data_6F3T
# 
_entry.id   6F3T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6F3T         
WWPDB D_1200007692 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6F3T 
_pdbx_database_status.recvd_initial_deposition_date   2017-11-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Haffke, M.' 1 ? 
'Berger, I.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat. Struct. Mol. Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                1119 
_citation.page_last                 1127 
_citation.title                     'Chaperonin CCT checkpoint function in basal transcription factor TFIID assembly.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41594-018-0156-z 
_citation.pdbx_database_id_PubMed   30510221 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Antonova, S.V.'  1  ?                   
primary 'Haffke, M.'      2  0000-0001-8126-9316 
primary 'Corradini, E.'   3  ?                   
primary 'Mikuciunas, M.'  4  ?                   
primary 'Low, T.Y.'       5  0000-0001-7878-7534 
primary 'Signor, L.'      6  0000-0003-3880-2466 
primary 'van Es, R.M.'    7  ?                   
primary 'Gupta, K.'       8  0000-0002-2115-3503 
primary 'Scheer, E.'      9  ?                   
primary 'Vos, H.R.'       10 ?                   
primary 'Tora, L.'        11 0000-0001-7398-2250 
primary 'Heck, A.J.R.'    12 0000-0002-2405-4404 
primary 'Timmers, H.T.M.' 13 ?                   
primary 'Berger, I.'      14 0000-0001-7518-9045 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6F3T 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     339.050 
_cell.length_a_esd                 ? 
_cell.length_b                     339.050 
_cell.length_b_esd                 ? 
_cell.length_c                     339.050 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        96 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6F3T 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                197 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 2 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Transcription initiation factor TFIID subunit 5' 68950.398 4   ? ? ? ? 
2 polymer     man 'Transcription initiation factor TFIID subunit 6' 10888.729 4   ? ? ? ? 
3 polymer     man 'Transcription initiation factor TFIID subunit 9' 13325.230 4   ? ? ? ? 
4 non-polymer syn 'CHLORIDE ION'                                    35.453    7   ? ? ? ? 
5 water       nat water                                             18.015    391 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Transcription initiation factor TFIID 100 kDa subunit,TAFII100' 
2 
;RNA polymerase II TBP-associated factor subunit E,Transcription initiation factor TFIID 70 kDa subunit,TAFII70,Transcription initiation factor TFIID 80 kDa subunit,TAFII80
;
3 
;RNA polymerase II TBP-associated factor subunit G,STAF31/32,Transcription initiation factor TFIID 31 kDa subunit,TAFII31,Transcription initiation factor TFIID 32 kDa subunit,TAFII32
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQE
CYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQI
DAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKSKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPEL
KDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVWSVTPKKLRSVKQASD
LSLIDKESDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQ
FSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPI
HSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDF
TTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ
;
;GDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQE
CYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQI
DAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKSKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPEL
KDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVWSVTPKKLRSVKQASD
LSLIDKESDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQ
FSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPI
HSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDF
TTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ
;
A,B,C,D ? 
2 'polypeptide(L)' no no  
;KKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLY
GFHAQEFIRLRRRA
;
;KKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLY
GFHAQEFIRLRRRA
;
E,G,I,K ? 
3 'polypeptide(L)' no yes 
;KTA(SEP)PKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRAD
QSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRY
;
;KTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFT
SPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRY
;
F,H,J,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASP n 
1 3   GLN n 
1 4   PRO n 
1 5   ASP n 
1 6   VAL n 
1 7   SER n 
1 8   ALA n 
1 9   VAL n 
1 10  LEU n 
1 11  SER n 
1 12  ALA n 
1 13  TYR n 
1 14  ASN n 
1 15  GLN n 
1 16  GLN n 
1 17  GLY n 
1 18  ASP n 
1 19  PRO n 
1 20  THR n 
1 21  MET n 
1 22  TYR n 
1 23  GLU n 
1 24  GLU n 
1 25  TYR n 
1 26  TYR n 
1 27  SER n 
1 28  GLY n 
1 29  LEU n 
1 30  LYS n 
1 31  HIS n 
1 32  PHE n 
1 33  ILE n 
1 34  GLU n 
1 35  CYS n 
1 36  SER n 
1 37  LEU n 
1 38  ASP n 
1 39  CYS n 
1 40  HIS n 
1 41  ARG n 
1 42  ALA n 
1 43  GLU n 
1 44  LEU n 
1 45  SER n 
1 46  GLN n 
1 47  LEU n 
1 48  PHE n 
1 49  TYR n 
1 50  PRO n 
1 51  LEU n 
1 52  PHE n 
1 53  VAL n 
1 54  HIS n 
1 55  MET n 
1 56  TYR n 
1 57  LEU n 
1 58  GLU n 
1 59  LEU n 
1 60  VAL n 
1 61  TYR n 
1 62  ASN n 
1 63  GLN n 
1 64  HIS n 
1 65  GLU n 
1 66  ASN n 
1 67  GLU n 
1 68  ALA n 
1 69  LYS n 
1 70  SER n 
1 71  PHE n 
1 72  PHE n 
1 73  GLU n 
1 74  LYS n 
1 75  PHE n 
1 76  HIS n 
1 77  GLY n 
1 78  ASP n 
1 79  GLN n 
1 80  GLU n 
1 81  CYS n 
1 82  TYR n 
1 83  TYR n 
1 84  GLN n 
1 85  ASP n 
1 86  ASP n 
1 87  LEU n 
1 88  ARG n 
1 89  VAL n 
1 90  LEU n 
1 91  SER n 
1 92  SER n 
1 93  LEU n 
1 94  THR n 
1 95  LYS n 
1 96  LYS n 
1 97  GLU n 
1 98  HIS n 
1 99  MET n 
1 100 LYS n 
1 101 GLY n 
1 102 ASN n 
1 103 GLU n 
1 104 THR n 
1 105 MET n 
1 106 LEU n 
1 107 ASP n 
1 108 PHE n 
1 109 ARG n 
1 110 THR n 
1 111 SER n 
1 112 LYS n 
1 113 PHE n 
1 114 VAL n 
1 115 LEU n 
1 116 ARG n 
1 117 ILE n 
1 118 SER n 
1 119 ARG n 
1 120 ASP n 
1 121 SER n 
1 122 TYR n 
1 123 GLN n 
1 124 LEU n 
1 125 LEU n 
1 126 LYS n 
1 127 ARG n 
1 128 HIS n 
1 129 LEU n 
1 130 GLN n 
1 131 GLU n 
1 132 LYS n 
1 133 GLN n 
1 134 ASN n 
1 135 ASN n 
1 136 GLN n 
1 137 ILE n 
1 138 TRP n 
1 139 ASN n 
1 140 ILE n 
1 141 VAL n 
1 142 GLN n 
1 143 GLU n 
1 144 HIS n 
1 145 LEU n 
1 146 TYR n 
1 147 ILE n 
1 148 ASP n 
1 149 ILE n 
1 150 PHE n 
1 151 ASP n 
1 152 GLY n 
1 153 MET n 
1 154 PRO n 
1 155 ARG n 
1 156 SER n 
1 157 LYS n 
1 158 GLN n 
1 159 GLN n 
1 160 ILE n 
1 161 ASP n 
1 162 ALA n 
1 163 MET n 
1 164 VAL n 
1 165 GLY n 
1 166 SER n 
1 167 LEU n 
1 168 ALA n 
1 169 GLY n 
1 170 GLU n 
1 171 ALA n 
1 172 LYS n 
1 173 ARG n 
1 174 GLU n 
1 175 ALA n 
1 176 ASN n 
1 177 LYS n 
1 178 SER n 
1 179 LYS n 
1 180 VAL n 
1 181 PHE n 
1 182 PHE n 
1 183 GLY n 
1 184 LEU n 
1 185 LEU n 
1 186 LYS n 
1 187 GLU n 
1 188 PRO n 
1 189 GLU n 
1 190 ILE n 
1 191 GLU n 
1 192 VAL n 
1 193 PRO n 
1 194 LEU n 
1 195 ASP n 
1 196 ASP n 
1 197 GLU n 
1 198 ASP n 
1 199 GLU n 
1 200 GLU n 
1 201 GLY n 
1 202 GLU n 
1 203 ASN n 
1 204 GLU n 
1 205 GLU n 
1 206 GLY n 
1 207 LYS n 
1 208 SER n 
1 209 LYS n 
1 210 LYS n 
1 211 LYS n 
1 212 LYS n 
1 213 PRO n 
1 214 LYS n 
1 215 LYS n 
1 216 ASP n 
1 217 SER n 
1 218 ILE n 
1 219 GLY n 
1 220 SER n 
1 221 LYS n 
1 222 SER n 
1 223 LYS n 
1 224 LYS n 
1 225 GLN n 
1 226 ASP n 
1 227 PRO n 
1 228 ASN n 
1 229 ALA n 
1 230 PRO n 
1 231 PRO n 
1 232 GLN n 
1 233 ASN n 
1 234 ARG n 
1 235 ILE n 
1 236 PRO n 
1 237 LEU n 
1 238 PRO n 
1 239 GLU n 
1 240 LEU n 
1 241 LYS n 
1 242 ASP n 
1 243 SER n 
1 244 ASP n 
1 245 LYS n 
1 246 LEU n 
1 247 ASP n 
1 248 LYS n 
1 249 ILE n 
1 250 MET n 
1 251 ASN n 
1 252 MET n 
1 253 LYS n 
1 254 GLU n 
1 255 THR n 
1 256 THR n 
1 257 LYS n 
1 258 ARG n 
1 259 VAL n 
1 260 ARG n 
1 261 LEU n 
1 262 GLY n 
1 263 PRO n 
1 264 ASP n 
1 265 CYS n 
1 266 LEU n 
1 267 PRO n 
1 268 SER n 
1 269 ILE n 
1 270 CYS n 
1 271 PHE n 
1 272 TYR n 
1 273 THR n 
1 274 PHE n 
1 275 LEU n 
1 276 ASN n 
1 277 ALA n 
1 278 TYR n 
1 279 GLN n 
1 280 GLY n 
1 281 LEU n 
1 282 THR n 
1 283 ALA n 
1 284 VAL n 
1 285 ASP n 
1 286 VAL n 
1 287 THR n 
1 288 ASP n 
1 289 ASP n 
1 290 SER n 
1 291 SER n 
1 292 LEU n 
1 293 ILE n 
1 294 ALA n 
1 295 GLY n 
1 296 GLY n 
1 297 PHE n 
1 298 ALA n 
1 299 ASP n 
1 300 SER n 
1 301 THR n 
1 302 VAL n 
1 303 ARG n 
1 304 VAL n 
1 305 TRP n 
1 306 SER n 
1 307 VAL n 
1 308 THR n 
1 309 PRO n 
1 310 LYS n 
1 311 LYS n 
1 312 LEU n 
1 313 ARG n 
1 314 SER n 
1 315 VAL n 
1 316 LYS n 
1 317 GLN n 
1 318 ALA n 
1 319 SER n 
1 320 ASP n 
1 321 LEU n 
1 322 SER n 
1 323 LEU n 
1 324 ILE n 
1 325 ASP n 
1 326 LYS n 
1 327 GLU n 
1 328 SER n 
1 329 ASP n 
1 330 ASP n 
1 331 VAL n 
1 332 LEU n 
1 333 GLU n 
1 334 ARG n 
1 335 ILE n 
1 336 MET n 
1 337 ASP n 
1 338 GLU n 
1 339 LYS n 
1 340 THR n 
1 341 ALA n 
1 342 SER n 
1 343 GLU n 
1 344 LEU n 
1 345 LYS n 
1 346 ILE n 
1 347 LEU n 
1 348 TYR n 
1 349 GLY n 
1 350 HIS n 
1 351 SER n 
1 352 GLY n 
1 353 PRO n 
1 354 VAL n 
1 355 TYR n 
1 356 GLY n 
1 357 ALA n 
1 358 SER n 
1 359 PHE n 
1 360 SER n 
1 361 PRO n 
1 362 ASP n 
1 363 ARG n 
1 364 ASN n 
1 365 TYR n 
1 366 LEU n 
1 367 LEU n 
1 368 SER n 
1 369 SER n 
1 370 SER n 
1 371 GLU n 
1 372 ASP n 
1 373 GLY n 
1 374 THR n 
1 375 VAL n 
1 376 ARG n 
1 377 LEU n 
1 378 TRP n 
1 379 SER n 
1 380 LEU n 
1 381 GLN n 
1 382 THR n 
1 383 PHE n 
1 384 THR n 
1 385 CYS n 
1 386 LEU n 
1 387 VAL n 
1 388 GLY n 
1 389 TYR n 
1 390 LYS n 
1 391 GLY n 
1 392 HIS n 
1 393 ASN n 
1 394 TYR n 
1 395 PRO n 
1 396 VAL n 
1 397 TRP n 
1 398 ASP n 
1 399 THR n 
1 400 GLN n 
1 401 PHE n 
1 402 SER n 
1 403 PRO n 
1 404 TYR n 
1 405 GLY n 
1 406 TYR n 
1 407 TYR n 
1 408 PHE n 
1 409 VAL n 
1 410 SER n 
1 411 GLY n 
1 412 GLY n 
1 413 HIS n 
1 414 ASP n 
1 415 ARG n 
1 416 VAL n 
1 417 ALA n 
1 418 ARG n 
1 419 LEU n 
1 420 TRP n 
1 421 ALA n 
1 422 THR n 
1 423 ASP n 
1 424 HIS n 
1 425 TYR n 
1 426 GLN n 
1 427 PRO n 
1 428 LEU n 
1 429 ARG n 
1 430 ILE n 
1 431 PHE n 
1 432 ALA n 
1 433 GLY n 
1 434 HIS n 
1 435 LEU n 
1 436 ALA n 
1 437 ASP n 
1 438 VAL n 
1 439 ASN n 
1 440 CYS n 
1 441 THR n 
1 442 ARG n 
1 443 PHE n 
1 444 HIS n 
1 445 PRO n 
1 446 ASN n 
1 447 SER n 
1 448 ASN n 
1 449 TYR n 
1 450 VAL n 
1 451 ALA n 
1 452 THR n 
1 453 GLY n 
1 454 SER n 
1 455 ALA n 
1 456 ASP n 
1 457 ARG n 
1 458 THR n 
1 459 VAL n 
1 460 ARG n 
1 461 LEU n 
1 462 TRP n 
1 463 ASP n 
1 464 VAL n 
1 465 LEU n 
1 466 ASN n 
1 467 GLY n 
1 468 ASN n 
1 469 CYS n 
1 470 VAL n 
1 471 ARG n 
1 472 ILE n 
1 473 PHE n 
1 474 THR n 
1 475 GLY n 
1 476 HIS n 
1 477 LYS n 
1 478 GLY n 
1 479 PRO n 
1 480 ILE n 
1 481 HIS n 
1 482 SER n 
1 483 LEU n 
1 484 THR n 
1 485 PHE n 
1 486 SER n 
1 487 PRO n 
1 488 ASN n 
1 489 GLY n 
1 490 ARG n 
1 491 PHE n 
1 492 LEU n 
1 493 ALA n 
1 494 THR n 
1 495 GLY n 
1 496 ALA n 
1 497 THR n 
1 498 ASP n 
1 499 GLY n 
1 500 ARG n 
1 501 VAL n 
1 502 LEU n 
1 503 LEU n 
1 504 TRP n 
1 505 ASP n 
1 506 ILE n 
1 507 GLY n 
1 508 HIS n 
1 509 GLY n 
1 510 LEU n 
1 511 MET n 
1 512 VAL n 
1 513 GLY n 
1 514 GLU n 
1 515 LEU n 
1 516 LYS n 
1 517 GLY n 
1 518 HIS n 
1 519 THR n 
1 520 ASP n 
1 521 THR n 
1 522 VAL n 
1 523 CYS n 
1 524 SER n 
1 525 LEU n 
1 526 ARG n 
1 527 PHE n 
1 528 SER n 
1 529 ARG n 
1 530 ASP n 
1 531 GLY n 
1 532 GLU n 
1 533 ILE n 
1 534 LEU n 
1 535 ALA n 
1 536 SER n 
1 537 GLY n 
1 538 SER n 
1 539 MET n 
1 540 ASP n 
1 541 ASN n 
1 542 THR n 
1 543 VAL n 
1 544 ARG n 
1 545 LEU n 
1 546 TRP n 
1 547 ASP n 
1 548 ALA n 
1 549 ILE n 
1 550 LYS n 
1 551 ALA n 
1 552 PHE n 
1 553 GLU n 
1 554 ASP n 
1 555 LEU n 
1 556 GLU n 
1 557 THR n 
1 558 ASP n 
1 559 ASP n 
1 560 PHE n 
1 561 THR n 
1 562 THR n 
1 563 ALA n 
1 564 THR n 
1 565 GLY n 
1 566 HIS n 
1 567 ILE n 
1 568 ASN n 
1 569 LEU n 
1 570 PRO n 
1 571 GLU n 
1 572 ASN n 
1 573 SER n 
1 574 GLN n 
1 575 GLU n 
1 576 LEU n 
1 577 LEU n 
1 578 LEU n 
1 579 GLY n 
1 580 THR n 
1 581 TYR n 
1 582 MET n 
1 583 THR n 
1 584 LYS n 
1 585 SER n 
1 586 THR n 
1 587 PRO n 
1 588 VAL n 
1 589 VAL n 
1 590 HIS n 
1 591 LEU n 
1 592 HIS n 
1 593 PHE n 
1 594 THR n 
1 595 ARG n 
1 596 ARG n 
1 597 ASN n 
1 598 LEU n 
1 599 VAL n 
1 600 LEU n 
1 601 ALA n 
1 602 ALA n 
1 603 GLY n 
1 604 ALA n 
1 605 TYR n 
1 606 SER n 
1 607 PRO n 
1 608 GLN n 
2 1   LYS n 
2 2   LYS n 
2 3   LEU n 
2 4   LYS n 
2 5   LEU n 
2 6   SER n 
2 7   ASN n 
2 8   THR n 
2 9   VAL n 
2 10  LEU n 
2 11  PRO n 
2 12  SER n 
2 13  GLU n 
2 14  SER n 
2 15  MET n 
2 16  LYS n 
2 17  VAL n 
2 18  VAL n 
2 19  ALA n 
2 20  GLU n 
2 21  SER n 
2 22  MET n 
2 23  GLY n 
2 24  ILE n 
2 25  ALA n 
2 26  GLN n 
2 27  ILE n 
2 28  GLN n 
2 29  GLU n 
2 30  GLU n 
2 31  THR n 
2 32  CYS n 
2 33  GLN n 
2 34  LEU n 
2 35  LEU n 
2 36  THR n 
2 37  ASP n 
2 38  GLU n 
2 39  VAL n 
2 40  SER n 
2 41  TYR n 
2 42  ARG n 
2 43  ILE n 
2 44  LYS n 
2 45  GLU n 
2 46  ILE n 
2 47  ALA n 
2 48  GLN n 
2 49  ASP n 
2 50  ALA n 
2 51  LEU n 
2 52  LYS n 
2 53  PHE n 
2 54  MET n 
2 55  HIS n 
2 56  MET n 
2 57  GLY n 
2 58  LYS n 
2 59  ARG n 
2 60  GLN n 
2 61  LYS n 
2 62  LEU n 
2 63  THR n 
2 64  THR n 
2 65  SER n 
2 66  ASP n 
2 67  ILE n 
2 68  ASP n 
2 69  TYR n 
2 70  ALA n 
2 71  LEU n 
2 72  LYS n 
2 73  LEU n 
2 74  LYS n 
2 75  ASN n 
2 76  VAL n 
2 77  GLU n 
2 78  PRO n 
2 79  LEU n 
2 80  TYR n 
2 81  GLY n 
2 82  PHE n 
2 83  HIS n 
2 84  ALA n 
2 85  GLN n 
2 86  GLU n 
2 87  PHE n 
2 88  ILE n 
2 89  ARG n 
2 90  LEU n 
2 91  ARG n 
2 92  ARG n 
2 93  ARG n 
2 94  ALA n 
3 1   LYS n 
3 2   THR n 
3 3   ALA n 
3 4   SEP n 
3 5   PRO n 
3 6   LYS n 
3 7   SER n 
3 8   MET n 
3 9   PRO n 
3 10  LYS n 
3 11  ASP n 
3 12  ALA n 
3 13  GLN n 
3 14  MET n 
3 15  MET n 
3 16  ALA n 
3 17  GLN n 
3 18  ILE n 
3 19  LEU n 
3 20  LYS n 
3 21  ASP n 
3 22  MET n 
3 23  GLY n 
3 24  ILE n 
3 25  THR n 
3 26  GLU n 
3 27  TYR n 
3 28  GLU n 
3 29  PRO n 
3 30  ARG n 
3 31  VAL n 
3 32  ILE n 
3 33  ASN n 
3 34  GLN n 
3 35  MET n 
3 36  LEU n 
3 37  GLU n 
3 38  PHE n 
3 39  ALA n 
3 40  PHE n 
3 41  ARG n 
3 42  TYR n 
3 43  VAL n 
3 44  THR n 
3 45  THR n 
3 46  ILE n 
3 47  LEU n 
3 48  ASP n 
3 49  ASP n 
3 50  ALA n 
3 51  LYS n 
3 52  ILE n 
3 53  TYR n 
3 54  SER n 
3 55  SER n 
3 56  HIS n 
3 57  ALA n 
3 58  LYS n 
3 59  LYS n 
3 60  ALA n 
3 61  THR n 
3 62  VAL n 
3 63  ASP n 
3 64  ALA n 
3 65  ASP n 
3 66  ASP n 
3 67  VAL n 
3 68  ARG n 
3 69  LEU n 
3 70  ALA n 
3 71  ILE n 
3 72  GLN n 
3 73  CYS n 
3 74  ARG n 
3 75  ALA n 
3 76  ASP n 
3 77  GLN n 
3 78  SER n 
3 79  PHE n 
3 80  THR n 
3 81  SER n 
3 82  PRO n 
3 83  PRO n 
3 84  PRO n 
3 85  ARG n 
3 86  ASP n 
3 87  PHE n 
3 88  LEU n 
3 89  LEU n 
3 90  ASP n 
3 91  ILE n 
3 92  ALA n 
3 93  ARG n 
3 94  GLN n 
3 95  ARG n 
3 96  ASN n 
3 97  GLN n 
3 98  THR n 
3 99  PRO n 
3 100 LEU n 
3 101 PRO n 
3 102 LEU n 
3 103 ILE n 
3 104 LYS n 
3 105 PRO n 
3 106 TYR n 
3 107 SER n 
3 108 GLY n 
3 109 PRO n 
3 110 ARG n 
3 111 LEU n 
3 112 PRO n 
3 113 PRO n 
3 114 ASP n 
3 115 ARG n 
3 116 TYR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 608 Human ? 'TAF5, TAF2D'          ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'unidentified baculovirus' 10469 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 94  Human ? 'TAF6, TAF2E, TAFII70' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'unidentified baculovirus' 10469 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 116 Human ? 'TAF9, TAF2G, TAFII31' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'unidentified baculovirus' 10469 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP TAF5_HUMAN Q15542 ?        1 
;DQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQEC
YYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQID
AMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELK
DSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVWSVTPKKLRSVKQASDL
SLIDKESDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQF
SPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIH
SLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFT
TATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ
;
194 
2 UNP TAF6_HUMAN P49848 P49848-3 2 
;KKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLY
GFHAQEFI
;
42  
3 UNP TAF9_HUMAN Q16594 ?        3 
;KTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFT
SPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRY
;
5   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6F3T A 2 ? 608 ? Q15542 194 ? 800 ? 194 800 
2  1 6F3T B 2 ? 608 ? Q15542 194 ? 800 ? 194 800 
3  1 6F3T C 2 ? 608 ? Q15542 194 ? 800 ? 194 800 
4  1 6F3T D 2 ? 608 ? Q15542 194 ? 800 ? 194 800 
5  2 6F3T E 1 ? 88  ? P49848 42  ? 129 ? 5   92  
6  3 6F3T F 1 ? 116 ? Q16594 5   ? 120 ? 5   120 
7  2 6F3T G 1 ? 88  ? P49848 42  ? 129 ? 5   92  
8  3 6F3T H 1 ? 116 ? Q16594 5   ? 120 ? 5   120 
9  2 6F3T I 1 ? 88  ? P49848 42  ? 129 ? 5   92  
10 3 6F3T J 1 ? 116 ? Q16594 5   ? 120 ? 5   120 
11 2 6F3T K 1 ? 88  ? P49848 42  ? 129 ? 5   92  
12 3 6F3T L 1 ? 116 ? Q16594 5   ? 120 ? 5   120 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6F3T GLY A 1   ? UNP Q15542 ?   ?   'expression tag' 193 1  
1  6F3T SER A 208 ? UNP Q15542 PRO 400 conflict         400 2  
2  6F3T GLY B 1   ? UNP Q15542 ?   ?   'expression tag' 193 3  
2  6F3T SER B 208 ? UNP Q15542 PRO 400 conflict         400 4  
3  6F3T GLY C 1   ? UNP Q15542 ?   ?   'expression tag' 193 5  
3  6F3T SER C 208 ? UNP Q15542 PRO 400 conflict         400 6  
4  6F3T GLY D 1   ? UNP Q15542 ?   ?   'expression tag' 193 7  
4  6F3T SER D 208 ? UNP Q15542 PRO 400 conflict         400 8  
5  6F3T ARG E 89  ? UNP P49848 ?   ?   'expression tag' 93  9  
5  6F3T LEU E 90  ? UNP P49848 ?   ?   'expression tag' 94  10 
5  6F3T ARG E 91  ? UNP P49848 ?   ?   'expression tag' 95  11 
5  6F3T ARG E 92  ? UNP P49848 ?   ?   'expression tag' 96  12 
5  6F3T ARG E 93  ? UNP P49848 ?   ?   'expression tag' 97  13 
5  6F3T ALA E 94  ? UNP P49848 ?   ?   'expression tag' 98  14 
7  6F3T ARG G 89  ? UNP P49848 ?   ?   'expression tag' 93  15 
7  6F3T LEU G 90  ? UNP P49848 ?   ?   'expression tag' 94  16 
7  6F3T ARG G 91  ? UNP P49848 ?   ?   'expression tag' 95  17 
7  6F3T ARG G 92  ? UNP P49848 ?   ?   'expression tag' 96  18 
7  6F3T ARG G 93  ? UNP P49848 ?   ?   'expression tag' 97  19 
7  6F3T ALA G 94  ? UNP P49848 ?   ?   'expression tag' 98  20 
9  6F3T ARG I 89  ? UNP P49848 ?   ?   'expression tag' 93  21 
9  6F3T LEU I 90  ? UNP P49848 ?   ?   'expression tag' 94  22 
9  6F3T ARG I 91  ? UNP P49848 ?   ?   'expression tag' 95  23 
9  6F3T ARG I 92  ? UNP P49848 ?   ?   'expression tag' 96  24 
9  6F3T ARG I 93  ? UNP P49848 ?   ?   'expression tag' 97  25 
9  6F3T ALA I 94  ? UNP P49848 ?   ?   'expression tag' 98  26 
11 6F3T ARG K 89  ? UNP P49848 ?   ?   'expression tag' 93  27 
11 6F3T LEU K 90  ? UNP P49848 ?   ?   'expression tag' 94  28 
11 6F3T ARG K 91  ? UNP P49848 ?   ?   'expression tag' 95  29 
11 6F3T ARG K 92  ? UNP P49848 ?   ?   'expression tag' 96  30 
11 6F3T ARG K 93  ? UNP P49848 ?   ?   'expression tag' 97  31 
11 6F3T ALA K 94  ? UNP P49848 ?   ?   'expression tag' 98  32 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ?               'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ?               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6F3T 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.42 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         72.20 
_exptl_crystal.description                 'Pyramidal shape' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Tris/HCl pH6.8, 0.8M Na-Citrate, 0.0-0.15M NaCl' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-02-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    Si 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0044 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0044 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            71.940 
_reflns.entry_id                         6F3T 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.500 
_reflns.d_resolution_low                 79.915 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       219180 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.690 
_reflns.pdbx_Rmerge_I_obs                0.136 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.670 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.833 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.153 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.995 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.500  2.600   ? 0.640  ? ? ? ? 22436 91.700  ? ? ? ? 3.048 ? ? ? ? ? ? ? ? 4.146 ? ? ? ? 3.491 ? ? 1  1 0.188 ? 
2.600  2.700   ? 0.990  ? ? ? ? 20949 99.900  ? ? ? ? 2.234 ? ? ? ? ? ? ? ? 4.742 ? ? ? ? 2.518 ? ? 2  1 0.312 ? 
2.700  2.800   ? 1.480  ? ? ? ? 18058 99.900  ? ? ? ? 1.563 ? ? ? ? ? ? ? ? 4.794 ? ? ? ? 1.759 ? ? 3  1 0.468 ? 
2.800  2.900   ? 2.010  ? ? ? ? 15686 100.000 ? ? ? ? 1.167 ? ? ? ? ? ? ? ? 4.799 ? ? ? ? 1.314 ? ? 4  1 0.603 ? 
2.900  3.000   ? 2.840  ? ? ? ? 13660 100.000 ? ? ? ? 0.808 ? ? ? ? ? ? ? ? 4.797 ? ? ? ? 0.910 ? ? 5  1 0.729 ? 
3.000  3.500   ? 6.410  ? ? ? ? 47288 100.000 ? ? ? ? 0.292 ? ? ? ? ? ? ? ? 4.796 ? ? ? ? 0.328 ? ? 6  1 0.959 ? 
3.500  4.000   ? 12.970 ? ? ? ? 26594 100.000 ? ? ? ? 0.107 ? ? ? ? ? ? ? ? 4.772 ? ? ? ? 0.121 ? ? 7  1 0.990 ? 
4.000  5.000   ? 18.950 ? ? ? ? 26426 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 4.730 ? ? ? ? 0.075 ? ? 8  1 0.994 ? 
5.000  6.000   ? 19.810 ? ? ? ? 11769 99.900  ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 4.671 ? ? ? ? 0.072 ? ? 9  1 0.994 ? 
6.000  10.000  ? 22.830 ? ? ? ? 12744 99.900  ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 4.605 ? ? ? ? 0.062 ? ? 10 1 0.996 ? 
10.000 30.000  ? 27.080 ? ? ? ? 3441  99.100  ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 4.480 ? ? ? ? 0.057 ? ? 11 1 0.995 ? 
30.000 50.000  ? 24.260 ? ? ? ? 108   91.500  ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 4.074 ? ? ? ? 0.056 ? ? 12 1 0.996 ? 
50.000 100.000 ? 16.930 ? ? ? ? 21    70.000  ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 2.857 ? ? ? ? 0.064 ? ? 13 1 0.992 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                260.340 
_refine.B_iso_mean                               97.2153 
_refine.B_iso_min                                46.130 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6F3T 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.5000 
_refine.ls_d_res_low                             79.9150 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     219090 
_refine.ls_number_reflns_R_free                  10958 
_refine.ls_number_reflns_R_work                  208132 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.9900 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1984 
_refine.ls_R_factor_R_free                       0.2200 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1973 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.330 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.3900 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.5000 
_refine_hist.d_res_low                        79.9150 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             391 
_refine_hist.number_atoms_total               24768 
_refine_hist.pdbx_number_residues_total       3040 
_refine_hist.pdbx_B_iso_mean_ligand           79.55 
_refine_hist.pdbx_B_iso_mean_solvent          68.85 
_refine_hist.pdbx_number_atoms_protein        24370 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 24918 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.658  ? 33699 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.044  ? 3675  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 4354  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 11.594 ? 15081 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1  'X-RAY DIFFRACTION' 1 1 TORSIONAL E 2333  11.468 ? ? ? ? ? 
2  'X-RAY DIFFRACTION' 1 2 TORSIONAL G 2333  11.468 ? ? ? ? ? 
3  'X-RAY DIFFRACTION' 1 3 TORSIONAL I 2333  11.468 ? ? ? ? ? 
4  'X-RAY DIFFRACTION' 1 4 TORSIONAL K 2333  11.468 ? ? ? ? ? 
5  'X-RAY DIFFRACTION' 2 1 TORSIONAL A 13741 11.468 ? ? ? ? ? 
6  'X-RAY DIFFRACTION' 2 2 TORSIONAL B 13741 11.468 ? ? ? ? ? 
7  'X-RAY DIFFRACTION' 2 3 TORSIONAL C 13741 11.468 ? ? ? ? ? 
8  'X-RAY DIFFRACTION' 2 4 TORSIONAL D 13741 11.468 ? ? ? ? ? 
9  'X-RAY DIFFRACTION' 3 1 TORSIONAL F 2886  11.468 ? ? ? ? ? 
10 'X-RAY DIFFRACTION' 3 2 TORSIONAL H 2886  11.468 ? ? ? ? ? 
11 'X-RAY DIFFRACTION' 3 3 TORSIONAL J 2886  11.468 ? ? ? ? ? 
12 'X-RAY DIFFRACTION' 3 4 TORSIONAL L 2886  11.468 ? ? ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.5001 2.5285  6372 . 318 6054 87.0000  . . . 0.3846 0.0000 0.3920 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5285 2.5582  6673 . 334 6339 91.0000  . . . 0.3835 0.0000 0.3837 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5582 2.5894  6987 . 350 6637 95.0000  . . . 0.4226 0.0000 0.3798 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5894 2.6222  7310 . 366 6944 100.0000 . . . 0.3517 0.0000 0.3629 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6222 2.6567  7270 . 363 6907 100.0000 . . . 0.3563 0.0000 0.3486 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6567 2.6931  7417 . 371 7046 100.0000 . . . 0.3696 0.0000 0.3403 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6931 2.7316  7262 . 364 6898 100.0000 . . . 0.3441 0.0000 0.3392 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.7316 2.7723  7379 . 369 7010 100.0000 . . . 0.4035 0.0000 0.3773 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.7723 2.8157  7343 . 367 6976 100.0000 . . . 0.3958 0.0000 0.3701 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.8157 2.8618  7331 . 366 6965 100.0000 . . . 0.3935 0.0000 0.3459 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.8618 2.9112  7328 . 367 6961 100.0000 . . . 0.3487 0.0000 0.3151 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.9112 2.9641  7390 . 369 7021 100.0000 . . . 0.2756 0.0000 0.2848 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.9641 3.0211  7346 . 368 6978 100.0000 . . . 0.2926 0.0000 0.2772 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0211 3.0828  7343 . 367 6976 100.0000 . . . 0.2948 0.0000 0.2750 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0828 3.1498  7328 . 366 6962 100.0000 . . . 0.2883 0.0000 0.2559 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.1498 3.2231  7414 . 371 7043 100.0000 . . . 0.2586 0.0000 0.2446 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.2231 3.3037  7316 . 366 6950 100.0000 . . . 0.2714 0.0000 0.2459 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.3037 3.3930  7389 . 369 7020 100.0000 . . . 0.2643 0.0000 0.2381 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.3930 3.4929  7346 . 367 6979 100.0000 . . . 0.2643 0.0000 0.2166 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.4929 3.6056  7386 . 370 7016 100.0000 . . . 0.2300 0.0000 0.1978 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.6056 3.7345  7356 . 367 6989 100.0000 . . . 0.1983 0.0000 0.1861 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.7345 3.8840  7373 . 369 7004 100.0000 . . . 0.2185 0.0000 0.1804 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.8840 4.0608  7371 . 369 7002 100.0000 . . . 0.1911 0.0000 0.1660 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.0608 4.2749  7385 . 369 7016 100.0000 . . . 0.1555 0.0000 0.1458 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.2749 4.5427  7410 . 371 7039 100.0000 . . . 0.1702 0.0000 0.1401 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.5427 4.8934  7438 . 371 7067 100.0000 . . . 0.1504 0.0000 0.1303 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.8934 5.3857  7372 . 369 7003 100.0000 . . . 0.1655 0.0000 0.1464 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 5.3857 6.1648  7455 . 373 7082 100.0000 . . . 0.1854 0.0000 0.1623 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 6.1648 7.7659  7460 . 373 7087 100.0000 . . . 0.1868 0.0000 0.1647 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 7.7659 79.9557 7540 . 379 7161 99.0000  . . . 0.1799 0.0000 0.1598 . . . . . . 30 . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 '(chain E and resid 7 through 98)'                                                        
1 2 'chain G'                                                                                 
1 3 '(chain I and resid 7 through 98)'                                                        
1 4 '(chain K and resid 7 through 98)'                                                        
2 1 '(chain A and (resid 209 through 747 or resid 756 through 800))'                          
2 2 '(chain B and (resid 209 through 380 or resid 417 through 747 or resid 756 through 800))' 
2 3 '(chain C and (resid 209 through 747 or resid 756 through 800))'                          
2 4 '(chain D and (resid 209 through 380 or resid 417 through 747 or resid 756 through 800))' 
3 1 'chain F'                                                                                 
3 2 'chain H'                                                                                 
3 3 'chain J'                                                                                 
3 4 'chain L'                                                                                 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 ? E 7   E 98  '(chain E and resid 7 through 98)'                                                        ? ? ? ? ? ? ? ? 
1 2 1 ? G 7   G 98  'chain G'                                                                                 ? ? ? ? ? ? ? ? 
1 3 1 ? I 7   I 98  '(chain I and resid 7 through 98)'                                                        ? ? ? ? ? ? ? ? 
1 4 1 ? K 7   K 98  '(chain K and resid 7 through 98)'                                                        ? ? ? ? ? ? ? ? 
2 1 1 ? A 209 A 747 '(chain A and (resid 209 through 747 or resid 756 through 800))'                          ? ? ? ? ? ? ? ? 
2 1 2 ? A 756 A 800 '(chain A and (resid 209 through 747 or resid 756 through 800))'                          ? ? ? ? ? ? ? ? 
2 2 1 ? B 209 B 380 '(chain B and (resid 209 through 380 or resid 417 through 747 or resid 756 through 800))' ? ? ? ? ? ? ? ? 
2 2 2 ? B 417 B 747 '(chain B and (resid 209 through 380 or resid 417 through 747 or resid 756 through 800))' ? ? ? ? ? ? ? ? 
2 2 3 ? B 756 B 800 '(chain B and (resid 209 through 380 or resid 417 through 747 or resid 756 through 800))' ? ? ? ? ? ? ? ? 
2 3 1 ? C 209 C 747 '(chain C and (resid 209 through 747 or resid 756 through 800))'                          ? ? ? ? ? ? ? ? 
2 3 2 ? C 756 C 800 '(chain C and (resid 209 through 747 or resid 756 through 800))'                          ? ? ? ? ? ? ? ? 
2 4 1 ? D 209 D 380 '(chain D and (resid 209 through 380 or resid 417 through 747 or resid 756 through 800))' ? ? ? ? ? ? ? ? 
2 4 2 ? D 417 D 747 '(chain D and (resid 209 through 380 or resid 417 through 747 or resid 756 through 800))' ? ? ? ? ? ? ? ? 
2 4 3 ? D 756 D 800 '(chain D and (resid 209 through 380 or resid 417 through 747 or resid 756 through 800))' ? ? ? ? ? ? ? ? 
3 1 1 ? F 5   F 120 'chain F'                                                                                 ? ? ? ? ? ? ? ? 
3 2 1 ? H 5   H 120 'chain H'                                                                                 ? ? ? ? ? ? ? ? 
3 3 1 ? J 5   J 120 'chain J'                                                                                 ? ? ? ? ? ? ? ? 
3 4 1 ? L 5   L 120 'chain L'                                                                                 ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                     6F3T 
_struct.title                        'Crystal structure of the human TAF5-TAF6-TAF9 complex' 
_struct.pdbx_descriptor              
;Transcription initiation factor TFIID subunit 5, Transcription initiation factor TFIID subunit 6, Transcription initiation factor TFIID subunit 9
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6F3T 
_struct_keywords.text            'Transcription, Complex, TFIID, TAF, TBD-associated Factor' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 2 ? 
H  N N 3 ? 
I  N N 2 ? 
J  N N 3 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 5 ? 
U  N N 5 ? 
V  N N 5 ? 
W  N N 5 ? 
X  N N 5 ? 
Y  N N 5 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 5 ? 
DA N N 5 ? 
