZ  . PHE B 1 331 ? 2.588   -2.923  -1.149  1.00 32.17 ? 331 PHE B CZ  1 
ATOM   6818 N  N   . LEU B 1 332 ? 8.622   -4.356  2.725   1.00 36.01 ? 332 LEU B N   1 
ATOM   6819 C  CA  . LEU B 1 332 ? 9.836   -4.358  3.532   1.00 30.64 ? 332 LEU B CA  1 
ATOM   6820 C  C   . LEU B 1 332 ? 11.033  -4.706  2.640   1.00 37.51 ? 332 LEU B C   1 
ATOM   6821 O  O   . LEU B 1 332 ? 12.115  -4.103  2.729   1.00 36.15 ? 332 LEU B O   1 
ATOM   6822 C  CB  . LEU B 1 332 ? 9.681   -5.343  4.693   1.00 32.80 ? 332 LEU B CB  1 
ATOM   6823 C  CG  . LEU B 1 332 ? 8.633   -4.802  5.672   1.00 34.51 ? 332 LEU B CG  1 
ATOM   6824 C  CD1 . LEU B 1 332 ? 8.124   -5.855  6.656   1.00 33.07 ? 332 LEU B CD1 1 
ATOM   6825 C  CD2 . LEU B 1 332 ? 9.198   -3.585  6.411   1.00 31.42 ? 332 LEU B CD2 1 
ATOM   6826 N  N   . LEU B 1 333 ? 10.809  -5.655  1.741   1.00 36.67 ? 333 LEU B N   1 
ATOM   6827 C  CA  . LEU B 1 333 ? 11.839  -6.093  0.814   1.00 37.64 ? 333 LEU B CA  1 
ATOM   6828 C  C   . LEU B 1 333 ? 12.442  -4.927  0.029   1.00 40.58 ? 333 LEU B C   1 
ATOM   6829 O  O   . LEU B 1 333 ? 13.656  -4.837  -0.123  1.00 41.51 ? 333 LEU B O   1 
ATOM   6830 C  CB  . LEU B 1 333 ? 11.262  -7.122  -0.141  1.00 37.04 ? 333 LEU B CB  1 
ATOM   6831 C  CG  . LEU B 1 333 ? 12.259  -7.680  -1.132  1.00 39.65 ? 333 LEU B CG  1 
ATOM   6832 C  CD1 . LEU B 1 333 ? 13.319  -8.409  -0.338  1.00 37.88 ? 333 LEU B CD1 1 
ATOM   6833 C  CD2 . LEU B 1 333 ? 11.551  -8.605  -2.110  1.00 35.45 ? 333 LEU B CD2 1 
ATOM   6834 N  N   . TYR B 1 334 ? 11.594  -4.013  -0.423  1.00 38.85 ? 334 TYR B N   1 
ATOM   6835 C  CA  . TYR B 1 334 ? 12.038  -2.917  -1.269  1.00 37.50 ? 334 TYR B CA  1 
ATOM   6836 C  C   . TYR B 1 334 ? 12.608  -1.734  -0.509  1.00 41.28 ? 334 TYR B C   1 
ATOM   6837 O  O   . TYR B 1 334 ? 13.501  -1.069  -1.011  1.00 53.71 ? 334 TYR B O   1 
ATOM   6838 C  CB  . TYR B 1 334 ? 10.883  -2.443  -2.165  1.00 38.90 ? 334 TYR B CB  1 
ATOM   6839 C  CG  . TYR B 1 334 ? 10.712  -3.335  -3.362  1.00 39.44 ? 334 TYR B CG  1 
ATOM   6840 C  CD1 . TYR B 1 334 ? 10.407  -4.677  -3.198  1.00 37.04 ? 334 TYR B CD1 1 
ATOM   6841 C  CD2 . TYR B 1 334 ? 10.899  -2.852  -4.662  1.00 40.54 ? 334 TYR B CD2 1 
ATOM   6842 C  CE1 . TYR B 1 334 ? 10.270  -5.515  -4.277  1.00 37.57 ? 334 TYR B CE1 1 
ATOM   6843 C  CE2 . TYR B 1 334 ? 10.758  -3.690  -5.754  1.00 34.19 ? 334 TYR B CE2 1 
ATOM   6844 C  CZ  . TYR B 1 334 ? 10.441  -5.022  -5.549  1.00 36.11 ? 334 TYR B CZ  1 
ATOM   6845 O  OH  . TYR B 1 334 ? 10.292  -5.889  -6.601  1.00 37.51 ? 334 TYR B OH  1 
ATOM   6846 N  N   . GLY B 1 335 ? 12.116  -1.465  0.692   1.00 40.51 ? 335 GLY B N   1 
ATOM   6847 C  CA  . GLY B 1 335 ? 12.509  -0.243  1.375   1.00 40.57 ? 335 GLY B CA  1 
ATOM   6848 C  C   . GLY B 1 335 ? 13.249  -0.337  2.703   1.00 40.18 ? 335 GLY B C   1 
ATOM   6849 O  O   . GLY B 1 335 ? 14.013  0.568   3.041   1.00 46.56 ? 335 GLY B O   1 
ATOM   6850 N  N   . ALA B 1 336 ? 13.045  -1.413  3.460   1.00 39.55 ? 336 ALA B N   1 
ATOM   6851 C  CA  . ALA B 1 336 ? 13.547  -1.471  4.850   1.00 39.16 ? 336 ALA B CA  1 
ATOM   6852 C  C   . ALA B 1 336 ? 14.884  -2.204  4.999   1.00 32.69 ? 336 ALA B C   1 
ATOM   6853 O  O   . ALA B 1 336 ? 15.124  -3.219  4.355   1.00 35.05 ? 336 ALA B O   1 
ATOM   6854 C  CB  . ALA B 1 336 ? 12.501  -2.122  5.756   1.00 31.31 ? 336 ALA B CB  1 
ATOM   6855 N  N   . PRO B 1 337 ? 15.751  -1.707  5.889   1.00 36.24 ? 337 PRO B N   1 
ATOM   6856 C  CA  . PRO B 1 337 ? 17.068  -2.332  6.101   1.00 33.23 ? 337 PRO B CA  1 
ATOM   6857 C  C   . PRO B 1 337 ? 16.994  -3.751  6.675   1.00 35.18 ? 337 PRO B C   1 
ATOM   6858 O  O   . PRO B 1 337 ? 16.151  -4.031  7.541   1.00 32.69 ? 337 PRO B O   1 
ATOM   6859 C  CB  . PRO B 1 337 ? 17.749  -1.382  7.088   1.00 37.93 ? 337 PRO B CB  1 
ATOM   6860 C  CG  . PRO B 1 337 ? 16.613  -0.602  7.731   1.00 36.96 ? 337 PRO B CG  1 
ATOM   6861 C  CD  . PRO B 1 337 ? 15.586  -0.464  6.660   1.00 35.09 ? 337 PRO B CD  1 
ATOM   6862 N  N   . GLY B 1 338 ? 17.860  -4.636  6.176   1.00 32.12 ? 338 GLY B N   1 
ATOM   6863 C  CA  . GLY B 1 338 ? 18.020  -5.987  6.702   1.00 31.51 ? 338 GLY B CA  1 
ATOM   6864 C  C   . GLY B 1 338 ? 17.242  -7.046  5.940   1.00 35.91 ? 338 GLY B C   1 
ATOM   6865 O  O   . GLY B 1 338 ? 17.419  -8.255  6.146   1.00 34.95 ? 338 GLY B O   1 
ATOM   6866 N  N   . PHE B 1 339 ? 16.358  -6.584  5.067   1.00 34.37 ? 339 PHE B N   1 
ATOM   6867 C  CA  . PHE B 1 339 ? 15.510  -7.471  4.275   1.00 38.13 ? 339 PHE B CA  1 
ATOM   6868 C  C   . PHE B 1 339 ? 16.192  -7.792  2.960   1.00 38.76 ? 339 PHE B C   1 
ATOM   6869 O  O   . PHE B 1 339 ? 16.783  -6.919  2.319   1.00 35.66 ? 339 PHE B O   1 
ATOM   6870 C  CB  . PHE B 1 339 ? 14.129  -6.843  4.037   1.00 31.84 ? 339 PHE B CB  1 
ATOM   6871 C  CG  . PHE B 1 339 ? 13.312  -6.732  5.292   1.00 33.78 ? 339 PHE B CG  1 
ATOM   6872 C  CD1 . PHE B 1 339 ? 12.530  -7.792  5.718   1.00 31.03 ? 339 PHE B CD1 1 
ATOM   6873 C  CD2 . PHE B 1 339 ? 13.374  -5.592  6.080   1.00 33.70 ? 339 PHE B CD2 1 
ATOM   6874 C  CE1 . PHE B 1 339 ? 11.799  -7.707  6.908   1.00 35.31 ? 339 PHE B CE1 1 
ATOM   6875 C  CE2 . PHE B 1 339 ? 12.645  -5.506  7.273   1.00 37.48 ? 339 PHE B CE2 1 
ATOM   6876 C  CZ  . PHE B 1 339 ? 11.855  -6.564  7.681   1.00 31.34 ? 339 PHE B CZ  1 
ATOM   6877 N  N   . SER B 1 340 ? 16.132  -9.058  2.583   1.00 36.74 ? 340 SER B N   1 
ATOM   6878 C  CA  . SER B 1 340 ? 16.700  -9.495  1.328   1.00 35.59 ? 340 SER B CA  1 
ATOM   6879 C  C   . SER B 1 340 ? 15.871  -10.625 0.773   1.00 42.03 ? 340 SER B C   1 
ATOM   6880 O  O   . SER B 1 340 ? 15.307  -11.426 1.525   1.00 38.37 ? 340 SER B O   1 
ATOM   6881 C  CB  . SER B 1 340 ? 18.142  -9.943  1.501   1.00 38.86 ? 340 SER B CB  1 
ATOM   6882 O  OG  . SER B 1 340 ? 18.406  -11.077 0.689   1.00 42.87 ? 340 SER B OG  1 
ATOM   6883 N  N   . LYS B 1 341 ? 15.804  -10.678 -0.554  1.00 40.80 ? 341 LYS B N   1 
ATOM   6884 C  CA  . LYS B 1 341 ? 15.043  -11.690 -1.247  1.00 38.69 ? 341 LYS B CA  1 
ATOM   6885 C  C   . LYS B 1 341 ? 15.714  -13.048 -1.096  1.00 41.55 ? 341 LYS B C   1 
ATOM   6886 O  O   . LYS B 1 341 ? 15.055  -14.085 -1.212  1.00 42.49 ? 341 LYS B O   1 
ATOM   6887 C  CB  . LYS B 1 341 ? 14.899  -11.290 -2.725  1.00 42.24 ? 341 LYS B CB  1 
ATOM   6888 C  CG  . LYS B 1 341 ? 14.640  -12.411 -3.688  1.00 42.68 ? 341 LYS B CG  1 
ATOM   6889 C  CD  . LYS B 1 341 ? 14.381  -11.848 -5.096  1.00 46.44 ? 341 LYS B CD  1 
ATOM   6890 C  CE  . LYS B 1 341 ? 15.511  -12.162 -6.053  1.00 35.42 ? 341 LYS B CE  1 
ATOM   6891 N  NZ  . LYS B 1 341 ? 15.654  -13.635 -6.151  1.00 43.23 ? 341 LYS B NZ  1 
ATOM   6892 N  N   . ASP B 1 342 ? 17.018  -13.035 -0.809  1.00 40.08 ? 342 ASP B N   1 
ATOM   6893 C  CA  . ASP B 1 342 ? 17.844  -14.247 -0.840  1.00 41.55 ? 342 ASP B CA  1 
ATOM   6894 C  C   . ASP B 1 342 ? 18.342  -14.726 0.539   1.00 46.50 ? 342 ASP B C   1 
ATOM   6895 O  O   . ASP B 1 342 ? 19.261  -15.545 0.627   1.00 45.13 ? 342 ASP B O   1 
ATOM   6896 C  CB  . ASP B 1 342 ? 19.051  -14.017 -1.755  1.00 41.24 ? 342 ASP B CB  1 
ATOM   6897 C  CG  . ASP B 1 342 ? 18.664  -13.418 -3.095  1.00 45.07 ? 342 ASP B CG  1 
ATOM   6898 O  OD1 . ASP B 1 342 ? 17.725  -13.943 -3.728  1.00 43.56 ? 342 ASP B OD1 1 
ATOM   6899 O  OD2 . ASP B 1 342 ? 19.291  -12.416 -3.510  1.00 46.61 ? 342 ASP B OD2 1 
ATOM   6900 N  N   . SER B 1 343 ? 17.741  -14.214 1.608   1.00 43.21 ? 343 SER B N   1 
ATOM   6901 C  CA  . SER B 1 343 ? 18.074  -14.650 2.957   1.00 41.07 ? 343 SER B CA  1 
ATOM   6902 C  C   . SER B 1 343 ? 16.825  -14.608 3.815   1.00 45.10 ? 343 SER B C   1 
ATOM   6903 O  O   . SER B 1 343 ? 15.799  -14.050 3.410   1.00 43.61 ? 343 SER B O   1 
ATOM   6904 C  CB  . SER B 1 343 ? 19.159  -13.772 3.582   1.00 40.81 ? 343 SER B CB  1 
ATOM   6905 O  OG  . SER B 1 343 ? 18.598  -12.586 4.132   1.00 43.16 ? 343 SER B OG  1 
ATOM   6906 N  N   . GLU B 1 344 ? 16.927  -15.196 5.002   1.00 40.99 ? 344 GLU B N   1 
ATOM   6907 C  CA  . GLU B 1 344 ? 15.835  -15.226 5.957   1.00 39.89 ? 344 GLU B CA  1 
ATOM   6908 C  C   . GLU B 1 344 ? 15.499  -13.848 6.494   1.00 39.63 ? 344 GLU B C   1 
ATOM   6909 O  O   . GLU B 1 344 ? 14.470  -13.673 7.152   1.00 42.80 ? 344 GLU B O   1 
ATOM   6910 C  CB  . GLU B 1 344 ? 16.179  -16.135 7.124   1.00 43.82 ? 344 GLU B CB  1 
ATOM   6911 C  CG  . GLU B 1 344 ? 16.099  -17.609 6.837   1.00 45.73 ? 344 GLU B CG  1 
ATOM   6912 C  CD  . GLU B 1 344 ? 16.427  -18.400 8.079   1.00 59.63 ? 344 GLU B CD  1 
ATOM   6913 O  OE1 . GLU B 1 344 ? 15.702  -19.369 8.393   1.00 63.91 ? 344 GLU B OE1 1 
ATOM   6914 O  OE2 . GLU B 1 344 ? 17.404  -18.025 8.763   1.00 59.31 ? 344 GLU B OE2 1 
ATOM   6915 N  N   . SER B 1 345 ? 16.376  -12.884 6.243   1.00 33.60 ? 345 SER B N   1 
ATOM   6916 C  CA  . SER B 1 345 ? 16.125  -11.514 6.646   1.00 35.86 ? 345 SER B CA  1 
ATOM   6917 C  C   . SER B 1 345 ? 15.827  -11.406 8.148   1.00 37.15 ? 345 SER B C   1 
ATOM   6918 O  O   . SER B 1 345 ? 14.861  -10.755 8.549   1.00 31.24 ? 345 SER B O   1 
ATOM   6919 C  CB  . SER B 1 345 ? 14.957  -10.930 5.841   1.00 37.52 ? 345 SER B CB  1 
ATOM   6920 O  OG  . SER B 1 345 ? 15.279  -10.793 4.465   1.00 40.61 ? 345 SER B OG  1 
ATOM   6921 N  N   . LYS B 1 346 ? 16.650  -12.056 8.967   1.00 38.22 ? 346 LYS B N   1 
ATOM   6922 C  CA  . LYS B 1 346 ? 16.570  -11.863 10.412  1.00 37.76 ? 346 LYS B CA  1 
ATOM   6923 C  C   . LYS B 1 346 ? 16.916  -10.412 10.693  1.00 36.01 ? 346 LYS B C   1 
ATOM   6924 O  O   . LYS B 1 346 ? 17.920  -9.893  10.206  1.00 38.79 ? 346 LYS B O   1 
ATOM   6925 C  CB  . LYS B 1 346 ? 17.493  -12.821 11.148  1.00 38.74 ? 346 LYS B CB  1 
ATOM   6926 C  CG  . LYS B 1 346 ? 17.002  -14.259 11.097  1.00 42.47 ? 346 LYS B CG  1 
ATOM   6927 C  CD  . LYS B 1 346 ? 18.006  -15.213 11.697  1.00 48.51 ? 346 LYS B CD  1 
ATOM   6928 C  CE  . LYS B 1 346 ? 17.526  -16.646 11.595  1.00 49.52 ? 346 LYS B CE  1 
ATOM   6929 N  NZ  . LYS B 1 346 ? 18.615  -17.598 11.949  1.00 63.64 ? 346 LYS B NZ  1 
ATOM   6930 N  N   . ILE B 1 347 ? 16.032  -9.742  11.407  1.00 32.32 ? 347 ILE B N   1 
ATOM   6931 C  CA  . ILE B 1 347 ? 16.129  -8.309  11.587  1.00 34.67 ? 347 ILE B CA  1 
ATOM   6932 C  C   . ILE B 1 347 ? 16.707  -7.980  12.966  1.00 39.64 ? 347 ILE B C   1 
ATOM   6933 O  O   . ILE B 1 347 ? 16.168  -8.392  14.003  1.00 35.73 ? 347 ILE B O   1 
ATOM   6934 C  CB  . ILE B 1 347 ? 14.744  -7.640  11.438  1.00 35.09 ? 347 ILE B CB  1 
ATOM   6935 C  CG1 . ILE B 1 347 ? 14.138  -7.950  10.060  1.00 38.13 ? 347 ILE B CG1 1 
ATOM   6936 C  CG2 . ILE B 1 347 ? 14.836  -6.145  11.667  1.00 37.71 ? 347 ILE B CG2 1 
ATOM   6937 C  CD1 . ILE B 1 347 ? 15.066  -7.650  8.896   1.00 35.49 ? 347 ILE B CD1 1 
ATOM   6938 N  N   . SER B 1 348 ? 17.800  -7.232  12.970  1.00 37.13 ? 348 SER B N   1 
ATOM   6939 C  CA  . SER B 1 348 ? 18.375  -6.758  14.209  1.00 38.32 ? 348 SER B CA  1 
ATOM   6940 C  C   . SER B 1 348 ? 17.419  -5.778  14.865  1.00 39.79 ? 348 SER B C   1 
ATOM   6941 O  O   . SER B 1 348 ? 16.481  -5.285  14.229  1.00 40.11 ? 348 SER B O   1 
ATOM   6942 C  CB  . SER B 1 348 ? 19.728  -6.091  13.964  1.00 36.54 ? 348 SER B CB  1 
ATOM   6943 O  OG  . SER B 1 348 ? 19.561  -4.759  13.506  1.00 38.66 ? 348 SER B OG  1 
ATOM   6944 N  N   . ARG B 1 349 ? 17.682  -5.488  16.132  1.00 33.51 ? 349 ARG B N   1 
ATOM   6945 C  CA  . ARG B 1 349 ? 16.920  -4.515  16.889  1.00 34.10 ? 349 ARG B CA  1 
ATOM   6946 C  C   . ARG B 1 349 ? 17.016  -3.118  16.297  1.00 33.16 ? 349 ARG B C   1 
ATOM   6947 O  O   . ARG B 1 349 ? 16.029  -2.387  16.235  1.00 35.09 ? 349 ARG B O   1 
ATOM   6948 C  CB  . ARG B 1 349 ? 17.406  -4.489  18.344  1.00 38.93 ? 349 ARG B CB  1 
ATOM   6949 C  CG  . ARG B 1 349 ? 16.512  -3.698  19.253  1.00 35.24 ? 349 ARG B CG  1 
ATOM   6950 C  CD  . ARG B 1 349 ? 15.151  -4.325  19.228  1.00 41.16 ? 349 ARG B CD  1 
ATOM   6951 N  NE  . ARG B 1 349 ? 14.129  -3.440  19.755  1.00 49.22 ? 349 ARG B NE  1 
ATOM   6952 C  CZ  . ARG B 1 349 ? 12.828  -3.680  19.654  1.00 44.11 ? 349 ARG B CZ  1 
ATOM   6953 N  NH1 . ARG B 1 349 ? 12.395  -4.777  19.042  1.00 37.68 ? 349 ARG B NH1 1 
ATOM   6954 N  NH2 . ARG B 1 349 ? 11.963  -2.823  20.170  1.00 48.24 ? 349 ARG B NH2 1 
ATOM   6955 N  N   . GLU B 1 350 ? 18.215  -2.751  15.866  1.00 36.30 ? 350 GLU B N   1 
ATOM   6956 C  CA  . GLU B 1 350 ? 18.455  -1.444  15.271  1.00 37.99 ? 350 GLU B CA  1 
ATOM   6957 C  C   . GLU B 1 350 ? 17.671  -1.301  13.955  1.00 35.48 ? 350 GLU B C   1 
ATOM   6958 O  O   . GLU B 1 350 ? 17.093  -0.250  13.682  1.00 33.20 ? 350 GLU B O   1 
ATOM   6959 C  CB  . GLU B 1 350 ? 19.960  -1.240  15.051  1.00 39.44 ? 350 GLU B CB  1 
ATOM   6960 C  CG  . GLU B 1 350 ? 20.342  0.052   14.343  1.00 41.76 ? 350 GLU B CG  1 
ATOM   6961 C  CD  . GLU B 1 350 ? 21.826  0.114   14.010  1.00 48.49 ? 350 GLU B CD  1 
ATOM   6962 O  OE1 . GLU B 1 350 ? 22.646  0.177   14.945  1.00 52.85 ? 350 GLU B OE1 1 
ATOM   6963 O  OE2 . GLU B 1 350 ? 22.179  0.092   12.811  1.00 52.23 ? 350 GLU B OE2 1 
ATOM   6964 N  N   . ASP B 1 351 ? 17.639  -2.364  13.158  1.00 35.78 ? 351 ASP B N   1 
ATOM   6965 C  CA  . ASP B 1 351 ? 16.932  -2.327  11.878  1.00 37.86 ? 351 ASP B CA  1 
ATOM   6966 C  C   . ASP B 1 351 ? 15.423  -2.376  12.117  1.00 37.02 ? 351 ASP B C   1 
ATOM   6967 O  O   . ASP B 1 351 ? 14.651  -1.792  11.358  1.00 35.89 ? 351 ASP B O   1 
ATOM   6968 C  CB  . ASP B 1 351 ? 17.370  -3.475  10.962  1.00 33.61 ? 351 ASP B CB  1 
ATOM   6969 C  CG  . ASP B 1 351 ? 18.727  -3.230  10.324  1.00 37.64 ? 351 ASP B CG  1 
ATOM   6970 O  OD1 . ASP B 1 351 ? 19.210  -2.074  10.343  1.00 34.92 ? 351 ASP B OD1 1 
ATOM   6971 O  OD2 . ASP B 1 351 ? 19.302  -4.198  9.781   1.00 34.51 ? 351 ASP B OD2 1 
ATOM   6972 N  N   . PHE B 1 352 ? 15.007  -3.052  13.189  1.00 38.66 ? 352 PHE B N   1 
ATOM   6973 C  CA  . PHE B 1 352 ? 13.591  -3.057  13.552  1.00 35.22 ? 352 PHE B CA  1 
ATOM   6974 C  C   . PHE B 1 352 ? 13.135  -1.635  13.848  1.00 34.35 ? 352 PHE B C   1 
ATOM   6975 O  O   . PHE B 1 352 ? 12.102  -1.197  13.334  1.00 33.41 ? 352 PHE B O   1 
ATOM   6976 C  CB  . PHE B 1 352 ? 13.314  -3.972  14.746  1.00 37.23 ? 352 PHE B CB  1 
ATOM   6977 C  CG  . PHE B 1 352 ? 11.866  -3.980  15.175  1.00 40.14 ? 352 PHE B CG  1 
ATOM   6978 C  CD1 . PHE B 1 352 ? 10.962  -4.866  14.602  1.00 36.74 ? 352 PHE B CD1 1 
ATOM   6979 C  CD2 . PHE B 1 352 ? 11.407  -3.091  16.136  1.00 35.28 ? 352 PHE B CD2 1 
ATOM   6980 C  CE1 . PHE B 1 352 ? 9.625   -4.873  14.987  1.00 35.88 ? 352 PHE B CE1 1 
ATOM   6981 C  CE2 . PHE B 1 352 ? 10.072  -3.086  16.527  1.00 36.23 ? 352 PHE B CE2 1 
ATOM   6982 C  CZ  . PHE B 1 352 ? 9.177   -3.979  15.946  1.00 38.03 ? 352 PHE B CZ  1 
ATOM   6983 N  N   . MET B 1 353 ? 13.913  -0.916  14.657  1.00 34.72 ? 353 MET B N   1 
ATOM   6984 C  CA  . MET B 1 353 ? 13.630  0.490   14.943  1.00 36.99 ? 353 MET B CA  1 
ATOM   6985 C  C   . MET B 1 353 ? 13.514  1.270   13.643  1.00 35.27 ? 353 MET B C   1 
ATOM   6986 O  O   . MET B 1 353 ? 12.542  1.984   13.443  1.00 36.56 ? 353 MET B O   1 
ATOM   6987 C  CB  . MET B 1 353 ? 14.718  1.142   15.815  1.00 38.95 ? 353 MET B CB  1 
ATOM   6988 C  CG  . MET B 1 353 ? 14.956  0.551   17.226  1.00 51.15 ? 353 MET B CG  1 
ATOM   6989 S  SD  . MET B 1 353 ? 13.509  0.274   18.277  1.00 66.25 ? 353 MET B SD  1 
ATOM   6990 C  CE  . MET B 1 353 ? 12.337  1.510   17.703  1.00 46.31 ? 353 MET B CE  1 
ATOM   6991 N  N   . SER B 1 354 ? 14.519  1.140   12.774  1.00 32.90 ? 354 SER B N   1 
ATOM   6992 C  CA  . SER B 1 354 ? 14.524  1.829   11.477  1.00 35.85 ? 354 SER B CA  1 
ATOM   6993 C  C   . SER B 1 354 ? 13.294  1.487   10.645  1.00 37.17 ? 354 SER B C   1 
ATOM   6994 O  O   . SER B 1 354 ? 12.672  2.367   10.047  1.00 40.72 ? 354 SER B O   1 
ATOM   6995 C  CB  . SER B 1 354 ? 15.792  1.493   10.690  1.00 36.06 ? 354 SER B CB  1 
ATOM   6996 O  OG  . SER B 1 354 ? 16.912  2.146   11.260  1.00 37.11 ? 354 SER B OG  1 
ATOM   6997 N  N   . GLY B 1 355 ? 12.933  0.208   10.631  1.00 38.68 ? 355 GLY B N   1 
ATOM   6998 C  CA  . GLY B 1 355 ? 11.736  -0.244  9.941   1.00 34.49 ? 355 GLY B CA  1 
ATOM   6999 C  C   . GLY B 1 355 ? 10.437  0.385   10.414  1.00 38.54 ? 355 GLY B C   1 
ATOM   7000 O  O   . GLY B 1 355 ? 9.596   0.721   9.583   1.00 34.84 ? 355 GLY B O   1 
ATOM   7001 N  N   . VAL B 1 356 ? 10.234  0.538   11.728  1.00 36.26 ? 356 VAL B N   1 
ATOM   7002 C  CA  . VAL B 1 356 ? 8.936   1.046   12.156  1.00 35.91 ? 356 VAL B CA  1 
ATOM   7003 C  C   . VAL B 1 356 ? 8.839   2.504   11.732  1.00 35.90 ? 356 VAL B C   1 
ATOM   7004 O  O   . VAL B 1 356 ? 7.781   2.961   11.301  1.00 36.71 ? 356 VAL B O   1 
ATOM   7005 C  CB  . VAL B 1 356 ? 8.666   0.909   13.703  1.00 36.29 ? 356 VAL B CB  1 
ATOM   7006 C  CG1 . VAL B 1 356 ? 9.347   -0.312  14.275  1.00 32.12 ? 356 VAL B CG1 1 
ATOM   7007 C  CG2 . VAL B 1 356 ? 9.065   2.157   14.434  1.00 35.36 ? 356 VAL B CG2 1 
ATOM   7008 N  N   . LYS B 1 357 ? 9.944   3.230   11.840  1.00 32.88 ? 357 LYS B N   1 
ATOM   7009 C  CA  . LYS B 1 357 ? 9.967   4.631   11.429  1.00 37.99 ? 357 LYS B CA  1 
ATOM   7010 C  C   . LYS B 1 357 ? 9.637   4.772   9.928   1.00 39.39 ? 357 LYS B C   1 
ATOM   7011 O  O   . LYS B 1 357 ? 8.880   5.656   9.519   1.00 37.58 ? 357 LYS B O   1 
ATOM   7012 C  CB  . LYS B 1 357 ? 11.331  5.242   11.750  1.00 39.34 ? 357 LYS B CB  1 
ATOM   7013 C  CG  . LYS B 1 357 ? 11.614  6.588   11.093  1.00 43.14 ? 357 LYS B CG  1 
ATOM   7014 C  CD  . LYS B 1 357 ? 10.872  7.718   11.777  1.00 47.17 ? 357 LYS B CD  1 
ATOM   7015 C  CE  . LYS B 1 357 ? 11.639  9.033   11.659  1.00 46.53 ? 357 LYS B CE  1 
ATOM   7016 N  NZ  . LYS B 1 357 ? 10.806  10.157  12.190  1.00 50.30 ? 357 LYS B NZ  1 
ATOM   7017 N  N   . LEU B 1 358 ? 10.197  3.887   9.114   1.00 37.03 ? 358 LEU B N   1 
ATOM   7018 C  CA  . LEU B 1 358 ? 9.881   3.892   7.683   1.00 40.31 ? 358 LEU B CA  1 
ATOM   7019 C  C   . LEU B 1 358 ? 8.421   3.494   7.456   1.00 38.09 ? 358 LEU B C   1 
ATOM   7020 O  O   . LEU B 1 358 ? 7.770   3.999   6.549   1.00 38.57 ? 358 LEU B O   1 
ATOM   7021 C  CB  . LEU B 1 358 ? 10.816  2.950   6.906   1.00 34.88 ? 358 LEU B CB  1 
ATOM   7022 C  CG  . LEU B 1 358 ? 12.284  3.365   6.746   1.00 36.71 ? 358 LEU B CG  1 
ATOM   7023 C  CD1 . LEU B 1 358 ? 13.083  2.288   6.022   1.00 34.49 ? 358 LEU B CD1 1 
ATOM   7024 C  CD2 . LEU B 1 358 ? 12.403  4.691   6.014   1.00 37.51 ? 358 LEU B CD2 1 
ATOM   7025 N  N   . SER B 1 359 ? 7.909   2.602   8.300   1.00 37.82 ? 359 SER B N   1 
ATOM   7026 C  CA  . SER B 1 359 ? 6.586   2.023   8.104   1.00 36.06 ? 359 SER B CA  1 
ATOM   7027 C  C   . SER B 1 359 ? 5.459   2.965   8.502   1.00 37.01 ? 359 SER B C   1 
ATOM   7028 O  O   . SER B 1 359 ? 4.382   2.941   7.907   1.00 39.94 ? 359 SER B O   1 
ATOM   7029 C  CB  . SER B 1 359 ? 6.467   0.722   8.891   1.00 37.89 ? 359 SER B CB  1 
ATOM   7030 O  OG  . SER B 1 359 ? 7.309   -0.271  8.337   1.00 40.09 ? 359 SER B OG  1 
ATOM   7031 N  N   . VAL B 1 360 ? 5.718   3.788   9.507   1.00 35.51 ? 360 VAL B N   1 
ATOM   7032 C  CA  . VAL B 1 360 ? 4.734   4.706   10.055  1.00 36.28 ? 360 VAL B CA  1 
ATOM   7033 C  C   . VAL B 1 360 ? 5.312   6.112   10.042  1.00 38.20 ? 360 VAL B C   1 
ATOM   7034 O  O   . VAL B 1 360 ? 5.572   6.687   11.097  1.00 39.25 ? 360 VAL B O   1 
ATOM   7035 C  CB  . VAL B 1 360 ? 4.346   4.331   11.494  1.00 35.52 ? 360 VAL B CB  1 
ATOM   7036 C  CG1 . VAL B 1 360 ? 3.127   5.122   11.943  1.00 32.70 ? 360 VAL B CG1 1 
ATOM   7037 C  CG2 . VAL B 1 360 ? 4.085   2.838   11.596  1.00 35.61 ? 360 VAL B CG2 1 
ATOM   7038 N  N   . PRO B 1 361 ? 5.508   6.669   8.841   1.00 37.58 ? 361 PRO B N   1 
ATOM   7039 C  CA  . PRO B 1 361 ? 6.303   7.891   8.658   1.00 41.24 ? 361 PRO B CA  1 
ATOM   7040 C  C   . PRO B 1 361 ? 5.648   9.164   9.171   1.00 39.91 ? 361 PRO B C   1 
ATOM   7041 O  O   . PRO B 1 361 ? 6.327   10.161  9.370   1.00 42.42 ? 361 PRO B O   1 
ATOM   7042 C  CB  . PRO B 1 361 ? 6.489   7.959   7.139   1.00 35.42 ? 361 PRO B CB  1 
ATOM   7043 C  CG  . PRO B 1 361 ? 5.314   7.216   6.584   1.00 38.31 ? 361 PRO B CG  1 
ATOM   7044 C  CD  . PRO B 1 361 ? 5.056   6.102   7.559   1.00 37.29 ? 361 PRO B CD  1 
ATOM   7045 N  N   . HIS B 1 362 ? 4.345   9.142   9.382   1.00 40.09 ? 362 HIS B N   1 
ATOM   7046 C  CA  . HIS B 1 362 ? 3.669   10.332  9.872   1.00 44.02 ? 362 HIS B CA  1 
ATOM   7047 C  C   . HIS B 1 362 ? 3.713   10.440  11.400  1.00 45.21 ? 362 HIS B C   1 
ATOM   7048 O  O   . HIS B 1 362 ? 3.507   11.520  11.945  1.00 50.09 ? 362 HIS B O   1 
ATOM   7049 C  CB  . HIS B 1 362 ? 2.221   10.341  9.386   1.00 44.10 ? 362 HIS B CB  1 
ATOM   7050 C  CG  . HIS B 1 362 ? 1.497   9.060   9.651   1.00 43.48 ? 362 HIS B CG  1 
ATOM   7051 N  ND1 . HIS B 1 362 ? 1.776   7.894   8.971   1.00 44.59 ? 362 HIS B ND1 1 
ATOM   7052 C  CD2 . HIS B 1 362 ? 0.513   8.757   10.528  1.00 45.22 ? 362 HIS B CD2 1 
ATOM   7053 C  CE1 . HIS B 1 362 ? 0.991   6.928   9.414   1.00 41.68 ? 362 HIS B CE1 1 
ATOM   7054 N  NE2 . HIS B 1 362 ? 0.216   7.426   10.360  1.00 47.36 ? 362 HIS B NE2 1 
ATOM   7055 N  N   . ALA B 1 363 ? 3.989   9.335   12.090  1.00 41.50 ? 363 ALA B N   1 
ATOM   7056 C  CA  . ALA B 1 363 ? 3.953   9.333   13.557  1.00 41.17 ? 363 ALA B CA  1 
ATOM   7057 C  C   . ALA B 1 363 ? 5.025   10.219  14.174  1.00 45.85 ? 363 ALA B C   1 
ATOM   7058 O  O   . ALA B 1 363 ? 6.142   10.323  13.654  1.00 43.83 ? 363 ALA B O   1 
ATOM   7059 C  CB  . ALA B 1 363 ? 4.096   7.912   14.095  1.00 36.03 ? 363 ALA B CB  1 
ATOM   7060 N  N   . ASN B 1 364 ? 4.677   10.855  15.292  1.00 43.64 ? 364 ASN B N   1 
ATOM   7061 C  CA  . ASN B 1 364 ? 5.663   11.523  16.127  1.00 42.36 ? 364 ASN B CA  1 
ATOM   7062 C  C   . ASN B 1 364 ? 6.395   10.501  16.979  1.00 40.81 ? 364 ASN B C   1 
ATOM   7063 O  O   . ASN B 1 364 ? 6.130   9.295   16.903  1.00 39.19 ? 364 ASN B O   1 
ATOM   7064 C  CB  . ASN B 1 364 ? 5.013   12.586  17.018  1.00 47.84 ? 364 ASN B CB  1 
ATOM   7065 C  CG  . ASN B 1 364 ? 3.826   12.051  17.806  1.00 46.87 ? 364 ASN B CG  1 
ATOM   7066 O  OD1 . ASN B 1 364 ? 3.743   10.860  18.102  1.00 44.58 ? 364 ASN B OD1 1 
ATOM   7067 N  ND2 . ASN B 1 364 ? 2.895   12.937  18.142  1.00 47.29 ? 364 ASN B ND2 1 
ATOM   7068 N  N   . ASP B 1 365 ? 7.320   10.981  17.793  1.00 43.36 ? 365 ASP B N   1 
ATOM   7069 C  CA  . ASP B 1 365 ? 8.123   10.083  18.604  1.00 44.12 ? 365 ASP B CA  1 
ATOM   7070 C  C   . ASP B 1 365 ? 7.256   9.265   19.562  1.00 42.65 ? 365 ASP B C   1 
ATOM   7071 O  O   . ASP B 1 365 ? 7.484   8.070   19.748  1.00 41.44 ? 365 ASP B O   1 
ATOM   7072 C  CB  . ASP B 1 365 ? 9.176   10.869  19.378  1.00 50.16 ? 365 ASP B CB  1 
ATOM   7073 C  CG  . ASP B 1 365 ? 10.281  9.978   19.909  1.00 59.89 ? 365 ASP B CG  1 
ATOM   7074 O  OD1 . ASP B 1 365 ? 11.054  9.430   19.078  1.00 62.27 ? 365 ASP B OD1 1 
ATOM   7075 O  OD2 . ASP B 1 365 ? 10.372  9.820   21.150  1.00 57.39 ? 365 ASP B OD2 1 
ATOM   7076 N  N   . LEU B 1 366 ? 6.251   9.899   20.153  1.00 38.63 ? 366 LEU B N   1 
ATOM   7077 C  CA  . LEU B 1 366 ? 5.360   9.176   21.050  1.00 43.56 ? 366 LEU B CA  1 
ATOM   7078 C  C   . LEU B 1 366 ? 4.699   8.026   20.296  1.00 40.02 ? 366 LEU B C   1 
ATOM   7079 O  O   . LEU B 1 366 ? 4.653   6.893   20.782  1.00 36.71 ? 366 LEU B O   1 
ATOM   7080 C  CB  . LEU B 1 366 ? 4.302   10.109  21.650  1.00 42.65 ? 366 LEU B CB  1 
ATOM   7081 C  CG  . LEU B 1 366 ? 3.473   9.477   22.763  1.00 44.49 ? 366 LEU B CG  1 
ATOM   7082 C  CD1 . LEU B 1 366 ? 4.386   9.072   23.897  1.00 41.12 ? 366 LEU B CD1 1 
ATOM   7083 C  CD2 . LEU B 1 366 ? 2.370   10.413  23.245  1.00 43.15 ? 366 LEU B CD2 1 
ATOM   7084 N  N   . GLY B 1 367 ? 4.214   8.327   19.093  1.00 41.41 ? 367 GLY B N   1 
ATOM   7085 C  CA  . GLY B 1 367 ? 3.593   7.337   18.234  1.00 36.68 ? 367 GLY B CA  1 
ATOM   7086 C  C   . GLY B 1 367 ? 4.512   6.193   17.851  1.00 36.25 ? 367 GLY B C   1 
ATOM   7087 O  O   . GLY B 1 367 ? 4.103   5.027   17.873  1.00 36.08 ? 367 GLY B O   1 
ATOM   7088 N  N   . LEU B 1 368 ? 5.750   6.512   17.485  1.00 35.01 ? 368 LEU B N   1 
ATOM   7089 C  CA  . LEU B 1 368 ? 6.713   5.471   17.166  1.00 35.78 ? 368 LEU B CA  1 
ATOM   7090 C  C   . LEU B 1 368 ? 6.930   4.545   18.371  1.00 37.00 ? 368 LEU B C   1 
ATOM   7091 O  O   . LEU B 1 368 ? 6.992   3.319   18.211  1.00 34.11 ? 368 LEU B O   1 
ATOM   7092 C  CB  . LEU B 1 368 ? 8.039   6.088   16.707  1.00 40.08 ? 368 LEU B CB  1 
ATOM   7093 C  CG  . LEU B 1 368 ? 8.027   6.821   15.361  1.00 41.59 ? 368 LEU B CG  1 
ATOM   7094 C  CD1 . LEU B 1 368 ? 9.333   7.570   15.160  1.00 42.73 ? 368 LEU B CD1 1 
ATOM   7095 C  CD2 . LEU B 1 368 ? 7.782   5.842   14.230  1.00 35.81 ? 368 LEU B CD2 1 
ATOM   7096 N  N   . ASP B 1 369 ? 7.030   5.125   19.570  1.00 34.42 ? 369 ASP B N   1 
ATOM   7097 C  CA  . ASP B 1 369 ? 7.212   4.331   20.790  1.00 34.72 ? 369 ASP B CA  1 
ATOM   7098 C  C   . ASP B 1 369 ? 6.031   3.394   21.021  1.00 35.27 ? 369 ASP B C   1 
ATOM   7099 O  O   . ASP B 1 369 ? 6.208   2.227   21.396  1.00 32.81 ? 369 ASP B O   1 
ATOM   7100 C  CB  . ASP B 1 369 ? 7.399   5.232   22.024  1.00 38.34 ? 369 ASP B CB  1 
ATOM   7101 C  CG  . ASP B 1 369 ? 8.737   5.966   22.027  1.00 44.04 ? 369 ASP B CG  1 
ATOM   7102 O  OD1 . ASP B 1 369 ? 9.626   5.620   21.215  1.00 46.02 ? 369 ASP B OD1 1 
ATOM   7103 O  OD2 . ASP B 1 369 ? 8.904   6.888   22.854  1.00 50.92 ? 369 ASP B OD2 1 
ATOM   7104 N  N   . ALA B 1 370 ? 4.829   3.925   20.802  1.00 33.94 ? 370 ALA B N   1 
ATOM   7105 C  CA  . ALA B 1 370 ? 3.588   3.162   20.901  1.00 31.35 ? 370 ALA B CA  1 
ATOM   7106 C  C   . ALA B 1 370 ? 3.584   1.944   19.987  1.00 31.76 ? 370 ALA B C   1 
ATOM   7107 O  O   . ALA B 1 370 ? 3.304   0.823   20.423  1.00 28.14 ? 370 ALA B O   1 
ATOM   7108 C  CB  . ALA B 1 370 ? 2.403   4.062   20.585  1.00 35.10 ? 370 ALA B CB  1 
ATOM   7109 N  N   . VAL B 1 371 ? 3.900   2.168   18.713  1.00 32.51 ? 371 VAL B N   1 
ATOM   7110 C  CA  . VAL B 1 371 ? 3.931   1.092   17.730  1.00 31.60 ? 371 VAL B CA  1 
ATOM   7111 C  C   . VAL B 1 371 ? 4.960   0.045   18.139  1.00 33.50 ? 371 VAL B C   1 
ATOM   7112 O  O   . VAL B 1 371 ? 4.681   -1.159  18.163  1.00 33.00 ? 371 VAL B O   1 
ATOM   7113 C  CB  . VAL B 1 371 ? 4.263   1.633   16.307  1.00 31.42 ? 371 VAL B CB  1 
ATOM   7114 C  CG1 . VAL B 1 371 ? 4.618   0.494   15.370  1.00 27.84 ? 371 VAL B CG1 1 
ATOM   7115 C  CG2 . VAL B 1 371 ? 3.096   2.432   15.768  1.00 28.84 ? 371 VAL B CG2 1 
ATOM   7116 N  N   . THR B 1 372 ? 6.143   0.528   18.500  1.00 33.56 ? 372 THR B N   1 
ATOM   7117 C  CA  . THR B 1 372 ? 7.251   -0.336  18.875  1.00 33.50 ? 372 THR B CA  1 
ATOM   7118 C  C   . THR B 1 372 ? 6.897   -1.216  20.068  1.00 33.47 ? 372 THR B C   1 
ATOM   7119 O  O   . THR B 1 372 ? 7.120   -2.431  20.043  1.00 32.01 ? 372 THR B O   1 
ATOM   7120 C  CB  . THR B 1 372 ? 8.510   0.502   19.181  1.00 38.29 ? 372 THR B CB  1 
ATOM   7121 O  OG1 . THR B 1 372 ? 8.942   1.149   17.973  1.00 37.73 ? 372 THR B OG1 1 
ATOM   7122 C  CG2 . THR B 1 372 ? 9.619   -0.381  19.708  1.00 34.11 ? 372 THR B CG2 1 
ATOM   7123 N  N   . LEU B 1 373 ? 6.323   -0.603  21.099  1.00 32.87 ? 373 LEU B N   1 
ATOM   7124 C  CA  . LEU B 1 373 ? 5.846   -1.342  22.263  1.00 31.97 ? 373 LEU B CA  1 
ATOM   7125 C  C   . LEU B 1 373 ? 4.809   -2.397  21.901  1.00 32.20 ? 373 LEU B C   1 
ATOM   7126 O  O   . LEU B 1 373 ? 4.839   -3.521  22.404  1.00 30.16 ? 373 LEU B O   1 
ATOM   7127 C  CB  . LEU B 1 373 ? 5.228   -0.395  23.287  1.00 36.05 ? 373 LEU B CB  1 
ATOM   7128 C  CG  . LEU B 1 373 ? 4.745   -1.120  24.547  1.00 35.74 ? 373 LEU B CG  1 
ATOM   7129 C  CD1 . LEU B 1 373 ? 5.881   -1.937  25.151  1.00 31.06 ? 373 LEU B CD1 1 
ATOM   7130 C  CD2 . LEU B 1 373 ? 4.188   -0.141  25.555  1.00 34.91 ? 373 LEU B CD2 1 
ATOM   7131 N  N   . GLN B 1 374 ? 3.879   -2.023  21.031  1.00 27.55 ? 374 GLN B N   1 
ATOM   7132 C  CA  . GLN B 1 374 ? 2.781   -2.905  20.684  1.00 30.39 ? 374 GLN B CA  1 
ATOM   7133 C  C   . GLN B 1 374 ? 3.236   -4.129  19.886  1.00 35.05 ? 374 GLN B C   1 
ATOM   7134 O  O   . GLN B 1 374 ? 2.540   -5.143  19.853  1.00 34.13 ? 374 GLN B O   1 
ATOM   7135 C  CB  . GLN B 1 374 ? 1.733   -2.129  19.891  1.00 31.97 ? 374 GLN B CB  1 
ATOM   7136 C  CG  . GLN B 1 374 ? 0.447   -2.881  19.660  1.00 37.10 ? 374 GLN B CG  1 
ATOM   7137 C  CD  . GLN B 1 374 ? -0.466  -2.857  20.868  1.00 37.63 ? 374 GLN B CD  1 
ATOM   7138 O  OE1 . GLN B 1 374 ? -1.443  -3.595  20.927  1.00 43.05 ? 374 GLN B OE1 1 
ATOM   7139 N  NE2 . GLN B 1 374 ? -0.155  -2.002  21.837  1.00 38.63 ? 374 GLN B NE2 1 
ATOM   7140 N  N   . TYR B 1 375 ? 4.398   -4.042  19.243  1.00 29.30 ? 375 TYR B N   1 
ATOM   7141 C  CA  . TYR B 1 375 ? 4.857   -5.150  18.404  1.00 34.90 ? 375 TYR B CA  1 
ATOM   7142 C  C   . TYR B 1 375 ? 6.181   -5.783  18.827  1.00 35.99 ? 375 TYR B C   1 
ATOM   7143 O  O   . TYR B 1 375 ? 6.795   -6.502  18.033  1.00 36.65 ? 375 TYR B O   1 
ATOM   7144 C  CB  . TYR B 1 375 ? 4.976   -4.682  16.955  1.00 29.38 ? 375 TYR B CB  1 
ATOM   7145 C  CG  . TYR B 1 375 ? 3.646   -4.601  16.250  1.00 32.52 ? 375 TYR B CG  1 
ATOM   7146 C  CD1 . TYR B 1 375 ? 2.870   -3.454  16.317  1.00 28.41 ? 375 TYR B CD1 1 
ATOM   7147 C  CD2 . TYR B 1 375 ? 3.169   -5.677  15.514  1.00 34.58 ? 375 TYR B CD2 1 
ATOM   7148 C  CE1 . TYR B 1 375 ? 1.663   -3.384  15.669  1.00 33.21 ? 375 TYR B CE1 1 
ATOM   7149 C  CE2 . TYR B 1 375 ? 1.956   -5.615  14.865  1.00 33.84 ? 375 TYR B CE2 1 
ATOM   7150 C  CZ  . TYR B 1 375 ? 1.212   -4.466  14.939  1.00 31.31 ? 375 TYR B CZ  1 
ATOM   7151 O  OH  . TYR B 1 375 ? 0.008   -4.408  14.294  1.00 32.29 ? 375 TYR B OH  1 
ATOM   7152 N  N   . THR B 1 376 ? 6.610   -5.513  20.063  1.00 31.83 ? 376 THR B N   1 
ATOM   7153 C  CA  . THR B 1 376 ? 7.875   -6.037  20.582  1.00 34.07 ? 376 THR B CA  1 
ATOM   7154 C  C   . THR B 1 376 ? 7.685   -6.998  21.750  1.00 32.93 ? 376 THR B C   1 
ATOM   7155 O  O   . THR B 1 376 ? 6.995   -6.686  22.719  1.00 35.11 ? 376 THR B O   1 
ATOM   7156 C  CB  . THR B 1 376 ? 8.799   -4.902  21.051  1.00 35.44 ? 376 THR B CB  1 
ATOM   7157 O  OG1 . THR B 1 376 ? 9.052   -4.011  19.959  1.00 32.89 ? 376 THR B OG1 1 
ATOM   7158 C  CG2 . THR B 1 376 ? 10.122  -5.458  21.615  1.00 34.74 ? 376 THR B CG2 1 
ATOM   7159 N  N   . ASP B 1 377 ? 8.299   -8.170  21.649  1.00 32.79 ? 377 ASP B N   1 
ATOM   7160 C  CA  . ASP B 1 377 ? 8.339   -9.114  22.754  1.00 36.01 ? 377 ASP B CA  1 
ATOM   7161 C  C   . ASP B 1 377 ? 9.553   -8.762  23.609  1.00 37.20 ? 377 ASP B C   1 
ATOM   7162 O  O   . ASP B 1 377 ? 10.692  -9.035  23.217  1.00 35.25 ? 377 ASP B O   1 
ATOM   7163 C  CB  . ASP B 1 377 ? 8.421   -10.544 22.231  1.00 34.82 ? 377 ASP B CB  1 
ATOM   7164 C  CG  . ASP B 1 377 ? 8.495   -11.583 23.333  1.00 39.42 ? 377 ASP B CG  1 
ATOM   7165 O  OD1 . ASP B 1 377 ? 8.644   -11.232 24.526  1.00 38.98 ? 377 ASP B OD1 1 
ATOM   7166 O  OD2 . ASP B 1 377 ? 8.420   -12.778 22.983  1.00 43.10 ? 377 ASP B OD2 1 
ATOM   7167 N  N   . TRP B 1 378 ? 9.321   -8.146  24.766  1.00 34.67 ? 378 TRP B N   1 
ATOM   7168 C  CA  . TRP B 1 378 ? 10.445  -7.616  25.545  1.00 38.45 ? 378 TRP B CA  1 
ATOM   7169 C  C   . TRP B 1 378 ? 11.126  -8.661  26.411  1.00 37.90 ? 378 TRP B C   1 
ATOM   7170 O  O   . TRP B 1 378 ? 12.098  -8.363  27.103  1.00 41.61 ? 378 TRP B O   1 
ATOM   7171 C  CB  . TRP B 1 378 ? 10.005  -6.433  26.397  1.00 36.95 ? 378 TRP B CB  1 
ATOM   7172 C  CG  . TRP B 1 378 ? 10.075  -5.148  25.629  1.00 36.76 ? 378 TRP B CG  1 
ATOM   7173 C  CD1 . TRP B 1 378 ? 9.032   -4.355  25.257  1.00 36.10 ? 378 TRP B CD1 1 
ATOM   7174 C  CD2 . TRP B 1 378 ? 11.259  -4.519  25.124  1.00 41.80 ? 378 TRP B CD2 1 
ATOM   7175 N  NE1 . TRP B 1 378 ? 9.489   -3.262  24.562  1.00 36.62 ? 378 TRP B NE1 1 
ATOM   7176 C  CE2 . TRP B 1 378 ? 10.854  -3.341  24.461  1.00 43.43 ? 378 TRP B CE2 1 
ATOM   7177 C  CE3 . TRP B 1 378 ? 12.622  -4.835  25.170  1.00 45.36 ? 378 TRP B CE3 1 
ATOM   7178 C  CZ2 . TRP B 1 378 ? 11.764  -2.476  23.845  1.00 45.67 ? 378 TRP B CZ2 1 
ATOM   7179 C  CZ3 . TRP B 1 378 ? 13.529  -3.972  24.556  1.00 47.25 ? 378 TRP B CZ3 1 
ATOM   7180 C  CH2 . TRP B 1 378 ? 13.092  -2.807  23.903  1.00 46.68 ? 378 TRP B CH2 1 
ATOM   7181 N  N   . MET B 1 379 ? 10.640  -9.892  26.350  1.00 37.61 ? 379 MET B N   1 
ATOM   7182 C  CA  . MET B 1 379 ? 11.406  -11.008 26.881  1.00 39.18 ? 379 MET B CA  1 
ATOM   7183 C  C   . MET B 1 379 ? 12.462  -11.490 25.884  1.00 41.86 ? 379 MET B C   1 
ATOM   7184 O  O   . MET B 1 379 ? 13.309  -12.312 26.226  1.00 42.30 ? 379 MET B O   1 
ATOM   7185 C  CB  . MET B 1 379 ? 10.494  -12.175 27.234  1.00 39.48 ? 379 MET B CB  1 
ATOM   7186 C  CG  . MET B 1 379 ? 9.557   -11.921 28.387  1.00 42.97 ? 379 MET B CG  1 
ATOM   7187 S  SD  . MET B 1 379 ? 8.560   -13.386 28.699  1.00 57.15 ? 379 MET B SD  1 
ATOM   7188 C  CE  . MET B 1 379 ? 7.605   -13.472 27.187  1.00 42.21 ? 379 MET B CE  1 
ATOM   7189 N  N   . ASP B 1 380 ? 12.413  -10.983 24.652  1.00 39.53 ? 380 ASP B N   1 
ATOM   7190 C  CA  . ASP B 1 380 ? 13.190  -11.594 23.579  1.00 39.76 ? 380 ASP B CA  1 