EA N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 ASP A 18  ? THR A 20  ? ASP A 210 THR A 212 5 ? 3  
HELX_P HELX_P2   AA2 MET A 21  ? CYS A 35  ? MET A 213 CYS A 227 1 ? 15 
HELX_P HELX_P3   AA3 LEU A 37  ? SER A 45  ? LEU A 229 SER A 237 1 ? 9  
HELX_P HELX_P4   AA4 LEU A 47  ? ASN A 62  ? LEU A 239 ASN A 254 1 ? 16 
HELX_P HELX_P5   AA5 HIS A 64  ? HIS A 76  ? HIS A 256 HIS A 268 1 ? 13 
HELX_P HELX_P6   AA6 GLY A 77  ? GLN A 79  ? GLY A 269 GLN A 271 5 ? 3  
HELX_P HELX_P7   AA7 GLU A 80  ? TYR A 82  ? GLU A 272 TYR A 274 5 ? 3  
HELX_P HELX_P8   AA8 TYR A 83  ? LEU A 93  ? TYR A 275 LEU A 285 1 ? 11 
HELX_P HELX_P9   AA9 LYS A 95  ? GLY A 101 ? LYS A 287 GLY A 293 1 ? 7  
HELX_P HELX_P10  AB1 ASN A 102 ? SER A 111 ? ASN A 294 SER A 303 1 ? 10 
HELX_P HELX_P11  AB2 ARG A 119 ? GLN A 130 ? ARG A 311 GLN A 322 1 ? 12 
HELX_P HELX_P12  AB3 GLU A 131 ? GLN A 133 ? GLU A 323 GLN A 325 5 ? 3  
HELX_P HELX_P13  AB4 ASN A 134 ? HIS A 144 ? ASN A 326 HIS A 336 1 ? 11 
HELX_P HELX_P14  AB5 SER A 156 ? VAL A 164 ? SER A 348 VAL A 356 1 ? 9  
HELX_P HELX_P15  AB6 LYS A 172 ? LYS A 177 ? LYS A 364 LYS A 369 5 ? 6  
HELX_P HELX_P16  AB7 LYS A 241 ? THR A 256 ? LYS A 433 THR A 448 1 ? 16 
HELX_P HELX_P17  AB8 PHE A 274 ? TYR A 278 ? PHE A 466 TYR A 470 1 ? 5  
HELX_P HELX_P18  AB9 GLN A 317 ? SER A 322 ? GLN A 509 SER A 514 1 ? 6  
HELX_P HELX_P19  AC1 LEU A 323 ? LYS A 326 ? LEU A 515 LYS A 518 5 ? 4  
HELX_P HELX_P20  AC2 ASP A 329 ? MET A 336 ? ASP A 521 MET A 528 1 ? 8  
HELX_P HELX_P21  AC3 ALA A 548 ? PHE A 552 ? ALA A 740 PHE A 744 1 ? 5  
HELX_P HELX_P22  AC4 ASN A 572 ? LEU A 576 ? ASN A 764 LEU A 768 1 ? 5  
HELX_P HELX_P23  AC5 ASP B 18  ? THR B 20  ? ASP B 210 THR B 212 5 ? 3  
HELX_P HELX_P24  AC6 MET B 21  ? CYS B 35  ? MET B 213 CYS B 227 1 ? 15 
HELX_P HELX_P25  AC7 LEU B 37  ? SER B 45  ? LEU B 229 SER B 237 1 ? 9  
HELX_P HELX_P26  AC8 LEU B 47  ? ASN B 62  ? LEU B 239 ASN B 254 1 ? 16 
HELX_P HELX_P27  AC9 HIS B 64  ? HIS B 76  ? HIS B 256 HIS B 268 1 ? 13 
HELX_P HELX_P28  AD1 GLY B 77  ? GLN B 79  ? GLY B 269 GLN B 271 5 ? 3  
HELX_P HELX_P29  AD2 GLU B 80  ? TYR B 82  ? GLU B 272 TYR B 274 5 ? 3  
HELX_P HELX_P30  AD3 TYR B 83  ? LEU B 93  ? TYR B 275 LEU B 285 1 ? 11 
HELX_P HELX_P31  AD4 LYS B 95  ? GLY B 101 ? LYS B 287 GLY B 293 1 ? 7  
HELX_P HELX_P32  AD5 ASN B 102 ? SER B 111 ? ASN B 294 SER B 303 1 ? 10 
HELX_P HELX_P33  AD6 ARG B 119 ? GLN B 130 ? ARG B 311 GLN B 322 1 ? 12 
HELX_P HELX_P34  AD7 ASN B 134 ? HIS B 144 ? ASN B 326 HIS B 336 1 ? 11 
HELX_P HELX_P35  AD8 SER B 156 ? VAL B 164 ? SER B 348 VAL B 356 1 ? 9  
HELX_P HELX_P36  AD9 LYS B 172 ? LYS B 177 ? LYS B 364 LYS B 369 5 ? 6  
HELX_P HELX_P37  AE1 LYS B 241 ? LYS B 257 ? LYS B 433 LYS B 449 1 ? 17 
HELX_P HELX_P38  AE2 PHE B 274 ? TYR B 278 ? PHE B 466 TYR B 470 1 ? 5  
HELX_P HELX_P39  AE3 GLN B 317 ? ASP B 325 ? GLN B 509 ASP B 517 1 ? 9  
HELX_P HELX_P40  AE4 ASP B 329 ? MET B 336 ? ASP B 521 MET B 528 1 ? 8  
HELX_P HELX_P41  AE5 ALA B 548 ? PHE B 552 ? ALA B 740 PHE B 744 1 ? 5  
HELX_P HELX_P42  AE6 ASN B 572 ? LEU B 576 ? ASN B 764 LEU B 768 1 ? 5  
HELX_P HELX_P43  AE7 ASP C 18  ? THR C 20  ? ASP C 210 THR C 212 5 ? 3  
HELX_P HELX_P44  AE8 MET C 21  ? CYS C 35  ? MET C 213 CYS C 227 1 ? 15 
HELX_P HELX_P45  AE9 LEU C 37  ? SER C 45  ? LEU C 229 SER C 237 1 ? 9  
HELX_P HELX_P46  AF1 LEU C 47  ? ASN C 62  ? LEU C 239 ASN C 254 1 ? 16 
HELX_P HELX_P47  AF2 HIS C 64  ? HIS C 76  ? HIS C 256 HIS C 268 1 ? 13 
HELX_P HELX_P48  AF3 GLY C 77  ? GLN C 79  ? GLY C 269 GLN C 271 5 ? 3  
HELX_P HELX_P49  AF4 GLU C 80  ? TYR C 82  ? GLU C 272 TYR C 274 5 ? 3  
HELX_P HELX_P50  AF5 TYR C 83  ? LEU C 93  ? TYR C 275 LEU C 285 1 ? 11 
HELX_P HELX_P51  AF6 LYS C 95  ? GLY C 101 ? LYS C 287 GLY C 293 1 ? 7  
HELX_P HELX_P52  AF7 ASN C 102 ? SER C 111 ? ASN C 294 SER C 303 1 ? 10 
HELX_P HELX_P53  AF8 ARG C 119 ? GLN C 130 ? ARG C 311 GLN C 322 1 ? 12 
HELX_P HELX_P54  AF9 GLU C 131 ? GLN C 133 ? GLU C 323 GLN C 325 5 ? 3  
HELX_P HELX_P55  AG1 ASN C 134 ? HIS C 144 ? ASN C 326 HIS C 336 1 ? 11 
HELX_P HELX_P56  AG2 SER C 156 ? VAL C 164 ? SER C 348 VAL C 356 1 ? 9  
HELX_P HELX_P57  AG3 LYS C 172 ? LYS C 177 ? LYS C 364 LYS C 369 5 ? 6  
HELX_P HELX_P58  AG4 LYS C 241 ? LYS C 257 ? LYS C 433 LYS C 449 1 ? 17 
HELX_P HELX_P59  AG5 PHE C 274 ? TYR C 278 ? PHE C 466 TYR C 470 1 ? 5  
HELX_P HELX_P60  AG6 GLN C 317 ? LYS C 326 ? GLN C 509 LYS C 518 1 ? 10 
HELX_P HELX_P61  AG7 ASP C 329 ? MET C 336 ? ASP C 521 MET C 528 1 ? 8  
HELX_P HELX_P62  AG8 ALA C 548 ? PHE C 552 ? ALA C 740 PHE C 744 1 ? 5  
HELX_P HELX_P63  AG9 ASN C 572 ? LEU C 576 ? ASN C 764 LEU C 768 1 ? 5  
HELX_P HELX_P64  AH1 ASP D 18  ? THR D 20  ? ASP D 210 THR D 212 5 ? 3  
HELX_P HELX_P65  AH2 MET D 21  ? SER D 36  ? MET D 213 SER D 228 1 ? 16 
HELX_P HELX_P66  AH3 LEU D 37  ? SER D 45  ? LEU D 229 SER D 237 1 ? 9  
HELX_P HELX_P67  AH4 LEU D 47  ? ASN D 62  ? LEU D 239 ASN D 254 1 ? 16 
HELX_P HELX_P68  AH5 HIS D 64  ? HIS D 76  ? HIS D 256 HIS D 268 1 ? 13 
HELX_P HELX_P69  AH6 GLY D 77  ? GLN D 79  ? GLY D 269 GLN D 271 5 ? 3  
HELX_P HELX_P70  AH7 GLU D 80  ? TYR D 82  ? GLU D 272 TYR D 274 5 ? 3  
HELX_P HELX_P71  AH8 TYR D 83  ? LEU D 93  ? TYR D 275 LEU D 285 1 ? 11 
HELX_P HELX_P72  AH9 LYS D 95  ? GLY D 101 ? LYS D 287 GLY D 293 1 ? 7  
HELX_P HELX_P73  AI1 ASN D 102 ? SER D 111 ? ASN D 294 SER D 303 1 ? 10 
HELX_P HELX_P74  AI2 ARG D 119 ? GLU D 131 ? ARG D 311 GLU D 323 1 ? 13 
HELX_P HELX_P75  AI3 ASN D 134 ? HIS D 144 ? ASN D 326 HIS D 336 1 ? 11 
HELX_P HELX_P76  AI4 SER D 156 ? VAL D 164 ? SER D 348 VAL D 356 1 ? 9  
HELX_P HELX_P77  AI5 LYS D 172 ? LYS D 177 ? LYS D 364 LYS D 369 5 ? 6  
HELX_P HELX_P78  AI6 LYS D 241 ? LYS D 257 ? LYS D 433 LYS D 449 1 ? 17 
HELX_P HELX_P79  AI7 PHE D 274 ? TYR D 278 ? PHE D 466 TYR D 470 1 ? 5  
HELX_P HELX_P80  AI8 GLN D 317 ? ASP D 325 ? GLN D 509 ASP D 517 1 ? 9  
HELX_P HELX_P81  AI9 ASP D 329 ? MET D 336 ? ASP D 521 MET D 528 1 ? 8  
HELX_P HELX_P82  AJ1 ALA D 548 ? PHE D 552 ? ALA D 740 PHE D 744 1 ? 5  
HELX_P HELX_P83  AJ2 ASN D 572 ? LEU D 576 ? ASN D 764 LEU D 768 1 ? 5  
HELX_P HELX_P84  AJ3 PRO E 11  ? SER E 21  ? PRO E 15  SER E 25  1 ? 11 
HELX_P HELX_P85  AJ4 GLN E 28  ? GLY E 57  ? GLN E 32  GLY E 61  1 ? 30 
HELX_P HELX_P86  AJ5 THR E 63  ? ASN E 75  ? THR E 67  ASN E 79  1 ? 13 
HELX_P HELX_P87  AJ6 ASP F 11  ? MET F 22  ? ASP F 15  MET F 26  1 ? 12 
HELX_P HELX_P88  AJ7 PRO F 29  ? ALA F 57  ? PRO F 33  ALA F 61  1 ? 29 
HELX_P HELX_P89  AJ8 ASP F 63  ? SER F 78  ? ASP F 67  SER F 82  1 ? 16 
HELX_P HELX_P90  AJ9 PRO F 84  ? GLN F 97  ? PRO F 88  GLN F 101 1 ? 14 
HELX_P HELX_P91  AK1 PRO G 11  ? MET G 22  ? PRO G 15  MET G 26  1 ? 12 
HELX_P HELX_P92  AK2 GLN G 28  ? GLY G 57  ? GLN G 32  GLY G 61  1 ? 30 
HELX_P HELX_P93  AK3 THR G 63  ? LYS G 74  ? THR G 67  LYS G 78  1 ? 12 
HELX_P HELX_P94  AK4 MET H 8   ? LYS H 10  ? MET H 12  LYS H 14  5 ? 3  
HELX_P HELX_P95  AK5 ASP H 11  ? MET H 22  ? ASP H 15  MET H 26  1 ? 12 
HELX_P HELX_P96  AK6 PRO H 29  ? ALA H 57  ? PRO H 33  ALA H 61  1 ? 29 
HELX_P HELX_P97  AK7 ASP H 63  ? SER H 78  ? ASP H 67  SER H 82  1 ? 16 
HELX_P HELX_P98  AK8 PRO H 84  ? GLN H 97  ? PRO H 88  GLN H 101 1 ? 14 
HELX_P HELX_P99  AK9 PRO I 11  ? SER I 21  ? PRO I 15  SER I 25  1 ? 11 
HELX_P HELX_P100 AL1 GLN I 28  ? GLY I 57  ? GLN I 32  GLY I 61  1 ? 30 
HELX_P HELX_P101 AL2 THR I 63  ? ASN I 75  ? THR I 67  ASN I 79  1 ? 13 
HELX_P HELX_P102 AL3 ASP J 11  ? MET J 22  ? ASP J 15  MET J 26  1 ? 12 
HELX_P HELX_P103 AL4 PRO J 29  ? ALA J 57  ? PRO J 33  ALA J 61  1 ? 29 
HELX_P HELX_P104 AL5 ASP J 63  ? SER J 78  ? ASP J 67  SER J 82  1 ? 16 
HELX_P HELX_P105 AL6 PRO J 84  ? GLN J 97  ? PRO J 88  GLN J 101 1 ? 14 
HELX_P HELX_P106 AL7 PRO K 11  ? SER K 21  ? PRO K 15  SER K 25  1 ? 11 
HELX_P HELX_P107 AL8 GLN K 28  ? GLY K 57  ? GLN K 32  GLY K 61  1 ? 30 
HELX_P HELX_P108 AL9 THR K 63  ? ASN K 75  ? THR K 67  ASN K 79  1 ? 13 
HELX_P HELX_P109 AM1 MET L 8   ? LYS L 10  ? MET L 12  LYS L 14  5 ? 3  
HELX_P HELX_P110 AM2 ASP L 11  ? MET L 22  ? ASP L 15  MET L 26  1 ? 12 
HELX_P HELX_P111 AM3 PRO L 29  ? ALA L 57  ? PRO L 33  ALA L 61  1 ? 29 
HELX_P HELX_P112 AM4 ASP L 63  ? SER L 78  ? ASP L 67  SER L 82  1 ? 16 
HELX_P HELX_P113 AM5 PRO L 84  ? GLN L 97  ? PRO L 88  GLN L 101 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? F ALA 3 C ? ? ? 1_555 F SEP 4 N ? ? F ALA 7 F SEP 8 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale2 covale both ? F SEP 4 C ? ? ? 1_555 F PRO 5 N ? ? F SEP 8 F PRO 9 1_555 ? ? ? ? ? ? ? 1.342 ? 
covale3 covale both ? H ALA 3 C ? ? ? 1_555 H SEP 4 N ? ? H ALA 7 H SEP 8 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale4 covale both ? H SEP 4 C ? ? ? 1_555 H PRO 5 N ? ? H SEP 8 H PRO 9 1_555 ? ? ? ? ? ? ? 1.345 ? 
covale5 covale both ? J ALA 3 C ? ? ? 1_555 J SEP 4 N ? ? J ALA 7 J SEP 8 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale6 covale both ? J SEP 4 C ? ? ? 1_555 J PRO 5 N ? ? J SEP 8 J PRO 9 1_555 ? ? ? ? ? ? ? 1.346 ? 
covale7 covale both ? L ALA 3 C ? ? ? 1_555 L SEP 4 N ? ? L ALA 7 L SEP 8 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale8 covale both ? L SEP 4 C ? ? ? 1_555 L PRO 5 N ? ? L SEP 8 L PRO 9 1_555 ? ? ? ? ? ? ? 1.345 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 4 ? 
AA3 ? 5 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 2 ? 
AB1 ? 4 ? 
AB2 ? 5 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 2 ? 
AB9 ? 4 ? 
AC1 ? 5 ? 
AC2 ? 4 ? 
AC3 ? 4 ? 
AC4 ? 4 ? 
AC5 ? 4 ? 
AC6 ? 4 ? 
AC7 ? 2 ? 
AC8 ? 4 ? 
AC9 ? 5 ? 
AD1 ? 4 ? 
AD2 ? 4 ? 
AD3 ? 4 ? 
AD4 ? 4 ? 
AD5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? parallel      
AB1 1 2 ? anti-parallel 
AB1 2 3 ? parallel      
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? parallel      
AB9 1 2 ? anti-parallel 
AB9 2 3 ? parallel      
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC1 4 5 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? parallel      
AC8 1 2 ? anti-parallel 
AC8 2 3 ? parallel      
AC8 3 4 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 113 ? SER A 118 ? PHE A 305 SER A 310 
AA1 2 LEU A 145 ? PHE A 150 ? LEU A 337 PHE A 342 
AA2 1 VAL A 588 ? PHE A 593 ? VAL A 780 PHE A 785 
AA2 2 LEU A 598 ? GLY A 603 ? LEU A 790 GLY A 795 
AA2 3 SER A 268 ? THR A 273 ? SER A 460 THR A 465 
AA2 4 ILE K 88  ? ARG K 89  ? ILE K 92  ARG K 93  
AA3 1 LEU A 281 ? VAL A 286 ? LEU A 473 VAL A 478 
AA3 2 LEU A 292 ? PHE A 297 ? LEU A 484 PHE A 489 
AA3 3 VAL A 302 ? SER A 306 ? VAL A 494 SER A 498 
AA3 4 SER A 342 ? LEU A 347 ? SER A 534 LEU A 539 
AA3 5 GLY K 81  ? HIS K 83  ? GLY K 85  HIS K 87  
AA4 1 VAL A 354 ? PHE A 359 ? VAL A 546 PHE A 551 
AA4 2 TYR A 365 ? SER A 370 ? TYR A 557 SER A 562 
AA4 3 THR A 374 ? SER A 379 ? THR A 566 SER A 571 
AA4 4 CYS A 385 ? LYS A 390 ? CYS A 577 LYS A 582 
AA5 1 VAL A 396 ? PHE A 401 ? VAL A 588 PHE A 593 
AA5 2 TYR A 407 ? GLY A 412 ? TYR A 599 GLY A 604 
AA5 3 VAL A 416 ? ALA A 421 ? VAL A 608 ALA A 613 
AA5 4 ARG A 429 ? ALA A 432 ? ARG A 621 ALA A 624 
AA6 1 VAL A 438 ? PHE A 443 ? VAL A 630 PHE A 635 
AA6 2 TYR A 449 ? SER A 454 ? TYR A 641 SER A 646 
AA6 3 THR A 458 ? ASP A 463 ? THR A 650 ASP A 655 
AA6 4 CYS A 469 ? THR A 474 ? CYS A 661 THR A 666 
AA7 1 ILE A 480 ? PHE A 485 ? ILE A 672 PHE A 677 
AA7 2 PHE A 491 ? ALA A 496 ? PHE A 683 ALA A 688 
AA7 3 VAL A 501 ? ASP A 505 ? VAL A 693 ASP A 697 
AA7 4 LEU A 510 ? LEU A 515 ? LEU A 702 LEU A 707 
AA8 1 VAL A 522 ? PHE A 527 ? VAL A 714 PHE A 719 
AA8 2 ILE A 533 ? SER A 538 ? ILE A 725 SER A 730 
AA8 3 THR A 542 ? ASP A 547 ? THR A 734 ASP A 739 
AA8 4 LEU A 577 ? MET A 582 ? LEU A 769 MET A 774 
AA9 1 PHE B 113 ? SER B 118 ? PHE B 305 SER B 310 
AA9 2 LEU B 145 ? PHE B 150 ? LEU B 337 PHE B 342 
AB1 1 VAL B 588 ? PHE B 593 ? VAL B 780 PHE B 785 
AB1 2 VAL B 599 ? GLY B 603 ? VAL B 791 GLY B 795 
AB1 3 ILE B 269 ? THR B 273 ? ILE B 461 THR B 465 
AB1 4 ILE I 88  ? LEU I 90  ? ILE I 92  LEU I 94  
AB2 1 LEU B 281 ? VAL B 286 ? LEU B 473 VAL B 478 
AB2 2 LEU B 292 ? PHE B 297 ? LEU B 484 PHE B 489 
AB2 3 VAL B 302 ? SER B 306 ? VAL B 494 SER B 498 
AB2 4 SER B 342 ? LEU B 347 ? SER B 534 LEU B 539 
AB2 5 GLY I 81  ? HIS I 83  ? GLY I 85  HIS I 87  
AB3 1 VAL B 354 ? PHE B 359 ? VAL B 546 PHE B 551 
AB3 2 TYR B 365 ? SER B 370 ? TYR B 557 SER B 562 
AB3 3 THR B 374 ? SER B 379 ? THR B 566 SER B 571 
AB3 4 CYS B 385 ? LYS B 390 ? CYS B 577 LYS B 582 
AB4 1 VAL B 396 ? PHE B 401 ? VAL B 588 PHE B 593 
AB4 2 TYR B 407 ? GLY B 412 ? TYR B 599 GLY B 604 
AB4 3 VAL B 416 ? ALA B 421 ? VAL B 608 ALA B 613 
AB4 4 ARG B 429 ? ALA B 432 ? ARG B 621 ALA B 624 
AB5 1 VAL B 438 ? PHE B 443 ? VAL B 630 PHE B 635 
AB5 2 TYR B 449 ? SER B 454 ? TYR B 641 SER B 646 
AB5 3 THR B 458 ? ASP B 463 ? THR B 650 ASP B 655 
AB5 4 CYS B 469 ? THR B 474 ? CYS B 661 THR B 666 
AB6 1 ILE B 480 ? PHE B 485 ? ILE B 672 PHE B 677 
AB6 2 PHE B 491 ? ALA B 496 ? PHE B 683 ALA B 688 
AB6 3 VAL B 501 ? ASP B 505 ? VAL B 693 ASP B 697 
AB6 4 LEU B 510 ? LEU B 515 ? LEU B 702 LEU B 707 
AB7 1 VAL B 522 ? PHE B 527 ? VAL B 714 PHE B 719 
AB7 2 ILE B 533 ? SER B 538 ? ILE B 725 SER B 730 
AB7 3 THR B 542 ? ASP B 547 ? THR B 734 ASP B 739 
AB7 4 LEU B 577 ? MET B 582 ? LEU B 769 MET B 774 
AB8 1 PHE C 113 ? SER C 118 ? PHE C 305 SER C 310 
AB8 2 LEU C 145 ? PHE C 150 ? LEU C 337 PHE C 342 
AB9 1 VAL C 588 ? PHE C 593 ? VAL C 780 PHE C 785 
AB9 2 VAL C 599 ? GLY C 603 ? VAL C 791 GLY C 795 
AB9 3 ILE C 269 ? THR C 273 ? ILE C 461 THR C 465 
AB9 4 ILE G 88  ? ARG G 89  ? ILE G 92  ARG G 93  
AC1 1 LEU C 281 ? VAL C 286 ? LEU C 473 VAL C 478 
AC1 2 LEU C 292 ? PHE C 297 ? LEU C 484 PHE C 489 
AC1 3 VAL C 302 ? SER C 306 ? VAL C 494 SER C 498 
AC1 4 SER C 342 ? LEU C 347 ? SER C 534 LEU C 539 
AC1 5 GLY G 81  ? HIS G 83  ? GLY G 85  HIS G 87  
AC2 1 VAL C 354 ? PHE C 359 ? VAL C 546 PHE C 551 
AC2 2 TYR C 365 ? SER C 370 ? TYR C 557 SER C 562 
AC2 3 THR C 374 ? SER C 379 ? THR C 566 SER C 571 
AC2 4 CYS C 385 ? LYS C 390 ? CYS C 577 LYS C 582 
AC3 1 VAL C 396 ? PHE C 401 ? VAL C 588 PHE C 593 
AC3 2 TYR C 407 ? GLY C 412 ? TYR C 599 GLY C 604 
AC3 3 VAL C 416 ? ALA C 421 ? VAL C 608 ALA C 613 
AC3 4 ARG C 429 ? ALA C 432 ? ARG C 621 ALA C 624 
AC4 1 VAL C 438 ? PHE C 443 ? VAL C 630 PHE C 635 
AC4 2 TYR C 449 ? SER C 454 ? TYR C 641 SER C 646 
AC4 3 THR C 458 ? ASP C 463 ? THR C 650 ASP C 655 
AC4 4 CYS C 469 ? THR C 474 ? CYS C 661 THR C 666 
AC5 1 ILE C 480 ? PHE C 485 ? ILE C 672 PHE C 677 
AC5 2 PHE C 491 ? ALA C 496 ? PHE C 683 ALA C 688 
AC5 3 VAL C 501 ? ASP C 505 ? VAL C 693 ASP C 697 
AC5 4 LEU C 510 ? LEU C 515 ? LEU C 702 LEU C 707 
AC6 1 VAL C 522 ? PHE C 527 ? VAL C 714 PHE C 719 
AC6 2 ILE C 533 ? SER C 538 ? ILE C 725 SER C 730 
AC6 3 THR C 542 ? ASP C 547 ? THR C 734 ASP C 739 
AC6 4 LEU C 577 ? MET C 582 ? LEU C 769 MET C 774 
AC7 1 PHE D 113 ? SER D 118 ? PHE D 305 SER D 310 
AC7 2 LEU D 145 ? PHE D 150 ? LEU D 337 PHE D 342 
AC8 1 VAL D 588 ? PHE D 593 ? VAL D 780 PHE D 785 
AC8 2 VAL D 599 ? GLY D 603 ? VAL D 791 GLY D 795 
AC8 3 ILE D 269 ? THR D 273 ? ILE D 461 THR D 465 
AC8 4 ILE E 88  ? ARG E 89  ? ILE E 92  ARG E 93  
AC9 1 LEU D 281 ? VAL D 286 ? LEU D 473 VAL D 478 
AC9 2 LEU D 292 ? PHE D 297 ? LEU D 484 PHE D 489 
AC9 3 VAL D 302 ? SER D 306 ? VAL D 494 SER D 498 
AC9 4 SER D 342 ? LEU D 347 ? SER D 534 LEU D 539 
AC9 5 GLY E 81  ? HIS E 83  ? GLY E 85  HIS E 87  
AD1 1 VAL D 354 ? PHE D 359 ? VAL D 546 PHE D 551 
AD1 2 TYR D 365 ? SER D 370 ? TYR D 557 SER D 562 
AD1 3 THR D 374 ? SER D 379 ? THR D 566 SER D 571 
AD1 4 CYS D 385 ? LYS D 390 ? CYS D 577 LYS D 582 
AD2 1 VAL D 396 ? PHE D 401 ? VAL D 588 PHE D 593 
AD2 2 TYR D 407 ? GLY D 412 ? TYR D 599 GLY D 604 
AD2 3 VAL D 416 ? ALA D 421 ? VAL D 608 ALA D 613 
AD2 4 ARG D 429 ? ALA D 432 ? ARG D 621 ALA D 624 
AD3 1 VAL D 438 ? PHE D 443 ? VAL D 630 PHE D 635 
AD3 2 TYR D 449 ? SER D 454 ? TYR D 641 SER D 646 
AD3 3 THR D 458 ? ASP D 463 ? THR D 650 ASP D 655 
AD3 4 CYS D 469 ? THR D 474 ? CYS D 661 THR D 666 
AD4 1 ILE D 480 ? PHE D 485 ? ILE D 672 PHE D 677 
AD4 2 PHE D 491 ? ALA D 496 ? PHE D 683 ALA D 688 
AD4 3 VAL D 501 ? ASP D 505 ? VAL D 693 ASP D 697 
AD4 4 LEU D 510 ? LEU D 515 ? LEU D 702 LEU D 707 
AD5 1 VAL D 522 ? PHE D 527 ? VAL D 714 PHE D 719 
AD5 2 ILE D 533 ? SER D 538 ? ILE D 725 SER D 730 
AD5 3 THR D 542 ? ASP D 547 ? THR D 734 ASP D 739 
AD5 4 LEU D 577 ? MET D 582 ? LEU D 769 MET D 774 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 115 ? N LEU A 307 O ASP A 148 ? O ASP A 340 
AA2 1 2 N HIS A 590 ? N HIS A 782 O ALA A 602 ? O ALA A 794 
AA2 2 3 O GLY A 603 ? O GLY A 795 N TYR A 272 ? N TYR A 464 
AA2 3 4 N PHE A 271 ? N PHE A 463 O ILE K 88  ? O ILE K 92  
AA3 1 2 N THR A 282 ? N THR A 474 O GLY A 296 ? O GLY A 488 
AA3 2 3 N ILE A 293 ? N ILE A 485 O TRP A 305 ? O TRP A 497 
AA3 3 4 N VAL A 302 ? N VAL A 494 O LEU A 347 ? O LEU A 539 
AA3 4 5 N SER A 342 ? N SER A 534 O HIS K 83  ? O HIS K 87  
AA4 1 2 N SER A 358 ? N SER A 550 O LEU A 367 ? O LEU A 559 
AA4 2 3 N LEU A 366 ? N LEU A 558 O TRP A 378 ? O TRP A 570 
AA4 3 4 N VAL A 375 ? N VAL A 567 O TYR A 389 ? O TYR A 581 
AA5 1 2 N GLN A 400 ? N GLN A 592 O VAL A 409 ? O VAL A 601 
AA5 2 3 N PHE A 408 ? N PHE A 600 O TRP A 420 ? O TRP A 612 
AA5 3 4 N ALA A 417 ? N ALA A 609 O PHE A 431 ? O PHE A 623 
AA6 1 2 N ARG A 442 ? N ARG A 634 O ALA A 451 ? O ALA A 643 
AA6 2 3 N VAL A 450 ? N VAL A 642 O TRP A 462 ? O TRP A 654 
AA6 3 4 N VAL A 459 ? N VAL A 651 O PHE A 473 ? O PHE A 665 
AA7 1 2 N THR A 484 ? N THR A 676 O ALA A 493 ? O ALA A 685 
AA7 2 3 N LEU A 492 ? N LEU A 684 O TRP A 504 ? O TRP A 696 
AA7 3 4 N VAL A 501 ? N VAL A 693 O LEU A 515 ? O LEU A 707 
AA8 1 2 N ARG A 526 ? N ARG A 718 O ALA A 535 ? O ALA A 727 
AA8 2 3 N LEU A 534 ? N LEU A 726 O TRP A 546 ? O TRP A 738 
AA8 3 4 N VAL A 543 ? N VAL A 735 O TYR A 581 ? O TYR A 773 
AA9 1 2 N PHE B 113 ? N PHE B 305 O TYR B 146 ? O TYR B 338 
AB1 1 2 N HIS B 590 ? N HIS B 782 O ALA B 602 ? O ALA B 794 
AB1 2 3 O GLY B 603 ? O GLY B 795 N TYR B 272 ? N TYR B 464 
AB1 3 4 N PHE B 271 ? N PHE B 463 O ILE I 88  ? O ILE I 92  
AB2 1 2 N ASP B 285 ? N ASP B 477 O ALA B 294 ? O ALA B 486 
AB2 2 3 N ILE B 293 ? N ILE B 485 O TRP B 305 ? O TRP B 497 
AB2 3 4 N VAL B 302 ? N VAL B 494 O LEU B 347 ? O LEU B 539 
AB2 4 5 N SER B 342 ? N SER B 534 O HIS I 83  ? O HIS I 87  
AB3 1 2 N SER B 358 ? N SER B 550 O LEU B 367 ? O LEU B 559 
AB3 2 3 N LEU B 366 ? N LEU B 558 O TRP B 378 ? O TRP B 570 
AB3 3 4 N LEU B 377 ? N LEU B 569 O LEU B 386 ? O LEU B 578 
AB4 1 2 N GLN B 400 ? N GLN B 592 O VAL B 409 ? O VAL B 601 
AB4 2 3 N PHE B 408 ? N PHE B 600 O TRP B 420 ? O TRP B 612 
AB4 3 4 N ALA B 417 ? N ALA B 609 O PHE B 431 ? O PHE B 623 
AB5 1 2 N ARG B 442 ? N ARG B 634 O ALA B 451 ? O ALA B 643 
AB5 2 3 N VAL B 450 ? N VAL B 642 O TRP B 462 ? O TRP B 654 
AB5 3 4 N VAL B 459 ? N VAL B 651 O PHE B 473 ? O PHE B 665 
AB6 1 2 N THR B 484 ? N THR B 676 O ALA B 493 ? O ALA B 685 
AB6 2 3 N LEU B 492 ? N LEU B 684 O TRP B 504 ? O TRP B 696 
AB6 3 4 N VAL B 501 ? N VAL B 693 O LEU B 515 ? O LEU B 707 
AB7 1 2 N ARG B 526 ? N ARG B 718 O ALA B 535 ? O ALA B 727 
AB7 2 3 N LEU B 534 ? N LEU B 726 O TRP B 546 ? O TRP B 738 
AB7 3 4 N VAL B 543 ? N VAL B 735 O TYR B 581 ? O TYR B 773 
AB8 1 2 N PHE C 113 ? N PHE C 305 O TYR C 146 ? O TYR C 338 
AB9 1 2 N HIS C 592 ? N HIS C 784 O LEU C 600 ? O LEU C 792 
AB9 2 3 O GLY C 603 ? O GLY C 795 N TYR C 272 ? N TYR C 464 
AB9 3 4 N PHE C 271 ? N PHE C 463 O ILE G 88  ? O ILE G 92  
AC1 1 2 N THR C 282 ? N THR C 474 O GLY C 296 ? O GLY C 488 
AC1 2 3 N ILE C 293 ? N ILE C 485 O TRP C 305 ? O TRP C 497 
AC1 3 4 N VAL C 302 ? N VAL C 494 O LEU C 347 ? O LEU C 539 
AC1 4 5 N SER C 342 ? N SER C 534 O HIS G 83  ? O HIS G 87  
AC2 1 2 N SER C 358 ? N SER C 550 O LEU C 367 ? O LEU C 559 
AC2 2 3 N LEU C 366 ? N LEU C 558 O TRP C 378 ? O TRP C 570 
AC2 3 4 N LEU C 377 ? N LEU C 569 O LEU C 386 ? O LEU C 578 
AC3 1 2 N GLN C 400 ? N GLN C 592 O VAL C 409 ? O VAL C 601 
AC3 2 3 N PHE C 408 ? N PHE C 600 O TRP C 420 ? O TRP C 612 
AC3 3 4 N ALA C 417 ? N ALA C 609 O PHE C 431 ? O PHE C 623 
AC4 1 2 N ARG C 442 ? N ARG C 634 O ALA C 451 ? O ALA C 643 
AC4 2 3 N VAL C 450 ? N VAL C 642 O TRP C 462 ? O TRP C 654 
AC4 3 4 N VAL C 459 ? N VAL C 651 O PHE C 473 ? O PHE C 665 
AC5 1 2 N THR C 484 ? N THR C 676 O ALA C 493 ? O ALA C 685 
AC5 2 3 N LEU C 492 ? N LEU C 684 O TRP C 504 ? O TRP C 696 
AC5 3 4 N VAL C 501 ? N VAL C 693 O LEU C 515 ? O LEU C 707 
AC6 1 2 N ARG C 526 ? N ARG C 718 O ALA C 535 ? O ALA C 727 
AC6 2 3 N LEU C 534 ? N LEU C 726 O TRP C 546 ? O TRP C 738 
AC6 3 4 N VAL C 543 ? N VAL C 735 O TYR C 581 ? O TYR C 773 
AC7 1 2 N PHE D 113 ? N PHE D 305 O TYR D 146 ? O TYR D 338 
AC8 1 2 N HIS D 592 ? N HIS D 784 O LEU D 600 ? O LEU D 792 
AC8 2 3 O GLY D 603 ? O GLY D 795 N TYR D 272 ? N TYR D 464 
AC8 3 4 N PHE D 271 ? N PHE D 463 O ILE E 88  ? O ILE E 92  
AC9 1 2 N ASP D 285 ? N ASP D 477 O ALA D 294 ? O ALA D 486 
AC9 2 3 N ILE D 293 ? N ILE D 485 O TRP D 305 ? O TRP D 497 
AC9 3 4 N VAL D 302 ? N VAL D 494 O LEU D 347 ? O LEU D 539 
AC9 4 5 N SER D 342 ? N SER D 534 O HIS E 83  ? O HIS E 87  
AD1 1 2 N SER D 358 ? N SER D 550 O LEU D 367 ? O LEU D 559 
AD1 2 3 N LEU D 366 ? N LEU D 558 O TRP D 378 ? O TRP D 570 
AD1 3 4 N LEU D 377 ? N LEU D 569 O LEU D 386 ? O LEU D 578 
AD2 1 2 N GLN D 400 ? N GLN D 592 O VAL D 409 ? O VAL D 601 
AD2 2 3 N PHE D 408 ? N PHE D 600 O TRP D 420 ? O TRP D 612 
AD2 3 4 N ALA D 417 ? N ALA D 609 O PHE D 431 ? O PHE D 623 
AD3 1 2 N ARG D 442 ? N ARG D 634 O ALA D 451 ? O ALA D 643 
AD3 2 3 N VAL D 450 ? N VAL D 642 O TRP D 462 ? O TRP D 654 
AD3 3 4 N VAL D 459 ? N VAL D 651 O PHE D 473 ? O PHE D 665 
AD4 1 2 N THR D 484 ? N THR D 676 O ALA D 493 ? O ALA D 685 
AD4 2 3 N LEU D 492 ? N LEU D 684 O TRP D 504 ? O TRP D 696 
AD4 3 4 N VAL D 501 ? N VAL D 693 O LEU D 515 ? O LEU D 707 
AD5 1 2 N ARG D 526 ? N ARG D 718 O ALA D 535 ? O ALA D 727 
AD5 2 3 N LEU D 534 ? N LEU D 726 O TRP D 546 ? O TRP D 738 
AD5 3 4 N VAL D 543 ? N VAL D 735 O TYR D 581 ? O TYR D 773 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CL 901 ? 1 'binding site for residue CL A 901' 
AC2 Software A CL 902 ? 3 'binding site for residue CL A 902' 
AC3 Software B CL 901 ? 1 'binding site for residue CL B 901' 
AC4 Software C CL 901 ? 1 'binding site for residue CL C 901' 
AC5 Software C CL 902 ? 4 'binding site for residue CL C 902' 
AC6 Software D CL 901 ? 2 'binding site for residue CL D 901' 
AC7 Software D CL 902 ? 4 'binding site for residue CL D 902' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1 TYR A 406 ? TYR A 598  . ? 1_555 ? 
2  AC2 3 TYR A 355 ? TYR A 547  . ? 1_555 ? 
3  AC2 3 TRP A 397 ? TRP A 589  . ? 1_555 ? 
4  AC2 3 MET E 56  ? MET E 60   . ? 1_555 ? 
5  AC3 1 TYR B 406 ? TYR B 598  . ? 1_555 ? 
6  AC4 1 TYR C 406 ? TYR C 598  . ? 1_555 ? 
7  AC5 4 ASN C 276 ? ASN C 468  . ? 1_555 ? 
8  AC5 4 HOH V .   ? HOH C 1058 . ? 1_555 ? 
9  AC5 4 GLN G 85  ? GLN G 89   . ? 1_555 ? 
10 AC5 4 GLU G 86  ? GLU G 90   . ? 1_555 ? 
11 AC6 2 TYR D 406 ? TYR D 598  . ? 1_555 ? 
12 AC6 2 HOH W .   ? HOH D 1061 . ? 1_555 ? 
13 AC7 4 ASN D 276 ? ASN D 468  . ? 1_555 ? 
14 AC7 4 HOH W .   ? HOH D 1012 . ? 1_555 ? 
15 AC7 4 GLN E 85  ? GLN E 89   . ? 1_555 ? 
16 AC7 4 GLU E 86  ? GLU E 90   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6F3T 
_atom_sites.fract_transf_matrix[1][1]   0.002949 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002949 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002949 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLN A  1 15  ? 191.414 73.567  38.713  1.00 132.17 ? 207  GLN A N    1 
ATOM   2     C  CA   . GLN A  1 15  ? 190.656 72.322  38.740  1.00 135.81 ? 207  GLN A CA   1 
ATOM   3     C  C    . GLN A  1 15  ? 190.737 71.606  37.391  1.00 142.49 ? 207  GLN A C    1 
ATOM   4     O  O    . GLN A  1 15  ? 189.874 70.794  37.057  1.00 142.64 ? 207  GLN A O    1 
ATOM   5     C  CB   . GLN A  1 15  ? 189.197 72.598  39.120  1.00 136.13 ? 207  GLN A CB   1 
ATOM   6     C  CG   . GLN A  1 15  ? 189.027 73.092  40.556  1.00 133.77 ? 207  GLN A CG   1 
ATOM   7     C  CD   . GLN A  1 15  ? 187.662 73.701  40.822  1.00 133.09 ? 207  GLN A CD   1 
ATOM   8     O  OE1  . GLN A  1 15  ? 187.559 74.837  41.288  1.00 129.75 ? 207  GLN A OE1  1 
ATOM   9     N  NE2  . GLN A  1 15  ? 186.606 72.945  40.542  1.00 133.63 ? 207  GLN A NE2  1 
ATOM   10    H  HA   . GLN A  1 15  ? 191.035 71.736  39.413  1.00 162.73 ? 207  GLN A HA   1 
ATOM   11    H  HB2  . GLN A  1 15  ? 188.841 73.279  38.527  1.00 163.11 ? 207  GLN A HB2  1 
ATOM   12    H  HB3  . GLN A  1 15  ? 188.687 71.779  39.025  1.00 163.11 ? 207  GLN A HB3  1 
ATOM   13    H  HG2  . GLN A  1 15  ? 189.143 72.344  41.161  1.00 160.27 ? 207  GLN A HG2  1 
ATOM   14    H  HG3  . GLN A  1 15  ? 189.696 73.771  40.736  1.00 160.27 ? 207  GLN A HG3  1 
ATOM   15    H  HE21 . GLN A  1 15  ? 186.717 72.155  40.219  1.00 160.10 ? 207  GLN A HE21 1 
ATOM   16    H  HE22 . GLN A  1 15  ? 185.813 73.246  40.677  1.00 160.10 ? 207  GLN A HE22 1 
ATOM   17    N  N    . GLN A  1 16  ? 191.781 71.913  36.618  1.00 160.95 ? 208  GLN A N    1 
ATOM   18    C  CA   . GLN A  1 16  ? 192.047 71.201  35.374  1.00 168.93 ? 208  GLN A CA   1 
ATOM   19    C  C    . GLN A  1 16  ? 193.493 71.414  34.937  1.00 166.31 ? 208  GLN A C    1 
ATOM   20    O  O    . GLN A  1 16  ? 193.760 71.716  33.769  1.00 168.67 ? 208  GLN A O    1 
ATOM   21    C  CB   . GLN A  1 16  ? 191.086 71.652  34.272  1.00 171.81 ? 208  GLN A CB   1 
ATOM   22    C  CG   . GLN A  1 16  ? 190.862 70.599  33.195  1.00 177.47 ? 208  GLN A CG   1 
ATOM   23    C  CD   . GLN A  1 16  ? 190.710 71.195  31.812  1.00 181.02 ? 208  GLN A CD   1 
ATOM   24    O  OE1  . GLN A  1 16  ? 189.613 71.235  31.256  1.00 183.22 ? 208  GLN A OE1  1 
ATOM   25    N  NE2  . GLN A  1 16  ? 191.818 71.656  31.244  1.00 181.00 ? 208  GLN A NE2  1 
ATOM   26    H  H    . GLN A  1 16  ? 192.351 72.533  36.796  1.00 192.89 ? 208  GLN A H    1 
ATOM   27    H  HA   . GLN A  1 16  ? 191.914 70.251  35.518  1.00 202.47 ? 208  GLN A HA   1 
ATOM   28    H  HB2  . GLN A  1 16  ? 190.226 71.857  34.671  1.00 205.93 ? 208  GLN A HB2  1 
ATOM   29    H  HB3  . GLN A  1 16  ? 191.448 72.443  33.843  1.00 205.93 ? 208  GLN A HB3  1 
ATOM   30    H  HG2  . GLN A  1 16  ? 191.622 69.996  33.180  1.00 212.72 ? 208  GLN A HG2  1 
ATOM   31    H  HG3  . GLN A  1 16  ? 190.052 70.106  33.400  1.00 212.72 ? 208  GLN A HG3  1 
ATOM   32    H  HE21 . GLN A  1 16  ? 192.567 71.610  31.663  1.00 216.96 ? 208  GLN A HE21 1 
ATOM   33    H  HE22 . GLN A  1 16  ? 191.785 72.004  30.458  1.00 216.96 ? 208  GLN A HE22 1 
ATOM   34    N  N    . GLY A  1 17  ? 194.424 71.260  35.868  1.00 153.90 ? 209  GLY A N    1 
ATOM   35    C  CA   . GLY A  1 17  ? 195.838 71.390  35.566  1.00 148.16 ? 209  GLY A CA   1 
ATOM   36    C  C    . GLY A  1 17  ? 196.622 70.293  36.253  1.00 144.18 ? 209  GLY A C    1 
ATOM   37    O  O    . GLY A  1 17  ? 196.219 69.772  37.296  1.00 147.88 ? 209  GLY A O    1 
ATOM   38    H  H    . GLY A  1 17  ? 194.258 71.078  36.692  1.00 184.43 ? 209  GLY A H    1 
ATOM   39    H  HA2  . GLY A  1 17  ? 195.978 71.325  34.609  1.00 177.55 ? 209  GLY A HA2  1 
ATOM   40    H  HA3  . GLY A  1 17  ? 196.164 72.250  35.874  1.00 177.55 ? 209  GLY A HA3  1 
ATOM   41    N  N    . ASP A  1 18  ? 197.756 69.944  35.656  1.00 123.20 ? 210  ASP A N    1 
ATOM   42    C  CA   . ASP A  1 18  ? 198.559 68.826  36.151  1.00 116.28 ? 210  ASP A CA   1 
ATOM   43    C  C    . ASP A  1 18  ? 199.302 69.228  37.422  1.00 112.32 ? 210  ASP A C    1 
ATOM   44    O  O    . ASP A  1 18  ? 200.137 70.141  37.373  1.00 111.17 ? 210  ASP A O    1 
ATOM   45    C  CB   . ASP A  1 18  ? 199.547 68.379  35.077  1.00 111.58 ? 210  ASP A CB   1 
ATOM   46    C  CG   . ASP A  1 18  ? 200.344 67.153  35.488  1.00 108.27 ? 210  ASP A CG   1 
ATOM   47    O  OD1  . ASP A  1 18  ? 200.181 66.683  36.633  1.00 105.99 ? 210  ASP A OD1  1 
ATOM   48    O  OD2  . ASP A  1 18  ? 201.133 66.655  34.659  1.00 109.71 ? 210  ASP A OD2  1 
ATOM   49    H  H    . ASP A  1 18  ? 198.085 70.336  34.964  1.00 147.59 ? 210  ASP A H    1 
ATOM   50    H  HA   . ASP A  1 18  ? 197.976 68.080  36.360  1.00 139.28 ? 210  ASP A HA   1 
ATOM   51    H  HB2  . ASP A  1 18  ? 199.058 68.161  34.268  1.00 133.64 ? 210  ASP A HB2  1 
ATOM   52    H  HB3  . ASP A  1 18  ? 200.173 69.099  34.903  1.00 133.64 ? 210  ASP A HB3  1 
ATOM   53    N  N    . PRO A  1 19  ? 199.048 68.579  38.567  1.00 114.95 ? 211  PRO A N    1 
ATOM   54    C  CA   . PRO A  1 19  ? 199.699 69.015  39.816  1.00 109.45 ? 211  PRO A CA   1 
ATOM   55    C  C    . PRO A  1 19  ? 201.212 68.886  39.816  1.00 108.52 ? 211  PRO A C    1 
ATOM   56    O  O    . PRO A  1 19  ? 201.884 69.680  40.488  1.00 107.03 ? 211  PRO A O    1 
ATOM   57    C  CB   . PRO A  1 19  ? 199.066 68.112  40.885  1.00 110.27 ? 211  PRO A CB   1 
ATOM   58    C  CG   . PRO A  1 19  ? 198.409 67.004  40.153  1.00 113.76 ? 211  PRO A CG   1 
ATOM   59    C  CD   . PRO A  1 19  ? 198.057 67.516  38.801  1.00 116.28 ? 211  PRO A CD   1 
ATOM   60    H  HA   . PRO A  1 19  ? 199.464 69.937  40.006  1.00 131.09 ? 211  PRO A HA   1 
ATOM   61    H  HB2  . PRO A  1 19  ? 199.758 67.768  41.471  1.00 132.08 ? 211  PRO A HB2  1 
ATOM   62    H  HB3  . PRO A  1 19  ? 198.412 68.618  41.392  1.00 132.08 ? 211  PRO A HB3  1 
ATOM   63    H  HG2  . PRO A  1 19  ? 199.025 66.258  40.081  1.00 136.26 ? 211  PRO A HG2  1 
ATOM   64    H  HG3  . PRO A  1 19  ? 197.609 66.735  40.630  1.00 136.26 ? 211  PRO A HG3  1 
ATOM   65    H  HD2  . PRO A  1 19  ? 198.152 66.814  38.139  1.00 139.29 ? 211  PRO A HD2  1 
ATOM   66    H  HD3  . PRO A  1 19  ? 197.160 67.885  38.803  1.00 139.29 ? 211  PRO A HD3  1 
ATOM   67    N  N    . THR A  1 20  ? 201.776 67.925  39.080  1.00 106.47 ? 212  THR A N    1 
ATOM   68    C  CA   . THR A  1 20  ? 203.228 67.814  39.050  1.00 108.44 ? 212  THR A CA   1 
ATOM   69    C  C    . THR A  1 20  ? 203.866 68.966  38.281  1.00 106.76 ? 212  THR A C    1 
ATOM   70    O  O    . THR A  1 20  ? 205.064 69.214  38.468  1.00 108.05 ? 212  THR A O    1 
ATOM   71    C  CB   . THR A  1 20  ? 203.650 66.483  38.425  1.00 112.78 ? 212  THR A CB   1 
ATOM   72    O  OG1  . THR A  1 20  ? 203.111 66.377  37.101  1.00 114.00 ? 212  THR A OG1  1 
ATOM   73    C  CG2  . THR A  1 20  ? 203.163 65.315  39.280  1.00 112.64 ? 212  THR A CG2  1 
ATOM   74    H  H    . THR A  1 20  ? 201.353 67.346  38.605  1.00 127.52 ? 212  THR A H    1 
ATOM   75    H  HA   . THR A  1 20  ? 203.565 67.838  39.960  1.00 129.88 ? 212  THR A HA   1 
ATOM   76    H  HB   . THR A  1 20  ? 204.618 66.444  38.380  1.00 135.08 ? 212  THR A HB   1 
ATOM   77    H  HG1  . THR A  1 20  ? 203.341 65.647  36.754  1.00 136.55 ? 212  THR A HG1  1 
ATOM   78    H  HG21 . THR A  1 20  ? 203.434 64.474  38.877  1.00 134.92 ? 212  THR A HG21 1 
ATOM   79    H  HG22 . THR A  1 20  ? 203.543 65.375  40.170  1.00 134.92 ? 212  THR A HG22 1 
ATOM   80    H  HG23 . THR A  1 20  ? 202.196 65.334  39.348  1.00 134.92 ? 212  THR A HG23 1 
ATOM   81    N  N    . MET A  1 21  ? 203.115 69.687  37.456  1.00 103.00 ? 213  MET A N    1 
ATOM   82    C  CA   . MET A  1 21  ? 203.677 70.770  36.655  1.00 103.94 ? 213  MET A CA   1 
ATOM   83    C  C    . MET A  1 21  ? 203.435 72.144  37.265  1.00 100.84 ? 213  MET A C    1 
ATOM   84    O  O    . MET A  1 21  ? 203.652 73.156  36.593  1.00 101.57 ? 213  MET A O    1 
ATOM   85    C  CB   . MET A  1 21  ? 203.127 70.726  35.223  1.00 106.90 ? 213  MET A CB   1 
ATOM   86    C  CG   . MET A  1 21  ? 203.586 69.526  34.381  1.00 111.45 ? 213  MET A CG   1 
ATOM   87    S  SD   . MET A  1 21  ? 205.368 69.352  34.114  1.00 118.18 ? 213  MET A SD   1 
ATOM   88    C  CE   . MET A  1 21  ? 205.801 68.295  35.492  1.00 119.73 ? 213  MET A CE   1 
ATOM   89    H  H    . MET A  1 21  ? 202.271 69.569  37.341  1.00 123.36 ? 213  MET A H    1 
ATOM   90    H  HA   . MET A  1 21  ? 204.635 70.633  36.596  1.00 124.48 ? 213  MET A HA   1 
ATOM   91    H  HB2  . MET A  1 21  ? 202.158 70.699  35.266  1.00 128.03 ? 213  MET A HB2  1 
ATOM   92    H  HB3  . MET A  1 21  ? 203.408 71.531  34.761  1.00 128.03 ? 213  MET A HB3  1 
ATOM   93    H  HG2  . MET A  1 21  ? 203.282 68.715  34.819  1.00 133.49 ? 213  MET A HG2  1 
ATOM   94    H  HG3  . MET A  1 21  ? 203.171 69.592  33.508  1.00 133.49 ? 213  MET A HG3  1 
ATOM   95    H  HE1  . MET A  1 21  ? 206.755 68.119  35.467  1.00 143.43 ? 213  MET A HE1  1 
ATOM   96    H  HE2  . MET A  1 21  ? 205.569 68.744  36.319  1.00 143.43 ? 213  MET A HE2  1 
ATOM   97    H  HE3  . MET A  1 21  ? 205.309 67.463  35.417  1.00 143.43 ? 213  MET A HE3  1 
ATOM   98    N  N    . TYR A  1 22  ? 202.937 72.207  38.497  1.00 93.86  ? 214  TYR A N    1 
ATOM   99    C  CA   . TYR A  1 22  ? 202.637 73.512  39.072  1.00 92.28  ? 214  TYR A CA   1 
ATOM   100   C  C    . TYR A  1 22  ? 203.895 74.350  39.261  1.00 90.45  ? 214  TYR A C    1 
ATOM   101   O  O    . TYR A  1 22  ? 203.849 75.576  39.127  1.00 87.65  ? 214  TYR A O    1 
ATOM   102   C  CB   . TYR A  1 22  ? 201.893 73.340  40.395  1.00 88.07  ? 214  TYR A CB   1 
ATOM   103   C  CG   . TYR A  1 22  ? 200.392 73.475  40.271  1.00 88.65  ? 214  TYR A CG   1 
ATOM   104   C  CD1  . TYR A  1 22  ? 199.695 72.834  39.253  1.00 91.20  ? 214  TYR A CD1  1 
ATOM   105   C  CD2  . TYR A  1 22  ? 199.674 74.245  41.174  1.00 87.24  ? 214  TYR A CD2  1 
ATOM   106   C  CE1  . TYR A  1 22  ? 198.322 72.963  39.141  1.00 91.12  ? 214  TYR A CE1  1 
ATOM   107   C  CE2  . TYR A  1 22  ? 198.304 74.378  41.070  1.00 86.23  ? 214  TYR A CE2  1 
ATOM   108   C  CZ   . TYR A  1 22  ? 197.634 73.735  40.052  1.00 89.97  ? 214  TYR A CZ   1 
ATOM   109   O  OH   . TYR A  1 22  ? 196.269 73.865  39.945  1.00 92.61  ? 214  TYR A OH   1 
ATOM   110   H  H    . TYR A  1 22  ? 202.769 71.534  39.005  1.00 112.39 ? 214  TYR A H    1 
ATOM   111   H  HA   . TYR A  1 22  ? 202.053 73.992  38.464  1.00 110.49 ? 214  TYR A HA   1 
ATOM   112   H  HB2  . TYR A  1 22  ? 202.084 72.457  40.749  1.00 105.43 ? 214  TYR A HB2  1 
ATOM   113   H  HB3  . TYR A  1 22  ? 202.202 74.017  41.017  1.00 105.43 ? 214  TYR A HB3  1 
ATOM   114   H  HD1  . TYR A  1 22  ? 200.158 72.314  38.636  1.00 109.19 ? 214  TYR A HD1  1 
ATOM   115   H  HD2  . TYR A  1 22  ? 200.123 74.681  41.861  1.00 104.43 ? 214  TYR A HD2  1 
ATOM   116   H  HE1  . TYR A  1 22  ? 197.866 72.530  38.456  1.00 109.10 ? 214  TYR A HE1  1 
ATOM   117   H  HE2  . TYR A  1 22  ? 197.836 74.898  41.682  1.00 103.22 ? 214  TYR A HE2  1 
ATOM   118   H  HH   . TYR A  1 22  ? 195.990 73.426  39.285  1.00 110.89 ? 214  TYR A HH   1 
ATOM   119   N  N    . GLU A  1 23  ? 205.025 73.715  39.577  1.00 92.02  ? 215  GLU A N    1 
ATOM   120   C  CA   . GLU A  1 23  ? 206.268 74.467  39.706  1.00 89.63  ? 215  GLU A CA   1 
ATOM   121   C  C    . GLU A  1 23  ? 206.697 75.059  38.370  1.00 94.28  ? 215  GLU A C    1 
ATOM   122   O  O    . GLU A  1 23  ? 207.178 76.199  38.312  1.00 93.93  ? 215  GLU A O    1 
ATOM   123   C  CB   . GLU A  1 23  ? 207.378 73.570  40.261  1.00 90.43  ? 215  GLU A CB   1 
ATOM   124   C  CG   . GLU A  1 23  ? 207.057 72.940  41.608  1.00 90.42  ? 215  GLU A CG   1 
ATOM   125   C  CD   . GLU A  1 23  ? 208.273 72.298  42.250  1.00 92.17  ? 215  GLU A CD   1 
ATOM   126   O  OE1  . GLU A  1 23  ? 209.371 72.375  41.655  1.00 94.33  ? 215  GLU A OE1  1 
ATOM   127   O  OE2  . GLU A  1 23  ? 208.132 71.718  43.347  1.00 91.91  ? 215  GLU A OE2  1 
ATOM   128   H  H    . GLU A  1 23  ? 205.097 72.869  39.718  1.00 110.18 ? 215  GLU A H    1 
ATOM   129   H  HA   . GLU A  1 23  ? 206.133 75.198  40.329  1.00 107.31 ? 215  GLU A HA   1 
ATOM   130   H  HB2  . GLU A  1 23  ? 207.541 72.851  39.630  1.00 108.27 ? 215  GLU A HB2  1 
ATOM   131   H  HB3  . GLU A  1 23  ? 208.182 74.101  40.368  1.00 108.27 ? 215  GLU A HB3  1 
ATOM   132   H  HG2  . GLU A  1 23  ? 206.726 73.626  42.208  1.00 108.25 ? 215  GLU A HG2  1 
ATOM   133   H  HG3  . GLU A  1 23  ? 206.384 72.252  41.484  1.00 108.25 ? 215  GLU A HG3  1 
ATOM   134   N  N    . GLU A  1 24  ? 206.518 74.309  37.280  1.00 103.91 ? 216  GLU A N    1 
ATOM   135   C  CA   . GLU A  1 24  ? 206.917 74.825  35.972  1.00 105.99 ? 216  GLU A CA   1 
ATOM   136   C  C    . GLU A  1 24  ? 205.974 75.932  35.514  1.00 100.62 ? 216  GLU A C    1 
ATOM   137   O  O    . GLU A  1 24  ? 206.423 76.929  34.938  1.00 104.57 ? 216  GLU A O    1 
ATOM   138   C  CB   . GLU A  1 24  ? 207.006 73.710  34.920  1.00 114.70 ? 216  GLU A CB   1 
ATOM   139   C  CG   . GLU A  1 24  ? 206.439 72.358  35.286  1.00 124.05 ? 216  GLU A CG   1 
ATOM   140   C  CD   . GLU A  1 24  ? 207.340 71.551  36.211  1.00 127.29 ? 216  GLU A CD   1 
ATOM   141   O  OE1  . GLU A  1 24  ? 208.463 71.188  35.796  1.00 127.21 ? 216  GLU A OE1  1 
ATOM   142   O  OE2  . GLU A  1 24  ? 206.919 71.272  37.356  1.00 126.62 ? 216  GLU A OE2  1 
ATOM   143   H  H    . GLU A  1 24  ? 206.177 73.520  37.271  1.00 124.44 ? 216  GLU A H    1 
ATOM   144   H  HA   . GLU A  1 24  ? 207.801 75.214  36.055  1.00 126.94 ? 216  GLU A HA   1 
ATOM   145   H  HB2  . GLU A  1 24  ? 206.536 74.009  34.126  1.00 137.39 ? 216  GLU A HB2  1 
ATOM   146   H  HB3  . GLU A  1 24  ? 207.942 73.576  34.704  1.00 137.39 ? 216  GLU A HB3  1 
ATOM   147   H  HG2  . GLU A  1 24  ? 205.589 72.486  35.737  1.00 148.61 ? 216  GLU A HG2  1 
ATOM   148   H  HG3  . GLU A  1 24  ? 206.307 71.843  34.475  1.00 148.61 ? 216  GLU A HG3  1 
ATOM   149   N  N    . TYR A  1 25  ? 204.665 75.781  35.749  1.00 87.93  ? 217  TYR A N    1 
ATOM   150   C  CA   . TYR A  1 25  ? 203.743 76.865  35.417  1.00 88.68  ? 217  TYR A CA   1 
ATOM   151   C  C    . TYR A  1 25  ? 204.171 78.159  36.095  1.00 84.42  ? 217  TYR A C    1 
ATOM   152   O  O    . TYR A  1 25  ? 204.173 79.228  35.472  1.00 84.33  ? 217  TYR A O    1 
ATOM   153   C  CB   . TYR A  1 25  ? 202.309 76.524  35.835  1.00 91.34  ? 217  TYR A CB   1 
ATOM   154   C  CG   . TYR A  1 25  ? 201.697 75.275  35.234  1.00 95.41  ? 217  TYR A CG   1 
ATOM   155   C  CD1  . TYR A  1 25  ? 202.106 74.788  33.999  1.00 98.95  ? 217  TYR A CD1  1 
ATOM   156   C  CD2  . TYR A  1 25  ? 200.676 74.604  35.896  1.00 94.25  ? 217  TYR A CD2  1 
ATOM   157   C  CE1  . TYR A  1 25  ? 201.528 73.651  33.453  1.00 99.88  ? 217  TYR A CE1  1 
ATOM   158   C  CE2  . TYR A  1 25  ? 200.095 73.472  35.359  1.00 98.19  ? 217  TYR A CE2  1 
ATOM   159   C  CZ   . TYR A  1 25  ? 200.522 73.000  34.138  1.00 100.31 ? 217  TYR A CZ   1 
ATOM   160   O  OH   . TYR A  1 25  ? 199.940 71.872  33.607  1.00 102.60 ? 217  TYR A OH   1 
ATOM   161   H  H    . TYR A  1 25  ? 204.298 75.082  36.089  1.00 105.26 ? 217  TYR A H    1 
ATOM   162   H  HA   . TYR A  1 25  ? 203.753 77.008  34.458  1.00 106.16 ? 217  TYR A HA   1 
ATOM   163   H  HB2  . TYR A  1 25  ? 202.293 76.414  36.799  1.00 109.36 ? 217  TYR A HB2  1 
ATOM   164   H  HB3  . TYR A  1 25  ? 201.738 77.268  35.589  1.00 109.36 ? 217  TYR A HB3  1 
ATOM   165   H  HD1  . TYR A  1 25  ? 202.784 75.224  33.536  1.00 118.50 ? 217  TYR A HD1  1 
ATOM   166   H  HD2  . TYR A  1 25  ? 200.384 74.918  36.721  1.00 112.85 ? 217  TYR A HD2  1 
ATOM   167   H  HE1  . TYR A  1 25  ? 201.815 73.331  32.628  1.00 119.60 ? 217  TYR A HE1  1 
ATOM   168   H  HE2  . TYR A  1 25  ? 199.418 73.032  35.819  1.00 117.58 ? 217  TYR A HE2  1 
ATOM   169   H  HH   . TYR A  1 25  ? 200.289 71.691  32.865  1.00 122.87 ? 217  TYR A HH   1 
ATOM   170   N  N    . TYR A  1 26  ? 204.539 78.079  37.374  1.00 83.06  ? 218  TYR A N    1 
ATOM   171   C  CA   . TYR A  1 26  ? 204.936 79.270  38.117  1.00 81.34  ? 218  TYR A CA   1 
ATOM   172   C  C    . TYR A  1 26  ? 206.242 79.838  37.575  1.00 83.40  ? 218  TYR A C    1 
ATOM   173   O  O    . TYR A  1 26  ? 206.354 81.045  37.331  1.00 82.03  ? 218  TYR A O    1 
ATOM   174   C  CB   . TYR A  1 26  ? 205.068 78.928  39.601  1.00 78.39  ? 218  TYR A CB   1 
ATOM   175   C  CG   . TYR A  1 26  ? 205.139 80.123  40.523  1.00 74.21  ? 218  TYR A CG   1 
ATOM   176   C  CD1  . TYR A  1 26  ? 203.986 80.675  41.063  1.00 73.79  ? 218  TYR A CD1  1 
ATOM   177   C  CD2  . TYR A  1 26  ? 206.359 80.691  40.864  1.00 73.80  ? 218  TYR A CD2  1 
ATOM   178   C  CE1  . TYR A  1 26  ? 204.043 81.763  41.909  1.00 67.34  ? 218  TYR A CE1  1 
ATOM   179   C  CE2  . TYR A  1 26  ? 206.427 81.781  41.712  1.00 72.39  ? 218  TYR A CE2  1 
ATOM   180   C  CZ   . TYR A  1 26  ? 205.264 82.311  42.232  1.00 68.22  ? 218  TYR A CZ   1 
ATOM   181   O  OH   . TYR A  1 26  ? 205.321 83.395  43.078  1.00 69.84  ? 218  TYR A OH   1 
ATOM   182   H  H    . TYR A  1 26  ? 204.566 77.351  37.831  1.00 99.42  ? 218  TYR A H    1 
ATOM   183   H  HA   . TYR A  1 26  ? 204.249 79.949  38.023  1.00 97.36  ? 218  TYR A HA   1 
ATOM   184   H  HB2  . TYR A  1 26  ? 204.299 78.399  39.866  1.00 93.82  ? 218  TYR A HB2  1 
ATOM   185   H  HB3  . TYR A  1 26  ? 205.879 78.411  39.729  1.00 93.82  ? 218  TYR A HB3  1 
ATOM   186   H  HD1  . TYR A  1 26  ? 203.160 80.307  40.847  1.00 88.30  ? 218  TYR A HD1  1 
ATOM   187   H  HD2  . TYR A  1 26  ? 207.143 80.334  40.515  1.00 88.31  ? 218  TYR A HD2  1 
ATOM   188   H  HE1  . TYR A  1 26  ? 203.261 82.123  42.262  1.00 80.55  ? 218  TYR A HE1  1 
ATOM   189   H  HE2  . TYR A  1 26  ? 207.250 82.153  41.931  1.00 86.62  ? 218  TYR A HE2  1 
ATOM   190   H  HH   . TYR A  1 26  ? 204.546 83.613  43.318  1.00 83.56  ? 218  TYR A HH   1 
ATOM   191   N  N    . SER A  1 27  ? 207.242 78.976  37.376  1.00 87.77  ? 219  SER A N    1 
ATOM   192   C  CA   . SER A  1 27  ? 208.512 79.425  36.817  1.00 87.27  ? 219  SER A CA   1 
ATOM   193   C  C    . SER A  1 27  ? 208.321 80.072  35.453  1.00 86.26  ? 219  SER A C    1 
ATOM   194   O  O    . SER A  1 27  ? 209.059 80.998  35.096  1.00 85.67  ? 219  SER A O    1 
ATOM   195   C  CB   . SER A  1 27  ? 209.485 78.251  36.713  1.00 90.53  ? 219  SER A CB   1 
ATOM   196   O  OG   . SER A  1 27  ? 210.040 77.933  37.977  1.00 93.96  ? 219  SER A OG   1 
ATOM   197   H  H    . SER A  1 27  ? 207.209 78.135  37.556  1.00 105.08 ? 219  SER A H    1 
ATOM   198   H  HA   . SER A  1 27  ? 208.902 80.087  37.410  1.00 104.48 ? 219  SER A HA   1 
ATOM   199   H  HB2  . SER A  1 27  ? 209.010 77.477  36.373  1.00 108.38 ? 219  SER A HB2  1 
ATOM   200   H  HB3  . SER A  1 27  ? 210.203 78.491  36.106  1.00 108.38 ? 219  SER A HB3  1 
ATOM   201   H  HG   . SER A  1 27  ? 210.571 77.287  37.903  1.00 112.50 ? 219  SER A HG   1 
ATOM   202   N  N    . GLY A  1 28  ? 207.343 79.601  34.679  1.00 81.85  ? 220  GLY A N    1 
ATOM   203   C  CA   . GLY A  1 28  ? 207.105 80.189  33.371  1.00 85.42  ? 220  GLY A CA   1 
ATOM   204   C  C    . GLY A  1 28  ? 206.689 81.643  33.468  1.00 87.19  ? 220  GLY A C    1 
ATOM   205   O  O    . GLY A  1 28  ? 207.189 82.497  32.732  1.00 87.83  ? 220  GLY A O    1 
ATOM   206   H  H    . GLY A  1 28  ? 206.815 78.955  34.886  1.00 97.97  ? 220  GLY A H    1 
ATOM   207   H  HA2  . GLY A  1 28  ? 207.914 80.135  32.839  1.00 102.25 ? 220  GLY A HA2  1 
ATOM   208   H  HA3  . GLY A  1 28  ? 206.403 79.697  32.917  1.00 102.25 ? 220  GLY A HA3  1 
ATOM   209   N  N    . LEU A  1 29  ? 205.757 81.943  34.375  1.00 94.07  ? 221  LEU A N    1 
ATOM   210   C  CA   . LEU A  1 29  ? 205.356 83.330  34.584  1.00 91.93  ? 221  LEU A CA   1 
ATOM   211   C  C    . LEU A  1 29  ? 206.455 84.115  35.290  1.00 87.30  ? 221  LEU A C    1 
ATOM   212   O  O    . LEU A  1 29  ? 206.675 85.294  34.990  1.00 90.53  ? 221  LEU A O    1 
ATOM   213   C  CB   . LEU A  1 29  ? 204.053 83.382  35.381  1.00 91.80  ? 221  LEU A CB   1 
ATOM   214   C  CG   . LEU A  1 29  ? 203.449 84.774  35.574  1.00 93.10  ? 221  LEU A CG   1 
ATOM   215   C  CD1  . LEU A  1 29  ? 202.870 85.276  34.260  1.00 96.72  ? 221  LEU A CD1  1 
ATOM   216   C  CD2  . LEU A  1 29  ? 202.381 84.748  36.650  1.00 91.82  ? 221  LEU A CD2  1 
ATOM   217   H  H    . LEU A  1 29  ? 205.351 81.372  34.873  1.00 112.63 ? 221  LEU A H    1 
ATOM   218   H  HA   . LEU A  1 29  ? 205.197 83.746  33.723  1.00 110.07 ? 221  LEU A HA   1 
ATOM   219   H  HB2  . LEU A  1 29  ? 203.392 82.840  34.923  1.00 109.91 ? 221  LEU A HB2  1 
ATOM   220   H  HB3  . LEU A  1 29  ? 204.219 83.013  36.263  1.00 109.91 ? 221  LEU A HB3  1 
ATOM   221   H  HG   . LEU A  1 29  ? 204.145 85.389  35.853  1.00 111.47 ? 221  LEU A HG   1 
ATOM   222   H  HD11 . LEU A  1 29  ? 202.491 86.158  34.399  1.00 115.82 ? 221  LEU A HD11 1 
ATOM   223   H  HD12 . LEU A  1 29  ? 203.580 85.320  33.600  1.00 115.82 ? 221  LEU A HD12 1 
ATOM   224   H  HD13 . LEU A  1 29  ? 202.180 84.662  33.964  1.00 115.82 ? 221  LEU A HD13 1 
ATOM   225   H  HD21 . LEU A  1 29  ? 202.015 85.640  36.752  1.00 109.93 ? 221  LEU A HD21 1 
ATOM   226   H  HD22 . LEU A  1 29  ? 201.681 84.131  36.385  1.00 109.93 ? 221  LEU A HD22 1 
ATOM   227   H  HD23 . LEU A  1 29  ? 202.781 84.457  37.484  1.00 109.93 ? 221  LEU A HD23 1 
ATOM   228   N  N    . LYS A  1 30  ? 207.158 83.476  36.229  1.00 82.72  ? 222  LYS A N    1 
ATOM   229   C  CA   . LYS A  1 30  ? 208.241 84.148  36.942  1.00 80.10  ? 222  LYS A CA   1 
ATOM   230   C  C    . LYS A  1 30  ? 209.301 84.650  35.970  1.00 82.54  ? 222  LYS A C    1 
ATOM   231   O  O    . LYS A  1 30  ? 209.722 85.810  36.033  1.00 79.04  ? 222  LYS A O    1 
ATOM   232   C  CB   . LYS A  1 30  ? 208.859 83.190  37.964  1.00 79.61  ? 222  LYS A CB   1 
ATOM   233   C  CG   . LYS A  1 30  ? 209.945 83.797  38.841  1.00 80.20  ? 222  LYS A CG   1 
ATOM   234   C  CD   . LYS A  1 30  ? 210.493 82.766  39.819  1.00 82.31  ? 222  LYS A CD   1 
ATOM   235   C  CE   . LYS A  1 30  ? 211.718 83.281  40.561  1.00 84.61  ? 222  LYS A CE   1 
ATOM   236   N  NZ   . LYS A  1 30  ? 212.499 82.170  41.179  1.00 89.86  ? 222  LYS A NZ   1 
ATOM   237   H  H    . LYS A  1 30  ? 207.027 82.661  36.469  1.00 99.02  ? 222  LYS A H    1 
ATOM   238   H  HA   . LYS A  1 30  ? 207.883 84.912  37.421  1.00 95.87  ? 222  LYS A HA   1 
ATOM   239   H  HB2  . LYS A  1 30  ? 208.156 82.868  38.549  1.00 95.29  ? 222  LYS A HB2  1 
ATOM   240   H  HB3  . LYS A  1 30  ? 209.252 82.442  37.487  1.00 95.29  ? 222  LYS A HB3  1 
ATOM   241   H  HG2  . LYS A  1 30  ? 210.675 84.107  38.282  1.00 95.99  ? 222  LYS A HG2  1 
ATOM   242   H  HG3  . LYS A  1 30  ? 209.573 84.535  39.350  1.00 95.99  ? 222  LYS A HG3  1 
ATOM   243   H  HD2  . LYS A  1 30  ? 209.810 82.554  40.474  1.00 98.52  ? 222  LYS A HD2  1 
ATOM   244   H  HD3  . LYS A  1 30  ? 210.748 81.968  39.331  1.00 98.52  ? 222  LYS A HD3  1 
ATOM   245   H  HE2  . LYS A  1 30  ? 212.296 83.747  39.937  1.00 101.29 ? 222  LYS A HE2  1 
ATOM   246   H  HE3  . LYS A  1 30  ? 211.434 83.881  41.268  1.00 101.29 ? 222  LYS A HE3  1 
ATOM   247   H  HZ1  . LYS A  1 30  ? 213.208 82.497  41.605  1.00 107.58 ? 222  LYS A HZ1  1 
ATOM   248   H  HZ2  . LYS A  1 30  ? 211.990 81.728  41.761  1.00 107.58 ? 222  LYS A HZ2  1 
ATOM   249   H  HZ3  . LYS A  1 30  ? 212.775 81.605  40.549  1.00 107.58 ? 222  LYS A HZ3  1 
ATOM   250   N  N    . HIS A  1 31  ? 209.736 83.785  35.052  1.00 86.67  ? 223  HIS A N    1 
ATOM   251   C  CA   . HIS A  1 31  ? 210.754 84.172  34.082  1.00 89.89  ? 223  HIS A CA   1 
ATOM   252   C  C    . HIS A  1 31  ? 210.292 85.368  33.257  1.00 86.89  ? 223  HIS A C    1 
ATOM   253   O  O    . HIS A  1 31  ? 211.049 86.323  33.045  1.00 85.74  ? 223  HIS A O    1 
ATOM   254   C  CB   . HIS A  1 31  ? 211.083 82.979  33.184  1.00 95.90  ? 223  HIS A CB   1 
ATOM   255   C  CG   . HIS A  1 31  ? 212.137 83.261  32.160  1.00 103.15 ? 223  HIS A CG   1 
ATOM   256   N  ND1  . HIS A  1 31  ? 213.484 83.205  32.446  1.00 103.48 ? 223  HIS A ND1  1 
ATOM   257   C  CD2  . HIS A  1 31  ? 212.044 83.589  30.849  1.00 105.96 ? 223  HIS A CD2  1 
ATOM   258   C  CE1  . HIS A  1 31  ? 214.176 83.492  31.358  1.00 108.78 ? 223  HIS A CE1  1 
ATOM   259   N  NE2  . HIS A  1 31  ? 213.326 83.730  30.375  1.00 109.04 ? 223  HIS A NE2  1 
ATOM   260   H  H    . HIS A  1 31  ? 209.458 82.975  34.972  1.00 103.75 ? 223  HIS A H    1 
ATOM   261   H  HA   . HIS A  1 31  ? 211.562 84.426  34.555  1.00 107.62 ? 223  HIS A HA   1 
ATOM   262   H  HB2  . HIS A  1 31  ? 211.398 82.248  33.739  1.00 114.83 ? 223  HIS A HB2  1 
ATOM   263   H  HB3  . HIS A  1 31  ? 210.278 82.711  32.715  1.00 114.83 ? 223  HIS A HB3  1 
ATOM   264   H  HD2  . HIS A  1 31  ? 211.260 83.702  30.362  1.00 126.91 ? 223  HIS A HD2  1 
ATOM   265   H  HE1  . HIS A  1 31  ? 215.103 83.523  31.295  1.00 130.29 ? 223  HIS A HE1  1 
ATOM   266   H  HE2  . HIS A  1 31  ? 213.540 83.938  29.569  1.00 130.60 ? 223  HIS A HE2  1 
ATOM   267   N  N    . PHE A  1 32  ? 209.050 85.326  32.770  1.00 80.74  ? 224  PHE A N    1 
ATOM   268   C  CA   . PHE A  1 32  ? 208.513 86.436  31.988  1.00 80.81  ? 224  PHE A CA   1 
ATOM   269   C  C    . PHE A  1 32  ? 208.572 87.742  32.771  1.00 82.92  ? 224  PHE A C    1 
ATOM   270   O  O    . PHE A  1 32  ? 209.022 88.771  32.254  1.00 85.39  ? 224  PHE A O    1 
ATOM   271   C  CB   . PHE A  1 32  ? 207.073 86.130  31.573  1.00 80.59  ? 224  PHE A CB   1 
ATOM   272   C  CG   . PHE A  1 32  ? 206.301 87.341  31.132  1.00 82.50  ? 224  PHE A CG   1 
ATOM   273   C  CD1  . PHE A  1 32  ? 206.541 87.919  29.897  1.00 88.03  ? 224  PHE A CD1  1 
ATOM   274   C  CD2  . PHE A  1 32  ? 205.339 87.904  31.955  1.00 82.68  ? 224  PHE A CD2  1 
ATOM   275   C  CE1  . PHE A  1 32  ? 205.833 89.034  29.487  1.00 89.57  ? 224  PHE A CE1  1 
ATOM   276   C  CE2  . PHE A  1 32  ? 204.628 89.019  31.552  1.00 85.77  ? 224  PHE A CE2  1 
ATOM   277   C  CZ   . PHE A  1 32  ? 204.876 89.585  30.316  1.00 87.51  ? 224  PHE A CZ   1 
ATOM   278   H  H    . PHE A  1 32  ? 208.504 84.671  32.879  1.00 96.64  ? 224  PHE A H    1 
ATOM   279   H  HA   . PHE A  1 32  ? 209.042 86.543  31.183  1.00 96.72  ? 224  PHE A HA   1 
ATOM   280   H  HB2  . PHE A  1 32  ? 207.087 85.502  30.835  1.00 96.46  ? 224  PHE A HB2  1 
ATOM   281   H  HB3  . PHE A  1 32  ? 206.606 85.740  32.329  1.00 96.46  ? 224  PHE A HB3  1 
ATOM   282   H  HD1  . PHE A  1 32  ? 207.184 87.551  29.335  1.00 105.39 ? 224  PHE A HD1  1 
ATOM   283   H  HD2  . PHE A  1 32  ? 205.168 87.526  32.787  1.00 98.97  ? 224  PHE A HD2  1 
ATOM   284   H  HE1  . PHE A  1 32  ? 206.003 89.413  28.655  1.00 107.23 ? 224  PHE A HE1  1 
ATOM   285   H  HE2  . PHE A  1 32  ? 203.983 89.388  32.112  1.00 102.68 ? 224  PHE A HE2  1 
ATOM   286   H  HZ   . PHE A  1 32  ? 204.399 90.335  30.042  1.00 104.76 ? 224  PHE A HZ   1 
ATOM   287   N  N    . ILE A  1 33  ? 208.117 87.719  34.025  1.00 80.67  ? 225  ILE A N    1 
ATOM   288   C  CA   . ILE A  1 33  ? 208.102 88.931  34.841  1.00 80.96  ? 225  ILE A CA   1 
ATOM   289   C  C    . ILE A  1 33  ? 209.515 89.466  35.027  1.00 81.97  ? 225  ILE A C    1 
ATOM   290   O  O    . ILE A  1 33  ? 209.780 90.657  34.824  1.00 84.34  ? 225  ILE A O    1 
ATOM   291   C  CB   . ILE A  1 33  ? 207.421 88.654  36.195  1.00 79.75  ? 225  ILE A CB   1 
ATOM   292   C  CG1  . ILE A  1 33  ? 205.924 88.413  35.990  1.00 80.77  ? 225  ILE A CG1  1 
ATOM   293   C  CG2  . ILE A  1 33  ? 207.656 89.813  37.172  1.00 79.52  ? 225  ILE A CG2  1 
ATOM   294   C  CD1  . ILE A  1 33  ? 205.200 87.924  37.232  1.00 80.82  ? 225  ILE A CD1  1 
ATOM   295   H  H    . ILE A  1 33  ? 207.814 87.019  34.423  1.00 96.55  ? 225  ILE A H    1 
ATOM   296   H  HA   . ILE A  1 33  ? 207.585 89.611  34.382  1.00 96.91  ? 225  ILE A HA   1 