ATOM   7191 C  C   . ASP B 1 380 ? 13.359  -10.627 22.403  1.00 43.57 ? 380 ASP B C   1 
ATOM   7192 O  O   . ASP B 1 380 ? 13.095  -10.969 21.247  1.00 41.11 ? 380 ASP B O   1 
ATOM   7193 C  CB  . ASP B 1 380 ? 12.490  -12.892 23.153  1.00 41.63 ? 380 ASP B CB  1 
ATOM   7194 C  CG  . ASP B 1 380 ? 13.355  -13.791 22.281  1.00 46.14 ? 380 ASP B CG  1 
ATOM   7195 O  OD1 . ASP B 1 380 ? 14.553  -13.495 22.085  1.00 46.09 ? 380 ASP B OD1 1 
ATOM   7196 O  OD2 . ASP B 1 380 ? 12.823  -14.815 21.800  1.00 47.27 ? 380 ASP B OD2 1 
ATOM   7197 N  N   . ASP B 1 381 ? 13.814  -9.416  22.709  1.00 39.74 ? 381 ASP B N   1 
ATOM   7198 C  CA  . ASP B 1 381 ? 13.783  -8.317  21.748  1.00 38.52 ? 381 ASP B CA  1 
ATOM   7199 C  C   . ASP B 1 381 ? 14.865  -8.418  20.662  1.00 43.31 ? 381 ASP B C   1 
ATOM   7200 O  O   . ASP B 1 381 ? 14.807  -7.707  19.656  1.00 41.34 ? 381 ASP B O   1 
ATOM   7201 C  CB  . ASP B 1 381 ? 13.907  -6.985  22.490  1.00 37.37 ? 381 ASP B CB  1 
ATOM   7202 C  CG  . ASP B 1 381 ? 15.093  -6.957  23.441  1.00 43.44 ? 381 ASP B CG  1 
ATOM   7203 O  OD1 . ASP B 1 381 ? 15.118  -7.757  24.404  1.00 42.47 ? 381 ASP B OD1 1 
ATOM   7204 O  OD2 . ASP B 1 381 ? 16.002  -6.127  23.225  1.00 49.94 ? 381 ASP B OD2 1 
ATOM   7205 N  N   . ASN B 1 382 ? 15.841  -9.298  20.864  1.00 43.47 ? 382 ASN B N   1 
ATOM   7206 C  CA  . ASN B 1 382 ? 16.916  -9.475  19.885  1.00 45.10 ? 382 ASN B CA  1 
ATOM   7207 C  C   . ASN B 1 382 ? 16.707  -10.703 19.012  1.00 39.45 ? 382 ASN B C   1 
ATOM   7208 O  O   . ASN B 1 382 ? 17.621  -11.136 18.314  1.00 45.46 ? 382 ASN B O   1 
ATOM   7209 C  CB  . ASN B 1 382 ? 18.275  -9.564  20.589  1.00 37.28 ? 382 ASN B CB  1 
ATOM   7210 C  CG  . ASN B 1 382 ? 18.712  -8.236  21.166  1.00 42.40 ? 382 ASN B CG  1 
ATOM   7211 O  OD1 . ASN B 1 382 ? 18.718  -7.217  20.474  1.00 38.66 ? 382 ASN B OD1 1 
ATOM   7212 N  ND2 . ASN B 1 382 ? 19.067  -8.235  22.447  1.00 42.74 ? 382 ASN B ND2 1 
ATOM   7213 N  N   . ASN B 1 383 ? 15.513  -11.281 19.076  1.00 40.61 ? 383 ASN B N   1 
ATOM   7214 C  CA  . ASN B 1 383 ? 15.147  -12.371 18.168  1.00 43.85 ? 383 ASN B CA  1 
ATOM   7215 C  C   . ASN B 1 383 ? 14.884  -11.825 16.754  1.00 37.16 ? 383 ASN B C   1 
ATOM   7216 O  O   . ASN B 1 383 ? 13.888  -11.155 16.525  1.00 34.91 ? 383 ASN B O   1 
ATOM   7217 C  CB  . ASN B 1 383 ? 13.922  -13.122 18.699  1.00 39.97 ? 383 ASN B CB  1 
ATOM   7218 C  CG  . ASN B 1 383 ? 13.623  -14.392 17.915  1.00 43.07 ? 383 ASN B CG  1 
ATOM   7219 O  OD1 . ASN B 1 383 ? 13.619  -14.398 16.678  1.00 38.82 ? 383 ASN B OD1 1 
ATOM   7220 N  ND2 . ASN B 1 383 ? 13.365  -15.475 18.635  1.00 44.62 ? 383 ASN B ND2 1 
ATOM   7221 N  N   . GLY B 1 384 ? 15.796  -12.102 15.823  1.00 37.16 ? 384 GLY B N   1 
ATOM   7222 C  CA  . GLY B 1 384 ? 15.716  -11.559 14.471  1.00 34.55 ? 384 GLY B CA  1 
ATOM   7223 C  C   . GLY B 1 384 ? 14.451  -11.971 13.745  1.00 35.37 ? 384 GLY B C   1 
ATOM   7224 O  O   . GLY B 1 384 ? 13.854  -11.188 13.025  1.00 37.59 ? 384 GLY B O   1 
ATOM   7225 N  N   . ILE B 1 385 ? 14.046  -13.216 13.946  1.00 35.53 ? 385 ILE B N   1 
ATOM   7226 C  CA  . ILE B 1 385 ? 12.779  -13.715 13.448  1.00 34.88 ? 385 ILE B CA  1 
ATOM   7227 C  C   . ILE B 1 385 ? 11.574  -12.924 13.980  1.00 37.11 ? 385 ILE B C   1 
ATOM   7228 O  O   . ILE B 1 385 ? 10.791  -12.419 13.191  1.00 35.57 ? 385 ILE B O   1 
ATOM   7229 C  CB  . ILE B 1 385 ? 12.600  -15.186 13.804  1.00 37.28 ? 385 ILE B CB  1 
ATOM   7230 C  CG1 . ILE B 1 385 ? 13.787  -16.004 13.273  1.00 39.71 ? 385 ILE B CG1 1 
ATOM   7231 C  CG2 . ILE B 1 385 ? 11.258  -15.696 13.298  1.00 40.46 ? 385 ILE B CG2 1 
ATOM   7232 C  CD1 . ILE B 1 385 ? 13.513  -16.776 12.011  1.00 43.16 ? 385 ILE B CD1 1 
ATOM   7233 N  N   . LYS B 1 386 ? 11.411  -12.810 15.298  1.00 35.97 ? 386 LYS B N   1 
ATOM   7234 C  CA  . LYS B 1 386 ? 10.239  -12.093 15.814  1.00 36.76 ? 386 LYS B CA  1 
ATOM   7235 C  C   . LYS B 1 386 ? 10.277  -10.648 15.333  1.00 34.77 ? 386 LYS B C   1 
ATOM   7236 O  O   . LYS B 1 386 ? 9.245   -10.063 15.029  1.00 35.87 ? 386 LYS B O   1 
ATOM   7237 C  CB  . LYS B 1 386 ? 10.159  -12.150 17.349  1.00 33.74 ? 386 LYS B CB  1 
ATOM   7238 C  CG  . LYS B 1 386 ? 9.783   -13.525 17.907  1.00 33.37 ? 386 LYS B CG  1 
ATOM   7239 C  CD  . LYS B 1 386 ? 9.858   -13.539 19.432  1.00 38.43 ? 386 LYS B CD  1 
ATOM   7240 C  CE  . LYS B 1 386 ? 9.613   -14.927 20.010  1.00 35.26 ? 386 LYS B CE  1 
ATOM   7241 N  NZ  . LYS B 1 386 ? 9.750   -14.941 21.507  1.00 43.46 ? 386 LYS B NZ  1 
ATOM   7242 N  N   . ASN B 1 387 ? 11.475  -10.083 15.238  1.00 34.67 ? 387 ASN B N   1 
ATOM   7243 C  CA  . ASN B 1 387 ? 11.622  -8.719  14.754  1.00 35.91 ? 387 ASN B CA  1 
ATOM   7244 C  C   . ASN B 1 387 ? 11.199  -8.568  13.282  1.00 37.89 ? 387 ASN B C   1 
ATOM   7245 O  O   . ASN B 1 387 ? 10.579  -7.569  12.901  1.00 36.67 ? 387 ASN B O   1 
ATOM   7246 C  CB  . ASN B 1 387 ? 13.067  -8.255  14.939  1.00 36.01 ? 387 ASN B CB  1 
ATOM   7247 C  CG  . ASN B 1 387 ? 13.431  -8.050  16.400  1.00 38.65 ? 387 ASN B CG  1 
ATOM   7248 O  OD1 . ASN B 1 387 ? 12.557  -7.845  17.233  1.00 38.32 ? 387 ASN B OD1 1 
ATOM   7249 N  ND2 . ASN B 1 387 ? 14.732  -8.094  16.715  1.00 34.84 ? 387 ASN B ND2 1 
ATOM   7250 N  N   . ARG B 1 388 ? 11.548  -9.563  12.469  1.00 34.98 ? 388 ARG B N   1 
ATOM   7251 C  CA  . ARG B 1 388 ? 11.180  -9.613  11.059  1.00 33.81 ? 388 ARG B CA  1 
ATOM   7252 C  C   . ARG B 1 388 ? 9.657   -9.685  10.887  1.00 38.07 ? 388 ARG B C   1 
ATOM   7253 O  O   . ARG B 1 388 ? 9.037   -8.862  10.205  1.00 32.35 ? 388 ARG B O   1 
ATOM   7254 C  CB  . ARG B 1 388 ? 11.838  -10.826 10.395  1.00 35.70 ? 388 ARG B CB  1 
ATOM   7255 C  CG  . ARG B 1 388 ? 11.571  -10.973 8.889   1.00 36.61 ? 388 ARG B CG  1 
ATOM   7256 C  CD  . ARG B 1 388 ? 11.911  -12.378 8.404   1.00 32.80 ? 388 ARG B CD  1 
ATOM   7257 N  NE  . ARG B 1 388 ? 10.942  -13.352 8.893   1.00 36.70 ? 388 ARG B NE  1 
ATOM   7258 C  CZ  . ARG B 1 388 ? 11.192  -14.644 9.085   1.00 36.34 ? 388 ARG B CZ  1 
ATOM   7259 N  NH1 . ARG B 1 388 ? 10.232  -15.443 9.536   1.00 38.42 ? 388 ARG B NH1 1 
ATOM   7260 N  NH2 . ARG B 1 388 ? 12.394  -15.138 8.829   1.00 34.14 ? 388 ARG B NH2 1 
ATOM   7261 N  N   . ASP B 1 389 ? 9.079   -10.702 11.512  1.00 34.34 ? 389 ASP B N   1 
ATOM   7262 C  CA  . ASP B 1 389 ? 7.659   -10.949 11.470  1.00 35.48 ? 389 ASP B CA  1 
ATOM   7263 C  C   . ASP B 1 389 ? 6.879   -9.809  12.115  1.00 36.01 ? 389 ASP B C   1 
ATOM   7264 O  O   . ASP B 1 389 ? 5.807   -9.449  11.644  1.00 32.31 ? 389 ASP B O   1 
ATOM   7265 C  CB  . ASP B 1 389 ? 7.340   -12.273 12.157  1.00 33.95 ? 389 ASP B CB  1 
ATOM   7266 C  CG  . ASP B 1 389 ? 7.845   -13.476 11.367  1.00 41.51 ? 389 ASP B CG  1 
ATOM   7267 O  OD1 . ASP B 1 389 ? 8.402   -13.294 10.253  1.00 35.38 ? 389 ASP B OD1 1 
ATOM   7268 O  OD2 . ASP B 1 389 ? 7.662   -14.612 11.855  1.00 43.60 ? 389 ASP B OD2 1 
ATOM   7269 N  N   . GLY B 1 390 ? 7.427   -9.238  13.186  1.00 35.84 ? 390 GLY B N   1 
ATOM   7270 C  CA  . GLY B 1 390 ? 6.808   -8.089  13.823  1.00 34.77 ? 390 GLY B CA  1 
ATOM   7271 C  C   . GLY B 1 390 ? 6.615   -6.921  12.867  1.00 36.22 ? 390 GLY B C   1 
ATOM   7272 O  O   . GLY B 1 390 ? 5.539   -6.319  12.803  1.00 33.04 ? 390 GLY B O   1 
ATOM   7273 N  N   . LEU B 1 391 ? 7.677   -6.612  12.128  1.00 34.92 ? 391 LEU B N   1 
ATOM   7274 C  CA  . LEU B 1 391 ? 7.701   -5.516  11.165  1.00 35.65 ? 391 LEU B CA  1 
ATOM   7275 C  C   . LEU B 1 391 ? 6.801   -5.838  9.976   1.00 33.05 ? 391 LEU B C   1 
ATOM   7276 O  O   . LEU B 1 391 ? 6.126   -4.973  9.431   1.00 30.54 ? 391 LEU B O   1 
ATOM   7277 C  CB  . LEU B 1 391 ? 9.139   -5.273  10.708  1.00 37.66 ? 391 LEU B CB  1 
ATOM   7278 C  CG  . LEU B 1 391 ? 9.637   -3.865  10.392  1.00 41.60 ? 391 LEU B CG  1 
ATOM   7279 C  CD1 . LEU B 1 391 ? 9.095   -2.855  11.372  1.00 38.05 ? 391 LEU B CD1 1 
ATOM   7280 C  CD2 . LEU B 1 391 ? 11.172  -3.845  10.410  1.00 36.42 ? 391 LEU B CD2 1 
ATOM   7281 N  N   . ASP B 1 392 ? 6.808   -7.105  9.585   1.00 35.64 ? 392 ASP B N   1 
ATOM   7282 C  CA  . ASP B 1 392 ? 5.881   -7.626  8.596   1.00 32.33 ? 392 ASP B CA  1 
ATOM   7283 C  C   . ASP B 1 392 ? 4.437   -7.303  9.005   1.00 34.11 ? 392 ASP B C   1 
ATOM   7284 O  O   . ASP B 1 392 ? 3.686   -6.711  8.236   1.00 32.20 ? 392 ASP B O   1 
ATOM   7285 C  CB  . ASP B 1 392 ? 6.074   -9.132  8.460   1.00 34.78 ? 392 ASP B CB  1 
ATOM   7286 C  CG  . ASP B 1 392 ? 5.648   -9.665  7.110   1.00 42.77 ? 392 ASP B CG  1 
ATOM   7287 O  OD1 . ASP B 1 392 ? 4.795   -9.044  6.431   1.00 42.36 ? 392 ASP B OD1 1 
ATOM   7288 O  OD2 . ASP B 1 392 ? 6.175   -10.734 6.725   1.00 47.70 ? 392 ASP B OD2 1 
ATOM   7289 N  N   . ASP B 1 393 ? 4.067   -7.675  10.233  1.00 33.12 ? 393 ASP B N   1 
ATOM   7290 C  CA  . ASP B 1 393 ? 2.722   -7.409  10.742  1.00 33.06 ? 393 ASP B CA  1 
ATOM   7291 C  C   . ASP B 1 393 ? 2.435   -5.915  10.807  1.00 32.08 ? 393 ASP B C   1 
ATOM   7292 O  O   . ASP B 1 393 ? 1.337   -5.490  10.472  1.00 32.64 ? 393 ASP B O   1 
ATOM   7293 C  CB  . ASP B 1 393 ? 2.525   -8.045  12.123  1.00 32.09 ? 393 ASP B CB  1 
ATOM   7294 C  CG  . ASP B 1 393 ? 2.393   -9.555  12.048  1.00 37.07 ? 393 ASP B CG  1 
ATOM   7295 O  OD1 . ASP B 1 393 ? 2.034   -10.062 10.964  1.00 41.44 ? 393 ASP B OD1 1 
ATOM   7296 O  OD2 . ASP B 1 393 ? 2.650   -10.237 13.061  1.00 38.12 ? 393 ASP B OD2 1 
ATOM   7297 N  N   . ILE B 1 394 ? 3.422   -5.117  11.203  1.00 31.89 ? 394 ILE B N   1 
ATOM   7298 C  CA  . ILE B 1 394 ? 3.221   -3.678  11.304  1.00 30.50 ? 394 ILE B CA  1 
ATOM   7299 C  C   . ILE B 1 394 ? 2.801   -3.073  9.967   1.00 32.04 ? 394 ILE B C   1 
ATOM   7300 O  O   . ILE B 1 394 ? 1.834   -2.316  9.892   1.00 31.12 ? 394 ILE B O   1 
ATOM   7301 C  CB  . ILE B 1 394 ? 4.498   -2.961  11.801  1.00 32.52 ? 394 ILE B CB  1 
ATOM   7302 C  CG1 . ILE B 1 394 ? 4.743   -3.254  13.290  1.00 32.12 ? 394 ILE B CG1 1 
ATOM   7303 C  CG2 . ILE B 1 394 ? 4.391   -1.465  11.572  1.00 29.01 ? 394 ILE B CG2 1 
ATOM   7304 C  CD1 . ILE B 1 394 ? 6.061   -2.706  13.792  1.00 32.01 ? 394 ILE B CD1 1 
ATOM   7305 N  N   . VAL B 1 395 ? 3.526   -3.423  8.911   1.00 33.20 ? 395 VAL B N   1 
ATOM   7306 C  CA  . VAL B 1 395 ? 3.257   -2.872  7.594   1.00 28.52 ? 395 VAL B CA  1 
ATOM   7307 C  C   . VAL B 1 395 ? 1.883   -3.315  7.089   1.00 30.41 ? 395 VAL B C   1 
ATOM   7308 O  O   . VAL B 1 395 ? 1.093   -2.500  6.632   1.00 28.17 ? 395 VAL B O   1 
ATOM   7309 C  CB  . VAL B 1 395 ? 4.325   -3.291  6.574   1.00 30.28 ? 395 VAL B CB  1 
ATOM   7310 C  CG1 . VAL B 1 395 ? 3.938   -2.784  5.157   1.00 28.97 ? 395 VAL B CG1 1 
ATOM   7311 C  CG2 . VAL B 1 395 ? 5.694   -2.759  7.002   1.00 31.31 ? 395 VAL B CG2 1 
ATOM   7312 N  N   . GLY B 1 396 ? 1.607   -4.611  7.195   1.00 28.86 ? 396 GLY B N   1 
ATOM   7313 C  CA  . GLY B 1 396 ? 0.340   -5.165  6.773   1.00 29.00 ? 396 GLY B CA  1 
ATOM   7314 C  C   . GLY B 1 396 ? -0.860  -4.670  7.568   1.00 30.09 ? 396 GLY B C   1 
ATOM   7315 O  O   . GLY B 1 396 ? -1.897  -4.387  6.977   1.00 26.83 ? 396 GLY B O   1 
ATOM   7316 N  N   . ASP B 1 397 ? -0.736  -4.594  8.901   1.00 28.97 ? 397 ASP B N   1 
ATOM   7317 C  CA  . ASP B 1 397 ? -1.862  -4.176  9.753   1.00 27.58 ? 397 ASP B CA  1 
ATOM   7318 C  C   . ASP B 1 397 ? -2.205  -2.725  9.487   1.00 27.54 ? 397 ASP B C   1 
ATOM   7319 O  O   . ASP B 1 397 ? -3.364  -2.377  9.266   1.00 31.59 ? 397 ASP B O   1 
ATOM   7320 C  CB  . ASP B 1 397 ? -1.555  -4.360  11.247  1.00 28.67 ? 397 ASP B CB  1 
ATOM   7321 C  CG  . ASP B 1 397 ? -1.452  -5.822  11.649  1.00 32.88 ? 397 ASP B CG  1 
ATOM   7322 O  OD1 . ASP B 1 397 ? -1.895  -6.704  10.870  1.00 31.11 ? 397 ASP B OD1 1 
ATOM   7323 O  OD2 . ASP B 1 397 ? -0.921  -6.089  12.750  1.00 32.27 ? 397 ASP B OD2 1 
ATOM   7324 N  N   . HIS B 1 398 ? -1.185  -1.880  9.506   1.00 29.36 ? 398 HIS B N   1 
ATOM   7325 C  CA  . HIS B 1 398 ? -1.353  -0.447  9.315   1.00 28.65 ? 398 HIS B CA  1 
ATOM   7326 C  C   . HIS B 1 398 ? -1.891  -0.069  7.930   1.00 31.04 ? 398 HIS B C   1 
ATOM   7327 O  O   . HIS B 1 398 ? -2.754  0.802   7.811   1.00 30.20 ? 398 HIS B O   1 
ATOM   7328 C  CB  . HIS B 1 398 ? -0.017  0.257   9.540   1.00 29.78 ? 398 HIS B CB  1 
ATOM   7329 C  CG  . HIS B 1 398 ? -0.030  1.709   9.176   1.00 29.95 ? 398 HIS B CG  1 
ATOM   7330 N  ND1 . HIS B 1 398 ? -0.905  2.609   9.744   1.00 32.24 ? 398 HIS B ND1 1 
ATOM   7331 C  CD2 . HIS B 1 398 ? 0.725   2.418   8.306   1.00 29.94 ? 398 HIS B CD2 1 
ATOM   7332 C  CE1 . HIS B 1 398 ? -0.687  3.811   9.241   1.00 31.56 ? 398 HIS B CE1 1 
ATOM   7333 N  NE2 . HIS B 1 398 ? 0.299   3.723   8.368   1.00 31.39 ? 398 HIS B NE2 1 
ATOM   7334 N  N   . ASN B 1 399 ? -1.365  -0.710  6.888   1.00 27.61 ? 399 ASN B N   1 
ATOM   7335 C  CA  . ASN B 1 399 ? -1.620  -0.262  5.524   1.00 30.23 ? 399 ASN B CA  1 
ATOM   7336 C  C   . ASN B 1 399 ? -2.804  -0.949  4.881   1.00 28.80 ? 399 ASN B C   1 
ATOM   7337 O  O   . ASN B 1 399 ? -3.504  -0.363  4.064   1.00 29.72 ? 399 ASN B O   1 
ATOM   7338 C  CB  . ASN B 1 399 ? -0.380  -0.474  4.648   1.00 27.68 ? 399 ASN B CB  1 
ATOM   7339 C  CG  . ASN B 1 399 ? 0.715   0.524   4.952   1.00 29.88 ? 399 ASN B CG  1 
ATOM   7340 O  OD1 . ASN B 1 399 ? 0.552   1.723   4.721   1.00 31.98 ? 399 ASN B OD1 1 
ATOM   7341 N  ND2 . ASN B 1 399 ? 1.829   0.041   5.487   1.00 28.85 ? 399 ASN B ND2 1 
ATOM   7342 N  N   . VAL B 1 400 ? -3.011  -2.207  5.236   1.00 30.05 ? 400 VAL B N   1 
ATOM   7343 C  CA  . VAL B 1 400 ? -4.046  -2.990  4.587   1.00 29.68 ? 400 VAL B CA  1 
ATOM   7344 C  C   . VAL B 1 400 ? -5.099  -3.538  5.552   1.00 29.98 ? 400 VAL B C   1 
ATOM   7345 O  O   . VAL B 1 400 ? -6.276  -3.183  5.467   1.00 28.58 ? 400 VAL B O   1 
ATOM   7346 C  CB  . VAL B 1 400 ? -3.442  -4.156  3.811   1.00 27.89 ? 400 VAL B CB  1 
ATOM   7347 C  CG1 . VAL B 1 400 ? -4.560  -4.980  3.168   1.00 30.34 ? 400 VAL B CG1 1 
ATOM   7348 C  CG2 . VAL B 1 400 ? -2.483  -3.627  2.713   1.00 28.26 ? 400 VAL B CG2 1 
ATOM   7349 N  N   . ILE B 1 401 ? -4.683  -4.410  6.462   1.00 30.62 ? 401 ILE B N   1 
ATOM   7350 C  CA  . ILE B 1 401 ? -5.661  -5.181  7.208   1.00 31.18 ? 401 ILE B CA  1 
ATOM   7351 C  C   . ILE B 1 401 ? -6.576  -4.311  8.056   1.00 30.89 ? 401 ILE B C   1 
ATOM   7352 O  O   . ILE B 1 401 ? -7.789  -4.440  7.945   1.00 32.64 ? 401 ILE B O   1 
ATOM   7353 C  CB  . ILE B 1 401 ? -4.991  -6.234  8.090   1.00 34.25 ? 401 ILE B CB  1 
ATOM   7354 C  CG1 . ILE B 1 401 ? -4.339  -7.288  7.190   1.00 33.50 ? 401 ILE B CG1 1 
ATOM   7355 C  CG2 . ILE B 1 401 ? -6.015  -6.885  9.011   1.00 28.96 ? 401 ILE B CG2 1 
ATOM   7356 C  CD1 . ILE B 1 401 ? -3.726  -8.454  7.939   1.00 36.57 ? 401 ILE B CD1 1 
ATOM   7357 N  N   . CYS B 1 402 ? -6.021  -3.416  8.870   1.00 29.71 ? 402 CYS B N   1 
ATOM   7358 C  CA  . CYS B 1 402 ? -6.856  -2.644  9.800   1.00 30.60 ? 402 CYS B CA  1 
ATOM   7359 C  C   . CYS B 1 402 ? -7.661  -1.526  9.131   1.00 34.41 ? 402 CYS B C   1 
ATOM   7360 O  O   . CYS B 1 402 ? -8.763  -1.209  9.581   1.00 30.66 ? 402 CYS B O   1 
ATOM   7361 C  CB  . CYS B 1 402 ? -5.997  -2.058  10.927  1.00 31.22 ? 402 CYS B CB  1 
ATOM   7362 S  SG  . CYS B 1 402 ? -5.303  -3.342  12.006  1.00 34.29 ? 402 CYS B SG  1 
ATOM   7363 N  N   . PRO B 1 403 ? -7.103  -0.897  8.076   1.00 30.98 ? 403 PRO B N   1 
ATOM   7364 C  CA  . PRO B 1 403 ? -7.965  -0.013  7.286   1.00 31.95 ? 403 PRO B CA  1 
ATOM   7365 C  C   . PRO B 1 403 ? -9.182  -0.745  6.765   1.00 33.66 ? 403 PRO B C   1 
ATOM   7366 O  O   . PRO B 1 403 ? -10.288 -0.208  6.841   1.00 33.68 ? 403 PRO B O   1 
ATOM   7367 C  CB  . PRO B 1 403 ? -7.059  0.423   6.136   1.00 30.52 ? 403 PRO B CB  1 
ATOM   7368 C  CG  . PRO B 1 403 ? -5.702  0.467   6.777   1.00 31.22 ? 403 PRO B CG  1 
ATOM   7369 C  CD  . PRO B 1 403 ? -5.678  -0.641  7.815   1.00 29.25 ? 403 PRO B CD  1 
ATOM   7370 N  N   . LEU B 1 404 ? -8.979  -1.952  6.242   1.00 32.46 ? 404 LEU B N   1 
ATOM   7371 C  CA  . LEU B 1 404 ? -10.083 -2.729  5.702   1.00 32.87 ? 404 LEU B CA  1 
ATOM   7372 C  C   . LEU B 1 404 ? -11.081 -3.114  6.795   1.00 31.72 ? 404 LEU B C   1 
ATOM   7373 O  O   . LEU B 1 404 ? -12.290 -3.049  6.585   1.00 34.14 ? 404 LEU B O   1 
ATOM   7374 C  CB  . LEU B 1 404 ? -9.565  -3.981  4.977   1.00 31.89 ? 404 LEU B CB  1 
ATOM   7375 C  CG  . LEU B 1 404 ? -10.633 -4.765  4.205   1.00 34.10 ? 404 LEU B CG  1 
ATOM   7376 C  CD1 . LEU B 1 404 ? -10.097 -5.293  2.875   1.00 32.58 ? 404 LEU B CD1 1 
ATOM   7377 C  CD2 . LEU B 1 404 ? -11.214 -5.900  5.052   1.00 32.45 ? 404 LEU B CD2 1 
ATOM   7378 N  N   . MET B 1 405 ? -10.581 -3.487  7.968   1.00 32.02 ? 405 MET B N   1 
ATOM   7379 C  CA  . MET B 1 405 ? -11.458 -3.902  9.055   1.00 32.45 ? 405 MET B CA  1 
ATOM   7380 C  C   . MET B 1 405 ? -12.315 -2.725  9.531   1.00 33.41 ? 405 MET B C   1 
ATOM   7381 O  O   . MET B 1 405 ? -13.487 -2.894  9.840   1.00 31.52 ? 405 MET B O   1 
ATOM   7382 C  CB  . MET B 1 405 ? -10.649 -4.495  10.207  1.00 32.62 ? 405 MET B CB  1 
ATOM   7383 C  CG  . MET B 1 405 ? -9.975  -5.808  9.857   1.00 29.29 ? 405 MET B CG  1 
ATOM   7384 S  SD  . MET B 1 405 ? -11.171 -6.958  9.141   1.00 34.27 ? 405 MET B SD  1 
ATOM   7385 C  CE  . MET B 1 405 ? -12.431 -6.882  10.420  1.00 28.30 ? 405 MET B CE  1 
ATOM   7386 N  N   . HIS B 1 406 ? -11.740 -1.528  9.549   1.00 33.27 ? 406 HIS B N   1 
ATOM   7387 C  CA  . HIS B 1 406 ? -12.503 -0.327  9.886   1.00 33.37 ? 406 HIS B CA  1 
ATOM   7388 C  C   . HIS B 1 406 ? -13.602 -0.136  8.839   1.00 37.46 ? 406 HIS B C   1 
ATOM   7389 O  O   . HIS B 1 406 ? -14.774 0.073   9.168   1.00 33.89 ? 406 HIS B O   1 
ATOM   7390 C  CB  . HIS B 1 406 ? -11.575 0.891   9.951   1.00 33.34 ? 406 HIS B CB  1 
ATOM   7391 C  CG  . HIS B 1 406 ? -12.261 2.181   10.289  1.00 39.45 ? 406 HIS B CG  1 
ATOM   7392 N  ND1 . HIS B 1 406 ? -12.766 2.457   11.543  1.00 36.04 ? 406 HIS B ND1 1 
ATOM   7393 C  CD2 . HIS B 1 406 ? -12.484 3.290   9.542   1.00 37.55 ? 406 HIS B CD2 1 
ATOM   7394 C  CE1 . HIS B 1 406 ? -13.289 3.671   11.548  1.00 36.57 ? 406 HIS B CE1 1 
ATOM   7395 N  NE2 . HIS B 1 406 ? -13.130 4.198   10.347  1.00 39.53 ? 406 HIS B NE2 1 
ATOM   7396 N  N   . PHE B 1 407 ? -13.222 -0.244  7.571   1.00 34.44 ? 407 PHE B N   1 
ATOM   7397 C  CA  . PHE B 1 407 ? -14.185 -0.101  6.484   1.00 33.74 ? 407 PHE B CA  1 
ATOM   7398 C  C   . PHE B 1 407 ? -15.300 -1.126  6.604   1.00 30.92 ? 407 PHE B C   1 
ATOM   7399 O  O   . PHE B 1 407 ? -16.473 -0.795  6.470   1.00 30.26 ? 407 PHE B O   1 
ATOM   7400 C  CB  . PHE B 1 407 ? -13.490 -0.231  5.114   1.00 30.47 ? 407 PHE B CB  1 
ATOM   7401 C  CG  . PHE B 1 407 ? -14.440 -0.197  3.942   1.00 30.32 ? 407 PHE B CG  1 
ATOM   7402 C  CD1 . PHE B 1 407 ? -14.951 1.003   3.485   1.00 31.59 ? 407 PHE B CD1 1 
ATOM   7403 C  CD2 . PHE B 1 407 ? -14.829 -1.365  3.310   1.00 29.18 ? 407 PHE B CD2 1 
ATOM   7404 C  CE1 . PHE B 1 407 ? -15.838 1.040   2.404   1.00 34.63 ? 407 PHE B CE1 1 
ATOM   7405 C  CE2 . PHE B 1 407 ? -15.709 -1.338  2.220   1.00 32.17 ? 407 PHE B CE2 1 
ATOM   7406 C  CZ  . PHE B 1 407 ? -16.218 -0.132  1.772   1.00 30.91 ? 407 PHE B CZ  1 
ATOM   7407 N  N   . VAL B 1 408 ? -14.938 -2.372  6.865   1.00 29.96 ? 408 VAL B N   1 
ATOM   7408 C  CA  . VAL B 1 408 ? -15.931 -3.435  6.857   1.00 32.79 ? 408 VAL B CA  1 
ATOM   7409 C  C   . VAL B 1 408 ? -16.920 -3.252  8.012   1.00 37.57 ? 408 VAL B C   1 
ATOM   7410 O  O   . VAL B 1 408 ? -18.135 -3.474  7.863   1.00 34.55 ? 408 VAL B O   1 
ATOM   7411 C  CB  . VAL B 1 408 ? -15.262 -4.825  6.929   1.00 34.41 ? 408 VAL B CB  1 
ATOM   7412 C  CG1 . VAL B 1 408 ? -14.731 -5.093  8.295   1.00 33.22 ? 408 VAL B CG1 1 
ATOM   7413 C  CG2 . VAL B 1 408 ? -16.248 -5.913  6.540   1.00 38.19 ? 408 VAL B CG2 1 
ATOM   7414 N  N   . ASN B 1 409 ? -16.400 -2.819  9.155   1.00 35.02 ? 409 ASN B N   1 
ATOM   7415 C  CA  . ASN B 1 409 ? -17.233 -2.571  10.324  1.00 33.49 ? 409 ASN B CA  1 
ATOM   7416 C  C   . ASN B 1 409 ? -18.162 -1.377  10.097  1.00 35.37 ? 409 ASN B C   1 
ATOM   7417 O  O   . ASN B 1 409 ? -19.356 -1.452  10.382  1.00 35.52 ? 409 ASN B O   1 
ATOM   7418 C  CB  . ASN B 1 409 ? -16.361 -2.354  11.571  1.00 32.39 ? 409 ASN B CB  1 
ATOM   7419 C  CG  . ASN B 1 409 ? -16.026 -3.661  12.286  1.00 39.09 ? 409 ASN B CG  1 
ATOM   7420 O  OD1 . ASN B 1 409 ? -16.899 -4.286  12.892  1.00 41.94 ? 409 ASN B OD1 1 
ATOM   7421 N  ND2 . ASN B 1 409 ? -14.757 -4.065  12.242  1.00 33.92 ? 409 ASN B ND2 1 
ATOM   7422 N  N   . LYS B 1 410 ? -17.625 -0.283  9.564   1.00 36.01 ? 410 LYS B N   1 
ATOM   7423 C  CA  . LYS B 1 410 ? -18.451 0.888   9.263   1.00 36.01 ? 410 LYS B CA  1 
ATOM   7424 C  C   . LYS B 1 410 ? -19.497 0.578   8.202   1.00 35.46 ? 410 LYS B C   1 
ATOM   7425 O  O   . LYS B 1 410 ? -20.647 0.988   8.310   1.00 37.04 ? 410 LYS B O   1 
ATOM   7426 C  CB  . LYS B 1 410 ? -17.598 2.058   8.789   1.00 35.75 ? 410 LYS B CB  1 
ATOM   7427 C  CG  . LYS B 1 410 ? -16.715 2.659   9.845   1.00 36.36 ? 410 LYS B CG  1 
ATOM   7428 C  CD  . LYS B 1 410 ? -17.525 3.531   10.793  1.00 40.65 ? 410 LYS B CD  1 
ATOM   7429 C  CE  . LYS B 1 410 ? -16.662 4.037   11.939  1.00 40.32 ? 410 LYS B CE  1 
ATOM   7430 N  NZ  . LYS B 1 410 ? -17.457 4.817   12.923  1.00 48.88 ? 410 LYS B NZ  1 
ATOM   7431 N  N   . TYR B 1 411 ? -19.090 -0.154  7.175   1.00 37.02 ? 411 TYR B N   1 
ATOM   7432 C  CA  . TYR B 1 411 ? -19.964 -0.375  6.026   1.00 33.59 ? 411 TYR B CA  1 
ATOM   7433 C  C   . TYR B 1 411 ? -21.140 -1.259  6.419   1.00 36.74 ? 411 TYR B C   1 
ATOM   7434 O  O   . TYR B 1 411 ? -22.281 -1.004  6.037   1.00 36.43 ? 411 TYR B O   1 
ATOM   7435 C  CB  . TYR B 1 411 ? -19.197 -0.998  4.852   1.00 30.56 ? 411 TYR B CB  1 
ATOM   7436 C  CG  . TYR B 1 411 ? -20.062 -1.112  3.616   1.00 31.55 ? 411 TYR B CG  1 
ATOM   7437 C  CD1 . TYR B 1 411 ? -20.151 -0.063  2.715   1.00 29.38 ? 411 TYR B CD1 1 
ATOM   7438 C  CD2 . TYR B 1 411 ? -20.830 -2.247  3.386   1.00 30.16 ? 411 TYR B CD2 1 
ATOM   7439 C  CE1 . TYR B 1 411 ? -20.973 -0.148  1.591   1.00 33.35 ? 411 TYR B CE1 1 
ATOM   7440 C  CE2 . TYR B 1 411 ? -21.647 -2.344  2.282   1.00 35.25 ? 411 TYR B CE2 1 
ATOM   7441 C  CZ  . TYR B 1 411 ? -21.714 -1.293  1.383   1.00 35.92 ? 411 TYR B CZ  1 
ATOM   7442 O  OH  . TYR B 1 411 ? -22.531 -1.381  0.280   1.00 38.60 ? 411 TYR B OH  1 
ATOM   7443 N  N   . THR B 1 412 ? -20.851 -2.283  7.211   1.00 37.39 ? 412 THR B N   1 
ATOM   7444 C  CA  . THR B 1 412 ? -21.819 -3.326  7.527   1.00 32.53 ? 412 THR B CA  1 
ATOM   7445 C  C   . THR B 1 412 ? -23.003 -2.792  8.333   1.00 37.82 ? 412 THR B C   1 
ATOM   7446 O  O   . THR B 1 412 ? -24.080 -3.403  8.351   1.00 37.95 ? 412 THR B O   1 
ATOM   7447 C  CB  . THR B 1 412 ? -21.127 -4.478  8.281   1.00 37.09 ? 412 THR B CB  1 
ATOM   7448 O  OG1 . THR B 1 412 ? -20.151 -5.078  7.421   1.00 35.23 ? 412 THR B OG1 1 
ATOM   7449 C  CG2 . THR B 1 412 ? -22.121 -5.549  8.729   1.00 37.97 ? 412 THR B CG2 1 
ATOM   7450 N  N   . LYS B 1 413 ? -22.824 -1.638  8.967   1.00 37.33 ? 413 LYS B N   1 
ATOM   7451 C  CA  . LYS B 1 413 ? -23.908 -1.021  9.734   1.00 36.96 ? 413 LYS B CA  1 
ATOM   7452 C  C   . LYS B 1 413 ? -25.009 -0.500  8.819   1.00 39.19 ? 413 LYS B C   1 
ATOM   7453 O  O   . LYS B 1 413 ? -26.127 -0.266  9.270   1.00 38.73 ? 413 LYS B O   1 
ATOM   7454 C  CB  . LYS B 1 413 ? -23.389 0.120   10.608  1.00 35.41 ? 413 LYS B CB  1 
ATOM   7455 C  CG  . LYS B 1 413 ? -22.414 -0.332  11.680  1.00 45.31 ? 413 LYS B CG  1 
ATOM   7456 C  CD  . LYS B 1 413 ? -22.094 0.790   12.661  1.00 43.65 ? 413 LYS B CD  1 
ATOM   7457 C  CE  . LYS B 1 413 ? -20.775 0.533   13.385  1.00 58.71 ? 413 LYS B CE  1 
ATOM   7458 N  NZ  . LYS B 1 413 ? -20.728 -0.774  14.120  1.00 60.29 ? 413 LYS B NZ  1 
ATOM   7459 N  N   . PHE B 1 414 ? -24.689 -0.321  7.538   1.00 39.70 ? 414 PHE B N   1 
ATOM   7460 C  CA  . PHE B 1 414 ? -25.652 0.213   6.570   1.00 39.30 ? 414 PHE B CA  1 
ATOM   7461 C  C   . PHE B 1 414 ? -25.895 -0.704  5.377   1.00 37.71 ? 414 PHE B C   1 
ATOM   7462 O  O   . PHE B 1 414 ? -26.953 -0.654  4.765   1.00 38.88 ? 414 PHE B O   1 
ATOM   7463 C  CB  . PHE B 1 414 ? -25.194 1.578   6.048   1.00 37.48 ? 414 PHE B CB  1 
ATOM   7464 C  CG  . PHE B 1 414 ? -25.315 2.684   7.050   1.00 41.46 ? 414 PHE B CG  1 
ATOM   7465 C  CD1 . PHE B 1 414 ? -26.549 3.256   7.324   1.00 43.61 ? 414 PHE B CD1 1 
ATOM   7466 C  CD2 . PHE B 1 414 ? -24.196 3.159   7.722   1.00 41.66 ? 414 PHE B CD2 1 
ATOM   7467 C  CE1 . PHE B 1 414 ? -26.664 4.281   8.252   1.00 42.10 ? 414 PHE B CE1 1 
ATOM   7468 C  CE2 . PHE B 1 414 ? -24.304 4.185   8.645   1.00 42.31 ? 414 PHE B CE2 1 
ATOM   7469 C  CZ  . PHE B 1 414 ? -25.541 4.745   8.915   1.00 39.02 ? 414 PHE B CZ  1 
ATOM   7470 N  N   . GLY B 1 415 ? -24.908 -1.524  5.035   1.00 38.04 ? 415 GLY B N   1 
ATOM   7471 C  CA  . GLY B 1 415 ? -24.962 -2.306  3.812   1.00 35.90 ? 415 GLY B CA  1 
ATOM   7472 C  C   . GLY B 1 415 ? -26.004 -3.408  3.818   1.00 38.67 ? 415 GLY B C   1 
ATOM   7473 O  O   . GLY B 1 415 ? -26.725 -3.598  4.793   1.00 36.79 ? 415 GLY B O   1 
ATOM   7474 N  N   . ASN B 1 416 ? -26.052 -4.157  2.725   1.00 38.94 ? 416 ASN B N   1 
ATOM   7475 C  CA  . ASN B 1 416 ? -27.047 -5.195  2.551   1.00 37.83 ? 416 ASN B CA  1 
ATOM   7476 C  C   . ASN B 1 416 ? -26.474 -6.614  2.571   1.00 39.20 ? 416 ASN B C   1 
ATOM   7477 O  O   . ASN B 1 416 ? -27.112 -7.575  2.111   1.00 35.20 ? 416 ASN B O   1 
ATOM   7478 C  CB  . ASN B 1 416 ? -27.800 -4.971  1.247   1.00 36.10 ? 416 ASN B CB  1 
ATOM   7479 C  CG  . ASN B 1 416 ? -29.047 -5.807  1.171   1.00 39.11 ? 416 ASN B CG  1 
ATOM   7480 O  OD1 . ASN B 1 416 ? -29.331 -6.450  0.161   1.00 40.15 ? 416 ASN B OD1 1 
ATOM   7481 N  ND2 . ASN B 1 416 ? -29.780 -5.837  2.268   1.00 40.12 ? 416 ASN B ND2 1 
ATOM   7482 N  N   . GLY B 1 417 ? -25.272 -6.744  3.109   1.00 36.78 ? 417 GLY B N   1 
ATOM   7483 C  CA  . GLY B 1 417 ? -24.643 -8.044  3.226   1.00 40.26 ? 417 GLY B CA  1 
ATOM   7484 C  C   . GLY B 1 417 ? -23.141 -7.939  3.057   1.00 35.65 ? 417 GLY B C   1 
ATOM   7485 O  O   . GLY B 1 417 ? -22.656 -7.362  2.085   1.00 33.56 ? 417 GLY B O   1 
ATOM   7486 N  N   . THR B 1 418 ? -22.412 -8.498  4.013   1.00 33.02 ? 418 THR B N   1 
ATOM   7487 C  CA  . THR B 1 418 ? -20.963 -8.437  4.010   1.00 29.00 ? 418 THR B CA  1 
ATOM   7488 C  C   . THR B 1 418 ? -20.388 -9.825  4.176   1.00 32.25 ? 418 THR B C   1 
ATOM   7489 O  O   . THR B 1 418 ? -20.742 -10.544 5.113   1.00 32.37 ? 418 THR B O   1 
ATOM   7490 C  CB  . THR B 1 418 ? -20.426 -7.536  5.133   1.00 30.99 ? 418 THR B CB  1 
ATOM   7491 O  OG1 . THR B 1 418 ? -20.848 -6.191  4.902   1.00 32.44 ? 418 THR B OG1 1 
ATOM   7492 C  CG2 . THR B 1 418 ? -18.874 -7.575  5.187   1.00 30.69 ? 418 THR B CG2 1 
ATOM   7493 N  N   . TYR B 1 419 ? -19.492 -10.189 3.266   1.00 30.90 ? 419 TYR B N   1 
ATOM   7494 C  CA  . TYR B 1 419 ? -18.718 -11.418 3.389   1.00 34.29 ? 419 TYR B CA  1 
ATOM   7495 C  C   . TYR B 1 419 ? -17.217 -11.095 3.458   1.00 34.62 ? 419 TYR B C   1 
ATOM   7496 O  O   . TYR B 1 419 ? -16.691 -10.349 2.633   1.00 33.87 ? 419 TYR B O   1 
ATOM   7497 C  CB  . TYR B 1 419 ? -19.036 -12.364 2.221   1.00 30.56 ? 419 TYR B CB  1 
ATOM   7498 C  CG  . TYR B 1 419 ? -20.492 -12.758 2.193   1.00 31.67 ? 419 TYR B CG  1 
ATOM   7499 C  CD1 . TYR B 1 419 ? -20.951 -13.848 2.917   1.00 32.34 ? 419 TYR B CD1 1 
ATOM   7500 C  CD2 . TYR B 1 419 ? -21.415 -12.022 1.454   1.00 31.49 ? 419 TYR B CD2 1 
ATOM   7501 C  CE1 . TYR B 1 419 ? -22.293 -14.197 2.909   1.00 34.58 ? 419 TYR B CE1 1 
ATOM   7502 C  CE2 . TYR B 1 419 ? -22.744 -12.365 1.428   1.00 30.62 ? 419 TYR B CE2 1 
ATOM   7503 C  CZ  . TYR B 1 419 ? -23.186 -13.450 2.157   1.00 33.94 ? 419 TYR B CZ  1 
ATOM   7504 O  OH  . TYR B 1 419 ? -24.526 -13.784 2.137   1.00 35.30 ? 419 TYR B OH  1 
ATOM   7505 N  N   . LEU B 1 420 ? -16.537 -11.665 4.446   1.00 33.84 ? 420 LEU B N   1 
ATOM   7506 C  CA  . LEU B 1 420 ? -15.145 -11.324 4.729   1.00 29.42 ? 420 LEU B CA  1 
ATOM   7507 C  C   . LEU B 1 420 ? -14.260 -12.574 4.716   1.00 34.20 ? 420 LEU B C   1 
ATOM   7508 O  O   . LEU B 1 420 ? -14.652 -13.617 5.234   1.00 32.65 ? 420 LEU B O   1 
ATOM   7509 C  CB  . LEU B 1 420 ? -15.047 -10.607 6.079   1.00 32.30 ? 420 LEU B CB  1 
ATOM   7510 C  CG  . LEU B 1 420 ? -13.654 -10.224 6.589   1.00 34.38 ? 420 LEU B CG  1 
ATOM   7511 C  CD1 . LEU B 1 420 ? -13.017 -9.137  5.708   1.00 31.49 ? 420 LEU B CD1 1 
ATOM   7512 C  CD2 . LEU B 1 420 ? -13.729 -9.773  8.039   1.00 30.58 ? 420 LEU B CD2 1 
ATOM   7513 N  N   . TYR B 1 421 ? -13.075 -12.477 4.108   1.00 33.10 ? 421 TYR B N   1 
ATOM   7514 C  CA  . TYR B 1 421 ? -12.174 -13.629 4.030   1.00 30.95 ? 421 TYR B CA  1 
ATOM   7515 C  C   . TYR B 1 421 ? -10.755 -13.280 4.486   1.00 32.47 ? 421 TYR B C   1 
ATOM   7516 O  O   . TYR B 1 421 ? -10.356 -12.109 4.516   1.00 29.75 ? 421 TYR B O   1 
ATOM   7517 C  CB  . TYR B 1 421 ? -12.138 -14.206 2.601   1.00 33.70 ? 421 TYR B CB  1 
ATOM   7518 C  CG  . TYR B 1 421 ? -11.396 -13.339 1.606   1.00 32.32 ? 421 TYR B CG  1 
ATOM   7519 C  CD1 . TYR B 1 421 ? -10.004 -13.352 1.538   1.00 31.73 ? 421 TYR B CD1 1 
ATOM   7520 C  CD2 . TYR B 1 421 ? -12.084 -12.492 0.748   1.00 31.20 ? 421 TYR B CD2 1 
ATOM   7521 C  CE1 . TYR B 1 421 ? -9.319  -12.539 0.636   1.00 32.08 ? 421 TYR B CE1 1 
ATOM   7522 C  CE2 . TYR B 1 421 ? -11.407 -11.681 -0.160  1.00 32.89 ? 421 TYR B CE2 1 
ATOM   7523 C  CZ  . TYR B 1 421 ? -10.032 -11.710 -0.210  1.00 31.17 ? 421 TYR B CZ  1 
ATOM   7524 O  OH  . TYR B 1 421 ? -9.373  -10.901 -1.094  1.00 29.61 ? 421 TYR B OH  1 
ATOM   7525 N  N   . PHE B 1 422 ? -10.001 -14.318 4.834   1.00 31.45 ? 422 PHE B N   1 
ATOM   7526 C  CA  . PHE B 1 422 ? -8.602  -14.194 5.238   1.00 31.17 ? 422 PHE B CA  1 
ATOM   7527 C  C   . PHE B 1 422 ? -7.817  -15.217 4.432   1.00 33.12 ? 422 PHE B C   1 
ATOM   7528 O  O   . PHE B 1 422 ? -7.840  -16.405 4.749   1.00 33.32 ? 422 PHE B O   1 
ATOM   7529 C  CB  . PHE B 1 422 ? -8.432  -14.426 6.758   1.00 31.58 ? 422 PHE B CB  1 
ATOM   7530 C  CG  . PHE B 1 422 ? -7.016  -14.236 7.266   1.00 32.81 ? 422 PHE B CG  1 
ATOM   7531 C  CD1 . PHE B 1 422 ? -6.465  -12.969 7.380   1.00 33.39 ? 422 PHE B CD1 1 
ATOM   7532 C  CD2 . PHE B 1 422 ? -6.248  -15.326 7.648   1.00 33.66 ? 422 PHE B CD2 1 
ATOM   7533 C  CE1 . PHE B 1 422 ? -5.165  -12.792 7.847   1.00 34.07 ? 422 PHE B CE1 1 
ATOM   7534 C  CE2 . PHE B 1 422 ? -4.944  -15.159 8.120   1.00 33.26 ? 422 PHE B CE2 1 
ATOM   7535 C  CZ  . PHE B 1 422 ? -4.402  -13.890 8.217   1.00 31.82 ? 422 PHE B CZ  1 
ATOM   7536 N  N   . PHE B 1 423 ? -7.158  -14.760 3.368   1.00 32.50 ? 423 PHE B N   1 
ATOM   7537 C  CA  . PHE B 1 423 ? -6.436  -15.653 2.456   1.00 32.28 ? 423 PHE B CA  1 
ATOM   7538 C  C   . PHE B 1 423 ? -5.055  -15.971 3.023   1.00 31.92 ? 423 PHE B C   1 
ATOM   7539 O  O   . PHE B 1 423 ? -4.229  -15.076 3.193   1.00 31.52 ? 423 PHE B O   1 
ATOM   7540 C  CB  . PHE B 1 423 ? -6.322  -15.012 1.062   1.00 31.87 ? 423 PHE B CB  1 
ATOM   7541 C  CG  . PHE B 1 423 ? -5.622  -15.873 0.043   1.00 32.98 ? 423 PHE B CG  1 
ATOM   7542 C  CD1 . PHE B 1 423 ? -6.328  -16.799 -0.708  1.00 30.78 ? 423 PHE B CD1 1 
ATOM   7543 C  CD2 . PHE B 1 423 ? -4.260  -15.748 -0.170  1.00 32.31 ? 423 PHE B CD2 1 
ATOM   7544 C  CE1 . PHE B 1 423 ? -5.681  -17.586 -1.649  1.00 32.18 ? 423 PHE B CE1 1 
ATOM   7545 C  CE2 . PHE B 1 423 ? -3.610  -16.533 -1.102  1.00 34.37 ? 423 PHE B CE2 1 
ATOM   7546 C  CZ  . PHE B 1 423 ? -4.323  -17.451 -1.847  1.00 35.01 ? 423 PHE B CZ  1 
ATOM   7547 N  N   . ASN B 1 424 ? -4.804  -17.240 3.330   1.00 30.38 ? 424 ASN B N   1 
ATOM   7548 C  CA  . ASN B 1 424 ? -3.539  -17.600 3.958   1.00 32.98 ? 424 ASN B CA  1 
ATOM   7549 C  C   . ASN B 1 424 ? -2.931  -18.879 3.387   1.00 35.70 ? 424 ASN B C   1 
ATOM   7550 O  O   . ASN B 1 424 ? -2.336  -19.687 4.107   1.00 32.08 ? 424 ASN B O   1 
ATOM   7551 C  CB  . ASN B 1 424 ? -3.700  -17.705 5.489   1.00 33.88 ? 424 ASN B CB  1 
ATOM   7552 C  CG  . ASN B 1 424 ? -4.709  -18.766 5.928   1.00 33.35 ? 424 ASN B CG  1 
ATOM   7553 O  OD1 . ASN B 1 424 ? -5.375  -19.402 5.120   1.00 37.56 ? 424 ASN B OD1 1 
ATOM   7554 N  ND2 . ASN B 1 424 ? -4.807  -18.962 7.233   1.00 39.95 ? 424 ASN B ND2 1 
ATOM   7555 N  N   . HIS B 1 425 ? -3.074  -19.043 2.077   1.00 33.05 ? 425 HIS B N   1 
ATOM   7556 C  CA  . HIS B 1 425 ? -2.414  -20.130 1.377   1.00 37.54 ? 425 HIS B CA  1 
ATOM   7557 C  C   . HIS B 1 425 ? -1.126  -19.662 0.697   1.00 37.83 ? 425 HIS B C   1 
ATOM   7558 O  O   . HIS B 1 425 ? -1.157  -18.759 -0.139  1.00 35.12 ? 425 HIS B O   1 
ATOM   7559 C  CB  . HIS B 1 425 ? -3.329  -20.753 0.325   1.00 33.51 ? 425 HIS B CB  1 
ATOM   7560 C  CG  . HIS B 1 425 ? -2.703  -21.913 -0.371  1.00 37.64 ? 425 HIS B CG  1 
ATOM   7561 N  ND1 . HIS B 1 425 ? -2.569  -23.147 0.228   1.00 42.50 ? 425 HIS B ND1 1 
ATOM   7562 C  CD2 . HIS B 1 425 ? -2.124  -22.019 -1.588  1.00 37.34 ? 425 HIS B CD2 1 
ATOM   7563 C  CE1 . HIS B 1 425 ? -1.953  -23.971 -0.600  1.00 41.91 ? 425 HIS B CE1 1 
ATOM   7564 N  NE2 . HIS B 1 425 ? -1.674  -23.311 -1.710  1.00 42.94 ? 425 HIS B NE2 1 