ATOM   297   H  HB   . ILE A  1 33  ? 207.811 87.851  36.574  1.00 95.45  ? 225  ILE A HB   1 
ATOM   298   H  HG12 . ILE A  1 33  ? 205.509 89.246  35.715  1.00 96.68  ? 225  ILE A HG12 1 
ATOM   299   H  HG13 . ILE A  1 33  ? 205.808 87.744  35.297  1.00 96.68  ? 225  ILE A HG13 1 
ATOM   300   H  HG21 . ILE A  1 33  ? 207.216 89.610  38.012  1.00 95.18  ? 225  ILE A HG21 1 
ATOM   301   H  HG22 . ILE A  1 33  ? 208.609 89.917  37.313  1.00 95.18  ? 225  ILE A HG22 1 
ATOM   302   H  HG23 . ILE A  1 33  ? 207.286 90.625  36.792  1.00 95.18  ? 225  ILE A HG23 1 
ATOM   303   H  HD11 . ILE A  1 33  ? 204.262 87.796  37.021  1.00 96.73  ? 225  ILE A HD11 1 
ATOM   304   H  HD12 . ILE A  1 33  ? 205.593 87.083  37.516  1.00 96.73  ? 225  ILE A HD12 1 
ATOM   305   H  HD13 . ILE A  1 33  ? 205.293 88.587  37.934  1.00 96.73  ? 225  ILE A HD13 1 
ATOM   306   N  N    . GLU A  1 34  ? 210.446 88.595  35.420  1.00 85.31  ? 226  GLU A N    1 
ATOM   307   C  CA   . GLU A  1 34  ? 211.793 89.046  35.742  1.00 88.65  ? 226  GLU A CA   1 
ATOM   308   C  C    . GLU A  1 34  ? 212.533 89.578  34.522  1.00 88.24  ? 226  GLU A C    1 
ATOM   309   O  O    . GLU A  1 34  ? 213.513 90.313  34.682  1.00 89.26  ? 226  GLU A O    1 
ATOM   310   C  CB   . GLU A  1 34  ? 212.577 87.903  36.389  1.00 96.11  ? 226  GLU A CB   1 
ATOM   311   C  CG   . GLU A  1 34  ? 211.953 87.415  37.691  1.00 102.37 ? 226  GLU A CG   1 
ATOM   312   C  CD   . GLU A  1 34  ? 212.924 86.650  38.568  1.00 110.70 ? 226  GLU A CD   1 
ATOM   313   O  OE1  . GLU A  1 34  ? 213.926 86.126  38.037  1.00 114.29 ? 226  GLU A OE1  1 
ATOM   314   O  OE2  . GLU A  1 34  ? 212.675 86.566  39.791  1.00 109.99 ? 226  GLU A OE2  1 
ATOM   315   H  H    . GLU A  1 34  ? 210.322 87.748  35.505  1.00 102.13 ? 226  GLU A H    1 
ATOM   316   H  HA   . GLU A  1 34  ? 211.733 89.767  36.388  1.00 106.13 ? 226  GLU A HA   1 
ATOM   317   H  HB2  . GLU A  1 34  ? 212.609 87.154  35.773  1.00 115.08 ? 226  GLU A HB2  1 
ATOM   318   H  HB3  . GLU A  1 34  ? 213.477 88.210  36.584  1.00 115.08 ? 226  GLU A HB3  1 
ATOM   319   H  HG2  . GLU A  1 34  ? 211.636 88.181  38.194  1.00 122.59 ? 226  GLU A HG2  1 
ATOM   320   H  HG3  . GLU A  1 34  ? 211.211 86.826  37.483  1.00 122.59 ? 226  GLU A HG3  1 
ATOM   321   N  N    . CYS A  1 35  ? 212.091 89.229  33.316  1.00 89.54  ? 227  CYS A N    1 
ATOM   322   C  CA   . CYS A  1 35  ? 212.681 89.747  32.088  1.00 89.46  ? 227  CYS A CA   1 
ATOM   323   C  C    . CYS A  1 35  ? 211.971 90.988  31.560  1.00 87.27  ? 227  CYS A C    1 
ATOM   324   O  O    . CYS A  1 35  ? 212.407 91.547  30.549  1.00 91.44  ? 227  CYS A O    1 
ATOM   325   C  CB   . CYS A  1 35  ? 212.686 88.659  31.012  1.00 93.81  ? 227  CYS A CB   1 
ATOM   326   S  SG   . CYS A  1 35  ? 213.781 87.276  31.387  1.00 97.55  ? 227  CYS A SG   1 
ATOM   327   H  H    . CYS A  1 35  ? 211.439 88.685  33.182  1.00 107.20 ? 227  CYS A H    1 
ATOM   328   H  HA   . CYS A  1 35  ? 213.603 89.989  32.266  1.00 107.10 ? 227  CYS A HA   1 
ATOM   329   H  HB2  . CYS A  1 35  ? 211.786 88.309  30.917  1.00 112.32 ? 227  CYS A HB2  1 
ATOM   330   H  HB3  . CYS A  1 35  ? 212.977 89.050  30.174  1.00 112.32 ? 227  CYS A HB3  1 
ATOM   331   H  HG   . CYS A  1 35  ? 213.430 86.767  32.416  1.00 116.81 ? 227  CYS A HG   1 
ATOM   332   N  N    . SER A  1 36  ? 210.896 91.432  32.207  1.00 81.97  ? 228  SER A N    1 
ATOM   333   C  CA   . SER A  1 36  ? 210.206 92.635  31.769  1.00 83.83  ? 228  SER A CA   1 
ATOM   334   C  C    . SER A  1 36  ? 211.017 93.875  32.141  1.00 84.19  ? 228  SER A C    1 
ATOM   335   O  O    . SER A  1 36  ? 211.992 93.816  32.897  1.00 87.29  ? 228  SER A O    1 
ATOM   336   C  CB   . SER A  1 36  ? 208.811 92.714  32.389  1.00 83.62  ? 228  SER A CB   1 
ATOM   337   O  OG   . SER A  1 36  ? 207.969 91.685  31.900  1.00 85.71  ? 228  SER A OG   1 
ATOM   338   H  H    . SER A  1 36  ? 210.549 91.055  32.898  1.00 98.11  ? 228  SER A H    1 
ATOM   339   H  HA   . SER A  1 36  ? 210.109 92.614  30.804  1.00 100.35 ? 228  SER A HA   1 
ATOM   340   H  HB2  . SER A  1 36  ? 208.890 92.625  33.352  1.00 100.10 ? 228  SER A HB2  1 
ATOM   341   H  HB3  . SER A  1 36  ? 208.418 93.573  32.169  1.00 100.10 ? 228  SER A HB3  1 
ATOM   342   H  HG   . SER A  1 36  ? 208.296 90.934  32.085  1.00 102.61 ? 228  SER A HG   1 
ATOM   343   N  N    . LEU A  1 37  ? 210.602 95.014  31.594  1.00 75.89  ? 229  LEU A N    1 
ATOM   344   C  CA   . LEU A  1 37  ? 211.229 96.279  31.948  1.00 75.90  ? 229  LEU A CA   1 
ATOM   345   C  C    . LEU A  1 37  ? 211.058 96.562  33.434  1.00 76.43  ? 229  LEU A C    1 
ATOM   346   O  O    . LEU A  1 37  ? 210.103 96.110  34.072  1.00 76.22  ? 229  LEU A O    1 
ATOM   347   C  CB   . LEU A  1 37  ? 210.634 97.423  31.130  1.00 77.35  ? 229  LEU A CB   1 
ATOM   348   C  CG   . LEU A  1 37  ? 210.979 97.404  29.644  1.00 81.64  ? 229  LEU A CG   1 
ATOM   349   C  CD1  . LEU A  1 37  ? 209.942 98.178  28.851  1.00 80.77  ? 229  LEU A CD1  1 
ATOM   350   C  CD2  . LEU A  1 37  ? 212.376 97.968  29.423  1.00 84.13  ? 229  LEU A CD2  1 
ATOM   351   H  H    . LEU A  1 37  ? 209.965 95.080  31.020  1.00 90.81  ? 229  LEU A H    1 
ATOM   352   H  HA   . LEU A  1 37  ? 212.178 96.230  31.755  1.00 90.83  ? 229  LEU A HA   1 
ATOM   353   H  HB2  . LEU A  1 37  ? 209.667 97.386  31.207  1.00 92.57  ? 229  LEU A HB2  1 
ATOM   354   H  HB3  . LEU A  1 37  ? 210.957 98.262  31.495  1.00 92.57  ? 229  LEU A HB3  1 
ATOM   355   H  HG   . LEU A  1 37  ? 210.973 96.486  29.330  1.00 97.72  ? 229  LEU A HG   1 
ATOM   356   H  HD11 . LEU A  1 37  ? 210.181 98.153  27.911  1.00 96.68  ? 229  LEU A HD11 1 
ATOM   357   H  HD12 . LEU A  1 37  ? 209.073 97.768  28.983  1.00 96.68  ? 229  LEU A HD12 1 
ATOM   358   H  HD13 . LEU A  1 37  ? 209.926 99.096  29.164  1.00 96.68  ? 229  LEU A HD13 1 
ATOM   359   H  HD21 . LEU A  1 37  ? 212.577 97.948  28.474  1.00 100.71 ? 229  LEU A HD21 1 
ATOM   360   H  HD22 . LEU A  1 37  ? 212.402 98.882  29.748  1.00 100.71 ? 229  LEU A HD22 1 
ATOM   361   H  HD23 . LEU A  1 37  ? 213.016 97.425  29.909  1.00 100.71 ? 229  LEU A HD23 1 
ATOM   362   N  N    . ASP A  1 38  ? 212.008 97.321  33.983  1.00 85.37  ? 230  ASP A N    1 
ATOM   363   C  CA   . ASP A  1 38  ? 211.966 97.672  35.398  1.00 80.41  ? 230  ASP A CA   1 
ATOM   364   C  C    . ASP A  1 38  ? 210.588 98.188  35.800  1.00 82.05  ? 230  ASP A C    1 
ATOM   365   O  O    . ASP A  1 38  ? 210.036 97.786  36.831  1.00 79.49  ? 230  ASP A O    1 
ATOM   366   C  CB   . ASP A  1 38  ? 213.035 98.726  35.697  1.00 80.36  ? 230  ASP A CB   1 
ATOM   367   C  CG   . ASP A  1 38  ? 214.439 98.147  35.739  1.00 80.04  ? 230  ASP A CG   1 
ATOM   368   O  OD1  . ASP A  1 38  ? 214.584 96.910  35.636  1.00 78.66  ? 230  ASP A OD1  1 
ATOM   369   O  OD2  . ASP A  1 38  ? 215.400 98.937  35.866  1.00 80.20  ? 230  ASP A OD2  1 
ATOM   370   H  H    . ASP A  1 38  ? 212.683 97.643  33.558  1.00 102.19 ? 230  ASP A H    1 
ATOM   371   H  HA   . ASP A  1 38  ? 212.160 96.883  35.928  1.00 96.25  ? 230  ASP A HA   1 
ATOM   372   H  HB2  . ASP A  1 38  ? 213.011 99.405  35.005  1.00 96.19  ? 230  ASP A HB2  1 
ATOM   373   H  HB3  . ASP A  1 38  ? 212.850 99.127  36.561  1.00 96.19  ? 230  ASP A HB3  1 
ATOM   374   N  N    . CYS A  1 39  ? 210.009 99.076  34.985  1.00 84.11  ? 231  CYS A N    1 
ATOM   375   C  CA   . CYS A  1 39  ? 208.742 99.702  35.352  1.00 80.41  ? 231  CYS A CA   1 
ATOM   376   C  C    . CYS A  1 39  ? 207.595 98.697  35.367  1.00 81.14  ? 231  CYS A C    1 
ATOM   377   O  O    . CYS A  1 39  ? 206.722 98.764  36.240  1.00 81.96  ? 231  CYS A O    1 
ATOM   378   C  CB   . CYS A  1 39  ? 208.434 100.862 34.403  1.00 84.31  ? 231  CYS A CB   1 
ATOM   379   S  SG   . CYS A  1 39  ? 208.432 100.443 32.646  1.00 87.67  ? 231  CYS A SG   1 
ATOM   380   H  H    . CYS A  1 39  ? 210.327 99.327  34.227  1.00 100.68 ? 231  CYS A H    1 
ATOM   381   H  HA   . CYS A  1 39  ? 208.825 100.068 36.247  1.00 96.24  ? 231  CYS A HA   1 
ATOM   382   H  HB2  . CYS A  1 39  ? 207.555 101.211 34.620  1.00 100.93 ? 231  CYS A HB2  1 
ATOM   383   H  HB3  . CYS A  1 39  ? 209.100 101.554 34.537  1.00 100.93 ? 231  CYS A HB3  1 
ATOM   384   H  HG   . CYS A  1 39  ? 208.179 101.429 32.010  1.00 104.96 ? 231  CYS A HG   1 
ATOM   385   N  N    . HIS A  1 40  ? 207.574 97.758  34.417  1.00 78.69  ? 232  HIS A N    1 
ATOM   386   C  CA   . HIS A  1 40  ? 206.504 96.763  34.385  1.00 77.04  ? 232  HIS A CA   1 
ATOM   387   C  C    . HIS A  1 40  ? 206.756 95.635  35.377  1.00 79.61  ? 232  HIS A C    1 
ATOM   388   O  O    . HIS A  1 40  ? 205.811 95.100  35.966  1.00 80.11  ? 232  HIS A O    1 
ATOM   389   C  CB   . HIS A  1 40  ? 206.351 96.192  32.976  1.00 76.21  ? 232  HIS A CB   1 
ATOM   390   C  CG   . HIS A  1 40  ? 206.110 97.229  31.925  1.00 83.81  ? 232  HIS A CG   1 
ATOM   391   N  ND1  . HIS A  1 40  ? 206.742 97.206  30.700  1.00 84.82  ? 232  HIS A ND1  1 
ATOM   392   C  CD2  . HIS A  1 40  ? 205.302 98.315  31.912  1.00 83.71  ? 232  HIS A CD2  1 
ATOM   393   C  CE1  . HIS A  1 40  ? 206.338 98.238  29.980  1.00 88.82  ? 232  HIS A CE1  1 
ATOM   394   N  NE2  . HIS A  1 40  ? 205.463 98.925  30.692  1.00 85.71  ? 232  HIS A NE2  1 
ATOM   395   H  H    . HIS A  1 40  ? 208.158 97.677  33.791  1.00 94.17  ? 232  HIS A H    1 
ATOM   396   H  HA   . HIS A  1 40  ? 205.668 97.192  34.627  1.00 92.21  ? 232  HIS A HA   1 
ATOM   397   H  HB2  . HIS A  1 40  ? 207.163 95.716  32.742  1.00 91.21  ? 232  HIS A HB2  1 
ATOM   398   H  HB3  . HIS A  1 40  ? 205.598 95.580  32.967  1.00 91.21  ? 232  HIS A HB3  1 
ATOM   399   H  HD2  . HIS A  1 40  ? 204.744 98.596  32.600  1.00 100.20 ? 232  HIS A HD2  1 
ATOM   400   H  HE1  . HIS A  1 40  ? 206.619 98.443  29.118  1.00 106.33 ? 232  HIS A HE1  1 
ATOM   401   H  HE2  . HIS A  1 40  ? 205.060 99.640  30.433  1.00 102.61 ? 232  HIS A HE2  1 
ATOM   402   N  N    . ARG A  1 41  ? 208.021 95.257  35.565  1.00 87.21  ? 233  ARG A N    1 
ATOM   403   C  CA   . ARG A  1 41  ? 208.357 94.221  36.535  1.00 88.90  ? 233  ARG A CA   1 
ATOM   404   C  C    . ARG A  1 41  ? 207.799 94.561  37.912  1.00 83.79  ? 233  ARG A C    1 
ATOM   405   O  O    . ARG A  1 41  ? 207.285 93.686  38.620  1.00 78.03  ? 233  ARG A O    1 
ATOM   406   C  CB   . ARG A  1 41  ? 209.875 94.054  36.591  1.00 97.52  ? 233  ARG A CB   1 
ATOM   407   C  CG   . ARG A  1 41  ? 210.377 92.916  37.462  1.00 104.04 ? 233  ARG A CG   1 
ATOM   408   C  CD   . ARG A  1 41  ? 211.897 92.907  37.466  1.00 113.05 ? 233  ARG A CD   1 
ATOM   409   N  NE   . ARG A  1 41  ? 212.416 94.120  38.091  1.00 121.01 ? 233  ARG A NE   1 
ATOM   410   C  CZ   . ARG A  1 41  ? 213.669 94.551  37.988  1.00 126.22 ? 233  ARG A CZ   1 
ATOM   411   N  NH1  . ARG A  1 41  ? 214.563 93.872  37.279  1.00 129.54 ? 233  ARG A NH1  1 
ATOM   412   N  NH2  . ARG A  1 41  ? 214.029 95.674  38.596  1.00 127.54 ? 233  ARG A NH2  1 
ATOM   413   H  H    . ARG A  1 41  ? 208.697 95.584  35.146  1.00 104.40 ? 233  ARG A H    1 
ATOM   414   H  HA   . ARG A  1 41  ? 207.969 93.379  36.250  1.00 106.43 ? 233  ARG A HA   1 
ATOM   415   H  HB2  . ARG A  1 41  ? 210.199 93.896  35.691  1.00 116.77 ? 233  ARG A HB2  1 
ATOM   416   H  HB3  . ARG A  1 41  ? 210.261 94.875  36.934  1.00 116.77 ? 233  ARG A HB3  1 
ATOM   417   H  HG2  . ARG A  1 41  ? 210.066 93.040  38.373  1.00 124.60 ? 233  ARG A HG2  1 
ATOM   418   H  HG3  . ARG A  1 41  ? 210.063 92.070  37.106  1.00 124.60 ? 233  ARG A HG3  1 
ATOM   419   H  HD2  . ARG A  1 41  ? 212.214 92.141  37.970  1.00 135.42 ? 233  ARG A HD2  1 
ATOM   420   H  HD3  . ARG A  1 41  ? 212.221 92.869  36.552  1.00 135.42 ? 233  ARG A HD3  1 
ATOM   421   H  HE   . ARG A  1 41  ? 211.871 94.591  38.561  1.00 144.96 ? 233  ARG A HE   1 
ATOM   422   H  HH11 . ARG A  1 41  ? 214.333 93.145  36.881  1.00 155.20 ? 233  ARG A HH11 1 
ATOM   423   H  HH12 . ARG A  1 41  ? 215.371 94.159  37.218  1.00 155.20 ? 233  ARG A HH12 1 
ATOM   424   H  HH21 . ARG A  1 41  ? 213.453 96.116  39.056  1.00 152.80 ? 233  ARG A HH21 1 
ATOM   425   H  HH22 . ARG A  1 41  ? 214.839 95.956  38.533  1.00 152.80 ? 233  ARG A HH22 1 
ATOM   426   N  N    . ALA A  1 42  ? 207.889 95.833  38.306  1.00 77.75  ? 234  ALA A N    1 
ATOM   427   C  CA   . ALA A  1 42  ? 207.389 96.249  39.612  1.00 74.93  ? 234  ALA A CA   1 
ATOM   428   C  C    . ALA A  1 42  ? 205.904 95.941  39.758  1.00 74.95  ? 234  ALA A C    1 
ATOM   429   O  O    . ALA A  1 42  ? 205.455 95.501  40.823  1.00 74.01  ? 234  ALA A O    1 
ATOM   430   C  CB   . ALA A  1 42  ? 207.648 97.741  39.817  1.00 74.51  ? 234  ALA A CB   1 
ATOM   431   H  H    . ALA A  1 42  ? 208.234 96.467  37.839  1.00 93.06  ? 234  ALA A H    1 
ATOM   432   H  HA   . ALA A  1 42  ? 207.865 95.763  40.303  1.00 89.67  ? 234  ALA A HA   1 
ATOM   433   H  HB1  . ALA A  1 42  ? 207.310 98.003  40.687  1.00 89.17  ? 234  ALA A HB1  1 
ATOM   434   H  HB2  . ALA A  1 42  ? 208.603 97.905  39.769  1.00 89.17  ? 234  ALA A HB2  1 
ATOM   435   H  HB3  . ALA A  1 42  ? 207.191 98.239  39.121  1.00 89.17  ? 234  ALA A HB3  1 
ATOM   436   N  N    . GLU A  1 43  ? 205.123 96.177  38.703  1.00 82.19  ? 235  GLU A N    1 
ATOM   437   C  CA   . GLU A  1 43  ? 203.686 95.935  38.764  1.00 81.42  ? 235  GLU A CA   1 
ATOM   438   C  C    . GLU A  1 43  ? 203.367 94.448  38.665  1.00 81.39  ? 235  GLU A C    1 
ATOM   439   O  O    . GLU A  1 43  ? 202.555 93.926  39.437  1.00 82.75  ? 235  GLU A O    1 
ATOM   440   C  CB   . GLU A  1 43  ? 202.979 96.701  37.645  1.00 85.22  ? 235  GLU A CB   1 
ATOM   441   C  CG   . GLU A  1 43  ? 203.105 98.208  37.752  1.00 89.29  ? 235  GLU A CG   1 
ATOM   442   C  CD   . GLU A  1 43  ? 201.930 98.934  37.129  1.00 94.57  ? 235  GLU A CD   1 
ATOM   443   O  OE1  . GLU A  1 43  ? 201.712 98.779  35.909  1.00 97.41  ? 235  GLU A OE1  1 
ATOM   444   O  OE2  . GLU A  1 43  ? 201.225 99.661  37.862  1.00 97.04  ? 235  GLU A OE2  1 
ATOM   445   H  H    . GLU A  1 43  ? 205.401 96.475  37.946  1.00 98.38  ? 235  GLU A H    1 
ATOM   446   H  HA   . GLU A  1 43  ? 203.345 96.260  39.612  1.00 97.45  ? 235  GLU A HA   1 
ATOM   447   H  HB2  . GLU A  1 43  ? 203.360 96.432  36.794  1.00 102.01 ? 235  GLU A HB2  1 
ATOM   448   H  HB3  . GLU A  1 43  ? 202.034 96.481  37.665  1.00 102.01 ? 235  GLU A HB3  1 
ATOM   449   H  HG2  . GLU A  1 43  ? 203.150 98.456  38.688  1.00 106.90 ? 235  GLU A HG2  1 
ATOM   450   H  HG3  . GLU A  1 43  ? 203.911 98.492  37.293  1.00 106.90 ? 235  GLU A HG3  1 
ATOM   451   N  N    . LEU A  1 44  ? 203.995 93.752  37.717  1.00 78.67  ? 236  LEU A N    1 
ATOM   452   C  CA   . LEU A  1 44  ? 203.684 92.347  37.489  1.00 78.73  ? 236  LEU A CA   1 
ATOM   453   C  C    . LEU A  1 44  ? 204.115 91.455  38.644  1.00 79.80  ? 236  LEU A C    1 
ATOM   454   O  O    . LEU A  1 44  ? 203.569 90.358  38.795  1.00 82.81  ? 236  LEU A O    1 
ATOM   455   C  CB   . LEU A  1 44  ? 204.341 91.874  36.191  1.00 84.03  ? 236  LEU A CB   1 
ATOM   456   C  CG   . LEU A  1 44  ? 203.905 92.619  34.927  1.00 86.64  ? 236  LEU A CG   1 
ATOM   457   C  CD1  . LEU A  1 44  ? 204.717 92.156  33.727  1.00 88.84  ? 236  LEU A CD1  1 
ATOM   458   C  CD2  . LEU A  1 44  ? 202.414 92.432  34.668  1.00 83.99  ? 236  LEU A CD2  1 
ATOM   459   H  H    . LEU A  1 44  ? 204.602 94.070  37.197  1.00 94.16  ? 236  LEU A H    1 
ATOM   460   H  HA   . LEU A  1 44  ? 202.724 92.254  37.386  1.00 94.23  ? 236  LEU A HA   1 
ATOM   461   H  HB2  . LEU A  1 44  ? 205.301 91.981  36.276  1.00 100.59 ? 236  LEU A HB2  1 
ATOM   462   H  HB3  . LEU A  1 44  ? 204.129 90.936  36.064  1.00 100.59 ? 236  LEU A HB3  1 
ATOM   463   H  HG   . LEU A  1 44  ? 204.069 93.567  35.049  1.00 103.71 ? 236  LEU A HG   1 
ATOM   464   H  HD11 . LEU A  1 44  ? 204.422 92.642  32.940  1.00 106.35 ? 236  LEU A HD11 1 
ATOM   465   H  HD12 . LEU A  1 44  ? 205.656 92.334  33.894  1.00 106.35 ? 236  LEU A HD12 1 
ATOM   466   H  HD13 . LEU A  1 44  ? 204.577 91.205  33.600  1.00 106.35 ? 236  LEU A HD13 1 
ATOM   467   H  HD21 . LEU A  1 44  ? 202.170 92.915  33.863  1.00 100.54 ? 236  LEU A HD21 1 
ATOM   468   H  HD22 . LEU A  1 44  ? 202.229 91.487  34.557  1.00 100.54 ? 236  LEU A HD22 1 
ATOM   469   H  HD23 . LEU A  1 44  ? 201.917 92.779  35.426  1.00 100.54 ? 236  LEU A HD23 1 
ATOM   470   N  N    . SER A  1 45  ? 205.074 91.893  39.461  1.00 78.46  ? 237  SER A N    1 
ATOM   471   C  CA   . SER A  1 45  ? 205.473 91.107  40.622  1.00 79.84  ? 237  SER A CA   1 
ATOM   472   C  C    . SER A  1 45  ? 204.376 91.023  41.676  1.00 78.40  ? 237  SER A C    1 
ATOM   473   O  O    . SER A  1 45  ? 204.487 90.207  42.597  1.00 80.04  ? 237  SER A O    1 
ATOM   474   C  CB   . SER A  1 45  ? 206.736 91.696  41.248  1.00 79.66  ? 237  SER A CB   1 
ATOM   475   O  OG   . SER A  1 45  ? 206.495 93.004  41.734  1.00 86.16  ? 237  SER A OG   1 
ATOM   476   H  H    . SER A  1 45  ? 205.503 92.632  39.366  1.00 93.90  ? 237  SER A H    1 
ATOM   477   H  HA   . SER A  1 45  ? 205.677 90.204  40.333  1.00 95.56  ? 237  SER A HA   1 
ATOM   478   H  HB2  . SER A  1 45  ? 207.016 91.131  41.985  1.00 95.34  ? 237  SER A HB2  1 
ATOM   479   H  HB3  . SER A  1 45  ? 207.434 91.733  40.575  1.00 95.34  ? 237  SER A HB3  1 
ATOM   480   H  HG   . SER A  1 45  ? 206.251 93.504  41.105  1.00 103.15 ? 237  SER A HG   1 
ATOM   481   N  N    . GLN A  1 46  ? 203.327 91.840  41.566  1.00 76.27  ? 238  GLN A N    1 
ATOM   482   C  CA   . GLN A  1 46  ? 202.186 91.717  42.464  1.00 72.55  ? 238  GLN A CA   1 
ATOM   483   C  C    . GLN A  1 46  ? 201.470 90.385  42.291  1.00 70.47  ? 238  GLN A C    1 
ATOM   484   O  O    . GLN A  1 46  ? 200.685 89.995  43.161  1.00 67.74  ? 238  GLN A O    1 
ATOM   485   C  CB   . GLN A  1 46  ? 201.212 92.872  42.225  1.00 74.13  ? 238  GLN A CB   1 
ATOM   486   C  CG   . GLN A  1 46  ? 201.804 94.243  42.507  1.00 76.98  ? 238  GLN A CG   1 
ATOM   487   C  CD   . GLN A  1 46  ? 200.833 95.366  42.213  1.00 82.09  ? 238  GLN A CD   1 
ATOM   488   O  OE1  . GLN A  1 46  ? 200.195 95.907  43.119  1.00 85.11  ? 238  GLN A OE1  1 
ATOM   489   N  NE2  . GLN A  1 46  ? 200.708 95.720  40.939  1.00 82.86  ? 238  GLN A NE2  1 
ATOM   490   H  H    . GLN A  1 46  ? 203.254 92.468  40.983  1.00 91.28  ? 238  GLN A H    1 
ATOM   491   H  HA   . GLN A  1 46  ? 202.498 91.773  43.381  1.00 86.82  ? 238  GLN A HA   1 
ATOM   492   H  HB2  . GLN A  1 46  ? 200.931 92.856  41.296  1.00 88.70  ? 238  GLN A HB2  1 
ATOM   493   H  HB3  . GLN A  1 46  ? 200.442 92.756  42.803  1.00 88.70  ? 238  GLN A HB3  1 
ATOM   494   H  HG2  . GLN A  1 46  ? 202.049 94.295  43.444  1.00 92.12  ? 238  GLN A HG2  1 
ATOM   495   H  HG3  . GLN A  1 46  ? 202.588 94.370  41.951  1.00 92.12  ? 238  GLN A HG3  1 
ATOM   496   H  HE21 . GLN A  1 46  ? 201.169 95.318  40.334  1.00 99.18  ? 238  GLN A HE21 1 
ATOM   497   H  HE22 . GLN A  1 46  ? 200.169 96.353  40.719  1.00 99.18  ? 238  GLN A HE22 1 
ATOM   498   N  N    . LEU A  1 47  ? 201.721 89.685  41.182  1.00 72.12  ? 239  LEU A N    1 
ATOM   499   C  CA   . LEU A  1 47  ? 201.121 88.380  40.936  1.00 70.26  ? 239  LEU A CA   1 
ATOM   500   C  C    . LEU A  1 47  ? 201.756 87.269  41.760  1.00 67.53  ? 239  LEU A C    1 
ATOM   501   O  O    . LEU A  1 47  ? 201.118 86.231  41.967  1.00 68.50  ? 239  LEU A O    1 
ATOM   502   C  CB   . LEU A  1 47  ? 201.250 88.022  39.454  1.00 71.78  ? 239  LEU A CB   1 
ATOM   503   C  CG   . LEU A  1 47  ? 200.434 88.848  38.462  1.00 74.63  ? 239  LEU A CG   1 
ATOM   504   C  CD1  . LEU A  1 47  ? 201.015 88.705  37.066  1.00 75.03  ? 239  LEU A CD1  1 
ATOM   505   C  CD2  . LEU A  1 47  ? 198.980 88.415  38.484  1.00 78.52  ? 239  LEU A CD2  1 
ATOM   506   H  H    . LEU A  1 47  ? 202.243 89.951  40.553  1.00 86.30  ? 239  LEU A H    1 
ATOM   507   H  HA   . LEU A  1 47  ? 200.178 88.418  41.156  1.00 84.06  ? 239  LEU A HA   1 
ATOM   508   H  HB2  . LEU A  1 47  ? 202.182 88.114  39.202  1.00 85.89  ? 239  LEU A HB2  1 
ATOM   509   H  HB3  . LEU A  1 47  ? 200.980 87.097  39.344  1.00 85.89  ? 239  LEU A HB3  1 
ATOM   510   H  HG   . LEU A  1 47  ? 200.476 89.784  38.714  1.00 89.31  ? 239  LEU A HG   1 
ATOM   511   H  HD11 . LEU A  1 47  ? 200.487 89.234  36.448  1.00 89.79  ? 239  LEU A HD11 1 
ATOM   512   H  HD12 . LEU A  1 47  ? 201.932 89.020  37.072  1.00 89.79  ? 239  LEU A HD12 1 
ATOM   513   H  HD13 . LEU A  1 47  ? 200.988 87.770  36.808  1.00 89.79  ? 239  LEU A HD13 1 
ATOM   514   H  HD21 . LEU A  1 47  ? 198.481 88.951  37.848  1.00 93.98  ? 239  LEU A HD21 1 
ATOM   515   H  HD22 . LEU A  1 47  ? 198.927 87.477  38.240  1.00 93.98  ? 239  LEU A HD22 1 
ATOM   516   H  HD23 . LEU A  1 47  ? 198.626 88.545  39.377  1.00 93.98  ? 239  LEU A HD23 1 
ATOM   517   N  N    . PHE A  1 48  ? 202.992 87.459  42.227  1.00 68.16  ? 240  PHE A N    1 
ATOM   518   C  CA   . PHE A  1 48  ? 203.736 86.362  42.837  1.00 68.70  ? 240  PHE A CA   1 
ATOM   519   C  C    . PHE A  1 48  ? 203.025 85.826  44.075  1.00 68.35  ? 240  PHE A C    1 
ATOM   520   O  O    . PHE A  1 48  ? 202.762 84.622  44.180  1.00 66.24  ? 240  PHE A O    1 
ATOM   521   C  CB   . PHE A  1 48  ? 205.152 86.828  43.189  1.00 68.77  ? 240  PHE A CB   1 
ATOM   522   C  CG   . PHE A  1 48  ? 206.085 86.900  42.008  1.00 71.87  ? 240  PHE A CG   1 
ATOM   523   C  CD1  . PHE A  1 48  ? 206.175 85.851  41.108  1.00 74.98  ? 240  PHE A CD1  1 
ATOM   524   C  CD2  . PHE A  1 48  ? 206.879 88.017  41.803  1.00 74.26  ? 240  PHE A CD2  1 
ATOM   525   C  CE1  . PHE A  1 48  ? 207.033 85.915  40.027  1.00 77.66  ? 240  PHE A CE1  1 
ATOM   526   C  CE2  . PHE A  1 48  ? 207.739 88.087  40.723  1.00 76.26  ? 240  PHE A CE2  1 
ATOM   527   C  CZ   . PHE A  1 48  ? 207.816 87.034  39.835  1.00 76.79  ? 240  PHE A CZ   1 
ATOM   528   H  H    . PHE A  1 48  ? 203.416 88.207  42.203  1.00 81.54  ? 240  PHE A H    1 
ATOM   529   H  HA   . PHE A  1 48  ? 203.810 85.637  42.197  1.00 82.19  ? 240  PHE A HA   1 
ATOM   530   H  HB2  . PHE A  1 48  ? 205.100 87.714  43.579  1.00 82.28  ? 240  PHE A HB2  1 
ATOM   531   H  HB3  . PHE A  1 48  ? 205.534 86.209  43.830  1.00 82.28  ? 240  PHE A HB3  1 
ATOM   532   H  HD1  . PHE A  1 48  ? 205.650 85.094  41.232  1.00 89.73  ? 240  PHE A HD1  1 
ATOM   533   H  HD2  . PHE A  1 48  ? 206.832 88.730  42.399  1.00 88.87  ? 240  PHE A HD2  1 
ATOM   534   H  HE1  . PHE A  1 48  ? 207.082 85.205  39.430  1.00 92.94  ? 240  PHE A HE1  1 
ATOM   535   H  HE2  . PHE A  1 48  ? 208.266 88.842  40.595  1.00 91.26  ? 240  PHE A HE2  1 
ATOM   536   H  HZ   . PHE A  1 48  ? 208.393 87.079  39.107  1.00 91.90  ? 240  PHE A HZ   1 
ATOM   537   N  N    . TYR A  1 49  ? 202.704 86.706  45.025  1.00 68.71  ? 241  TYR A N    1 
ATOM   538   C  CA   . TYR A  1 49  ? 202.095 86.255  46.276  1.00 68.56  ? 241  TYR A CA   1 
ATOM   539   C  C    . TYR A  1 49  ? 200.742 85.594  46.050  1.00 68.17  ? 241  TYR A C    1 
ATOM   540   O  O    . TYR A  1 49  ? 200.561 84.438  46.469  1.00 73.00  ? 241  TYR A O    1 
ATOM   541   C  CB   . TYR A  1 49  ? 202.003 87.435  47.246  1.00 72.87  ? 241  TYR A CB   1 
ATOM   542   C  CG   . TYR A  1 49  ? 201.226 87.139  48.510  1.00 75.25  ? 241  TYR A CG   1 
ATOM   543   C  CD1  . TYR A  1 49  ? 201.759 86.330  49.506  1.00 73.30  ? 241  TYR A CD1  1 
ATOM   544   C  CD2  . TYR A  1 49  ? 199.962 87.675  48.709  1.00 75.71  ? 241  TYR A CD2  1 
ATOM   545   C  CE1  . TYR A  1 49  ? 201.049 86.061  50.665  1.00 72.60  ? 241  TYR A CE1  1 
ATOM   546   C  CE2  . TYR A  1 49  ? 199.247 87.413  49.861  1.00 77.39  ? 241  TYR A CE2  1 
ATOM   547   C  CZ   . TYR A  1 49  ? 199.794 86.607  50.836  1.00 75.48  ? 241  TYR A CZ   1 
ATOM   548   O  OH   . TYR A  1 49  ? 199.077 86.350  51.983  1.00 78.55  ? 241  TYR A OH   1 
ATOM   549   H  H    . TYR A  1 49  ? 202.827 87.555  44.972  1.00 82.21  ? 241  TYR A H    1 
ATOM   550   H  HA   . TYR A  1 49  ? 202.677 85.592  46.679  1.00 82.02  ? 241  TYR A HA   1 
ATOM   551   H  HB2  . TYR A  1 49  ? 202.900 87.696  47.505  1.00 87.20  ? 241  TYR A HB2  1 
ATOM   552   H  HB3  . TYR A  1 49  ? 201.563 88.174  46.796  1.00 87.20  ? 241  TYR A HB3  1 
ATOM   553   H  HD1  . TYR A  1 49  ? 202.605 85.962  49.393  1.00 87.71  ? 241  TYR A HD1  1 
ATOM   554   H  HD2  . TYR A  1 49  ? 199.589 88.220  48.055  1.00 90.60  ? 241  TYR A HD2  1 
ATOM   555   H  HE1  . TYR A  1 49  ? 201.417 85.518  51.324  1.00 86.87  ? 241  TYR A HE1  1 
ATOM   556   H  HE2  . TYR A  1 49  ? 198.400 87.779  49.979  1.00 92.62  ? 241  TYR A HE2  1 
ATOM   557   H  HH   . TYR A  1 49  ? 199.519 85.849  52.492  1.00 94.01  ? 241  TYR A HH   1 
ATOM   558   N  N    . PRO A  1 50  ? 199.764 86.240  45.407  1.00 66.88  ? 242  PRO A N    1 
ATOM   559   C  CA   . PRO A  1 50  ? 198.450 85.587  45.265  1.00 67.79  ? 242  PRO A CA   1 
ATOM   560   C  C    . PRO A  1 50  ? 198.501 84.290  44.477  1.00 69.22  ? 242  PRO A C    1 
ATOM   561   O  O    . PRO A  1 50  ? 197.806 83.331  44.835  1.00 72.40  ? 242  PRO A O    1 
ATOM   562   C  CB   . PRO A  1 50  ? 197.603 86.659  44.564  1.00 69.65  ? 242  PRO A CB   1 
ATOM   563   C  CG   . PRO A  1 50  ? 198.586 87.558  43.901  1.00 71.58  ? 242  PRO A CG   1 
ATOM   564   C  CD   . PRO A  1 50  ? 199.772 87.587  44.812  1.00 71.44  ? 242  PRO A CD   1 
ATOM   565   H  HA   . PRO A  1 50  ? 198.073 85.410  46.140  1.00 81.10  ? 242  PRO A HA   1 
ATOM   566   H  HB2  . PRO A  1 50  ? 197.023 86.241  43.908  1.00 83.33  ? 242  PRO A HB2  1 
ATOM   567   H  HB3  . PRO A  1 50  ? 197.082 87.146  45.222  1.00 83.33  ? 242  PRO A HB3  1 
ATOM   568   H  HG2  . PRO A  1 50  ? 198.828 87.195  43.034  1.00 85.65  ? 242  PRO A HG2  1 
ATOM   569   H  HG3  . PRO A  1 50  ? 198.205 88.446  43.806  1.00 85.65  ? 242  PRO A HG3  1 
ATOM   570   H  HD2  . PRO A  1 50  ? 200.586 87.729  44.304  1.00 85.48  ? 242  PRO A HD2  1 
ATOM   571   H  HD3  . PRO A  1 50  ? 199.656 88.262  45.499  1.00 85.48  ? 242  PRO A HD3  1 
ATOM   572   N  N    . LEU A  1 51  ? 199.296 84.227  43.406  1.00 70.27  ? 243  LEU A N    1 
ATOM   573   C  CA   . LEU A  1 51  ? 199.410 82.977  42.661  1.00 71.94  ? 243  LEU A CA   1 
ATOM   574   C  C    . LEU A  1 51  ? 200.110 81.904  43.484  1.00 71.43  ? 243  LEU A C    1 
ATOM   575   O  O    . LEU A  1 51  ? 199.738 80.727  43.421  1.00 77.67  ? 243  LEU A O    1 
ATOM   576   C  CB   . LEU A  1 51  ? 200.151 83.201  41.343  1.00 73.23  ? 243  LEU A CB   1 
ATOM   577   C  CG   . LEU A  1 51  ? 199.390 83.939  40.241  1.00 75.60  ? 243  LEU A CG   1 
ATOM   578   C  CD1  . LEU A  1 51  ? 200.302 84.179  39.050  1.00 83.59  ? 243  LEU A CD1  1 
ATOM   579   C  CD2  . LEU A  1 51  ? 198.161 83.151  39.814  1.00 77.19  ? 243  LEU A CD2  1 
ATOM   580   H  H    . LEU A  1 51  ? 199.767 84.877  43.099  1.00 84.08  ? 243  LEU A H    1 
ATOM   581   H  HA   . LEU A  1 51  ? 198.520 82.655  42.450  1.00 86.08  ? 243  LEU A HA   1 
ATOM   582   H  HB2  . LEU A  1 51  ? 200.952 83.714  41.530  1.00 87.62  ? 243  LEU A HB2  1 
ATOM   583   H  HB3  . LEU A  1 51  ? 200.402 82.335  40.986  1.00 87.62  ? 243  LEU A HB3  1 
ATOM   584   H  HG   . LEU A  1 51  ? 199.097 84.800  40.577  1.00 90.48  ? 243  LEU A HG   1 
ATOM   585   H  HD11 . LEU A  1 51  ? 199.805 84.647  38.361  1.00 100.06 ? 243  LEU A HD11 1 
ATOM   586   H  HD12 . LEU A  1 51  ? 201.058 84.716  39.335  1.00 100.06 ? 243  LEU A HD12 1 
ATOM   587   H  HD13 . LEU A  1 51  ? 200.611 83.324  38.712  1.00 100.06 ? 243  LEU A HD13 1 
ATOM   588   H  HD21 . LEU A  1 51  ? 197.699 83.641  39.116  1.00 92.37  ? 243  LEU A HD21 1 
ATOM   589   H  HD22 . LEU A  1 51  ? 198.443 82.285  39.479  1.00 92.37  ? 243  LEU A HD22 1 
ATOM   590   H  HD23 . LEU A  1 51  ? 197.578 83.036  40.580  1.00 92.37  ? 243  LEU A HD23 1 
ATOM   591   N  N    . PHE A  1 52  ? 201.128 82.285  44.258  1.00 68.68  ? 244  PHE A N    1 
ATOM   592   C  CA   . PHE A  1 52  ? 201.816 81.303  45.089  1.00 71.46  ? 244  PHE A CA   1 
ATOM   593   C  C    . PHE A  1 52  ? 200.861 80.680  46.097  1.00 73.71  ? 244  PHE A C    1 
ATOM   594   O  O    . PHE A  1 52  ? 200.884 79.463  46.316  1.00 76.43  ? 244  PHE A O    1 
ATOM   595   C  CB   . PHE A  1 52  ? 203.001 81.949  45.804  1.00 76.66  ? 244  PHE A CB   1 
ATOM   596   C  CG   . PHE A  1 52  ? 203.658 81.051  46.815  1.00 78.40  ? 244  PHE A CG   1 
ATOM   597   C  CD1  . PHE A  1 52  ? 204.525 80.051  46.410  1.00 80.13  ? 244  PHE A CD1  1 
ATOM   598   C  CD2  . PHE A  1 52  ? 203.407 81.205  48.168  1.00 79.03  ? 244  PHE A CD2  1 
ATOM   599   C  CE1  . PHE A  1 52  ? 205.127 79.219  47.335  1.00 80.51  ? 244  PHE A CE1  1 
ATOM   600   C  CE2  . PHE A  1 52  ? 204.010 80.376  49.097  1.00 78.65  ? 244  PHE A CE2  1 
ATOM   601   C  CZ   . PHE A  1 52  ? 204.871 79.384  48.679  1.00 77.17  ? 244  PHE A CZ   1 
ATOM   602   H  H    . PHE A  1 52  ? 201.433 83.087  44.317  1.00 82.16  ? 244  PHE A H    1 