ATOM   7565 N  N   . ARG B 1 426 ? -0.003  -20.276 1.057   1.00 38.30 ? 426 ARG B N   1 
ATOM   7566 C  CA  . ARG B 1 426 ? 1.246   -20.037 0.343   1.00 38.15 ? 426 ARG B CA  1 
ATOM   7567 C  C   . ARG B 1 426 ? 1.362   -21.037 -0.799  1.00 40.83 ? 426 ARG B C   1 
ATOM   7568 O  O   . ARG B 1 426 ? 1.399   -22.249 -0.561  1.00 42.09 ? 426 ARG B O   1 
ATOM   7569 C  CB  . ARG B 1 426 ? 2.465   -20.143 1.264   1.00 36.77 ? 426 ARG B CB  1 
ATOM   7570 C  CG  . ARG B 1 426 ? 3.765   -20.164 0.465   1.00 43.32 ? 426 ARG B CG  1 
ATOM   7571 C  CD  . ARG B 1 426 ? 4.997   -19.803 1.269   1.00 43.54 ? 426 ARG B CD  1 
ATOM   7572 N  NE  . ARG B 1 426 ? 6.166   -19.790 0.389   1.00 44.86 ? 426 ARG B NE  1 
ATOM   7573 C  CZ  . ARG B 1 426 ? 6.869   -18.705 0.070   1.00 44.63 ? 426 ARG B CZ  1 
ATOM   7574 N  NH1 . ARG B 1 426 ? 7.907   -18.816 -0.752  1.00 45.46 ? 426 ARG B NH1 1 
ATOM   7575 N  NH2 . ARG B 1 426 ? 6.552   -17.515 0.573   1.00 37.84 ? 426 ARG B NH2 1 
ATOM   7576 N  N   . ALA B 1 427 ? 1.415   -20.523 -2.028  1.00 37.33 ? 427 ALA B N   1 
ATOM   7577 C  CA  . ALA B 1 427 ? 1.421   -21.356 -3.231  1.00 42.18 ? 427 ALA B CA  1 
ATOM   7578 C  C   . ALA B 1 427 ? 2.664   -22.236 -3.330  1.00 39.67 ? 427 ALA B C   1 
ATOM   7579 O  O   . ALA B 1 427 ? 3.762   -21.823 -2.987  1.00 39.55 ? 427 ALA B O   1 
ATOM   7580 C  CB  . ALA B 1 427 ? 1.294   -20.478 -4.498  1.00 39.51 ? 427 ALA B CB  1 
ATOM   7581 N  N   . SER B 1 428 ? 2.465   -23.449 -3.832  1.00 40.27 ? 428 SER B N   1 
ATOM   7582 C  CA  . SER B 1 428 ? 3.510   -24.459 -3.904  1.00 41.98 ? 428 SER B CA  1 
ATOM   7583 C  C   . SER B 1 428 ? 4.658   -24.053 -4.828  1.00 45.00 ? 428 SER B C   1 
ATOM   7584 O  O   . SER B 1 428 ? 5.796   -24.479 -4.641  1.00 43.74 ? 428 SER B O   1 
ATOM   7585 C  CB  . SER B 1 428 ? 2.906   -25.787 -4.379  1.00 43.77 ? 428 SER B CB  1 
ATOM   7586 O  OG  . SER B 1 428 ? 2.398   -25.661 -5.699  1.00 43.17 ? 428 SER B OG  1 
ATOM   7587 N  N   . ASN B 1 429 ? 4.349   -23.233 -5.827  1.00 43.86 ? 429 ASN B N   1 
ATOM   7588 C  CA  . ASN B 1 429 ? 5.331   -22.830 -6.823  1.00 42.03 ? 429 ASN B CA  1 
ATOM   7589 C  C   . ASN B 1 429 ? 5.760   -21.371 -6.701  1.00 42.72 ? 429 ASN B C   1 
ATOM   7590 O  O   . ASN B 1 429 ? 6.091   -20.745 -7.703  1.00 40.70 ? 429 ASN B O   1 
ATOM   7591 C  CB  . ASN B 1 429 ? 4.775   -23.069 -8.231  1.00 41.96 ? 429 ASN B CB  1 
ATOM   7592 C  CG  . ASN B 1 429 ? 3.415   -22.425 -8.431  1.00 42.72 ? 429 ASN B CG  1 
ATOM   7593 O  OD1 . ASN B 1 429 ? 2.959   -21.641 -7.596  1.00 39.25 ? 429 ASN B OD1 1 
ATOM   7594 N  ND2 . ASN B 1 429 ? 2.752   -22.764 -9.533  1.00 43.83 ? 429 ASN B ND2 1 
ATOM   7595 N  N   . LEU B 1 430 ? 5.754   -20.827 -5.486  1.00 43.06 ? 430 LEU B N   1 
ATOM   7596 C  CA  . LEU B 1 430 ? 6.154   -19.435 -5.290  1.00 40.44 ? 430 LEU B CA  1 
ATOM   7597 C  C   . LEU B 1 430 ? 7.658   -19.261 -5.498  1.00 42.85 ? 430 LEU B C   1 
ATOM   7598 O  O   . LEU B 1 430 ? 8.440   -20.125 -5.106  1.00 43.24 ? 430 LEU B O   1 
ATOM   7599 C  CB  . LEU B 1 430 ? 5.756   -18.953 -3.898  1.00 41.71 ? 430 LEU B CB  1 
ATOM   7600 C  CG  . LEU B 1 430 ? 5.340   -17.482 -3.857  1.00 43.84 ? 430 LEU B CG  1 
ATOM   7601 C  CD1 . LEU B 1 430 ? 3.962   -17.298 -4.492  1.00 42.78 ? 430 LEU B CD1 1 
ATOM   7602 C  CD2 . LEU B 1 430 ? 5.365   -16.939 -2.439  1.00 44.03 ? 430 LEU B CD2 1 
ATOM   7603 N  N   . VAL B 1 431 ? 8.052   -18.147 -6.115  1.00 40.89 ? 431 VAL B N   1 
ATOM   7604 C  CA  . VAL B 1 431 ? 9.454   -17.871 -6.424  1.00 40.37 ? 431 VAL B CA  1 
ATOM   7605 C  C   . VAL B 1 431 ? 10.098  -16.991 -5.367  1.00 42.53 ? 431 VAL B C   1 
ATOM   7606 O  O   . VAL B 1 431 ? 11.321  -16.849 -5.327  1.00 42.23 ? 431 VAL B O   1 
ATOM   7607 C  CB  . VAL B 1 431 ? 9.612   -17.177 -7.788  1.00 45.92 ? 431 VAL B CB  1 
ATOM   7608 C  CG1 . VAL B 1 431 ? 9.174   -18.104 -8.917  1.00 43.45 ? 431 VAL B CG1 1 
ATOM   7609 C  CG2 . VAL B 1 431 ? 8.815   -15.874 -7.805  1.00 44.18 ? 431 VAL B CG2 1 
ATOM   7610 N  N   . TRP B 1 432 ? 9.269   -16.387 -4.523  1.00 38.59 ? 432 TRP B N   1 
ATOM   7611 C  CA  . TRP B 1 432 ? 9.761   -15.600 -3.397  1.00 40.02 ? 432 TRP B CA  1 
ATOM   7612 C  C   . TRP B 1 432 ? 10.104  -16.491 -2.203  1.00 41.40 ? 432 TRP B C   1 
ATOM   7613 O  O   . TRP B 1 432 ? 9.551   -17.585 -2.070  1.00 40.04 ? 432 TRP B O   1 
ATOM   7614 C  CB  . TRP B 1 432 ? 8.724   -14.564 -2.981  1.00 39.04 ? 432 TRP B CB  1 
ATOM   7615 C  CG  . TRP B 1 432 ? 8.381   -13.558 -4.042  1.00 37.38 ? 432 TRP B CG  1 
ATOM   7616 C  CD1 . TRP B 1 432 ? 7.282   -13.561 -4.856  1.00 38.54 ? 432 TRP B CD1 1 
ATOM   7617 C  CD2 . TRP B 1 432 ? 9.127   -12.384 -4.377  1.00 32.94 ? 432 TRP B CD2 1 
ATOM   7618 N  NE1 . TRP B 1 432 ? 7.302   -12.459 -5.679  1.00 34.61 ? 432 TRP B NE1 1 
ATOM   7619 C  CE2 . TRP B 1 432 ? 8.425   -11.721 -5.404  1.00 38.24 ? 432 TRP B CE2 1 
ATOM   7620 C  CE3 . TRP B 1 432 ? 10.316  -11.825 -3.905  1.00 33.81 ? 432 TRP B CE3 1 
ATOM   7621 C  CZ2 . TRP B 1 432 ? 8.886   -10.531 -5.976  1.00 36.22 ? 432 TRP B CZ2 1 
ATOM   7622 C  CZ3 . TRP B 1 432 ? 10.771  -10.647 -4.473  1.00 34.43 ? 432 TRP B CZ3 1 
ATOM   7623 C  CH2 . TRP B 1 432 ? 10.056  -10.013 -5.497  1.00 37.16 ? 432 TRP B CH2 1 
ATOM   7624 N  N   . PRO B 1 433 ? 11.008  -16.015 -1.323  1.00 38.41 ? 433 PRO B N   1 
ATOM   7625 C  CA  . PRO B 1 433 ? 11.454  -16.741 -0.131  1.00 37.27 ? 433 PRO B CA  1 
ATOM   7626 C  C   . PRO B 1 433 ? 10.331  -16.986 0.872   1.00 42.39 ? 433 PRO B C   1 
ATOM   7627 O  O   . PRO B 1 433 ? 9.361   -16.227 0.925   1.00 39.80 ? 433 PRO B O   1 
ATOM   7628 C  CB  . PRO B 1 433 ? 12.505  -15.808 0.475   1.00 38.03 ? 433 PRO B CB  1 
ATOM   7629 C  CG  . PRO B 1 433 ? 12.107  -14.450 0.012   1.00 36.06 ? 433 PRO B CG  1 
ATOM   7630 C  CD  . PRO B 1 433 ? 11.597  -14.666 -1.388  1.00 37.74 ? 433 PRO B CD  1 
ATOM   7631 N  N   . GLU B 1 434 ? 10.490  -18.028 1.680   1.00 41.42 ? 434 GLU B N   1 
ATOM   7632 C  CA  . GLU B 1 434 ? 9.477   -18.417 2.652   1.00 42.54 ? 434 GLU B CA  1 
ATOM   7633 C  C   . GLU B 1 434 ? 9.142   -17.339 3.676   1.00 41.41 ? 434 GLU B C   1 
ATOM   7634 O  O   . GLU B 1 434 ? 8.024   -17.313 4.204   1.00 39.23 ? 434 GLU B O   1 
ATOM   7635 C  CB  . GLU B 1 434 ? 9.922   -19.672 3.399   1.00 45.85 ? 434 GLU B CB  1 
ATOM   7636 C  CG  . GLU B 1 434 ? 10.089  -20.889 2.525   1.00 51.75 ? 434 GLU B CG  1 
ATOM   7637 C  CD  . GLU B 1 434 ? 9.258   -22.056 3.015   1.00 66.37 ? 434 GLU B CD  1 
ATOM   7638 O  OE1 . GLU B 1 434 ? 9.507   -22.532 4.146   1.00 64.56 ? 434 GLU B OE1 1 
ATOM   7639 O  OE2 . GLU B 1 434 ? 8.347   -22.485 2.270   1.00 71.37 ? 434 GLU B OE2 1 
ATOM   7640 N  N   . TRP B 1 435 ? 10.093  -16.462 3.988   1.00 37.09 ? 435 TRP B N   1 
ATOM   7641 C  CA  . TRP B 1 435 ? 9.838   -15.526 5.076   1.00 40.13 ? 435 TRP B CA  1 
ATOM   7642 C  C   . TRP B 1 435 ? 8.759   -14.524 4.676   1.00 37.62 ? 435 TRP B C   1 
ATOM   7643 O  O   . TRP B 1 435 ? 8.054   -13.984 5.534   1.00 39.59 ? 435 TRP B O   1 
ATOM   7644 C  CB  . TRP B 1 435 ? 11.115  -14.800 5.521   1.00 36.45 ? 435 TRP B CB  1 
ATOM   7645 C  CG  . TRP B 1 435 ? 11.676  -13.788 4.557   1.00 37.68 ? 435 TRP B CG  1 
ATOM   7646 C  CD1 . TRP B 1 435 ? 12.751  -13.960 3.717   1.00 36.17 ? 435 TRP B CD1 1 
ATOM   7647 C  CD2 . TRP B 1 435 ? 11.230  -12.435 4.358   1.00 36.05 ? 435 TRP B CD2 1 
ATOM   7648 N  NE1 . TRP B 1 435 ? 12.986  -12.808 3.006   1.00 33.38 ? 435 TRP B NE1 1 
ATOM   7649 C  CE2 . TRP B 1 435 ? 12.069  -11.859 3.373   1.00 33.86 ? 435 TRP B CE2 1 
ATOM   7650 C  CE3 . TRP B 1 435 ? 10.203  -11.659 4.908   1.00 32.19 ? 435 TRP B CE3 1 
ATOM   7651 C  CZ2 . TRP B 1 435 ? 11.913  -10.548 2.935   1.00 33.92 ? 435 TRP B CZ2 1 
ATOM   7652 C  CZ3 . TRP B 1 435 ? 10.050  -10.355 4.474   1.00 30.97 ? 435 TRP B CZ3 1 
ATOM   7653 C  CH2 . TRP B 1 435 ? 10.896  -9.814  3.491   1.00 37.22 ? 435 TRP B CH2 1 
ATOM   7654 N  N   . MET B 1 436 ? 8.618   -14.293 3.379   1.00 37.45 ? 436 MET B N   1 
ATOM   7655 C  CA  . MET B 1 436 ? 7.634   -13.333 2.897   1.00 36.71 ? 436 MET B CA  1 
ATOM   7656 C  C   . MET B 1 436 ? 6.200   -13.856 3.032   1.00 33.37 ? 436 MET B C   1 
ATOM   7657 O  O   . MET B 1 436 ? 5.258   -13.087 2.938   1.00 31.79 ? 436 MET B O   1 
ATOM   7658 C  CB  . MET B 1 436 ? 7.929   -12.958 1.445   1.00 34.69 ? 436 MET B CB  1 
ATOM   7659 C  CG  . MET B 1 436 ? 9.195   -12.122 1.286   1.00 35.11 ? 436 MET B CG  1 
ATOM   7660 S  SD  . MET B 1 436 ? 9.529   -11.693 -0.437  1.00 31.29 ? 436 MET B SD  1 
ATOM   7661 C  CE  . MET B 1 436 ? 8.273   -10.474 -0.780  1.00 29.85 ? 436 MET B CE  1 
ATOM   7662 N  N   . GLY B 1 437 ? 6.051   -15.159 3.244   1.00 31.94 ? 437 GLY B N   1 
ATOM   7663 C  CA  . GLY B 1 437 ? 4.763   -15.755 3.550   1.00 33.02 ? 437 GLY B CA  1 
ATOM   7664 C  C   . GLY B 1 437 ? 3.725   -15.696 2.434   1.00 40.48 ? 437 GLY B C   1 
ATOM   7665 O  O   . GLY B 1 437 ? 3.997   -16.041 1.282   1.00 35.54 ? 437 GLY B O   1 
ATOM   7666 N  N   . VAL B 1 438 ? 2.518   -15.276 2.810   1.00 35.87 ? 438 VAL B N   1 
ATOM   7667 C  CA  . VAL B 1 438 ? 1.410   -15.106 1.893   1.00 33.15 ? 438 VAL B CA  1 
ATOM   7668 C  C   . VAL B 1 438 ? 1.379   -13.671 1.402   1.00 33.71 ? 438 VAL B C   1 
ATOM   7669 O  O   . VAL B 1 438 ? 0.892   -12.777 2.089   1.00 35.23 ? 438 VAL B O   1 
ATOM   7670 C  CB  . VAL B 1 438 ? 0.065   -15.439 2.547   1.00 32.74 ? 438 VAL B CB  1 
ATOM   7671 C  CG1 . VAL B 1 438 ? -1.052  -15.291 1.506   1.00 36.93 ? 438 VAL B CG1 1 
ATOM   7672 C  CG2 . VAL B 1 438 ? 0.096   -16.841 3.106   1.00 31.19 ? 438 VAL B CG2 1 
ATOM   7673 N  N   . ILE B 1 439 ? 1.864   -13.466 0.189   1.00 32.05 ? 439 ILE B N   1 
ATOM   7674 C  CA  . ILE B 1 439 ? 2.282   -12.150 -0.239  1.00 33.33 ? 439 ILE B CA  1 
ATOM   7675 C  C   . ILE B 1 439 ? 1.146   -11.300 -0.795  1.00 31.13 ? 439 ILE B C   1 
ATOM   7676 O  O   . ILE B 1 439 ? 0.166   -11.810 -1.321  1.00 31.76 ? 439 ILE B O   1 
ATOM   7677 C  CB  . ILE B 1 439 ? 3.416   -12.285 -1.291  1.00 34.47 ? 439 ILE B CB  1 
ATOM   7678 C  CG1 . ILE B 1 439 ? 4.605   -13.018 -0.657  1.00 33.07 ? 439 ILE B CG1 1 
ATOM   7679 C  CG2 . ILE B 1 439 ? 3.838   -10.922 -1.828  1.00 32.62 ? 439 ILE B CG2 1 
ATOM   7680 C  CD1 . ILE B 1 439 ? 5.768   -13.216 -1.585  1.00 34.08 ? 439 ILE B CD1 1 
ATOM   7681 N  N   . HIS B 1 440 ? 1.293   -9.995  -0.630  1.00 29.58 ? 440 HIS B N   1 
ATOM   7682 C  CA  . HIS B 1 440 ? 0.423   -9.002  -1.216  1.00 29.51 ? 440 HIS B CA  1 
ATOM   7683 C  C   . HIS B 1 440 ? 0.317   -9.250  -2.736  1.00 36.68 ? 440 HIS B C   1 
ATOM   7684 O  O   . HIS B 1 440 ? 1.309   -9.150  -3.455  1.00 31.31 ? 440 HIS B O   1 
ATOM   7685 C  CB  . HIS B 1 440 ? 0.988   -7.617  -0.903  1.00 29.40 ? 440 HIS B CB  1 
ATOM   7686 C  CG  . HIS B 1 440 ? 0.126   -6.472  -1.332  1.00 33.98 ? 440 HIS B CG  1 
ATOM   7687 N  ND1 . HIS B 1 440 ? -1.102  -6.205  -0.767  1.00 34.79 ? 440 HIS B ND1 1 
ATOM   7688 C  CD2 . HIS B 1 440 ? 0.343   -5.491  -2.243  1.00 34.38 ? 440 HIS B CD2 1 
ATOM   7689 C  CE1 . HIS B 1 440 ? -1.613  -5.117  -1.321  1.00 33.91 ? 440 HIS B CE1 1 
ATOM   7690 N  NE2 . HIS B 1 440 ? -0.752  -4.663  -2.215  1.00 35.68 ? 440 HIS B NE2 1 
ATOM   7691 N  N   . GLY B 1 441 ? -0.878  -9.619  -3.199  1.00 31.81 ? 441 GLY B N   1 
ATOM   7692 C  CA  . GLY B 1 441 ? -1.137  -9.817  -4.615  1.00 33.93 ? 441 GLY B CA  1 
ATOM   7693 C  C   . GLY B 1 441 ? -1.257  -11.265 -5.050  1.00 31.88 ? 441 GLY B C   1 
ATOM   7694 O  O   . GLY B 1 441 ? -1.618  -11.537 -6.176  1.00 31.23 ? 441 GLY B O   1 
ATOM   7695 N  N   . TYR B 1 442 ? -0.975  -12.209 -4.159  1.00 33.25 ? 442 TYR B N   1 
ATOM   7696 C  CA  . TYR B 1 442 ? -0.778  -13.566 -4.639  1.00 30.51 ? 442 TYR B CA  1 
ATOM   7697 C  C   . TYR B 1 442 ? -1.992  -14.445 -4.447  1.00 30.71 ? 442 TYR B C   1 
ATOM   7698 O  O   . TYR B 1 442 ? -1.933  -15.647 -4.645  1.00 32.48 ? 442 TYR B O   1 
ATOM   7699 C  CB  . TYR B 1 442 ? 0.489   -14.156 -4.007  1.00 33.39 ? 442 TYR B CB  1 
ATOM   7700 C  CG  . TYR B 1 442 ? 1.681   -13.683 -4.815  1.00 35.04 ? 442 TYR B CG  1 
ATOM   7701 C  CD1 . TYR B 1 442 ? 2.266   -12.442 -4.577  1.00 34.88 ? 442 TYR B CD1 1 
ATOM   7702 C  CD2 . TYR B 1 442 ? 2.147   -14.430 -5.895  1.00 37.73 ? 442 TYR B CD2 1 
ATOM   7703 C  CE1 . TYR B 1 442 ? 3.327   -11.991 -5.361  1.00 33.23 ? 442 TYR B CE1 1 
ATOM   7704 C  CE2 . TYR B 1 442 ? 3.192   -13.987 -6.680  1.00 38.57 ? 442 TYR B CE2 1 
ATOM   7705 C  CZ  . TYR B 1 442 ? 3.775   -12.774 -6.415  1.00 37.38 ? 442 TYR B CZ  1 
ATOM   7706 O  OH  . TYR B 1 442 ? 4.807   -12.353 -7.218  1.00 38.47 ? 442 TYR B OH  1 
ATOM   7707 N  N   . GLU B 1 443 ? -3.117  -13.826 -4.116  1.00 32.30 ? 443 GLU B N   1 
ATOM   7708 C  CA  . GLU B 1 443 ? -4.394  -14.524 -4.184  1.00 33.01 ? 443 GLU B CA  1 
ATOM   7709 C  C   . GLU B 1 443 ? -5.017  -14.305 -5.568  1.00 33.60 ? 443 GLU B C   1 
ATOM   7710 O  O   . GLU B 1 443 ? -5.950  -15.010 -5.974  1.00 32.42 ? 443 GLU B O   1 
ATOM   7711 C  CB  . GLU B 1 443 ? -5.348  -14.038 -3.104  1.00 29.28 ? 443 GLU B CB  1 
ATOM   7712 C  CG  . GLU B 1 443 ? -6.175  -12.836 -3.518  1.00 32.14 ? 443 GLU B CG  1 
ATOM   7713 C  CD  . GLU B 1 443 ? -5.347  -11.576 -3.704  1.00 36.31 ? 443 GLU B CD  1 
ATOM   7714 O  OE1 . GLU B 1 443 ? -4.167  -11.561 -3.258  1.00 31.26 ? 443 GLU B OE1 1 
ATOM   7715 O  OE2 . GLU B 1 443 ? -5.890  -10.599 -4.288  1.00 32.46 ? 443 GLU B OE2 1 
ATOM   7716 N  N   . ILE B 1 444 ? -4.494  -13.313 -6.280  1.00 32.06 ? 444 ILE B N   1 
ATOM   7717 C  CA  . ILE B 1 444 ? -5.030  -12.944 -7.584  1.00 32.71 ? 444 ILE B CA  1 
ATOM   7718 C  C   . ILE B 1 444 ? -4.985  -14.120 -8.564  1.00 33.35 ? 444 ILE B C   1 
ATOM   7719 O  O   . ILE B 1 444 ? -5.962  -14.390 -9.253  1.00 35.12 ? 444 ILE B O   1 
ATOM   7720 C  CB  . ILE B 1 444 ? -4.283  -11.737 -8.181  1.00 30.64 ? 444 ILE B CB  1 
ATOM   7721 C  CG1 . ILE B 1 444 ? -4.465  -10.512 -7.277  1.00 27.94 ? 444 ILE B CG1 1 
ATOM   7722 C  CG2 . ILE B 1 444 ? -4.812  -11.423 -9.583  1.00 30.60 ? 444 ILE B CG2 1 
ATOM   7723 C  CD1 . ILE B 1 444 ? -3.697  -9.281  -7.723  1.00 28.63 ? 444 ILE B CD1 1 
ATOM   7724 N  N   . GLU B 1 445 ? -3.876  -14.845 -8.603  1.00 34.50 ? 445 GLU B N   1 
ATOM   7725 C  CA  . GLU B 1 445 ? -3.759  -15.969 -9.537  1.00 33.93 ? 445 GLU B CA  1 
ATOM   7726 C  C   . GLU B 1 445 ? -4.796  -17.057 -9.246  1.00 35.22 ? 445 GLU B C   1 
ATOM   7727 O  O   . GLU B 1 445 ? -5.080  -17.889 -10.107 1.00 34.05 ? 445 GLU B O   1 
ATOM   7728 C  CB  . GLU B 1 445 ? -2.342  -16.557 -9.499  1.00 36.68 ? 445 GLU B CB  1 
ATOM   7729 C  CG  . GLU B 1 445 ? -1.816  -16.828 -8.075  1.00 35.26 ? 445 GLU B CG  1 
ATOM   7730 C  CD  . GLU B 1 445 ? -0.293  -16.922 -8.020  1.00 43.16 ? 445 GLU B CD  1 
ATOM   7731 O  OE1 . GLU B 1 445 ? 0.388   -15.877 -8.157  1.00 40.84 ? 445 GLU B OE1 1 
ATOM   7732 O  OE2 . GLU B 1 445 ? 0.221   -18.048 -7.838  1.00 44.44 ? 445 GLU B OE2 1 
ATOM   7733 N  N   . PHE B 1 446 ? -5.354  -17.058 -8.033  1.00 32.77 ? 446 PHE B N   1 
ATOM   7734 C  CA  . PHE B 1 446 ? -6.374  -18.040 -7.676  1.00 32.24 ? 446 PHE B CA  1 
ATOM   7735 C  C   . PHE B 1 446 ? -7.749  -17.554 -8.110  1.00 33.11 ? 446 PHE B C   1 
ATOM   7736 O  O   . PHE B 1 446 ? -8.550  -18.320 -8.652  1.00 32.75 ? 446 PHE B O   1 
ATOM   7737 C  CB  . PHE B 1 446 ? -6.350  -18.340 -6.166  1.00 33.88 ? 446 PHE B CB  1 
ATOM   7738 C  CG  . PHE B 1 446 ? -5.215  -19.232 -5.767  1.00 35.65 ? 446 PHE B CG  1 
ATOM   7739 C  CD1 . PHE B 1 446 ? -3.950  -18.705 -5.520  1.00 34.30 ? 446 PHE B CD1 1 
ATOM   7740 C  CD2 . PHE B 1 446 ? -5.391  -20.601 -5.703  1.00 34.62 ? 446 PHE B CD2 1 
ATOM   7741 C  CE1 . PHE B 1 446 ? -2.898  -19.517 -5.200  1.00 32.81 ? 446 PHE B CE1 1 
ATOM   7742 C  CE2 . PHE B 1 446 ? -4.330  -21.427 -5.378  1.00 39.29 ? 446 PHE B CE2 1 
ATOM   7743 C  CZ  . PHE B 1 446 ? -3.082  -20.881 -5.126  1.00 36.50 ? 446 PHE B CZ  1 
ATOM   7744 N  N   . VAL B 1 447 ? -8.011  -16.275 -7.879  1.00 30.30 ? 447 VAL B N   1 
ATOM   7745 C  CA  . VAL B 1 447 ? -9.251  -15.659 -8.307  1.00 29.78 ? 447 VAL B CA  1 
ATOM   7746 C  C   . VAL B 1 447 ? -9.410  -15.789 -9.828  1.00 31.33 ? 447 VAL B C   1 
ATOM   7747 O  O   . VAL B 1 447 ? -10.525 -15.988 -10.321 1.00 31.67 ? 447 VAL B O   1 
ATOM   7748 C  CB  . VAL B 1 447 ? -9.293  -14.175 -7.877  1.00 31.91 ? 447 VAL B CB  1 
ATOM   7749 C  CG1 . VAL B 1 447 ? -10.417 -13.438 -8.559  1.00 29.56 ? 447 VAL B CG1 1 
ATOM   7750 C  CG2 . VAL B 1 447 ? -9.394  -14.049 -6.329  1.00 34.30 ? 447 VAL B CG2 1 
ATOM   7751 N  N   . PHE B 1 448 ? -8.296  -15.713 -10.561 1.00 31.15 ? 448 PHE B N   1 
ATOM   7752 C  CA  . PHE B 1 448 ? -8.336  -15.762 -12.028 1.00 34.33 ? 448 PHE B CA  1 
ATOM   7753 C  C   . PHE B 1 448 ? -8.082  -17.150 -12.612 1.00 35.98 ? 448 PHE B C   1 
ATOM   7754 O  O   . PHE B 1 448 ? -7.980  -17.301 -13.832 1.00 36.60 ? 448 PHE B O   1 
ATOM   7755 C  CB  . PHE B 1 448 ? -7.341  -14.767 -12.627 1.00 32.06 ? 448 PHE B CB  1 
ATOM   7756 C  CG  . PHE B 1 448 ? -7.872  -13.369 -12.728 1.00 34.32 ? 448 PHE B CG  1 
ATOM   7757 C  CD1 . PHE B 1 448 ? -7.812  -12.510 -11.637 1.00 31.63 ? 448 PHE B CD1 1 
ATOM   7758 C  CD2 . PHE B 1 448 ? -8.435  -12.907 -13.913 1.00 37.57 ? 448 PHE B CD2 1 
ATOM   7759 C  CE1 . PHE B 1 448 ? -8.307  -11.212 -11.722 1.00 32.82 ? 448 PHE B CE1 1 
ATOM   7760 C  CE2 . PHE B 1 448 ? -8.937  -11.607 -14.009 1.00 36.24 ? 448 PHE B CE2 1 
ATOM   7761 C  CZ  . PHE B 1 448 ? -8.870  -10.757 -12.910 1.00 35.89 ? 448 PHE B CZ  1 
ATOM   7762 N  N   . GLY B 1 449 ? -7.978  -18.158 -11.752 1.00 33.02 ? 449 GLY B N   1 
ATOM   7763 C  CA  . GLY B 1 449 ? -7.968  -19.539 -12.212 1.00 35.11 ? 449 GLY B CA  1 
ATOM   7764 C  C   . GLY B 1 449 ? -6.682  -20.086 -12.830 1.00 37.23 ? 449 GLY B C   1 
ATOM   7765 O  O   . GLY B 1 449 ? -6.695  -21.143 -13.463 1.00 38.27 ? 449 GLY B O   1 
ATOM   7766 N  N   . LEU B 1 450 ? -5.568  -19.390 -12.644 1.00 33.55 ? 450 LEU B N   1 
ATOM   7767 C  CA  . LEU B 1 450 ? -4.288  -19.876 -13.152 1.00 35.57 ? 450 LEU B CA  1 
ATOM   7768 C  C   . LEU B 1 450 ? -3.961  -21.319 -12.729 1.00 38.99 ? 450 LEU B C   1 
ATOM   7769 O  O   . LEU B 1 450 ? -3.391  -22.071 -13.510 1.00 41.49 ? 450 LEU B O   1 
ATOM   7770 C  CB  . LEU B 1 450 ? -3.159  -18.941 -12.718 1.00 33.93 ? 450 LEU B CB  1 
ATOM   7771 C  CG  . LEU B 1 450 ? -2.972  -17.669 -13.553 1.00 39.99 ? 450 LEU B CG  1 
ATOM   7772 C  CD1 . LEU B 1 450 ? -2.540  -18.034 -14.941 1.00 42.78 ? 450 LEU B CD1 1 
ATOM   7773 C  CD2 . LEU B 1 450 ? -4.251  -16.862 -13.627 1.00 41.19 ? 450 LEU B CD2 1 
ATOM   7774 N  N   . PRO B 1 451 ? -4.316  -21.716 -11.493 1.00 40.77 ? 451 PRO B N   1 
ATOM   7775 C  CA  . PRO B 1 451 ? -3.993  -23.096 -11.103 1.00 39.78 ? 451 PRO B CA  1 
ATOM   7776 C  C   . PRO B 1 451 ? -4.711  -24.172 -11.927 1.00 42.05 ? 451 PRO B C   1 
ATOM   7777 O  O   . PRO B 1 451 ? -4.383  -25.350 -11.779 1.00 44.44 ? 451 PRO B O   1 
ATOM   7778 C  CB  . PRO B 1 451 ? -4.440  -23.156 -9.632  1.00 36.72 ? 451 PRO B CB  1 
ATOM   7779 C  CG  . PRO B 1 451 ? -4.384  -21.758 -9.165  1.00 37.03 ? 451 PRO B CG  1 
ATOM   7780 C  CD  . PRO B 1 451 ? -4.798  -20.921 -10.347 1.00 33.52 ? 451 PRO B CD  1 
ATOM   7781 N  N   . LEU B 1 452 ? -5.663  -23.782 -12.774 1.00 43.58 ? 452 LEU B N   1 
ATOM   7782 C  CA  . LEU B 1 452 ? -6.341  -24.740 -13.651 1.00 42.33 ? 452 LEU B CA  1 
ATOM   7783 C  C   . LEU B 1 452 ? -5.467  -25.095 -14.843 1.00 43.98 ? 452 LEU B C   1 
ATOM   7784 O  O   . LEU B 1 452 ? -5.699  -26.104 -15.512 1.00 46.02 ? 452 LEU B O   1 
ATOM   7785 C  CB  . LEU B 1 452 ? -7.686  -24.193 -14.135 1.00 42.26 ? 452 LEU B CB  1 
ATOM   7786 C  CG  . LEU B 1 452 ? -8.836  -24.248 -13.127 1.00 42.16 ? 452 LEU B CG  1 
ATOM   7787 C  CD1 . LEU B 1 452 ? -8.476  -23.504 -11.850 1.00 39.78 ? 452 LEU B CD1 1 
ATOM   7788 C  CD2 . LEU B 1 452 ? -10.102 -23.688 -13.715 1.00 40.76 ? 452 LEU B CD2 1 
ATOM   7789 N  N   . VAL B 1 453 ? -4.465  -24.256 -15.101 1.00 43.33 ? 453 VAL B N   1 
ATOM   7790 C  CA  . VAL B 1 453 ? -3.517  -24.472 -16.195 1.00 42.09 ? 453 VAL B CA  1 
ATOM   7791 C  C   . VAL B 1 453 ? -2.424  -25.443 -15.770 1.00 45.82 ? 453 VAL B C   1 
ATOM   7792 O  O   . VAL B 1 453 ? -1.490  -25.057 -15.068 1.00 44.16 ? 453 VAL B O   1 
ATOM   7793 C  CB  . VAL B 1 453 ? -2.849  -23.161 -16.643 1.00 40.26 ? 453 VAL B CB  1 
ATOM   7794 C  CG1 . VAL B 1 453 ? -2.025  -23.395 -17.907 1.00 42.40 ? 453 VAL B CG1 1 
ATOM   7795 C  CG2 . VAL B 1 453 ? -3.882  -22.071 -16.863 1.00 35.99 ? 453 VAL B CG2 1 
ATOM   7796 N  N   . LYS B 1 454 ? -2.532  -26.694 -16.205 1.00 47.95 ? 454 LYS B N   1 
ATOM   7797 C  CA  . LYS B 1 454 ? -1.645  -27.752 -15.714 1.00 52.52 ? 454 LYS B CA  1 
ATOM   7798 C  C   . LYS B 1 454 ? -0.159  -27.465 -15.940 1.00 50.83 ? 454 LYS B C   1 
ATOM   7799 O  O   . LYS B 1 454 ? 0.681   -27.872 -15.133 1.00 53.07 ? 454 LYS B O   1 
ATOM   7800 C  CB  . LYS B 1 454 ? -2.020  -29.090 -16.354 1.00 56.91 ? 454 LYS B CB  1 
ATOM   7801 C  CG  . LYS B 1 454 ? -3.328  -29.672 -15.816 1.00 60.51 ? 454 LYS B CG  1 
ATOM   7802 C  CD  . LYS B 1 454 ? -3.136  -30.433 -14.504 1.00 60.12 ? 454 LYS B CD  1 
ATOM   7803 C  CE  . LYS B 1 454 ? -4.478  -30.708 -13.824 1.00 64.35 ? 454 LYS B CE  1 
ATOM   7804 N  NZ  . LYS B 1 454 ? -5.542  -31.088 -14.809 1.00 62.43 ? 454 LYS B NZ  1 
ATOM   7805 N  N   . GLU B 1 455 ? 0.169   -26.744 -17.007 1.00 46.00 ? 455 GLU B N   1 
ATOM   7806 C  CA  . GLU B 1 455 ? 1.567   -26.410 -17.264 1.00 51.58 ? 455 GLU B CA  1 
ATOM   7807 C  C   . GLU B 1 455 ? 2.158   -25.484 -16.197 1.00 47.49 ? 455 GLU B C   1 
ATOM   7808 O  O   . GLU B 1 455 ? 3.375   -25.386 -16.071 1.00 49.08 ? 455 GLU B O   1 
ATOM   7809 C  CB  . GLU B 1 455 ? 1.734   -25.767 -18.645 1.00 53.14 ? 455 GLU B CB  1 
ATOM   7810 C  CG  . GLU B 1 455 ? 1.490   -26.713 -19.810 1.00 60.68 ? 455 GLU B CG  1 
ATOM   7811 C  CD  . GLU B 1 455 ? 0.039   -26.741 -20.258 1.00 61.96 ? 455 GLU B CD  1 
ATOM   7812 O  OE1 . GLU B 1 455 ? -0.735  -25.861 -19.831 1.00 60.45 ? 455 GLU B OE1 1 
ATOM   7813 O  OE2 . GLU B 1 455 ? -0.328  -27.642 -21.045 1.00 70.93 ? 455 GLU B OE2 1 
ATOM   7814 N  N   . LEU B 1 456 ? 1.310   -24.802 -15.433 1.00 44.99 ? 456 LEU B N   1 
ATOM   7815 C  CA  . LEU B 1 456 ? 1.815   -23.894 -14.405 1.00 46.92 ? 456 LEU B CA  1 
ATOM   7816 C  C   . LEU B 1 456 ? 2.262   -24.651 -13.161 1.00 45.04 ? 456 LEU B C   1 
ATOM   7817 O  O   . LEU B 1 456 ? 2.876   -24.073 -12.267 1.00 44.88 ? 456 LEU B O   1 
ATOM   7818 C  CB  . LEU B 1 456 ? 0.771   -22.844 -14.044 1.00 44.72 ? 456 LEU B CB  1 
ATOM   7819 C  CG  . LEU B 1 456 ? 0.493   -21.887 -15.200 1.00 43.51 ? 456 LEU B CG  1 
ATOM   7820 C  CD1 . LEU B 1 456 ? -0.345  -20.699 -14.750 1.00 43.20 ? 456 LEU B CD1 1 
ATOM   7821 C  CD2 . LEU B 1 456 ? 1.802   -21.425 -15.789 1.00 47.39 ? 456 LEU B CD2 1 
ATOM   7822 N  N   . ASN B 1 457 ? 1.960   -25.946 -13.126 1.00 48.20 ? 457 ASN B N   1 
ATOM   7823 C  CA  . ASN B 1 457 ? 2.447   -26.854 -12.085 1.00 49.04 ? 457 ASN B CA  1 
ATOM   7824 C  C   . ASN B 1 457 ? 1.948   -26.560 -10.665 1.00 50.99 ? 457 ASN B C   1 
ATOM   7825 O  O   . ASN B 1 457 ? 2.683   -26.764 -9.687  1.00 53.71 ? 457 ASN B O   1 
ATOM   7826 C  CB  . ASN B 1 457 ? 3.982   -26.871 -12.076 1.00 53.37 ? 457 ASN B CB  1 
ATOM   7827 C  CG  . ASN B 1 457 ? 4.568   -27.715 -13.203 1.00 58.84 ? 457 ASN B CG  1 
ATOM   7828 O  OD1 . ASN B 1 457 ? 4.016   -28.755 -13.568 1.00 63.40 ? 457 ASN B OD1 1 
ATOM   7829 N  ND2 . ASN B 1 457 ? 5.691   -27.265 -13.760 1.00 59.95 ? 457 ASN B ND2 1 
ATOM   7830 N  N   . TYR B 1 458 ? 0.713   -26.084 -10.537 1.00 44.43 ? 458 TYR B N   1 
ATOM   7831 C  CA  . TYR B 1 458 ? 0.100   -26.004 -9.216  1.00 41.91 ? 458 TYR B CA  1 
ATOM   7832 C  C   . TYR B 1 458 ? -0.348  -27.398 -8.803  1.00 44.67 ? 458 TYR B C   1 
ATOM   7833 O  O   . TYR B 1 458 ? -0.557  -28.260 -9.659  1.00 41.32 ? 458 TYR B O   1 
ATOM   7834 C  CB  . TYR B 1 458 ? -1.098  -25.055 -9.194  1.00 39.23 ? 458 TYR B CB  1 
ATOM   7835 C  CG  . TYR B 1 458 ? -0.789  -23.581 -9.343  1.00 38.04 ? 458 TYR B CG  1 
ATOM   7836 C  CD1 . TYR B 1 458 ? -0.766  -22.980 -10.599 1.00 41.48 ? 458 TYR B CD1 1 
ATOM   7837 C  CD2 . TYR B 1 458 ? -0.569  -22.780 -8.230  1.00 39.48 ? 458 TYR B CD2 1 
ATOM   7838 C  CE1 . TYR B 1 458 ? -0.513  -21.622 -10.743 1.00 37.90 ? 458 TYR B CE1 1 
ATOM   7839 C  CE2 . TYR B 1 458 ? -0.309  -21.423 -8.363  1.00 39.89 ? 458 TYR B CE2 1 
ATOM   7840 C  CZ  . TYR B 1 458 ? -0.284  -20.852 -9.627  1.00 38.08 ? 458 TYR B CZ  1 
ATOM   7841 O  OH  . TYR B 1 458 ? -0.032  -19.508 -9.769  1.00 37.82 ? 458 TYR B OH  1 
ATOM   7842 N  N   . THR B 1 459 ? -0.510  -27.612 -7.495  1.00 43.13 ? 459 THR B N   1 
ATOM   7843 C  CA  . THR B 1 459 ? -0.961  -28.899 -6.976  1.00 40.12 ? 459 THR B CA  1 
ATOM   7844 C  C   . THR B 1 459 ? -2.424  -29.121 -7.312  1.00 42.30 ? 459 THR B C   1 
ATOM   7845 O  O   . THR B 1 459 ? -3.160  -28.165 -7.573  1.00 41.94 ? 459 THR B O   1 
ATOM   7846 C  CB  . THR B 1 459 ? -0.822  -28.994 -5.446  1.00 41.99 ? 459 THR B CB  1 
ATOM   7847 O  OG1 . THR B 1 459 ? -1.758  -28.096 -4.842  1.00 41.46 ? 459 THR B OG1 1 
ATOM   7848 C  CG2 . THR B 1 459 ? 0.580   -28.642 -4.988  1.00 37.81 ? 459 THR B CG2 1 
ATOM   7849 N  N   . ALA B 1 460 ? -2.862  -30.373 -7.255  1.00 39.92 ? 460 ALA B N   1 
ATOM   7850 C  CA  . ALA B 1 460 ? -4.272  -30.669 -7.431  1.00 42.37 ? 460 ALA B CA  1 
ATOM   7851 C  C   . ALA B 1 460 ? -5.132  -29.929 -6.407  1.00 41.28 ? 460 ALA B C   1 
ATOM   7852 O  O   . ALA B 1 460 ? -6.216  -29.461 -6.742  1.00 45.08 ? 460 ALA B O   1 
ATOM   7853 C  CB  . ALA B 1 460 ? -4.521  -32.159 -7.344  1.00 46.51 ? 460 ALA B CB  1 
ATOM   7854 N  N   . GLU B 1 461 ? -4.664  -29.807 -5.165  1.00 42.02 ? 461 GLU B N   1 
ATOM   7855 C  CA  . GLU B 1 461 ? -5.486  -29.137 -4.153  1.00 43.76 ? 461 GLU B CA  1 
ATOM   7856 C  C   . GLU B 1 461 ? -5.483  -27.614 -4.356  1.00 41.40 ? 461 GLU B C   1 
ATOM   7857 O  O   . GLU B 1 461 ? -6.397  -26.920 -3.918  1.00 38.10 ? 461 GLU B O   1 
ATOM   7858 C  CB  . GLU B 1 461 ? -5.039  -29.500 -2.725  1.00 45.09 ? 461 GLU B CB  1 
ATOM   7859 C  CG  . GLU B 1 461 ? -3.539  -29.554 -2.484  1.00 53.07 ? 461 GLU B CG  1 
ATOM   7860 C  CD  . GLU B 1 461 ? -2.931  -30.922 -2.793  1.00 56.57 ? 461 GLU B CD  1 
ATOM   7861 O  OE1 . GLU B 1 461 ? -2.463  -31.587 -1.843  1.00 62.40 ? 461 GLU B OE1 1 
ATOM   7862 O  OE2 . GLU B 1 461 ? -2.909  -31.328 -3.982  1.00 52.04 ? 461 GLU B OE2 1 
ATOM   7863 N  N   . GLU B 1 462 ? -4.475  -27.099 -5.049  1.00 41.54 ? 462 GLU B N   1 
ATOM   7864 C  CA  . GLU B 1 462 ? -4.464  -25.680 -5.388  1.00 41.09 ? 462 GLU B CA  1 
ATOM   7865 C  C   . GLU B 1 462 ? -5.461  -25.372 -6.526  1.00 39.28 ? 462 GLU B C   1 
ATOM   7866 O  O   . GLU B 1 462 ? -6.142  -24.344 -6.498  1.00 35.59 ? 462 GLU B O   1 
ATOM   7867 C  CB  . GLU B 1 462 ? -3.042  -25.226 -5.737  1.00 39.97 ? 462 GLU B CB  1 
ATOM   7868 C  CG  . GLU B 1 462 ? -2.182  -25.016 -4.483  1.00 38.29 ? 462 GLU B CG  1 
ATOM   7869 C  CD  . GLU B 1 462 ? -0.714  -24.743 -4.776  1.00 43.40 ? 462 GLU B CD  1 
ATOM   7870 O  OE1 . GLU B 1 462 ? -0.189  -25.284 -5.779  1.00 40.29 ? 462 GLU B OE1 1 
ATOM   7871 O  OE2 . GLU B 1 462 ? -0.084  -23.992 -3.987  1.00 41.99 ? 462 GLU B OE2 1 
ATOM   7872 N  N   . GLU B 1 463 ? -5.571  -26.275 -7.501  1.00 40.40 ? 463 GLU B N   1 
ATOM   7873 C  CA  . GLU B 1 463 ? -6.629  -26.185 -8.517  1.00 40.11 ? 463 GLU B CA  1 
ATOM   7874 C  C   . GLU B 1 463 ? -8.027  -26.165 -7.878  1.00 39.72 ? 463 GLU B C   1 
ATOM   7875 O  O   . GLU B 1 463 ? -8.897  -25.380 -8.271  1.00 36.41 ? 463 GLU B O   1 
ATOM   7876 C  CB  . GLU B 1 463 ? -6.534  -27.354 -9.507  1.00 39.66 ? 463 GLU B CB  1 
ATOM   7877 C  CG  . GLU B 1 463 ? -7.509  -27.237 -10.675 1.00 47.34 ? 463 GLU B CG  1 
ATOM   7878 C  CD  . GLU B 1 463 ? -7.581  -28.486 -11.541 1.00 46.50 ? 463 GLU B CD  1 
ATOM   7879 O  OE1 . GLU B 1 463 ? -6.566  -29.219 -11.646 1.00 44.83 ? 463 GLU B OE1 1 
ATOM   7880 O  OE2 . GLU B 1 463 ? -8.665  -28.729 -12.114 1.00 44.52 ? 463 GLU B OE2 1 
ATOM   7881 N  N   . ALA B 1 464 ? -8.236  -27.037 -6.892  1.00 39.66 ? 464 ALA B N   1 
ATOM   7882 C  CA  . ALA B 1 464 ? -9.522  -27.127 -6.198  1.00 38.48 ? 464 ALA B CA  1 
ATOM   7883 C  C   . ALA B 1 464 ? -9.820  -25.831 -5.456  1.00 38.18 ? 464 ALA B C   1 
ATOM   7884 O  O   . ALA B 1 464 ? -10.950 -25.342 -5.471  1.00 35.99 ? 464 ALA B O   1 
ATOM   7885 C  CB  . ALA B 1 464 ? -9.538  -28.310 -5.232  1.00 38.18 ? 464 ALA B CB  1 
ATOM   7886 N  N   . LEU B 1 465 ? -8.796  -25.275 -4.819  1.00 37.61 ? 465 LEU B N   1 
ATOM   7887 C  CA  . LEU B 1 465 ? -8.937  -24.011 -4.114  1.00 35.80 ? 465 LEU B CA  1 
ATOM   7888 C  C   . LEU B 1 465 ? -9.326  -22.888 -5.077  1.00 34.62 ? 465 LEU B C   1 
ATOM   7889 O  O   . LEU B 1 465 ? -10.256 -22.133 -4.811  1.00 33.75 ? 465 LEU B O   1 
ATOM   7890 C  CB  . LEU B 1 465 ? -7.642  -23.655 -3.381  1.00 31.84 ? 465 LEU B CB  1 
ATOM   7891 C  CG  . LEU B 1 465 ? -7.640  -22.261 -2.760  1.00 32.13 ? 465 LEU B CG  1 
ATOM   7892 C  CD1 . LEU B 1 465 ? -8.704  -22.163 -1.661  1.00 36.35 ? 465 LEU B CD1 1 
ATOM   7893 C  CD2 . LEU B 1 465 ? -6.268  -21.928 -2.219  1.00 33.67 ? 465 LEU B CD2 1 
ATOM   7894 N  N   . SER B 1 466 ? -8.600  -22.775 -6.189  1.00 36.13 ? 466 SER B N   1 
ATOM   7895 C  CA  . SER B 1 466 ? -8.933  -21.792 -7.216  1.00 36.49 ? 466 SER B CA  1 
ATOM   7896 C  C   . SER B 1 466 ? -10.383 -21.929 -7.681  1.00 34.06 ? 466 SER B C   1 
ATOM   7897 O  O   . SER B 1 466 ? -11.121 -20.944 -7.746  1.00 33.85 ? 466 SER B O   1 
ATOM   7898 C  CB  . SER B 1 466 ? -7.997  -21.919 -8.420  1.00 37.32 ? 466 SER B CB  1 
ATOM   7899 O  OG  . SER B 1 466 ? -8.328  -20.929 -9.383  1.00 34.30 ? 466 SER B OG  1 
ATOM   7900 N  N   . ARG B 1 467 ? -10.807 -23.153 -7.971  1.00 37.18 ? 467 ARG B N   1 
ATOM   7901 C  CA  . ARG B 1 467 ? -12.176 -23.367 -8.446  1.00 36.56 ? 467 ARG B CA  1 
ATOM   7902 C  C   . ARG B 1 467 ? -13.202 -22.929 -7.410  1.00 37.76 ? 467 ARG B C   1 
ATOM   7903 O  O   . ARG B 1 467 ? -14.225 -22.335 -7.768  1.00 36.84 ? 467 ARG B O   1 
ATOM   7904 C  CB  . ARG B 1 467 ? -12.393 -24.831 -8.831  1.00 40.12 ? 467 ARG B CB  1 
ATOM   7905 C  CG  . ARG B 1 467 ? -11.686 -25.230 -10.119 1.00 41.08 ? 467 ARG B CG  1 
ATOM   7906 C  CD  . ARG B 1 467 ? -11.967 -26.681 -10.481 1.00 41.85 ? 467 ARG B CD  1 
ATOM   7907 N  NE  . ARG B 1 467 ? -11.353 -27.039 -11.752 1.00 41.82 ? 467 ARG B NE  1 
ATOM   7908 C  CZ  . ARG B 1 467 ? -11.915 -26.805 -12.934 1.00 45.83 ? 467 ARG B CZ  1 
ATOM   7909 N  NH1 . ARG B 1 467 ? -13.101 -26.210 -13.002 1.00 44.76 ? 467 ARG B NH1 1 
ATOM   7910 N  NH2 . ARG B 1 467 ? -11.290 -27.160 -14.048 1.00 49.02 ? 467 ARG B NH2 1 
ATOM   7911 N  N   . ARG B 1 468 ? -12.918 -23.215 -6.134  1.00 37.61 ? 468 ARG B N   1 
ATOM   7912 C  CA  . ARG B 1 468 ? -13.760 -22.791 -5.002  1.00 36.12 ? 468 ARG B CA  1 
ATOM   7913 C  C   . ARG B 1 468 ? -13.875 -21.264 -4.972  1.00 34.85 ? 468 ARG B C   1 
ATOM   7914 O  O   . ARG B 1 468 ? -14.964 -20.711 -4.835  1.00 35.95 ? 468 ARG B O   1 
ATOM   7915 C  CB  . ARG B 1 468 ? -13.179 -23.293 -3.660  1.00 38.75 ? 468 ARG B CB  1 
ATOM   7916 C  CG  . ARG B 1 468 ? -14.157 -24.082 -2.762  1.00 46.74 ? 468 ARG B CG  1 
ATOM   7917 C  CD  . ARG B 1 468 ? -13.771 -24.137 -1.244  1.00 41.96 ? 468 ARG B CD  1 
ATOM   7918 N  NE  . ARG B 1 468 ? -12.348 -24.354 -0.944  1.00 46.98 ? 468 ARG B NE  1 
ATOM   7919 C  CZ  . ARG B 1 468 ? -11.602 -25.344 -1.441  1.00 50.10 ? 468 ARG B CZ  1 
ATOM   7920 N  NH1 . ARG B 1 468 ? -12.126 -26.233 -2.284  1.00 51.05 ? 468 ARG B NH1 1 
ATOM   7921 N  NH2 . ARG B 1 468 ? -10.321 -25.447 -1.107  1.00 45.42 ? 468 ARG B NH2 1 
ATOM   7922 N  N   . ILE B 1 469 ? -12.733 -20.593 -5.101  1.00 33.25 ? 469 ILE B N   1 
ATOM   7923 C  CA  . ILE B 1 469 ? -12.667 -19.141 -5.037  1.00 30.45 ? 469 ILE B CA  1 
ATOM   7924 C  C   . ILE B 1 469 ? -13.358 -18.489 -6.237  1.00 35.36 ? 469 ILE B C   1 
ATOM   7925 O  O   . ILE B 1 469 ? -14.123 -17.533 -6.069  1.00 34.56 ? 469 ILE B O   1 
ATOM   7926 C  CB  . ILE B 1 469 ? -11.200 -18.649 -4.948  1.00 28.78 ? 469 ILE B CB  1 
ATOM   7927 C  CG1 . ILE B 1 469 ? -10.612 -18.962 -3.557  1.00 33.07 ? 469 ILE B CG1 1 
ATOM   7928 C  CG2 . ILE B 1 469 ? -11.133 -17.157 -5.224  1.00 26.92 ? 469 ILE B CG2 1 
ATOM   7929 C  CD1 . ILE B 1 469 ? -9.110  -18.593 -3.372  1.00 30.59 ? 469 ILE B CD1 1 
ATOM   7930 N  N   . MET B 1 470 ? -13.102 -19.003 -7.442  1.00 32.01 ? 470 MET B N   1 
ATOM   7931 C  CA  . MET B 1 470 ? -13.781 -18.485 -8.626  1.00 32.97 ? 470 MET B CA  1 
ATOM   7932 C  C   . MET B 1 470 ? -15.300 -18.648 -8.484  1.00 34.65 ? 470 MET B C   1 
ATOM   7933 O  O   . MET B 1 470 ? -16.062 -17.746 -8.851  1.00 31.31 ? 470 MET B O   1 
ATOM   7934 C  CB  . MET B 1 470 ? -13.274 -19.178 -9.897  1.00 32.68 ? 470 MET B CB  1 
ATOM   7935 C  CG  . MET B 1 470 ? -11.908 -18.685 -10.393 1.00 29.54 ? 470 MET B CG  1 
ATOM   7936 S  SD  . MET B 1 470 ? -11.514 -19.315 -12.054 1.00 38.27 ? 470 MET B SD  1 
ATOM   7937 C  CE  . MET B 1 470 ? -11.425 -21.067 -11.688 1.00 37.68 ? 470 MET B CE  1 
ATOM   7938 N  N   . HIS B 1 471 ? -15.740 -19.775 -7.922  1.00 32.79 ? 471 HIS B N   1 
ATOM   7939 C  CA  . HIS B 1 471 ? -17.179 -19.997 -7.747  1.00 37.26 ? 471 HIS B CA  1 
ATOM   7940 C  C   . HIS B 1 471 ? -17.777 -19.061 -6.692  1.00 35.78 ? 471 HIS B C   1 
ATOM   7941 O  O   . HIS B 1 471 ? -18.881 -18.552 -6.884  1.00 35.61 ? 471 HIS B O   1 
ATOM   7942 C  CB  . HIS B 1 471 ? -17.492 -21.452 -7.380  1.00 39.09 ? 471 HIS B CB  1 
ATOM   7943 C  CG  . HIS B 1 471 ? -18.925 -21.834 -7.620  1.00 39.14 ? 471 HIS B CG  1 
ATOM   7944 N  ND1 . HIS B 1 471 ? -19.551 -21.654 -8.837  1.00 43.27 ? 471 HIS B ND1 1 
ATOM   7945 C  CD2 . HIS B 1 471 ? -19.853 -22.377 -6.799  1.00 41.91 ? 471 HIS B CD2 1 
ATOM   7946 C  CE1 . HIS B 1 471 ? -20.802 -22.071 -8.756  1.00 43.60 ? 471 HIS B CE1 1 
ATOM   7947 N  NE2 . HIS B 1 471 ? -21.012 -22.510 -7.528  1.00 47.57 ? 471 HIS B NE2 1 
ATOM   7948 N  N   . TYR B 1 472 ? -17.055 -18.831 -5.596  1.00 32.22 ? 472 TYR B N   1 
ATOM   7949 C  CA  . TYR B 1 472 ? -17.468 -17.843 -4.591  1.00 33.66 ? 472 TYR B CA  1 
ATOM   7950 C  C   . TYR B 1 472 ? -17.641 -16.452 -5.205  1.00 31.95 ? 472 TYR B C   1 
ATOM   7951 O  O   . TYR B 1 472 ? -18.666 -15.804 -5.009  1.00 33.37 ? 472 TYR B O   1 
ATOM   7952 C  CB  . TYR B 1 472 ? -16.444 -17.730 -3.453  1.00 31.91 ? 472 TYR B CB  1 
ATOM   7953 C  CG  . TYR B 1 472 ? -16.404 -18.865 -2.449  1.00 36.40 ? 472 TYR B CG  1 
ATOM   7954 C  CD1 . TYR B 1 472 ? -17.536 -19.612 -2.143  1.00 34.93 ? 472 TYR B CD1 1 
ATOM   7955 C  CD2 . TYR B 1 472 ? -15.222 -19.166 -1.782  1.00 37.56 ? 472 TYR B CD2 1 
ATOM   7956 C  CE1 . TYR B 1 472 ? -17.478 -20.639 -1.214  1.00 33.33 ? 472 TYR B CE1 1 
ATOM   7957 C  CE2 . TYR B 1 472 ? -15.155 -20.182 -0.848  1.00 38.91 ? 472 TYR B CE2 1 
ATOM   7958 C  CZ  . TYR B 1 472 ? -16.281 -20.915 -0.564  1.00 38.16 ? 472 TYR B CZ  1 
ATOM   7959 O  OH  . TYR B 1 472 ? -16.188 -21.929 0.362   1.00 35.37 ? 472 TYR B OH  1 
ATOM   7960 N  N   . TRP B 1 473 ? -16.600 -15.981 -5.892  1.00 29.80 ? 473 TRP B N   1 
ATOM   7961 C  CA  . TRP B 1 473 ? -16.618 -14.666 -6.541  1.00 33.65 ? 473 TRP B CA  1 
ATOM   7962 C  C   . TRP B 1 473 ? -17.769 -14.539 -7.553  1.00 33.66 ? 473 TRP B C   1 
ATOM   7963 O  O   . TRP B 1 473 ? -18.524 -13.569 -7.531  1.00 32.00 ? 473 TRP B O   1 
ATOM   7964 C  CB  . TRP B 1 473 ? -15.297 -14.402 -7.259  1.00 27.49 ? 473 TRP B CB  1 
ATOM   7965 C  CG  . TRP B 1 473 ? -14.236 -13.695 -6.455  1.00 33.14 ? 473 TRP B CG  1 
ATOM   7966 C  CD1 . TRP B 1 473 ? -13.527 -12.593 -6.836  1.00 33.42 ? 473 TRP B CD1 1 
ATOM   7967 C  CD2 . TRP B 1 473 ? -13.762 -14.036 -5.138  1.00 29.92 ? 473 TRP B CD2 1 
ATOM   7968 N  NE1 . TRP B 1 473 ? -12.647 -12.228 -5.846  1.00 28.86 ? 473 TRP B NE1 1 
ATOM   7969 C  CE2 . TRP B 1 473 ? -12.769 -13.099 -4.796  1.00 33.09 ? 473 TRP B CE2 1 
ATOM   7970 C  CE3 . TRP B 1 473 ? -14.086 -15.038 -4.216  1.00 31.19 ? 473 TRP B CE3 1 
ATOM   7971 C  CZ2 . TRP B 1 473 ? -12.079 -13.142 -3.565  1.00 33.55 ? 473 TRP B CZ2 1 
ATOM   7972 C  CZ3 . TRP B 1 473 ? -13.404 -15.080 -2.999  1.00 30.76 ? 473 TRP B CZ3 1 
ATOM   7973 C  CH2 . TRP B 1 473 ? -12.418 -14.133 -2.686  1.00 30.79 ? 473 TRP B CH2 1 
ATOM   7974 N  N   . ALA B 1 474 ? -17.884 -15.525 -8.438  1.00 31.79 ? 474 ALA B N   1 
ATOM   7975 C  CA  . ALA B 1 474 ? -18.897 -15.498 -9.489  1.00 33.29 ? 474 ALA B CA  1 
ATOM   7976 C  C   . ALA B 1 474 ? -20.308 -15.663 -8.912  1.00 37.19 ? 474 ALA B C   1 
ATOM   7977 O  O   . ALA B 1 474 ? -21.225 -14.924 -9.286  1.00 36.28 ? 474 ALA B O   1 
ATOM   7978 C  CB  . ALA B 1 474 ? -18.612 -16.572 -10.519 1.00 31.32 ? 474 ALA B CB  1 
ATOM   7979 N  N   . THR B 1 475 ? -20.487 -16.615 -7.998  1.00 35.36 ? 475 THR B N   1 
ATOM   7980 C  CA  . THR B 1 475 ? -21.799 -16.794 -7.376  1.00 33.88 ? 475 THR B CA  1 
ATOM   7981 C  C   . THR B 1 475 ? -22.198 -15.530 -6.615  1.00 33.15 ? 475 THR B C   1 
ATOM   7982 O  O   . THR B 1 475 ? -23.337 -15.089 -6.702  1.00 34.50 ? 475 THR B O   1 
ATOM   7983 C  CB  . THR B 1 475 ? -21.838 -18.010 -6.440  1.00 35.21 ? 475 THR B CB  1 
ATOM   7984 O  OG1 . THR B 1 475 ? -21.481 -19.187 -7.179  1.00 36.58 ? 475 THR B OG1 1 
ATOM   7985 C  CG2 . THR B 1 475 ? -23.240 -18.190 -5.858  1.00 35.56 ? 475 THR B CG2 1 
ATOM   7986 N  N   . PHE B 1 476 ? -21.260 -14.934 -5.887  1.00 35.62 ? 476 PHE B N   1 
ATOM   7987 C  CA  . PHE B 1 476 ? -21.516 -13.644 -5.254  1.00 32.41 ? 476 PHE B CA  1 
ATOM   7988 C  C   . PHE B 1 476 ? -21.924 -12.600 -6.299  1.00 34.28 ? 476 PHE B C   1 
ATOM   7989 O  O   . PHE B 1 476 ? -22.865 -11.827 -6.091  1.00 34.09 ? 476 PHE B O   1 
ATOM   7990 C  CB  . PHE B 1 476 ? -20.286 -13.149 -4.483  1.00 30.83 ? 476 PHE B CB  1 
ATOM   7991 C  CG  . PHE B 1 476 ? -20.432 -11.740 -3.980  1.00 30.03 ? 476 PHE B CG  1 
ATOM   7992 C  CD1 . PHE B 1 476 ? -21.148 -11.476 -2.825  1.00 29.24 ? 476 PHE B CD1 1 
ATOM   7993 C  CD2 . PHE B 1 476 ? -19.887 -10.679 -4.680  1.00 28.10 ? 476 PHE B CD2 1 
ATOM   7994 C  CE1 . PHE B 1 476 ? -21.306 -10.171 -2.361  1.00 31.00 ? 476 PHE B CE1 1 
ATOM   7995 C  CE2 . PHE B 1 476 ? -20.036 -9.378  -4.229  1.00 28.49 ? 476 PHE B CE2 1 
ATOM   7996 C  CZ  . PHE B 1 476 ? -20.753 -9.119  -3.065  1.00 29.98 ? 476 PHE B CZ  1 
ATOM   7997 N  N   . ALA B 1 477 ? -21.204 -12.575 -7.420  1.00 32.51 ? 477 ALA B N   1 
ATOM   7998 C  CA  . ALA B 1 477 ? -21.501 -11.629 -8.488  1.00 34.72 ? 477 ALA B CA  1 
ATOM   7999 C  C   . ALA B 1 477 ? -22.935 -11.805 -8.983  1.00 35.56 ? 477 ALA B C   1 
ATOM   8000 O  O   . ALA B 1 477 ? -23.647 -10.821 -9.180  1.00 37.02 ? 477 ALA B O   1 
ATOM   8001 C  CB  . ALA B 1 477 ? -20.496 -11.786 -9.663  1.00 31.61 ? 477 ALA B CB  1 
ATOM   8002 N  N   . LYS B 1 478 ? -23.362 -13.056 -9.159  1.00 33.96 ? 478 LYS B N   1 
ATOM   8003 C  CA  . LYS B 1 478 ? -24.693 -13.340 -9.700  1.00 37.71 ? 478 LYS B CA  1 
ATOM   8004 C  C   . LYS B 1 478 ? -25.833 -13.037 -8.725  1.00 40.10 ? 478 LYS B C   1 
ATOM   8005 O  O   . LYS B 1 478 ? -26.902 -12.596 -9.138  1.00 40.12 ? 478 LYS B O   1 
ATOM   8006 C  CB  . LYS B 1 478 ? -24.795 -14.806 -10.141 1.00 39.23 ? 478 LYS B CB  1 
ATOM   8007 C  CG  . LYS B 1 478 ? -23.818 -15.210 -11.253 1.00 45.61 ? 478 LYS B CG  1 
ATOM   8008 C  CD  . LYS B 1 478 ? -24.328 -16.415 -12.044 1.00 51.78 ? 478 LYS B CD  1 
ATOM   8009 C  CE  . LYS B 1 478 ? -23.323 -16.893 -13.095 1.00 48.94 ? 478 LYS B CE  1 
ATOM   8010 N  NZ  . LYS B 1 478 ? -22.209 -17.672 -12.481 1.00 44.75 ? 478 LYS B NZ  1 
ATOM   8011 N  N   . THR B 1 479 ? -25.591 -13.254 -7.433  1.00 38.15 ? 479 THR B N   1 
ATOM   8012 C  CA  . THR B 1 479 ? -26.668 -13.313 -6.444  1.00 36.39 ? 479 THR B CA  1 
ATOM   8013 C  C   . THR B 1 479 ? -26.442 -12.473 -5.187  1.00 36.57 ? 479 THR B C   1 
ATOM   8014 O  O   . THR B 1 479 ? -27.369 -12.249 -4.435  1.00 35.97 ? 479 THR B O   1 
ATOM   8015 C  CB  . THR B 1 479 ? -26.889 -14.749 -5.978  1.00 37.58 ? 479 THR B CB  1 
ATOM   8016 O  OG1 . THR B 1 479 ? -25.795 -15.138 -5.128  1.00 33.17 ? 479 THR B OG1 1 
ATOM   8017 C  CG2 . THR B 1 479 ? -26.977 -15.679 -7.172  1.00 32.02 ? 479 THR B CG2 1 
ATOM   8018 N  N   . GLY B 1 480 ? -25.211 -12.041 -4.950  1.00 37.15 ? 480 GLY B N   1 
ATOM   8019 C  CA  . GLY B 1 480 ? -24.892 -11.248 -3.775  1.00 33.94 ? 480 GLY B CA  1 
ATOM   8020 C  C   . GLY B 1 480 ? -24.549 -12.128 -2.589  1.00 31.80 ? 480 GLY B C   1 
ATOM   8021 O  O   . GLY B 1 480 ? -24.534 -11.678 -1.442  1.00 31.45 ? 480 GLY B O   1 
ATOM   8022 N  N   . ASN B 1 481 ? -24.283 -13.396 -2.879  1.00 31.85 ? 481 ASN B N   1 
ATOM   8023 C  CA  . ASN B 1 481 ? -24.024 -14.403 -1.864  1.00 32.22 ? 481 ASN B CA  1 
ATOM   8024 C  C   . ASN B 1 481 ? -23.089 -15.442 -2.444  1.00 34.31 ? 481 ASN B C   1 
ATOM   8025 O  O   . ASN B 1 481 ? -23.400 -16.038 -3.475  1.00 38.54 ? 481 ASN B O   1 
ATOM   8026 C  CB  . ASN B 1 481 ? -25.336 -15.039 -1.397  1.00 37.92 ? 481 ASN B CB  1 
ATOM   8027 C  CG  . ASN B 1 481 ? -25.175 -15.912 -0.153  1.00 36.67 ? 481 ASN B CG  1 
ATOM   8028 O  OD1 . ASN B 1 481 ? -24.117 -16.491 0.099   1.00 38.88 ? 481 ASN B OD1 1 
ATOM   8029 N  ND2 . ASN B 1 481 ? -26.248 -16.029 0.612   1.00 35.64 ? 481 ASN B ND2 1 
ATOM   8030 N  N   . PRO B 1 482 ? -21.925 -15.649 -1.803  1.00 33.62 ? 482 PRO B N   1 
ATOM   8031 C  CA  . PRO B 1 482 ? -20.915 -16.541 -2.388  1.00 31.65 ? 482 PRO B CA  1 
ATOM   8032 C  C   . PRO B 1 482 ? -21.355 -17.989 -2.312  1.00 34.55 ? 482 PRO B C   1 
ATOM   8033 O  O   . PRO B 1 482 ? -20.801 -18.846 -3.003  1.00 36.97 ? 482 PRO B O   1 
ATOM   8034 C  CB  . PRO B 1 482 ? -19.676 -16.289 -1.524  1.00 32.73 ? 482 PRO B CB  1 
ATOM   8035 C  CG  . PRO B 1 482 ? -20.235 -15.880 -0.175  1.00 34.89 ? 482 PRO B CG  1 
ATOM   8036 C  CD  . PRO B 1 482 ? -21.518 -15.125 -0.480  1.00 33.51 ? 482 PRO B CD  1 
ATOM   8037 N  N   . ASN B 1 483 ? -22.357 -18.243 -1.475  1.00 34.44 ? 483 ASN B N   1 
ATOM   8038 C  CA  . ASN B 1 483 ? -22.897 -19.579 -1.276  1.00 37.17 ? 483 ASN B CA  1 
ATOM   8039 C  C   . ASN B 1 483 ? -24.039 -19.894 -2.227  1.00 41.35 ? 483 ASN B C   1 
ATOM   8040 O  O   . ASN B 1 483 ? -24.845 -19.024 -2.546  1.00 40.05 ? 483 ASN B O   1 
ATOM   8041 C  CB  . ASN B 1 483 ? -23.410 -19.741 0.161   1.00 34.82 ? 483 ASN B CB  1 
ATOM   8042 C  CG  . ASN B 1 483 ? -22.341 -19.466 1.198   1.00 35.51 ? 483 ASN B CG  1 
ATOM   8043 O  OD1 . ASN B 1 483 ? -21.395 -20.232 1.337   1.00 36.05 ? 483 ASN B OD1 1 
ATOM   8044 N  ND2 . ASN B 1 483 ? -22.493 -18.375 1.936   1.00 34.06 ? 483 ASN B ND2 1 
ATOM   8045 N  N   . GLU B 1 484 ? -24.118 -21.147 -2.649  1.00 43.20 ? 484 GLU B N   1 
ATOM   8046 C  CA  . GLU B 1 484 ? -25.331 -21.673 -3.258  1.00 50.12 ? 484 GLU B CA  1 
ATOM   8047 C  C   . GLU B 1 484 ? -26.179 -22.331 -2.185  1.00 60.03 ? 484 GLU B C   1 
ATOM   8048 O  O   . GLU B 1 484 ? -25.849 -23.426 -1.742  1.00 63.24 ? 484 GLU B O   1 
ATOM   8049 C  CB  . GLU B 1 484 ? -24.993 -22.684 -4.353  1.00 53.72 ? 484 GLU B CB  1 
ATOM   8050 C  CG  . GLU B 1 484 ? -24.575 -22.051 -5.659  1.00 48.67 ? 484 GLU B CG  1 
ATOM   8051 C  CD  . GLU B 1 484 ? -24.084 -23.071 -6.666  1.00 56.69 ? 484 GLU B CD  1 
ATOM   8052 O  OE1 . GLU B 1 484 ? -23.763 -24.210 -6.261  1.00 58.78 ? 484 GLU B OE1 1 
ATOM   8053 O  OE2 . GLU B 1 484 ? -24.010 -22.729 -7.867  1.00 61.50 ? 484 GLU B OE2 1 
ATOM   8054 N  N   . PRO B 1 485 ? -27.263 -21.668 -1.738  1.00 66.45 ? 485 PRO B N   1 
ATOM   8055 C  CA  . PRO B 1 485 ? -28.124 -22.407 -0.806  1.00 68.34 ? 485 PRO B CA  1 
ATOM   8056 C  C   . PRO B 1 485 ? -28.692 -23.640 -1.504  1.00 73.71 ? 485 PRO B C   1 
ATOM   8057 O  O   . PRO B 1 485 ? -28.666 -23.698 -2.738  1.00 77.06 ? 485 PRO B O   1 
ATOM   8058 C  CB  . PRO B 1 485 ? -29.219 -21.397 -0.443  1.00 65.50 ? 485 PRO B CB  1 
ATOM   8059 C  CG  . PRO B 1 485 ? -29.235 -20.430 -1.583  1.00 67.47 ? 485 PRO B CG  1 
ATOM   8060 C  CD  . PRO B 1 485 ? -27.805 -20.336 -2.058  1.00 65.05 ? 485 PRO B CD  1 
ATOM   8061 N  N   . HIS B 1 486 ? -29.176 -24.605 -0.726  1.00 80.92 ? 486 HIS B N   1 
ATOM   8062 C  CA  . HIS B 1 486 ? -29.583 -25.918 -1.236  1.00 82.93 ? 486 HIS B CA  1 
ATOM   8063 C  C   . HIS B 1 486 ? -28.368 -26.786 -1.556  1.00 79.32 ? 486 HIS B C   1 
ATOM   8064 O  O   . HIS B 1 486 ? -28.513 -27.973 -1.849  1.00 82.73 ? 486 HIS B O   1 
ATOM   8065 C  CB  . HIS B 1 486 ? -30.472 -25.796 -2.480  1.00 83.95 ? 486 HIS B CB  1 
ATOM   8066 C  CG  . HIS B 1 486 ? -31.753 -25.058 -2.244  1.00 88.37 ? 486 HIS B CG  1 
ATOM   8067 N  ND1 . HIS B 1 486 ? -32.513 -24.543 -3.272  1.00 92.19 ? 486 HIS B ND1 1 
ATOM   8068 C  CD2 . HIS B 1 486 ? -32.407 -24.747 -1.098  1.00 88.34 ? 486 HIS B CD2 1 
ATOM   8069 C  CE1 . HIS B 1 486 ? -33.580 -23.945 -2.771  1.00 92.62 ? 486 HIS B CE1 1 
ATOM   8070 N  NE2 . HIS B 1 486 ? -33.540 -24.055 -1.455  1.00 94.86 ? 486 HIS B NE2 1 
ATOM   8071 N  N   . SER B 1 487 ? -27.174 -26.197 -1.496  1.00 74.48 ? 487 SER B N   1 
ATOM   8072 C  CA  . SER B 1 487 ? -25.942 -26.950 -1.722  1.00 69.92 ? 487 SER B CA  1 
ATOM   8073 C  C   . SER B 1 487 ? -25.514 -27.694 -0.471  1.00 70.10 ? 487 SER B C   1 
ATOM   8074 O  O   . SER B 1 487 ? -26.014 -27.438 0.621   1.00 72.26 ? 487 SER B O   1 
ATOM   8075 C  CB  . SER B 1 487 ? -24.805 -26.035 -2.163  1.00 68.96 ? 487 SER B CB  1 
ATOM   8076 O  OG  . SER B 1 487 ? -23.844 -25.912 -1.125  1.00 65.19 ? 487 SER B OG  1 
ATOM   8077 N  N   . GLN B 1 488 ? -24.558 -28.598 -0.639  1.00 69.79 ? 488 GLN B N   1 
ATOM   8078 C  CA  . GLN B 1 488 ? -24.111 -29.451 0.449   1.00 69.70 ? 488 GLN B CA  1 
ATOM   8079 C  C   . GLN B 1 488 ? -22.847 -28.934 1.145   1.00 65.63 ? 488 GLN B C   1 
ATOM   8080 O  O   . GLN B 1 488 ? -22.586 -29.291 2.289   1.00 66.49 ? 488 GLN B O   1 
ATOM   8081 C  CB  . GLN B 1 488 ? -23.867 -30.869 -0.076  1.00 70.91 ? 488 GLN B CB  1 
ATOM   8082 C  CG  . GLN B 1 488 ? -25.068 -31.487 -0.763  1.00 71.39 ? 488 GLN B CG  1 
ATOM   8083 C  CD  . GLN B 1 488 ? -26.265 -31.605 0.161   1.00 78.70 ? 488 GLN B CD  1 
ATOM   8084 O  OE1 . GLN B 1 488 ? -26.144 -32.056 1.303   1.00 79.28 ? 488 GLN B OE1 1 
ATOM   8085 N  NE2 . GLN B 1 488 ? -27.431 -31.193 -0.327  1.00 82.75 ? 488 GLN B NE2 1 
ATOM   8086 N  N   . GLU B 1 489 ? -22.063 -28.102 0.460   1.00 66.05 ? 489 GLU B N   1 
ATOM   8087 C  CA  . GLU B 1 489 ? -20.770 -27.667 0.997   1.00 64.00 ? 489 GLU B CA  1 
ATOM   8088 C  C   . GLU B 1 489 ? -20.917 -26.696 2.154   1.00 56.61 ? 489 GLU B C   1 
ATOM   8089 O  O   . GLU B 1 489 ? -21.985 -26.133 2.374   1.00 54.84 ? 489 GLU B O   1 
ATOM   8090 C  CB  . GLU B 1 489 ? -19.902 -27.017 -0.087  1.00 63.95 ? 489 GLU B CB  1 
ATOM   8091 C  CG  . GLU B 1 489 ? -19.386 -27.971 -1.141  1.00 58.58 ? 489 GLU B CG  1 
ATOM   8092 C  CD  . GLU B 1 489 ? -20.477 -28.409 -2.070  1.00 69.45 ? 489 GLU B CD  1 
ATOM   8093 O  OE1 . GLU B 1 489 ? -21.559 -27.780 -2.036  1.00 71.92 ? 489 GLU B OE1 1 
ATOM   8094 O  OE2 . GLU B 1 489 ? -20.263 -29.378 -2.828  1.00 78.37 ? 489 GLU B OE2 1 
ATOM   8095 N  N   . SER B 1 490 ? -19.815 -26.512 2.876   1.00 55.38 ? 490 SER B N   1 
ATOM   8096 C  CA  . SER B 1 490 ? -19.736 -25.591 4.003   1.00 50.31 ? 490 SER B CA  1 
ATOM   8097 C  C   . SER B 1 490 ? -20.152 -24.188 3.594   1.00 45.01 ? 490 SER B C   1 
ATOM   8098 O  O   . SER B 1 490 ? -19.830 -23.726 2.506   1.00 46.75 ? 490 SER B O   1 
ATOM   8099 C  CB  . SER B 1 490 ? -18.314 -25.566 4.569   1.00 52.22 ? 490 SER B CB  1 
ATOM   8100 O  OG  . SER B 1 490 ? -17.798 -26.874 4.719   1.00 56.13 ? 490 SER B OG  1 
ATOM   8101 N  N   . LYS B 1 491 ? -20.856 -23.505 4.482   1.00 45.44 ? 491 LYS B N   1 
ATOM   8102 C  CA  . LYS B 1 491 ? -21.418 -22.206 4.154   1.00 45.10 ? 491 LYS B CA  1 
ATOM   8103 C  C   . LYS B 1 491 ? -20.551 -21.077 4.691   1.00 44.91 ? 491 LYS B C   1 
ATOM   8104 O  O   . LYS B 1 491 ? -20.132 -21.095 5.854   1.00 45.27 ? 491 LYS B O   1 
ATOM   8105 C  CB  . LYS B 1 491 ? -22.844 -22.095 4.705   1.00 46.58 ? 491 LYS B CB  1 
ATOM   8106 C  CG  . LYS B 1 491 ? -23.847 -23.065 4.073   1.00 46.76 ? 491 LYS B CG  1 
ATOM   8107 C  CD  . LYS B 1 491 ? -24.193 -22.651 2.651   1.00 50.28 ? 491 LYS B CD  1 
ATOM   8108 C  CE  . LYS B 1 491 ? -25.355 -23.471 2.093   1.00 56.09 ? 491 LYS B CE  1 
ATOM   8109 N  NZ  . LYS B 1 491 ? -25.067 -24.932 2.164   1.00 59.33 ? 491 LYS B NZ  1 
ATOM   8110 N  N   . TRP B 1 492 ? -20.276 -20.101 3.833   1.00 40.68 ? 492 TRP B N   1 
ATOM   8111 C  CA  . TRP B 1 492 ? -19.527 -18.908 4.214   1.00 36.18 ? 492 TRP B CA  1 
ATOM   8112 C  C   . TRP B 1 492 ? -20.511 -17.934 4.838   1.00 37.09 ? 492 TRP B C   1 
ATOM   8113 O  O   . TRP B 1 492 ? -21.398 -17.424 4.150   1.00 38.95 ? 492 TRP B O   1 
ATOM   8114 C  CB  . TRP B 1 492 ? -18.822 -18.324 2.980   1.00 34.59 ? 492 TRP B CB  1 
ATOM   8115 C  CG  . TRP B 1 492 ? -18.014 -17.040 3.142   1.00 34.07 ? 492 TRP B CG  1 
ATOM   8116 C  CD1 . TRP B 1 492 ? -17.955 -16.212 4.235   1.00 34.76 ? 492 TRP B CD1 1 
ATOM   8117 C  CD2 . TRP B 1 492 ? -17.160 -16.450 2.151   1.00 32.96 ? 492 TRP B CD2 1 
ATOM   8118 N  NE1 . TRP B 1 492 ? -17.119 -15.147 3.980   1.00 32.76 ? 492 TRP B NE1 1 
ATOM   8119 C  CE2 . TRP B 1 492 ? -16.618 -15.272 2.709   1.00 32.79 ? 492 TRP B CE2 1 
ATOM   8120 C  CE3 . TRP B 1 492 ? -16.817 -16.796 0.836   1.00 34.75 ? 492 TRP B CE3 1 
ATOM   8121 C  CZ2 . TRP B 1 492 ? -15.748 -14.442 1.999   1.00 30.63 ? 492 TRP B CZ2 1 
ATOM   8122 C  CZ3 . TRP B 1 492 ? -15.942 -15.976 0.132   1.00 33.39 ? 492 TRP B CZ3 1 
ATOM   8123 C  CH2 . TRP B 1 492 ? -15.419 -14.813 0.718   1.00 36.41 ? 492 TRP B CH2 1 
ATOM   8124 N  N   . PRO B 1 493 ? -20.387 -17.699 6.157   1.00 35.38 ? 493 PRO B N   1 
ATOM   8125 C  CA  . PRO B 1 493 ? -21.398 -16.900 6.853   1.00 36.60 ? 493 PRO B CA  1 
ATOM   8126 C  C   . PRO B 1 493 ? -21.227 -15.409 6.656   1.00 35.54 ? 493 PRO B C   1 
ATOM   8127 O  O   . PRO B 1 493 ? -20.104 -14.922 6.485   1.00 30.51 ? 493 PRO B O   1 
ATOM   8128 C  CB  . PRO B 1 493 ? -21.191 -17.271 8.326   1.00 37.05 ? 493 PRO B CB  1 
ATOM   8129 C  CG  . PRO B 1 493 ? -19.742 -17.635 8.401   1.00 38.80 ? 493 PRO B CG  1 
ATOM   8130 C  CD  . PRO B 1 493 ? -19.425 -18.311 7.087   1.00 34.68 ? 493 PRO B CD  1 
ATOM   8131 N  N   . LEU B 1 494 ? -22.357 -14.706 6.685   1.00 33.52 ? 494 LEU B N   1 
ATOM   8132 C  CA  . LEU B 1 494 ? -22.380 -13.257 6.690   1.00 34.46 ? 494 LEU B CA  1 
ATOM   8133 C  C   . LEU B 1 494 ? -21.556 -12.671 7.832   1.00 37.24 ? 494 LEU B C   1 
ATOM   8134 O  O   . LEU B 1 494 ? -21.667 -13.107 8.983   1.00 38.21 ? 494 LEU B O   1 
ATOM   8135 C  CB  . LEU B 1 494 ? -23.821 -12.749 6.801   1.00 32.28 ? 494 LEU B CB  1 
ATOM   8136 C  CG  . LEU B 1 494 ? -24.720 -12.719 5.563   1.00 37.17 ? 494 LEU B CG  1 
ATOM   8137 C  CD1 . LEU B 1 494 ? -26.180 -12.541 5.985   1.00 39.65 ? 494 LEU B CD1 1 
ATOM   8138 C  CD2 . LEU B 1 494 ? -24.303 -11.590 4.642   1.00 35.82 ? 494 LEU B CD2 1 
ATOM   8139 N  N   . PHE B 1 495 ? -20.735 -11.681 7.507   1.00 34.54 ? 495 PHE B N   1 
ATOM   8140 C  CA  . PHE B 1 495 ? -20.160 -10.815 8.517   1.00 35.14 ? 495 PHE B CA  1 
ATOM   8141 C  C   . PHE B 1 495 ? -21.269 -9.948  9.107   1.00 37.94 ? 495 PHE B C   1 
ATOM   8142 O  O   . PHE B 1 495 ? -21.947 -9.222  8.380   1.00 35.01 ? 495 PHE B O   1 
ATOM   8143 C  CB  . PHE B 1 495 ? -19.067 -9.939  7.910   1.00 33.89 ? 495 PHE B CB  1 
ATOM   8144 C  CG  . PHE B 1 495 ? -18.417 -9.016  8.888   1.00 33.84 ? 495 PHE B CG  1 
ATOM   8145 C  CD1 . PHE B 1 495 ? -18.990 -7.793  9.193   1.00 33.49 ? 495 PHE B CD1 1 
ATOM   8146 C  CD2 . PHE B 1 495 ? -17.219 -9.366  9.500   1.00 33.74 ? 495 PHE B CD2 1 
ATOM   8147 C  CE1 . PHE B 1 495 ? -18.383 -6.933  10.105  1.00 33.41 ? 495 PHE B CE1 1 
ATOM   8148 C  CE2 . PHE B 1 495 ? -16.605 -8.506  10.412  1.00 32.21 ? 495 PHE B CE2 1 
ATOM   8149 C  CZ  . PHE B 1 495 ? -17.183 -7.293  10.703  1.00 33.62 ? 495 PHE B CZ  1 
ATOM   8150 N  N   . THR B 1 496 ? -21.450 -10.012 10.421  1.00 35.52 ? 496 THR B N   1 
ATOM   8151 C  CA  . THR B 1 496 ? -22.444 -9.180  11.083  1.00 36.19 ? 496 THR B CA  1 
ATOM   8152 C  C   . THR B 1 496 ? -21.791 -8.294  12.132  1.00 37.25 ? 496 THR B C   1 
ATOM   8153 O  O   . THR B 1 496 ? -20.708 -8.613  12.642  1.00 34.05 ? 496 THR B O   1 
ATOM   8154 C  CB  . THR B 1 496 ? -23.524 -10.032 11.738  1.00 37.93 ? 496 THR B CB  1 
ATOM   8155 O  OG1 . THR B 1 496 ? -22.914 -10.911 12.686  1.00 34.02 ? 496 THR B OG1 1 
ATOM   8156 C  CG2 . THR B 1 496 ? -24.247 -10.866 10.671  1.00 36.50 ? 496 THR B CG2 1 
ATOM   8157 N  N   . THR B 1 497 ? -22.444 -7.183  12.454  1.00 37.33 ? 497 THR B N   1 
ATOM   8158 C  CA  . THR B 1 497 ? -21.885 -6.239  13.422  1.00 40.22 ? 497 THR B CA  1 
ATOM   8159 C  C   . THR B 1 497 ? -21.583 -6.886  14.771  1.00 40.19 ? 497 THR B C   1 
ATOM   8160 O  O   . THR B 1 497 ? -20.597 -6.544  15.429  1.00 40.42 ? 497 THR B O   1 
ATOM   8161 C  CB  . THR B 1 497 ? -22.819 -5.060  13.682  1.00 40.23 ? 497 THR B CB  1 
ATOM   8162 O  OG1 . THR B 1 497 ? -22.962 -4.281  12.490  1.00 42.55 ? 497 THR B OG1 1 
ATOM   8163 C  CG2 . THR B 1 497 ? -22.246 -4.186  14.796  1.00 38.75 ? 497 THR B CG2 1 
ATOM   8164 N  N   . LYS B 1 498 ? -22.431 -7.827  15.168  1.00 40.14 ? 498 LYS B N   1 
ATOM   8165 C  CA  . LYS B 1 498 ? -22.324 -8.442  16.482  1.00 41.24 ? 498 LYS B CA  1 
ATOM   8166 C  C   . LYS B 1 498 ? -21.292 -9.552  16.472  1.00 42.45 ? 498 LYS B C   1 
ATOM   8167 O  O   . LYS B 1 498 ? -20.431 -9.609  17.354  1.00 46.91 ? 498 LYS B O   1 
ATOM   8168 C  CB  . LYS B 1 498 ? -23.678 -8.994  16.946  1.00 38.60 ? 498 LYS B CB  1 
ATOM   8169 C  CG  . LYS B 1 498 ? -23.634 -9.593  18.354  1.00 48.89 ? 498 LYS B CG  1 
ATOM   8170 C  CD  . LYS B 1 498 ? -24.987 -10.153 18.785  1.00 48.14 ? 498 LYS B CD  1 
ATOM   8171 C  CE  . LYS B 1 498 ? -24.938 -10.685 20.221  1.00 54.67 ? 498 LYS B CE  1 
ATOM   8172 N  NZ  . LYS B 1 498 ? -26.174 -11.451 20.586  1.00 57.07 ? 498 LYS B NZ  1 
ATOM   8173 N  N   . GLU B 1 499 ? -21.369 -10.437 15.483  1.00 36.73 ? 499 GLU B N   1 
ATOM   8174 C  CA  . GLU B 1 499 ? -20.539 -11.638 15.530  1.00 39.88 ? 499 GLU B CA  1 
ATOM   8175 C  C   . GLU B 1 499 ? -19.266 -11.531 14.682  1.00 37.67 ? 499 GLU B C   1 
ATOM   8176 O  O   . GLU B 1 499 ? -18.298 -12.236 14.938  1.00 36.22 ? 499 GLU B O   1 
ATOM   8177 C  CB  . GLU B 1 499 ? -21.359 -12.859 15.114  1.00 42.03 ? 499 GLU B CB  1 
ATOM   8178 C  CG  . GLU B 1 499 ? -22.639 -13.041 15.938  1.00 44.77 ? 499 GLU B CG  1 
ATOM   8179 C  CD  . GLU B 1 499 ? -23.277 -14.410 15.744  1.00 52.18 ? 499 GLU B CD  1 
ATOM   8180 O  OE1 . GLU B 1 499 ? -23.896 -14.638 14.685  1.00 58.39 ? 499 GLU B OE1 1 
ATOM   8181 O  OE2 . GLU B 1 499 ? -23.155 -15.267 16.648  1.00 58.31 ? 499 GLU B OE2 1 
ATOM   8182 N  N   . GLN B 1 500 ? -19.275 -10.657 13.676  1.00 37.16 ? 500 GLN B N   1 
ATOM   8183 C  CA  . GLN B 1 500 ? -18.063 -10.341 12.924  1.00 35.75 ? 500 GLN B CA  1 
ATOM   8184 C  C   . GLN B 1 500 ? -17.328 -11.579 12.403  1.00 34.79 ? 500 GLN B C   1 
ATOM   8185 O  O   . GLN B 1 500 ? -16.099 -11.645 12.461  1.00 33.51 ? 500 GLN B O   1 
ATOM   8186 C  CB  . GLN B 1 500 ? -17.123 -9.504  13.805  1.00 36.61 ? 500 GLN B CB  1 
ATOM   8187 C  CG  . GLN B 1 500 ? -17.775 -8.209  14.284  1.00 37.16 ? 500 GLN B CG  1 
ATOM   8188 C  CD  . GLN B 1 500 ? -17.002 -7.505  15.394  1.00 39.95 ? 500 GLN B CD  1 
ATOM   8189 O  OE1 . GLN B 1 500 ? -15.857 -7.101  15.210  1.00 35.22 ? 500 GLN B OE1 1 
ATOM   8190 N  NE2 . GLN B 1 500 ? -17.648 -7.329  16.546  1.00 41.98 ? 500 GLN B NE2 1 
ATOM   8191 N  N   . LYS B 1 501 ? -18.082 -12.558 11.907  1.00 32.05 ? 501 LYS B N   1 
ATOM   8192 C  CA  . LYS B 1 501 ? -17.485 -13.780 11.383  1.00 33.34 ? 501 LYS B CA  1 
ATOM   8193 C  C   . LYS B 1 501 ? -16.775 -13.568 10.037  1.00 35.21 ? 501 LYS B C   1 
ATOM   8194 O  O   . LYS B 1 501 ? -17.134 -12.680 9.247   1.00 29.83 ? 501 LYS B O   1 
ATOM   8195 C  CB  . LYS B 1 501 ? -18.540 -14.885 11.229  1.00 34.09 ? 501 LYS B CB  1 
ATOM   8196 C  CG  . LYS B 1 501 ? -19.260 -15.259 12.506  1.00 39.37 ? 501 LYS B CG  1 
ATOM   8197 C  CD  . LYS B 1 501 ? -20.225 -16.419 12.301  1.00 39.05 ? 501 LYS B CD  1 
ATOM   8198 C  CE  . LYS B 1 501 ? -20.813 -16.857 13.631  1.00 40.23 ? 501 LYS B CE  1 
ATOM   8199 N  NZ  . LYS B 1 501 ? -21.768 -17.990 13.522  1.00 44.55 ? 501 LYS B NZ  1 
ATOM   8200 N  N   . PHE B 1 502 ? -15.762 -14.401 9.811   1.00 30.41 ? 502 PHE B N   1 
ATOM   8201 C  CA  . PHE B 1 502 ? -15.007 -14.435 8.565   1.00 34.21 ? 502 PHE B CA  1 
ATOM   8202 C  C   . PHE B 1 502 ? -14.466 -15.846 8.367   1.00 33.86 ? 502 PHE B C   1 
ATOM   8203 O  O   . PHE B 1 502 ? -14.447 -16.636 9.316   1.00 33.15 ? 502 PHE B O   1 
ATOM   8204 C  CB  . PHE B 1 502 ? -13.878 -13.401 8.580   1.00 32.25 ? 502 PHE B CB  1 
ATOM   8205 C  CG  . PHE B 1 502 ? -12.702 -13.763 9.469   1.00 33.98 ? 502 PHE B CG  1 
ATOM   8206 C  CD1 . PHE B 1 502 ? -12.700 -13.428 10.814  1.00 34.16 ? 502 PHE B CD1 1 
ATOM   8207 C  CD2 . PHE B 1 502 ? -11.581 -14.406 8.939   1.00 33.11 ? 502 PHE B CD2 1 
ATOM   8208 C  CE1 . PHE B 1 502 ? -11.601 -13.743 11.631  1.00 36.57 ? 502 PHE B CE1 1 
ATOM   8209 C  CE2 . PHE B 1 502 ? -10.488 -14.722 9.734   1.00 32.73 ? 502 PHE B CE2 1 
ATOM   8210 C  CZ  . PHE B 1 502 ? -10.492 -14.395 11.080  1.00 34.44 ? 502 PHE B CZ  1 
ATOM   8211 N  N   . ILE B 1 503 ? -14.039 -16.171 7.148   1.00 35.33 ? 503 ILE B N   1 
ATOM   8212 C  CA  . ILE B 1 503 ? -13.482 -17.496 6.875   1.00 32.99 ? 503 ILE B CA  1 
ATOM   8213 C  C   . ILE B 1 503 ? -12.039 -17.432 6.387   1.00 35.83 ? 503 ILE B C   1 
ATOM   8214 O  O   . ILE B 1 503 ? -11.606 -16.420 5.837   1.00 35.02 ? 503 ILE B O   1 
ATOM   8215 C  CB  . ILE B 1 503 ? -14.321 -18.260 5.830   1.00 31.94 ? 503 ILE B CB  1 
ATOM   8216 C  CG1 . ILE B 1 503 ? -14.189 -17.619 4.444   1.00 35.80 ? 503 ILE B CG1 1 
ATOM   8217 C  CG2 . ILE B 1 503 ? -15.773 -18.294 6.262   1.00 37.33 ? 503 ILE B CG2 1 
ATOM   8218 C  CD1 . ILE B 1 503 ? -14.602 -18.542 3.293   1.00 35.82 ? 503 ILE B CD1 1 
ATOM   8219 N  N   . ASP B 1 504 ? -11.297 -18.514 6.604   1.00 35.01 ? 504 ASP B N   1 
ATOM   8220 C  CA  . ASP B 1 504 ? -10.005 -18.683 5.959   1.00 38.80 ? 504 ASP B CA  1 
ATOM   8221 C  C   . ASP B 1 504 ? -10.225 -19.179 4.545   1.00 36.77 ? 504 ASP B C   1 
ATOM   8222 O  O   . ASP B 1 504 ? -11.083 -20.021 4.309   1.00 40.65 ? 504 ASP B O   1 
ATOM   8223 C  CB  . ASP B 1 504 ? -9.114  -19.677 6.708   1.00 38.13 ? 504 ASP B CB  1 
ATOM   8224 C  CG  . ASP B 1 504 ? -8.791  -19.231 8.118   1.00 40.94 ? 504 ASP B CG  1 
ATOM   8225 O  OD1 . ASP B 1 504 ? -8.605  -18.013 8.347   1.00 39.71 ? 504 ASP B OD1 1 
ATOM   8226 O  OD2 . ASP B 1 504 ? -8.724  -20.112 8.998   1.00 45.48 ? 504 ASP B OD2 1 
ATOM   8227 N  N   . LEU B 1 505 ? -9.447  -18.659 3.608   1.00 34.58 ? 505 LEU B N   1 
ATOM   8228 C  CA  . LEU B 1 505 ? -9.368  -19.263 2.285   1.00 35.87 ? 505 LEU B CA  1 
ATOM   8229 C  C   . LEU B 1 505 ? -8.034  -19.981 2.160   1.00 33.40 ? 505 LEU B C   1 
ATOM   8230 O  O   . LEU B 1 505 ? -6.985  -19.349 2.171   1.00 34.09 ? 505 LEU B O   1 
ATOM   8231 C  CB  . LEU B 1 505 ? -9.521  -18.214 1.177   1.00 34.71 ? 505 LEU B CB  1 
ATOM   8232 C  CG  . LEU B 1 505 ? -10.899 -17.584 0.984   1.00 40.26 ? 505 LEU B CG  1 
ATOM   8233 C  CD1 . LEU B 1 505 ? -10.847 -16.539 -0.122  1.00 40.26 ? 505 LEU B CD1 1 
ATOM   8234 C  CD2 . LEU B 1 505 ? -11.923 -18.648 0.641   1.00 42.11 ? 505 LEU B CD2 1 
ATOM   8235 N  N   . ASN B 1 506 ? -8.084  -21.303 2.065   1.00 32.31 ? 506 ASN B N   1 
ATOM   8236 C  CA  . ASN B 1 506 ? -6.905  -22.119 1.821   1.00 34.02 ? 506 ASN B CA  1 
ATOM   8237 C  C   . ASN B 1 506 ? -7.337  -23.522 1.394   1.00 36.12 ? 506 ASN B C   1 
ATOM   8238 O  O   . ASN B 1 506 ? -8.497  -23.736 1.061   1.00 38.21 ? 506 ASN B O   1 
ATOM   8239 C  CB  . ASN B 1 506 ? -5.990  -22.162 3.062   1.00 37.92 ? 506 ASN B CB  1 
ATOM   8240 C  CG  . ASN B 1 506 ? -6.716  -22.612 4.319   1.00 38.96 ? 506 ASN B CG  1 
ATOM   8241 O  OD1 . ASN B 1 506 ? -7.461  -23.591 4.308   1.00 38.59 ? 506 ASN B OD1 1 
ATOM   8242 N  ND2 . ASN B 1 506 ? -6.502  -21.888 5.409   1.00 37.09 ? 506 ASN B ND2 1 
ATOM   8243 N  N   . THR B 1 507 ? -6.409  -24.472 1.398   1.00 38.58 ? 507 THR B N   1 
ATOM   8244 C  CA  . THR B 1 507 ? -6.676  -25.804 0.853   1.00 40.69 ? 507 THR B CA  1 
ATOM   8245 C  C   . THR B 1 507 ? -7.349  -26.762 1.831   1.00 43.59 ? 507 THR B C   1 
ATOM   8246 O  O   . THR B 1 507 ? -7.764  -27.855 1.431   1.00 43.18 ? 507 THR B O   1 
ATOM   8247 C  CB  . THR B 1 507 ? -5.380  -26.464 0.364   1.00 43.28 ? 507 THR B CB  1 
ATOM   8248 O  OG1 . THR B 1 507 ? -4.391  -26.379 1.400   1.00 41.02 ? 507 THR B OG1 1 
ATOM   8249 C  CG2 . THR B 1 507 ? -4.872  -25.763 -0.884  1.00 39.61 ? 507 THR B CG2 1 
ATOM   8250 N  N   . GLU B 1 508 ? -7.442  -26.356 3.101   1.00 40.63 ? 508 GLU B N   1 
ATOM   8251 C  CA  . GLU B 1 508 ? -8.109  -27.136 4.141   1.00 40.08 ? 508 GLU B CA  1 
ATOM   8252 C  C   . GLU B 1 508 ? -9.617  -26.854 4.214   1.00 41.94 ? 508 GLU B C   1 
ATOM   8253 O  O   . GLU B 1 508 ? -10.074 -25.795 3.774   1.00 41.46 ? 508 GLU B O   1 
ATOM   8254 C  CB  . GLU B 1 508 ? -7.493  -26.838 5.517   1.00 40.93 ? 508 GLU B CB  1 
ATOM   8255 C  CG  . GLU B 1 508 ? -6.015  -27.133 5.660   1.00 40.96 ? 508 GLU B CG  1 
ATOM   8256 C  CD  . GLU B 1 508 ? -5.450  -26.631 6.993   1.00 49.19 ? 508 GLU B CD  1 
ATOM   8257 O  OE1 . GLU B 1 508 ? -6.011  -25.672 7.564   1.00 50.32 ? 508 GLU B OE1 1 
ATOM   8258 O  OE2 . GLU B 1 508 ? -4.447  -27.195 7.474   1.00 49.83 ? 508 GLU B OE2 1 
ATOM   8259 N  N   . PRO B 1 509 ? -10.381 -27.795 4.803   1.00 40.59 ? 509 PRO B N   1 
ATOM   8260 C  CA  . PRO B 1 509 ? -11.795 -27.628 5.158   1.00 43.54 ? 509 PRO B CA  1 
ATOM   8261 C  C   . PRO B 1 509 ? -12.036 -26.279 5.816   1.00 44.55 ? 509 PRO B C   1 
ATOM   8262 O  O   . PRO B 1 509 ? -11.200 -25.828 6.601   1.00 41.19 ? 509 PRO B O   1 
ATOM   8263 C  CB  . PRO B 1 509 ? -12.042 -28.762 6.153   1.00 39.67 ? 509 PRO B CB  1 
ATOM   8264 C  CG  . PRO B 1 509 ? -11.099 -29.817 5.744   1.00 43.10 ? 509 PRO B CG  1 
ATOM   8265 C  CD  . PRO B 1 509 ? -9.870  -29.115 5.211   1.00 42.42 ? 509 PRO B CD  1 
ATOM   8266 N  N   . MET B 1 510 ? -13.158 -25.648 5.495   1.00 41.11 ? 510 MET B N   1 
ATOM   8267 C  CA  . MET B 1 510 ? -13.415 -24.287 5.933   1.00 41.79 ? 510 MET B CA  1 
ATOM   8268 C  C   . MET B 1 510 ? -13.419 -24.159 7.445   1.00 42.29 ? 510 MET B C   1 
ATOM   8269 O  O   . MET B 1 510 ? -13.909 -25.045 8.135   1.00 45.25 ? 510 MET B O   1 
ATOM   8270 C  CB  . MET B 1 510 ? -14.747 -23.805 5.372   1.00 45.22 ? 510 MET B CB  1 
ATOM   8271 C  CG  . MET B 1 510 ? -15.246 -22.507 5.974   1.00 42.51 ? 510 MET B CG  1 
ATOM   8272 S  SD  . MET B 1 510 ? -16.870 -22.100 5.297   1.00 47.96 ? 510 MET B SD  1 
ATOM   8273 C  CE  . MET B 1 510 ? -16.553 -22.370 3.539   1.00 41.54 ? 510 MET B CE  1 
ATOM   8274 N  N   . LYS B 1 511 ? -12.831 -23.075 7.949   1.00 41.56 ? 511 LYS B N   1 
ATOM   8275 C  CA  . LYS B 1 511 ? -12.960 -22.690 9.352   1.00 41.59 ? 511 LYS B CA  1 
ATOM   8276 C  C   . LYS B 1 511 ? -13.618 -21.320 9.425   1.00 38.62 ? 511 LYS B C   1 
ATOM   8277 O  O   . LYS B 1 511 ? -13.335 -20.452 8.605   1.00 38.28 ? 511 LYS B O   1 
ATOM   8278 C  CB  . LYS B 1 511 ? -11.604 -22.633 10.072  1.00 41.71 ? 511 LYS B CB  1 
ATOM   8279 C  CG  . LYS B 1 511 ? -10.751 -23.897 10.055  1.00 44.56 ? 511 LYS B CG  1 
ATOM   8280 C  CD  . LYS B 1 511 ? -9.563  -23.714 11.017  1.00 49.97 ? 511 LYS B CD  1 
ATOM   8281 C  CE  . LYS B 1 511 ? -8.529  -24.835 10.915  1.00 50.17 ? 511 LYS B CE  1 
ATOM   8282 N  NZ  . LYS B 1 511 ? -7.993  -25.003 9.530   1.00 44.58 ? 511 LYS B NZ  1 
ATOM   8283 N  N   . VAL B 1 512 ? -14.493 -21.126 10.402  1.00 34.86 ? 512 VAL B N   1 
ATOM   8284 C  CA  . VAL B 1 512 ? -15.044 -19.811 10.669  1.00 33.28 ? 512 VAL B CA  1 
ATOM   8285 C  C   . VAL B 1 512 ? -14.347 -19.212 11.894  1.00 38.44 ? 512 VAL B C   1 
ATOM   8286 O  O   . VAL B 1 512 ? -14.183 -19.885 12.912  1.00 36.22 ? 512 VAL B O   1 
ATOM   8287 C  CB  . VAL B 1 512 ? -16.568 -19.870 10.923  1.00 37.36 ? 512 VAL B CB  1 
ATOM   8288 C  CG1 . VAL B 1 512 ? -17.076 -18.533 11.418  1.00 36.49 ? 512 VAL B CG1 1 
ATOM   8289 C  CG2 . VAL B 1 512 ? -17.318 -20.315 9.667   1.00 38.88 ? 512 VAL B CG2 1 
ATOM   8290 N  N   . HIS B 1 513 ? -13.929 -17.956 11.786  1.00 35.08 ? 513 HIS B N   1 
ATOM   8291 C  CA  . HIS B 1 513 ? -13.381 -17.224 12.919  1.00 36.86 ? 513 HIS B CA  1 
ATOM   8292 C  C   . HIS B 1 513 ? -14.195 -15.955 13.153  1.00 34.94 ? 513 HIS B C   1 
ATOM   8293 O  O   . HIS B 1 513 ? -15.097 -15.634 12.374  1.00 32.76 ? 513 HIS B O   1 
ATOM   8294 C  CB  . HIS B 1 513 ? -11.912 -16.852 12.688  1.00 36.14 ? 513 HIS B CB  1 
ATOM   8295 C  CG  . HIS B 1 513 ? -11.054 -17.987 12.221  1.00 36.98 ? 513 HIS B CG  1 
ATOM   8296 N  ND1 . HIS B 1 513 ? -10.703 -19.043 13.036  1.00 38.72 ? 513 HIS B ND1 1 
ATOM   8297 C  CD2 . HIS B 1 513 ? -10.438 -18.210 11.034  1.00 37.01 ? 513 HIS B CD2 1 
ATOM   8298 C  CE1 . HIS B 1 513 ? -9.920  -19.873 12.368  1.00 40.63 ? 513 HIS B CE1 1 
ATOM   8299 N  NE2 . HIS B 1 513 ? -9.745  -19.390 11.150  1.00 41.00 ? 513 HIS B NE2 1 
ATOM   8300 N  N   . GLN B 1 514 ? -13.855 -15.228 14.213  1.00 32.72 ? 514 GLN B N   1 
ATOM   8301 C  CA  . GLN B 1 514 ? -14.498 -13.957 14.525  1.00 32.41 ? 514 GLN B CA  1 
ATOM   8302 C  C   . GLN B 1 514 ? -13.457 -12.893 14.852  1.00 34.01 ? 514 GLN B C   1 
ATOM   8303 O  O   . GLN B 1 514 ? -12.369 -13.214 15.332  1.00 33.52 ? 514 GLN B O   1 
ATOM   8304 C  CB  . GLN B 1 514 ? -15.467 -14.108 15.704  1.00 34.87 ? 514 GLN B CB  1 
ATOM   8305 C  CG  . GLN B 1 514 ? -16.542 -15.170 15.509  1.00 40.36 ? 514 GLN B CG  1 
ATOM   8306 C  CD  . GLN B 1 514 ? -17.646 -15.121 16.579  1.00 46.33 ? 514 GLN B CD  1 
ATOM   8307 O  OE1 . GLN B 1 514 ? -17.699 -14.207 17.409  1.00 45.25 ? 514 GLN B OE1 1 
ATOM   8308 N  NE2 . GLN B 1 514 ? -18.535 -16.108 16.548  1.00 51.27 ? 514 GLN B NE2 1 
ATOM   8309 N  N   . ARG B 1 515 ? -13.804 -11.631 14.608  1.00 30.93 ? 515 ARG B N   1 
ATOM   8310 C  CA  . ARG B 1 515 ? -12.944 -10.490 14.928  1.00 32.99 ? 515 ARG B CA  1 
ATOM   8311 C  C   . ARG B 1 515 ? -11.533 -10.630 14.351  1.00 35.14 ? 515 ARG B C   1 