ATOM   603   H  HA   . PHE A  1 52  ? 202.158 80.594  44.522  1.00 85.50  ? 244  PHE A HA   1 
ATOM   604   H  HB2  . PHE A  1 52  ? 203.670 82.193  45.145  1.00 91.75  ? 244  PHE A HB2  1 
ATOM   605   H  HB3  . PHE A  1 52  ? 202.692 82.743  46.269  1.00 91.75  ? 244  PHE A HB3  1 
ATOM   606   H  HD1  . PHE A  1 52  ? 204.701 79.935  45.504  1.00 95.91  ? 244  PHE A HD1  1 
ATOM   607   H  HD2  . PHE A  1 52  ? 202.827 81.872  48.455  1.00 94.59  ? 244  PHE A HD2  1 
ATOM   608   H  HE1  . PHE A  1 52  ? 205.708 78.551  47.050  1.00 96.36  ? 244  PHE A HE1  1 
ATOM   609   H  HE2  . PHE A  1 52  ? 203.834 80.489  50.004  1.00 94.13  ? 244  PHE A HE2  1 
ATOM   610   H  HZ   . PHE A  1 52  ? 205.277 78.826  49.303  1.00 92.35  ? 244  PHE A HZ   1 
ATOM   611   N  N    . VAL A  1 53  ? 200.003 81.495  46.711  1.00 70.26  ? 245  VAL A N    1 
ATOM   612   C  CA   . VAL A  1 53  ? 199.105 80.989  47.742  1.00 69.26  ? 245  VAL A CA   1 
ATOM   613   C  C    . VAL A  1 53  ? 197.964 80.195  47.120  1.00 69.68  ? 245  VAL A C    1 
ATOM   614   O  O    . VAL A  1 53  ? 197.616 79.111  47.600  1.00 74.94  ? 245  VAL A O    1 
ATOM   615   C  CB   . VAL A  1 53  ? 198.587 82.154  48.606  1.00 72.23  ? 245  VAL A CB   1 
ATOM   616   C  CG1  . VAL A  1 53  ? 197.651 81.642  49.694  1.00 70.54  ? 245  VAL A CG1  1 
ATOM   617   C  CG2  . VAL A  1 53  ? 199.754 82.917  49.222  1.00 73.75  ? 245  VAL A CG2  1 
ATOM   618   H  H    . VAL A  1 53  ? 199.924 82.336  46.549  1.00 84.07  ? 245  VAL A H    1 
ATOM   619   H  HA   . VAL A  1 53  ? 199.601 80.390  48.321  1.00 82.86  ? 245  VAL A HA   1 
ATOM   620   H  HB   . VAL A  1 53  ? 198.088 82.768  48.045  1.00 86.42  ? 245  VAL A HB   1 
ATOM   621   H  HG11 . VAL A  1 53  ? 197.340 82.393  50.223  1.00 84.40  ? 245  VAL A HG11 1 
ATOM   622   H  HG12 . VAL A  1 53  ? 196.897 81.195  49.278  1.00 84.40  ? 245  VAL A HG12 1 
ATOM   623   H  HG13 . VAL A  1 53  ? 198.134 81.018  50.258  1.00 84.40  ? 245  VAL A HG13 1 
ATOM   624   H  HG21 . VAL A  1 53  ? 199.406 83.644  49.761  1.00 88.25  ? 245  VAL A HG21 1 
ATOM   625   H  HG22 . VAL A  1 53  ? 200.269 82.310  49.777  1.00 88.25  ? 245  VAL A HG22 1 
ATOM   626   H  HG23 . VAL A  1 53  ? 200.311 83.269  48.510  1.00 88.25  ? 245  VAL A HG23 1 
ATOM   627   N  N    . HIS A  1 54  ? 197.357 80.716  46.051  1.00 69.69  ? 246  HIS A N    1 
ATOM   628   C  CA   . HIS A  1 54  ? 196.268 79.996  45.398  1.00 70.31  ? 246  HIS A CA   1 
ATOM   629   C  C    . HIS A  1 54  ? 196.741 78.663  44.836  1.00 73.80  ? 246  HIS A C    1 
ATOM   630   O  O    . HIS A  1 54  ? 196.023 77.659  44.911  1.00 75.93  ? 246  HIS A O    1 
ATOM   631   C  CB   . HIS A  1 54  ? 195.660 80.855  44.291  1.00 71.33  ? 246  HIS A CB   1 
ATOM   632   C  CG   . HIS A  1 54  ? 194.569 81.761  44.767  1.00 72.59  ? 246  HIS A CG   1 
ATOM   633   N  ND1  . HIS A  1 54  ? 193.307 81.300  45.074  1.00 77.29  ? 246  HIS A ND1  1 
ATOM   634   C  CD2  . HIS A  1 54  ? 194.549 83.095  44.995  1.00 74.31  ? 246  HIS A CD2  1 
ATOM   635   C  CE1  . HIS A  1 54  ? 192.556 82.312  45.470  1.00 77.38  ? 246  HIS A CE1  1 
ATOM   636   N  NE2  . HIS A  1 54  ? 193.285 83.412  45.430  1.00 75.80  ? 246  HIS A NE2  1 
ATOM   637   H  H    . HIS A  1 54  ? 197.555 81.472  45.691  1.00 83.38  ? 246  HIS A H    1 
ATOM   638   H  HA   . HIS A  1 54  ? 195.575 79.816  46.051  1.00 84.13  ? 246  HIS A HA   1 
ATOM   639   H  HB2  . HIS A  1 54  ? 196.357 81.407  43.904  1.00 85.34  ? 246  HIS A HB2  1 
ATOM   640   H  HB3  . HIS A  1 54  ? 195.287 80.272  43.612  1.00 85.34  ? 246  HIS A HB3  1 
ATOM   641   H  HD2  . HIS A  1 54  ? 195.258 83.686  44.878  1.00 88.93  ? 246  HIS A HD2  1 
ATOM   642   H  HE1  . HIS A  1 54  ? 191.665 82.259  45.730  1.00 92.61  ? 246  HIS A HE1  1 
ATOM   643   H  HE2  . HIS A  1 54  ? 193.013 84.200  45.642  1.00 90.71  ? 246  HIS A HE2  1 
ATOM   644   N  N    . MET A  1 55  ? 197.947 78.630  44.268  1.00 68.44  ? 247  MET A N    1 
ATOM   645   C  CA   . MET A  1 55  ? 198.459 77.388  43.700  1.00 72.04  ? 247  MET A CA   1 
ATOM   646   C  C    . MET A  1 55  ? 198.885 76.416  44.793  1.00 72.20  ? 247  MET A C    1 
ATOM   647   O  O    . MET A  1 55  ? 198.698 75.201  44.658  1.00 70.93  ? 247  MET A O    1 
ATOM   648   C  CB   . MET A  1 55  ? 199.618 77.695  42.754  1.00 72.35  ? 247  MET A CB   1 
ATOM   649   C  CG   . MET A  1 55  ? 199.167 78.401  41.484  1.00 77.13  ? 247  MET A CG   1 
ATOM   650   S  SD   . MET A  1 55  ? 200.521 78.928  40.421  1.00 80.19  ? 247  MET A SD   1 
ATOM   651   C  CE   . MET A  1 55  ? 201.048 77.353  39.748  1.00 82.84  ? 247  MET A CE   1 
ATOM   652   H  H    . MET A  1 55  ? 198.479 79.302  44.201  1.00 81.89  ? 247  MET A H    1 
ATOM   653   H  HA   . MET A  1 55  ? 197.755 76.975  43.176  1.00 86.20  ? 247  MET A HA   1 
ATOM   654   H  HB2  . MET A  1 55  ? 200.253 78.270  43.208  1.00 86.57  ? 247  MET A HB2  1 
ATOM   655   H  HB3  . MET A  1 55  ? 200.047 76.863  42.498  1.00 86.57  ? 247  MET A HB3  1 
ATOM   656   H  HG2  . MET A  1 55  ? 198.607 77.796  40.973  1.00 92.31  ? 247  MET A HG2  1 
ATOM   657   H  HG3  . MET A  1 55  ? 198.659 79.190  41.730  1.00 92.31  ? 247  MET A HG3  1 
ATOM   658   H  HE1  . MET A  1 55  ? 201.791 77.502  39.143  1.00 99.15  ? 247  MET A HE1  1 
ATOM   659   H  HE2  . MET A  1 55  ? 201.323 76.775  40.477  1.00 99.15  ? 247  MET A HE2  1 
ATOM   660   H  HE3  . MET A  1 55  ? 200.306 76.951  39.269  1.00 99.15  ? 247  MET A HE3  1 
ATOM   661   N  N    . TYR A  1 56  ? 199.457 76.928  45.884  1.00 75.00  ? 248  TYR A N    1 
ATOM   662   C  CA   . TYR A  1 56  ? 199.821 76.064  47.001  1.00 72.85  ? 248  TYR A CA   1 
ATOM   663   C  C    . TYR A  1 56  ? 198.583 75.460  47.649  1.00 71.86  ? 248  TYR A C    1 
ATOM   664   O  O    . TYR A  1 56  ? 198.543 74.257  47.932  1.00 74.91  ? 248  TYR A O    1 
ATOM   665   C  CB   . TYR A  1 56  ? 200.636 76.845  48.031  1.00 72.31  ? 248  TYR A CB   1 
ATOM   666   C  CG   . TYR A  1 56  ? 200.947 76.052  49.278  1.00 68.66  ? 248  TYR A CG   1 
ATOM   667   C  CD1  . TYR A  1 56  ? 201.902 75.046  49.262  1.00 69.76  ? 248  TYR A CD1  1 
ATOM   668   C  CD2  . TYR A  1 56  ? 200.289 76.312  50.473  1.00 68.32  ? 248  TYR A CD2  1 
ATOM   669   C  CE1  . TYR A  1 56  ? 202.190 74.315  50.398  1.00 71.15  ? 248  TYR A CE1  1 
ATOM   670   C  CE2  . TYR A  1 56  ? 200.571 75.587  51.616  1.00 70.95  ? 248  TYR A CE2  1 
ATOM   671   C  CZ   . TYR A  1 56  ? 201.522 74.589  51.572  1.00 72.02  ? 248  TYR A CZ   1 
ATOM   672   O  OH   . TYR A  1 56  ? 201.810 73.863  52.705  1.00 71.96  ? 248  TYR A OH   1 
ATOM   673   H  H    . TYR A  1 56  ? 199.641 77.761  45.999  1.00 89.76  ? 248  TYR A H    1 
ATOM   674   H  HA   . TYR A  1 56  ? 200.372 75.337  46.671  1.00 87.17  ? 248  TYR A HA   1 
ATOM   675   H  HB2  . TYR A  1 56  ? 201.478 77.111  47.629  1.00 86.52  ? 248  TYR A HB2  1 
ATOM   676   H  HB3  . TYR A  1 56  ? 200.135 77.633  48.296  1.00 86.52  ? 248  TYR A HB3  1 
ATOM   677   H  HD1  . TYR A  1 56  ? 202.353 74.857  48.471  1.00 83.46  ? 248  TYR A HD1  1 
ATOM   678   H  HD2  . TYR A  1 56  ? 199.646 76.983  50.504  1.00 81.73  ? 248  TYR A HD2  1 
ATOM   679   H  HE1  . TYR A  1 56  ? 202.832 73.643  50.372  1.00 85.14  ? 248  TYR A HE1  1 
ATOM   680   H  HE2  . TYR A  1 56  ? 200.122 75.770  52.409  1.00 84.89  ? 248  TYR A HE2  1 
ATOM   681   H  HH   . TYR A  1 56  ? 201.336 74.130  53.345  1.00 86.11  ? 248  TYR A HH   1 
ATOM   682   N  N    . LEU A  1 57  ? 197.560 76.282  47.892  1.00 68.46  ? 249  LEU A N    1 
ATOM   683   C  CA   . LEU A  1 57  ? 196.344 75.786  48.527  1.00 71.20  ? 249  LEU A CA   1 
ATOM   684   C  C    . LEU A  1 57  ? 195.591 74.807  47.634  1.00 77.43  ? 249  LEU A C    1 
ATOM   685   O  O    . LEU A  1 57  ? 194.889 73.927  48.144  1.00 79.44  ? 249  LEU A O    1 
ATOM   686   C  CB   . LEU A  1 57  ? 195.437 76.955  48.914  1.00 73.03  ? 249  LEU A CB   1 
ATOM   687   C  CG   . LEU A  1 57  ? 195.918 77.865  50.049  1.00 71.75  ? 249  LEU A CG   1 
ATOM   688   C  CD1  . LEU A  1 57  ? 194.867 78.923  50.348  1.00 72.20  ? 249  LEU A CD1  1 
ATOM   689   C  CD2  . LEU A  1 57  ? 196.251 77.075  51.311  1.00 72.51  ? 249  LEU A CD2  1 
ATOM   690   H  H    . LEU A  1 57  ? 197.547 77.121  47.700  1.00 81.90  ? 249  LEU A H    1 
ATOM   691   H  HA   . LEU A  1 57  ? 196.586 75.317  49.341  1.00 85.20  ? 249  LEU A HA   1 
ATOM   692   H  HB2  . LEU A  1 57  ? 195.317 77.514  48.131  1.00 87.38  ? 249  LEU A HB2  1 
ATOM   693   H  HB3  . LEU A  1 57  ? 194.578 76.593  49.182  1.00 87.38  ? 249  LEU A HB3  1 
ATOM   694   H  HG   . LEU A  1 57  ? 196.725 78.321  49.763  1.00 85.85  ? 249  LEU A HG   1 
ATOM   695   H  HD11 . LEU A  1 57  ? 195.187 79.490  51.068  1.00 86.39  ? 249  LEU A HD11 1 
ATOM   696   H  HD12 . LEU A  1 57  ? 194.718 79.453  49.550  1.00 86.39  ? 249  LEU A HD12 1 
ATOM   697   H  HD13 . LEU A  1 57  ? 194.044 78.483  50.613  1.00 86.39  ? 249  LEU A HD13 1 
ATOM   698   H  HD21 . LEU A  1 57  ? 196.549 77.690  51.999  1.00 86.76  ? 249  LEU A HD21 1 
ATOM   699   H  HD22 . LEU A  1 57  ? 195.455 76.607  51.608  1.00 86.76  ? 249  LEU A HD22 1 
ATOM   700   H  HD23 . LEU A  1 57  ? 196.954 76.438  51.108  1.00 86.76  ? 249  LEU A HD23 1 
ATOM   701   N  N    . GLU A  1 58  ? 195.712 74.937  46.311  1.00 86.54  ? 250  GLU A N    1 
ATOM   702   C  CA   . GLU A  1 58  ? 195.052 73.980  45.429  1.00 92.76  ? 250  GLU A CA   1 
ATOM   703   C  C    . GLU A  1 58  ? 195.681 72.602  45.559  1.00 90.41  ? 250  GLU A C    1 
ATOM   704   O  O    . GLU A  1 58  ? 194.975 71.587  45.569  1.00 89.96  ? 250  GLU A O    1 
ATOM   705   C  CB   . GLU A  1 58  ? 195.114 74.455  43.978  1.00 100.51 ? 250  GLU A CB   1 
ATOM   706   C  CG   . GLU A  1 58  ? 194.238 73.627  43.036  1.00 108.69 ? 250  GLU A CG   1 
ATOM   707   C  CD   . GLU A  1 58  ? 193.937 74.333  41.727  1.00 116.33 ? 250  GLU A CD   1 
ATOM   708   O  OE1  . GLU A  1 58  ? 194.176 75.557  41.635  1.00 115.51 ? 250  GLU A OE1  1 
ATOM   709   O  OE2  . GLU A  1 58  ? 193.450 73.662  40.792  1.00 119.11 ? 250  GLU A OE2  1 
ATOM   710   H  H    . GLU A  1 58  ? 196.159 75.553  45.911  1.00 103.60 ? 250  GLU A H    1 
ATOM   711   H  HA   . GLU A  1 58  ? 194.118 73.909  45.682  1.00 111.06 ? 250  GLU A HA   1 
ATOM   712   H  HB2  . GLU A  1 58  ? 194.812 75.376  43.935  1.00 120.36 ? 250  GLU A HB2  1 
ATOM   713   H  HB3  . GLU A  1 58  ? 196.030 74.393  43.666  1.00 120.36 ? 250  GLU A HB3  1 
ATOM   714   H  HG2  . GLU A  1 58  ? 194.695 72.797  42.830  1.00 130.18 ? 250  GLU A HG2  1 
ATOM   715   H  HG3  . GLU A  1 58  ? 193.393 73.440  43.475  1.00 130.18 ? 250  GLU A HG3  1 
ATOM   716   N  N    . LEU A  1 59  ? 197.009 72.549  45.662  1.00 84.53  ? 251  LEU A N    1 
ATOM   717   C  CA   . LEU A  1 59  ? 197.688 71.274  45.860  1.00 86.36  ? 251  LEU A CA   1 
ATOM   718   C  C    . LEU A  1 59  ? 197.342 70.671  47.215  1.00 83.39  ? 251  LEU A C    1 
ATOM   719   O  O    . LEU A  1 59  ? 197.188 69.450  47.337  1.00 83.78  ? 251  LEU A O    1 
ATOM   720   C  CB   . LEU A  1 59  ? 199.195 71.476  45.717  1.00 80.92  ? 251  LEU A CB   1 
ATOM   721   C  CG   . LEU A  1 59  ? 199.616 71.902  44.310  1.00 80.66  ? 251  LEU A CG   1 
ATOM   722   C  CD1  . LEU A  1 59  ? 201.032 72.444  44.315  1.00 80.21  ? 251  LEU A CD1  1 
ATOM   723   C  CD2  . LEU A  1 59  ? 199.494 70.735  43.340  1.00 84.86  ? 251  LEU A CD2  1 
ATOM   724   H  H    . LEU A  1 59  ? 197.532 73.230  45.620  1.00 101.19 ? 251  LEU A H    1 
ATOM   725   H  HA   . LEU A  1 59  ? 197.402 70.653  45.172  1.00 103.38 ? 251  LEU A HA   1 
ATOM   726   H  HB2  . LEU A  1 59  ? 199.480 72.167  46.336  1.00 96.86  ? 251  LEU A HB2  1 
ATOM   727   H  HB3  . LEU A  1 59  ? 199.645 70.642  45.924  1.00 96.86  ? 251  LEU A HB3  1 
ATOM   728   H  HG   . LEU A  1 59  ? 199.026 72.608  44.005  1.00 96.54  ? 251  LEU A HG   1 
ATOM   729   H  HD11 . LEU A  1 59  ? 201.272 72.706  43.412  1.00 96.00  ? 251  LEU A HD11 1 
ATOM   730   H  HD12 . LEU A  1 59  ? 201.073 73.213  44.904  1.00 96.00  ? 251  LEU A HD12 1 
ATOM   731   H  HD13 . LEU A  1 59  ? 201.634 71.752  44.630  1.00 96.00  ? 251  LEU A HD13 1 
ATOM   732   H  HD21 . LEU A  1 59  ? 199.765 71.030  42.457  1.00 101.58 ? 251  LEU A HD21 1 
ATOM   733   H  HD22 . LEU A  1 59  ? 200.068 70.014  43.640  1.00 101.58 ? 251  LEU A HD22 1 
ATOM   734   H  HD23 . LEU A  1 59  ? 198.571 70.437  43.320  1.00 101.58 ? 251  LEU A HD23 1 
ATOM   735   N  N    . VAL A  1 60  ? 197.215 71.508  48.245  1.00 80.65  ? 252  VAL A N    1 
ATOM   736   C  CA   . VAL A  1 60  ? 196.852 71.011  49.568  1.00 79.08  ? 252  VAL A CA   1 
ATOM   737   C  C    . VAL A  1 60  ? 195.422 70.485  49.565  1.00 84.92  ? 252  VAL A C    1 
ATOM   738   O  O    . VAL A  1 60  ? 195.155 69.365  50.016  1.00 86.00  ? 252  VAL A O    1 
ATOM   739   C  CB   . VAL A  1 60  ? 197.042 72.117  50.623  1.00 74.07  ? 252  VAL A CB   1 
ATOM   740   C  CG1  . VAL A  1 60  ? 196.391 71.726  51.952  1.00 76.22  ? 252  VAL A CG1  1 
ATOM   741   C  CG2  . VAL A  1 60  ? 198.520 72.414  50.818  1.00 70.18  ? 252  VAL A CG2  1 
ATOM   742   H  H    . VAL A  1 60  ? 197.332 72.359  48.203  1.00 96.54  ? 252  VAL A H    1 
ATOM   743   H  HA   . VAL A  1 60  ? 197.440 70.275  49.799  1.00 94.64  ? 252  VAL A HA   1 
ATOM   744   H  HB   . VAL A  1 60  ? 196.614 72.929  50.308  1.00 88.63  ? 252  VAL A HB   1 
ATOM   745   H  HG11 . VAL A  1 60  ? 196.527 72.441  52.593  1.00 91.21  ? 252  VAL A HG11 1 
ATOM   746   H  HG12 . VAL A  1 60  ? 195.441 71.586  51.808  1.00 91.21  ? 252  VAL A HG12 1 
ATOM   747   H  HG13 . VAL A  1 60  ? 196.801 70.908  52.275  1.00 91.21  ? 252  VAL A HG13 1 
ATOM   748   H  HG21 . VAL A  1 60  ? 198.615 73.112  51.485  1.00 83.97  ? 252  VAL A HG21 1 
ATOM   749   H  HG22 . VAL A  1 60  ? 198.967 71.607  51.117  1.00 83.97  ? 252  VAL A HG22 1 
ATOM   750   H  HG23 . VAL A  1 60  ? 198.896 72.709  49.974  1.00 83.97  ? 252  VAL A HG23 1 
ATOM   751   N  N    . TYR A  1 61  ? 194.482 71.284  49.056  1.00 84.20  ? 253  TYR A N    1 
ATOM   752   C  CA   . TYR A  1 61  ? 193.075 70.902  49.124  1.00 84.92  ? 253  TYR A CA   1 
ATOM   753   C  C    . TYR A  1 61  ? 192.806 69.629  48.333  1.00 84.45  ? 253  TYR A C    1 
ATOM   754   O  O    . TYR A  1 61  ? 191.978 68.803  48.734  1.00 87.21  ? 253  TYR A O    1 
ATOM   755   C  CB   . TYR A  1 61  ? 192.190 72.038  48.614  1.00 87.43  ? 253  TYR A CB   1 
ATOM   756   C  CG   . TYR A  1 61  ? 190.727 71.823  48.920  1.00 93.19  ? 253  TYR A CG   1 
ATOM   757   C  CD1  . TYR A  1 61  ? 190.161 72.336  50.080  1.00 93.25  ? 253  TYR A CD1  1 
ATOM   758   C  CD2  . TYR A  1 61  ? 189.913 71.100  48.059  1.00 96.44  ? 253  TYR A CD2  1 
ATOM   759   C  CE1  . TYR A  1 61  ? 188.826 72.139  50.371  1.00 93.67  ? 253  TYR A CE1  1 
ATOM   760   C  CE2  . TYR A  1 61  ? 188.575 70.897  48.342  1.00 98.13  ? 253  TYR A CE2  1 
ATOM   761   C  CZ   . TYR A  1 61  ? 188.038 71.419  49.499  1.00 98.59  ? 253  TYR A CZ   1 
ATOM   762   O  OH   . TYR A  1 61  ? 186.707 71.220  49.786  1.00 104.11 ? 253  TYR A OH   1 
ATOM   763   H  H    . TYR A  1 61  ? 194.631 72.039  48.672  1.00 100.79 ? 253  TYR A H    1 
ATOM   764   H  HA   . TYR A  1 61  ? 192.840 70.733  50.049  1.00 101.65 ? 253  TYR A HA   1 
ATOM   765   H  HB2  . TYR A  1 61  ? 192.466 72.867  49.035  1.00 104.66 ? 253  TYR A HB2  1 
ATOM   766   H  HB3  . TYR A  1 61  ? 192.288 72.107  47.651  1.00 104.66 ? 253  TYR A HB3  1 
ATOM   767   H  HD1  . TYR A  1 61  ? 190.691 72.822  50.670  1.00 111.65 ? 253  TYR A HD1  1 
ATOM   768   H  HD2  . TYR A  1 61  ? 190.273 70.746  47.278  1.00 115.48 ? 253  TYR A HD2  1 
ATOM   769   H  HE1  . TYR A  1 61  ? 188.461 72.490  51.151  1.00 112.16 ? 253  TYR A HE1  1 
ATOM   770   H  HE2  . TYR A  1 61  ? 188.041 70.411  47.755  1.00 117.51 ? 253  TYR A HE2  1 
ATOM   771   H  HH   . TYR A  1 61  ? 186.346 70.769  49.177  1.00 124.68 ? 253  TYR A HH   1 
ATOM   772   N  N    . ASN A  1 62  ? 193.487 69.454  47.202  1.00 82.53  ? 254  ASN A N    1 
ATOM   773   C  CA   . ASN A  1 62  ? 193.341 68.259  46.385  1.00 84.74  ? 254  ASN A CA   1 
ATOM   774   C  C    . ASN A  1 62  ? 194.294 67.146  46.810  1.00 83.90  ? 254  ASN A C    1 
ATOM   775   O  O    . ASN A  1 62  ? 194.490 66.183  46.060  1.00 83.57  ? 254  ASN A O    1 
ATOM   776   C  CB   . ASN A  1 62  ? 193.545 68.614  44.911  1.00 87.17  ? 254  ASN A CB   1 
ATOM   777   C  CG   . ASN A  1 62  ? 192.476 69.557  44.391  1.00 89.38  ? 254  ASN A CG   1 
ATOM   778   O  OD1  . ASN A  1 62  ? 191.284 69.266  44.477  1.00 92.51  ? 254  ASN A OD1  1 
ATOM   779   N  ND2  . ASN A  1 62  ? 192.896 70.704  43.874  1.00 91.99  ? 254  ASN A ND2  1 
ATOM   780   H  H    . ASN A  1 62  ? 194.048 70.024  46.885  1.00 98.79  ? 254  ASN A H    1 
ATOM   781   H  HA   . ASN A  1 62  ? 192.436 67.924  46.484  1.00 101.44 ? 254  ASN A HA   1 
ATOM   782   H  HB2  . ASN A  1 62  ? 194.407 69.047  44.805  1.00 104.35 ? 254  ASN A HB2  1 
ATOM   783   H  HB3  . ASN A  1 62  ? 193.514 67.802  44.381  1.00 104.35 ? 254  ASN A HB3  1 
ATOM   784   H  HD21 . ASN A  1 62  ? 192.326 71.272  43.568  1.00 110.14 ? 254  ASN A HD21 1 
ATOM   785   H  HD22 . ASN A  1 62  ? 193.737 70.876  43.835  1.00 110.14 ? 254  ASN A HD22 1 
ATOM   786   N  N    . GLN A  1 63  ? 194.884 67.264  48.000  1.00 83.14  ? 255  GLN A N    1 
ATOM   787   C  CA   . GLN A  1 63  ? 195.642 66.182  48.627  1.00 85.03  ? 255  GLN A CA   1 
ATOM   788   C  C    . GLN A  1 63  ? 196.791 65.709  47.736  1.00 79.80  ? 255  GLN A C    1 
ATOM   789   O  O    . GLN A  1 63  ? 197.008 64.512  47.539  1.00 82.26  ? 255  GLN A O    1 
ATOM   790   C  CB   . GLN A  1 63  ? 194.716 65.024  49.003  1.00 90.02  ? 255  GLN A CB   1 
ATOM   791   C  CG   . GLN A  1 63  ? 193.641 65.427  50.000  1.00 88.28  ? 255  GLN A CG   1 
ATOM   792   C  CD   . GLN A  1 63  ? 192.640 64.323  50.269  1.00 91.66  ? 255  GLN A CD   1 
ATOM   793   O  OE1  . GLN A  1 63  ? 192.047 63.767  49.346  1.00 95.28  ? 255  GLN A OE1  1 
ATOM   794   N  NE2  . GLN A  1 63  ? 192.445 64.002  51.542  1.00 93.74  ? 255  GLN A NE2  1 
ATOM   795   H  H    . GLN A  1 63  ? 194.857 67.980  48.476  1.00 99.52  ? 255  GLN A H    1 
ATOM   796   H  HA   . GLN A  1 63  ? 196.033 66.518  49.448  1.00 101.78 ? 255  GLN A HA   1 
ATOM   797   H  HB2  . GLN A  1 63  ? 194.275 64.700  48.202  1.00 107.78 ? 255  GLN A HB2  1 
ATOM   798   H  HB3  . GLN A  1 63  ? 195.244 64.314  49.401  1.00 107.78 ? 255  GLN A HB3  1 
ATOM   799   H  HG2  . GLN A  1 63  ? 194.064 65.659  50.842  1.00 105.69 ? 255  GLN A HG2  1 
ATOM   800   H  HG3  . GLN A  1 63  ? 193.157 66.191  49.651  1.00 105.69 ? 255  GLN A HG3  1 
ATOM   801   H  HE21 . GLN A  1 63  ? 192.878 64.414  52.161  1.00 112.24 ? 255  GLN A HE21 1 
ATOM   802   H  HE22 . GLN A  1 63  ? 191.886 63.382  51.748  1.00 112.24 ? 255  GLN A HE22 1 
ATOM   803   N  N    . HIS A  1 64  ? 197.531 66.671  47.198  1.00 76.99  ? 256  HIS A N    1 
ATOM   804   C  CA   . HIS A  1 64  ? 198.825 66.422  46.574  1.00 82.23  ? 256  HIS A CA   1 
ATOM   805   C  C    . HIS A  1 64  ? 199.908 66.954  47.507  1.00 83.49  ? 256  HIS A C    1 
ATOM   806   O  O    . HIS A  1 64  ? 200.558 67.968  47.245  1.00 84.84  ? 256  HIS A O    1 
ATOM   807   C  CB   . HIS A  1 64  ? 198.891 67.072  45.185  1.00 81.90  ? 256  HIS A CB   1 
ATOM   808   C  CG   . HIS A  1 64  ? 197.781 66.658  44.270  1.00 80.03  ? 256  HIS A CG   1 
ATOM   809   N  ND1  . HIS A  1 64  ? 197.644 65.368  43.805  1.00 83.31  ? 256  HIS A ND1  1 
ATOM   810   C  CD2  . HIS A  1 64  ? 196.762 67.364  43.727  1.00 78.87  ? 256  HIS A CD2  1 
ATOM   811   C  CE1  . HIS A  1 64  ? 196.585 65.296  43.019  1.00 82.87  ? 256  HIS A CE1  1 
ATOM   812   N  NE2  . HIS A  1 64  ? 196.032 66.494  42.954  1.00 81.04  ? 256  HIS A NE2  1 
ATOM   813   H  H    . HIS A  1 64  ? 197.299 67.499  47.182  1.00 92.14  ? 256  HIS A H    1 
ATOM   814   H  HA   . HIS A  1 64  ? 198.953 65.466  46.470  1.00 98.43  ? 256  HIS A HA   1 
ATOM   815   H  HB2  . HIS A  1 64  ? 198.846 68.035  45.289  1.00 98.03  ? 256  HIS A HB2  1 
ATOM   816   H  HB3  . HIS A  1 64  ? 199.730 66.825  44.765  1.00 98.03  ? 256  HIS A HB3  1 
ATOM   817   H  HD2  . HIS A  1 64  ? 196.587 68.269  43.854  1.00 94.40  ? 256  HIS A HD2  1 
ATOM   818   H  HE1  . HIS A  1 64  ? 196.280 64.532  42.584  1.00 99.20  ? 256  HIS A HE1  1 
ATOM   819   H  HE2  . HIS A  1 64  ? 195.329 66.696  42.502  1.00 97.00  ? 256  HIS A HE2  1 
ATOM   820   N  N    . GLU A  1 65  ? 200.087 66.249  48.626  1.00 93.12  ? 257  GLU A N    1 
ATOM   821   C  CA   . GLU A  1 65  ? 200.890 66.779  49.723  1.00 96.54  ? 257  GLU A CA   1 
ATOM   822   C  C    . GLU A  1 65  ? 202.356 66.927  49.329  1.00 95.34  ? 257  GLU A C    1 
ATOM   823   O  O    . GLU A  1 65  ? 202.987 67.941  49.647  1.00 94.25  ? 257  GLU A O    1 
ATOM   824   C  CB   . GLU A  1 65  ? 200.744 65.877  50.949  1.00 103.98 ? 257  GLU A CB   1 
ATOM   825   C  CG   . GLU A  1 65  ? 201.120 66.548  52.261  1.00 109.76 ? 257  GLU A CG   1 
ATOM   826   C  CD   . GLU A  1 65  ? 200.654 65.763  53.474  1.00 114.83 ? 257  GLU A CD   1 
ATOM   827   O  OE1  . GLU A  1 65  ? 199.901 64.781  53.297  1.00 115.89 ? 257  GLU A OE1  1 
ATOM   828   O  OE2  . GLU A  1 65  ? 201.037 66.133  54.604  1.00 115.29 ? 257  GLU A OE2  1 
ATOM   829   H  H    . GLU A  1 65  ? 199.757 65.468  48.772  1.00 111.50 ? 257  GLU A H    1 
ATOM   830   H  HA   . GLU A  1 65  ? 200.556 67.658  49.959  1.00 115.60 ? 257  GLU A HA   1 
ATOM   831   H  HB2  . GLU A  1 65  ? 199.820 65.591  51.017  1.00 124.53 ? 257  GLU A HB2  1 
ATOM   832   H  HB3  . GLU A  1 65  ? 201.319 65.104  50.837  1.00 124.53 ? 257  GLU A HB3  1 
ATOM   833   H  HG2  . GLU A  1 65  ? 202.086 66.629  52.309  1.00 131.46 ? 257  GLU A HG2  1 
ATOM   834   H  HG3  . GLU A  1 65  ? 200.711 67.426  52.296  1.00 131.46 ? 257  GLU A HG3  1 
ATOM   835   N  N    . ASN A  1 66  ? 202.917 65.932  48.636  1.00 92.95  ? 258  ASN A N    1 
ATOM   836   C  CA   . ASN A  1 66  ? 204.312 66.029  48.217  1.00 93.94  ? 258  ASN A CA   1 
ATOM   837   C  C    . ASN A  1 66  ? 204.516 67.179  47.238  1.00 89.07  ? 258  ASN A C    1 
ATOM   838   O  O    . ASN A  1 66  ? 205.493 67.929  47.344  1.00 85.77  ? 258  ASN A O    1 
ATOM   839   C  CB   . ASN A  1 66  ? 204.771 64.715  47.584  1.00 99.63  ? 258  ASN A CB   1 
ATOM   840   C  CG   . ASN A  1 66  ? 204.782 63.563  48.567  1.00 102.98 ? 258  ASN A CG   1 
ATOM   841   O  OD1  . ASN A  1 66  ? 204.519 63.741  49.757  1.00 104.11 ? 258  ASN A OD1  1 
ATOM   842   N  ND2  . ASN A  1 66  ? 205.096 62.371  48.073  1.00 103.80 ? 258  ASN A ND2  1 
ATOM   843   H  H    . ASN A  1 66  ? 202.519 65.207  48.401  1.00 111.29 ? 258  ASN A H    1 
ATOM   844   H  HA   . ASN A  1 66  ? 204.865 66.197  48.996  1.00 112.48 ? 258  ASN A HA   1 
ATOM   845   H  HB2  . ASN A  1 66  ? 204.168 64.486  46.860  1.00 119.31 ? 258  ASN A HB2  1 
ATOM   846   H  HB3  . ASN A  1 66  ? 205.672 64.827  47.243  1.00 119.31 ? 258  ASN A HB3  1 
ATOM   847   H  HD21 . ASN A  1 66  ? 205.118 61.684  48.589  1.00 124.32 ? 258  ASN A HD21 1 
ATOM   848   H  HD22 . ASN A  1 66  ? 205.276 62.286  47.236  1.00 124.32 ? 258  ASN A HD22 1 
ATOM   849   N  N    . GLU A  1 67  ? 203.604 67.332  46.276  1.00 89.93  ? 259  GLU A N    1 
ATOM   850   C  CA   . GLU A  1 67  ? 203.725 68.423  45.315  1.00 89.12  ? 259  GLU A CA   1 
ATOM   851   C  C    . GLU A  1 67  ? 203.619 69.777  46.006  1.00 84.88  ? 259  GLU A C    1 
ATOM   852   O  O    . GLU A  1 67  ? 204.338 70.720  45.655  1.00 85.00  ? 259  GLU A O    1 
ATOM   853   C  CB   . GLU A  1 67  ? 202.660 68.286  44.226  1.00 91.01  ? 259  GLU A CB   1 
ATOM   854   C  CG   . GLU A  1 67  ? 202.923 67.156  43.231  1.00 96.00  ? 259  GLU A CG   1 
ATOM   855   C  CD   . GLU A  1 67  ? 202.562 65.785  43.775  1.00 101.82 ? 259  GLU A CD   1 
ATOM   856   O  OE1  . GLU A  1 67  ? 201.959 65.711  44.867  1.00 100.13 ? 259  GLU A OE1  1 
ATOM   857   O  OE2  . GLU A  1 67  ? 202.883 64.780  43.104  1.00 104.10 ? 259  GLU A OE2  1 
ATOM   858   H  H    . GLU A  1 67  ? 202.919 66.826  46.161  1.00 107.67 ? 259  GLU A H    1 
ATOM   859   H  HA   . GLU A  1 67  ? 204.595 68.373  44.890  1.00 106.69 ? 259  GLU A HA   1 
ATOM   860   H  HB2  . GLU A  1 67  ? 201.804 68.115  44.647  1.00 108.97 ? 259  GLU A HB2  1 
ATOM   861   H  HB3  . GLU A  1 67  ? 202.618 69.116  43.725  1.00 108.97 ? 259  GLU A HB3  1 
ATOM   862   H  HG2  . GLU A  1 67  ? 202.393 67.310  42.433  1.00 114.95 ? 259  GLU A HG2  1 
ATOM   863   H  HG3  . GLU A  1 67  ? 203.866 67.149  43.006  1.00 114.95 ? 259  GLU A HG3  1 
ATOM   864   N  N    . ALA A  1 68  ? 202.729 69.891  46.996  1.00 77.85  ? 260  ALA A N    1 
ATOM   865   C  CA   . ALA A  1 68  ? 202.581 71.152  47.716  1.00 74.43  ? 260  ALA A CA   1 
ATOM   866   C  C    . ALA A  1 68  ? 203.847 71.494  48.491  1.00 76.05  ? 260  ALA A C    1 
ATOM   867   O  O    . ALA A  1 68  ? 204.301 72.643  48.476  1.00 76.88  ? 260  ALA A O    1 
ATOM   868   C  CB   . ALA A  1 68  ? 201.380 71.080  48.657  1.00 73.55  ? 260  ALA A CB   1 
ATOM   869   H  H    . ALA A  1 68  ? 202.208 69.262  47.264  1.00 93.17  ? 260  ALA A H    1 
ATOM   870   H  HA   . ALA A  1 68  ? 202.419 71.864  47.077  1.00 89.07  ? 260  ALA A HA   1 
ATOM   871   H  HB1  . ALA A  1 68  ? 201.296 71.925  49.127  1.00 88.01  ? 260  ALA A HB1  1 
ATOM   872   H  HB2  . ALA A  1 68  ? 200.580 70.911  48.136  1.00 88.01  ? 260  ALA A HB2  1 
ATOM   873   H  HB3  . ALA A  1 68  ? 201.520 70.361  49.293  1.00 88.01  ? 260  ALA A HB3  1 
ATOM   874   N  N    . LYS A  1 69  ? 204.432 70.508  49.175  1.00 88.31  ? 261  LYS A N    1 
ATOM   875   C  CA   . LYS A  1 69  ? 205.659 70.759  49.924  1.00 90.97  ? 261  LYS A CA   1 
ATOM   876   C  C    . LYS A  1 69  ? 206.785 71.193  48.995  1.00 91.15  ? 261  LYS A C    1 
ATOM   877   O  O    . LYS A  1 69  ? 207.529 72.132  49.303  1.00 91.28  ? 261  LYS A O    1 
ATOM   878   C  CB   . LYS A  1 69  ? 206.055 69.508  50.711  1.00 97.27  ? 261  LYS A CB   1 
ATOM   879   C  CG   . LYS A  1 69  ? 207.364 69.628  51.483  1.00 103.23 ? 261  LYS A CG   1 
ATOM   880   C  CD   . LYS A  1 69  ? 207.711 68.320  52.180  1.00 111.11 ? 261  LYS A CD   1 
ATOM   881   C  CE   . LYS A  1 69  ? 209.051 68.398  52.897  1.00 114.19 ? 261  LYS A CE   1 
ATOM   882   N  NZ   . LYS A  1 69  ? 209.412 67.109  53.553  1.00 118.25 ? 261  LYS A NZ   1 
ATOM   883   H  H    . LYS A  1 69  ? 204.143 69.699  49.219  1.00 105.72 ? 261  LYS A H    1 
ATOM   884   H  HA   . LYS A  1 69  ? 205.501 71.475  50.559  1.00 108.92 ? 261  LYS A HA   1 
ATOM   885   H  HB2  . LYS A  1 69  ? 205.353 69.311  51.352  1.00 116.48 ? 261  LYS A HB2  1 
ATOM   886   H  HB3  . LYS A  1 69  ? 206.147 68.768  50.091  1.00 116.48 ? 261  LYS A HB3  1 
ATOM   887   H  HG2  . LYS A  1 69  ? 208.081 69.846  50.868  1.00 123.63 ? 261  LYS A HG2  1 
ATOM   888   H  HG3  . LYS A  1 69  ? 207.276 70.320  52.158  1.00 123.63 ? 261  LYS A HG3  1 
ATOM   889   H  HD2  . LYS A  1 69  ? 207.028 68.117  52.838  1.00 133.08 ? 261  LYS A HD2  1 
ATOM   890   H  HD3  . LYS A  1 69  ? 207.762 67.611  51.520  1.00 133.08 ? 261  LYS A HD3  1 
ATOM   891   H  HE2  . LYS A  1 69  ? 209.745 68.614  52.254  1.00 136.78 ? 261  LYS A HE2  1 
ATOM   892   H  HE3  . LYS A  1 69  ? 209.006 69.083  53.582  1.00 136.78 ? 261  LYS A HE3  1 
ATOM   893   H  HZ1  . LYS A  1 69  ? 210.198 67.186  53.963  1.00 141.66 ? 261  LYS A HZ1  1 
ATOM   894   H  HZ2  . LYS A  1 69  ? 208.793 66.890  54.154  1.00 141.66 ? 261  LYS A HZ2  1 
ATOM   895   H  HZ3  . LYS A  1 69  ? 209.465 66.462  52.944  1.00 141.66 ? 261  LYS A HZ3  1 
ATOM   896   N  N    . SER A  1 70  ? 206.927 70.523  47.849  1.00 90.45  ? 262  SER A N    1 
ATOM   897   C  CA   . SER A  1 70  ? 207.949 70.918  46.886  1.00 90.21  ? 262  SER A CA   1 
ATOM   898   C  C    . SER A  1 70  ? 207.685 72.320  46.353  1.00 90.74  ? 262  SER A C    1 
ATOM   899   O  O    . SER A  1 70  ? 208.608 73.135  46.238  1.00 92.76  ? 262  SER A O    1 
ATOM   900   C  CB   . SER A  1 70  ? 207.995 69.915  45.734  1.00 90.71  ? 262  SER A CB   1 
ATOM   901   O  OG   . SER A  1 70  ? 209.166 70.086  44.956  1.00 95.95  ? 262  SER A OG   1 
ATOM   902   H  H    . SER A  1 70  ? 206.451 69.848  47.611  1.00 108.30 ? 262  SER A H    1 
ATOM   903   H  HA   . SER A  1 70  ? 208.815 70.919  47.322  1.00 108.00 ? 262  SER A HA   1 
ATOM   904   H  HB2  . SER A  1 70  ? 207.988 69.016  46.099  1.00 108.60 ? 262  SER A HB2  1 
ATOM   905   H  HB3  . SER A  1 70  ? 207.219 70.048  45.168  1.00 108.60 ? 262  SER A HB3  1 
ATOM   906   H  HG   . SER A  1 70  ? 209.185 70.861  44.632  1.00 114.89 ? 262  SER A HG   1 
ATOM   907   N  N    . PHE A  1 71  ? 206.426 72.620  46.027  1.00 85.26  ? 263  PHE A N    1 
ATOM   908   C  CA   . PHE A  1 71  ? 206.077 73.944  45.525  1.00 80.92  ? 263  PHE A CA   1 