ATOM   8312 O  O   . ARG B 1 515 ? -10.569 -10.912 15.079  1.00 32.86 ? 515 ARG B O   1 
ATOM   8313 C  CB  . ARG B 1 515 ? -12.878 -10.293 16.442  1.00 33.79 ? 515 ARG B CB  1 
ATOM   8314 C  CG  . ARG B 1 515 ? -14.259 -10.209 17.080  1.00 36.95 ? 515 ARG B CG  1 
ATOM   8315 C  CD  . ARG B 1 515 ? -14.241 -9.527  18.427  1.00 36.06 ? 515 ARG B CD  1 
ATOM   8316 N  NE  . ARG B 1 515 ? -15.588 -9.218  18.900  1.00 38.15 ? 515 ARG B NE  1 
ATOM   8317 C  CZ  . ARG B 1 515 ? -15.852 -8.734  20.108  1.00 46.42 ? 515 ARG B CZ  1 
ATOM   8318 N  NH1 . ARG B 1 515 ? -14.855 -8.514  20.960  1.00 41.68 ? 515 ARG B NH1 1 
ATOM   8319 N  NH2 . ARG B 1 515 ? -17.108 -8.475  20.467  1.00 44.41 ? 515 ARG B NH2 1 
ATOM   8320 N  N   . LEU B 1 516 ? -11.424 -10.434 13.039  1.00 32.51 ? 516 LEU B N   1 
ATOM   8321 C  CA  . LEU B 1 516 ? -10.132 -10.483 12.357  1.00 32.81 ? 516 LEU B CA  1 
ATOM   8322 C  C   . LEU B 1 516 ? -9.169  -9.442  12.941  1.00 30.65 ? 516 LEU B C   1 
ATOM   8323 O  O   . LEU B 1 516 ? -9.443  -8.240  12.930  1.00 27.97 ? 516 LEU B O   1 
ATOM   8324 C  CB  . LEU B 1 516 ? -10.316 -10.277 10.846  1.00 31.26 ? 516 LEU B CB  1 
ATOM   8325 C  CG  . LEU B 1 516 ? -9.095  -10.228 9.907   1.00 32.50 ? 516 LEU B CG  1 
ATOM   8326 C  CD1 . LEU B 1 516 ? -8.119  -11.330 10.187  1.00 31.45 ? 516 LEU B CD1 1 
ATOM   8327 C  CD2 . LEU B 1 516 ? -9.593  -10.347 8.466   1.00 31.26 ? 516 LEU B CD2 1 
ATOM   8328 N  N   . ARG B 1 517 ? -8.053  -9.946  13.464  1.00 31.74 ? 517 ARG B N   1 
ATOM   8329 C  CA  . ARG B 1 517 ? -7.016  -9.166  14.139  1.00 32.38 ? 517 ARG B CA  1 
ATOM   8330 C  C   . ARG B 1 517 ? -7.539  -7.974  14.960  1.00 34.11 ? 517 ARG B C   1 
ATOM   8331 O  O   . ARG B 1 517 ? -7.004  -6.861  14.850  1.00 30.65 ? 517 ARG B O   1 
ATOM   8332 C  CB  . ARG B 1 517 ? -5.980  -8.704  13.098  1.00 37.86 ? 517 ARG B CB  1 
ATOM   8333 C  CG  . ARG B 1 517 ? -5.084  -9.877  12.635  1.00 40.14 ? 517 ARG B CG  1 
ATOM   8334 C  CD  . ARG B 1 517 ? -3.968  -9.509  11.658  1.00 43.78 ? 517 ARG B CD  1 
ATOM   8335 N  NE  . ARG B 1 517 ? -2.902  -8.747  12.294  1.00 44.85 ? 517 ARG B NE  1 
ATOM   8336 C  CZ  . ARG B 1 517 ? -1.912  -9.291  12.998  1.00 43.65 ? 517 ARG B CZ  1 
ATOM   8337 N  NH1 . ARG B 1 517 ? -1.863  -10.608 13.160  1.00 43.61 ? 517 ARG B NH1 1 
ATOM   8338 N  NH2 . ARG B 1 517 ? -0.975  -8.521  13.539  1.00 33.51 ? 517 ARG B NH2 1 
ATOM   8339 N  N   . VAL B 1 518 ? -8.565  -8.218  15.793  1.00 32.22 ? 518 VAL B N   1 
ATOM   8340 C  CA  . VAL B 1 518 ? -9.151  -7.161  16.635  1.00 31.62 ? 518 VAL B CA  1 
ATOM   8341 C  C   . VAL B 1 518 ? -8.119  -6.410  17.464  1.00 31.96 ? 518 VAL B C   1 
ATOM   8342 O  O   . VAL B 1 518 ? -8.138  -5.181  17.518  1.00 33.63 ? 518 VAL B O   1 
ATOM   8343 C  CB  . VAL B 1 518 ? -10.212 -7.683  17.659  1.00 33.63 ? 518 VAL B CB  1 
ATOM   8344 C  CG1 . VAL B 1 518 ? -11.611 -7.498  17.137  1.00 39.83 ? 518 VAL B CG1 1 
ATOM   8345 C  CG2 . VAL B 1 518 ? -9.938  -9.125  18.096  1.00 33.31 ? 518 VAL B CG2 1 
ATOM   8346 N  N   . GLN B 1 519 ? -7.238  -7.144  18.133  1.00 32.87 ? 519 GLN B N   1 
ATOM   8347 C  CA  . GLN B 1 519 ? -6.342  -6.502  19.099  1.00 30.58 ? 519 GLN B CA  1 
ATOM   8348 C  C   . GLN B 1 519 ? -5.526  -5.416  18.408  1.00 33.35 ? 519 GLN B C   1 
ATOM   8349 O  O   . GLN B 1 519 ? -5.530  -4.261  18.833  1.00 34.51 ? 519 GLN B O   1 
ATOM   8350 C  CB  . GLN B 1 519 ? -5.417  -7.517  19.768  1.00 29.74 ? 519 GLN B CB  1 
ATOM   8351 C  CG  . GLN B 1 519 ? -4.723  -6.969  21.016  1.00 31.22 ? 519 GLN B CG  1 
ATOM   8352 C  CD  . GLN B 1 519 ? -5.694  -6.843  22.193  1.00 33.72 ? 519 GLN B CD  1 
ATOM   8353 O  OE1 . GLN B 1 519 ? -6.602  -7.663  22.346  1.00 31.64 ? 519 GLN B OE1 1 
ATOM   8354 N  NE2 . GLN B 1 519 ? -5.526  -5.801  22.998  1.00 27.91 ? 519 GLN B NE2 1 
ATOM   8355 N  N   . MET B 1 520 ? -4.854  -5.768  17.321  1.00 29.60 ? 520 MET B N   1 
ATOM   8356 C  CA  . MET B 1 520 ? -4.013  -4.785  16.652  1.00 35.48 ? 520 MET B CA  1 
ATOM   8357 C  C   . MET B 1 520 ? -4.867  -3.705  15.987  1.00 31.60 ? 520 MET B C   1 
ATOM   8358 O  O   . MET B 1 520 ? -4.521  -2.524  15.983  1.00 31.45 ? 520 MET B O   1 
ATOM   8359 C  CB  . MET B 1 520 ? -3.088  -5.457  15.629  1.00 29.88 ? 520 MET B CB  1 
ATOM   8360 C  CG  . MET B 1 520 ? -2.038  -6.408  16.226  1.00 32.38 ? 520 MET B CG  1 
ATOM   8361 S  SD  . MET B 1 520 ? -0.906  -5.703  17.480  1.00 39.94 ? 520 MET B SD  1 
ATOM   8362 C  CE  . MET B 1 520 ? -2.025  -5.547  18.875  1.00 38.32 ? 520 MET B CE  1 
ATOM   8363 N  N   . CYS B 1 521 ? -6.005  -4.085  15.437  1.00 31.01 ? 521 CYS B N   1 
ATOM   8364 C  CA  . CYS B 1 521 ? -6.773  -3.076  14.732  1.00 34.54 ? 521 CYS B CA  1 
ATOM   8365 C  C   . CYS B 1 521 ? -7.431  -2.076  15.694  1.00 31.62 ? 521 CYS B C   1 
ATOM   8366 O  O   . CYS B 1 521 ? -7.636  -0.918  15.329  1.00 31.25 ? 521 CYS B O   1 
ATOM   8367 C  CB  . CYS B 1 521 ? -7.778  -3.750  13.799  1.00 33.76 ? 521 CYS B CB  1 
ATOM   8368 S  SG  . CYS B 1 521 ? -6.886  -4.548  12.416  1.00 37.38 ? 521 CYS B SG  1 
ATOM   8369 N  N   . VAL B 1 522 ? -7.704  -2.486  16.933  1.00 30.94 ? 522 VAL B N   1 
ATOM   8370 C  CA  . VAL B 1 522 ? -8.116  -1.506  17.941  1.00 32.25 ? 522 VAL B CA  1 
ATOM   8371 C  C   . VAL B 1 522 ? -6.986  -0.501  18.156  1.00 32.13 ? 522 VAL B C   1 
ATOM   8372 O  O   . VAL B 1 522 ? -7.211  0.705   18.275  1.00 31.68 ? 522 VAL B O   1 
ATOM   8373 C  CB  . VAL B 1 522 ? -8.493  -2.171  19.292  1.00 38.56 ? 522 VAL B CB  1 
ATOM   8374 C  CG1 . VAL B 1 522 ? -8.584  -1.129  20.409  1.00 32.40 ? 522 VAL B CG1 1 
ATOM   8375 C  CG2 . VAL B 1 522 ? -9.798  -2.953  19.148  1.00 36.70 ? 522 VAL B CG2 1 
ATOM   8376 N  N   . PHE B 1 523 ? -5.758  -0.999  18.184  1.00 30.13 ? 523 PHE B N   1 
ATOM   8377 C  CA  . PHE B 1 523 ? -4.610  -0.113  18.299  1.00 31.49 ? 523 PHE B CA  1 
ATOM   8378 C  C   . PHE B 1 523 ? -4.519  0.831   17.094  1.00 31.44 ? 523 PHE B C   1 
ATOM   8379 O  O   . PHE B 1 523 ? -4.431  2.048   17.252  1.00 32.49 ? 523 PHE B O   1 
ATOM   8380 C  CB  . PHE B 1 523 ? -3.320  -0.917  18.442  1.00 29.07 ? 523 PHE B CB  1 
ATOM   8381 C  CG  . PHE B 1 523 ? -2.075  -0.082  18.358  1.00 31.65 ? 523 PHE B CG  1 
ATOM   8382 C  CD1 . PHE B 1 523 ? -1.631  0.643   19.450  1.00 35.52 ? 523 PHE B CD1 1 
ATOM   8383 C  CD2 . PHE B 1 523 ? -1.345  -0.023  17.184  1.00 34.12 ? 523 PHE B CD2 1 
ATOM   8384 C  CE1 . PHE B 1 523 ? -0.481  1.409   19.375  1.00 32.03 ? 523 PHE B CE1 1 
ATOM   8385 C  CE2 . PHE B 1 523 ? -0.192  0.738   17.101  1.00 33.80 ? 523 PHE B CE2 1 
ATOM   8386 C  CZ  . PHE B 1 523 ? 0.242   1.455   18.190  1.00 32.16 ? 523 PHE B CZ  1 
ATOM   8387 N  N   . TRP B 1 524 ? -4.556  0.274   15.890  1.00 29.91 ? 524 TRP B N   1 
ATOM   8388 C  CA  . TRP B 1 524 ? -4.378  1.104   14.701  1.00 34.38 ? 524 TRP B CA  1 
ATOM   8389 C  C   . TRP B 1 524 ? -5.578  2.014   14.450  1.00 34.73 ? 524 TRP B C   1 
ATOM   8390 O  O   . TRP B 1 524 ? -5.411  3.144   13.994  1.00 33.57 ? 524 TRP B O   1 
ATOM   8391 C  CB  . TRP B 1 524 ? -4.102  0.237   13.474  1.00 28.35 ? 524 TRP B CB  1 
ATOM   8392 C  CG  . TRP B 1 524 ? -2.761  -0.406  13.517  1.00 30.69 ? 524 TRP B CG  1 
ATOM   8393 C  CD1 . TRP B 1 524 ? -2.492  -1.719  13.766  1.00 31.59 ? 524 TRP B CD1 1 
ATOM   8394 C  CD2 . TRP B 1 524 ? -1.486  0.236   13.319  1.00 30.49 ? 524 TRP B CD2 1 
ATOM   8395 N  NE1 . TRP B 1 524 ? -1.131  -1.939  13.728  1.00 31.86 ? 524 TRP B NE1 1 
ATOM   8396 C  CE2 . TRP B 1 524 ? -0.493  -0.756  13.455  1.00 29.28 ? 524 TRP B CE2 1 
ATOM   8397 C  CE3 . TRP B 1 524 ? -1.093  1.548   13.032  1.00 28.44 ? 524 TRP B CE3 1 
ATOM   8398 C  CZ2 . TRP B 1 524 ? 0.872   -0.476  13.320  1.00 30.13 ? 524 TRP B CZ2 1 
ATOM   8399 C  CZ3 . TRP B 1 524 ? 0.267   1.826   12.895  1.00 29.80 ? 524 TRP B CZ3 1 
ATOM   8400 C  CH2 . TRP B 1 524 ? 1.231   0.818   13.044  1.00 28.59 ? 524 TRP B CH2 1 
ATOM   8401 N  N   . ASN B 1 525 ? -6.778  1.552   14.796  1.00 34.39 ? 525 ASN B N   1 
ATOM   8402 C  CA  . ASN B 1 525 ? -7.983  2.286   14.406  1.00 35.82 ? 525 ASN B CA  1 
ATOM   8403 C  C   . ASN B 1 525 ? -8.520  3.221   15.482  1.00 40.44 ? 525 ASN B C   1 
ATOM   8404 O  O   . ASN B 1 525 ? -9.120  4.254   15.168  1.00 42.19 ? 525 ASN B O   1 
ATOM   8405 C  CB  . ASN B 1 525 ? -9.068  1.300   13.957  1.00 33.32 ? 525 ASN B CB  1 
ATOM   8406 C  CG  . ASN B 1 525 ? -8.702  0.633   12.645  1.00 31.93 ? 525 ASN B CG  1 
ATOM   8407 O  OD1 . ASN B 1 525 ? -7.908  1.183   11.913  1.00 36.69 ? 525 ASN B OD1 1 
ATOM   8408 N  ND2 . ASN B 1 525 ? -9.238  -0.547  12.363  1.00 29.52 ? 525 ASN B ND2 1 
ATOM   8409 N  N   . GLN B 1 526 ? -8.292  2.881   16.746  1.00 39.38 ? 526 GLN B N   1 
ATOM   8410 C  CA  . GLN B 1 526 ? -8.783  3.719   17.829  1.00 40.24 ? 526 GLN B CA  1 
ATOM   8411 C  C   . GLN B 1 526 ? -7.645  4.426   18.566  1.00 41.18 ? 526 GLN B C   1 
ATOM   8412 O  O   . GLN B 1 526 ? -7.587  5.649   18.582  1.00 45.93 ? 526 GLN B O   1 
ATOM   8413 C  CB  . GLN B 1 526 ? -9.625  2.893   18.797  1.00 38.91 ? 526 GLN B CB  1 
ATOM   8414 C  CG  . GLN B 1 526 ? -10.874 2.308   18.153  1.00 45.75 ? 526 GLN B CG  1 
ATOM   8415 C  CD  . GLN B 1 526 ? -11.764 1.569   19.144  1.00 58.57 ? 526 GLN B CD  1 
ATOM   8416 O  OE1 . GLN B 1 526 ? -11.856 1.948   20.321  1.00 66.77 ? 526 GLN B OE1 1 
ATOM   8417 N  NE2 . GLN B 1 526 ? -12.427 0.505   18.675  1.00 58.11 ? 526 GLN B NE2 1 
ATOM   8418 N  N   . PHE B 1 527 ? -6.723  3.673   19.151  1.00 36.83 ? 527 PHE B N   1 
ATOM   8419 C  CA  . PHE B 1 527 ? -5.738  4.285   20.026  1.00 33.00 ? 527 PHE B CA  1 
ATOM   8420 C  C   . PHE B 1 527 ? -4.721  5.206   19.332  1.00 36.58 ? 527 PHE B C   1 
ATOM   8421 O  O   . PHE B 1 527 ? -4.567  6.361   19.717  1.00 37.51 ? 527 PHE B O   1 
ATOM   8422 C  CB  . PHE B 1 527 ? -4.982  3.209   20.800  1.00 34.28 ? 527 PHE B CB  1 
ATOM   8423 C  CG  . PHE B 1 527 ? -4.011  3.775   21.781  1.00 35.37 ? 527 PHE B CG  1 
ATOM   8424 C  CD1 . PHE B 1 527 ? -4.463  4.436   22.907  1.00 37.14 ? 527 PHE B CD1 1 
ATOM   8425 C  CD2 . PHE B 1 527 ? -2.651  3.690   21.561  1.00 34.47 ? 527 PHE B CD2 1 
ATOM   8426 C  CE1 . PHE B 1 527 ? -3.578  4.982   23.798  1.00 34.28 ? 527 PHE B CE1 1 
ATOM   8427 C  CE2 . PHE B 1 527 ? -1.770  4.236   22.448  1.00 33.34 ? 527 PHE B CE2 1 
ATOM   8428 C  CZ  . PHE B 1 527 ? -2.228  4.883   23.565  1.00 35.48 ? 527 PHE B CZ  1 
ATOM   8429 N  N   . LEU B 1 528 ? -4.017  4.704   18.324  1.00 35.34 ? 528 LEU B N   1 
ATOM   8430 C  CA  . LEU B 1 528 ? -2.934  5.482   17.723  1.00 34.26 ? 528 LEU B CA  1 
ATOM   8431 C  C   . LEU B 1 528 ? -3.379  6.844   17.197  1.00 37.31 ? 528 LEU B C   1 
ATOM   8432 O  O   . LEU B 1 528 ? -2.722  7.848   17.477  1.00 37.49 ? 528 LEU B O   1 
ATOM   8433 C  CB  . LEU B 1 528 ? -2.266  4.697   16.597  1.00 35.02 ? 528 LEU B CB  1 
ATOM   8434 C  CG  . LEU B 1 528 ? -0.970  5.294   16.027  1.00 32.89 ? 528 LEU B CG  1 
ATOM   8435 C  CD1 . LEU B 1 528 ? 0.043   5.625   17.120  1.00 35.72 ? 528 LEU B CD1 1 
ATOM   8436 C  CD2 . LEU B 1 528 ? -0.382  4.321   15.030  1.00 32.38 ? 528 LEU B CD2 1 
ATOM   8437 N  N   . PRO B 1 529 ? -4.493  6.889   16.434  1.00 39.31 ? 529 PRO B N   1 
ATOM   8438 C  CA  . PRO B 1 529 ? -4.994  8.181   15.947  1.00 36.76 ? 529 PRO B CA  1 
ATOM   8439 C  C   . PRO B 1 529 ? -5.331  9.147   17.091  1.00 39.36 ? 529 PRO B C   1 
ATOM   8440 O  O   . PRO B 1 529 ? -5.104  10.349  16.946  1.00 39.54 ? 529 PRO B O   1 
ATOM   8441 C  CB  . PRO B 1 529 ? -6.247  7.796   15.145  1.00 38.92 ? 529 PRO B CB  1 
ATOM   8442 C  CG  . PRO B 1 529 ? -6.043  6.362   14.777  1.00 37.25 ? 529 PRO B CG  1 
ATOM   8443 C  CD  . PRO B 1 529 ? -5.312  5.764   15.951  1.00 36.15 ? 529 PRO B CD  1 
ATOM   8444 N  N   . LYS B 1 530 ? -5.825  8.642   18.221  1.00 39.57 ? 530 LYS B N   1 
ATOM   8445 C  CA  . LYS B 1 530 ? -6.057  9.517   19.380  1.00 41.90 ? 530 LYS B CA  1 
ATOM   8446 C  C   . LYS B 1 530 ? -4.725  10.068  19.878  1.00 41.63 ? 530 LYS B C   1 
ATOM   8447 O  O   . LYS B 1 530 ? -4.594  11.255  20.169  1.00 47.91 ? 530 LYS B O   1 
ATOM   8448 C  CB  . LYS B 1 530 ? -6.791  8.782   20.514  1.00 42.05 ? 530 LYS B CB  1 
ATOM   8449 C  CG  . LYS B 1 530 ? -8.284  8.641   20.305  1.00 47.39 ? 530 LYS B CG  1 
ATOM   8450 C  CD  . LYS B 1 530 ? -8.601  8.514   18.803  1.00 56.86 ? 530 LYS B CD  1 
ATOM   8451 C  CE  . LYS B 1 530 ? -9.991  7.963   18.499  1.00 51.33 ? 530 LYS B CE  1 
ATOM   8452 N  NZ  . LYS B 1 530 ? -10.094 7.657   17.045  1.00 57.99 ? 530 LYS B NZ  1 
ATOM   8453 N  N   . LEU B 1 531 ? -3.727  9.202   19.959  1.00 42.14 ? 531 LEU B N   1 
ATOM   8454 C  CA  . LEU B 1 531 ? -2.410  9.615   20.431  1.00 40.69 ? 531 LEU B CA  1 
ATOM   8455 C  C   . LEU B 1 531 ? -1.743  10.640  19.504  1.00 43.44 ? 531 LEU B C   1 
ATOM   8456 O  O   . LEU B 1 531 ? -1.142  11.610  19.969  1.00 46.30 ? 531 LEU B O   1 
ATOM   8457 C  CB  . LEU B 1 531 ? -1.512  8.385   20.600  1.00 38.97 ? 531 LEU B CB  1 
ATOM   8458 C  CG  . LEU B 1 531 ? -0.075  8.615   21.082  1.00 44.02 ? 531 LEU B CG  1 
ATOM   8459 C  CD1 . LEU B 1 531 ? 0.541   7.326   21.598  1.00 42.30 ? 531 LEU B CD1 1 
ATOM   8460 C  CD2 . LEU B 1 531 ? 0.784   9.179   19.970  1.00 40.65 ? 531 LEU B CD2 1 
ATOM   8461 N  N   . LEU B 1 532 ? -1.826  10.424  18.196  1.00 42.56 ? 532 LEU B N   1 
ATOM   8462 C  CA  . LEU B 1 532 ? -1.179  11.330  17.247  1.00 44.58 ? 532 LEU B CA  1 
ATOM   8463 C  C   . LEU B 1 532 ? -1.862  12.694  17.181  1.00 45.84 ? 532 LEU B C   1 
ATOM   8464 O  O   . LEU B 1 532 ? -1.234  13.693  16.833  1.00 49.63 ? 532 LEU B O   1 
ATOM   8465 C  CB  . LEU B 1 532 ? -1.146  10.698  15.858  1.00 45.31 ? 532 LEU B CB  1 
ATOM   8466 C  CG  . LEU B 1 532 ? -0.228  9.482   15.748  1.00 46.06 ? 532 LEU B CG  1 
ATOM   8467 C  CD1 . LEU B 1 532 ? -0.240  8.958   14.334  1.00 39.75 ? 532 LEU B CD1 1 
ATOM   8468 C  CD2 . LEU B 1 532 ? 1.192   9.846   16.187  1.00 43.07 ? 532 LEU B CD2 1 
ATOM   8469 N  N   . ASN B 1 533 ? -3.144  12.727  17.522  1.00 44.89 ? 533 ASN B N   1 
ATOM   8470 C  CA  . ASN B 1 533 ? -3.928  13.961  17.542  1.00 53.70 ? 533 ASN B CA  1 
ATOM   8471 C  C   . ASN B 1 533 ? -3.739  14.867  18.773  1.00 55.24 ? 533 ASN B C   1 
ATOM   8472 O  O   . ASN B 1 533 ? -4.106  16.038  18.746  1.00 57.71 ? 533 ASN B O   1 
ATOM   8473 C  CB  . ASN B 1 533 ? -5.411  13.626  17.428  1.00 51.37 ? 533 ASN B CB  1 
ATOM   8474 C  CG  . ASN B 1 533 ? -6.210  14.770  16.870  1.00 58.70 ? 533 ASN B CG  1 
ATOM   8475 O  OD1 . ASN B 1 533 ? -5.826  15.362  15.860  1.00 59.42 ? 533 ASN B OD1 1 
ATOM   8476 N  ND2 . ASN B 1 533 ? -7.320  15.108  17.527  1.00 64.26 ? 533 ASN B ND2 1 
ATOM   8477 N  N   . ALA B 1 534 ? -3.190  14.329  19.854  1.00 52.58 ? 534 ALA B N   1 
ATOM   8478 C  CA  . ALA B 1 534 ? -2.951  15.127  21.054  1.00 56.30 ? 534 ALA B CA  1 
ATOM   8479 C  C   . ALA B 1 534 ? -1.534  15.691  21.074  1.00 61.64 ? 534 ALA B C   1 
ATOM   8480 O  O   . ALA B 1 534 ? -0.627  15.114  20.470  1.00 64.52 ? 534 ALA B O   1 
ATOM   8481 C  CB  . ALA B 1 534 ? -3.195  14.292  22.286  1.00 53.70 ? 534 ALA B CB  1 
ATOM   8482 N  N   . THR B 1 535 ? -1.336  16.813  21.766  1.00 67.31 ? 535 THR B N   1 
ATOM   8483 C  CA  . THR B 1 535 ? 0.022   17.345  21.970  1.00 74.47 ? 535 THR B CA  1 
ATOM   8484 C  C   . THR B 1 535 ? 0.198   18.050  23.320  1.00 67.10 ? 535 THR B C   1 
ATOM   8485 O  O   . THR B 1 535 ? -0.693  18.754  23.795  1.00 69.61 ? 535 THR B O   1 
ATOM   8486 C  CB  . THR B 1 535 ? 0.431   18.327  20.846  1.00 76.50 ? 535 THR B CB  1 
ATOM   8487 O  OG1 . THR B 1 535 ? 0.959   17.592  19.731  1.00 76.94 ? 535 THR B OG1 1 
ATOM   8488 C  CG2 . THR B 1 535 ? 1.498   19.293  21.347  1.00 75.77 ? 535 THR B CG2 1 
HETATM 8489 C  C1  . NAG C 2 .   ? 5.566   -5.654  84.393  1.00 56.94 ? 601 NAG A C1  1 
HETATM 8490 C  C2  . NAG C 2 .   ? 5.666   -6.183  85.826  1.00 62.62 ? 601 NAG A C2  1 
HETATM 8491 C  C3  . NAG C 2 .   ? 4.891   -7.488  85.950  1.00 63.27 ? 601 NAG A C3  1 
HETATM 8492 C  C4  . NAG C 2 .   ? 3.437   -7.267  85.557  1.00 66.71 ? 601 NAG A C4  1 
HETATM 8493 C  C5  . NAG C 2 .   ? 3.348   -6.695  84.140  1.00 63.55 ? 601 NAG A C5  1 
HETATM 8494 C  C6  . NAG C 2 .   ? 1.929   -6.322  83.760  1.00 63.87 ? 601 NAG A C6  1 
HETATM 8495 C  C7  . NAG C 2 .   ? 7.551   -5.851  87.365  1.00 62.41 ? 601 NAG A C7  1 
HETATM 8496 C  C8  . NAG C 2 .   ? 8.994   -6.145  87.640  1.00 63.17 ? 601 NAG A C8  1 
HETATM 8497 N  N2  . NAG C 2 .   ? 7.048   -6.368  86.238  1.00 62.02 ? 601 NAG A N2  1 
HETATM 8498 O  O3  . NAG C 2 .   ? 4.966   -7.959  87.290  1.00 73.49 ? 601 NAG A O3  1 
HETATM 8499 O  O4  . NAG C 2 .   ? 2.716   -8.493  85.646  1.00 71.01 ? 601 NAG A O4  1 
HETATM 8500 O  O5  . NAG C 2 .   ? 4.150   -5.503  84.020  1.00 61.34 ? 601 NAG A O5  1 
HETATM 8501 O  O6  . NAG C 2 .   ? 1.851   -5.169  82.931  1.00 63.91 ? 601 NAG A O6  1 
HETATM 8502 O  O7  . NAG C 2 .   ? 6.873   -5.171  88.124  1.00 67.16 ? 601 NAG A O7  1 
HETATM 8503 C  C1  . NAG D 2 .   ? 31.343  -6.080  45.718  1.00 53.07 ? 602 NAG A C1  1 
HETATM 8504 C  C2  . NAG D 2 .   ? 31.415  -6.736  44.313  1.00 54.61 ? 602 NAG A C2  1 
HETATM 8505 C  C3  . NAG D 2 .   ? 32.728  -7.503  44.116  1.00 55.83 ? 602 NAG A C3  1 
HETATM 8506 C  C4  . NAG D 2 .   ? 33.920  -6.608  44.417  1.00 59.38 ? 602 NAG A C4  1 
HETATM 8507 C  C5  . NAG D 2 .   ? 33.803  -6.118  45.853  1.00 56.77 ? 602 NAG A C5  1 
HETATM 8508 C  C6  . NAG D 2 .   ? 34.955  -5.233  46.277  1.00 58.96 ? 602 NAG A C6  1 
HETATM 8509 C  C7  . NAG D 2 .   ? 29.219  -7.333  43.366  1.00 50.49 ? 602 NAG A C7  1 
HETATM 8510 C  C8  . NAG D 2 .   ? 28.159  -8.384  43.291  1.00 47.73 ? 602 NAG A C8  1 
HETATM 8511 N  N2  . NAG D 2 .   ? 30.279  -7.630  44.123  1.00 51.22 ? 602 NAG A N2  1 
HETATM 8512 O  O3  . NAG D 2 .   ? 32.797  -7.962  42.770  1.00 59.27 ? 602 NAG A O3  1 
HETATM 8513 O  O4  . NAG D 2 .   ? 35.139  -7.318  44.211  1.00 66.97 ? 602 NAG A O4  1 
HETATM 8514 O  O5  . NAG D 2 .   ? 32.598  -5.348  45.990  1.00 55.97 ? 602 NAG A O5  1 
HETATM 8515 O  O6  . NAG D 2 .   ? 34.807  -3.888  45.841  1.00 59.08 ? 602 NAG A O6  1 
HETATM 8516 O  O7  . NAG D 2 .   ? 29.112  -6.260  42.769  1.00 47.08 ? 602 NAG A O7  1 
HETATM 8517 C  C10 . C6K E 3 .   ? -4.975  -2.511  52.540  0.83 43.25 ? 603 C6K A C10 1 
HETATM 8518 N  N12 . C6K E 3 .   ? -4.176  -3.703  54.588  0.83 48.48 ? 603 C6K A N12 1 
HETATM 8519 C  C13 . C6K E 3 .   ? -3.629  -4.710  54.981  0.83 44.65 ? 603 C6K A C13 1 
HETATM 8520 C  C15 . C6K E 3 .   ? -1.494  -3.813  56.020  0.83 45.03 ? 603 C6K A C15 1 
HETATM 8521 C  C17 . C6K E 3 .   ? 0.679   -4.267  55.114  0.83 40.99 ? 603 C6K A C17 1 
HETATM 8522 C  C20 . C6K E 3 .   ? -5.501  -3.697  55.086  0.83 46.02 ? 603 C6K A C20 1 
HETATM 8523 C  C21 . C6K E 3 .   ? -6.420  -2.651  54.428  0.83 41.25 ? 603 C6K A C21 1 
HETATM 8524 C  C22 . C6K E 3 .   ? -8.424  1.249   52.803  0.83 44.12 ? 603 C6K A C22 1 
HETATM 8525 C  C28 . C6K E 3 .   ? -9.778  4.685   50.593  0.83 50.74 ? 603 C6K A C28 1 
HETATM 8526 C  C01 . C6K E 3 .   ? -7.345  1.925   48.514  0.83 43.70 ? 603 C6K A C01 1 
HETATM 8527 O  O02 . C6K E 3 .   ? -7.231  2.847   49.633  0.83 53.71 ? 603 C6K A O02 1 
HETATM 8528 C  C03 . C6K E 3 .   ? -8.015  2.608   50.793  0.83 51.23 ? 603 C6K A C03 1 
HETATM 8529 C  C04 . C6K E 3 .   ? -7.692  1.505   51.629  0.83 49.95 ? 603 C6K A C04 1 
HETATM 8530 C  C05 . C6K E 3 .   ? -6.553  0.626   51.257  0.83 48.90 ? 603 C6K A C05 1 
HETATM 8531 O  O06 . C6K E 3 .   ? -5.469  1.146   51.006  0.83 51.93 ? 603 C6K A O06 1 
HETATM 8532 C  C07 . C6K E 3 .   ? -6.708  -0.884  51.167  0.83 41.86 ? 603 C6K A C07 1 
HETATM 8533 C  C08 . C6K E 3 .   ? -7.191  -1.467  52.463  0.83 42.45 ? 603 C6K A C08 1 
HETATM 8534 C  C09 . C6K E 3 .   ? -6.329  -2.655  52.976  0.83 46.62 ? 603 C6K A C09 1 
HETATM 8535 C  C11 . C6K E 3 .   ? -4.129  -3.643  53.111  0.83 45.03 ? 603 C6K A C11 1 
HETATM 8536 C  C14 . C6K E 3 .   ? -2.057  -4.539  55.033  0.83 44.87 ? 603 C6K A C14 1 
HETATM 8537 C  C16 . C6K E 3 .   ? -0.113  -3.659  56.071  0.83 41.14 ? 603 C6K A C16 1 
HETATM 8538 C  C18 . C6K E 3 .   ? 0.101   -5.022  54.102  0.83 40.14 ? 603 C6K A C18 1 
HETATM 8539 C  C19 . C6K E 3 .   ? -1.234  -5.167  54.048  0.83 41.96 ? 603 C6K A C19 1 
HETATM 8540 C  C23 . C6K E 3 .   ? -9.524  2.095   53.160  0.83 50.59 ? 603 C6K A C23 1 
HETATM 8541 CL CL  . C6K E 3 .   ? -10.416 1.753   54.588  0.83 73.93 ? 603 C6K A CL  1 
HETATM 8542 C  C25 . C6K E 3 .   ? -9.891  3.251   52.317  0.83 50.86 ? 603 C6K A C25 1 
HETATM 8543 N  N26 . C6K E 3 .   ? -10.883 4.189   52.465  0.83 47.77 ? 603 C6K A N26 1 
HETATM 8544 C  C27 . C6K E 3 .   ? -10.811 5.054   51.419  0.83 55.74 ? 603 C6K A C27 1 
HETATM 8545 C  C29 . C6K E 3 .   ? -9.178  3.514   51.179  0.83 54.94 ? 603 C6K A C29 1 
HETATM 8546 C  C1  . NAG F 2 .   ? -6.293  -8.299  -36.516 1.00 56.86 ? 601 NAG B C1  1 
HETATM 8547 C  C2  . NAG F 2 .   ? -6.166  -8.720  -38.007 1.00 57.65 ? 601 NAG B C2  1 
HETATM 8548 C  C3  . NAG F 2 .   ? -5.529  -10.111 -38.144 1.00 59.86 ? 601 NAG B C3  1 
HETATM 8549 C  C4  . NAG F 2 .   ? -4.234  -10.207 -37.352 1.00 63.24 ? 601 NAG B C4  1 
HETATM 8550 C  C5  . NAG F 2 .   ? -4.506  -9.829  -35.900 1.00 59.56 ? 601 NAG B C5  1 
HETATM 8551 C  C6  . NAG F 2 .   ? -3.261  -9.874  -35.044 1.00 59.65 ? 601 NAG B C6  1 
HETATM 8552 C  C7  . NAG F 2 .   ? -7.814  -7.862  -39.633 1.00 60.79 ? 601 NAG B C7  1 
HETATM 8553 C  C8  . NAG F 2 .   ? -9.198  -8.011  -40.171 1.00 52.45 ? 601 NAG B C8  1 
HETATM 8554 N  N2  . NAG F 2 .   ? -7.476  -8.703  -38.646 1.00 63.34 ? 601 NAG B N2  1 
HETATM 8555 O  O3  . NAG F 2 .   ? -5.256  -10.365 -39.520 1.00 66.22 ? 601 NAG B O3  1 
HETATM 8556 O  O4  . NAG F 2 .   ? -3.715  -11.530 -37.429 1.00 63.20 ? 601 NAG B O4  1 
HETATM 8557 O  O5  . NAG F 2 .   ? -5.008  -8.487  -35.846 1.00 53.74 ? 601 NAG B O5  1 
HETATM 8558 O  O6  . NAG F 2 .   ? -2.210  -9.089  -35.591 1.00 57.63 ? 601 NAG B O6  1 
HETATM 8559 O  O7  . NAG F 2 .   ? -7.039  -7.010  -40.061 1.00 63.30 ? 601 NAG B O7  1 
HETATM 8560 C  C1  . NAG G 2 .   ? -30.970 -6.598  2.267   1.00 41.66 ? 602 NAG B C1  1 
HETATM 8561 C  C2  . NAG G 2 .   ? -31.268 -7.243  3.640   1.00 42.31 ? 602 NAG B C2  1 
HETATM 8562 C  C3  . NAG G 2 .   ? -32.637 -7.926  3.616   1.00 46.70 ? 602 NAG B C3  1 
HETATM 8563 C  C4  . NAG G 2 .   ? -33.705 -6.995  3.050   1.00 48.21 ? 602 NAG B C4  1 
HETATM 8564 C  C5  . NAG G 2 .   ? -33.244 -6.437  1.713   1.00 50.34 ? 602 NAG B C5  1 
HETATM 8565 C  C6  . NAG G 2 .   ? -34.209 -5.437  1.103   1.00 52.41 ? 602 NAG B C6  1 
HETATM 8566 C  C7  . NAG G 2 .   ? -29.231 -7.941  4.855   1.00 42.49 ? 602 NAG B C7  1 
HETATM 8567 C  C8  . NAG G 2 .   ? -28.267 -9.064  5.087   1.00 44.25 ? 602 NAG B C8  1 
HETATM 8568 N  N2  . NAG G 2 .   ? -30.236 -8.205  4.012   1.00 39.79 ? 602 NAG B N2  1 
HETATM 8569 O  O3  . NAG G 2 .   ? -32.984 -8.328  4.934   1.00 51.67 ? 602 NAG B O3  1 
HETATM 8570 O  O4  . NAG G 2 .   ? -34.928 -7.692  2.846   1.00 54.25 ? 602 NAG B O4  1 
HETATM 8571 O  O5  . NAG G 2 .   ? -32.001 -5.758  1.912   1.00 43.95 ? 602 NAG B O5  1 
HETATM 8572 O  O6  . NAG G 2 .   ? -34.957 -4.773  2.113   1.00 54.43 ? 602 NAG B O6  1 
HETATM 8573 O  O7  . NAG G 2 .   ? -29.108 -6.851  5.416   1.00 42.60 ? 602 NAG B O7  1 
HETATM 8574 C  C10 . C6K H 3 .   ? 6.751   -3.704  -5.610  0.88 39.49 ? 603 C6K B C10 1 
HETATM 8575 N  N12 . C6K H 3 .   ? 4.492   -4.562  -6.488  0.88 41.20 ? 603 C6K B N12 1 
HETATM 8576 C  C13 . C6K H 3 .   ? 4.080   -5.618  -6.929  0.88 41.70 ? 603 C6K B C13 1 
HETATM 8577 C  C15 . C6K H 3 .   ? 1.768   -5.020  -7.839  0.88 41.21 ? 603 C6K B C15 1 
HETATM 8578 C  C17 . C6K H 3 .   ? -0.293  -5.748  -6.813  0.88 37.28 ? 603 C6K B C17 1 
HETATM 8579 C  C20 . C6K H 3 .   ? 3.931   -4.257  -5.224  0.88 41.50 ? 603 C6K B C20 1 
HETATM 8580 C  C21 . C6K H 3 .   ? 4.905   -3.790  -4.136  0.88 41.98 ? 603 C6K B C21 1 
HETATM 8581 C  C22 . C6K H 3 .   ? 8.610   2.193   -2.697  0.88 54.27 ? 603 C6K B C22 1 
HETATM 8582 C  C28 . C6K H 3 .   ? 11.025  2.797   -6.185  0.88 47.37 ? 603 C6K B C28 1 
HETATM 8583 C  C01 . C6K H 3 .   ? 9.979   0.029   -6.842  0.88 52.32 ? 603 C6K B C01 1 
HETATM 8584 O  O02 . C6K H 3 .   ? 8.876   0.377   -5.956  0.88 55.56 ? 603 C6K B O02 1 
HETATM 8585 C  C03 . C6K H 3 .   ? 9.121   1.321   -4.933  0.88 49.24 ? 603 C6K B C03 1 
HETATM 8586 C  C04 . C6K H 3 .   ? 8.385   1.245   -3.726  0.88 50.55 ? 603 C6K B C04 1 
HETATM 8587 C  C05 . C6K H 3 .   ? 7.385   0.155   -3.518  0.88 50.15 ? 603 C6K B C05 1 
HETATM 8588 O  O06 . C6K H 3 .   ? 6.411   0.339   -2.786  0.88 47.99 ? 603 C6K B O06 1 
HETATM 8589 C  C07 . C6K H 3 .   ? 7.608   -1.198  -4.182  0.88 43.39 ? 603 C6K B C07 1 
HETATM 8590 C  C08 . C6K H 3 .   ? 6.786   -2.312  -3.595  0.88 38.96 ? 603 C6K B C08 1 
HETATM 8591 C  C09 . C6K H 3 .   ? 5.924   -2.948  -4.726  0.88 47.62 ? 603 C6K B C09 1 
HETATM 8592 C  C11 . C6K H 3 .   ? 5.941   -4.367  -6.716  0.88 42.15 ? 603 C6K B C11 1 
HETATM 8593 C  C14 . C6K H 3 .   ? 2.486   -5.669  -6.891  0.88 41.65 ? 603 C6K B C14 1 
HETATM 8594 C  C16 . C6K H 3 .   ? 0.373   -5.048  -7.813  0.88 39.12 ? 603 C6K B C16 1 
HETATM 8595 C  C18 . C6K H 3 .   ? 0.438   -6.429  -5.842  0.88 39.48 ? 603 C6K B C18 1 
HETATM 8596 C  C19 . C6K H 3 .   ? 1.792   -6.398  -5.867  0.88 42.66 ? 603 C6K B C19 1 
HETATM 8597 C  C23 . C6K H 3 .   ? 9.585   3.247   -2.875  0.88 53.60 ? 603 C6K B C23 1 
HETATM 8598 CL CL  . C6K H 3 .   ? 9.871   4.418   -1.644  0.88 61.58 ? 603 C6K B CL  1 
HETATM 8599 C  C25 . C6K H 3 .   ? 10.351  3.336   -4.136  0.88 51.50 ? 603 C6K B C25 1 
HETATM 8600 N  N26 . C6K H 3 .   ? 11.309  4.228   -4.544  0.88 50.37 ? 603 C6K B N26 1 
HETATM 8601 C  C27 . C6K H 3 .   ? 11.721  3.899   -5.786  0.88 50.19 ? 603 C6K B C27 1 
HETATM 8602 C  C29 . C6K H 3 .   ? 10.142  2.428   -5.120  0.88 48.80 ? 603 C6K B C29 1 
HETATM 8603 C  C1  . PEG I 4 .   ? -15.797 -3.655  17.161  1.00 55.98 ? 604 PEG B C1  1 
HETATM 8604 O  O1  . PEG I 4 .   ? -16.523 -4.212  18.244  1.00 54.51 ? 604 PEG B O1  1 
HETATM 8605 C  C2  . PEG I 4 .   ? -14.321 -4.060  17.281  1.00 51.87 ? 604 PEG B C2  1 
HETATM 8606 O  O2  . PEG I 4 .   ? -13.757 -4.208  15.975  1.00 59.81 ? 604 PEG B O2  1 
HETATM 8607 C  C3  . PEG I 4 .   ? -13.077 -3.062  15.379  1.00 49.91 ? 604 PEG B C3  1 
HETATM 8608 C  C4  . PEG I 4 .   ? -12.017 -3.518  14.477  1.00 46.45 ? 604 PEG B C4  1 
HETATM 8609 O  O4  . PEG I 4 .   ? -11.763 -2.553  13.498  1.00 38.59 ? 604 PEG B O4  1 
HETATM 8610 H  H11 . PEG I 4 .   ? -16.160 -3.991  16.315  1.00 67.18 ? 604 PEG B H11 1 
HETATM 8611 H  H12 . PEG I 4 .   ? -15.872 -2.674  17.184  1.00 67.18 ? 604 PEG B H12 1 
HETATM 8612 H  HO1 . PEG I 4 .   ? -16.249 -3.852  18.994  1.00 65.42 ? 604 PEG B HO1 1 
HETATM 8613 H  H21 . PEG I 4 .   ? -13.836 -3.375  17.766  1.00 62.25 ? 604 PEG B H21 1 
HETATM 8614 H  H22 . PEG I 4 .   ? -14.254 -4.905  17.760  1.00 62.25 ? 604 PEG B H22 1 
HETATM 8615 H  H31 . PEG I 4 .   ? -13.719 -2.530  14.878  1.00 59.89 ? 604 PEG B H31 1 
HETATM 8616 H  H32 . PEG I 4 .   ? -12.687 -2.516  16.084  1.00 59.89 ? 604 PEG B H32 1 
HETATM 8617 H  H41 . PEG I 4 .   ? -11.209 -3.677  14.989  1.00 55.75 ? 604 PEG B H41 1 
HETATM 8618 H  H42 . PEG I 4 .   ? -12.291 -4.337  14.052  1.00 55.75 ? 604 PEG B H42 1 
HETATM 8619 H  HO4 . PEG I 4 .   ? -11.325 -2.897  12.875  1.00 46.31 ? 604 PEG B HO4 1 
HETATM 8620 C  C1  . PEG J 4 .   ? -10.672 1.841   -38.601 1.00 64.68 ? 605 PEG B C1  1 
HETATM 8621 O  O1  . PEG J 4 .   ? -10.747 0.428   -38.616 1.00 65.78 ? 605 PEG B O1  1 
HETATM 8622 C  C2  . PEG J 4 .   ? -11.261 2.361   -37.282 1.00 57.39 ? 605 PEG B C2  1 
HETATM 8623 O  O2  . PEG J 4 .   ? -10.273 3.035   -36.505 1.00 64.22 ? 605 PEG B O2  1 
HETATM 8624 C  C3  . PEG J 4 .   ? -9.631  4.179   -37.129 1.00 71.10 ? 605 PEG B C3  1 
HETATM 8625 C  C4  . PEG J 4 .   ? -8.891  4.940   -36.130 1.00 78.60 ? 605 PEG B C4  1 
HETATM 8626 O  O4  . PEG J 4 .   ? -8.009  4.107   -35.423 1.00 73.49 ? 605 PEG B O4  1 
HETATM 8627 H  H11 . PEG J 4 .   ? -9.736  2.121   -38.675 1.00 77.61 ? 605 PEG B H11 1 
HETATM 8628 H  H12 . PEG J 4 .   ? -11.186 2.205   -39.357 1.00 77.61 ? 605 PEG B H12 1 
HETATM 8629 H  HO1 . PEG J 4 .   ? -10.135 0.110   -39.155 1.00 78.94 ? 605 PEG B HO1 1 
HETATM 8630 H  H21 . PEG J 4 .   ? -11.984 2.977   -37.478 1.00 68.86 ? 605 PEG B H21 1 
HETATM 8631 H  H22 . PEG J 4 .   ? -11.611 1.610   -36.770 1.00 68.86 ? 605 PEG B H22 1 
HETATM 8632 H  H31 . PEG J 4 .   ? -9.017  3.870   -37.818 1.00 85.32 ? 605 PEG B H31 1 
HETATM 8633 H  H32 . PEG J 4 .   ? -10.308 4.750   -37.533 1.00 85.32 ? 605 PEG B H32 1 
HETATM 8634 H  H41 . PEG J 4 .   ? -8.385  5.639   -36.573 1.00 94.32 ? 605 PEG B H41 1 
HETATM 8635 H  H42 . PEG J 4 .   ? -9.512  5.341   -35.513 1.00 94.32 ? 605 PEG B H42 1 
HETATM 8636 H  HO4 . PEG J 4 .   ? -7.624  4.550   -34.827 1.00 88.18 ? 605 PEG B HO4 1 
HETATM 8637 O  O   . HOH K 5 .   ? 19.968  -19.915 52.091  1.00 46.00 ? 701 HOH A O   1 
HETATM 8638 O  O   . HOH K 5 .   ? -4.601  -6.802  64.933  1.00 38.65 ? 702 HOH A O   1 
HETATM 8639 O  O   . HOH K 5 .   ? 8.324   -21.755 39.988  1.00 55.48 ? 703 HOH A O   1 
HETATM 8640 O  O   . HOH K 5 .   ? 21.117  -18.073 59.796  1.00 50.66 ? 704 HOH A O   1 
HETATM 8641 O  O   . HOH K 5 .   ? -2.879  -9.984  68.527  1.00 44.73 ? 705 HOH A O   1 
HETATM 8642 O  O   . HOH K 5 .   ? -18.969 0.841   37.548  1.00 35.34 ? 706 HOH A O   1 
HETATM 8643 O  O   . HOH K 5 .   ? 10.741  10.487  78.740  1.00 42.56 ? 707 HOH A O   1 
HETATM 8644 O  O   . HOH K 5 .   ? -17.005 -15.295 51.925  1.00 53.56 ? 708 HOH A O   1 
HETATM 8645 O  O   . HOH K 5 .   ? -2.765  -15.904 41.936  1.00 54.97 ? 709 HOH A O   1 
HETATM 8646 O  O   . HOH K 5 .   ? -12.996 -5.155  61.649  1.00 48.98 ? 710 HOH A O   1 
HETATM 8647 O  O   . HOH K 5 .   ? 7.584   7.761   45.960  1.00 31.67 ? 711 HOH A O   1 
HETATM 8648 O  O   . HOH K 5 .   ? 21.076  3.648   38.647  1.00 39.17 ? 712 HOH A O   1 
HETATM 8649 O  O   . HOH K 5 .   ? 14.846  -21.627 58.839  1.00 45.26 ? 713 HOH A O   1 
HETATM 8650 O  O   . HOH K 5 .   ? 10.903  1.616   25.622  1.00 53.21 ? 714 HOH A O   1 
HETATM 8651 O  O   . HOH K 5 .   ? 21.194  0.357   63.276  1.00 34.28 ? 715 HOH A O   1 
HETATM 8652 O  O   . HOH K 5 .   ? -11.934 -0.046  55.965  1.00 47.09 ? 716 HOH A O   1 
HETATM 8653 O  O   . HOH K 5 .   ? 1.585   -12.749 56.355  1.00 39.80 ? 717 HOH A O   1 
HETATM 8654 O  O   . HOH K 5 .   ? -12.046 -14.386 60.638  1.00 45.41 ? 718 HOH A O   1 
HETATM 8655 O  O   . HOH K 5 .   ? -17.383 2.669   33.867  1.00 41.69 ? 719 HOH A O   1 
HETATM 8656 O  O   . HOH K 5 .   ? -10.408 -17.177 38.683  1.00 46.25 ? 720 HOH A O   1 
HETATM 8657 O  O   . HOH K 5 .   ? -9.234  5.371   64.564  1.00 42.37 ? 721 HOH A O   1 
HETATM 8658 O  O   . HOH K 5 .   ? 18.128  -22.165 59.318  1.00 54.91 ? 722 HOH A O   1 
HETATM 8659 O  O   . HOH K 5 .   ? 24.646  -4.749  41.196  1.00 37.86 ? 723 HOH A O   1 
HETATM 8660 O  O   . HOH K 5 .   ? 2.781   14.298  53.360  1.00 30.61 ? 724 HOH A O   1 
HETATM 8661 O  O   . HOH K 5 .   ? 0.770   23.854  47.669  1.00 47.13 ? 725 HOH A O   1 
HETATM 8662 O  O   . HOH K 5 .   ? -4.626  8.109   54.264  1.00 35.18 ? 726 HOH A O   1 
HETATM 8663 O  O   . HOH K 5 .   ? 9.316   -14.562 64.034  1.00 40.55 ? 727 HOH A O   1 
HETATM 8664 O  O   . HOH K 5 .   ? -6.768  -14.950 59.624  1.00 51.19 ? 728 HOH A O   1 
HETATM 8665 O  O   . HOH K 5 .   ? 4.346   -14.990 72.125  1.00 49.55 ? 729 HOH A O   1 
HETATM 8666 O  O   . HOH K 5 .   ? -2.805  -14.581 49.474  1.00 39.73 ? 730 HOH A O   1 
HETATM 8667 O  O   . HOH K 5 .   ? 1.435   7.546   78.219  1.00 49.08 ? 731 HOH A O   1 
HETATM 8668 O  O   . HOH K 5 .   ? -19.075 -6.013  37.822  1.00 34.75 ? 732 HOH A O   1 
HETATM 8669 O  O   . HOH K 5 .   ? 26.107  -16.860 52.383  1.00 47.21 ? 733 HOH A O   1 
HETATM 8670 O  O   . HOH K 5 .   ? 14.383  -6.712  34.854  1.00 35.29 ? 734 HOH A O   1 
HETATM 8671 O  O   . HOH K 5 .   ? -16.281 -11.932 25.934  1.00 40.25 ? 735 HOH A O   1 
HETATM 8672 O  O   . HOH K 5 .   ? 3.417   -8.034  50.602  1.00 35.04 ? 736 HOH A O   1 
HETATM 8673 O  O   . HOH K 5 .   ? 24.122  -0.074  63.352  1.00 37.35 ? 737 HOH A O   1 
HETATM 8674 O  O   . HOH K 5 .   ? -2.347  -1.452  62.949  1.00 31.58 ? 738 HOH A O   1 
HETATM 8675 O  O   . HOH K 5 .   ? -1.684  -7.550  41.063  1.00 37.43 ? 739 HOH A O   1 
HETATM 8676 O  O   . HOH K 5 .   ? 19.989  12.894  55.167  1.00 43.28 ? 740 HOH A O   1 
HETATM 8677 O  O   . HOH K 5 .   ? 15.384  14.371  74.484  1.00 46.80 ? 741 HOH A O   1 
HETATM 8678 O  O   . HOH K 5 .   ? 27.450  1.623   53.185  1.00 47.18 ? 742 HOH A O   1 
HETATM 8679 O  O   . HOH K 5 .   ? -10.375 -6.056  30.081  1.00 43.77 ? 743 HOH A O   1 
HETATM 8680 O  O   . HOH K 5 .   ? -16.858 -7.782  50.219  1.00 41.10 ? 744 HOH A O   1 
HETATM 8681 O  O   . HOH K 5 .   ? 7.277   -7.073  66.069  1.00 34.93 ? 745 HOH A O   1 
HETATM 8682 O  O   . HOH K 5 .   ? -8.818  -14.490 23.570  1.00 46.99 ? 746 HOH A O   1 
HETATM 8683 O  O   . HOH K 5 .   ? -12.426 -9.687  29.204  1.00 43.20 ? 747 HOH A O   1 
HETATM 8684 O  O   . HOH K 5 .   ? 17.905  3.148   84.732  1.00 40.19 ? 748 HOH A O   1 
HETATM 8685 O  O   . HOH K 5 .   ? -18.860 -4.650  26.637  1.00 48.16 ? 749 HOH A O   1 
HETATM 8686 O  O   . HOH K 5 .   ? 3.221   13.940  65.738  1.00 30.42 ? 750 HOH A O   1 
HETATM 8687 O  O   . HOH K 5 .   ? 6.809   -9.531  48.905  1.00 33.24 ? 751 HOH A O   1 
HETATM 8688 O  O   . HOH K 5 .   ? 0.654   -8.055  38.621  1.00 38.49 ? 752 HOH A O   1 
HETATM 8689 O  O   . HOH K 5 .   ? -15.069 -2.643  46.639  1.00 41.42 ? 753 HOH A O   1 
HETATM 8690 O  O   . HOH K 5 .   ? -9.162  -1.048  24.464  1.00 38.56 ? 754 HOH A O   1 
HETATM 8691 O  O   . HOH K 5 .   ? -4.665  6.885   59.849  1.00 27.49 ? 755 HOH A O   1 
HETATM 8692 O  O   . HOH K 5 .   ? 19.363  -7.565  29.024  1.00 56.83 ? 756 HOH A O   1 
HETATM 8693 O  O   . HOH K 5 .   ? 22.757  -7.296  58.686  1.00 34.91 ? 757 HOH A O   1 
HETATM 8694 O  O   . HOH K 5 .   ? 12.306  18.674  55.890  1.00 48.42 ? 758 HOH A O   1 
HETATM 8695 O  O   . HOH K 5 .   ? 17.681  -23.442 48.007  1.00 64.60 ? 759 HOH A O   1 
HETATM 8696 O  O   . HOH K 5 .   ? 28.826  -0.903  44.838  1.00 36.58 ? 760 HOH A O   1 
HETATM 8697 O  O   . HOH K 5 .   ? -2.534  -14.830 58.196  1.00 46.83 ? 761 HOH A O   1 
HETATM 8698 O  O   . HOH K 5 .   ? 6.462   -0.287  69.132  1.00 33.29 ? 762 HOH A O   1 
HETATM 8699 O  O   . HOH K 5 .   ? 0.028   8.307   66.792  1.00 34.87 ? 763 HOH A O   1 
HETATM 8700 O  O   . HOH K 5 .   ? 5.140   11.865  33.094  1.00 46.78 ? 764 HOH A O   1 
HETATM 8701 O  O   . HOH K 5 .   ? 16.881  7.864   71.541  1.00 41.42 ? 765 HOH A O   1 
HETATM 8702 O  O   . HOH K 5 .   ? 34.536  -12.125 74.516  1.00 49.04 ? 766 HOH A O   1 
HETATM 8703 O  O   . HOH K 5 .   ? -3.033  -1.393  57.999  1.00 35.01 ? 767 HOH A O   1 
HETATM 8704 O  O   . HOH K 5 .   ? 1.650   -10.483 38.982  1.00 37.66 ? 768 HOH A O   1 
HETATM 8705 O  O   . HOH K 5 .   ? -3.978  2.376   42.330  1.00 31.10 ? 769 HOH A O   1 
HETATM 8706 O  O   . HOH K 5 .   ? 6.865   2.560   38.138  1.00 42.30 ? 770 HOH A O   1 
HETATM 8707 O  O   . HOH K 5 .   ? 28.773  -6.264  69.159  1.00 48.27 ? 771 HOH A O   1 
HETATM 8708 O  O   . HOH K 5 .   ? -11.893 10.948  56.058  1.00 42.22 ? 772 HOH A O   1 
HETATM 8709 O  O   . HOH K 5 .   ? -19.509 -6.096  30.383  1.00 38.63 ? 773 HOH A O   1 
HETATM 8710 O  O   . HOH K 5 .   ? -12.750 -16.230 44.355  1.00 45.31 ? 774 HOH A O   1 
HETATM 8711 O  O   . HOH K 5 .   ? -4.075  10.796  60.327  1.00 36.60 ? 775 HOH A O   1 
HETATM 8712 O  O   . HOH K 5 .   ? 1.380   -3.189  59.611  1.00 35.50 ? 776 HOH A O   1 
HETATM 8713 O  O   . HOH K 5 .   ? 9.234   16.706  31.480  1.00 63.18 ? 777 HOH A O   1 
HETATM 8714 O  O   . HOH K 5 .   ? -6.879  -10.135 32.061  1.00 37.61 ? 778 HOH A O   1 
HETATM 8715 O  O   . HOH K 5 .   ? -3.281  12.291  72.463  1.00 35.73 ? 779 HOH A O   1 
HETATM 8716 O  O   . HOH K 5 .   ? -1.272  18.157  70.037  1.00 40.37 ? 780 HOH A O   1 
HETATM 8717 O  O   . HOH K 5 .   ? 3.439   -23.303 45.868  1.00 49.26 ? 781 HOH A O   1 
HETATM 8718 O  O   . HOH K 5 .   ? 4.049   -4.708  56.868  1.00 29.99 ? 782 HOH A O   1 
HETATM 8719 O  O   . HOH K 5 .   ? 27.818  -9.338  46.787  1.00 44.07 ? 783 HOH A O   1 
HETATM 8720 O  O   . HOH K 5 .   ? 1.850   10.435  45.498  1.00 35.09 ? 784 HOH A O   1 
HETATM 8721 O  O   . HOH K 5 .   ? -10.501 4.335   63.016  1.00 45.24 ? 785 HOH A O   1 
HETATM 8722 O  O   . HOH K 5 .   ? 26.690  8.055   51.972  1.00 48.19 ? 786 HOH A O   1 
HETATM 8723 O  O   . HOH K 5 .   ? -0.450  7.601   54.474  1.00 31.07 ? 787 HOH A O   1 
HETATM 8724 O  O   . HOH K 5 .   ? 10.631  19.589  64.326  1.00 44.89 ? 788 HOH A O   1 
HETATM 8725 O  O   . HOH K 5 .   ? 5.740   13.970  55.254  1.00 30.71 ? 789 HOH A O   1 
HETATM 8726 O  O   . HOH K 5 .   ? -13.322 25.810  57.429  1.00 47.21 ? 790 HOH A O   1 
HETATM 8727 O  O   . HOH K 5 .   ? -12.470 -5.319  58.997  1.00 40.52 ? 791 HOH A O   1 
HETATM 8728 O  O   . HOH K 5 .   ? -7.072  5.598   47.774  1.00 36.17 ? 792 HOH A O   1 
HETATM 8729 O  O   . HOH K 5 .   ? -5.396  23.094  50.426  1.00 44.70 ? 793 HOH A O   1 
HETATM 8730 O  O   . HOH K 5 .   ? 29.376  -8.279  58.870  1.00 46.05 ? 794 HOH A O   1 
HETATM 8731 O  O   . HOH K 5 .   ? 23.908  -7.493  41.423  1.00 35.50 ? 795 HOH A O   1 
HETATM 8732 O  O   . HOH K 5 .   ? -13.094 15.435  62.745  1.00 41.25 ? 796 HOH A O   1 
HETATM 8733 O  O   . HOH K 5 .   ? 8.208   -26.200 50.482  1.00 51.55 ? 797 HOH A O   1 
HETATM 8734 O  O   . HOH K 5 .   ? 26.017  -1.546  83.215  1.00 46.86 ? 798 HOH A O   1 
HETATM 8735 O  O   . HOH K 5 .   ? -21.086 -2.660  40.174  1.00 37.02 ? 799 HOH A O   1 
HETATM 8736 O  O   . HOH K 5 .   ? 21.006  -12.081 36.736  1.00 42.63 ? 800 HOH A O   1 
HETATM 8737 O  O   . HOH K 5 .   ? 7.028   -10.328 26.634  1.00 42.15 ? 801 HOH A O   1 
HETATM 8738 O  O   . HOH K 5 .   ? 7.016   -2.262  78.176  1.00 43.49 ? 802 HOH A O   1 
HETATM 8739 O  O   . HOH K 5 .   ? -0.254  8.225   48.570  1.00 28.81 ? 803 HOH A O   1 
HETATM 8740 O  O   . HOH K 5 .   ? -1.286  -2.984  59.717  1.00 35.22 ? 804 HOH A O   1 
HETATM 8741 O  O   . HOH K 5 .   ? 8.125   -2.415  62.693  1.00 27.42 ? 805 HOH A O   1 
HETATM 8742 O  O   . HOH K 5 .   ? 17.824  -10.288 30.330  1.00 42.01 ? 806 HOH A O   1 
HETATM 8743 O  O   . HOH K 5 .   ? 9.907   13.028  70.304  1.00 35.37 ? 807 HOH A O   1 
HETATM 8744 O  O   . HOH K 5 .   ? -11.589 4.749   32.770  1.00 44.00 ? 808 HOH A O   1 
HETATM 8745 O  O   . HOH K 5 .   ? 13.087  -23.750 64.279  1.00 45.24 ? 809 HOH A O   1 
HETATM 8746 O  O   . HOH K 5 .   ? 1.826   -7.913  75.685  1.00 52.26 ? 810 HOH A O   1 
HETATM 8747 O  O   . HOH K 5 .   ? 1.878   12.578  67.722  1.00 32.43 ? 811 HOH A O   1 
HETATM 8748 O  O   . HOH K 5 .   ? 21.313  -24.616 41.850  1.00 65.55 ? 812 HOH A O   1 
HETATM 8749 O  O   . HOH K 5 .   ? -7.936  -14.158 33.610  1.00 42.22 ? 813 HOH A O   1 
HETATM 8750 O  O   . HOH K 5 .   ? 17.518  -13.478 84.120  1.00 49.06 ? 814 HOH A O   1 
HETATM 8751 O  O   . HOH K 5 .   ? -22.015 -3.487  35.792  1.00 42.77 ? 815 HOH A O   1 
HETATM 8752 O  O   . HOH K 5 .   ? -7.951  9.555   35.585  1.00 41.95 ? 816 HOH A O   1 
HETATM 8753 O  O   . HOH K 5 .   ? 21.115  13.522  44.083  1.00 45.08 ? 817 HOH A O   1 
HETATM 8754 O  O   . HOH K 5 .   ? 19.012  -13.699 76.135  1.00 43.64 ? 818 HOH A O   1 
HETATM 8755 O  O   . HOH K 5 .   ? -16.512 -3.307  24.980  1.00 48.66 ? 819 HOH A O   1 
HETATM 8756 O  O   . HOH K 5 .   ? -9.099  10.877  38.392  1.00 38.86 ? 820 HOH A O   1 
HETATM 8757 O  O   . HOH K 5 .   ? -3.607  -7.850  47.231  1.00 32.62 ? 821 HOH A O   1 
HETATM 8758 O  O   . HOH K 5 .   ? -0.379  -17.093 50.603  1.00 45.43 ? 822 HOH A O   1 
HETATM 8759 O  O   . HOH K 5 .   ? -7.978  -16.987 26.678  1.00 51.72 ? 823 HOH A O   1 
HETATM 8760 O  O   . HOH K 5 .   ? 11.779  16.819  58.302  1.00 40.39 ? 824 HOH A O   1 
HETATM 8761 O  O   . HOH K 5 .   ? 25.442  -1.466  69.814  1.00 38.89 ? 825 HOH A O   1 
HETATM 8762 O  O   . HOH K 5 .   ? 4.876   20.736  52.468  1.00 37.66 ? 826 HOH A O   1 
HETATM 8763 O  O   . HOH K 5 .   ? 5.970   16.929  60.165  1.00 36.48 ? 827 HOH A O   1 
HETATM 8764 O  O   . HOH K 5 .   ? -13.862 -2.152  39.401  1.00 32.56 ? 828 HOH A O   1 
HETATM 8765 O  O   . HOH K 5 .   ? 0.774   17.081  54.554  1.00 35.25 ? 829 HOH A O   1 
HETATM 8766 O  O   . HOH K 5 .   ? -9.836  8.728   39.618  1.00 45.36 ? 830 HOH A O   1 
HETATM 8767 O  O   . HOH K 5 .   ? 9.443   4.750   39.179  1.00 39.94 ? 831 HOH A O   1 
HETATM 8768 O  O   . HOH K 5 .   ? 2.703   2.465   57.221  1.00 26.83 ? 832 HOH A O   1 
HETATM 8769 O  O   . HOH K 5 .   ? 1.444   24.895  68.105  1.00 46.11 ? 833 HOH A O   1 
HETATM 8770 O  O   . HOH K 5 .   ? 6.202   7.447   72.578  1.00 34.01 ? 834 HOH A O   1 
HETATM 8771 O  O   . HOH K 5 .   ? -2.274  9.416   55.961  1.00 29.78 ? 835 HOH A O   1 
HETATM 8772 O  O   . HOH K 5 .   ? 21.761  10.780  61.177  1.00 43.39 ? 836 HOH A O   1 
HETATM 8773 O  O   . HOH K 5 .   ? -7.375  -4.117  57.880  1.00 39.14 ? 837 HOH A O   1 
HETATM 8774 O  O   . HOH K 5 .   ? -6.688  0.157   69.632  1.00 41.50 ? 838 HOH A O   1 
HETATM 8775 O  O   . HOH K 5 .   ? 4.602   -8.174  31.730  1.00 35.61 ? 839 HOH A O   1 
HETATM 8776 O  O   . HOH K 5 .   ? -15.887 -15.555 27.529  1.00 45.75 ? 840 HOH A O   1 
HETATM 8777 O  O   . HOH K 5 .   ? 0.288   7.860   64.134  1.00 31.90 ? 841 HOH A O   1 
HETATM 8778 O  O   . HOH K 5 .   ? -7.868  -11.454 40.538  1.00 40.98 ? 842 HOH A O   1 
HETATM 8779 O  O   . HOH K 5 .   ? 8.929   18.345  46.196  1.00 42.53 ? 843 HOH A O   1 
HETATM 8780 O  O   . HOH K 5 .   ? 20.594  6.006   70.548  1.00 38.40 ? 844 HOH A O   1 
HETATM 8781 O  O   . HOH K 5 .   ? 12.716  0.139   88.927  1.00 50.65 ? 845 HOH A O   1 
HETATM 8782 O  O   . HOH K 5 .   ? 17.736  -12.636 41.803  1.00 35.48 ? 846 HOH A O   1 
HETATM 8783 O  O   . HOH K 5 .   ? 15.845  11.005  63.722  1.00 33.43 ? 847 HOH A O   1 
HETATM 8784 O  O   . HOH K 5 .   ? -21.886 -0.975  37.086  1.00 46.70 ? 848 HOH A O   1 
HETATM 8785 O  O   . HOH K 5 .   ? -18.250 -13.137 32.340  1.00 42.49 ? 849 HOH A O   1 
HETATM 8786 O  O   . HOH K 5 .   ? -0.038  -16.785 53.148  1.00 43.79 ? 850 HOH A O   1 
HETATM 8787 O  O   . HOH K 5 .   ? 1.939   1.690   65.612  1.00 32.55 ? 851 HOH A O   1 
HETATM 8788 O  O   . HOH K 5 .   ? -1.123  15.658  71.438  1.00 39.11 ? 852 HOH A O   1 
HETATM 8789 O  O   . HOH K 5 .   ? 30.016  -3.441  43.676  1.00 50.80 ? 853 HOH A O   1 
HETATM 8790 O  O   . HOH K 5 .   ? 23.348  -4.348  43.601  1.00 33.98 ? 854 HOH A O   1 
HETATM 8791 O  O   . HOH K 5 .   ? 18.293  -19.920 68.906  1.00 49.50 ? 855 HOH A O   1 
HETATM 8792 O  O   . HOH K 5 .   ? 0.114   -2.121  75.798  1.00 44.50 ? 856 HOH A O   1 
HETATM 8793 O  O   . HOH K 5 .   ? -8.212  -2.141  66.341  1.00 40.45 ? 857 HOH A O   1 
HETATM 8794 O  O   . HOH K 5 .   ? 8.265   11.779  44.410  1.00 35.47 ? 858 HOH A O   1 
HETATM 8795 O  O   . HOH K 5 .   ? 24.874  -2.361  60.391  1.00 31.77 ? 859 HOH A O   1 
HETATM 8796 O  O   . HOH K 5 .   ? -17.686 -6.506  22.614  1.00 52.38 ? 860 HOH A O   1 
HETATM 8797 O  O   . HOH K 5 .   ? -1.300  -10.232 62.663  1.00 41.22 ? 861 HOH A O   1 
HETATM 8798 O  O   . HOH K 5 .   ? -1.715  9.863   41.871  1.00 43.25 ? 862 HOH A O   1 
HETATM 8799 O  O   . HOH K 5 .   ? 4.069   2.427   37.813  1.00 35.95 ? 863 HOH A O   1 
HETATM 8800 O  O   . HOH K 5 .   ? 4.536   1.025   69.290  1.00 30.56 ? 864 HOH A O   1 
HETATM 8801 O  O   . HOH K 5 .   ? 9.811   -13.741 33.780  1.00 38.86 ? 865 HOH A O   1 
HETATM 8802 O  O   . HOH K 5 .   ? -12.851 -18.769 47.272  1.00 46.96 ? 866 HOH A O   1 
HETATM 8803 O  O   . HOH K 5 .   ? 3.683   30.608  60.595  1.00 53.78 ? 867 HOH A O   1 
HETATM 8804 O  O   . HOH K 5 .   ? 23.214  -8.428  80.887  1.00 52.80 ? 868 HOH A O   1 
HETATM 8805 O  O   . HOH K 5 .   ? 14.014  -9.535  36.439  1.00 38.96 ? 869 HOH A O   1 
HETATM 8806 O  O   . HOH K 5 .   ? 2.864   18.838  42.801  1.00 45.11 ? 870 HOH A O   1 
HETATM 8807 O  O   . HOH K 5 .   ? -14.105 5.394   38.511  1.00 42.48 ? 871 HOH A O   1 
HETATM 8808 O  O   . HOH K 5 .   ? -17.919 0.032   55.689  1.00 33.77 ? 872 HOH A O   1 
HETATM 8809 O  O   . HOH K 5 .   ? 17.500  -21.058 52.737  1.00 44.14 ? 873 HOH A O   1 
HETATM 8810 O  O   . HOH K 5 .   ? 13.337  8.155   85.673  1.00 51.09 ? 874 HOH A O   1 
HETATM 8811 O  O   . HOH K 5 .   ? 29.566  2.874   72.864  1.00 47.15 ? 875 HOH A O   1 
HETATM 8812 O  O   . HOH K 5 .   ? 6.758   14.504  75.788  1.00 42.07 ? 876 HOH A O   1 
HETATM 8813 O  O   . HOH K 5 .   ? 2.189   9.800   67.792  1.00 31.14 ? 877 HOH A O   1 
HETATM 8814 O  O   . HOH K 5 .   ? -13.616 -14.180 52.937  1.00 44.88 ? 878 HOH A O   1 
HETATM 8815 O  O   . HOH K 5 .   ? -3.121  8.568   61.781  1.00 30.61 ? 879 HOH A O   1 
HETATM 8816 O  O   . HOH K 5 .   ? -0.737  10.262  46.738  1.00 33.95 ? 880 HOH A O   1 
HETATM 8817 O  O   . HOH K 5 .   ? 5.891   7.168   78.166  1.00 44.56 ? 881 HOH A O   1 
HETATM 8818 O  O   . HOH K 5 .   ? 22.254  2.932   84.233  1.00 51.48 ? 882 HOH A O   1 
HETATM 8819 O  O   . HOH K 5 .   ? -17.459 -9.805  58.901  1.00 50.41 ? 883 HOH A O   1 
HETATM 8820 O  O   . HOH K 5 .   ? -8.002  31.479  57.524  1.00 51.08 ? 884 HOH A O   1 
HETATM 8821 O  O   . HOH K 5 .   ? 20.785  9.704   63.503  1.00 38.87 ? 885 HOH A O   1 
HETATM 8822 O  O   . HOH K 5 .   ? -7.372  2.473   71.339  1.00 37.79 ? 886 HOH A O   1 
HETATM 8823 O  O   . HOH K 5 .   ? 8.629   0.683   83.513  1.00 41.11 ? 887 HOH A O   1 
HETATM 8824 O  O   . HOH K 5 .   ? 2.884   -17.663 38.929  1.00 40.52 ? 888 HOH A O   1 
HETATM 8825 O  O   . HOH K 5 .   ? 8.231   -26.635 63.899  1.00 56.08 ? 889 HOH A O   1 
HETATM 8826 O  O   . HOH K 5 .   ? 1.552   -25.359 60.823  1.00 50.87 ? 890 HOH A O   1 
HETATM 8827 O  O   . HOH K 5 .   ? -14.218 0.865   54.140  1.00 44.76 ? 891 HOH A O   1 
HETATM 8828 O  O   . HOH K 5 .   ? -11.231 19.673  69.905  1.00 47.13 ? 892 HOH A O   1 
HETATM 8829 O  O   . HOH K 5 .   ? 9.076   15.498  76.293  1.00 47.22 ? 893 HOH A O   1 
HETATM 8830 O  O   . HOH K 5 .   ? 12.766  0.576   34.426  1.00 30.67 ? 894 HOH A O   1 
HETATM 8831 O  O   . HOH K 5 .   ? -8.363  1.615   24.719  1.00 41.87 ? 895 HOH A O   1 
HETATM 8832 O  O   . HOH K 5 .   ? 25.324  -7.452  33.952  1.00 45.38 ? 896 HOH A O   1 
HETATM 8833 O  O   . HOH K 5 .   ? 11.880  -6.480  34.028  1.00 35.47 ? 897 HOH A O   1 
HETATM 8834 O  O   . HOH K 5 .   ? 10.961  12.324  43.693  1.00 39.61 ? 898 HOH A O   1 
HETATM 8835 O  O   . HOH K 5 .   ? 26.370  -11.121 47.241  1.00 36.82 ? 899 HOH A O   1 
HETATM 8836 O  O   . HOH K 5 .   ? -5.895  10.765  45.229  1.00 39.28 ? 900 HOH A O   1 
HETATM 8837 O  O   . HOH K 5 .   ? 22.323  -18.679 32.324  1.00 60.88 ? 901 HOH A O   1 
HETATM 8838 O  O   . HOH K 5 .   ? -9.724  -8.867  29.062  1.00 41.14 ? 902 HOH A O   1 
HETATM 8839 O  O   . HOH K 5 .   ? 3.072   0.076   67.279  1.00 31.89 ? 903 HOH A O   1 
HETATM 8840 O  O   . HOH K 5 .   ? 7.113   -12.480 34.675  1.00 46.67 ? 904 HOH A O   1 
HETATM 8841 O  O   . HOH K 5 .   ? 8.371   7.071   76.559  1.00 32.26 ? 905 HOH A O   1 
HETATM 8842 O  O   . HOH K 5 .   ? 6.737   21.380  45.338  1.00 39.06 ? 906 HOH A O   1 
HETATM 8843 O  O   . HOH K 5 .   ? -3.381  9.610   72.304  1.00 33.78 ? 907 HOH A O   1 
HETATM 8844 O  O   . HOH K 5 .   ? 27.308  -4.839  40.753  1.00 51.45 ? 908 HOH A O   1 
HETATM 8845 O  O   . HOH K 5 .   ? 29.257  0.778   38.460  1.00 50.96 ? 909 HOH A O   1 
HETATM 8846 O  O   . HOH K 5 .   ? -20.664 -3.682  31.123  1.00 45.04 ? 910 HOH A O   1 
HETATM 8847 O  O   . HOH K 5 .   ? -1.431  13.495  44.272  1.00 44.10 ? 911 HOH A O   1 
HETATM 8848 O  O   . HOH K 5 .   ? -8.600  13.987  30.073  1.00 55.86 ? 912 HOH A O   1 
HETATM 8849 O  O   . HOH K 5 .   ? 25.157  -6.611  78.486  1.00 54.32 ? 913 HOH A O   1 
HETATM 8850 O  O   . HOH K 5 .   ? -0.544  20.651  44.848  1.00 48.86 ? 914 HOH A O   1 
HETATM 8851 O  O   . HOH K 5 .   ? 0.405   15.212  52.334  1.00 37.92 ? 915 HOH A O   1 
HETATM 8852 O  O   . HOH K 5 .   ? 17.695  14.428  57.059  1.00 45.11 ? 916 HOH A O   1 
HETATM 8853 O  O   . HOH K 5 .   ? 11.496  11.300  41.482  1.00 40.23 ? 917 HOH A O   1 
HETATM 8854 O  O   . HOH K 5 .   ? 27.851  0.565   62.754  1.00 38.88 ? 918 HOH A O   1 
HETATM 8855 O  O   . HOH K 5 .   ? 28.569  -10.708 59.717  1.00 46.48 ? 919 HOH A O   1 
HETATM 8856 O  O   . HOH K 5 .   ? -10.958 27.118  57.256  1.00 46.05 ? 920 HOH A O   1 
HETATM 8857 O  O   . HOH K 5 .   ? 6.665   -9.957  30.694  1.00 36.94 ? 921 HOH A O   1 
HETATM 8858 O  O   . HOH K 5 .   ? -5.782  -1.879  58.862  1.00 39.78 ? 922 HOH A O   1 
HETATM 8859 O  O   . HOH K 5 .   ? 2.742   14.841  44.647  1.00 39.96 ? 923 HOH A O   1 
HETATM 8860 O  O   . HOH K 5 .   ? -5.342  -14.340 40.246  1.00 44.49 ? 924 HOH A O   1 
HETATM 8861 O  O   . HOH K 5 .   ? 7.139   -16.333 37.368  1.00 43.71 ? 925 HOH A O   1 
HETATM 8862 O  O   . HOH K 5 .   ? 0.938   5.185   78.142  1.00 52.52 ? 926 HOH A O   1 
HETATM 8863 O  O   . HOH K 5 .   ? -18.899 1.890   64.270  1.00 38.07 ? 927 HOH A O   1 
HETATM 8864 O  O   . HOH K 5 .   ? -17.246 -11.916 57.258  1.00 54.30 ? 928 HOH A O   1 
HETATM 8865 O  O   . HOH K 5 .   ? -10.571 -11.730 64.557  1.00 54.71 ? 929 HOH A O   1 
HETATM 8866 O  O   . HOH K 5 .   ? 25.486  -6.403  37.099  1.00 43.81 ? 930 HOH A O   1 
HETATM 8867 O  O   . HOH K 5 .   ? -10.123 18.576  71.925  1.00 56.47 ? 931 HOH A O   1 
HETATM 8868 O  O   . HOH K 5 .   ? 5.215   10.390  43.591  1.00 42.83 ? 932 HOH A O   1 
HETATM 8869 O  O   . HOH K 5 .   ? -8.364  -23.243 63.048  1.00 57.06 ? 933 HOH A O   1 
HETATM 8870 O  O   . HOH K 5 .   ? -0.457  -1.737  53.074  1.00 46.19 ? 934 HOH A O   1 
HETATM 8871 O  O   . HOH K 5 .   ? 15.179  -24.048 59.610  1.00 44.64 ? 935 HOH A O   1 
HETATM 8872 O  O   . HOH K 5 .   ? 5.147   -21.011 70.315  1.00 46.95 ? 936 HOH A O   1 
HETATM 8873 O  O   . HOH K 5 .   ? -17.264 0.543   44.881  1.00 45.28 ? 937 HOH A O   1 
HETATM 8874 O  O   . HOH K 5 .   ? 28.275  -13.166 59.986  1.00 47.82 ? 938 HOH A O   1 
HETATM 8875 O  O   . HOH K 5 .   ? -15.698 -1.051  26.145  1.00 49.77 ? 939 HOH A O   1 
HETATM 8876 O  O   . HOH K 5 .   ? 26.854  -1.046  59.192  1.00 38.66 ? 940 HOH A O   1 
HETATM 8877 O  O   . HOH K 5 .   ? 16.809  -3.817  30.033  1.00 48.57 ? 941 HOH A O   1 
HETATM 8878 O  O   . HOH K 5 .   ? 18.633  7.494   69.537  1.00 40.07 ? 942 HOH A O   1 
HETATM 8879 O  O   . HOH K 5 .   ? -5.283  16.918  72.082  1.00 46.25 ? 943 HOH A O   1 
HETATM 8880 O  O   . HOH K 5 .   ? -0.503  22.782  74.622  1.00 62.90 ? 944 HOH A O   1 
HETATM 8881 O  O   . HOH K 5 .   ? -3.092  10.964  44.627  1.00 40.24 ? 945 HOH A O   1 
HETATM 8882 O  O   . HOH K 5 .   ? -11.576 30.038  59.917  1.00 50.30 ? 946 HOH A O   1 
HETATM 8883 O  O   . HOH K 5 .   ? 11.871  -2.311  34.326  1.00 39.67 ? 947 HOH A O   1 
HETATM 8884 O  O   . HOH K 5 .   ? -16.352 -0.252  47.472  1.00 48.50 ? 948 HOH A O   1 
HETATM 8885 O  O   . HOH K 5 .   ? 7.056   14.196  43.952  1.00 47.68 ? 949 HOH A O   1 
HETATM 8886 O  O   . HOH K 5 .   ? -12.493 1.059   29.912  1.00 45.60 ? 950 HOH A O   1 
HETATM 8887 O  O   . HOH K 5 .   ? -4.599  14.706  72.666  1.00 48.43 ? 951 HOH A O   1 
HETATM 8888 O  O   . HOH K 5 .   ? -0.525  23.262  45.350  1.00 51.54 ? 952 HOH A O   1 
HETATM 8889 O  O   . HOH K 5 .   ? -17.965 -14.627 28.887  1.00 47.13 ? 953 HOH A O   1 
HETATM 8890 O  O   . HOH K 5 .   ? -16.540 0.894   58.028  1.00 32.83 ? 954 HOH A O   1 
HETATM 8891 O  O   . HOH K 5 .   ? -9.210  36.343  59.359  1.00 50.05 ? 955 HOH A O   1 
HETATM 8892 O  O   . HOH K 5 .   ? 2.301   -9.872  30.967  1.00 43.28 ? 956 HOH A O   1 
HETATM 8893 O  O   . HOH K 5 .   ? 7.549   11.944  78.970  1.00 49.37 ? 957 HOH A O   1 
HETATM 8894 O  O   . HOH K 5 .   ? 10.607  8.853   41.449  1.00 41.38 ? 958 HOH A O   1 
HETATM 8895 O  O   . HOH K 5 .   ? 10.952  3.176   85.125  1.00 50.92 ? 959 HOH A O   1 
HETATM 8896 O  O   . HOH K 5 .   ? -1.443  21.251  73.036  1.00 51.19 ? 960 HOH A O   1 
HETATM 8897 O  O   . HOH K 5 .   ? -6.626  -16.101 40.593  1.00 50.52 ? 961 HOH A O   1 
HETATM 8898 O  O   . HOH K 5 .   ? 5.000   12.760  43.239  1.00 45.01 ? 962 HOH A O   1 
HETATM 8899 O  O   . HOH K 5 .   ? 14.698  -3.574  31.232  1.00 50.78 ? 963 HOH A O   1 
HETATM 8900 O  O   . HOH K 5 .   ? -1.787  15.518  42.762  1.00 44.37 ? 964 HOH A O   1 
HETATM 8901 O  O   . HOH K 5 .   ? 12.448  20.796  46.948  1.00 47.29 ? 965 HOH A O   1 
HETATM 8902 O  O   . HOH K 5 .   ? 29.660  -2.017  40.350  1.00 55.63 ? 966 HOH A O   1 
HETATM 8903 O  O   . HOH K 5 .   ? 8.496   16.540  44.169  1.00 46.58 ? 967 HOH A O   1 
HETATM 8904 O  O   . HOH K 5 .   ? 1.055   12.497  44.230  1.00 43.74 ? 968 HOH A O   1 
HETATM 8905 O  O   . HOH K 5 .   ? 11.372  -1.825  89.396  1.00 48.81 ? 969 HOH A O   1 
HETATM 8906 O  O   . HOH K 5 .   ? 9.454   20.698  45.390  1.00 48.34 ? 970 HOH A O   1 
HETATM 8907 O  O   . HOH K 5 .   ? 29.366  2.937   37.621  1.00 52.09 ? 971 HOH A O   1 
HETATM 8908 O  O   . HOH K 5 .   ? 27.141  5.640   52.340  1.00 44.61 ? 972 HOH A O   1 
HETATM 8909 O  O   . HOH K 5 .   ? -13.315 7.999   39.596  1.00 50.35 ? 973 HOH A O   1 
HETATM 8910 O  O   . HOH K 5 .   ? 6.719   -17.093 34.798  1.00 51.48 ? 974 HOH A O   1 
HETATM 8911 O  O   . HOH K 5 .   ? 15.672  -24.852 64.916  1.00 47.12 ? 975 HOH A O   1 
HETATM 8912 O  O   . HOH K 5 .   ? 10.696  14.881  43.062  1.00 39.86 ? 976 HOH A O   1 
HETATM 8913 O  O   . HOH K 5 .   ? 17.430  -23.711 52.623  1.00 58.69 ? 977 HOH A O   1 
HETATM 8914 O  O   . HOH K 5 .   ? -9.091  -16.511 32.582  1.00 54.14 ? 978 HOH A O   1 
HETATM 8915 O  O   . HOH K 5 .   ? 5.464   13.355  77.849  1.00 50.95 ? 979 HOH A O   1 
HETATM 8916 O  O   . HOH K 5 .   ? 6.603   -13.628 36.987  1.00 45.19 ? 980 HOH A O   1 
HETATM 8917 O  O   . HOH K 5 .   ? 12.415  18.582  42.704  1.00 46.10 ? 981 HOH A O   1 
HETATM 8918 O  O   . HOH K 5 .   ? -5.803  12.735  73.518  1.00 45.08 ? 982 HOH A O   1 
HETATM 8919 O  O   . HOH K 5 .   ? -9.231  -27.917 65.735  1.00 67.59 ? 983 HOH A O   1 
HETATM 8920 O  O   . HOH K 5 .   ? -11.254 -29.029 66.188  1.00 63.61 ? 984 HOH A O   1 
HETATM 8921 O  O   . HOH L 5 .   ? -28.213 -10.143 -8.514  1.00 40.05 ? 701 HOH B O   1 
HETATM 8922 O  O   . HOH L 5 .   ? 11.073  10.676  17.232  1.00 59.16 ? 702 HOH B O   1 
HETATM 8923 O  O   . HOH L 5 .   ? -0.973  -7.205  -35.528 1.00 54.66 ? 703 HOH B O   1 
HETATM 8924 O  O   . HOH L 5 .   ? -6.933  -9.844  21.870  1.00 33.62 ? 704 HOH B O   1 
HETATM 8925 O  O   . HOH L 5 .   ? -8.730  16.863  17.724  1.00 56.83 ? 705 HOH B O   1 
HETATM 8926 O  O   . HOH L 5 .   ? -0.637  -8.993  -37.244 1.00 54.66 ? 706 HOH B O   1 
HETATM 8927 O  O   . HOH L 5 .   ? -21.158 -19.538 -11.674 1.00 47.78 ? 707 HOH B O   1 
HETATM 8928 O  O   . HOH L 5 .   ? 19.160  0.219   10.395  1.00 38.97 ? 708 HOH B O   1 
HETATM 8929 O  O   . HOH L 5 .   ? 0.761   -2.125  -27.293 1.00 44.75 ? 709 HOH B O   1 
HETATM 8930 O  O   . HOH L 5 .   ? -6.585  1.890   10.152  1.00 39.93 ? 710 HOH B O   1 
HETATM 8931 O  O   . HOH L 5 .   ? -17.612 -23.768 0.634   1.00 46.20 ? 711 HOH B O   1 
HETATM 8932 O  O   . HOH L 5 .   ? -0.341  -5.994  -27.576 1.00 45.65 ? 712 HOH B O   1 
HETATM 8933 O  O   . HOH L 5 .   ? 13.341  -6.271  -13.931 1.00 46.04 ? 713 HOH B O   1 
HETATM 8934 O  O   . HOH L 5 .   ? -14.496 -23.960 -28.754 1.00 53.71 ? 714 HOH B O   1 
HETATM 8935 O  O   . HOH L 5 .   ? -34.559 -12.860 -26.846 1.00 47.87 ? 715 HOH B O   1 
HETATM 8936 O  O   . HOH L 5 .   ? -12.137 -23.973 -32.372 1.00 55.51 ? 716 HOH B O   1 
HETATM 8937 O  O   . HOH L 5 .   ? -21.205 -0.447  -15.293 1.00 35.27 ? 717 HOH B O   1 
HETATM 8938 O  O   . HOH L 5 .   ? -10.426 -3.893  -38.071 1.00 48.70 ? 718 HOH B O   1 
HETATM 8939 O  O   . HOH L 5 .   ? -28.208 -9.036  -23.609 1.00 49.44 ? 719 HOH B O   1 
HETATM 8940 O  O   . HOH L 5 .   ? -9.552  14.460  16.889  1.00 58.44 ? 720 HOH B O   1 
HETATM 8941 O  O   . HOH L 5 .   ? -20.943 3.542   9.372   1.00 38.83 ? 721 HOH B O   1 
HETATM 8942 O  O   . HOH L 5 .   ? -9.371  -15.593 -15.791 1.00 33.01 ? 722 HOH B O   1 
HETATM 8943 O  O   . HOH L 5 .   ? -27.861 -9.748  1.359   1.00 39.95 ? 723 HOH B O   1 
HETATM 8944 O  O   . HOH L 5 .   ? -14.893 -22.720 -10.555 1.00 35.58 ? 724 HOH B O   1 
HETATM 8945 O  O   . HOH L 5 .   ? 17.437  -16.316 -3.337  1.00 44.34 ? 725 HOH B O   1 
HETATM 8946 O  O   . HOH L 5 .   ? -17.763 1.471   -36.745 1.00 38.14 ? 726 HOH B O   1 
HETATM 8947 O  O   . HOH L 5 .   ? -2.584  13.162  -5.661  1.00 33.11 ? 727 HOH B O   1 
HETATM 8948 O  O   . HOH L 5 .   ? 7.990   -12.016 7.700   1.00 41.49 ? 728 HOH B O   1 
HETATM 8949 O  O   . HOH L 5 .   ? -2.677  19.054  -27.182 1.00 55.37 ? 729 HOH B O   1 
HETATM 8950 O  O   . HOH L 5 .   ? 3.089   -10.810 -20.136 1.00 45.76 ? 730 HOH B O   1 
HETATM 8951 O  O   . HOH L 5 .   ? -0.764  -11.615 -20.699 1.00 40.15 ? 731 HOH B O   1 
HETATM 8952 O  O   . HOH L 5 .   ? -8.142  -30.467 -7.875  1.00 48.77 ? 732 HOH B O   1 
HETATM 8953 O  O   . HOH L 5 .   ? -29.001 -3.493  -10.753 1.00 42.86 ? 733 HOH B O   1 
HETATM 8954 O  O   . HOH L 5 .   ? 0.484   6.889   -6.762  1.00 31.28 ? 734 HOH B O   1 
HETATM 8955 O  O   . HOH L 5 .   ? 4.733   5.869   -12.157 1.00 36.49 ? 735 HOH B O   1 
HETATM 8956 O  O   . HOH L 5 .   ? 16.271  -11.718 22.292  1.00 42.11 ? 736 HOH B O   1 
HETATM 8957 O  O   . HOH L 5 .   ? -19.050 -15.642 -27.693 1.00 43.08 ? 737 HOH B O   1 
HETATM 8958 O  O   . HOH L 5 .   ? -3.389  -24.134 2.376   1.00 38.90 ? 738 HOH B O   1 
HETATM 8959 O  O   . HOH L 5 .   ? -26.295 -17.335 -4.028  1.00 38.36 ? 739 HOH B O   1 
HETATM 8960 O  O   . HOH L 5 .   ? -27.617 -0.947  -14.718 1.00 41.17 ? 740 HOH B O   1 
HETATM 8961 O  O   . HOH L 5 .   ? -22.762 -17.741 16.356  1.00 47.86 ? 741 HOH B O   1 
HETATM 8962 O  O   . HOH L 5 .   ? 18.993  -9.106  8.060   1.00 44.18 ? 742 HOH B O   1 
HETATM 8963 O  O   . HOH L 5 .   ? -11.094 -21.203 -32.158 1.00 53.17 ? 743 HOH B O   1 
HETATM 8964 O  O   . HOH L 5 .   ? 9.178   -0.976  23.524  1.00 41.21 ? 744 HOH B O   1 
HETATM 8965 O  O   . HOH L 5 .   ? 8.803   -14.532 24.774  1.00 45.61 ? 745 HOH B O   1 
HETATM 8966 O  O   . HOH L 5 .   ? 19.038  -6.687  10.190  1.00 37.87 ? 746 HOH B O   1 
HETATM 8967 O  O   . HOH L 5 .   ? 3.128   -19.127 -7.306  1.00 38.27 ? 747 HOH B O   1 
HETATM 8968 O  O   . HOH L 5 .   ? 12.536  -6.480  -10.842 1.00 43.49 ? 748 HOH B O   1 
HETATM 8969 O  O   . HOH L 5 .   ? 12.949  19.535  -16.785 1.00 56.78 ? 749 HOH B O   1 
HETATM 8970 O  O   . HOH L 5 .   ? -7.627  7.072   2.103   1.00 33.79 ? 750 HOH B O   1 
HETATM 8971 O  O   . HOH L 5 .   ? 4.067   1.750   5.681   1.00 32.28 ? 751 HOH B O   1 
HETATM 8972 O  O   . HOH L 5 .   ? -1.573  -4.244  -11.521 1.00 30.66 ? 752 HOH B O   1 
HETATM 8973 O  O   . HOH L 5 .   ? 3.728   -27.265 -7.419  1.00 45.44 ? 753 HOH B O   1 
HETATM 8974 O  O   . HOH L 5 .   ? -33.948 -13.648 -28.873 1.00 48.32 ? 754 HOH B O   1 
HETATM 8975 O  O   . HOH L 5 .   ? -7.320  -8.281  -17.855 1.00 35.57 ? 755 HOH B O   1 
HETATM 8976 O  O   . HOH L 5 .   ? 12.059  -10.010 19.107  1.00 40.94 ? 756 HOH B O   1 
HETATM 8977 O  O   . HOH L 5 .   ? -4.579  19.837  -4.661  1.00 47.11 ? 757 HOH B O   1 
HETATM 8978 O  O   . HOH L 5 .   ? -14.334 -6.972  13.139  1.00 31.70 ? 758 HOH B O   1 
HETATM 8979 O  O   . HOH L 5 .   ? -7.674  -27.723 -15.181 1.00 50.53 ? 759 HOH B O   1 
HETATM 8980 O  O   . HOH L 5 .   ? -3.596  -9.161  -2.510  1.00 32.26 ? 760 HOH B O   1 
HETATM 8981 O  O   . HOH L 5 .   ? -23.298 7.512   -21.705 1.00 47.80 ? 761 HOH B O   1 
HETATM 8982 O  O   . HOH L 5 .   ? -24.274 -0.834  -15.269 1.00 30.20 ? 762 HOH B O   1 
HETATM 8983 O  O   . HOH L 5 .   ? -6.906  -10.223 -0.712  1.00 27.74 ? 763 HOH B O   1 
HETATM 8984 O  O   . HOH L 5 .   ? -4.048  -5.621  -8.767  1.00 31.19 ? 764 HOH B O   1 
HETATM 8985 O  O   . HOH L 5 .   ? 21.815  -4.261  12.335  1.00 44.27 ? 765 HOH B O   1 
HETATM 8986 O  O   . HOH L 5 .   ? 21.673  -1.839  11.105  1.00 40.02 ? 766 HOH B O   1 
HETATM 8987 O  O   . HOH L 5 .   ? 7.214   4.660   0.121   1.00 39.77 ? 767 HOH B O   1 
HETATM 8988 O  O   . HOH L 5 .   ? -12.885 8.532   -32.850 1.00 47.64 ? 768 HOH B O   1 
HETATM 8989 O  O   . HOH L 5 .   ? -22.953 -8.331  -10.383 1.00 35.79 ? 769 HOH B O   1 
HETATM 8990 O  O   . HOH L 5 .   ? -1.613  9.678   2.043   1.00 38.29 ? 770 HOH B O   1 
HETATM 8991 O  O   . HOH L 5 .   ? -0.249  -17.626 -4.718  1.00 39.85 ? 771 HOH B O   1 
HETATM 8992 O  O   . HOH L 5 .   ? -27.884 7.226   4.412   1.00 54.32 ? 772 HOH B O   1 
HETATM 8993 O  O   . HOH L 5 .   ? -29.533 -4.595  -26.595 1.00 49.55 ? 773 HOH B O   1 
HETATM 8994 O  O   . HOH L 5 .   ? -24.454 -5.506  6.868   1.00 32.03 ? 774 HOH B O   1 
HETATM 8995 O  O   . HOH L 5 .   ? 7.336   -5.422  -9.678  1.00 39.42 ? 775 HOH B O   1 
HETATM 8996 O  O   . HOH L 5 .   ? -0.687  16.109  -6.832  1.00 40.19 ? 776 HOH B O   1 
HETATM 8997 O  O   . HOH L 5 .   ? -20.558 -3.263  11.827  1.00 41.57 ? 777 HOH B O   1 
HETATM 8998 O  O   . HOH L 5 .   ? 2.193   -2.600  -14.831 1.00 34.70 ? 778 HOH B O   1 
HETATM 8999 O  O   . HOH L 5 .   ? 21.123  -3.732  7.964   1.00 35.41 ? 779 HOH B O   1 
HETATM 9000 O  O   . HOH L 5 .   ? -9.623  21.198  -25.172 1.00 64.82 ? 780 HOH B O   1 
HETATM 9001 O  O   . HOH L 5 .   ? -15.950 -25.230 -27.056 1.00 54.39 ? 781 HOH B O   1 
HETATM 9002 O  O   . HOH L 5 .   ? 0.864   19.401  2.621   1.00 47.16 ? 782 HOH B O   1 
HETATM 9003 O  O   . HOH L 5 .   ? 6.637   -1.689  -21.696 1.00 38.56 ? 783 HOH B O   1 
HETATM 9004 O  O   . HOH L 5 .   ? -4.757  -16.690 -23.711 1.00 45.26 ? 784 HOH B O   1 
HETATM 9005 O  O   . HOH L 5 .   ? 1.084   12.995  20.358  1.00 46.88 ? 785 HOH B O   1 
HETATM 9006 O  O   . HOH L 5 .   ? 11.239  6.812   18.704  1.00 46.81 ? 786 HOH B O   1 
HETATM 9007 O  O   . HOH L 5 .   ? -4.505  -0.031  -21.380 1.00 33.07 ? 787 HOH B O   1 
HETATM 9008 O  O   . HOH L 5 .   ? 13.817  -0.461  -10.079 1.00 37.57 ? 788 HOH B O   1 
HETATM 9009 O  O   . HOH L 5 .   ? -10.367 21.657  -9.349  1.00 53.06 ? 789 HOH B O   1 
HETATM 9010 O  O   . HOH L 5 .   ? 4.799   7.149   -6.384  1.00 37.39 ? 790 HOH B O   1 
HETATM 9011 O  O   . HOH L 5 .   ? -5.003  -27.355 -17.758 1.00 51.21 ? 791 HOH B O   1 
HETATM 9012 O  O   . HOH L 5 .   ? -25.475 -2.650  -21.909 1.00 37.27 ? 792 HOH B O   1 
HETATM 9013 O  O   . HOH L 5 .   ? 4.102   9.637   -12.522 1.00 37.11 ? 793 HOH B O   1 
HETATM 9014 O  O   . HOH L 5 .   ? -28.897 -1.820  3.357   1.00 35.86 ? 794 HOH B O   1 
HETATM 9015 O  O   . HOH L 5 .   ? -19.593 11.987  -7.390  1.00 48.34 ? 795 HOH B O   1 
HETATM 9016 O  O   . HOH L 5 .   ? 7.753   -26.704 -15.362 1.00 53.81 ? 796 HOH B O   1 
HETATM 9017 O  O   . HOH L 5 .   ? -1.535  -32.692 -7.209  1.00 52.90 ? 797 HOH B O   1 
HETATM 9018 O  O   . HOH L 5 .   ? -8.044  -3.706  -14.730 1.00 27.99 ? 798 HOH B O   1 
HETATM 9019 O  O   . HOH L 5 .   ? -20.453 4.917   -22.796 1.00 40.10 ? 799 HOH B O   1 
HETATM 9020 O  O   . HOH L 5 .   ? -6.589  -1.678  -21.070 1.00 34.84 ? 800 HOH B O   1 
HETATM 9021 O  O   . HOH L 5 .   ? -0.823  -9.180  6.477   1.00 41.28 ? 801 HOH B O   1 
HETATM 9022 O  O   . HOH L 5 .   ? -2.193  8.301   -20.138 1.00 36.59 ? 802 HOH B O   1 
HETATM 9023 O  O   . HOH L 5 .   ? 19.505  -6.634  17.761  1.00 36.24 ? 803 HOH B O   1 
HETATM 9024 O  O   . HOH L 5 .   ? -3.556  -12.075 -19.860 1.00 43.77 ? 804 HOH B O   1 
HETATM 9025 O  O   . HOH L 5 .   ? -2.992  12.646  -17.949 1.00 38.66 ? 805 HOH B O   1 
HETATM 9026 O  O   . HOH L 5 .   ? 2.129   8.901   5.769   1.00 41.75 ? 806 HOH B O   1 
HETATM 9027 O  O   . HOH L 5 .   ? -11.573 10.306  6.503   1.00 40.37 ? 807 HOH B O   1 
HETATM 9028 O  O   . HOH L 5 .   ? -23.880 -8.154  6.800   1.00 34.21 ? 808 HOH B O   1 
HETATM 9029 O  O   . HOH L 5 .   ? -28.026 -5.177  -4.876  1.00 47.44 ? 809 HOH B O   1 
HETATM 9030 O  O   . HOH L 5 .   ? -9.603  11.886  -22.713 1.00 39.19 ? 810 HOH B O   1 
HETATM 9031 O  O   . HOH L 5 .   ? 0.826   -17.863 -2.032  1.00 37.61 ? 811 HOH B O   1 
HETATM 9032 O  O   . HOH L 5 .   ? 0.102   7.289   -19.025 1.00 38.85 ? 812 HOH B O   1 
HETATM 9033 O  O   . HOH L 5 .   ? -17.818 -10.380 17.845  1.00 36.96 ? 813 HOH B O   1 
HETATM 9034 O  O   . HOH L 5 .   ? -24.768 -3.397  -12.375 1.00 31.02 ? 814 HOH B O   1 
HETATM 9035 O  O   . HOH L 5 .   ? 16.116  -15.461 21.015  1.00 44.30 ? 815 HOH B O   1 
HETATM 9036 O  O   . HOH L 5 .   ? 1.392   16.487  -22.488 1.00 46.82 ? 816 HOH B O   1 
HETATM 9037 O  O   . HOH L 5 .   ? 1.744   -8.147  6.960   1.00 39.71 ? 817 HOH B O   1 
HETATM 9038 O  O   . HOH L 5 .   ? 2.326   8.429   -8.152  1.00 38.01 ? 818 HOH B O   1 
HETATM 9039 O  O   . HOH L 5 .   ? -26.256 -2.465  -35.281 1.00 46.48 ? 819 HOH B O   1 
HETATM 9040 O  O   . HOH L 5 .   ? 17.928  -13.788 16.130  1.00 42.78 ? 820 HOH B O   1 
HETATM 9041 O  O   . HOH L 5 .   ? 10.015  8.045   8.067   1.00 45.01 ? 821 HOH B O   1 
HETATM 9042 O  O   . HOH L 5 .   ? -4.546  -8.353  16.476  1.00 34.83 ? 822 HOH B O   1 
HETATM 9043 O  O   . HOH L 5 .   ? 17.749  -1.166  -7.778  1.00 41.17 ? 823 HOH B O   1 
HETATM 9044 O  O   . HOH L 5 .   ? -2.781  1.337   -9.382  1.00 32.40 ? 824 HOH B O   1 
HETATM 9045 O  O   . HOH L 5 .   ? -23.390 -5.250  4.461   1.00 30.52 ? 825 HOH B O   1 
HETATM 9046 O  O   . HOH L 5 .   ? -2.560  -13.100 -39.365 1.00 64.90 ? 826 HOH B O   1 
HETATM 9047 O  O   . HOH L 5 .   ? 0.381   7.528   -0.752  1.00 29.52 ? 827 HOH B O   1 
HETATM 9048 O  O   . HOH L 5 .   ? 15.304  -3.490  1.621   1.00 40.01 ? 828 HOH B O   1 
HETATM 9049 O  O   . HOH L 5 .   ? 20.766  2.222   11.784  1.00 46.03 ? 829 HOH B O   1 
HETATM 9050 O  O   . HOH L 5 .   ? -11.746 -7.111  13.935  1.00 33.69 ? 830 HOH B O   1 
HETATM 9051 O  O   . HOH L 5 .   ? -6.290  6.233   -24.821 1.00 32.50 ? 831 HOH B O   1 
HETATM 9052 O  O   . HOH L 5 .   ? -3.079  -14.111 -36.670 1.00 62.74 ? 832 HOH B O   1 
HETATM 9053 O  O   . HOH L 5 .   ? 1.761   -9.421  15.554  1.00 40.31 ? 833 HOH B O   1 
HETATM 9054 O  O   . HOH L 5 .   ? -1.870  11.158  -19.997 1.00 37.33 ? 834 HOH B O   1 
HETATM 9055 O  O   . HOH L 5 .   ? -8.105  -22.607 7.960   1.00 44.89 ? 835 HOH B O   1 
HETATM 9056 O  O   . HOH L 5 .   ? 8.120   -3.622  -18.269 1.00 38.23 ? 836 HOH B O   1 
HETATM 9057 O  O   . HOH L 5 .   ? -1.392  -13.357 -8.259  1.00 32.59 ? 837 HOH B O   1 
HETATM 9058 O  O   . HOH L 5 .   ? -24.347 -22.702 -10.626 1.00 58.39 ? 838 HOH B O   1 
HETATM 9059 O  O   . HOH L 5 .   ? -27.305 -1.147  -8.206  1.00 40.48 ? 839 HOH B O   1 