ATOM   909   C  C    . PHE A  1 71  ? 206.398 75.024  46.553  1.00 79.65  ? 263  PHE A C    1 
ATOM   910   O  O    . PHE A  1 71  ? 206.917 76.090  46.203  1.00 79.88  ? 263  PHE A O    1 
ATOM   911   C  CB   . PHE A  1 71  ? 204.596 73.971  45.149  1.00 79.27  ? 263  PHE A CB   1 
ATOM   912   C  CG   . PHE A  1 71  ? 204.145 75.259  44.528  1.00 77.05  ? 263  PHE A CG   1 
ATOM   913   C  CD1  . PHE A  1 71  ? 204.319 75.485  43.174  1.00 78.93  ? 263  PHE A CD1  1 
ATOM   914   C  CD2  . PHE A  1 71  ? 203.532 76.235  45.293  1.00 76.75  ? 263  PHE A CD2  1 
ATOM   915   C  CE1  . PHE A  1 71  ? 203.900 76.666  42.596  1.00 80.25  ? 263  PHE A CE1  1 
ATOM   916   C  CE2  . PHE A  1 71  ? 203.110 77.419  44.721  1.00 77.22  ? 263  PHE A CE2  1 
ATOM   917   C  CZ   . PHE A  1 71  ? 203.293 77.634  43.370  1.00 78.49  ? 263  PHE A CZ   1 
ATOM   918   H  H    . PHE A  1 71  ? 205.762 72.076  46.087  1.00 102.07 ? 263  PHE A H    1 
ATOM   919   H  HA   . PHE A  1 71  ? 206.594 74.127  44.725  1.00 96.85  ? 263  PHE A HA   1 
ATOM   920   H  HB2  . PHE A  1 71  ? 204.423 73.260  44.512  1.00 94.88  ? 263  PHE A HB2  1 
ATOM   921   H  HB3  . PHE A  1 71  ? 204.068 73.828  45.950  1.00 94.88  ? 263  PHE A HB3  1 
ATOM   922   H  HD1  . PHE A  1 71  ? 204.727 74.836  42.648  1.00 94.47  ? 263  PHE A HD1  1 
ATOM   923   H  HD2  . PHE A  1 71  ? 203.406 76.094  46.204  1.00 91.85  ? 263  PHE A HD2  1 
ATOM   924   H  HE1  . PHE A  1 71  ? 204.025 76.809  41.685  1.00 96.05  ? 263  PHE A HE1  1 
ATOM   925   H  HE2  . PHE A  1 71  ? 202.702 78.069  45.245  1.00 92.41  ? 263  PHE A HE2  1 
ATOM   926   H  HZ   . PHE A  1 71  ? 203.010 78.431  42.983  1.00 93.95  ? 263  PHE A HZ   1 
ATOM   927   N  N    . PHE A  1 72  ? 206.102 74.763  47.828  1.00 77.02  ? 264  PHE A N    1 
ATOM   928   C  CA   . PHE A  1 72  ? 206.388 75.739  48.875  1.00 76.83  ? 264  PHE A CA   1 
ATOM   929   C  C    . PHE A  1 72  ? 207.888 75.968  49.008  1.00 80.65  ? 264  PHE A C    1 
ATOM   930   O  O    . PHE A  1 72  ? 208.355 77.112  49.051  1.00 77.79  ? 264  PHE A O    1 
ATOM   931   C  CB   . PHE A  1 72  ? 205.795 75.265  50.202  1.00 75.25  ? 264  PHE A CB   1 
ATOM   932   C  CG   . PHE A  1 72  ? 205.744 76.330  51.257  1.00 73.87  ? 264  PHE A CG   1 
ATOM   933   C  CD1  . PHE A  1 72  ? 206.839 76.579  52.067  1.00 73.62  ? 264  PHE A CD1  1 
ATOM   934   C  CD2  . PHE A  1 72  ? 204.597 77.083  51.438  1.00 75.01  ? 264  PHE A CD2  1 
ATOM   935   C  CE1  . PHE A  1 72  ? 206.792 77.563  53.037  1.00 74.73  ? 264  PHE A CE1  1 
ATOM   936   C  CE2  . PHE A  1 72  ? 204.543 78.067  52.406  1.00 74.16  ? 264  PHE A CE2  1 
ATOM   937   C  CZ   . PHE A  1 72  ? 205.642 78.307  53.207  1.00 72.10  ? 264  PHE A CZ   1 
ATOM   938   H  H    . PHE A  1 72  ? 205.739 74.035  48.109  1.00 92.18  ? 264  PHE A H    1 
ATOM   939   H  HA   . PHE A  1 72  ? 205.973 76.585  48.644  1.00 91.94  ? 264  PHE A HA   1 
ATOM   940   H  HB2  . PHE A  1 72  ? 204.889 74.956  50.048  1.00 90.05  ? 264  PHE A HB2  1 
ATOM   941   H  HB3  . PHE A  1 72  ? 206.337 74.536  50.544  1.00 90.05  ? 264  PHE A HB3  1 
ATOM   942   H  HD1  . PHE A  1 72  ? 207.617 76.081  51.956  1.00 88.10  ? 264  PHE A HD1  1 
ATOM   943   H  HD2  . PHE A  1 72  ? 203.854 76.926  50.901  1.00 89.77  ? 264  PHE A HD2  1 
ATOM   944   H  HE1  . PHE A  1 72  ? 207.533 77.722  53.576  1.00 89.43  ? 264  PHE A HE1  1 
ATOM   945   H  HE2  . PHE A  1 72  ? 203.767 78.567  52.519  1.00 88.75  ? 264  PHE A HE2  1 
ATOM   946   H  HZ   . PHE A  1 72  ? 205.607 78.968  53.860  1.00 86.27  ? 264  PHE A HZ   1 
ATOM   947   N  N    . GLU A  1 73  ? 208.659 74.881  49.087  1.00 91.69  ? 265  GLU A N    1 
ATOM   948   C  CA   . GLU A  1 73  ? 210.108 74.992  49.228  1.00 94.19  ? 265  GLU A CA   1 
ATOM   949   C  C    . GLU A  1 73  ? 210.707 75.837  48.113  1.00 90.53  ? 265  GLU A C    1 
ATOM   950   O  O    . GLU A  1 73  ? 211.637 76.620  48.343  1.00 90.91  ? 265  GLU A O    1 
ATOM   951   C  CB   . GLU A  1 73  ? 210.735 73.599  49.237  1.00 103.68 ? 265  GLU A CB   1 
ATOM   952   C  CG   . GLU A  1 73  ? 210.718 72.922  50.596  1.00 111.94 ? 265  GLU A CG   1 
ATOM   953   C  CD   . GLU A  1 73  ? 211.222 71.494  50.543  1.00 119.90 ? 265  GLU A CD   1 
ATOM   954   O  OE1  . GLU A  1 73  ? 212.210 71.234  49.823  1.00 123.11 ? 265  GLU A OE1  1 
ATOM   955   O  OE2  . GLU A  1 73  ? 210.631 70.630  51.225  1.00 119.78 ? 265  GLU A OE2  1 
ATOM   956   H  H    . GLU A  1 73  ? 208.368 74.072  49.061  1.00 109.78 ? 265  GLU A H    1 
ATOM   957   H  HA   . GLU A  1 73  ? 210.313 75.421  50.074  1.00 112.78 ? 265  GLU A HA   1 
ATOM   958   H  HB2  . GLU A  1 73  ? 210.246 73.033  48.619  1.00 124.16 ? 265  GLU A HB2  1 
ATOM   959   H  HB3  . GLU A  1 73  ? 211.660 73.671  48.955  1.00 124.16 ? 265  GLU A HB3  1 
ATOM   960   H  HG2  . GLU A  1 73  ? 211.287 73.419  51.204  1.00 134.09 ? 265  GLU A HG2  1 
ATOM   961   H  HG3  . GLU A  1 73  ? 209.807 72.907  50.930  1.00 134.09 ? 265  GLU A HG3  1 
ATOM   962   N  N    . LYS A  1 74  ? 210.191 75.684  46.895  1.00 85.98  ? 266  LYS A N    1 
ATOM   963   C  CA   . LYS A  1 74  ? 210.814 76.283  45.723  1.00 87.78  ? 266  LYS A CA   1 
ATOM   964   C  C    . LYS A  1 74  ? 210.572 77.785  45.628  1.00 84.25  ? 266  LYS A C    1 
ATOM   965   O  O    . LYS A  1 74  ? 211.427 78.509  45.106  1.00 86.55  ? 266  LYS A O    1 
ATOM   966   C  CB   . LYS A  1 74  ? 210.272 75.597  44.463  1.00 91.13  ? 266  LYS A CB   1 
ATOM   967   C  CG   . LYS A  1 74  ? 210.821 76.110  43.136  1.00 93.98  ? 266  LYS A CG   1 
ATOM   968   C  CD   . LYS A  1 74  ? 212.173 75.503  42.816  1.00 101.18 ? 266  LYS A CD   1 
ATOM   969   C  CE   . LYS A  1 74  ? 212.655 75.935  41.441  1.00 103.89 ? 266  LYS A CE   1 
ATOM   970   N  NZ   . LYS A  1 74  ? 211.769 75.424  40.357  1.00 106.79 ? 266  LYS A NZ   1 
ATOM   971   H  H    . LYS A  1 74  ? 209.479 75.235  46.723  1.00 102.93 ? 266  LYS A H    1 
ATOM   972   H  HA   . LYS A  1 74  ? 211.772 76.134  45.760  1.00 105.09 ? 266  LYS A HA   1 
ATOM   973   H  HB2  . LYS A  1 74  ? 210.481 74.652  44.517  1.00 109.11 ? 266  LYS A HB2  1 
ATOM   974   H  HB3  . LYS A  1 74  ? 209.309 75.714  44.442  1.00 109.11 ? 266  LYS A HB3  1 
ATOM   975   H  HG2  . LYS A  1 74  ? 210.206 75.874  42.424  1.00 112.53 ? 266  LYS A HG2  1 
ATOM   976   H  HG3  . LYS A  1 74  ? 210.925 77.073  43.184  1.00 112.53 ? 266  LYS A HG3  1 
ATOM   977   H  HD2  . LYS A  1 74  ? 212.822 75.798  43.474  1.00 121.17 ? 266  LYS A HD2  1 
ATOM   978   H  HD3  . LYS A  1 74  ? 212.101 74.535  42.824  1.00 121.17 ? 266  LYS A HD3  1 
ATOM   979   H  HE2  . LYS A  1 74  ? 212.662 76.904  41.396  1.00 124.42 ? 266  LYS A HE2  1 
ATOM   980   H  HE3  . LYS A  1 74  ? 213.548 75.587  41.292  1.00 124.42 ? 266  LYS A HE3  1 
ATOM   981   H  HZ1  . LYS A  1 74  ? 212.074 75.691  39.564  1.00 127.90 ? 266  LYS A HZ1  1 
ATOM   982   H  HZ2  . LYS A  1 74  ? 211.750 74.535  40.374  1.00 127.90 ? 266  LYS A HZ2  1 
ATOM   983   H  HZ3  . LYS A  1 74  ? 210.942 75.734  40.468  1.00 127.90 ? 266  LYS A HZ3  1 
ATOM   984   N  N    . PHE A  1 75  ? 209.436 78.276  46.129  1.00 79.35  ? 267  PHE A N    1 
ATOM   985   C  CA   . PHE A  1 75  ? 209.019 79.646  45.859  1.00 77.34  ? 267  PHE A CA   1 
ATOM   986   C  C    . PHE A  1 75  ? 208.710 80.497  47.083  1.00 74.33  ? 267  PHE A C    1 
ATOM   987   O  O    . PHE A  1 75  ? 208.508 81.705  46.922  1.00 72.96  ? 267  PHE A O    1 
ATOM   988   C  CB   . PHE A  1 75  ? 207.785 79.632  44.945  1.00 78.19  ? 267  PHE A CB   1 
ATOM   989   C  CG   . PHE A  1 75  ? 208.048 79.019  43.598  1.00 79.96  ? 267  PHE A CG   1 
ATOM   990   C  CD1  . PHE A  1 75  ? 209.106 79.454  42.818  1.00 79.28  ? 267  PHE A CD1  1 
ATOM   991   C  CD2  . PHE A  1 75  ? 207.265 77.977  43.134  1.00 81.17  ? 267  PHE A CD2  1 
ATOM   992   C  CE1  . PHE A  1 75  ? 209.357 78.884  41.586  1.00 81.89  ? 267  PHE A CE1  1 
ATOM   993   C  CE2  . PHE A  1 75  ? 207.513 77.401  41.905  1.00 81.46  ? 267  PHE A CE2  1 
ATOM   994   C  CZ   . PHE A  1 75  ? 208.564 77.853  41.132  1.00 83.72  ? 267  PHE A CZ   1 
ATOM   995   H  H    . PHE A  1 75  ? 208.892 77.834  46.628  1.00 94.97  ? 267  PHE A H    1 
ATOM   996   H  HA   . PHE A  1 75  ? 209.733 80.090  45.374  1.00 92.56  ? 267  PHE A HA   1 
ATOM   997   H  HB2  . PHE A  1 75  ? 207.083 79.119  45.374  1.00 93.58  ? 267  PHE A HB2  1 
ATOM   998   H  HB3  . PHE A  1 75  ? 207.489 80.545  44.805  1.00 93.58  ? 267  PHE A HB3  1 
ATOM   999   H  HD1  . PHE A  1 75  ? 209.644 80.150  43.120  1.00 94.88  ? 267  PHE A HD1  1 
ATOM   1000  H  HD2  . PHE A  1 75  ? 206.556 77.669  43.651  1.00 97.16  ? 267  PHE A HD2  1 
ATOM   1001  H  HE1  . PHE A  1 75  ? 210.066 79.190  41.067  1.00 98.02  ? 267  PHE A HE1  1 
ATOM   1002  H  HE2  . PHE A  1 75  ? 206.975 76.707  41.599  1.00 97.51  ? 267  PHE A HE2  1 
ATOM   1003  H  HZ   . PHE A  1 75  ? 208.731 77.467  40.303  1.00 100.22 ? 267  PHE A HZ   1 
ATOM   1004  N  N    . HIS A  1 76  ? 208.664 79.931  48.291  1.00 73.71  ? 268  HIS A N    1 
ATOM   1005  C  CA   . HIS A  1 76  ? 208.287 80.744  49.442  1.00 73.65  ? 268  HIS A CA   1 
ATOM   1006  C  C    . HIS A  1 76  ? 209.343 81.799  49.745  1.00 74.77  ? 268  HIS A C    1 
ATOM   1007  O  O    . HIS A  1 76  ? 209.016 82.868  50.271  1.00 77.36  ? 268  HIS A O    1 
ATOM   1008  C  CB   . HIS A  1 76  ? 208.046 79.860  50.667  1.00 74.28  ? 268  HIS A CB   1 
ATOM   1009  C  CG   . HIS A  1 76  ? 209.299 79.410  51.349  1.00 74.14  ? 268  HIS A CG   1 
ATOM   1010  N  ND1  . HIS A  1 76  ? 209.969 78.260  50.994  1.00 79.11  ? 268  HIS A ND1  1 
ATOM   1011  C  CD2  . HIS A  1 76  ? 209.995 79.949  52.378  1.00 76.34  ? 268  HIS A CD2  1 
ATOM   1012  C  CE1  . HIS A  1 76  ? 211.031 78.116  51.767  1.00 79.68  ? 268  HIS A CE1  1 
ATOM   1013  N  NE2  . HIS A  1 76  ? 211.070 79.128  52.614  1.00 78.35  ? 268  HIS A NE2  1 
ATOM   1014  H  H    . HIS A  1 76  ? 208.841 79.107  48.464  1.00 88.21  ? 268  HIS A H    1 
ATOM   1015  H  HA   . HIS A  1 76  ? 207.457 81.204  49.241  1.00 88.13  ? 268  HIS A HA   1 
ATOM   1016  H  HB2  . HIS A  1 76  ? 207.520 80.358  51.313  1.00 88.89  ? 268  HIS A HB2  1 
ATOM   1017  H  HB3  . HIS A  1 76  ? 207.559 79.067  50.390  1.00 88.89  ? 268  HIS A HB3  1 
ATOM   1018  H  HD1  . HIS A  1 76  ? 209.736 77.723  50.364  1.00 94.68  ? 268  HIS A HD1  1 
ATOM   1019  H  HD2  . HIS A  1 76  ? 209.789 80.734  52.833  1.00 91.35  ? 268  HIS A HD2  1 
ATOM   1020  H  HE1  . HIS A  1 76  ? 211.646 77.419  51.723  1.00 95.37  ? 268  HIS A HE1  1 
ATOM   1021  N  N    . GLY A  1 77  ? 210.605 81.525  49.413  1.00 71.06  ? 269  GLY A N    1 
ATOM   1022  C  CA   . GLY A  1 77  ? 211.668 82.493  49.609  1.00 74.94  ? 269  GLY A CA   1 
ATOM   1023  C  C    . GLY A  1 77  ? 211.687 83.625  48.606  1.00 76.80  ? 269  GLY A C    1 
ATOM   1024  O  O    . GLY A  1 77  ? 212.404 84.608  48.816  1.00 77.39  ? 269  GLY A O    1 
ATOM   1025  H  H    . GLY A  1 77  ? 210.867 80.780  49.072  1.00 85.03  ? 269  GLY A H    1 
ATOM   1026  H  HA2  . GLY A  1 77  ? 211.582 82.880  50.494  1.00 89.68  ? 269  GLY A HA2  1 
ATOM   1027  H  HA3  . GLY A  1 77  ? 212.522 82.037  49.562  1.00 89.68  ? 269  GLY A HA3  1 
ATOM   1028  N  N    . ASP A  1 78  ? 210.926 83.506  47.518  1.00 85.34  ? 270  ASP A N    1 
ATOM   1029  C  CA   . ASP A  1 78  ? 210.848 84.546  46.502  1.00 85.61  ? 270  ASP A CA   1 
ATOM   1030  C  C    . ASP A  1 78  ? 209.807 85.610  46.816  1.00 83.13  ? 270  ASP A C    1 
ATOM   1031  O  O    . ASP A  1 78  ? 209.757 86.628  46.117  1.00 85.78  ? 270  ASP A O    1 
ATOM   1032  C  CB   . ASP A  1 78  ? 210.517 83.925  45.140  1.00 90.51  ? 270  ASP A CB   1 
ATOM   1033  C  CG   . ASP A  1 78  ? 211.529 82.881  44.712  1.00 98.06  ? 270  ASP A CG   1 
ATOM   1034  O  OD1  . ASP A  1 78  ? 212.561 82.733  45.400  1.00 100.43 ? 270  ASP A OD1  1 
ATOM   1035  O  OD2  . ASP A  1 78  ? 211.285 82.203  43.692  1.00 99.41  ? 270  ASP A OD2  1 
ATOM   1036  H  H    . ASP A  1 78  ? 210.439 82.818  47.346  1.00 102.15 ? 270  ASP A H    1 
ATOM   1037  H  HA   . ASP A  1 78  ? 211.711 84.983  46.431  1.00 102.49 ? 270  ASP A HA   1 
ATOM   1038  H  HB2  . ASP A  1 78  ? 209.648 83.498  45.190  1.00 108.37 ? 270  ASP A HB2  1 
ATOM   1039  H  HB3  . ASP A  1 78  ? 210.505 84.625  44.468  1.00 108.37 ? 270  ASP A HB3  1 
ATOM   1040  N  N    . GLN A  1 79  ? 208.986 85.409  47.841  1.00 81.32  ? 271  GLN A N    1 
ATOM   1041  C  CA   . GLN A  1 79  ? 207.910 86.338  48.139  1.00 76.68  ? 271  GLN A CA   1 
ATOM   1042  C  C    . GLN A  1 79  ? 208.438 87.539  48.916  1.00 74.29  ? 271  GLN A C    1 
ATOM   1043  O  O    . GLN A  1 79  ? 209.514 87.502  49.520  1.00 76.03  ? 271  GLN A O    1 
ATOM   1044  C  CB   . GLN A  1 79  ? 206.808 85.640  48.937  1.00 71.91  ? 271  GLN A CB   1 
ATOM   1045  C  CG   . GLN A  1 79  ? 206.304 84.358  48.291  1.00 75.14  ? 271  GLN A CG   1 
ATOM   1046  C  CD   . GLN A  1 79  ? 205.896 84.550  46.843  1.00 75.35  ? 271  GLN A CD   1 
ATOM   1047  O  OE1  . GLN A  1 79  ? 205.219 85.520  46.499  1.00 72.68  ? 271  GLN A OE1  1 
ATOM   1048  N  NE2  . GLN A  1 79  ? 206.331 83.637  45.981  1.00 72.91  ? 271  GLN A NE2  1 
ATOM   1049  H  H    . GLN A  1 79  ? 209.033 84.740  48.379  1.00 97.33  ? 271  GLN A H    1 
ATOM   1050  H  HA   . GLN A  1 79  ? 207.526 86.660  47.308  1.00 91.77  ? 271  GLN A HA   1 
ATOM   1051  H  HB2  . GLN A  1 79  ? 207.152 85.414  49.815  1.00 86.04  ? 271  GLN A HB2  1 
ATOM   1052  H  HB3  . GLN A  1 79  ? 206.054 86.244  49.024  1.00 86.04  ? 271  GLN A HB3  1 
ATOM   1053  H  HG2  . GLN A  1 79  ? 207.009 83.693  48.319  1.00 89.92  ? 271  GLN A HG2  1 
ATOM   1054  H  HG3  . GLN A  1 79  ? 205.529 84.041  48.781  1.00 89.92  ? 271  GLN A HG3  1 
ATOM   1055  H  HE21 . GLN A  1 79  ? 206.806 82.976  46.259  1.00 87.25  ? 271  GLN A HE21 1 
ATOM   1056  H  HE22 . GLN A  1 79  ? 206.129 83.701  45.148  1.00 87.25  ? 271  GLN A HE22 1 
ATOM   1057  N  N    . GLU A  1 80  ? 207.660 88.618  48.890  1.00 72.69  ? 272  GLU A N    1 
ATOM   1058  C  CA   . GLU A  1 80  ? 208.045 89.836  49.585  1.00 73.17  ? 272  GLU A CA   1 
ATOM   1059  C  C    . GLU A  1 80  ? 208.213 89.560  51.075  1.00 74.82  ? 272  GLU A C    1 
ATOM   1060  O  O    . GLU A  1 80  ? 207.563 88.680  51.646  1.00 76.20  ? 272  GLU A O    1 
ATOM   1061  C  CB   . GLU A  1 80  ? 206.995 90.924  49.370  1.00 74.40  ? 272  GLU A CB   1 
ATOM   1062  C  CG   . GLU A  1 80  ? 206.814 91.342  47.915  1.00 78.63  ? 272  GLU A CG   1 
ATOM   1063  C  CD   . GLU A  1 80  ? 207.934 92.229  47.401  1.00 86.96  ? 272  GLU A CD   1 
ATOM   1064  O  OE1  . GLU A  1 80  ? 208.811 92.615  48.202  1.00 89.70  ? 272  GLU A OE1  1 
ATOM   1065  O  OE2  . GLU A  1 80  ? 207.933 92.541  46.191  1.00 89.49  ? 272  GLU A OE2  1 
ATOM   1066  H  H    . GLU A  1 80  ? 206.907 88.668  48.477  1.00 86.98  ? 272  GLU A H    1 
ATOM   1067  H  HA   . GLU A  1 80  ? 208.892 90.154  49.235  1.00 87.56  ? 272  GLU A HA   1 
ATOM   1068  H  HB2  . GLU A  1 80  ? 206.139 90.599  49.692  1.00 89.03  ? 272  GLU A HB2  1 
ATOM   1069  H  HB3  . GLU A  1 80  ? 207.255 91.712  49.873  1.00 89.03  ? 272  GLU A HB3  1 
ATOM   1070  H  HG2  . GLU A  1 80  ? 206.786 90.546  47.361  1.00 94.10  ? 272  GLU A HG2  1 
ATOM   1071  H  HG3  . GLU A  1 80  ? 205.982 91.833  47.830  1.00 94.10  ? 272  GLU A HG3  1 
ATOM   1072  N  N    . CYS A  1 81  ? 209.103 90.328  51.707  1.00 70.76  ? 273  CYS A N    1 
ATOM   1073  C  CA   . CYS A  1 81  ? 209.385 90.117  53.123  1.00 77.93  ? 273  CYS A CA   1 
ATOM   1074  C  C    . CYS A  1 81  ? 208.161 90.383  53.992  1.00 71.49  ? 273  CYS A C    1 
ATOM   1075  O  O    . CYS A  1 81  ? 208.045 89.810  55.081  1.00 71.05  ? 273  CYS A O    1 
ATOM   1076  C  CB   . CYS A  1 81  ? 210.556 90.996  53.564  1.00 88.39  ? 273  CYS A CB   1 
ATOM   1077  S  SG   . CYS A  1 81  ? 210.330 92.762  53.251  1.00 101.72 ? 273  CYS A SG   1 
ATOM   1078  H  H    . CYS A  1 81  ? 209.550 90.966  51.343  1.00 84.66  ? 273  CYS A H    1 
ATOM   1079  H  HA   . CYS A  1 81  ? 209.644 89.192  53.254  1.00 93.26  ? 273  CYS A HA   1 
ATOM   1080  H  HB2  . CYS A  1 81  ? 210.688 90.881  54.518  1.00 105.82 ? 273  CYS A HB2  1 
ATOM   1081  H  HB3  . CYS A  1 81  ? 211.353 90.712  53.088  1.00 105.82 ? 273  CYS A HB3  1 
ATOM   1082  H  HG   . CYS A  1 81  ? 211.302 93.354  53.632  1.00 121.82 ? 273  CYS A HG   1 
ATOM   1083  N  N    . TYR A  1 82  ? 207.244 91.244  53.546  1.00 73.50  ? 274  TYR A N    1 
ATOM   1084  C  CA   . TYR A  1 82  ? 206.080 91.564  54.367  1.00 67.71  ? 274  TYR A CA   1 
ATOM   1085  C  C    . TYR A  1 82  ? 204.989 90.501  54.302  1.00 67.19  ? 274  TYR A C    1 
ATOM   1086  O  O    . TYR A  1 82  ? 203.927 90.696  54.901  1.00 70.11  ? 274  TYR A O    1 
ATOM   1087  C  CB   . TYR A  1 82  ? 205.486 92.931  53.990  1.00 65.07  ? 274  TYR A CB   1 
ATOM   1088  C  CG   . TYR A  1 82  ? 205.379 93.250  52.513  1.00 65.15  ? 274  TYR A CG   1 
ATOM   1089  C  CD1  . TYR A  1 82  ? 204.323 92.771  51.746  1.00 68.67  ? 274  TYR A CD1  1 
ATOM   1090  C  CD2  . TYR A  1 82  ? 206.311 94.075  51.898  1.00 65.77  ? 274  TYR A CD2  1 
ATOM   1091  C  CE1  . TYR A  1 82  ? 204.221 93.081  50.399  1.00 71.36  ? 274  TYR A CE1  1 
ATOM   1092  C  CE2  . TYR A  1 82  ? 206.215 94.390  50.556  1.00 64.20  ? 274  TYR A CE2  1 
ATOM   1093  C  CZ   . TYR A  1 82  ? 205.170 93.893  49.812  1.00 69.55  ? 274  TYR A CZ   1 
ATOM   1094  O  OH   . TYR A  1 82  ? 205.077 94.211  48.475  1.00 71.20  ? 274  TYR A OH   1 
ATOM   1095  H  H    . TYR A  1 82  ? 207.272 91.648  52.787  1.00 87.95  ? 274  TYR A H    1 
ATOM   1096  H  HA   . TYR A  1 82  ? 206.369 91.621  55.291  1.00 81.01  ? 274  TYR A HA   1 
ATOM   1097  H  HB2  . TYR A  1 82  ? 204.590 92.983  54.359  1.00 77.84  ? 274  TYR A HB2  1 
ATOM   1098  H  HB3  . TYR A  1 82  ? 206.037 93.620  54.392  1.00 77.84  ? 274  TYR A HB3  1 
ATOM   1099  H  HD1  . TYR A  1 82  ? 203.684 92.222  52.140  1.00 82.16  ? 274  TYR A HD1  1 
ATOM   1100  H  HD2  . TYR A  1 82  ? 207.020 94.412  52.396  1.00 78.68  ? 274  TYR A HD2  1 
ATOM   1101  H  HE1  . TYR A  1 82  ? 203.515 92.746  49.895  1.00 85.39  ? 274  TYR A HE1  1 
ATOM   1102  H  HE2  . TYR A  1 82  ? 206.853 94.937  50.158  1.00 76.80  ? 274  TYR A HE2  1 
ATOM   1103  H  HH   . TYR A  1 82  ? 205.716 94.708  48.253  1.00 85.19  ? 274  TYR A HH   1 
ATOM   1104  N  N    . TYR A  1 83  ? 205.220 89.388  53.608  1.00 67.16  ? 275  TYR A N    1 
ATOM   1105  C  CA   . TYR A  1 83  ? 204.338 88.231  53.674  1.00 67.46  ? 275  TYR A CA   1 
ATOM   1106  C  C    . TYR A  1 83  ? 204.926 87.111  54.527  1.00 72.99  ? 275  TYR A C    1 
ATOM   1107  O  O    . TYR A  1 83  ? 204.403 85.992  54.513  1.00 72.37  ? 275  TYR A O    1 
ATOM   1108  C  CB   . TYR A  1 83  ? 204.032 87.711  52.266  1.00 65.82  ? 275  TYR A CB   1 
ATOM   1109  C  CG   . TYR A  1 83  ? 203.295 88.700  51.386  1.00 65.03  ? 275  TYR A CG   1 
ATOM   1110  C  CD1  . TYR A  1 83  ? 202.070 89.228  51.773  1.00 62.13  ? 275  TYR A CD1  1 
ATOM   1111  C  CD2  . TYR A  1 83  ? 203.814 89.086  50.158  1.00 66.37  ? 275  TYR A CD2  1 
ATOM   1112  C  CE1  . TYR A  1 83  ? 201.392 90.126  50.969  1.00 63.79  ? 275  TYR A CE1  1 
ATOM   1113  C  CE2  . TYR A  1 83  ? 203.141 89.983  49.347  1.00 67.90  ? 275  TYR A CE2  1 
ATOM   1114  C  CZ   . TYR A  1 83  ? 201.930 90.498  49.758  1.00 69.10  ? 275  TYR A CZ   1 
ATOM   1115  O  OH   . TYR A  1 83  ? 201.255 91.390  48.954  1.00 68.78  ? 275  TYR A OH   1 
ATOM   1116  H  H    . TYR A  1 83  ? 205.892 89.280  53.083  1.00 80.35  ? 275  TYR A H    1 
ATOM   1117  H  HA   . TYR A  1 83  ? 203.499 88.501  54.079  1.00 80.70  ? 275  TYR A HA   1 
ATOM   1118  H  HB2  . TYR A  1 83  ? 204.868 87.491  51.827  1.00 78.73  ? 275  TYR A HB2  1 
ATOM   1119  H  HB3  . TYR A  1 83  ? 203.482 86.915  52.341  1.00 78.73  ? 275  TYR A HB3  1 
ATOM   1120  H  HD1  . TYR A  1 83  ? 201.704 88.980  52.591  1.00 74.30  ? 275  TYR A HD1  1 
ATOM   1121  H  HD2  . TYR A  1 83  ? 204.631 88.741  49.878  1.00 79.40  ? 275  TYR A HD2  1 
ATOM   1122  H  HE1  . TYR A  1 83  ? 200.574 90.474  51.244  1.00 76.30  ? 275  TYR A HE1  1 
ATOM   1123  H  HE2  . TYR A  1 83  ? 203.503 90.236  48.528  1.00 81.24  ? 275  TYR A HE2  1 
ATOM   1124  H  HH   . TYR A  1 83  ? 201.691 91.528  48.250  1.00 82.29  ? 275  TYR A HH   1 
ATOM   1125  N  N    . GLN A  1 84  ? 206.006 87.392  55.262  1.00 84.14  ? 276  GLN A N    1 
ATOM   1126  C  CA   . GLN A  1 84  ? 206.675 86.373  56.067  1.00 88.26  ? 276  GLN A CA   1 
ATOM   1127  C  C    . GLN A  1 84  ? 205.701 85.640  56.984  1.00 89.49  ? 276  GLN A C    1 
ATOM   1128  O  O    . GLN A  1 84  ? 205.706 84.406  57.054  1.00 89.52  ? 276  GLN A O    1 
ATOM   1129  C  CB   . GLN A  1 84  ? 207.798 87.025  56.878  1.00 95.00  ? 276  GLN A CB   1 
ATOM   1130  C  CG   . GLN A  1 84  ? 208.264 86.229  58.091  1.00 102.89 ? 276  GLN A CG   1 
ATOM   1131  C  CD   . GLN A  1 84  ? 209.400 86.908  58.828  1.00 107.60 ? 276  GLN A CD   1 
ATOM   1132  O  OE1  . GLN A  1 84  ? 210.538 86.435  58.814  1.00 109.23 ? 276  GLN A OE1  1 
ATOM   1133  N  NE2  . GLN A  1 84  ? 209.097 88.025  59.479  1.00 109.64 ? 276  GLN A NE2  1 
ATOM   1134  H  H    . GLN A  1 84  ? 206.370 88.169  55.310  1.00 100.72 ? 276  GLN A H    1 
ATOM   1135  H  HA   . GLN A  1 84  ? 207.076 85.718  55.474  1.00 105.67 ? 276  GLN A HA   1 
ATOM   1136  H  HB2  . GLN A  1 84  ? 208.566 87.149  56.297  1.00 113.75 ? 276  GLN A HB2  1 
ATOM   1137  H  HB3  . GLN A  1 84  ? 207.488 87.887  57.195  1.00 113.75 ? 276  GLN A HB3  1 
ATOM   1138  H  HG2  . GLN A  1 84  ? 207.523 86.128  58.708  1.00 123.22 ? 276  GLN A HG2  1 
ATOM   1139  H  HG3  . GLN A  1 84  ? 208.574 85.357  57.798  1.00 123.22 ? 276  GLN A HG3  1 
ATOM   1140  H  HE21 . GLN A  1 84  ? 208.291 88.325  59.466  1.00 131.32 ? 276  GLN A HE21 1 
ATOM   1141  H  HE22 . GLN A  1 84  ? 209.707 88.449  59.913  1.00 131.32 ? 276  GLN A HE22 1 
ATOM   1142  N  N    . ASP A  1 85  ? 204.858 86.385  57.704  1.00 85.06  ? 277  ASP A N    1 
ATOM   1143  C  CA   . ASP A  1 85  ? 203.984 85.757  58.692  1.00 81.97  ? 277  ASP A CA   1 
ATOM   1144  C  C    . ASP A  1 85  ? 202.973 84.826  58.033  1.00 80.04  ? 277  ASP A C    1 
ATOM   1145  O  O    . ASP A  1 85  ? 202.699 83.738  58.551  1.00 82.33  ? 277  ASP A O    1 
ATOM   1146  C  CB   . ASP A  1 85  ? 203.276 86.825  59.525  1.00 86.19  ? 277  ASP A CB   1 
ATOM   1147  C  CG   . ASP A  1 85  ? 204.216 87.538  60.482  1.00 93.56  ? 277  ASP A CG   1 
ATOM   1148  O  OD1  . ASP A  1 85  ? 205.388 87.117  60.592  1.00 95.19  ? 277  ASP A OD1  1 
ATOM   1149  O  OD2  . ASP A  1 85  ? 203.779 88.514  61.130  1.00 93.38  ? 277  ASP A OD2  1 
ATOM   1150  H  H    . ASP A  1 85  ? 204.775 87.239  57.641  1.00 101.83 ? 277  ASP A H    1 
ATOM   1151  H  HA   . ASP A  1 85  ? 204.527 85.225  59.294  1.00 98.11  ? 277  ASP A HA   1 
ATOM   1152  H  HB2  . ASP A  1 85  ? 202.893 87.489  58.930  1.00 103.17 ? 277  ASP A HB2  1 
ATOM   1153  H  HB3  . ASP A  1 85  ? 202.576 86.405  60.049  1.00 103.17 ? 277  ASP A HB3  1 
ATOM   1154  N  N    . ASP A  1 86  ? 202.399 85.234  56.898  1.00 81.82  ? 278  ASP A N    1 
ATOM   1155  C  CA   . ASP A  1 86  ? 201.501 84.343  56.169  1.00 79.17  ? 278  ASP A CA   1 
ATOM   1156  C  C    . ASP A  1 86  ? 202.212 83.066  55.748  1.00 76.86  ? 278  ASP A C    1 
ATOM   1157  O  O    . ASP A  1 86  ? 201.629 81.977  55.789  1.00 79.20  ? 278  ASP A O    1 
ATOM   1158  C  CB   . ASP A  1 86  ? 200.938 85.047  54.939  1.00 81.05  ? 278  ASP A CB   1 
ATOM   1159  C  CG   . ASP A  1 86  ? 200.040 86.193  55.294  1.00 85.52  ? 278  ASP A CG   1 
ATOM   1160  O  OD1  . ASP A  1 86  ? 199.676 86.319  56.482  1.00 89.22  ? 278  ASP A OD1  1 
ATOM   1161  O  OD2  . ASP A  1 86  ? 199.683 86.974  54.387  1.00 86.53  ? 278  ASP A OD2  1 
ATOM   1162  H  H    . ASP A  1 86  ? 202.512 86.007  56.537  1.00 97.94  ? 278  ASP A H    1 
ATOM   1163  H  HA   . ASP A  1 86  ? 200.759 84.100  56.744  1.00 94.75  ? 278  ASP A HA   1 
ATOM   1164  H  HB2  . ASP A  1 86  ? 201.673 85.393  54.409  1.00 97.01  ? 278  ASP A HB2  1 
ATOM   1165  H  HB3  . ASP A  1 86  ? 200.423 84.411  54.419  1.00 97.01  ? 278  ASP A HB3  1 
ATOM   1166  N  N    . LEU A  1 87  ? 203.473 83.181  55.334  1.00 75.07  ? 279  LEU A N    1 
ATOM   1167  C  CA   . LEU A  1 87  ? 204.201 82.009  54.868  1.00 78.52  ? 279  LEU A CA   1 
ATOM   1168  C  C    . LEU A  1 87  ? 204.508 81.053  56.014  1.00 78.90  ? 279  LEU A C    1 
ATOM   1169  O  O    . LEU A  1 87  ? 204.523 79.834  55.812  1.00 81.43  ? 279  LEU A O    1 
ATOM   1170  C  CB   . LEU A  1 87  ? 205.479 82.451  54.158  1.00 78.22  ? 279  LEU A CB   1 
ATOM   1171  C  CG   . LEU A  1 87  ? 205.223 83.296  52.905  1.00 75.68  ? 279  LEU A CG   1 
ATOM   1172  C  CD1  . LEU A  1 87  ? 206.507 83.938  52.420  1.00 79.42  ? 279  LEU A CD1  1 
ATOM   1173  C  CD2  . LEU A  1 87  ? 204.599 82.456  51.797  1.00 75.85  ? 279  LEU A CD2  1 
ATOM   1174  H  H    . LEU A  1 87  ? 203.921 83.914  55.315  1.00 89.84  ? 279  LEU A H    1 
ATOM   1175  H  HA   . LEU A  1 87  ? 203.652 81.535  54.225  1.00 93.98  ? 279  LEU A HA   1 
ATOM   1176  H  HB2  . LEU A  1 87  ? 206.010 82.982  54.771  1.00 93.62  ? 279  LEU A HB2  1 
ATOM   1177  H  HB3  . LEU A  1 87  ? 205.976 81.663  53.889  1.00 93.62  ? 279  LEU A HB3  1 
ATOM   1178  H  HG   . LEU A  1 87  ? 204.600 84.005  53.127  1.00 90.57  ? 279  LEU A HG   1 
ATOM   1179  H  HD11 . LEU A  1 87  ? 206.316 84.465  51.628  1.00 95.05  ? 279  LEU A HD11 1 
ATOM   1180  H  HD12 . LEU A  1 87  ? 206.858 84.509  53.121  1.00 95.05  ? 279  LEU A HD12 1 
ATOM   1181  H  HD13 . LEU A  1 87  ? 207.147 83.241  52.207  1.00 95.05  ? 279  LEU A HD13 1 
ATOM   1182  H  HD21 . LEU A  1 87  ? 204.451 83.019  51.021  1.00 90.77  ? 279  LEU A HD21 1 
ATOM   1183  H  HD22 . LEU A  1 87  ? 205.205 81.733  51.571  1.00 90.77  ? 279  LEU A HD22 1 
ATOM   1184  H  HD23 . LEU A  1 87  ? 203.755 82.096  52.111  1.00 90.77  ? 279  LEU A HD23 1 
ATOM   1185  N  N    . ARG A  1 88  ? 204.753 81.579  57.216  1.00 77.04  ? 280  ARG A N    1 
ATOM   1186  C  CA   . ARG A  1 88  ? 204.928 80.708  58.373  1.00 81.12  ? 280  ARG A CA   1 
ATOM   1187  C  C    . ARG A  1 88  ? 203.676 79.875  58.619  1.00 78.71  ? 280  ARG A C    1 
ATOM   1188  O  O    . ARG A  1 88  ? 203.763 78.685  58.942  1.00 79.59  ? 280  ARG A O    1 
ATOM   1189  C  CB   . ARG A  1 88  ? 205.258 81.536  59.614  1.00 85.11  ? 280  ARG A CB   1 
ATOM   1190  C  CG   . ARG A  1 88  ? 206.647 82.144  59.614  1.00 90.26  ? 280  ARG A CG   1 
ATOM   1191  C  CD   . ARG A  1 88  ? 206.906 82.921  60.895  1.00 94.51  ? 280  ARG A CD   1 
ATOM   1192  N  NE   . ARG A  1 88  ? 208.067 83.796  60.770  1.00 98.42  ? 280  ARG A NE   1 
ATOM   1193  C  CZ   . ARG A  1 88  ? 209.329 83.386  60.853  1.00 103.54 ? 280  ARG A CZ   1 
ATOM   1194  N  NH1  . ARG A  1 88  ? 209.609 82.106  61.063  1.00 104.00 ? 280  ARG A NH1  1 
ATOM   1195  N  NH2  . ARG A  1 88  ? 210.317 84.261  60.723  1.00 107.21 ? 280  ARG A NH2  1 
ATOM   1196  H  H    . ARG A  1 88  ? 204.821 82.420  57.384  1.00 92.20  ? 280  ARG A H    1 
ATOM   1197  H  HA   . ARG A  1 88  ? 205.667 80.102  58.208  1.00 97.10  ? 280  ARG A HA   1 
ATOM   1198  H  HB2  . ARG A  1 88  ? 204.619 82.263  59.681  1.00 101.89 ? 280  ARG A HB2  1 
ATOM   1199  H  HB3  . ARG A  1 88  ? 205.186 80.966  60.396  1.00 101.89 ? 280  ARG A HB3  1 
ATOM   1200  H  HG2  . ARG A  1 88  ? 207.307 81.436  59.548  1.00 108.06 ? 280  ARG A HG2  1 
ATOM   1201  H  HG3  . ARG A  1 88  ? 206.731 82.754  58.865  1.00 108.06 ? 280  ARG A HG3  1 
ATOM   1202  H  HD2  . ARG A  1 88  ? 206.133 83.470  61.097  1.00 113.17 ? 280  ARG A HD2  1 
ATOM   1203  H  HD3  . ARG A  1 88  ? 207.073 82.297  61.619  1.00 113.17 ? 280  ARG A HD3  1 
ATOM   1204  H  HE   . ARG A  1 88  ? 207.926 84.633  60.634  1.00 117.86 ? 280  ARG A HE   1 
ATOM   1205  H  HH11 . ARG A  1 88  ? 208.972 81.535  61.147  1.00 124.56 ? 280  ARG A HH11 1 
ATOM   1206  H  HH12 . ARG A  1 88  ? 210.428 81.847  61.116  1.00 124.56 ? 280  ARG A HH12 1 
ATOM   1207  H  HH21 . ARG A  1 88  ? 210.141 85.092  60.587  1.00 128.40 ? 280  ARG A HH21 1 
ATOM   1208  H  HH22 . ARG A  1 88  ? 211.134 83.998  60.777  1.00 128.40 ? 280  ARG A HH22 1 
ATOM   1209  N  N    . VAL A  1 89  ? 202.501 80.487  58.459  1.00 72.74  ? 281  VAL A N    1 
ATOM   1210  C  CA   . VAL A  1 89  ? 201.247 79.773  58.673  1.00 71.92  ? 281  VAL A CA   1 
ATOM   1211  C  C    . VAL A  1 89  ? 201.035 78.723  57.590  1.00 71.91  ? 281  VAL A C    1 
ATOM   1212  O  O    . VAL A  1 89  ? 200.641 77.587  57.879  1.00 73.36  ? 281  VAL A O    1 
ATOM   1213  C  CB   . VAL A  1 89  ? 200.081 80.776  58.741  1.00 66.07  ? 281  VAL A CB   1 
ATOM   1214  C  CG1  . VAL A  1 89  ? 198.738 80.063  58.693  1.00 67.93  ? 281  VAL A CG1  1 