HETATM 9060 O  O   . HOH L 5 .   ? 2.935   -2.708  -9.925  1.00 34.02 ? 840 HOH B O   1 
HETATM 9061 O  O   . HOH L 5 .   ? -17.903 -13.209 6.484   1.00 30.39 ? 841 HOH B O   1 
HETATM 9062 O  O   . HOH L 5 .   ? -9.174  -12.479 16.926  1.00 47.03 ? 842 HOH B O   1 
HETATM 9063 O  O   . HOH L 5 .   ? 10.672  -18.143 10.131  1.00 41.98 ? 843 HOH B O   1 
HETATM 9064 O  O   . HOH L 5 .   ? -11.590 17.108  -20.379 1.00 49.65 ? 844 HOH B O   1 
HETATM 9065 O  O   . HOH L 5 .   ? -27.672 2.462   -2.173  1.00 46.10 ? 845 HOH B O   1 
HETATM 9066 O  O   . HOH L 5 .   ? -26.252 -11.934 0.927   1.00 35.31 ? 846 HOH B O   1 
HETATM 9067 O  O   . HOH L 5 .   ? -6.679  -9.850  17.649  1.00 34.91 ? 847 HOH B O   1 
HETATM 9068 O  O   . HOH L 5 .   ? -20.925 -12.600 11.641  1.00 37.40 ? 848 HOH B O   1 
HETATM 9069 O  O   . HOH L 5 .   ? -23.922 -14.596 9.739   1.00 40.26 ? 849 HOH B O   1 
HETATM 9070 O  O   . HOH L 5 .   ? -0.584  -8.675  9.361   1.00 35.44 ? 850 HOH B O   1 
HETATM 9071 O  O   . HOH L 5 .   ? -2.017  0.631   -17.605 1.00 31.52 ? 851 HOH B O   1 
HETATM 9072 O  O   . HOH L 5 .   ? 6.055   9.583   2.626   1.00 42.42 ? 852 HOH B O   1 
HETATM 9073 O  O   . HOH L 5 .   ? -1.913  -11.249 9.352   1.00 42.91 ? 853 HOH B O   1 
HETATM 9074 O  O   . HOH L 5 .   ? -13.479 7.006   -38.025 1.00 49.91 ? 854 HOH B O   1 
HETATM 9075 O  O   . HOH L 5 .   ? -3.227  -33.455 0.130   1.00 43.56 ? 855 HOH B O   1 
HETATM 9076 O  O   . HOH L 5 .   ? 2.678   -15.757 -1.250  1.00 37.22 ? 856 HOH B O   1 
HETATM 9077 O  O   . HOH L 5 .   ? -9.751  -23.428 6.237   1.00 47.12 ? 857 HOH B O   1 
HETATM 9078 O  O   . HOH L 5 .   ? -14.996 -25.053 -11.249 1.00 39.50 ? 858 HOH B O   1 
HETATM 9079 O  O   . HOH L 5 .   ? -13.165 -25.035 -15.882 1.00 42.71 ? 859 HOH B O   1 
HETATM 9080 O  O   . HOH L 5 .   ? -17.405 -22.042 -4.311  1.00 35.84 ? 860 HOH B O   1 
HETATM 9081 O  O   . HOH L 5 .   ? -5.700  12.927  -7.486  1.00 35.50 ? 861 HOH B O   1 
HETATM 9082 O  O   . HOH L 5 .   ? -18.174 -18.640 15.313  1.00 53.12 ? 862 HOH B O   1 
HETATM 9083 O  O   . HOH L 5 .   ? 17.751  -4.253  2.504   1.00 44.92 ? 863 HOH B O   1 
HETATM 9084 O  O   . HOH L 5 .   ? -11.306 6.320   7.842   1.00 44.18 ? 864 HOH B O   1 
HETATM 9085 O  O   . HOH L 5 .   ? -20.809 4.298   -25.346 1.00 43.54 ? 865 HOH B O   1 
HETATM 9086 O  O   . HOH L 5 .   ? -7.517  -12.739 13.540  1.00 36.01 ? 866 HOH B O   1 
HETATM 9087 O  O   . HOH L 5 .   ? -25.570 -16.317 3.361   1.00 37.94 ? 867 HOH B O   1 
HETATM 9088 O  O   . HOH L 5 .   ? 20.149  -10.906 5.827   1.00 57.42 ? 868 HOH B O   1 
HETATM 9089 O  O   . HOH L 5 .   ? -23.971 7.055   -9.968  1.00 44.03 ? 869 HOH B O   1 
HETATM 9090 O  O   . HOH L 5 .   ? 11.812  -17.152 16.935  1.00 51.39 ? 870 HOH B O   1 
HETATM 9091 O  O   . HOH L 5 .   ? -8.513  5.180   -25.862 1.00 37.13 ? 871 HOH B O   1 
HETATM 9092 O  O   . HOH L 5 .   ? -15.542 13.361  -26.480 1.00 46.03 ? 872 HOH B O   1 
HETATM 9093 O  O   . HOH L 5 .   ? -8.280  -27.338 -1.737  1.00 42.38 ? 873 HOH B O   1 
HETATM 9094 O  O   . HOH L 5 .   ? -25.031 7.221   -15.799 1.00 40.76 ? 874 HOH B O   1 
HETATM 9095 O  O   . HOH L 5 .   ? -23.318 -20.331 -9.272  1.00 52.94 ? 875 HOH B O   1 
HETATM 9096 O  O   . HOH L 5 .   ? 1.252   -11.574 -14.648 1.00 38.20 ? 876 HOH B O   1 
HETATM 9097 O  O   . HOH L 5 .   ? -9.742  -14.041 14.541  1.00 38.66 ? 877 HOH B O   1 
HETATM 9098 O  O   . HOH L 5 .   ? -4.051  2.241   9.933   1.00 34.30 ? 878 HOH B O   1 
HETATM 9099 O  O   . HOH L 5 .   ? 3.547   -8.818  0.798   1.00 31.20 ? 879 HOH B O   1 
HETATM 9100 O  O   . HOH L 5 .   ? -10.952 11.776  4.114   1.00 44.52 ? 880 HOH B O   1 
HETATM 9101 O  O   . HOH L 5 .   ? -1.481  -26.268 -12.397 1.00 43.92 ? 881 HOH B O   1 
HETATM 9102 O  O   . HOH L 5 .   ? 3.278   8.160   -24.507 1.00 41.18 ? 882 HOH B O   1 
HETATM 9103 O  O   . HOH L 5 .   ? -1.940  -18.458 -18.178 1.00 44.39 ? 883 HOH B O   1 
HETATM 9104 O  O   . HOH L 5 .   ? 13.788  -2.867  8.821   1.00 30.44 ? 884 HOH B O   1 
HETATM 9105 O  O   . HOH L 5 .   ? -8.615  10.355  3.358   1.00 43.32 ? 885 HOH B O   1 
HETATM 9106 O  O   . HOH L 5 .   ? -1.456  7.351   -29.895 1.00 50.40 ? 886 HOH B O   1 
HETATM 9107 O  O   . HOH L 5 .   ? -15.016 -27.232 3.935   1.00 46.58 ? 887 HOH B O   1 
HETATM 9108 O  O   . HOH L 5 .   ? -17.341 -23.097 -24.810 1.00 59.27 ? 888 HOH B O   1 
HETATM 9109 O  O   . HOH L 5 .   ? 3.094   7.357   -14.123 1.00 37.60 ? 889 HOH B O   1 
HETATM 9110 O  O   . HOH L 5 .   ? 16.949  -8.540  -2.151  1.00 40.06 ? 890 HOH B O   1 
HETATM 9111 O  O   . HOH L 5 .   ? 1.028   -4.280  -11.618 1.00 33.99 ? 891 HOH B O   1 
HETATM 9112 O  O   . HOH L 5 .   ? -13.983 -9.742  11.849  1.00 30.94 ? 892 HOH B O   1 
HETATM 9113 O  O   . HOH L 5 .   ? 3.246   10.732  -24.894 1.00 38.06 ? 893 HOH B O   1 
HETATM 9114 O  O   . HOH L 5 .   ? -29.955 -3.940  4.474   1.00 42.14 ? 894 HOH B O   1 
HETATM 9115 O  O   . HOH L 5 .   ? 11.728  9.580   -8.416  1.00 42.51 ? 895 HOH B O   1 
HETATM 9116 O  O   . HOH L 5 .   ? -24.864 -7.778  -30.195 1.00 44.70 ? 896 HOH B O   1 
HETATM 9117 O  O   . HOH L 5 .   ? 13.740  -15.381 -4.589  1.00 44.50 ? 897 HOH B O   1 
HETATM 9118 O  O   . HOH L 5 .   ? -17.549 -27.971 1.732   1.00 56.18 ? 898 HOH B O   1 
HETATM 9119 O  O   . HOH L 5 .   ? -15.841 10.015  -15.893 1.00 35.98 ? 899 HOH B O   1 
HETATM 9120 O  O   . HOH L 5 .   ? 13.066  -19.425 1.435   1.00 48.52 ? 900 HOH B O   1 
HETATM 9121 O  O   . HOH L 5 .   ? -0.383  6.768   -16.544 1.00 35.85 ? 901 HOH B O   1 
HETATM 9122 O  O   . HOH L 5 .   ? 0.760   9.472   0.949   1.00 34.58 ? 902 HOH B O   1 
HETATM 9123 O  O   . HOH L 5 .   ? -2.984  -18.031 9.359   1.00 43.69 ? 903 HOH B O   1 
HETATM 9124 O  O   . HOH L 5 .   ? -27.660 0.263   -4.819  1.00 43.93 ? 904 HOH B O   1 
HETATM 9125 O  O   . HOH L 5 .   ? 12.922  -17.336 3.954   1.00 38.74 ? 905 HOH B O   1 
HETATM 9126 O  O   . HOH L 5 .   ? -8.779  17.748  1.625   1.00 45.52 ? 906 HOH B O   1 
HETATM 9127 O  O   . HOH L 5 .   ? 0.012   -22.465 3.067   1.00 42.85 ? 907 HOH B O   1 
HETATM 9128 O  O   . HOH L 5 .   ? -1.109  4.306   -30.218 1.00 48.08 ? 908 HOH B O   1 
HETATM 9129 O  O   . HOH L 5 .   ? -3.000  -4.299  23.481  1.00 38.92 ? 909 HOH B O   1 
HETATM 9130 O  O   . HOH L 5 .   ? -8.357  5.769   -28.646 1.00 36.96 ? 910 HOH B O   1 
HETATM 9131 O  O   . HOH L 5 .   ? 9.655   -9.151  19.179  1.00 37.91 ? 911 HOH B O   1 
HETATM 9132 O  O   . HOH L 5 .   ? -2.348  -15.876 -18.728 1.00 47.69 ? 912 HOH B O   1 
HETATM 9133 O  O   . HOH L 5 .   ? -12.208 -16.631 16.281  1.00 46.96 ? 913 HOH B O   1 
HETATM 9134 O  O   . HOH L 5 .   ? -30.341 -3.324  -21.365 1.00 43.62 ? 914 HOH B O   1 
HETATM 9135 O  O   . HOH L 5 .   ? 1.484   12.848  3.406   1.00 49.82 ? 915 HOH B O   1 
HETATM 9136 O  O   . HOH L 5 .   ? -13.360 -1.516  20.715  1.00 54.02 ? 916 HOH B O   1 
HETATM 9137 O  O   . HOH L 5 .   ? -2.543  -9.632  -27.302 1.00 40.57 ? 917 HOH B O   1 
HETATM 9138 O  O   . HOH L 5 .   ? -19.699 -13.139 -28.332 1.00 38.62 ? 918 HOH B O   1 
HETATM 9139 O  O   . HOH L 5 .   ? 1.076   6.275   -28.827 1.00 49.27 ? 919 HOH B O   1 
HETATM 9140 O  O   . HOH L 5 .   ? 20.736  -4.122  16.995  1.00 41.88 ? 920 HOH B O   1 
HETATM 9141 O  O   . HOH L 5 .   ? 12.849  -18.151 9.324   1.00 48.74 ? 921 HOH B O   1 
HETATM 9142 O  O   . HOH L 5 .   ? 6.620   -16.360 -10.523 1.00 48.20 ? 922 HOH B O   1 
HETATM 9143 O  O   . HOH L 5 .   ? -29.674 -7.620  -4.408  1.00 48.29 ? 923 HOH B O   1 
HETATM 9144 O  O   . HOH L 5 .   ? -9.417  4.682   8.573   1.00 36.46 ? 924 HOH B O   1 
HETATM 9145 O  O   . HOH L 5 .   ? 13.487  14.058  -15.413 1.00 44.34 ? 925 HOH B O   1 
HETATM 9146 O  O   . HOH L 5 .   ? -2.795  14.190  3.225   1.00 38.55 ? 926 HOH B O   1 
HETATM 9147 O  O   . HOH L 5 .   ? 19.282  -13.452 8.058   1.00 46.10 ? 927 HOH B O   1 
HETATM 9148 O  O   . HOH L 5 .   ? 11.827  9.830   15.126  1.00 54.23 ? 928 HOH B O   1 
HETATM 9149 O  O   . HOH L 5 .   ? 8.747   1.478   23.105  1.00 37.04 ? 929 HOH B O   1 
HETATM 9150 O  O   . HOH L 5 .   ? -26.885 3.031   -5.893  1.00 49.47 ? 930 HOH B O   1 
HETATM 9151 O  O   . HOH L 5 .   ? -3.052  -1.186  -19.166 1.00 31.77 ? 931 HOH B O   1 
HETATM 9152 O  O   . HOH L 5 .   ? 5.386   -17.286 -7.698  1.00 44.63 ? 932 HOH B O   1 
HETATM 9153 O  O   . HOH L 5 .   ? -18.536 6.191   -21.413 1.00 40.49 ? 933 HOH B O   1 
HETATM 9154 O  O   . HOH L 5 .   ? 5.448   -3.185  -10.782 1.00 42.19 ? 934 HOH B O   1 
HETATM 9155 O  O   . HOH L 5 .   ? -25.793 -0.791  -31.253 1.00 45.50 ? 935 HOH B O   1 
HETATM 9156 O  O   . HOH L 5 .   ? 4.736   16.302  -24.281 1.00 50.62 ? 936 HOH B O   1 
HETATM 9157 O  O   . HOH L 5 .   ? -9.564  16.186  15.361  1.00 61.08 ? 937 HOH B O   1 
HETATM 9158 O  O   . HOH L 5 .   ? -22.220 2.089   -36.270 1.00 51.62 ? 938 HOH B O   1 
HETATM 9159 O  O   . HOH L 5 .   ? 5.492   -15.137 -8.976  1.00 43.81 ? 939 HOH B O   1 
HETATM 9160 O  O   . HOH L 5 .   ? -23.953 -8.182  -32.843 1.00 44.97 ? 940 HOH B O   1 
HETATM 9161 O  O   . HOH L 5 .   ? 1.253   27.534  -7.481  1.00 60.22 ? 941 HOH B O   1 
HETATM 9162 O  O   . HOH L 5 .   ? -4.946  -22.346 -21.565 1.00 44.23 ? 942 HOH B O   1 
HETATM 9163 O  O   . HOH L 5 .   ? -25.517 -6.726  10.808  1.00 36.97 ? 943 HOH B O   1 
HETATM 9164 O  O   . HOH L 5 .   ? 16.588  -0.418  -10.140 1.00 31.44 ? 944 HOH B O   1 
HETATM 9165 O  O   . HOH L 5 .   ? 1.066   21.749  2.008   1.00 49.09 ? 945 HOH B O   1 
HETATM 9166 O  O   . HOH L 5 .   ? -10.378 -29.064 -8.883  1.00 47.65 ? 946 HOH B O   1 
HETATM 9167 O  O   . HOH L 5 .   ? 11.794  -20.125 -3.165  1.00 54.97 ? 947 HOH B O   1 
HETATM 9168 O  O   . HOH L 5 .   ? -2.526  -9.860  16.580  1.00 46.52 ? 948 HOH B O   1 
HETATM 9169 O  O   . HOH L 5 .   ? -7.745  8.394   5.173   1.00 44.58 ? 949 HOH B O   1 
HETATM 9170 O  O   . HOH L 5 .   ? -27.938 -2.080  -5.672  1.00 46.47 ? 950 HOH B O   1 
HETATM 9171 O  O   . HOH L 5 .   ? -5.317  10.254  4.482   1.00 44.14 ? 951 HOH B O   1 
HETATM 9172 O  O   . HOH L 5 .   ? 16.845  -15.682 15.418  1.00 49.24 ? 952 HOH B O   1 
HETATM 9173 O  O   . HOH L 5 .   ? -6.506  -1.378  -33.820 1.00 46.56 ? 953 HOH B O   1 
HETATM 9174 O  O   . HOH L 5 .   ? 5.089   13.976  -24.838 1.00 53.09 ? 954 HOH B O   1 
HETATM 9175 O  O   . HOH L 5 .   ? -8.510  3.503   22.517  1.00 38.74 ? 955 HOH B O   1 
HETATM 9176 O  O   . HOH L 5 .   ? -18.261 8.748   -17.246 1.00 39.93 ? 956 HOH B O   1 
HETATM 9177 O  O   . HOH L 5 .   ? -22.898 4.457   -34.165 1.00 50.45 ? 957 HOH B O   1 
HETATM 9178 O  O   . HOH L 5 .   ? -28.793 -16.683 -3.175  1.00 48.48 ? 958 HOH B O   1 
HETATM 9179 O  O   . HOH L 5 .   ? -2.556  -23.550 4.731   1.00 48.74 ? 959 HOH B O   1 
HETATM 9180 O  O   . HOH L 5 .   ? -26.226 -19.290 2.803   1.00 33.07 ? 960 HOH B O   1 
HETATM 9181 O  O   . HOH L 5 .   ? -20.829 4.661   -35.059 1.00 43.32 ? 961 HOH B O   1 
HETATM 9182 O  O   . HOH L 5 .   ? -8.078  0.056   -35.108 1.00 53.52 ? 962 HOH B O   1 
HETATM 9183 O  O   . HOH L 5 .   ? -8.945  13.931  13.837  1.00 60.53 ? 963 HOH B O   1 
HETATM 9184 O  O   . HOH L 5 .   ? -4.880  -13.713 -24.307 1.00 45.41 ? 964 HOH B O   1 
HETATM 9185 O  O   . HOH L 5 .   ? -0.397  27.591  -25.298 1.00 60.16 ? 965 HOH B O   1 
HETATM 9186 O  O   . HOH L 5 .   ? -15.107 12.406  -16.115 1.00 49.40 ? 966 HOH B O   1 
HETATM 9187 O  O   . HOH L 5 .   ? -10.115 7.989   6.221   1.00 43.80 ? 967 HOH B O   1 
HETATM 9188 O  O   . HOH L 5 .   ? -11.175 -6.282  -37.868 1.00 49.08 ? 968 HOH B O   1 
HETATM 9189 O  O   . HOH L 5 .   ? -8.455  15.639  3.384   1.00 47.98 ? 969 HOH B O   1 
HETATM 9190 O  O   . HOH L 5 .   ? -1.141  12.376  3.509   1.00 46.24 ? 970 HOH B O   1 
HETATM 9191 O  O   . HOH L 5 .   ? 13.803  -19.139 -2.340  1.00 48.31 ? 971 HOH B O   1 
HETATM 9192 O  O   . HOH L 5 .   ? -26.402 -8.807  8.333   1.00 46.48 ? 972 HOH B O   1 
HETATM 9193 O  O   . HOH L 5 .   ? -9.571  19.895  2.684   1.00 52.94 ? 973 HOH B O   1 
HETATM 9194 O  O   . HOH L 5 .   ? -10.494 14.448  4.574   1.00 47.37 ? 974 HOH B O   1 
HETATM 9195 O  O   . HOH L 5 .   ? -26.352 -14.010 9.614   1.00 40.97 ? 975 HOH B O   1 
HETATM 9196 O  O   . HOH L 5 .   ? -19.128 8.658   -20.745 1.00 46.92 ? 976 HOH B O   1 
HETATM 9197 O  O   . HOH L 5 .   ? -1.926  -15.836 -39.160 1.00 53.61 ? 977 HOH B O   1 
HETATM 9198 O  O   . HOH L 5 .   ? -1.538  -35.286 -8.017  1.00 60.81 ? 978 HOH B O   1 
HETATM 9199 O  O   . HOH L 5 .   ? 0.386   27.829  -27.751 1.00 57.55 ? 979 HOH B O   1 
HETATM 9200 O  O   . HOH L 5 .   ? -6.362  11.134  6.209   1.00 51.87 ? 980 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
B 1 1   ASP 1   1   ?   ?   ?   B . n 
B 1 2   ASP 2   2   ?   ?   ?   B . n 
B 1 3   HIS 3   3   ?   ?   ?   B . n 
B 1 4   SER 4   4   4   SER SER B . n 
B 1 5   GLU 5   5   5   GLU GLU B . n 
B 1 6   LEU 6   6   6   LEU LEU B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   VAL 8   8   8   VAL VAL B . n 
B 1 9   ASN 9   9   9   ASN ASN B . n 
B 1 10  THR 10  10  10  THR THR B . n 
B 1 11  LYS 11  11  11  LYS LYS B . n 
B 1 12  SER 12  12  12  SER SER B . n 
B 1 13  GLY 13  13  13  GLY GLY B . n 
B 1 14  LYS 14  14  14  LYS LYS B . n 
B 1 15  VAL 15  15  15  VAL VAL B . n 
B 1 16  MET 16  16  16  MET MET B . n 
B 1 17  GLY 17  17  17  GLY GLY B . n 
B 1 18  THR 18  18  18  THR THR B . n 
B 1 19  ARG 19  19  19  ARG ARG B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  PRO 21  21  21  PRO PRO B . n 
B 1 22  VAL 22  22  22  VAL VAL B . n 
B 1 23  LEU 23  23  23  LEU LEU B . n 
B 1 24  SER 24  24  24  SER SER B . n 
B 1 25  SER 25  25  25  SER SER B . n 
B 1 26  HIS 26  26  26  HIS HIS B . n 
B 1 27  ILE 27  27  27  ILE ILE B . n 
B 1 28  SER 28  28  28  SER SER B . n 
B 1 29  ALA 29  29  29  ALA ALA B . n 
B 1 30  PHE 30  30  30  PHE PHE B . n 
B 1 31  LEU 31  31  31  LEU LEU B . n 
B 1 32  GLY 32  32  32  GLY GLY B . n 
B 1 33  ILE 33  33  33  ILE ILE B . n 
B 1 34  PRO 34  34  34  PRO PRO B . n 
B 1 35  PHE 35  35  35  PHE PHE B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  GLU 37  37  37  GLU GLU B . n 
B 1 38  PRO 38  38  38  PRO PRO B . n 
B 1 39  PRO 39  39  39  PRO PRO B . n 
B 1 40  VAL 40  40  40  VAL VAL B . n 
B 1 41  GLY 41  41  41  GLY GLY B . n 
B 1 42  ASN 42  42  42  ASN ASN B . n 
B 1 43  MET 43  43  43  MET MET B . n 
B 1 44  ARG 44  44  44  ARG ARG B . n 
B 1 45  PHE 45  45  45  PHE PHE B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  ARG 47  47  47  ARG ARG B . n 
B 1 48  PRO 48  48  48  PRO PRO B . n 
B 1 49  GLU 49  49  49  GLU GLU B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  LYS 52  52  52  LYS LYS B . n 
B 1 53  PRO 53  53  53  PRO PRO B . n 
B 1 54  TRP 54  54  54  TRP TRP B . n 
B 1 55  SER 55  55  55  SER SER B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  VAL 57  57  57  VAL VAL B . n 
B 1 58  TRP 58  58  58  TRP TRP B . n 
B 1 59  ASN 59  59  59  ASN ASN B . n 
B 1 60  ALA 60  60  60  ALA ALA B . n 
B 1 61  SER 61  61  61  SER SER B . n 
B 1 62  THR 62  62  62  THR THR B . n 
B 1 63  TYR 63  63  63  TYR TYR B . n 
B 1 64  PRO 64  64  64  PRO PRO B . n 
B 1 65  ASN 65  65  65  ASN ASN B . n 
B 1 66  ASN 66  66  66  ASN ASN B . n 
B 1 67  CYS 67  67  67  CYS CYS B . n 
B 1 68  GLN 68  68  68  GLN GLN B . n 
B 1 69  GLN 69  69  69  GLN GLN B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  VAL 71  71  71  VAL VAL B . n 
B 1 72  ASP 72  72  72  ASP ASP B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  GLN 74  74  74  GLN GLN B . n 
B 1 75  PHE 75  75  75  PHE PHE B . n 
B 1 76  PRO 76  76  76  PRO PRO B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  PHE 78  78  78  PHE PHE B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  GLY 80  80  80  GLY GLY B . n 
B 1 81  SER 81  81  81  SER SER B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  MET 83  83  83  MET MET B . n 
B 1 84  TRP 84  84  84  TRP TRP B . n 
B 1 85  ASN 85  85  85  ASN ASN B . n 
B 1 86  PRO 86  86  86  PRO PRO B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  ARG 88  88  88  ARG ARG B . n 
B 1 89  GLU 89  89  89  GLU GLU B . n 
B 1 90  MET 90  90  90  MET MET B . n 
B 1 91  SER 91  91  91  SER SER B . n 
B 1 92  GLU 92  92  92  GLU GLU B . n 
B 1 93  ASP 93  93  93  ASP ASP B . n 
B 1 94  CYS 94  94  94  CYS CYS B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  TYR 96  96  96  TYR TYR B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  ASN 98  98  98  ASN ASN B . n 
B 1 99  ILE 99  99  99  ILE ILE B . n 
B 1 100 TRP 100 100 100 TRP TRP B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 PRO 102 102 102 PRO PRO B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 ARG 105 105 105 ARG ARG B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 THR 109 109 109 THR THR B . n 
B 1 110 THR 110 110 110 THR THR B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 MET 112 112 112 MET MET B . n 
B 1 113 VAL 113 113 113 VAL VAL B . n 
B 1 114 TRP 114 114 114 TRP TRP B . n 
B 1 115 ILE 115 115 115 ILE ILE B . n 
B 1 116 TYR 116 116 116 TYR TYR B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 GLY 118 118 118 GLY GLY B . n 
B 1 119 GLY 119 119 119 GLY GLY B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 TYR 121 121 121 TYR TYR B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 GLY 123 123 123 GLY GLY B . n 
B 1 124 SER 124 124 124 SER SER B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 THR 126 126 126 THR THR B . n 
B 1 127 LEU 127 127 127 LEU LEU B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 VAL 129 129 129 VAL VAL B . n 
B 1 130 TYR 130 130 130 TYR TYR B . n 
B 1 131 ASN 131 131 131 ASN ASN B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 LYS 133 133 133 LYS LYS B . n 
B 1 134 TYR 134 134 134 TYR TYR B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 TYR 137 137 137 TYR TYR B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 GLU 140 140 140 GLU GLU B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 VAL 144 144 144 VAL VAL B . n 
B 1 145 SER 145 145 145 SER SER B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 SER 147 147 147 SER SER B . n 
B 1 148 TYR 148 148 148 TYR TYR B . n 
B 1 149 ARG 149 149 149 ARG ARG B . n 
B 1 150 VAL 150 150 150 VAL VAL B . n 
B 1 151 GLY 151 151 151 GLY GLY B . n 
B 1 152 ALA 152 152 152 ALA ALA B . n 
B 1 153 PHE 153 153 153 PHE PHE B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 PHE 155 155 155 PHE PHE B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 LEU 158 158 158 LEU LEU B . n 
B 1 159 HIS 159 159 159 HIS HIS B . n 
B 1 160 GLY 160 160 160 GLY GLY B . n 
B 1 161 SER 161 161 161 SER SER B . n 
B 1 162 GLN 162 162 162 GLN GLN B . n 
B 1 163 GLU 163 163 163 GLU GLU B . n 
B 1 164 ALA 164 164 164 ALA ALA B . n 
B 1 165 PRO 165 165 165 PRO PRO B . n 
B 1 166 GLY 166 166 166 GLY GLY B . n 
B 1 167 ASN 167 167 167 ASN ASN B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 LEU 171 171 171 LEU LEU B . n 
B 1 172 ASP 172 172 172 ASP ASP B . n 
B 1 173 GLN 173 173 173 GLN GLN B . n 
B 1 174 ARG 174 174 174 ARG ARG B . n 
B 1 175 MET 175 175 175 MET MET B . n 
B 1 176 ALA 176 176 176 ALA ALA B . n 
B 1 177 LEU 177 177 177 LEU LEU B . n 
B 1 178 GLN 178 178 178 GLN GLN B . n 
B 1 179 TRP 179 179 179 TRP TRP B . n 
B 1 180 VAL 180 180 180 VAL VAL B . n 
B 1 181 HIS 181 181 181 HIS HIS B . n 
B 1 182 ASP 182 182 182 ASP ASP B . n 
B 1 183 ASN 183 183 183 ASN ASN B . n 
B 1 184 ILE 184 184 184 ILE ILE B . n 
B 1 185 GLN 185 185 185 GLN GLN B . n 
B 1 186 PHE 186 186 186 PHE PHE B . n 
B 1 187 PHE 187 187 187 PHE PHE B . n 
B 1 188 GLY 188 188 188 GLY GLY B . n 
B 1 189 GLY 189 189 189 GLY GLY B . n 
B 1 190 ASP 190 190 190 ASP ASP B . n 
B 1 191 PRO 191 191 191 PRO PRO B . n 
B 1 192 LYS 192 192 192 LYS LYS B . n 
B 1 193 THR 193 193 193 THR THR B . n 
B 1 194 VAL 194 194 194 VAL VAL B . n 
B 1 195 THR 195 195 195 THR THR B . n 
B 1 196 ILE 196 196 196 ILE ILE B . n 
B 1 197 PHE 197 197 197 PHE PHE B . n 
B 1 198 GLY 198 198 198 GLY GLY B . n 
B 1 199 GLU 199 199 199 GLU GLU B . n 
B 1 200 SER 200 200 200 SER SER B . n 
B 1 201 ALA 201 201 201 ALA ALA B . n 
B 1 202 GLY 202 202 202 GLY GLY B . n 
B 1 203 GLY 203 203 203 GLY GLY B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 SER 205 205 205 SER SER B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 GLY 207 207 207 GLY GLY B . n 
B 1 208 MET 208 208 208 MET MET B . n 
B 1 209 HIS 209 209 209 HIS HIS B . n 
B 1 210 ILE 210 210 210 ILE ILE B . n 
B 1 211 LEU 211 211 211 LEU LEU B . n 
B 1 212 SER 212 212 212 SER SER B . n 
B 1 213 PRO 213 213 213 PRO PRO B . n 
B 1 214 GLY 214 214 214 GLY GLY B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 ARG 216 216 216 ARG ARG B . n 
B 1 217 ASP 217 217 217 ASP ASP B . n 
B 1 218 LEU 218 218 218 LEU LEU B . n 
B 1 219 PHE 219 219 219 PHE PHE B . n 
B 1 220 ARG 220 220 220 ARG ARG B . n 
B 1 221 ARG 221 221 221 ARG ARG B . n 
B 1 222 ALA 222 222 222 ALA ALA B . n 
B 1 223 ILE 223 223 223 ILE ILE B . n 
B 1 224 LEU 224 224 224 LEU LEU B . n 
B 1 225 GLN 225 225 225 GLN GLN B . n 
B 1 226 SER 226 226 226 SER SER B . n 
B 1 227 GLY 227 227 227 GLY GLY B . n 
B 1 228 SER 228 228 228 SER SER B . n 
B 1 229 PRO 229 229 229 PRO PRO B . n 
B 1 230 ASN 230 230 230 ASN ASN B . n 
B 1 231 CYS 231 231 231 CYS CYS B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 TRP 233 233 233 TRP TRP B . n 
B 1 234 ALA 234 234 234 ALA ALA B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 VAL 236 236 236 VAL VAL B . n 
B 1 237 SER 237 237 237 SER SER B . n 
B 1 238 VAL 238 238 238 VAL VAL B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 GLU 240 240 240 GLU GLU B . n 
B 1 241 GLY 241 241 241 GLY GLY B . n 
B 1 242 ARG 242 242 242 ARG ARG B . n 
B 1 243 ARG 243 243 243 ARG ARG B . n 
B 1 244 ARG 244 244 244 ARG ARG B . n 
B 1 245 ALA 245 245 245 ALA ALA B . n 
B 1 246 VAL 246 246 246 VAL VAL B . n 
B 1 247 GLU 247 247 247 GLU GLU B . n 
B 1 248 LEU 248 248 248 LEU LEU B . n 
B 1 249 GLY 249 249 249 GLY GLY B . n 
B 1 250 ARG 250 250 250 ARG ARG B . n 
B 1 251 ASN 251 251 251 ASN ASN B . n 
B 1 252 LEU 252 252 252 LEU LEU B . n 
B 1 253 ASN 253 253 253 ASN ASN B . n 
B 1 254 CYS 254 254 254 CYS CYS B . n 
B 1 255 ASN 255 255 255 ASN ASN B . n 
B 1 256 LEU 256 256 256 LEU LEU B . n 
B 1 257 ASN 257 257 257 ASN ASN B . n 
B 1 258 SER 258 258 258 SER SER B . n 
B 1 259 ASP 259 259 259 ASP ASP B . n 
B 1 260 GLU 260 260 260 GLU GLU B . n 
B 1 261 GLU 261 261 261 GLU GLU B . n 
B 1 262 LEU 262 262 262 LEU LEU B . n 
B 1 263 ILE 263 263 263 ILE ILE B . n 
B 1 264 HIS 264 264 264 HIS HIS B . n 
B 1 265 CYS 265 265 265 CYS CYS B . n 
B 1 266 LEU 266 266 266 LEU LEU B . n 
B 1 267 ARG 267 267 267 ARG ARG B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LYS 269 269 269 LYS LYS B . n 
B 1 270 LYS 270 270 270 LYS LYS B . n 
B 1 271 PRO 271 271 271 PRO PRO B . n 
B 1 272 GLN 272 272 272 GLN GLN B . n 
B 1 273 GLU 273 273 273 GLU GLU B . n 
B 1 274 LEU 274 274 274 LEU LEU B . n 
B 1 275 ILE 275 275 275 ILE ILE B . n 
B 1 276 ASP 276 276 276 ASP ASP B . n 
B 1 277 VAL 277 277 277 VAL VAL B . n 
B 1 278 GLU 278 278 278 GLU GLU B . n 
B 1 279 TRP 279 279 279 TRP TRP B . n 
B 1 280 ASN 280 280 280 ASN ASN B . n 
B 1 281 VAL 281 281 281 VAL VAL B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 PRO 283 283 283 PRO PRO B . n 
B 1 284 PHE 284 284 284 PHE PHE B . n 
B 1 285 ASP 285 285 285 ASP ASP B . n 
B 1 286 SER 286 286 286 SER SER B . n 
B 1 287 ILE 287 287 287 ILE ILE B . n 
B 1 288 PHE 288 288 288 PHE PHE B . n 
B 1 289 ARG 289 289 289 ARG ARG B . n 
B 1 290 PHE 290 290 290 PHE PHE B . n 
B 1 291 SER 291 291 291 SER SER B . n 
B 1 292 PHE 292 292 292 PHE PHE B . n 
B 1 293 VAL 293 293 293 VAL VAL B . n 
B 1 294 PRO 294 294 294 PRO PRO B . n 
B 1 295 VAL 295 295 295 VAL VAL B . n 
B 1 296 ILE 296 296 296 ILE ILE B . n 
B 1 297 ASP 297 297 297 ASP ASP B . n 
B 1 298 GLY 298 298 298 GLY GLY B . n 
B 1 299 GLU 299 299 299 GLU GLU B . n 
B 1 300 PHE 300 300 300 PHE PHE B . n 
B 1 301 PHE 301 301 301 PHE PHE B . n 
B 1 302 PRO 302 302 302 PRO PRO B . n 
B 1 303 THR 303 303 303 THR THR B . n 
B 1 304 SER 304 304 304 SER SER B . n 
B 1 305 LEU 305 305 305 LEU LEU B . n 
B 1 306 GLU 306 306 306 GLU GLU B . n 
B 1 307 SER 307 307 307 SER SER B . n 
B 1 308 MET 308 308 308 MET MET B . n 
B 1 309 LEU 309 309 309 LEU LEU B . n 
B 1 310 ASN 310 310 310 ASN ASN B . n 
B 1 311 SER 311 311 311 SER SER B . n 
B 1 312 GLY 312 312 312 GLY GLY B . n 
B 1 313 ASN 313 313 313 ASN ASN B . n 
B 1 314 PHE 314 314 314 PHE PHE B . n 
B 1 315 LYS 315 315 315 LYS LYS B . n 
B 1 316 LYS 316 316 316 LYS LYS B . n 
B 1 317 THR 317 317 317 THR THR B . n 
B 1 318 GLN 318 318 318 GLN GLN B . n 
B 1 319 ILE 319 319 319 ILE ILE B . n 
B 1 320 LEU 320 320 320 LEU LEU B . n 
B 1 321 LEU 321 321 321 LEU LEU B . n 
B 1 322 GLY 322 322 322 GLY GLY B . n 
B 1 323 VAL 323 323 323 VAL VAL B . n 
B 1 324 ASN 324 324 324 ASN ASN B . n 
B 1 325 LYS 325 325 325 LYS LYS B . n 
B 1 326 ASP 326 326 326 ASP ASP B . n 
B 1 327 GLU 327 327 327 GLU GLU B . n 
B 1 328 GLY 328 328 328 GLY GLY B . n 
B 1 329 SER 329 329 329 SER SER B . n 
B 1 330 PHE 330 330 330 PHE PHE B . n 
B 1 331 PHE 331 331 331 PHE PHE B . n 
B 1 332 LEU 332 332 332 LEU LEU B . n 
B 1 333 LEU 333 333 333 LEU LEU B . n 
B 1 334 TYR 334 334 334 TYR TYR B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 ALA 336 336 336 ALA ALA B . n 
B 1 337 PRO 337 337 337 PRO PRO B . n 
B 1 338 GLY 338 338 338 GLY GLY B . n 
B 1 339 PHE 339 339 339 PHE PHE B . n 
B 1 340 SER 340 340 340 SER SER B . n 
B 1 341 LYS 341 341 341 LYS LYS B . n 
B 1 342 ASP 342 342 342 ASP ASP B . n 
B 1 343 SER 343 343 343 SER SER B . n 
B 1 344 GLU 344 344 344 GLU GLU B . n 
B 1 345 SER 345 345 345 SER SER B . n 
B 1 346 LYS 346 346 346 LYS LYS B . n 
B 1 347 ILE 347 347 347 ILE ILE B . n 
B 1 348 SER 348 348 348 SER SER B . n 
B 1 349 ARG 349 349 349 ARG ARG B . n 
B 1 350 GLU 350 350 350 GLU GLU B . n 
B 1 351 ASP 351 351 351 ASP ASP B . n 
B 1 352 PHE 352 352 352 PHE PHE B . n 
B 1 353 MET 353 353 353 MET MET B . n 
B 1 354 SER 354 354 354 SER SER B . n 
B 1 355 GLY 355 355 355 GLY GLY B . n 
B 1 356 VAL 356 356 356 VAL VAL B . n 
B 1 357 LYS 357 357 357 LYS LYS B . n 
B 1 358 LEU 358 358 358 LEU LEU B . n 
B 1 359 SER 359 359 359 SER SER B . n 
B 1 360 VAL 360 360 360 VAL VAL B . n 
B 1 361 PRO 361 361 361 PRO PRO B . n 
B 1 362 HIS 362 362 362 HIS HIS B . n 
B 1 363 ALA 363 363 363 ALA ALA B . n 
B 1 364 ASN 364 364 364 ASN ASN B . n 
B 1 365 ASP 365 365 365 ASP ASP B . n 
B 1 366 LEU 366 366 366 LEU LEU B . n 
B 1 367 GLY 367 367 367 GLY GLY B . n 
B 1 368 LEU 368 368 368 LEU LEU B . n 
B 1 369 ASP 369 369 369 ASP ASP B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 VAL 371 371 371 VAL VAL B . n 
B 1 372 THR 372 372 372 THR THR B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 GLN 374 374 374 GLN GLN B . n 
B 1 375 TYR 375 375 375 TYR TYR B . n 
B 1 376 THR 376 376 376 THR THR B . n 
B 1 377 ASP 377 377 377 ASP ASP B . n 
B 1 378 TRP 378 378 378 TRP TRP B . n 
B 1 379 MET 379 379 379 MET MET B . n 
B 1 380 ASP 380 380 380 ASP ASP B . n 
B 1 381 ASP 381 381 381 ASP ASP B . n 
B 1 382 ASN 382 382 382 ASN ASN B . n 
B 1 383 ASN 383 383 383 ASN ASN B . n 
B 1 384 GLY 384 384 384 GLY GLY B . n 
B 1 385 ILE 385 385 385 ILE ILE B . n 
B 1 386 LYS 386 386 386 LYS LYS B . n 
B 1 387 ASN 387 387 387 ASN ASN B . n 
B 1 388 ARG 388 388 388 ARG ARG B . n 
B 1 389 ASP 389 389 389 ASP ASP B . n 
B 1 390 GLY 390 390 390 GLY GLY B . n 
B 1 391 LEU 391 391 391 LEU LEU B . n 
B 1 392 ASP 392 392 392 ASP ASP B . n 
B 1 393 ASP 393 393 393 ASP ASP B . n 
B 1 394 ILE 394 394 394 ILE ILE B . n 
B 1 395 VAL 395 395 395 VAL VAL B . n 
B 1 396 GLY 396 396 396 GLY GLY B . n 
B 1 397 ASP 397 397 397 ASP ASP B . n 
B 1 398 HIS 398 398 398 HIS HIS B . n 
B 1 399 ASN 399 399 399 ASN ASN B . n 
B 1 400 VAL 400 400 400 VAL VAL B . n 
B 1 401 ILE 401 401 401 ILE ILE B . n 
B 1 402 CYS 402 402 402 CYS CYS B . n 
B 1 403 PRO 403 403 403 PRO PRO B . n 
B 1 404 LEU 404 404 404 LEU LEU B . n 
B 1 405 MET 405 405 405 MET MET B . n 
B 1 406 HIS 406 406 406 HIS HIS B . n 
B 1 407 PHE 407 407 407 PHE PHE B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 ASN 409 409 409 ASN ASN B . n 
B 1 410 LYS 410 410 410 LYS LYS B . n 
B 1 411 TYR 411 411 411 TYR TYR B . n 
B 1 412 THR 412 412 412 THR THR B . n 
B 1 413 LYS 413 413 413 LYS LYS B . n 
B 1 414 PHE 414 414 414 PHE PHE B . n 
B 1 415 GLY 415 415 415 GLY GLY B . n 
B 1 416 ASN 416 416 416 ASN ASN B . n 
B 1 417 GLY 417 417 417 GLY GLY B . n 
B 1 418 THR 418 418 418 THR THR B . n 
B 1 419 TYR 419 419 419 TYR TYR B . n 
B 1 420 LEU 420 420 420 LEU LEU B . n 
B 1 421 TYR 421 421 421 TYR TYR B . n 
B 1 422 PHE 422 422 422 PHE PHE B . n 
B 1 423 PHE 423 423 423 PHE PHE B . n 
B 1 424 ASN 424 424 424 ASN ASN B . n 
B 1 425 HIS 425 425 425 HIS HIS B . n 
B 1 426 ARG 426 426 426 ARG ARG B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 SER 428 428 428 SER SER B . n 
B 1 429 ASN 429 429 429 ASN ASN B . n 
B 1 430 LEU 430 430 430 LEU LEU B . n 
B 1 431 VAL 431 431 431 VAL VAL B . n 
B 1 432 TRP 432 432 432 TRP TRP B . n 
B 1 433 PRO 433 433 433 PRO PRO B . n 
B 1 434 GLU 434 434 434 GLU GLU B . n 
B 1 435 TRP 435 435 435 TRP TRP B . n 
B 1 436 MET 436 436 436 MET MET B . n 
B 1 437 GLY 437 437 437 GLY GLY B . n 
B 1 438 VAL 438 438 438 VAL VAL B . n 
B 1 439 ILE 439 439 439 ILE ILE B . n 
B 1 440 HIS 440 440 440 HIS HIS B . n 
B 1 441 GLY 441 441 441 GLY GLY B . n 
B 1 442 TYR 442 442 442 TYR TYR B . n 
B 1 443 GLU 443 443 443 GLU GLU B . n 
B 1 444 ILE 444 444 444 ILE ILE B . n 
B 1 445 GLU 445 445 445 GLU GLU B . n 
B 1 446 PHE 446 446 446 PHE PHE B . n 
B 1 447 VAL 447 447 447 VAL VAL B . n 
B 1 448 PHE 448 448 448 PHE PHE B . n 
B 1 449 GLY 449 449 449 GLY GLY B . n 
B 1 450 LEU 450 450 450 LEU LEU B . n 
B 1 451 PRO 451 451 451 PRO PRO B . n 
B 1 452 LEU 452 452 452 LEU LEU B . n 
B 1 453 VAL 453 453 453 VAL VAL B . n 
B 1 454 LYS 454 454 454 LYS LYS B . n 
B 1 455 GLU 455 455 455 GLU GLU B . n 
B 1 456 LEU 456 456 456 LEU LEU B . n 
B 1 457 ASN 457 457 457 ASN ASN B . n 
B 1 458 TYR 458 458 458 TYR TYR B . n 
B 1 459 THR 459 459 459 THR THR B . n 
B 1 460 ALA 460 460 460 ALA ALA B . n 
B 1 461 GLU 461 461 461 GLU GLU B . n 
B 1 462 GLU 462 462 462 GLU GLU B . n 
B 1 463 GLU 463 463 463 GLU GLU B . n 
B 1 464 ALA 464 464 464 ALA ALA B . n 
B 1 465 LEU 465 465 465 LEU LEU B . n 
B 1 466 SER 466 466 466 SER SER B . n 
B 1 467 ARG 467 467 467 ARG ARG B . n 
B 1 468 ARG 468 468 468 ARG ARG B . n 
B 1 469 ILE 469 469 469 ILE ILE B . n 
B 1 470 MET 470 470 470 MET MET B . n 
B 1 471 HIS 471 471 471 HIS HIS B . n 
B 1 472 TYR 472 472 472 TYR TYR B . n 
B 1 473 TRP 473 473 473 TRP TRP B . n 
B 1 474 ALA 474 474 474 ALA ALA B . n 
B 1 475 THR 475 475 475 THR THR B . n 
B 1 476 PHE 476 476 476 PHE PHE B . n 
B 1 477 ALA 477 477 477 ALA ALA B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 THR 479 479 479 THR THR B . n 
B 1 480 GLY 480 480 480 GLY GLY B . n 
B 1 481 ASN 481 481 481 ASN ASN B . n 
B 1 482 PRO 482 482 482 PRO PRO B . n 
B 1 483 ASN 483 483 483 ASN ASN B . n 
B 1 484 GLU 484 484 484 GLU GLU B . n 
B 1 485 PRO 485 485 485 PRO PRO B . n 
B 1 486 HIS 486 486 486 HIS HIS B . n 
B 1 487 SER 487 487 487 SER SER B . n 
B 1 488 GLN 488 488 488 GLN GLN B . n 
B 1 489 GLU 489 489 489 GLU GLU B . n 
B 1 490 SER 490 490 490 SER SER B . n 
B 1 491 LYS 491 491 491 LYS LYS B . n 
B 1 492 TRP 492 492 492 TRP TRP B . n 
B 1 493 PRO 493 493 493 PRO PRO B . n 
B 1 494 LEU 494 494 494 LEU LEU B . n 
B 1 495 PHE 495 495 495 PHE PHE B . n 
B 1 496 THR 496 496 496 THR THR B . n 
B 1 497 THR 497 497 497 THR THR B . n 
B 1 498 LYS 498 498 498 LYS LYS B . n 
B 1 499 GLU 499 499 499 GLU GLU B . n 
B 1 500 GLN 500 500 500 GLN GLN B . n 
B 1 501 LYS 501 501 501 LYS LYS B . n 
B 1 502 PHE 502 502 502 PHE PHE B . n 
B 1 503 ILE 503 503 503 ILE ILE B . n 
B 1 504 ASP 504 504 504 ASP ASP B . n 
B 1 505 LEU 505 505 505 LEU LEU B . n 
B 1 506 ASN 506 506 506 ASN ASN B . n 
B 1 507 THR 507 507 507 THR THR B . n 
B 1 508 GLU 508 508 508 GLU GLU B . n 
B 1 509 PRO 509 509 509 PRO PRO B . n 
B 1 510 MET 510 510 510 MET MET B . n 
B 1 511 LYS 511 511 511 LYS LYS B . n 
B 1 512 VAL 512 512 512 VAL VAL B . n 
B 1 513 HIS 513 513 513 HIS HIS B . n 
B 1 514 GLN 514 514 514 GLN GLN B . n 
B 1 515 ARG 515 515 515 ARG ARG B . n 
B 1 516 LEU 516 516 516 LEU LEU B . n 
B 1 517 ARG 517 517 517 ARG ARG B . n 
B 1 518 VAL 518 518 518 VAL VAL B . n 
B 1 519 GLN 519 519 519 GLN GLN B . n 
B 1 520 MET 520 520 520 MET MET B . n 
B 1 521 CYS 521 521 521 CYS CYS B . n 
B 1 522 VAL 522 522 522 VAL VAL B . n 
B 1 523 PHE 523 523 523 PHE PHE B . n 
B 1 524 TRP 524 524 524 TRP TRP B . n 
B 1 525 ASN 525 525 525 ASN ASN B . n 
B 1 526 GLN 526 526 526 GLN GLN B . n 
B 1 527 PHE 527 527 527 PHE PHE B . n 
B 1 528 LEU 528 528 528 LEU LEU B . n 
B 1 529 PRO 529 529 529 PRO PRO B . n 
B 1 530 LYS 530 530 530 LYS LYS B . n 
B 1 531 LEU 531 531 531 LEU LEU B . n 
B 1 532 LEU 532 532 532 LEU LEU B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ALA 534 534 534 ALA ALA B . n 
B 1 535 THR 535 535 535 THR THR B . n 
B 1 536 ALA 536 536 ?   ?   ?   B . n 
B 1 537 CYS 537 537 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1   601 1536 NAG NAG A . 
D 2 NAG 1   602 1537 NAG NAG A . 
E 3 C6K 1   603 2    C6K LIG A . 
F 2 NAG 1   601 1536 NAG NAG B . 
G 2 NAG 1   602 1537 NAG NAG B . 
H 3 C6K 1   603 1    C6K LIG B . 
I 4 PEG 1   604 1    PEG PEG B . 
J 4 PEG 1   605 2    PEG PEG B . 
K 5 HOH 1   701 427  HOH HOH A . 
K 5 HOH 2   702 86   HOH HOH A . 
K 5 HOH 3   703 233  HOH HOH A . 
K 5 HOH 4   704 153  HOH HOH A . 
K 5 HOH 5   705 385  HOH HOH A . 
K 5 HOH 6   706 149  HOH HOH A . 
K 5 HOH 7   707 380  HOH HOH A . 
K 5 HOH 8   708 295  HOH HOH A . 
K 5 HOH 9   709 525  HOH HOH A . 
K 5 HOH 10  710 189  HOH HOH A . 
K 5 HOH 11  711 20   HOH HOH A . 
K 5 HOH 12  712 36   HOH HOH A . 
K 5 HOH 13  713 109  HOH HOH A . 
K 5 HOH 14  714 497  HOH HOH A . 
K 5 HOH 15  715 59   HOH HOH A . 
K 5 HOH 16  716 224  HOH HOH A . 
K 5 HOH 17  717 73   HOH HOH A . 
K 5 HOH 18  718 282  HOH HOH A . 
K 5 HOH 19  719 99   HOH HOH A . 
K 5 HOH 20  720 393  HOH HOH A . 
K 5 HOH 21  721 52   HOH HOH A . 
K 5 HOH 22  722 565  HOH HOH A . 
K 5 HOH 23  723 204  HOH HOH A . 
K 5 HOH 24  724 250  HOH HOH A . 
K 5 HOH 25  725 290  HOH HOH A . 
K 5 HOH 26  726 48   HOH HOH A . 
K 5 HOH 27  727 80   HOH HOH A . 
K 5 HOH 28  728 349  HOH HOH A . 
K 5 HOH 29  729 519  HOH HOH A . 
K 5 HOH 30  730 72   HOH HOH A . 
K 5 HOH 31  731 352  HOH HOH A . 
K 5 HOH 32  732 63   HOH HOH A . 
K 5 HOH 33  733 389  HOH HOH A . 
K 5 HOH 34  734 199  HOH HOH A . 
K 5 HOH 35  735 184  HOH HOH A . 
K 5 HOH 36  736 15   HOH HOH A . 
K 5 HOH 37  737 76   HOH HOH A . 
K 5 HOH 38  738 18   HOH HOH A . 
K 5 HOH 39  739 308  HOH HOH A . 
K 5 HOH 40  740 64   HOH HOH A . 
K 5 HOH 41  741 269  HOH HOH A . 
K 5 HOH 42  742 532  HOH HOH A . 
K 5 HOH 43  743 384  HOH HOH A . 
K 5 HOH 44  744 386  HOH HOH A . 
K 5 HOH 45  745 42   HOH HOH A . 
K 5 HOH 46  746 383  HOH HOH A . 
K 5 HOH 47  747 146  HOH HOH A . 
K 5 HOH 48  748 28   HOH HOH A . 
K 5 HOH 49  749 564  HOH HOH A . 
K 5 HOH 50  750 39   HOH HOH A . 
K 5 HOH 51  751 23   HOH HOH A . 
K 5 HOH 52  752 118  HOH HOH A . 
K 5 HOH 53  753 220  HOH HOH A . 
K 5 HOH 54  754 339  HOH HOH A . 
K 5 HOH 55  755 4    HOH HOH A . 
K 5 HOH 56  756 535  HOH HOH A . 
K 5 HOH 57  757 217  HOH HOH A . 
K 5 HOH 58  758 538  HOH HOH A . 
K 5 HOH 59  759 79   HOH HOH A . 
K 5 HOH 60  760 196  HOH HOH A . 
K 5 HOH 61  761 340  HOH HOH A . 
K 5 HOH 62  762 57   HOH HOH A . 
K 5 HOH 63  763 231  HOH HOH A . 
K 5 HOH 64  764 347  HOH HOH A . 
K 5 HOH 65  765 430  HOH HOH A . 
K 5 HOH 66  766 528  HOH HOH A . 
K 5 HOH 67  767 115  HOH HOH A . 
K 5 HOH 68  768 249  HOH HOH A . 
K 5 HOH 69  769 97   HOH HOH A . 
K 5 HOH 70  770 318  HOH HOH A . 
K 5 HOH 71  771 445  HOH HOH A . 
K 5 HOH 72  772 183  HOH HOH A . 
K 5 HOH 73  773 314  HOH HOH A . 
K 5 HOH 74  774 465  HOH HOH A . 
K 5 HOH 75  775 91   HOH HOH A . 
K 5 HOH 76  776 56   HOH HOH A . 
K 5 HOH 77  777 577  HOH HOH A . 
K 5 HOH 78  778 200  HOH HOH A . 
K 5 HOH 79  779 135  HOH HOH A . 
K 5 HOH 80  780 180  HOH HOH A . 
K 5 HOH 81  781 373  HOH HOH A . 
K 5 HOH 82  782 55   HOH HOH A . 
K 5 HOH 83  783 516  HOH HOH A . 
K 5 HOH 84  784 34   HOH HOH A . 
K 5 HOH 85  785 260  HOH HOH A . 
K 5 HOH 86  786 542  HOH HOH A . 
K 5 HOH 87  787 14   HOH HOH A . 
K 5 HOH 88  788 87   HOH HOH A . 
K 5 HOH 89  789 5    HOH HOH A . 
K 5 HOH 90  790 433  HOH HOH A . 
K 5 HOH 91  791 304  HOH HOH A . 
K 5 HOH 92  792 422  HOH HOH A . 
K 5 HOH 93  793 221  HOH HOH A . 
K 5 HOH 94  794 252  HOH HOH A . 
K 5 HOH 95  795 124  HOH HOH A . 
K 5 HOH 96  796 139  HOH HOH A . 
K 5 HOH 97  797 278  HOH HOH A . 
K 5 HOH 98  798 281  HOH HOH A . 
K 5 HOH 99  799 168  HOH HOH A . 
K 5 HOH 100 800 65   HOH HOH A . 
K 5 HOH 101 801 421  HOH HOH A . 
K 5 HOH 102 802 359  HOH HOH A . 
K 5 HOH 103 803 21   HOH HOH A . 
K 5 HOH 104 804 75   HOH HOH A . 
K 5 HOH 105 805 29   HOH HOH A . 
K 5 HOH 106 806 209  HOH HOH A . 
K 5 HOH 107 807 78   HOH HOH A . 
K 5 HOH 108 808 469  HOH HOH A . 
K 5 HOH 109 809 206  HOH HOH A . 
K 5 HOH 110 810 534  HOH HOH A . 
K 5 HOH 111 811 235  HOH HOH A . 
K 5 HOH 112 812 503  HOH HOH A . 
K 5 HOH 113 813 211  HOH HOH A . 
K 5 HOH 114 814 502  HOH HOH A . 
K 5 HOH 115 815 467  HOH HOH A . 
K 5 HOH 116 816 113  HOH HOH A . 
K 5 HOH 117 817 472  HOH HOH A . 
K 5 HOH 118 818 98   HOH HOH A . 
K 5 HOH 119 819 447  HOH HOH A . 
K 5 HOH 120 820 247  HOH HOH A . 
K 5 HOH 121 821 22   HOH HOH A . 
K 5 HOH 122 822 353  HOH HOH A . 
K 5 HOH 123 823 494  HOH HOH A . 
K 5 HOH 124 824 411  HOH HOH A . 
K 5 HOH 125 825 89   HOH HOH A . 
K 5 HOH 126 826 107  HOH HOH A . 
K 5 HOH 127 827 45   HOH HOH A . 
K 5 HOH 128 828 35   HOH HOH A . 
K 5 HOH 129 829 102  HOH HOH A . 
K 5 HOH 130 830 215  HOH HOH A . 
K 5 HOH 131 831 145  HOH HOH A . 
K 5 HOH 132 832 1    HOH HOH A . 
K 5 HOH 133 833 262  HOH HOH A . 
K 5 HOH 134 834 83   HOH HOH A . 
K 5 HOH 135 835 30   HOH HOH A . 
K 5 HOH 136 836 354  HOH HOH A . 
K 5 HOH 137 837 248  HOH HOH A . 
K 5 HOH 138 838 194  HOH HOH A . 
K 5 HOH 139 839 92   HOH HOH A . 
K 5 HOH 140 840 492  HOH HOH A . 
K 5 HOH 141 841 26   HOH HOH A . 
K 5 HOH 142 842 356  HOH HOH A . 
K 5 HOH 143 843 11   HOH HOH A . 
K 5 HOH 144 844 171  HOH HOH A . 
K 5 HOH 145 845 441  HOH HOH A . 
K 5 HOH 146 846 51   HOH HOH A . 
K 5 HOH 147 847 105  HOH HOH A . 
K 5 HOH 148 848 438  HOH HOH A . 
K 5 HOH 149 849 367  HOH HOH A . 
K 5 HOH 150 850 313  HOH HOH A . 
K 5 HOH 151 851 512  HOH HOH A . 
K 5 HOH 152 852 219  HOH HOH A . 
K 5 HOH 153 853 167  HOH HOH A . 
K 5 HOH 154 854 62   HOH HOH A . 
K 5 HOH 155 855 208  HOH HOH A . 
K 5 HOH 156 856 562  HOH HOH A . 
K 5 HOH 157 857 136  HOH HOH A . 
K 5 HOH 158 858 131  HOH HOH A . 
K 5 HOH 159 859 7    HOH HOH A . 
K 5 HOH 160 860 293  HOH HOH A . 
K 5 HOH 161 861 37   HOH HOH A . 
K 5 HOH 162 862 259  HOH HOH A . 
K 5 HOH 163 863 60   HOH HOH A . 
K 5 HOH 164 864 40   HOH HOH A . 
K 5 HOH 165 865 127  HOH HOH A . 
K 5 HOH 166 866 450  HOH HOH A . 
K 5 HOH 167 867 111  HOH HOH A . 
K 5 HOH 168 868 397  HOH HOH A . 
K 5 HOH 169 869 101  HOH HOH A . 
K 5 HOH 170 870 298  HOH HOH A . 
K 5 HOH 171 871 148  HOH HOH A . 
K 5 HOH 172 872 326  HOH HOH A . 
K 5 HOH 173 873 128  HOH HOH A . 
K 5 HOH 174 874 507  HOH HOH A . 
K 5 HOH 175 875 517  HOH HOH A . 
K 5 HOH 176 876 317  HOH HOH A . 
K 5 HOH 177 877 573  HOH HOH A . 
K 5 HOH 178 878 431  HOH HOH A . 
K 5 HOH 179 879 33   HOH HOH A . 
K 5 HOH 180 880 123  HOH HOH A . 
K 5 HOH 181 881 192  HOH HOH A . 
K 5 HOH 182 882 395  HOH HOH A . 
K 5 HOH 183 883 552  HOH HOH A . 
K 5 HOH 184 884 499  HOH HOH A . 
K 5 HOH 185 885 277  HOH HOH A . 
K 5 HOH 186 886 158  HOH HOH A . 
K 5 HOH 187 887 342  HOH HOH A . 
K 5 HOH 188 888 193  HOH HOH A . 
K 5 HOH 189 889 435  HOH HOH A . 
K 5 HOH 190 890 346  HOH HOH A . 
K 5 HOH 191 891 446  HOH HOH A . 
K 5 HOH 192 892 461  HOH HOH A . 
K 5 HOH 193 893 285  HOH HOH A . 
K 5 HOH 194 894 366  HOH HOH A . 
K 5 HOH 195 895 390  HOH HOH A . 
K 5 HOH 196 896 529  HOH HOH A . 
K 5 HOH 197 897 280  HOH HOH A . 
K 5 HOH 198 898 408  HOH HOH A . 
K 5 HOH 199 899 457  HOH HOH A . 
K 5 HOH 200 900 142  HOH HOH A . 
K 5 HOH 201 901 537  HOH HOH A . 
K 5 HOH 202 902 330  HOH HOH A . 
K 5 HOH 203 903 137  HOH HOH A . 
K 5 HOH 204 904 338  HOH HOH A . 
K 5 HOH 205 905 205  HOH HOH A . 
K 5 HOH 206 906 524  HOH HOH A . 
K 5 HOH 207 907 172  HOH HOH A . 
K 5 HOH 208 908 541  HOH HOH A . 
K 5 HOH 209 909 555  HOH HOH A . 
K 5 HOH 210 910 329  HOH HOH A . 
K 5 HOH 211 911 265  HOH HOH A . 
K 5 HOH 212 912 511  HOH HOH A . 
K 5 HOH 213 913 440  HOH HOH A . 
K 5 HOH 214 914 536  HOH HOH A . 
K 5 HOH 215 915 426  HOH HOH A . 
K 5 HOH 216 916 143  HOH HOH A . 
K 5 HOH 217 917 93   HOH HOH A . 
K 5 HOH 218 918 355  HOH HOH A . 
K 5 HOH 219 919 428  HOH HOH A . 
K 5 HOH 220 920 396  HOH HOH A . 
K 5 HOH 221 921 132  HOH HOH A . 
K 5 HOH 222 922 413  HOH HOH A . 
K 5 HOH 223 923 581  HOH HOH A . 
K 5 HOH 224 924 417  HOH HOH A . 
K 5 HOH 225 925 307  HOH HOH A . 
K 5 HOH 226 926 312  HOH HOH A . 
K 5 HOH 227 927 415  HOH HOH A . 
K 5 HOH 228 928 551  HOH HOH A . 
K 5 HOH 229 929 539  HOH HOH A . 
K 5 HOH 230 930 365  HOH HOH A . 
K 5 HOH 231 931 491  HOH HOH A . 
K 5 HOH 232 932 319  HOH HOH A . 
K 5 HOH 233 933 505  HOH HOH A . 
K 5 HOH 234 934 579  HOH HOH A . 
K 5 HOH 235 935 351  HOH HOH A . 
K 5 HOH 236 936 575  HOH HOH A . 
K 5 HOH 237 937 496  HOH HOH A . 
K 5 HOH 238 938 439  HOH HOH A . 
K 5 HOH 239 939 404  HOH HOH A . 
K 5 HOH 240 940 173  HOH HOH A . 
K 5 HOH 241 941 569  HOH HOH A . 
K 5 HOH 242 942 273  HOH HOH A . 
K 5 HOH 243 943 242  HOH HOH A . 
K 5 HOH 244 944 527  HOH HOH A . 
K 5 HOH 245 945 480  HOH HOH A . 
K 5 HOH 246 946 578  HOH HOH A . 
K 5 HOH 247 947 567  HOH HOH A . 
K 5 HOH 248 948 357  HOH HOH A . 
K 5 HOH 249 949 582  HOH HOH A . 
K 5 HOH 250 950 459  HOH HOH A . 
K 5 HOH 251 951 258  HOH HOH A . 
K 5 HOH 252 952 485  HOH HOH A . 
K 5 HOH 253 953 476  HOH HOH A . 
K 5 HOH 254 954 256  HOH HOH A . 
K 5 HOH 255 955 543  HOH HOH A . 
K 5 HOH 256 956 279  HOH HOH A . 
K 5 HOH 257 957 471  HOH HOH A . 
K 5 HOH 258 958 548  HOH HOH A . 
K 5 HOH 259 959 412  HOH HOH A . 
K 5 HOH 260 960 510  HOH HOH A . 
K 5 HOH 261 961 484  HOH HOH A . 
K 5 HOH 262 962 337  HOH HOH A . 
K 5 HOH 263 963 568  HOH HOH A . 
K 5 HOH 264 964 370  HOH HOH A . 
K 5 HOH 265 965 574  HOH HOH A . 
K 5 HOH 266 966 462  HOH HOH A . 
K 5 HOH 267 967 483  HOH HOH A . 
K 5 HOH 268 968 580  HOH HOH A . 
K 5 HOH 269 969 561  HOH HOH A . 
K 5 HOH 270 970 251  HOH HOH A . 
K 5 HOH 271 971 533  HOH HOH A . 
K 5 HOH 272 972 521  HOH HOH A . 
K 5 HOH 273 973 372  HOH HOH A . 
K 5 HOH 274 974 481  HOH HOH A . 
K 5 HOH 275 975 489  HOH HOH A . 
K 5 HOH 276 976 468  HOH HOH A . 
K 5 HOH 277 977 501  HOH HOH A . 
K 5 HOH 278 978 363  HOH HOH A . 
K 5 HOH 279 979 394  HOH HOH A . 
K 5 HOH 280 980 311  HOH HOH A . 
K 5 HOH 281 981 453  HOH HOH A . 
K 5 HOH 282 982 420  HOH HOH A . 
K 5 HOH 283 983 182  HOH HOH A . 
K 5 HOH 284 984 244  HOH HOH A . 
L 5 HOH 1   701 47   HOH HOH B . 
L 5 HOH 2   702 566  HOH HOH B . 
L 5 HOH 3   703 341  HOH HOH B . 
L 5 HOH 4   704 267  HOH HOH B . 
L 5 HOH 5   705 320  HOH HOH B . 
L 5 HOH 6   706 310  HOH HOH B . 
L 5 HOH 7   707 513  HOH HOH B . 
L 5 HOH 8   708 175  HOH HOH B . 
L 5 HOH 9   709 549  HOH HOH B . 
L 5 HOH 10  710 161  HOH HOH B . 
L 5 HOH 11  711 434  HOH HOH B . 
L 5 HOH 12  712 518  HOH HOH B . 
L 5 HOH 13  713 456  HOH HOH B . 
L 5 HOH 14  714 436  HOH HOH B . 
L 5 HOH 15  715 179  HOH HOH B . 
L 5 HOH 16  716 490  HOH HOH B . 
L 5 HOH 17  717 74   HOH HOH B . 
L 5 HOH 18  718 119  HOH HOH B . 
L 5 HOH 19  719 401  HOH HOH B . 
L 5 HOH 20  720 103  HOH HOH B . 
L 5 HOH 21  721 126  HOH HOH B . 
L 5 HOH 22  722 31   HOH HOH B . 
L 5 HOH 23  723 150  HOH HOH B . 
L 5 HOH 24  724 69   HOH HOH B . 
L 5 HOH 25  725 442  HOH HOH B . 
L 5 HOH 26  726 58   HOH HOH B . 
L 5 HOH 27  727 95   HOH HOH B . 
L 5 HOH 28  728 210  HOH HOH B . 
L 5 HOH 29  729 557  HOH HOH B . 
L 5 HOH 30  730 545  HOH HOH B . 
L 5 HOH 31  731 414  HOH HOH B . 
L 5 HOH 32  732 190  HOH HOH B . 
L 5 HOH 33  733 207  HOH HOH B . 
L 5 HOH 34  734 152  HOH HOH B . 
L 5 HOH 35  735 43   HOH HOH B . 
L 5 HOH 36  736 230  HOH HOH B . 
L 5 HOH 37  737 121  HOH HOH B . 
L 5 HOH 38  738 9    HOH HOH B . 
L 5 HOH 39  739 82   HOH HOH B . 
L 5 HOH 40  740 88   HOH HOH B . 
L 5 HOH 41  741 437  HOH HOH B . 
L 5 HOH 42  742 416  HOH HOH B . 
L 5 HOH 43  743 563  HOH HOH B . 
L 5 HOH 44  744 406  HOH HOH B . 
L 5 HOH 45  745 263  HOH HOH B . 
L 5 HOH 46  746 151  HOH HOH B . 
L 5 HOH 47  747 68   HOH HOH B . 
L 5 HOH 48  748 129  HOH HOH B . 
L 5 HOH 49  749 225  HOH HOH B . 
L 5 HOH 50  750 24   HOH HOH B . 
L 5 HOH 51  751 66   HOH HOH B . 
L 5 HOH 52  752 94   HOH HOH B . 
L 5 HOH 53  753 291  HOH HOH B . 
L 5 HOH 54  754 185  HOH HOH B . 
L 5 HOH 55  755 12   HOH HOH B . 
L 5 HOH 56  756 90   HOH HOH B . 
L 5 HOH 57  757 44   HOH HOH B . 
L 5 HOH 58  758 302  HOH HOH B . 
L 5 HOH 59  759 198  HOH HOH B . 
L 5 HOH 60  760 2    HOH HOH B . 
L 5 HOH 61  761 186  HOH HOH B . 
L 5 HOH 62  762 305  HOH HOH B . 
L 5 HOH 63  763 17   HOH HOH B . 
L 5 HOH 64  764 166  HOH HOH B . 
L 5 HOH 65  765 272  HOH HOH B . 
L 5 HOH 66  766 67   HOH HOH B . 
L 5 HOH 67  767 324  HOH HOH B . 
L 5 HOH 68  768 350  HOH HOH B . 
L 5 HOH 69  769 253  HOH HOH B . 
L 5 HOH 70  770 147  HOH HOH B . 
L 5 HOH 71  771 134  HOH HOH B . 
L 5 HOH 72  772 283  HOH HOH B . 
L 5 HOH 73  773 170  HOH HOH B . 
L 5 HOH 74  774 187  HOH HOH B . 
L 5 HOH 75  775 174  HOH HOH B . 
L 5 HOH 76  776 177  HOH HOH B . 
L 5 HOH 77  777 409  HOH HOH B . 
L 5 HOH 78  778 8    HOH HOH B . 
L 5 HOH 79  779 515  HOH HOH B . 
L 5 HOH 80  780 458  HOH HOH B . 
L 5 HOH 81  781 531  HOH HOH B . 
L 5 HOH 82  782 297  HOH HOH B . 
L 5 HOH 83  783 348  HOH HOH B . 
L 5 HOH 84  784 181  HOH HOH B . 
L 5 HOH 85  785 271  HOH HOH B . 
L 5 HOH 86  786 475  HOH HOH B . 
L 5 HOH 87  787 133  HOH HOH B . 
L 5 HOH 88  788 368  HOH HOH B . 
L 5 HOH 89  789 246  HOH HOH B . 
L 5 HOH 90  790 70   HOH HOH B . 
L 5 HOH 91  791 323  HOH HOH B . 
L 5 HOH 92  792 32   HOH HOH B . 
L 5 HOH 93  793 163  HOH HOH B . 
L 5 HOH 94  794 176  HOH HOH B . 
L 5 HOH 95  795 376  HOH HOH B . 
L 5 HOH 96  796 509  HOH HOH B . 
L 5 HOH 97  797 294  HOH HOH B . 
L 5 HOH 98  798 3    HOH HOH B . 
L 5 HOH 99  799 130  HOH HOH B . 
L 5 HOH 100 800 240  HOH HOH B . 
L 5 HOH 101 801 378  HOH HOH B . 
L 5 HOH 102 802 255  HOH HOH B . 
L 5 HOH 103 803 336  HOH HOH B . 
L 5 HOH 104 804 214  HOH HOH B . 
L 5 HOH 105 805 13   HOH HOH B . 
L 5 HOH 106 806 61   HOH HOH B . 
L 5 HOH 107 807 117  HOH HOH B . 
L 5 HOH 108 808 344  HOH HOH B . 
L 5 HOH 109 809 322  HOH HOH B . 
L 5 HOH 110 810 138  HOH HOH B . 
L 5 HOH 111 811 228  HOH HOH B . 
L 5 HOH 112 812 325  HOH HOH B . 
L 5 HOH 113 813 388  HOH HOH B . 
L 5 HOH 114 814 245  HOH HOH B . 
L 5 HOH 115 815 266  HOH HOH B . 
L 5 HOH 116 816 53   HOH HOH B . 
L 5 HOH 117 817 264  HOH HOH B . 
L 5 HOH 118 818 100  HOH HOH B . 
L 5 HOH 119 819 358  HOH HOH B . 
L 5 HOH 120 820 335  HOH HOH B . 
L 5 HOH 121 821 165  HOH HOH B . 
L 5 HOH 122 822 27   HOH HOH B . 
L 5 HOH 123 823 432  HOH HOH B . 
L 5 HOH 124 824 19   HOH HOH B . 
L 5 HOH 125 825 85   HOH HOH B . 
L 5 HOH 126 826 553  HOH HOH B . 
L 5 HOH 127 827 212  HOH HOH B . 
L 5 HOH 128 828 160  HOH HOH B . 
L 5 HOH 129 829 156  HOH HOH B . 
L 5 HOH 130 830 71   HOH HOH B . 
L 5 HOH 131 831 157  HOH HOH B . 
L 5 HOH 132 832 321  HOH HOH B . 
L 5 HOH 133 833 108  HOH HOH B . 
L 5 HOH 134 834 238  HOH HOH B . 
L 5 HOH 135 835 300  HOH HOH B . 
L 5 HOH 136 836 104  HOH HOH B . 
L 5 HOH 137 837 25   HOH HOH B . 
L 5 HOH 138 838 460  HOH HOH B . 
L 5 HOH 139 839 191  HOH HOH B . 
L 5 HOH 140 840 303  HOH HOH B . 
L 5 HOH 141 841 50   HOH HOH B . 
L 5 HOH 142 842 382  HOH HOH B . 
L 5 HOH 143 843 429  HOH HOH B . 
L 5 HOH 144 844 333  HOH HOH B . 
L 5 HOH 145 845 223  HOH HOH B . 
L 5 HOH 146 846 112  HOH HOH B . 
L 5 HOH 147 847 232  HOH HOH B . 
L 5 HOH 148 848 125  HOH HOH B . 
L 5 HOH 149 849 560  HOH HOH B . 
L 5 HOH 150 850 54   HOH HOH B . 
L 5 HOH 151 851 122  HOH HOH B . 
L 5 HOH 152 852 526  HOH HOH B . 
L 5 HOH 153 853 299  HOH HOH B . 
L 5 HOH 154 854 479  HOH HOH B . 
L 5 HOH 155 855 159  HOH HOH B . 
L 5 HOH 156 856 239  HOH HOH B . 
L 5 HOH 157 857 276  HOH HOH B . 
L 5 HOH 158 858 84   HOH HOH B . 
L 5 HOH 159 859 140  HOH HOH B . 
L 5 HOH 160 860 268  HOH HOH B . 
L 5 HOH 161 861 16   HOH HOH B . 
L 5 HOH 162 862 216  HOH HOH B . 
L 5 HOH 163 863 374  HOH HOH B . 
L 5 HOH 164 864 550  HOH HOH B . 
L 5 HOH 165 865 287  HOH HOH B . 
L 5 HOH 166 866 360  HOH HOH B . 
L 5 HOH 167 867 343  HOH HOH B . 
L 5 HOH 168 868 547  HOH HOH B . 
L 5 HOH 169 869 292  HOH HOH B . 
L 5 HOH 170 870 473  HOH HOH B . 
L 5 HOH 171 871 77   HOH HOH B . 
L 5 HOH 172 872 425  HOH HOH B . 
L 5 HOH 173 873 213  HOH HOH B . 
L 5 HOH 174 874 495  HOH HOH B . 
L 5 HOH 175 875 274  HOH HOH B . 
L 5 HOH 176 876 144  HOH HOH B . 
L 5 HOH 177 877 392  HOH HOH B . 
L 5 HOH 178 878 106  HOH HOH B . 
L 5 HOH 179 879 6    HOH HOH B . 
L 5 HOH 180 880 10   HOH HOH B . 
L 5 HOH 181 881 38   HOH HOH B . 
L 5 HOH 182 882 284  HOH HOH B . 
L 5 HOH 183 883 504  HOH HOH B . 
L 5 HOH 184 884 237  HOH HOH B . 
L 5 HOH 185 885 155  HOH HOH B . 
L 5 HOH 186 886 455  HOH HOH B . 
L 5 HOH 187 887 222  HOH HOH B . 
L 5 HOH 188 888 486  HOH HOH B . 
L 5 HOH 189 889 243  HOH HOH B . 
L 5 HOH 190 890 289  HOH HOH B . 
L 5 HOH 191 891 120  HOH HOH B . 
L 5 HOH 192 892 49   HOH HOH B . 
L 5 HOH 193 893 419  HOH HOH B . 
L 5 HOH 194 894 110  HOH HOH B . 
L 5 HOH 195 895 410  HOH HOH B . 
L 5 HOH 196 896 331  HOH HOH B . 
L 5 HOH 197 897 275  HOH HOH B . 
L 5 HOH 198 898 162  HOH HOH B . 
L 5 HOH 199 899 327  HOH HOH B . 
L 5 HOH 200 900 332  HOH HOH B . 
L 5 HOH 201 901 81   HOH HOH B . 
L 5 HOH 202 902 241  HOH HOH B . 
L 5 HOH 203 903 301  HOH HOH B . 
L 5 HOH 204 904 114  HOH HOH B . 
L 5 HOH 205 905 164  HOH HOH B . 
L 5 HOH 206 906 41   HOH HOH B . 
L 5 HOH 207 907 464  HOH HOH B . 
L 5 HOH 208 908 443  HOH HOH B . 
L 5 HOH 209 909 178  HOH HOH B . 
L 5 HOH 210 910 286  HOH HOH B . 
L 5 HOH 211 911 116  HOH HOH B . 
L 5 HOH 212 912 554  HOH HOH B . 
L 5 HOH 213 913 296  HOH HOH B . 
L 5 HOH 214 914 474  HOH HOH B . 
L 5 HOH 215 915 316  HOH HOH B . 
L 5 HOH 216 916 530  HOH HOH B . 
L 5 HOH 217 917 506  HOH HOH B . 
L 5 HOH 218 918 387  HOH HOH B . 
L 5 HOH 219 919 202  HOH HOH B . 
L 5 HOH 220 920 154  HOH HOH B . 
L 5 HOH 221 921 270  HOH HOH B . 
L 5 HOH 222 922 478  HOH HOH B . 
L 5 HOH 223 923 229  HOH HOH B . 
L 5 HOH 224 924 508  HOH HOH B . 
L 5 HOH 225 925 141  HOH HOH B . 
L 5 HOH 226 926 254  HOH HOH B . 
L 5 HOH 227 927 452  HOH HOH B . 
L 5 HOH 228 928 559  HOH HOH B . 
L 5 HOH 229 929 334  HOH HOH B . 
L 5 HOH 230 930 227  HOH HOH B . 
L 5 HOH 231 931 195  HOH HOH B . 
L 5 HOH 232 932 520  HOH HOH B . 
L 5 HOH 233 933 403  HOH HOH B . 
L 5 HOH 234 934 381  HOH HOH B . 
L 5 HOH 235 935 514  HOH HOH B . 
L 5 HOH 236 936 423  HOH HOH B . 
L 5 HOH 237 937 558  HOH HOH B . 
L 5 HOH 238 938 454  HOH HOH B . 
L 5 HOH 239 939 487  HOH HOH B . 
L 5 HOH 240 940 556  HOH HOH B . 
L 5 HOH 241 941 576  HOH HOH B . 
L 5 HOH 242 942 405  HOH HOH B . 
L 5 HOH 243 943 570  HOH HOH B . 
L 5 HOH 244 944 188  HOH HOH B . 
L 5 HOH 245 945 328  HOH HOH B . 
L 5 HOH 246 946 236  HOH HOH B . 
L 5 HOH 247 947 402  HOH HOH B . 
L 5 HOH 248 948 362  HOH HOH B . 
L 5 HOH 249 949 377  HOH HOH B . 
L 5 HOH 250 950 375  HOH HOH B . 
L 5 HOH 251 951 364  HOH HOH B . 
L 5 HOH 252 952 345  HOH HOH B . 
L 5 HOH 253 953 546  HOH HOH B . 
L 5 HOH 254 954 451  HOH HOH B . 
L 5 HOH 255 955 488  HOH HOH B . 
L 5 HOH 256 956 361  HOH HOH B . 
L 5 HOH 257 957 261  HOH HOH B . 
L 5 HOH 258 958 201  HOH HOH B . 
L 5 HOH 259 959 197  HOH HOH B . 
L 5 HOH 260 960 571  HOH HOH B . 
L 5 HOH 261 961 407  HOH HOH B . 
L 5 HOH 262 962 523  HOH HOH B . 
L 5 HOH 263 963 470  HOH HOH B . 
L 5 HOH 264 964 572  HOH HOH B . 
L 5 HOH 265 965 444  HOH HOH B . 
L 5 HOH 266 966 493  HOH HOH B . 
L 5 HOH 267 967 309  HOH HOH B . 
L 5 HOH 268 968 257  HOH HOH B . 
L 5 HOH 269 969 226  HOH HOH B . 
L 5 HOH 270 970 288  HOH HOH B . 
L 5 HOH 271 971 391  HOH HOH B . 
L 5 HOH 272 972 398  HOH HOH B . 
L 5 HOH 273 973 218  HOH HOH B . 
L 5 HOH 274 974 522  HOH HOH B . 
L 5 HOH 275 975 540  HOH HOH B . 
L 5 HOH 276 976 482  HOH HOH B . 
L 5 HOH 277 977 544  HOH HOH B . 
L 5 HOH 278 978 500  HOH HOH B . 
L 5 HOH 279 979 448  HOH HOH B . 
L 5 HOH 280 980 498  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3130  ? 
1 MORE         4     ? 
1 'SSA (A^2)'  39200 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-11-21 
2 'Structure model' 1 1 2018-11-28 
3 'Structure model' 1 2 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Structure summary'    
4 3 'Structure model' 'Data collection'      
5 3 'Structure model' 'Derived calculations' 
6 3 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' citation                  
2  2 'Structure model' citation_author           
3  2 'Structure model' database_PDB_rev          
4  2 'Structure model' database_PDB_rev_record   
5  2 'Structure model' pdbx_database_proc        
6  2 'Structure model' struct                    
7  3 'Structure model' chem_comp                 
8  3 'Structure model' entity                    
9  3 'Structure model' pdbx_chem_comp_identifier 
10 3 'Structure model' pdbx_entity_nonpoly       
11 3 'Structure model' struct_conn               
12 3 'Structure model' struct_site               
13 3 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.journal_abbrev'          
2  2 'Structure model' '_citation.journal_id_ISSN'         
3  2 'Structure model' '_citation.journal_volume'          
4  2 'Structure model' '_citation.page_first'              
5  2 'Structure model' '_citation.page_last'               
6  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
7  2 'Structure model' '_citation.title'                   
8  2 'Structure model' '_citation_author.name'             
9  2 'Structure model' '_struct.title'                     
10 3 'Structure model' '_chem_comp.name'                   
11 3 'Structure model' '_chem_comp.type'                   
12 3 'Structure model' '_entity.pdbx_description'          
13 3 'Structure model' '_pdbx_entity_nonpoly.name'         
14 3 'Structure model' '_struct_conn.pdbx_role'            
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 45  ? ? 82.05   -5.92   
2  1 ASN A 131 ? ? -56.15  108.09  
3  1 SER A 200 ? ? 56.65   -122.15 
4  1 GLU A 299 ? ? -134.90 -57.91  
5  1 ASN A 313 ? ? -69.28  77.87   
6  1 THR A 317 ? ? -163.85 -167.35 
7  1 ASP A 380 ? ? -163.65 50.71   
8  1 VAL A 400 ? ? -121.13 -59.97  
9  1 HIS A 486 ? ? -68.32  -118.10 
10 1 SER A 487 ? ? 69.59   116.71  
11 1 ARG A 517 ? ? 33.35   44.07   
12 1 PHE B 45  ? ? 79.68   -10.05  
13 1 ALA B 60  ? ? -105.21 48.88   
14 1 SER B 108 ? ? -155.97 78.99   
15 1 PHE B 155 ? ? -145.67 17.38   
16 1 SER B 200 ? ? 58.47   -120.14 
17 1 GLU B 299 ? ? -121.40 -70.44  
18 1 ASP B 380 ? ? -161.40 51.30   
19 1 VAL B 400 ? ? -121.62 -64.04  
20 1 HIS B 486 ? ? 75.37   -8.15   
21 1 ASN B 506 ? ? -164.77 -166.43 
22 1 ARG B 515 ? ? 52.59   74.59   
23 1 ARG B 517 ? ? 35.14   48.27   
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       984 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   7.36 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A ALA 536 ? A ALA 536 
5  1 Y 1 A CYS 537 ? A CYS 537 
6  1 Y 1 B ASP 1   ? B ASP 1   
7  1 Y 1 B ASP 2   ? B ASP 2   
8  1 Y 1 B HIS 3   ? B HIS 3   
9  1 Y 1 B ALA 536 ? B ALA 536 
10 1 Y 1 B CYS 537 ? B CYS 537 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        C6K 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   C6K 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose                                                    NAG 
3 '1-(7-chloranyl-4-methoxy-1~{H}-indol-5-yl)-3-[1-(phenylmethyl)piperidin-4-yl]propan-1-one' C6K 
4 'DI(HYDROXYETHYL)ETHER'                                                                     PEG 
5 water                                                                                       HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#