ATOM   1215  C  CG2  . VAL A  1 89  ? 200.189 81.608  60.008  1.00 69.43  ? 281  VAL A CG2  1 
ATOM   1216  H  H    . VAL A  1 89  ? 202.406 81.310  58.228  1.00 87.04  ? 281  VAL A H    1 
ATOM   1217  H  HA   . VAL A  1 89  ? 201.292 79.313  59.526  1.00 86.06  ? 281  VAL A HA   1 
ATOM   1218  H  HB   . VAL A  1 89  ? 200.132 81.376  57.980  1.00 79.03  ? 281  VAL A HB   1 
ATOM   1219  H  HG11 . VAL A  1 89  ? 198.028 80.723  58.737  1.00 81.26  ? 281  VAL A HG11 1 
ATOM   1220  H  HG12 . VAL A  1 89  ? 198.675 79.565  57.863  1.00 81.26  ? 281  VAL A HG12 1 
ATOM   1221  H  HG13 . VAL A  1 89  ? 198.675 79.457  59.448  1.00 81.26  ? 281  VAL A HG13 1 
ATOM   1222  H  HG21 . VAL A  1 89  ? 199.449 82.235  60.038  1.00 83.07  ? 281  VAL A HG21 1 
ATOM   1223  H  HG22 . VAL A  1 89  ? 200.153 81.018  60.777  1.00 83.07  ? 281  VAL A HG22 1 
ATOM   1224  H  HG23 . VAL A  1 89  ? 201.030 82.090  59.999  1.00 83.07  ? 281  VAL A HG23 1 
ATOM   1225  N  N    . LEU A  1 90  ? 201.283 79.083  56.328  1.00 74.50  ? 282  LEU A N    1 
ATOM   1226  C  CA   . LEU A  1 90  ? 201.132 78.116  55.246  1.00 76.08  ? 282  LEU A CA   1 
ATOM   1227  C  C    . LEU A  1 90  ? 202.114 76.962  55.389  1.00 76.89  ? 282  LEU A C    1 
ATOM   1228  O  O    . LEU A  1 90  ? 201.790 75.825  55.029  1.00 77.97  ? 282  LEU A O    1 
ATOM   1229  C  CB   . LEU A  1 90  ? 201.326 78.800  53.892  1.00 74.75  ? 282  LEU A CB   1 
ATOM   1230  C  CG   . LEU A  1 90  ? 200.240 79.780  53.449  1.00 71.42  ? 282  LEU A CG   1 
ATOM   1231  C  CD1  . LEU A  1 90  ? 200.712 80.566  52.237  1.00 74.33  ? 282  LEU A CD1  1 
ATOM   1232  C  CD2  . LEU A  1 90  ? 198.945 79.048  53.138  1.00 71.06  ? 282  LEU A CD2  1 
ATOM   1233  H  H    . LEU A  1 90  ? 201.535 79.866  56.079  1.00 89.15  ? 282  LEU A H    1 
ATOM   1234  H  HA   . LEU A  1 90  ? 200.234 77.751  55.272  1.00 91.05  ? 282  LEU A HA   1 
ATOM   1235  H  HB2  . LEU A  1 90  ? 202.161 79.292  53.920  1.00 89.46  ? 282  LEU A HB2  1 
ATOM   1236  H  HB3  . LEU A  1 90  ? 201.384 78.111  53.212  1.00 89.46  ? 282  LEU A HB3  1 
ATOM   1237  H  HG   . LEU A  1 90  ? 200.067 80.409  54.167  1.00 85.46  ? 282  LEU A HG   1 
ATOM   1238  H  HD11 . LEU A  1 90  ? 200.012 81.182  51.969  1.00 88.94  ? 282  LEU A HD11 1 
ATOM   1239  H  HD12 . LEU A  1 90  ? 201.514 81.057  52.473  1.00 88.94  ? 282  LEU A HD12 1 
ATOM   1240  H  HD13 . LEU A  1 90  ? 200.903 79.947  51.515  1.00 88.94  ? 282  LEU A HD13 1 
ATOM   1241  H  HD21 . LEU A  1 90  ? 198.277 79.694  52.861  1.00 85.03  ? 282  LEU A HD21 1 
ATOM   1242  H  HD22 . LEU A  1 90  ? 199.106 78.411  52.425  1.00 85.03  ? 282  LEU A HD22 1 
ATOM   1243  H  HD23 . LEU A  1 90  ? 198.646 78.585  53.936  1.00 85.03  ? 282  LEU A HD23 1 
ATOM   1244  N  N    . SER A  1 91  ? 203.317 77.236  55.900  1.00 77.70  ? 283  SER A N    1 
ATOM   1245  C  CA   . SER A  1 91  ? 204.315 76.185  56.073  1.00 76.15  ? 283  SER A CA   1 
ATOM   1246  C  C    . SER A  1 91  ? 203.759 75.008  56.863  1.00 76.40  ? 283  SER A C    1 
ATOM   1247  O  O    . SER A  1 91  ? 204.108 73.851  56.600  1.00 73.99  ? 283  SER A O    1 
ATOM   1248  C  CB   . SER A  1 91  ? 205.549 76.754  56.774  1.00 78.38  ? 283  SER A CB   1 
ATOM   1249  O  OG   . SER A  1 91  ? 206.576 75.784  56.868  1.00 87.18  ? 283  SER A OG   1 
ATOM   1250  H  H    . SER A  1 91  ? 203.576 78.016  56.152  1.00 92.99  ? 283  SER A H    1 
ATOM   1251  H  HA   . SER A  1 91  ? 204.588 75.860  55.201  1.00 91.13  ? 283  SER A HA   1 
ATOM   1252  H  HB2  . SER A  1 91  ? 205.877 77.513  56.266  1.00 93.81  ? 283  SER A HB2  1 
ATOM   1253  H  HB3  . SER A  1 91  ? 205.300 77.037  57.668  1.00 93.81  ? 283  SER A HB3  1 
ATOM   1254  H  HG   . SER A  1 91  ? 207.246 76.111  57.255  1.00 104.36 ? 283  SER A HG   1 
ATOM   1255  N  N    . SER A  1 92  ? 202.892 75.283  57.835  1.00 85.75  ? 284  SER A N    1 
ATOM   1256  C  CA   . SER A  1 92  ? 202.347 74.243  58.696  1.00 90.01  ? 284  SER A CA   1 
ATOM   1257  C  C    . SER A  1 92  ? 201.045 73.653  58.172  1.00 90.17  ? 284  SER A C    1 
ATOM   1258  O  O    . SER A  1 92  ? 200.633 72.585  58.641  1.00 89.74  ? 284  SER A O    1 
ATOM   1259  C  CB   . SER A  1 92  ? 202.134 74.804  60.104  1.00 91.11  ? 284  SER A CB   1 
ATOM   1260  O  OG   . SER A  1 92  ? 203.341 75.373  60.587  1.00 91.71  ? 284  SER A OG   1 
ATOM   1261  H  H    . SER A  1 92  ? 202.602 76.073  58.016  1.00 102.65 ? 284  SER A H    1 
ATOM   1262  H  HA   . SER A  1 92  ? 202.993 73.522  58.760  1.00 107.76 ? 284  SER A HA   1 
ATOM   1263  H  HB2  . SER A  1 92  ? 201.449 75.490  60.073  1.00 109.08 ? 284  SER A HB2  1 
ATOM   1264  H  HB3  . SER A  1 92  ? 201.861 74.085  60.695  1.00 109.08 ? 284  SER A HB3  1 
ATOM   1265  H  HG   . SER A  1 92  ? 203.224 75.681  61.360  1.00 109.80 ? 284  SER A HG   1 
ATOM   1266  N  N    . LEU A  1 93  ? 200.389 74.324  57.230  1.00 83.54  ? 285  LEU A N    1 
ATOM   1267  C  CA   . LEU A  1 93  ? 199.132 73.851  56.653  1.00 83.02  ? 285  LEU A CA   1 
ATOM   1268  C  C    . LEU A  1 93  ? 199.457 72.949  55.467  1.00 85.22  ? 285  LEU A C    1 
ATOM   1269  O  O    . LEU A  1 93  ? 199.805 73.427  54.386  1.00 85.59  ? 285  LEU A O    1 
ATOM   1270  C  CB   . LEU A  1 93  ? 198.264 75.034  56.238  1.00 82.57  ? 285  LEU A CB   1 
ATOM   1271  C  CG   . LEU A  1 93  ? 196.792 74.753  55.944  1.00 84.93  ? 285  LEU A CG   1 
ATOM   1272  C  CD1  . LEU A  1 93  ? 196.079 74.300  57.207  1.00 87.35  ? 285  LEU A CD1  1 
ATOM   1273  C  CD2  . LEU A  1 93  ? 196.124 75.993  55.364  1.00 86.82  ? 285  LEU A CD2  1 
ATOM   1274  H  H    . LEU A  1 93  ? 200.657 75.072  56.901  1.00 100.00 ? 285  LEU A H    1 
ATOM   1275  H  HA   . LEU A  1 93  ? 198.648 73.330  57.313  1.00 99.38  ? 285  LEU A HA   1 
ATOM   1276  H  HB2  . LEU A  1 93  ? 198.291 75.691  56.951  1.00 98.84  ? 285  LEU A HB2  1 
ATOM   1277  H  HB3  . LEU A  1 93  ? 198.646 75.420  55.434  1.00 98.84  ? 285  LEU A HB3  1 
ATOM   1278  H  HG   . LEU A  1 93  ? 196.729 74.041  55.289  1.00 101.66 ? 285  LEU A HG   1 
ATOM   1279  H  HD11 . LEU A  1 93  ? 195.147 74.128  56.999  1.00 104.57 ? 285  LEU A HD11 1 
ATOM   1280  H  HD12 . LEU A  1 93  ? 196.501 73.491  57.535  1.00 104.57 ? 285  LEU A HD12 1 
ATOM   1281  H  HD13 . LEU A  1 93  ? 196.144 75.001  57.875  1.00 104.57 ? 285  LEU A HD13 1 
ATOM   1282  H  HD21 . LEU A  1 93  ? 195.192 75.794  55.185  1.00 103.94 ? 285  LEU A HD21 1 
ATOM   1283  H  HD22 . LEU A  1 93  ? 196.191 76.717  56.007  1.00 103.94 ? 285  LEU A HD22 1 
ATOM   1284  H  HD23 . LEU A  1 93  ? 196.575 76.238  54.541  1.00 103.94 ? 285  LEU A HD23 1 
ATOM   1285  N  N    . THR A  1 94  ? 199.348 71.632  55.669  1.00 81.13  ? 286  THR A N    1 
ATOM   1286  C  CA   . THR A  1 94  ? 199.649 70.669  54.619  1.00 76.21  ? 286  THR A CA   1 
ATOM   1287  C  C    . THR A  1 94  ? 198.529 69.668  54.366  1.00 75.79  ? 286  THR A C    1 
ATOM   1288  O  O    . THR A  1 94  ? 198.638 68.874  53.426  1.00 77.92  ? 286  THR A O    1 
ATOM   1289  C  CB   . THR A  1 94  ? 200.935 69.892  54.946  1.00 76.62  ? 286  THR A CB   1 
ATOM   1290  O  OG1  . THR A  1 94  ? 200.662 68.895  55.937  1.00 78.62  ? 286  THR A OG1  1 
ATOM   1291  C  CG2  . THR A  1 94  ? 202.021 70.830  55.462  1.00 75.20  ? 286  THR A CG2  1 
ATOM   1292  H  H    . THR A  1 94  ? 199.100 71.275  56.411  1.00 97.10  ? 286  THR A H    1 
ATOM   1293  H  HA   . THR A  1 94  ? 199.801 71.153  53.792  1.00 91.21  ? 286  THR A HA   1 
ATOM   1294  H  HB   . THR A  1 94  ? 201.263 69.461  54.141  1.00 91.69  ? 286  THR A HB   1 
ATOM   1295  H  HG1  . THR A  1 94  ? 201.363 68.469  56.117  1.00 94.09  ? 286  THR A HG1  1 
ATOM   1296  H  HG21 . THR A  1 94  ? 202.826 70.327  55.664  1.00 89.99  ? 286  THR A HG21 1 
ATOM   1297  H  HG22 . THR A  1 94  ? 202.228 71.499  54.791  1.00 89.99  ? 286  THR A HG22 1 
ATOM   1298  H  HG23 . THR A  1 94  ? 201.718 71.276  56.269  1.00 89.99  ? 286  THR A HG23 1 
ATOM   1299  N  N    . LYS A  1 95  ? 197.460 69.684  55.159  1.00 71.99  ? 287  LYS A N    1 
ATOM   1300  C  CA   . LYS A  1 95  ? 196.379 68.715  55.042  1.00 70.72  ? 287  LYS A CA   1 
ATOM   1301  C  C    . LYS A  1 95  ? 195.094 69.399  54.599  1.00 71.36  ? 287  LYS A C    1 
ATOM   1302  O  O    . LYS A  1 95  ? 194.819 70.541  54.984  1.00 71.68  ? 287  LYS A O    1 
ATOM   1303  C  CB   . LYS A  1 95  ? 196.135 68.001  56.374  1.00 74.91  ? 287  LYS A CB   1 
ATOM   1304  C  CG   . LYS A  1 95  ? 197.354 67.326  56.979  1.00 78.60  ? 287  LYS A CG   1 
ATOM   1305  C  CD   . LYS A  1 95  ? 197.721 66.061  56.222  1.00 83.80  ? 287  LYS A CD   1 
ATOM   1306  C  CE   . LYS A  1 95  ? 198.787 65.271  56.960  1.00 89.07  ? 287  LYS A CE   1 
ATOM   1307  N  NZ   . LYS A  1 95  ? 198.908 63.879  56.445  1.00 96.22  ? 287  LYS A NZ   1 
ATOM   1308  H  H    . LYS A  1 95  ? 197.339 70.260  55.786  1.00 86.14  ? 287  LYS A H    1 
ATOM   1309  H  HA   . LYS A  1 95  ? 196.615 68.049  54.378  1.00 84.62  ? 287  LYS A HA   1 
ATOM   1310  H  HB2  . LYS A  1 95  ? 195.813 68.652  57.018  1.00 89.65  ? 287  LYS A HB2  1 
ATOM   1311  H  HB3  . LYS A  1 95  ? 195.461 67.318  56.238  1.00 89.65  ? 287  LYS A HB3  1 
ATOM   1312  H  HG2  . LYS A  1 95  ? 198.109 67.934  56.940  1.00 94.07  ? 287  LYS A HG2  1 
ATOM   1313  H  HG3  . LYS A  1 95  ? 197.163 67.085  57.899  1.00 94.07  ? 287  LYS A HG3  1 
ATOM   1314  H  HD2  . LYS A  1 95  ? 196.934 65.501  56.132  1.00 100.31 ? 287  LYS A HD2  1 
ATOM   1315  H  HD3  . LYS A  1 95  ? 198.068 66.299  55.348  1.00 100.31 ? 287  LYS A HD3  1 
ATOM   1316  H  HE2  . LYS A  1 95  ? 199.645 65.710  56.847  1.00 106.64 ? 287  LYS A HE2  1 
ATOM   1317  H  HE3  . LYS A  1 95  ? 198.556 65.226  57.901  1.00 106.64 ? 287  LYS A HE3  1 
ATOM   1318  H  HZ1  . LYS A  1 95  ? 199.539 63.442  56.896  1.00 115.22 ? 287  LYS A HZ1  1 
ATOM   1319  H  HZ2  . LYS A  1 95  ? 198.134 63.451  56.542  1.00 115.22 ? 287  LYS A HZ2  1 
ATOM   1320  H  HZ3  . LYS A  1 95  ? 199.125 63.892  55.582  1.00 115.22 ? 287  LYS A HZ3  1 
ATOM   1321  N  N    . LYS A  1 96  ? 194.304 68.687  53.793  1.00 78.22  ? 288  LYS A N    1 
ATOM   1322  C  CA   . LYS A  1 96  ? 193.005 69.203  53.376  1.00 78.26  ? 288  LYS A CA   1 
ATOM   1323  C  C    . LYS A  1 96  ? 192.119 69.486  54.582  1.00 77.66  ? 288  LYS A C    1 
ATOM   1324  O  O    . LYS A  1 96  ? 191.480 70.541  54.667  1.00 79.59  ? 288  LYS A O    1 
ATOM   1325  C  CB   . LYS A  1 96  ? 192.323 68.205  52.439  1.00 81.32  ? 288  LYS A CB   1 
ATOM   1326  C  CG   . LYS A  1 96  ? 190.965 68.659  51.922  1.00 81.70  ? 288  LYS A CG   1 
ATOM   1327  C  CD   . LYS A  1 96  ? 190.222 67.529  51.233  1.00 87.46  ? 288  LYS A CD   1 
ATOM   1328  C  CE   . LYS A  1 96  ? 188.898 68.010  50.666  1.00 92.05  ? 288  LYS A CE   1 
ATOM   1329  N  NZ   . LYS A  1 96  ? 188.154 66.922  49.977  1.00 96.59  ? 288  LYS A NZ   1 
ATOM   1330  H  H    . LYS A  1 96  ? 194.497 67.911  53.478  1.00 93.61  ? 288  LYS A H    1 
ATOM   1331  H  HA   . LYS A  1 96  ? 193.132 70.034  52.892  1.00 93.67  ? 288  LYS A HA   1 
ATOM   1332  H  HB2  . LYS A  1 96  ? 192.897 68.058  51.670  1.00 97.33  ? 288  LYS A HB2  1 
ATOM   1333  H  HB3  . LYS A  1 96  ? 192.194 67.370  52.915  1.00 97.33  ? 288  LYS A HB3  1 
ATOM   1334  H  HG2  . LYS A  1 96  ? 190.426 68.966  52.667  1.00 97.80  ? 288  LYS A HG2  1 
ATOM   1335  H  HG3  . LYS A  1 96  ? 191.090 69.375  51.280  1.00 97.80  ? 288  LYS A HG3  1 
ATOM   1336  H  HD2  . LYS A  1 96  ? 190.761 67.188  50.503  1.00 104.70 ? 288  LYS A HD2  1 
ATOM   1337  H  HD3  . LYS A  1 96  ? 190.040 66.825  51.876  1.00 104.70 ? 288  LYS A HD3  1 
ATOM   1338  H  HE2  . LYS A  1 96  ? 188.344 68.343  51.389  1.00 110.21 ? 288  LYS A HE2  1 
ATOM   1339  H  HE3  . LYS A  1 96  ? 189.066 68.716  50.022  1.00 110.21 ? 288  LYS A HE3  1 
ATOM   1340  H  HZ1  . LYS A  1 96  ? 187.385 67.235  49.656  1.00 115.66 ? 288  LYS A HZ1  1 
ATOM   1341  H  HZ2  . LYS A  1 96  ? 188.639 66.602  49.303  1.00 115.66 ? 288  LYS A HZ2  1 
ATOM   1342  H  HZ3  . LYS A  1 96  ? 187.982 66.262  50.549  1.00 115.66 ? 288  LYS A HZ3  1 
ATOM   1343  N  N    . GLU A  1 97  ? 192.071 68.550  55.531  1.00 80.86  ? 289  GLU A N    1 
ATOM   1344  C  CA   . GLU A  1 97  ? 191.173 68.700  56.670  1.00 83.76  ? 289  GLU A CA   1 
ATOM   1345  C  C    . GLU A  1 97  ? 191.576 69.873  57.557  1.00 83.11  ? 289  GLU A C    1 
ATOM   1346  O  O    . GLU A  1 97  ? 190.713 70.483  58.199  1.00 84.00  ? 289  GLU A O    1 
ATOM   1347  C  CB   . GLU A  1 97  ? 191.124 67.397  57.472  1.00 86.97  ? 289  GLU A CB   1 
ATOM   1348  C  CG   . GLU A  1 97  ? 192.436 66.994  58.139  1.00 94.40  ? 289  GLU A CG   1 
ATOM   1349  C  CD   . GLU A  1 97  ? 193.240 66.011  57.308  1.00 100.44 ? 289  GLU A CD   1 
ATOM   1350  O  OE1  . GLU A  1 97  ? 193.036 65.961  56.073  1.00 100.15 ? 289  GLU A OE1  1 
ATOM   1351  O  OE2  . GLU A  1 97  ? 194.076 65.287  57.893  1.00 100.36 ? 289  GLU A OE2  1 
ATOM   1352  H  H    . GLU A  1 97  ? 192.541 67.830  55.537  1.00 96.79  ? 289  GLU A H    1 
ATOM   1353  H  HA   . GLU A  1 97  ? 190.278 68.876  56.339  1.00 100.26 ? 289  GLU A HA   1 
ATOM   1354  H  HB2  . GLU A  1 97  ? 190.457 67.490  58.170  1.00 104.12 ? 289  GLU A HB2  1 
ATOM   1355  H  HB3  . GLU A  1 97  ? 190.868 66.677  56.873  1.00 104.12 ? 289  GLU A HB3  1 
ATOM   1356  H  HG2  . GLU A  1 97  ? 192.979 67.787  58.274  1.00 113.03 ? 289  GLU A HG2  1 
ATOM   1357  H  HG3  . GLU A  1 97  ? 192.241 66.576  58.993  1.00 113.03 ? 289  GLU A HG3  1 
ATOM   1358  N  N    . HIS A  1 98  ? 192.868 70.207  57.604  1.00 78.42  ? 290  HIS A N    1 
ATOM   1359  C  CA   . HIS A  1 98  ? 193.300 71.364  58.380  1.00 75.93  ? 290  HIS A CA   1 
ATOM   1360  C  C    . HIS A  1 98  ? 192.917 72.663  57.690  1.00 76.25  ? 290  HIS A C    1 
ATOM   1361  O  O    . HIS A  1 98  ? 192.611 73.657  58.358  1.00 78.70  ? 290  HIS A O    1 
ATOM   1362  C  CB   . HIS A  1 98  ? 194.809 71.315  58.604  1.00 71.05  ? 290  HIS A CB   1 
ATOM   1363  C  CG   . HIS A  1 98  ? 195.255 70.157  59.438  1.00 71.59  ? 290  HIS A CG   1 
ATOM   1364  N  ND1  . HIS A  1 98  ? 196.532 69.642  59.378  1.00 65.80  ? 290  HIS A ND1  1 
ATOM   1365  C  CD2  . HIS A  1 98  ? 194.591 69.410  60.351  1.00 67.93  ? 290  HIS A CD2  1 
ATOM   1366  C  CE1  . HIS A  1 98  ? 196.636 68.629  60.219  1.00 72.98  ? 290  HIS A CE1  1 
ATOM   1367  N  NE2  . HIS A  1 98  ? 195.471 68.467  60.821  1.00 72.06  ? 290  HIS A NE2  1 
ATOM   1368  H  H    . HIS A  1 98  ? 193.502 69.787  57.201  1.00 93.86  ? 290  HIS A H    1 
ATOM   1369  H  HA   . HIS A  1 98  ? 192.865 71.344  59.247  1.00 90.87  ? 290  HIS A HA   1 
ATOM   1370  H  HB2  . HIS A  1 98  ? 195.251 71.248  57.743  1.00 85.01  ? 290  HIS A HB2  1 
ATOM   1371  H  HB3  . HIS A  1 98  ? 195.086 72.128  59.053  1.00 85.01  ? 290  HIS A HB3  1 
ATOM   1372  H  HD2  . HIS A  1 98  ? 193.704 69.515  60.611  1.00 81.27  ? 290  HIS A HD2  1 
ATOM   1373  H  HE1  . HIS A  1 98  ? 197.398 68.117  60.362  1.00 87.33  ? 290  HIS A HE1  1 
ATOM   1374  H  HE2  . HIS A  1 98  ? 195.294 67.869  61.413  1.00 86.22  ? 290  HIS A HE2  1 
ATOM   1375  N  N    . MET A  1 99  ? 192.926 72.669  56.357  1.00 80.14  ? 291  MET A N    1 
ATOM   1376  C  CA   . MET A  1 99  ? 192.493 73.840  55.608  1.00 74.97  ? 291  MET A CA   1 
ATOM   1377  C  C    . MET A  1 99  ? 191.002 74.090  55.797  1.00 73.53  ? 291  MET A C    1 
ATOM   1378  O  O    . MET A  1 99  ? 190.569 75.241  55.919  1.00 79.10  ? 291  MET A O    1 
ATOM   1379  C  CB   . MET A  1 99  ? 192.829 73.642  54.133  1.00 80.08  ? 291  MET A CB   1 
ATOM   1380  C  CG   . MET A  1 99  ? 192.679 74.868  53.268  1.00 83.57  ? 291  MET A CG   1 
ATOM   1381  S  SD   . MET A  1 99  ? 193.183 74.484  51.584  1.00 89.03  ? 291  MET A SD   1 
ATOM   1382  C  CE   . MET A  1 99  ? 192.158 75.617  50.658  1.00 90.50  ? 291  MET A CE   1 
ATOM   1383  H  H    . MET A  1 99  ? 193.177 72.008  55.867  1.00 95.93  ? 291  MET A H    1 
ATOM   1384  H  HA   . MET A  1 99  ? 192.984 74.615  55.924  1.00 89.72  ? 291  MET A HA   1 
ATOM   1385  H  HB2  . MET A  1 99  ? 193.751 73.348  54.065  1.00 95.85  ? 291  MET A HB2  1 
ATOM   1386  H  HB3  . MET A  1 99  ? 192.244 72.957  53.773  1.00 95.85  ? 291  MET A HB3  1 
ATOM   1387  H  HG2  . MET A  1 99  ? 191.750 75.148  53.257  1.00 100.04 ? 291  MET A HG2  1 
ATOM   1388  H  HG3  . MET A  1 99  ? 193.246 75.578  53.607  1.00 100.04 ? 291  MET A HG3  1 
ATOM   1389  H  HE1  . MET A  1 99  ? 192.341 75.506  49.712  1.00 108.35 ? 291  MET A HE1  1 
ATOM   1390  H  HE2  . MET A  1 99  ? 191.226 75.421  50.841  1.00 108.35 ? 291  MET A HE2  1 
ATOM   1391  H  HE3  . MET A  1 99  ? 192.365 76.525  50.931  1.00 108.35 ? 291  MET A HE3  1 
ATOM   1392  N  N    . LYS A  1 100 ? 190.202 73.023  55.828  1.00 70.07  ? 292  LYS A N    1 
ATOM   1393  C  CA   . LYS A  1 100 ? 188.764 73.168  56.021  1.00 76.96  ? 292  LYS A CA   1 
ATOM   1394  C  C    . LYS A  1 100 ? 188.422 73.756  57.383  1.00 77.36  ? 292  LYS A C    1 
ATOM   1395  O  O    . LYS A  1 100 ? 187.323 74.295  57.553  1.00 80.57  ? 292  LYS A O    1 
ATOM   1396  C  CB   . LYS A  1 100 ? 188.079 71.811  55.850  1.00 79.22  ? 292  LYS A CB   1 
ATOM   1397  C  CG   . LYS A  1 100 ? 188.046 71.312  54.411  1.00 83.28  ? 292  LYS A CG   1 
ATOM   1398  C  CD   . LYS A  1 100 ? 187.677 69.836  54.335  1.00 93.17  ? 292  LYS A CD   1 
ATOM   1399  C  CE   . LYS A  1 100 ? 186.179 69.625  54.177  1.00 97.18  ? 292  LYS A CE   1 
ATOM   1400  N  NZ   . LYS A  1 100 ? 185.733 69.815  52.768  1.00 101.64 ? 292  LYS A NZ   1 
ATOM   1401  H  H    . LYS A  1 100 ? 190.468 72.210  55.739  1.00 83.84  ? 292  LYS A H    1 
ATOM   1402  H  HA   . LYS A  1 100 ? 188.415 73.766  55.342  1.00 92.11  ? 292  LYS A HA   1 
ATOM   1403  H  HB2  . LYS A  1 100 ? 188.554 71.152  56.380  1.00 94.82  ? 292  LYS A HB2  1 
ATOM   1404  H  HB3  . LYS A  1 100 ? 187.162 71.883  56.159  1.00 94.82  ? 292  LYS A HB3  1 
ATOM   1405  H  HG2  . LYS A  1 100 ? 187.384 71.816  53.913  1.00 99.69  ? 292  LYS A HG2  1 
ATOM   1406  H  HG3  . LYS A  1 100 ? 188.923 71.426  54.013  1.00 99.69  ? 292  LYS A HG3  1 
ATOM   1407  H  HD2  . LYS A  1 100 ? 188.120 69.437  53.570  1.00 111.55 ? 292  LYS A HD2  1 
ATOM   1408  H  HD3  . LYS A  1 100 ? 187.959 69.396  55.152  1.00 111.55 ? 292  LYS A HD3  1 
ATOM   1409  H  HE2  . LYS A  1 100 ? 185.955 68.720  54.445  1.00 116.37 ? 292  LYS A HE2  1 
ATOM   1410  H  HE3  . LYS A  1 100 ? 185.706 70.264  54.732  1.00 116.37 ? 292  LYS A HE3  1 
ATOM   1411  H  HZ1  . LYS A  1 100 ? 184.854 69.685  52.707  1.00 121.72 ? 292  LYS A HZ1  1 
ATOM   1412  H  HZ2  . LYS A  1 100 ? 185.922 70.642  52.498  1.00 121.72 ? 292  LYS A HZ2  1 
ATOM   1413  H  HZ3  . LYS A  1 100 ? 186.149 69.235  52.236  1.00 121.72 ? 292  LYS A HZ3  1 
ATOM   1414  N  N    . GLY A  1 101 ? 189.329 73.662  58.352  1.00 74.21  ? 293  GLY A N    1 
ATOM   1415  C  CA   . GLY A  1 101 ? 189.116 74.227  59.666  1.00 73.93  ? 293  GLY A CA   1 
ATOM   1416  C  C    . GLY A  1 101 ? 189.581 75.654  59.827  1.00 74.77  ? 293  GLY A C    1 
ATOM   1417  O  O    . GLY A  1 101 ? 189.443 76.221  60.916  1.00 77.08  ? 293  GLY A O    1 
ATOM   1418  H  H    . GLY A  1 101 ? 190.088 73.268  58.264  1.00 88.81  ? 293  GLY A H    1 
ATOM   1419  H  HA2  . GLY A  1 101 ? 188.169 74.197  59.872  1.00 88.46  ? 293  GLY A HA2  1 
ATOM   1420  H  HA3  . GLY A  1 101 ? 189.583 73.685  60.321  1.00 88.46  ? 293  GLY A HA3  1 
ATOM   1421  N  N    . ASN A  1 102 ? 190.132 76.256  58.775  1.00 77.89  ? 294  ASN A N    1 
ATOM   1422  C  CA   . ASN A  1 102 ? 190.609 77.636  58.798  1.00 77.03  ? 294  ASN A CA   1 
ATOM   1423  C  C    . ASN A  1 102 ? 189.720 78.438  57.853  1.00 74.50  ? 294  ASN A C    1 
ATOM   1424  O  O    . ASN A  1 102 ? 189.893 78.389  56.631  1.00 74.77  ? 294  ASN A O    1 
ATOM   1425  C  CB   . ASN A  1 102 ? 192.079 77.711  58.392  1.00 79.90  ? 294  ASN A CB   1 
ATOM   1426  C  CG   . ASN A  1 102 ? 192.647 79.114  58.500  1.00 81.95  ? 294  ASN A CG   1 
ATOM   1427  O  OD1  . ASN A  1 102 ? 191.964 80.100  58.222  1.00 83.61  ? 294  ASN A OD1  1 
ATOM   1428  N  ND2  . ASN A  1 102 ? 193.907 79.209  58.906  1.00 83.72  ? 294  ASN A ND2  1 
ATOM   1429  H  H    . ASN A  1 102 ? 190.243 75.872  58.014  1.00 93.22  ? 294  ASN A H    1 
ATOM   1430  H  HA   . ASN A  1 102 ? 190.516 77.998  59.693  1.00 92.19  ? 294  ASN A HA   1 
ATOM   1431  H  HB2  . ASN A  1 102 ? 192.597 77.132  58.973  1.00 95.63  ? 294  ASN A HB2  1 
ATOM   1432  H  HB3  . ASN A  1 102 ? 192.167 77.421  57.471  1.00 95.63  ? 294  ASN A HB3  1 
ATOM   1433  H  HD21 . ASN A  1 102 ? 194.276 79.982  58.984  1.00 100.21 ? 294  ASN A HD21 1 
ATOM   1434  H  HD22 . ASN A  1 102 ? 194.353 78.498  59.091  1.00 100.21 ? 294  ASN A HD22 1 
ATOM   1435  N  N    . GLU A  1 103 ? 188.770 79.182  58.423  1.00 71.76  ? 295  GLU A N    1 
ATOM   1436  C  CA   . GLU A  1 103 ? 187.817 79.918  57.600  1.00 73.02  ? 295  GLU A CA   1 
ATOM   1437  C  C    . GLU A  1 103 ? 188.495 81.042  56.827  1.00 70.41  ? 295  GLU A C    1 
ATOM   1438  O  O    . GLU A  1 103 ? 188.045 81.396  55.732  1.00 69.04  ? 295  GLU A O    1 
ATOM   1439  C  CB   . GLU A  1 103 ? 186.693 80.476  58.473  1.00 72.32  ? 295  GLU A CB   1 
ATOM   1440  C  CG   . GLU A  1 103 ? 185.825 79.406  59.121  1.00 78.26  ? 295  GLU A CG   1 
ATOM   1441  C  CD   . GLU A  1 103 ? 184.976 78.652  58.115  1.00 80.13  ? 295  GLU A CD   1 
ATOM   1442  O  OE1  . GLU A  1 103 ? 184.867 79.117  56.959  1.00 77.67  ? 295  GLU A OE1  1 
ATOM   1443  O  OE2  . GLU A  1 103 ? 184.418 77.594  58.480  1.00 80.50  ? 295  GLU A OE2  1 
ATOM   1444  H  H    . GLU A  1 103 ? 188.658 79.274  59.271  1.00 85.86  ? 295  GLU A H    1 
ATOM   1445  H  HA   . GLU A  1 103 ? 187.422 79.310  56.956  1.00 87.37  ? 295  GLU A HA   1 
ATOM   1446  H  HB2  . GLU A  1 103 ? 187.084 81.010  59.182  1.00 86.54  ? 295  GLU A HB2  1 
ATOM   1447  H  HB3  . GLU A  1 103 ? 186.117 81.031  57.924  1.00 86.54  ? 295  GLU A HB3  1 
ATOM   1448  H  HG2  . GLU A  1 103 ? 186.398 78.766  59.571  1.00 93.67  ? 295  GLU A HG2  1 
ATOM   1449  H  HG3  . GLU A  1 103 ? 185.230 79.827  59.761  1.00 93.67  ? 295  GLU A HG3  1 
ATOM   1450  N  N    . THR A  1 104 ? 189.570 81.614  57.374  1.00 73.41  ? 296  THR A N    1 
ATOM   1451  C  CA   . THR A  1 104 ? 190.295 82.655  56.654  1.00 70.98  ? 296  THR A CA   1 
ATOM   1452  C  C    . THR A  1 104 ? 190.891 82.115  55.359  1.00 73.42  ? 296  THR A C    1 
ATOM   1453  O  O    . THR A  1 104 ? 190.818 82.771  54.313  1.00 75.21  ? 296  THR A O    1 
ATOM   1454  C  CB   . THR A  1 104 ? 191.390 83.245  57.542  1.00 65.66  ? 296  THR A CB   1 
ATOM   1455  O  OG1  . THR A  1 104 ? 190.807 83.737  58.754  1.00 71.51  ? 296  THR A OG1  1 
ATOM   1456  C  CG2  . THR A  1 104 ? 192.100 84.393  56.833  1.00 64.56  ? 296  THR A CG2  1 
ATOM   1457  H  H    . THR A  1 104 ? 189.892 81.420  58.147  1.00 87.85  ? 296  THR A H    1 
ATOM   1458  H  HA   . THR A  1 104 ? 189.679 83.368  56.424  1.00 84.93  ? 296  THR A HA   1 
ATOM   1459  H  HB   . THR A  1 104 ? 192.043 82.559  57.752  1.00 78.55  ? 296  THR A HB   1 
ATOM   1460  H  HG1  . THR A  1 104 ? 190.241 84.333  58.579  1.00 85.57  ? 296  THR A HG1  1 
ATOM   1461  H  HG21 . THR A  1 104 ? 192.792 84.759  57.407  1.00 77.23  ? 296  THR A HG21 1 
ATOM   1462  H  HG22 . THR A  1 104 ? 192.507 84.075  56.013  1.00 77.23  ? 296  THR A HG22 1 
ATOM   1463  H  HG23 . THR A  1 104 ? 191.465 85.094  56.619  1.00 77.23  ? 296  THR A HG23 1 
ATOM   1464  N  N    . MET A  1 105 ? 191.481 80.917  55.402  1.00 72.94  ? 297  MET A N    1 
ATOM   1465  C  CA   . MET A  1 105 ? 192.063 80.346  54.192  1.00 75.92  ? 297  MET A CA   1 
ATOM   1466  C  C    . MET A  1 105 ? 190.980 79.964  53.191  1.00 74.07  ? 297  MET A C    1 
ATOM   1467  O  O    . MET A  1 105 ? 191.151 80.152  51.981  1.00 75.12  ? 297  MET A O    1 
ATOM   1468  C  CB   . MET A  1 105 ? 192.908 79.116  54.535  1.00 82.59  ? 297  MET A CB   1 
ATOM   1469  C  CG   . MET A  1 105 ? 194.260 79.387  55.198  1.00 86.65  ? 297  MET A CG   1 
ATOM   1470  S  SD   . MET A  1 105 ? 195.427 80.334  54.194  1.00 95.92  ? 297  MET A SD   1 
ATOM   1471  C  CE   . MET A  1 105 ? 195.323 81.960  54.945  1.00 90.18  ? 297  MET A CE   1 
ATOM   1472  H  H    . MET A  1 105 ? 191.555 80.427  56.105  1.00 87.28  ? 297  MET A H    1 
ATOM   1473  H  HA   . MET A  1 105 ? 192.647 81.004  53.785  1.00 90.86  ? 297  MET A HA   1 
ATOM   1474  H  HB2  . MET A  1 105 ? 192.398 78.556  55.140  1.00 98.86  ? 297  MET A HB2  1 
ATOM   1475  H  HB3  . MET A  1 105 ? 193.082 78.629  53.715  1.00 98.86  ? 297  MET A HB3  1 
ATOM   1476  H  HG2  . MET A  1 105 ? 194.109 79.884  56.017  1.00 103.73 ? 297  MET A HG2  1 
ATOM   1477  H  HG3  . MET A  1 105 ? 194.677 78.536  55.406  1.00 103.73 ? 297  MET A HG3  1 
ATOM   1478  H  HE1  . MET A  1 105 ? 195.921 82.563  54.475  1.00 107.96 ? 297  MET A HE1  1 
ATOM   1479  H  HE2  . MET A  1 105 ? 194.410 82.281  54.877  1.00 107.96 ? 297  MET A HE2  1 
ATOM   1480  H  HE3  . MET A  1 105 ? 195.583 81.895  55.877  1.00 107.96 ? 297  MET A HE3  1 
ATOM   1481  N  N    . LEU A  1 106 ? 189.854 79.435  53.677  1.00 74.03  ? 298  LEU A N    1 
ATOM   1482  C  CA   . LEU A  1 106 ? 188.743 79.107  52.788  1.00 75.52  ? 298  LEU A CA   1 
ATOM   1483  C  C    . LEU A  1 106 ? 188.202 80.351  52.099  1.00 78.93  ? 298  LEU A C    1 
ATOM   1484  O  O    . LEU A  1 106 ? 187.854 80.312  50.913  1.00 79.96  ? 298  LEU A O    1 
ATOM   1485  C  CB   . LEU A  1 106 ? 187.634 78.412  53.577  1.00 71.65  ? 298  LEU A CB   1 
ATOM   1486  C  CG   . LEU A  1 106 ? 187.956 77.025  54.132  1.00 69.64  ? 298  LEU A CG   1 
ATOM   1487  C  CD1  . LEU A  1 106 ? 186.829 76.554  55.028  1.00 69.78  ? 298  LEU A CD1  1 
ATOM   1488  C  CD2  . LEU A  1 106 ? 188.186 76.029  53.007  1.00 67.08  ? 298  LEU A CD2  1 
ATOM   1489  H  H    . LEU A  1 106 ? 189.712 79.259  54.506  1.00 88.58  ? 298  LEU A H    1 
ATOM   1490  H  HA   . LEU A  1 106 ? 189.055 78.495  52.104  1.00 90.37  ? 298  LEU A HA   1 
ATOM   1491  H  HB2  . LEU A  1 106 ? 187.399 78.976  54.331  1.00 85.73  ? 298  LEU A HB2  1 
ATOM   1492  H  HB3  . LEU A  1 106 ? 186.863 78.317  52.996  1.00 85.73  ? 298  LEU A HB3  1 
ATOM   1493  H  HG   . LEU A  1 106 ? 188.766 77.074  54.663  1.00 83.32  ? 298  LEU A HG   1 
ATOM   1494  H  HD11 . LEU A  1 106 ? 187.046 75.674  55.372  1.00 83.48  ? 298  LEU A HD11 1 
ATOM   1495  H  HD12 . LEU A  1 106 ? 186.726 77.180  55.761  1.00 83.48  ? 298  LEU A HD12 1 
ATOM   1496  H  HD13 . LEU A  1 106 ? 186.010 76.514  54.510  1.00 83.48  ? 298  LEU A HD13 1 
ATOM   1497  H  HD21 . LEU A  1 106 ? 188.388 75.162  53.390  1.00 80.25  ? 298  LEU A HD21 1 
ATOM   1498  H  HD22 . LEU A  1 106 ? 187.383 75.974  52.465  1.00 80.25  ? 298  LEU A HD22 1 
ATOM   1499  H  HD23 . LEU A  1 106 ? 188.931 76.333  52.465  1.00 80.25  ? 298  LEU A HD23 1 
ATOM   1500  N  N    . ASP A  1 107 ? 188.123 81.466  52.826  1.00 80.29  ? 299  ASP A N    1 
ATOM   1501  C  CA   . ASP A  1 107 ? 187.669 82.711  52.218  1.00 80.14  ? 299  ASP A CA   1 
ATOM   1502  C  C    . ASP A  1 107 ? 188.647 83.187  51.154  1.00 73.17  ? 299  ASP A C    1 
ATOM   1503  O  O    . ASP A  1 107 ? 188.234 83.666  50.092  1.00 74.47  ? 299  ASP A O    1 
ATOM   1504  C  CB   . ASP A  1 107 ? 187.486 83.779  53.295  1.00 85.87  ? 299  ASP A CB   1 
ATOM   1505  C  CG   . ASP A  1 107 ? 186.299 83.500  54.197  1.00 93.15  ? 299  ASP A CG   1 
ATOM   1506  O  OD1  . ASP A  1 107 ? 185.534 82.557  53.903  1.00 95.19  ? 299  ASP A OD1  1 
ATOM   1507  O  OD2  . ASP A  1 107 ? 186.134 84.221  55.202  1.00 94.62  ? 299  ASP A OD2  1 
ATOM   1508  H  H    . ASP A  1 107 ? 188.323 81.526  53.661  1.00 96.10  ? 299  ASP A H    1 
ATOM   1509  H  HA   . ASP A  1 107 ? 186.810 82.561  51.793  1.00 95.91  ? 299  ASP A HA   1 
ATOM   1510  H  HB2  . ASP A  1 107 ? 188.282 83.812  53.848  1.00 102.79 ? 299  ASP A HB2  1 
ATOM   1511  H  HB3  . ASP A  1 107 ? 187.342 84.638  52.868  1.00 102.79 ? 299  ASP A HB3  1 
ATOM   1512  N  N    . PHE A  1 108 ? 189.947 83.062  51.421  1.00 73.36  ? 300  PHE A N    1 
ATOM   1513  C  CA   . PHE A  1 108 ? 190.949 83.440  50.432  1.00 75.75  ? 300  PHE A CA   1 
ATOM   1514  C  C    . PHE A  1 108 ? 190.778 82.643  49.145  1.00 80.27  ? 300  PHE A C    1 
ATOM   1515  O  O    . PHE A  1 108 ? 190.809 83.206  48.044  1.00 81.72  ? 300  PHE A O    1 
ATOM   1516  C  CB   . PHE A  1 108 ? 192.350 83.232  51.010  1.00 73.90  ? 300  PHE A CB   1 
ATOM   1517  C  CG   . PHE A  1 108 ? 193.458 83.613  50.068  1.00 76.77  ? 300  PHE A CG   1 
ATOM   1518  C  CD1  . PHE A  1 108 ? 193.914 82.718  49.115  1.00 77.11  ? 300  PHE A CD1  1 
ATOM   1519  C  CD2  . PHE A  1 108 ? 194.046 84.864  50.139  1.00 78.47  ? 300  PHE A CD2  1 
ATOM   1520  C  CE1  . PHE A  1 108 ? 194.929 83.063  48.249  1.00 78.26  ? 300  PHE A CE1  1 
ATOM   1521  C  CE2  . PHE A  1 108 ? 195.064 85.215  49.276  1.00 77.80  ? 300  PHE A CE2  1 
ATOM   1522  C  CZ   . PHE A  1 108 ? 195.505 84.313  48.330  1.00 80.33  ? 300  PHE A CZ   1 
ATOM   1523  H  H    . PHE A  1 108 ? 190.270 82.764  52.161  1.00 87.78  ? 300  PHE A H    1 
ATOM   1524  H  HA   . PHE A  1 108 ? 190.847 84.381  50.220  1.00 90.65  ? 300  PHE A HA   1 
ATOM   1525  H  HB2  . PHE A  1 108 ? 192.442 83.774  51.810  1.00 88.44  ? 300  PHE A HB2  1 
ATOM   1526  H  HB3  . PHE A  1 108 ? 192.460 82.295  51.234  1.00 88.44  ? 300  PHE A HB3  1 
ATOM   1527  H  HD1  . PHE A  1 108 ? 193.528 81.874  49.056  1.00 92.28  ? 300  PHE A HD1  1 
ATOM   1528  H  HD2  . PHE A  1 108 ? 193.751 85.475  50.775  1.00 93.91  ? 300  PHE A HD2  1 
ATOM   1529  H  HE1  . PHE A  1 108 ? 195.226 82.454  47.613  1.00 93.66  ? 300  PHE A HE1  1 
ATOM   1530  H  HE2  . PHE A  1 108 ? 195.451 86.059  49.332  1.00 93.11  ? 300  PHE A HE2  1 
ATOM   1531  H  HZ   . PHE A  1 108 ? 196.191 84.548  47.747  1.00 96.15  ? 300  PHE A HZ   1 
ATOM   1532  N  N    . ARG A  1 109 ? 190.595 81.326  49.262  1.00 78.86  ? 301  ARG A N    1 
ATOM   1533  C  CA   . ARG A  1 109 ? 190.537 80.484  48.072  1.00 85.46  ? 301  ARG A CA   1 
ATOM   1534  C  C    . ARG A  1 109 ? 189.297 80.783  47.237  1.00 83.79  ? 301  ARG A C    1 
ATOM   1535  O  O    . ARG A  1 109 ? 189.353 80.756  46.002  1.00 87.38  ? 301  ARG A O    1 
ATOM   1536  C  CB   . ARG A  1 109 ? 190.565 79.008  48.465  1.00 94.17  ? 301  ARG A CB   1 
ATOM   1537  C  CG   . ARG A  1 109 ? 190.541 78.082  47.262  1.00 106.01 ? 301  ARG A CG   1 
ATOM   1538  C  CD   . ARG A  1 109 ? 191.195 76.734  47.526  1.00 111.85 ? 301  ARG A CD   1 
ATOM   1539  N  NE   . ARG A  1 109 ? 191.326 75.987  46.280  1.00 119.63 ? 301  ARG A NE   1 
ATOM   1540  C  CZ   . ARG A  1 109 ? 192.240 76.234  45.345  1.00 126.06 ? 301  ARG A CZ   1 
ATOM   1541  N  NH1  . ARG A  1 109 ? 192.257 75.507  44.239  1.00 129.71 ? 301  ARG A NH1  1 
ATOM   1542  N  NH2  . ARG A  1 109 ? 193.151 77.185  45.519  1.00 125.60 ? 301  ARG A NH2  1 
ATOM   1543  H  H    . ARG A  1 109 ? 190.505 80.905  50.006  1.00 94.39  ? 301  ARG A H    1 
ATOM   1544  H  HA   . ARG A  1 109 ? 191.316 80.661  47.523  1.00 102.30 ? 301  ARG A HA   1 
ATOM   1545  H  HB2  . ARG A  1 109 ? 191.376 78.829  48.966  1.00 112.76 ? 301  ARG A HB2  1 
ATOM   1546  H  HB3  . ARG A  1 109 ? 189.787 78.811  49.011  1.00 112.76 ? 301  ARG A HB3  1 
ATOM   1547  H  HG2  . ARG A  1 109 ? 189.619 77.922  47.007  1.00 126.96 ? 301  ARG A HG2  1 
ATOM   1548  H  HG3  . ARG A  1 109 ? 191.017 78.506  46.531  1.00 126.96 ? 301  ARG A HG3  1 
ATOM   1549  H  HD2  . ARG A  1 109 ? 192.080 76.869  47.900  1.00 133.97 ? 301  ARG A HD2  1 
ATOM   1550  H  HD3  . ARG A  1 109 ? 190.643 76.220  48.137  1.00 133.97 ? 301  ARG A HD3  1 
ATOM   1551  H  HE   . ARG A  1 109 ? 190.775 75.342  46.140  1.00 143.30 ? 301  ARG A HE   1 
ATOM   1552  H  HH11 . ARG A  1 109 ? 191.675 74.884  44.125  1.00 155.41 ? 301  ARG A HH11 1 
ATOM   1553  H  HH12 . ARG A  1 109 ? 192.854 75.653  43.638  1.00 155.41 ? 301  ARG A HH12 1 
ATOM   1554  H  HH21 . ARG A  1 109 ? 193.142 77.663  46.234  1.00 150.47 ? 301  ARG A HH21 1 
ATOM   1555  H  HH22 . ARG A  1 109 ? 193.741 77.332  44.911  1.00 150.47 ? 301  ARG A HH22 1 
ATOM   1556  N  N    . THR A  1 110 ? 188.171 81.070  47.887  1.00 73.32  ? 302  THR A N    1 
ATOM   1557  C  CA   . THR A  1 110 ? 186.902 81.258  47.194  1.00 75.44  ? 302  THR A CA   1 
ATOM   1558  C  C    . THR A  1 110 ? 186.671 82.698  46.753  1.00 78.85  ? 302  THR A C    1 
ATOM   1559  O  O    . THR A  1 110 ? 185.667 82.970  46.086  1.00 79.87  ? 302  THR A O    1 
ATOM   1560  C  CB   . THR A  1 110 ? 185.739 80.813  48.088  1.00 74.27  ? 302  THR A CB   1 
ATOM   1561  O  OG1  . THR A  1 110 ? 185.725 81.593  49.290  1.00 75.87  ? 302  THR A OG1  1 
ATOM   1562  C  CG2  . THR A  1 110 ? 185.870 79.341  48.447  1.00 74.74  ? 302  THR A CG2  1 
ATOM   1563  H  H    . THR A  1 110 ? 188.117 81.161  48.741  1.00 87.73  ? 302  THR A H    1 
ATOM   1564  H  HA   . THR A  1 110 ? 186.896 80.701  46.400  1.00 90.28  ? 302  THR A HA   1 
ATOM   1565  H  HB   . THR A  1 110 ? 184.902 80.938  47.614  1.00 88.88  ? 302  THR A HB   1 
ATOM   1566  H  HG1  . THR A  1 110 ? 186.446 81.491  49.707  1.00 90.80  ? 302  THR A HG1  1 
ATOM   1567  H  HG21 . THR A  1 110 ? 185.130 79.070  49.012  1.00 89.44  ? 302  THR A HG21 1 
ATOM   1568  H  HG22 . THR A  1 110 ? 185.865 78.802  47.640  1.00 89.44  ? 302  THR A HG22 1 
ATOM   1569  H  HG23 . THR A  1 110 ? 186.702 79.189  48.922  1.00 89.44  ? 302  THR A HG23 1 
ATOM   1570  N  N    . SER A  1 111 ? 187.564 83.618  47.104  1.00 85.98  ? 303  SER A N    1 
ATOM   1571  C  CA   . SER A  1 111 ? 187.433 85.021  46.745  1.00 84.91  ? 303  SER A CA   1 
ATOM   1572  C  C    . SER A  1 111 ? 188.482 85.384  45.705  1.00 82.76  ? 303  SER A C    1 
ATOM   1573  O  O    . SER A  1 111 ? 189.561 84.786  45.650  1.00 84.94  ? 303  SER A O    1 
ATOM   1574  C  CB   . SER A  1 111 ? 187.591 85.926  47.970  1.00 87.60  ? 303  SER A CB   1 
ATOM   1575  O  OG   . SER A  1 111 ? 186.593 85.658  48.939  1.00 92.98  ? 303  SER A OG   1 
ATOM   1576  H  H    . SER A  1 111 ? 188.271 83.446  47.562  1.00 102.93 ? 303  SER A H    1 
ATOM   1577  H  HA   . SER A  1 111 ? 186.555 85.175  46.362  1.00 101.64 ? 303  SER A HA   1 
ATOM   1578  H  HB2  . SER A  1 111 ? 188.463 85.770  48.366  1.00 104.87 ? 303  SER A HB2  1 
ATOM   1579  H  HB3  . SER A  1 111 ? 187.517 86.851  47.689  1.00 104.87 ? 303  SER A HB3  1 
ATOM   1580  H  HG   . SER A  1 111 ? 186.645 84.859  49.193  1.00 111.33 ? 303  SER A HG   1 
ATOM   1581  N  N    . LYS A  1 112 ? 188.155 86.368  44.875  1.00 72.32  ? 304  LYS A N    1 
ATOM   1582  C  CA   . LYS A  1 112 ? 189.092 86.851  43.873  1.00 72.14  ? 304  LYS A CA   1 
ATOM   1583  C  C    . LYS A  1 112 ? 190.030 87.874  44.503  1.00 73.95  ? 304  LYS A C    1 
ATOM   1584  O  O    . LYS A  1 112 ? 189.583 88.889  45.047  1.00 76.04  ? 304  LYS A O    1 
ATOM   1585  C  CB   . LYS A  1 112 ? 188.345 87.450  42.684  1.00 74.54  ? 304  LYS A CB   1 
ATOM   1586  C  CG   . LYS A  1 112 ? 187.568 86.419  41.880  1.00 83.59  ? 304  LYS A CG   1 
ATOM   1587  C  CD   . LYS A  1 112 ? 188.002 86.394  40.422  1.00 93.70  ? 304  LYS A CD   1 
ATOM   1588  C  CE   . LYS A  1 112 ? 187.037 85.590  39.565  1.00 99.39  ? 304  LYS A CE   1 
ATOM   1589  N  NZ   . LYS A  1 112 ? 187.425 85.602  38.126  1.00 104.08 ? 304  LYS A NZ   1 
ATOM   1590  H  H    . LYS A  1 112 ? 187.395 86.771  44.872  1.00 86.53  ? 304  LYS A H    1 
ATOM   1591  H  HA   . LYS A  1 112 ? 189.626 86.108  43.552  1.00 86.32  ? 304  LYS A HA   1 
ATOM   1592  H  HB2  . LYS A  1 112 ? 187.715 88.111  43.009  1.00 89.20  ? 304  LYS A HB2  1 
ATOM   1593  H  HB3  . LYS A  1 112 ? 188.987 87.870  42.089  1.00 89.20  ? 304  LYS A HB3  1 
ATOM   1594  H  HG2  . LYS A  1 112 ? 187.722 85.539  42.257  1.00 100.06 ? 304  LYS A HG2  1 
ATOM   1595  H  HG3  . LYS A  1 112 ? 186.623 86.637  41.911  1.00 100.06 ? 304  LYS A HG3  1 
ATOM   1596  H  HD2  . LYS A  1 112 ? 188.028 87.302  40.081  1.00 112.19 ? 304  LYS A HD2  1 
ATOM   1597  H  HD3  . LYS A  1 112 ? 188.880 85.986  40.357  1.00 112.19 ? 304  LYS A HD3  1 
ATOM   1598  H  HE2  . LYS A  1 112 ? 187.033 84.669  39.870  1.00 119.02 ? 304  LYS A HE2  1 
ATOM   1599  H  HE3  . LYS A  1 112 ? 186.149 85.971  39.643  1.00 119.02 ? 304  LYS A HE3  1 
ATOM   1600  H  HZ1  . LYS A  1 112 ? 186.843 85.124  37.651  1.00 124.65 ? 304  LYS A HZ1  1 
ATOM   1601  H  HZ2  . LYS A  1 112 ? 187.431 86.438  37.820  1.00 124.65 ? 304  LYS A HZ2  1 
ATOM   1602  H  HZ3  . LYS A  1 112 ? 188.237 85.251  38.027  1.00 124.65 ? 304  LYS A HZ3  1 
ATOM   1603  N  N    . PHE A  1 113 ? 191.328 87.592  44.437  1.00 74.73  ? 305  PHE A N    1 
ATOM   1604  C  CA   . PHE A  1 113 ? 192.342 88.507  44.943  1.00 74.51  ? 305  PHE A CA   1 
ATOM   1605  C  C    . PHE A  1 113 ? 192.481 89.687  43.990  1.00 76.44  ? 305  PHE A C    1 
ATOM   1606  O  O    . PHE A  1 113 ? 192.686 89.502  42.786  1.00 79.99  ? 305  PHE A O    1 
ATOM   1607  C  CB   . PHE A  1 113 ? 193.667 87.757  45.089  1.00 74.25  ? 305  PHE A CB   1 
ATOM   1608  C  CG   . PHE A  1 113 ? 194.775 88.562  45.710  1.00 76.70  ? 305  PHE A CG   1 
ATOM   1609  C  CD1  . PHE A  1 113 ? 195.541 89.422  44.939  1.00 77.12  ? 305  PHE A CD1  1 
ATOM   1610  C  CD2  . PHE A  1 113 ? 195.073 88.432  47.057  1.00 75.58  ? 305  PHE A CD2  1 
ATOM   1611  C  CE1  . PHE A  1 113 ? 196.573 90.149  45.504  1.00 75.89  ? 305  PHE A CE1  1 
ATOM   1612  C  CE2  . PHE A  1 113 ? 196.104 89.158  47.627  1.00 75.58  ? 305  PHE A CE2  1 
ATOM   1613  C  CZ   . PHE A  1 113 ? 196.855 90.017  46.848  1.00 75.94  ? 305  PHE A CZ   1 
ATOM   1614  H  H    . PHE A  1 113 ? 191.649 86.869  44.100  1.00 89.43  ? 305  PHE A H    1 
ATOM   1615  H  HA   . PHE A  1 113 ? 192.076 88.840  45.814  1.00 89.17  ? 305  PHE A HA   1 
ATOM   1616  H  HB2  . PHE A  1 113 ? 193.522 86.978  45.648  1.00 88.86  ? 305  PHE A HB2  1 
ATOM   1617  H  HB3  . PHE A  1 113 ? 193.964 87.478  44.209  1.00 88.86  ? 305  PHE A HB3  1 
ATOM   1618  H  HD1  . PHE A  1 113 ? 195.357 89.514  44.032  1.00 92.30  ? 305  PHE A HD1  1 
ATOM   1619  H  HD2  . PHE A  1 113 ? 194.571 87.854  47.585  1.00 90.45  ? 305  PHE A HD2  1 
ATOM   1620  H  HE1  . PHE A  1 113 ? 197.077 90.728  44.978  1.00 90.82  ? 305  PHE A HE1  1 
ATOM   1621  H  HE2  . PHE A  1 113 ? 196.291 89.068  48.533  1.00 90.44  ? 305  PHE A HE2  1 
ATOM   1622  H  HZ   . PHE A  1 113 ? 197.547 90.508  47.230  1.00 90.88  ? 305  PHE A HZ   1 
ATOM   1623  N  N    . VAL A  1 114 ? 192.357 90.901  44.520  1.00 76.86  ? 306  VAL A N    1 
ATOM   1624  C  CA   . VAL A  1 114 ? 192.366 92.101  43.692  1.00 78.54  ? 306  VAL A CA   1 
ATOM   1625  C  C    . VAL A  1 114 ? 193.799 92.562  43.488  1.00 76.02  ? 306  VAL A C    1 
ATOM   1626  O  O    . VAL A  1 114 ? 194.640 92.473  44.389  1.00 75.51  ? 306  VAL A O    1 
ATOM   1627  C  CB   . VAL A  1 114 ? 191.505 93.214  44.315  1.00 82.40  ? 306  VAL A CB   1 
ATOM   1628  C  CG1  . VAL A  1 114 ? 191.622 94.506  43.501  1.00 83.07  ? 306  VAL A CG1  1 
ATOM   1629  C  CG2  . VAL A  1 114 ? 190.054 92.776  44.393  1.00 83.90  ? 306  VAL A CG2  1 
ATOM   1630  H  H    . VAL A  1 114 ? 192.267 91.056  45.361  1.00 91.99  ? 306  VAL A H    1 
ATOM   1631  H  HA   . VAL A  1 114 ? 191.994 91.886  42.822  1.00 94.00  ? 306  VAL A HA   1 
ATOM   1632  H  HB   . VAL A  1 114 ? 191.817 93.393  45.216  1.00 98.64  ? 306  VAL A HB   1 
ATOM   1633  H  HG11 . VAL A  1 114 ? 191.071 95.189  43.914  1.00 99.44  ? 306  VAL A HG11 1 
ATOM   1634  H  HG12 . VAL A  1 114 ? 192.550 94.789  43.491  1.00 99.44  ? 306  VAL A HG12 1 
ATOM   1635  H  HG13 . VAL A  1 114 ? 191.317 94.337  42.596  1.00 99.44  ? 306  VAL A HG13 1 
ATOM   1636  H  HG21 . VAL A  1 114 ? 189.530 93.490  44.788  1.00 100.43 ? 306  VAL A HG21 1 
ATOM   1637  H  HG22 . VAL A  1 114 ? 189.734 92.585  43.497  1.00 100.43 ? 306  VAL A HG22 1 
ATOM   1638  H  HG23 . VAL A  1 114 ? 189.995 91.978  44.942  1.00 100.43 ? 306  VAL A HG23 1 
ATOM   1639  N  N    . LEU A  1 115 ? 194.064 93.073  42.291  1.00 83.62  ? 307  LEU A N    1 
ATOM   1640  C  CA   . LEU A  1 115 ? 195.413 93.394  41.846  1.00 85.48  ? 307  LEU A CA   1 
ATOM   1641  C  C    . LEU A  1 115 ? 195.306 94.566  40.883  1.00 86.59  ? 307  LEU A C    1 
ATOM   1642  O  O    . LEU A  1 115 ? 194.597 94.469  39.877  1.00 87.43  ? 307  LEU A O    1 
ATOM   1643  C  CB   . LEU A  1 115 ? 196.039 92.169  41.176  1.00 89.20  ? 307  LEU A CB   1 
ATOM   1644  C  CG   . LEU A  1 115 ? 197.529 92.102  40.861  1.00 92.54  ? 307  LEU A CG   1 
ATOM   1645  C  CD1  . LEU A  1 115 ? 198.010 90.679  41.066  1.00 95.62  ? 307  LEU A CD1  1 
ATOM   1646  C  CD2  . LEU A  1 115 ? 197.779 92.533  39.433  1.00 95.83  ? 307  LEU A CD2  1 
ATOM   1647  H  H    . LEU A  1 115 ? 193.461 93.248  41.703  1.00 100.09 ? 307  LEU A H    1 
ATOM   1648  H  HA   . LEU A  1 115 ? 195.960 93.656  42.604  1.00 102.32 ? 307  LEU A HA   1 
ATOM   1649  H  HB2  . LEU A  1 115 ? 195.851 91.406  41.745  1.00 106.79 ? 307  LEU A HB2  1 
ATOM   1650  H  HB3  . LEU A  1 115 ? 195.580 92.041  40.331  1.00 106.79 ? 307  LEU A HB3  1 
ATOM   1651  H  HG   . LEU A  1 115 ? 198.020 92.689  41.457  1.00 110.80 ? 307  LEU A HG   1 
ATOM   1652  H  HD11 . LEU A  1 115 ? 198.958 90.635  40.866  1.00 114.50 ? 307  LEU A HD11 1 
ATOM   1653  H  HD12 . LEU A  1 115 ? 197.854 90.424  41.989  1.00 114.50 ? 307  LEU A HD12 1 
ATOM   1654  H  HD13 . LEU A  1 115 ? 197.518 90.092  40.472  1.00 114.50 ? 307  LEU A HD13 1 
ATOM   1655  H  HD21 . LEU A  1 115 ? 198.731 92.484  39.251  1.00 114.75 ? 307  LEU A HD21 1 
ATOM   1656  H  HD22 . LEU A  1 115 ? 197.297 91.940  38.836  1.00 114.75 ? 307  LEU A HD22 1 
ATOM   1657  H  HD23 . LEU A  1 115 ? 197.466 93.444  39.319  1.00 114.75 ? 307  LEU A HD23 1 
ATOM   1658  N  N    . ARG A  1 116 ? 195.989 95.667  41.189  1.00 82.91  ? 308  ARG A N    1 
ATOM   1659  C  CA   . ARG A  1 116 ? 195.873 96.901  40.418  1.00 81.43  ? 308  ARG A CA   1 
ATOM   1660  C  C    . ARG A  1 116 ? 197.146 97.116  39.612  1.00 80.24  ? 308  ARG A C    1 
ATOM   1661  O  O    . ARG A  1 116 ? 198.235 97.230  40.185  1.00 82.73  ? 308  ARG A O    1 
ATOM   1662  C  CB   . ARG A  1 116 ? 195.615 98.103  41.329  1.00 80.07  ? 308  ARG A CB   1 
ATOM   1663  C  CG   . ARG A  1 116 ? 194.498 97.896  42.341  1.00 82.50  ? 308  ARG A CG   1 
ATOM   1664  C  CD   . ARG A  1 116 ? 193.909 99.218  42.820  1.00 84.92  ? 308  ARG A CD   1 
ATOM   1665  N  NE   . ARG A  1 116 ? 193.236 99.932  41.733  1.00 89.74  ? 308  ARG A NE   1 
ATOM   1666  C  CZ   . ARG A  1 116 ? 193.564 101.143 41.284  1.00 90.42  ? 308  ARG A CZ   1 
ATOM   1667  N  NH1  . ARG A  1 116 ? 194.561 101.834 41.823  1.00 88.10  ? 308  ARG A NH1  1 
ATOM   1668  N  NH2  . ARG A  1 116 ? 192.873 101.678 40.286  1.00 93.94  ? 308  ARG A NH2  1 
ATOM   1669  H  H    . ARG A  1 116 ? 196.536 95.724  41.851  1.00 99.25  ? 308  ARG A H    1 
ATOM   1670  H  HA   . ARG A  1 116 ? 195.130 96.823  39.799  1.00 97.46  ? 308  ARG A HA   1 
ATOM   1671  H  HB2  . ARG A  1 116 ? 196.427 98.299  41.822  1.00 95.83  ? 308  ARG A HB2  1 
ATOM   1672  H  HB3  . ARG A  1 116 ? 195.375 98.864  40.777  1.00 95.83  ? 308  ARG A HB3  1 
ATOM   1673  H  HG2  . ARG A  1 116 ? 193.787 97.380  41.930  1.00 98.75  ? 308  ARG A HG2  1 
ATOM   1674  H  HG3  . ARG A  1 116 ? 194.851 97.426  43.112  1.00 98.75  ? 308  ARG A HG3  1 
ATOM   1675  H  HD2  . ARG A  1 116 ? 193.258 99.044  43.518  1.00 101.66 ? 308  ARG A HD2  1 
ATOM   1676  H  HD3  . ARG A  1 116 ? 194.622 99.782  43.159  1.00 101.66 ? 308  ARG A HD3  1 
ATOM   1677  H  HE   . ARG A  1 116 ? 192.574 99.537  41.353  1.00 107.44 ? 308  ARG A HE   1 
ATOM   1678  H  HH11 . ARG A  1 116 ? 195.017 101.498 42.471  1.00 105.48 ? 308  ARG A HH11 1 
ATOM   1679  H  HH12 . ARG A  1 116 ? 194.756 102.615 41.521  1.00 105.48 ? 308  ARG A HH12 1 
ATOM   1680  H  HH21 . ARG A  1 116 ? 192.222 101.241 39.931  1.00 112.48 ? 308  ARG A HH21 1 
ATOM   1681  H  HH22 . ARG A  1 116 ? 193.075 102.461 39.993  1.00 112.48 ? 308  ARG A HH22 1 
ATOM   1682  N  N    . ILE A  1 117 ? 197.007 97.172  38.286  1.00 78.57  ? 309  ILE A N    1 
ATOM   1683  C  CA   . ILE A  1 117 ? 198.127 97.436  37.393  1.00 81.36  ? 309  ILE A CA   1 
ATOM   1684  C  C    . ILE A  1 117 ? 197.669 98.389  36.299  1.00 83.41  ? 309  ILE A C    1 
ATOM   1685  O  O    . ILE A  1 117 ? 196.475 98.552  36.039  1.00 83.64  ? 309  ILE A O    1 
ATOM   1686  C  CB   . ILE A  1 117 ? 198.712 96.151  36.762  1.00 81.14  ? 309  ILE A CB   1 
ATOM   1687  C  CG1  . ILE A  1 117 ? 197.635 95.382  35.990  1.00 83.76  ? 309  ILE A CG1  1 
ATOM   1688  C  CG2  . ILE A  1 117 ? 199.327 95.275  37.840  1.00 83.48  ? 309  ILE A CG2  1 
ATOM   1689  C  CD1  . ILE A  1 117 ? 198.177 94.208  35.191  1.00 86.01  ? 309  ILE A CD1  1 
ATOM   1690  H  H    . ILE A  1 117 ? 196.259 97.057  37.876  1.00 94.03  ? 309  ILE A H    1 
ATOM   1691  H  HA   . ILE A  1 117 ? 198.834 97.872  37.895  1.00 97.38  ? 309  ILE A HA   1 
ATOM   1692  H  HB   . ILE A  1 117 ? 199.411 96.407  36.139  1.00 97.11  ? 309  ILE A HB   1 
ATOM   1693  H  HG12 . ILE A  1 117 ? 196.984 95.037  36.621  1.00 100.27 ? 309  ILE A HG12 1 
ATOM   1694  H  HG13 . ILE A  1 117 ? 197.201 95.988  35.369  1.00 100.27 ? 309  ILE A HG13 1 
ATOM   1695  H  HG21 . ILE A  1 117 ? 199.688 94.475  37.428  1.00 99.93  ? 309  ILE A HG21 1 
ATOM   1696  H  HG22 . ILE A  1 117 ? 200.035 95.769  38.282  1.00 99.93  ? 309  ILE A HG22 1 
ATOM   1697  H  HG23 . ILE A  1 117 ? 198.640 95.036  38.482  1.00 99.93  ? 309  ILE A HG23 1 
ATOM   1698  H  HD11 . ILE A  1 117 ? 197.442 93.772  34.733  1.00 102.96 ? 309  ILE A HD11 1 
ATOM   1699  H  HD12 . ILE A  1 117 ? 198.823 94.536  34.546  1.00 102.96 ? 309  ILE A HD12 1 
ATOM   1700  H  HD13 . ILE A  1 117 ? 198.605 93.584  35.799  1.00 102.96 ? 309  ILE A HD13 1 
ATOM   1701  N  N    . SER A  1 118 ? 198.643 99.027  35.659  1.00 85.77  ? 310  SER A N    1 
ATOM   1702  C  CA   . SER A  1 118 ? 198.357 99.920  34.551  1.00 87.60  ? 310  SER A CA   1 
ATOM   1703  C  C    . SER A  1 118 ? 198.009 99.116  33.303  1.00 89.34  ? 310  SER A C    1 
ATOM   1704  O  O    . SER A  1 118 ? 198.373 97.944  33.163  1.00 86.38  ? 310  SER A O    1 
ATOM   1705  C  CB   . SER A  1 118 ? 199.553 100.830 34.271  1.00 89.75  ? 310  SER A CB   1 
ATOM   1706  O  OG   . SER A  1 118 ? 200.628 100.096 33.712  1.00 90.32  ? 310  SER A OG   1 
ATOM   1707  H  H    . SER A  1 118 ? 199.479 98.957  35.848  1.00 102.67 ? 310  SER A H    1 
ATOM   1708  H  HA   . SER A  1 118 ? 197.595 100.478 34.777  1.00 104.87 ? 310  SER A HA   1 
ATOM   1709  H  HB2  . SER A  1 118 ? 199.284 101.522 33.646  1.00 107.46 ? 310  SER A HB2  1 
ATOM   1710  H  HB3  . SER A  1 118 ? 199.845 101.232 35.104  1.00 107.46 ? 310  SER A HB3  1 
ATOM   1711  H  HG   . SER A  1 118 ? 200.871 99.493  34.243  1.00 108.13 ? 310  SER A HG   1 
ATOM   1712  N  N    . ARG A  1 119 ? 197.286 99.763  32.387  1.00 92.19  ? 311  ARG A N    1 
ATOM   1713  C  CA   . ARG A  1 119 ? 196.956 99.115  31.123  1.00 99.31  ? 311  ARG A CA   1 
ATOM   1714  C  C    . ARG A  1 119 ? 198.212 98.741  30.346  1.00 101.68 ? 311  ARG A C    1 
ATOM   1715  O  O    . ARG A  1 119 ? 198.224 97.727  29.637  1.00 102.06 ? 311  ARG A O    1 
ATOM   1716  C  CB   . ARG A  1 119 ? 196.043 100.020 30.295  1.00 103.68 ? 311  ARG A CB   1 
ATOM   1717  C  CG   . ARG A  1 119 ? 195.402 99.324  29.102  1.00 107.00 ? 311  ARG A CG   1 
ATOM   1718  C  CD   . ARG A  1 119 ? 194.201 100.098 28.577  1.00 109.88 ? 311  ARG A CD   1 
ATOM   1719  N  NE   . ARG A  1 119 ? 193.133 100.163 29.572  1.00 112.88 ? 311  ARG A NE   1 
ATOM   1720  C  CZ   . ARG A  1 119 ? 192.297 99.163  29.838  1.00 115.65 ? 311  ARG A CZ   1 
ATOM   1721  N  NH1  . ARG A  1 119 ? 192.402 98.010  29.187  1.00 116.66 ? 311  ARG A NH1  1 
ATOM   1722  N  NH2  . ARG A  1 119 ? 191.356 99.310  30.762  1.00 115.32 ? 311  ARG A NH2  1 
ATOM   1723  H  H    . ARG A  1 119 ? 196.980 100.562 32.473  1.00 110.38 ? 311  ARG A H    1 
ATOM   1724  H  HA   . ARG A  1 119 ? 196.470 98.296  31.310  1.00 118.92 ? 311  ARG A HA   1 
ATOM   1725  H  HB2  . ARG A  1 119 ? 195.331 100.349 30.864  1.00 124.16 ? 311  ARG A HB2  1 
ATOM   1726  H  HB3  . ARG A  1 119 ? 196.565 100.765 29.958  1.00 124.16 ? 311  ARG A HB3  1 
ATOM   1727  H  HG2  . ARG A  1 119 ? 196.052 99.252  28.386  1.00 128.15 ? 311  ARG A HG2  1 
ATOM   1728  H  HG3  . ARG A  1 119 ? 195.100 98.442  29.371  1.00 128.15 ? 311  ARG A HG3  1 
ATOM   1729  H  HD2  . ARG A  1 119 ? 194.473 101.005 28.364  1.00 131.60 ? 311  ARG A HD2  1 
ATOM   1730  H  HD3  . ARG A  1 119 ? 193.855 99.656  27.786  1.00 131.60 ? 311  ARG A HD3  1 
ATOM   1731  H  HE   . ARG A  1 119 ? 193.038 100.895 30.013  1.00 135.21 ? 311  ARG A HE   1 
ATOM   1732  H  HH11 . ARG A  1 119 ? 193.010 97.908  28.588  1.00 139.75 ? 311  ARG A HH11 1 
ATOM   1733  H  HH12 . ARG A  1 119 ? 191.860 97.366  29.363  1.00 139.75 ? 311  ARG A HH12 1 
ATOM   1734  H  HH21 . ARG A  1 119 ? 191.283 100.054 31.187  1.00 138.13 ? 311  ARG A HH21 1 
ATOM   1735  H  HH22 . ARG A  1 119 ? 190.816 98.662  30.933  1.00 138.13 ? 311  ARG A HH22 1 
ATOM   1736  N  N    . ASP A  1 120 ? 199.274 99.541  30.462  1.00 112.05 ? 312  ASP A N    1 
ATOM   1737  C  CA   . ASP A  1 120 ? 200.534 99.205  29.805  1.00 113.21 ? 312  ASP A CA   1 
ATOM   1738  C  C    . ASP A  1 120 ? 201.027 97.832  30.246  1.00 105.96 ? 312  ASP A C    1 
ATOM   1739  O  O    . ASP A  1 120 ? 201.317 96.964  29.414  1.00 104.95 ? 312  ASP A O    1 
ATOM   1740  C  CB   . ASP A  1 120 ? 201.586 100.274 30.104  1.00 117.18 ? 312  ASP A CB   1 
ATOM   1741  C  CG   . ASP A  1 120 ? 201.272 101.603 29.447  1.00 123.45 ? 312  ASP A CG   1 
ATOM   1742  O  OD1  . ASP A  1 120 ? 200.938 101.609 28.244  1.00 127.28 ? 312  ASP A OD1  1 
ATOM   1743  O  OD2  . ASP A  1 120 ? 201.364 102.643 30.134  1.00 125.51 ? 312  ASP A OD2  1 
ATOM   1744  H  H    . ASP A  1 120 ? 199.290 100.275 30.910  1.00 134.21 ? 312  ASP A H    1 
ATOM   1745  H  HA   . ASP A  1 120 ? 200.394 99.180  28.845  1.00 135.60 ? 312  ASP A HA   1 
ATOM   1746  H  HB2  . ASP A  1 120 ? 201.629 100.416 31.063  1.00 140.37 ? 312  ASP A HB2  1 
ATOM   1747  H  HB3  . ASP A  1 120 ? 202.446 99.972  29.774  1.00 140.37 ? 312  ASP A HB3  1 
ATOM   1748  N  N    . SER A  1 121 ? 201.131 97.619  31.560  1.00 93.06  ? 313  SER A N    1 
ATOM   1749  C  CA   . SER A  1 121 ? 201.609 96.338  32.068  1.00 86.02  ? 313  SER A CA   1 
ATOM   1750  C  C    . SER A  1 121 ? 200.623 95.216  31.770  1.00 88.55  ? 313  SER A C    1 
ATOM   1751  O  O    . SER A  1 121 ? 201.032 94.081  31.499  1.00 88.38  ? 313  SER A O    1 
ATOM   1752  C  CB   . SER A  1 121 ? 201.856 96.430  33.574  1.00 78.03  ? 313  SER A CB   1 
ATOM   1753  O  OG   . SER A  1 121 ? 202.682 97.534  33.895  1.00 76.82  ? 313  SER A OG   1 
ATOM   1754  H  H    . SER A  1 121 ? 200.934 98.194  32.168  1.00 111.43 ? 313  SER A H    1 
ATOM   1755  H  HA   . SER A  1 121 ? 202.451 96.120  31.638  1.00 102.98 ? 313  SER A HA   1 
ATOM   1756  H  HB2  . SER A  1 121 ? 201.004 96.533  34.026  1.00 93.39  ? 313  SER A HB2  1 
ATOM   1757  H  HB3  . SER A  1 121 ? 202.291 95.616  33.871  1.00 93.39  ? 313  SER A HB3  1 
ATOM   1758  H  HG   . SER A  1 121 ? 202.806 97.568  34.725  1.00 91.94  ? 313  SER A HG   1 
ATOM   1759  N  N    . TYR A  1 122 ? 199.321 95.509  31.814  1.00 92.86  ? 314  TYR A N    1 
ATOM   1760  C  CA   . TYR A  1 122 ? 198.329 94.458  31.608  1.00 98.11  ? 314  TYR A CA   1 
ATOM   1761  C  C    . TYR A  1 122 ? 198.381 93.897  30.191  1.00 97.47  ? 314  TYR A C    1 
ATOM   1762  O  O    . TYR A  1 122 ? 198.302 92.678  30.001  1.00 94.04  ? 314  TYR A O    1 
ATOM   1763  C  CB   . TYR A  1 122 ? 196.929 94.986  31.917  1.00 102.22 ? 314  TYR A CB   1 
ATOM   1764  C  CG   . TYR A  1 122 ? 195.846 93.972  31.629  1.00 106.57 ? 314  TYR A CG   1 
ATOM   1765  C  CD1  . TYR A  1 122 ? 195.747 92.807  32.377  1.00 106.53 ? 314  TYR A CD1  1 
ATOM   1766  C  CD2  . TYR A  1 122 ? 194.931 94.173  30.605  1.00 109.10 ? 314  TYR A CD2  1 
ATOM   1767  C  CE1  . TYR A  1 122 ? 194.766 91.872  32.117  1.00 108.83 ? 314  TYR A CE1  1 
ATOM   1768  C  CE2  . TYR A  1 122 ? 193.944 93.243  30.337  1.00 111.53 ? 314  TYR A CE2  1 
ATOM   1769  C  CZ   . TYR A  1 122 ? 193.866 92.095  31.097  1.00 112.05 ? 314  TYR A CZ   1 
ATOM   1770  O  OH   . TYR A  1 122 ? 192.886 91.167  30.834  1.00 114.82 ? 314  TYR A OH   1 
ATOM   1771  H  H    . TYR A  1 122 ? 198.994 96.291  31.957  1.00 111.19 ? 314  TYR A H    1 
ATOM   1772  H  HA   . TYR A  1 122 ? 198.513 93.730  32.222  1.00 117.48 ? 314  TYR A HA   1 
ATOM   1773  H  HB2  . TYR A  1 122 ? 196.879 95.219  32.857  1.00 122.42 ? 314  TYR A HB2  1 
ATOM   1774  H  HB3  . TYR A  1 122 ? 196.759 95.769  31.370  1.00 122.42 ? 314  TYR A HB3  1 
ATOM   1775  H  HD1  . TYR A  1 122 ? 196.353 92.654  33.066  1.00 127.59 ? 314  TYR A HD1  1 
ATOM   1776  H  HD2  . TYR A  1 122 ? 194.982 94.947  30.091  1.00 130.67 ? 314  TYR A HD2  1 
ATOM   1777  H  HE1  . TYR A  1 122 ? 194.711 91.097  32.628  1.00 130.35 ? 314  TYR A HE1  1 
ATOM   1778  H  HE2  . TYR A  1 122 ? 193.336 93.392  29.649  1.00 133.59 ? 314  TYR A HE2  1 
ATOM   1779  H  HH   . TYR A  1 122 ? 192.410 91.425  30.193  1.00 137.53 ? 314  TYR A HH   1 
ATOM   1780  N  N    . GLN A  1 123 ? 198.514 94.763  29.183  1.00 105.99 ? 315  GLN A N    1 
ATOM   1781  C  CA   . GLN A  1 123 ? 198.564 94.278  27.807  1.00 113.43 ? 315  GLN A CA   1 
ATOM   1782  C  C    . GLN A  1 123 ? 199.769 93.373  27.584  1.00 111.75 ? 315  GLN A C    1 
ATOM   1783  O  O    . GLN A  1 123 ? 199.671 92.360  26.882  1.00 113.67 ? 315  GLN A O    1 
ATOM   1784  C  CB   . GLN A  1 123 ? 198.566 95.447  26.825  1.00 118.51 ? 315  GLN A CB   1 
ATOM   1785  C  CG   . GLN A  1 123 ? 197.237 96.184  26.769  1.00 121.37 ? 315  GLN A CG   1 
ATOM   1786  C  CD   . GLN A  1 123 ? 197.261 97.363  25.821  1.00 127.17 ? 315  GLN A CD   1 
ATOM   1787  O  OE1  . GLN A  1 123 ? 198.310 97.725  25.286  1.00 130.56 ? 315  GLN A OE1  1 
ATOM   1788  N  NE2  . GLN A  1 123 ? 196.099 97.965  25.598  1.00 128.16 ? 315  GLN A NE2  1 
ATOM   1789  H  H    . GLN A  1 123 ? 198.575 95.616  29.268  1.00 126.94 ? 315  GLN A H    1 
ATOM   1790  H  HA   . GLN A  1 123 ? 197.767 93.752  27.635  1.00 135.87 ? 315  GLN A HA   1 
ATOM   1791  H  HB2  . GLN A  1 123 ? 199.248 96.082  27.094  1.00 141.96 ? 315  GLN A HB2  1 
ATOM   1792  H  HB3  . GLN A  1 123 ? 198.758 95.111  25.936  1.00 141.96 ? 315  GLN A HB3  1 
ATOM   1793  H  HG2  . GLN A  1 123 ? 196.548 95.571  26.469  1.00 145.39 ? 315  GLN A HG2  1 
ATOM   1794  H  HG3  . GLN A  1 123 ? 197.023 96.516  27.655  1.00 145.39 ? 315  GLN A HG3  1 
ATOM   1795  H  HE21 . GLN A  1 123 ? 195.387 97.683  25.989  1.00 153.54 ? 315  GLN A HE21 1 
ATOM   1796  H  HE22 . GLN A  1 123 ? 196.059 98.640  25.066  1.00 153.54 ? 315  GLN A HE22 1 
ATOM   1797  N  N    . LEU A  1 124 ? 200.917 93.718  28.172  1.00 102.36 ? 316  LEU A N    1 
ATOM   1798  C  CA   . LEU A  1 124 ? 202.084 92.850  28.050  1.00 99.24  ? 316  LEU A CA   1 
ATOM   1799  C  C    . LEU A  1 124 ? 201.838 91.521  28.747  1.00 96.13  ? 316  LEU A C    1 
ATOM   1800  O  O    . LEU A  1 124 ? 202.242 90.465  28.248  1.00 97.25  ? 316  LEU A O    1 
ATOM   1801  C  CB   . LEU A  1 124 ? 203.316 93.532  28.644  1.00 97.49  ? 316  LEU A CB   1 
ATOM   1802  C  CG   . LEU A  1 124 ? 203.780 94.846  28.020  1.00 98.18  ? 316  LEU A CG   1 
ATOM   1803  C  CD1  . LEU A  1 124 ? 204.932 95.418  28.826  1.00 96.82  ? 316  LEU A CD1  1 
ATOM   1804  C  CD2  . LEU A  1 124 ? 204.197 94.635  26.575  1.00 101.95 ? 316  LEU A CD2  1 
ATOM   1805  H  H    . LEU A  1 124 ? 201.043 94.432  28.634  1.00 122.58 ? 316  LEU A H    1 
ATOM   1806  H  HA   . LEU A  1 124 ? 202.256 92.675  27.112  1.00 118.84 ? 316  LEU A HA   1 
ATOM   1807  H  HB2  . LEU A  1 124 ? 203.134 93.713  29.580  1.00 116.74 ? 316  LEU A HB2  1 
ATOM   1808  H  HB3  . LEU A  1 124 ? 204.059 92.912  28.581  1.00 116.74 ? 316  LEU A HB3  1 
ATOM   1809  H  HG   . LEU A  1 124 ? 203.050 95.484  28.036  1.00 117.56 ? 316  LEU A HG   1 
ATOM   1810  H  HD11 . LEU A  1 124 ? 205.218 96.252  28.420  1.00 115.93 ? 316  LEU A HD11 1 
ATOM   1811  H  HD12 . LEU A  1 124 ? 204.632 95.578  29.735  1.00 115.93 ? 316  LEU A HD12 1 
ATOM   1812  H  HD13 . LEU A  1 124 ? 205.664 94.782  28.826  1.00 115.93 ? 316  LEU A HD13 1 
ATOM   1813  H  HD21 . LEU A  1 124 ? 204.486 95.482  26.203  1.00 122.10 ? 316  LEU A HD21 1 
ATOM   1814  H  HD22 . LEU A  1 124 ? 204.925 93.995  26.547  1.00 122.10 ? 316  LEU A HD22 1 
ATOM   1815  H  HD23 . LEU A  1 124 ? 203.438 94.295  26.074  1.00 122.10 ? 316  LEU A HD23 1 
ATOM   1816  N  N    . LEU A  1 125 ? 201.176 91.556  29.904  1.00 88.92  ? 317  LEU A N    1 
ATOM   1817  C  CA   . LEU A  1 125 ? 200.826 90.324  30.600  1.00 89.32  ? 317  LEU A CA   1 
ATOM   1818  C  C    . LEU A  1 125 ? 199.830 89.502  29.792  1.00 94.08  ? 317  LEU A C    1 
ATOM   1819  O  O    . LEU A  1 125 ? 200.023 88.297  29.591  1.00 94.20  ? 317  LEU A O    1 
ATOM   1820  C  CB   . LEU A  1 125 ? 200.256 90.653  31.980  1.00 84.43  ? 317  LEU A CB   1 
ATOM   1821  C  CG   . LEU A  1 125 ? 199.752 89.471  32.813  1.00 83.18  ? 317  LEU A CG   1 
ATOM   1822  C  CD1  . LEU A  1 125 ? 200.891 88.530  33.181  1.00 81.69  ? 317  LEU A CD1  1 
ATOM   1823  C  CD2  . LEU A  1 125 ? 199.043 89.978  34.055  1.00 79.30  ? 317  LEU A CD2  1 
ATOM   1824  H  H    . LEU A  1 125 ? 200.921 92.274  30.301  1.00 106.46 ? 317  LEU A H    1 
ATOM   1825  H  HA   . LEU A  1 125 ? 201.627 89.791  30.724  1.00 106.94 ? 317  LEU A HA   1 
ATOM   1826  H  HB2  . LEU A  1 125 ? 200.949 91.093  32.497  1.00 101.07 ? 317  LEU A HB2  1 
ATOM   1827  H  HB3  . LEU A  1 125 ? 199.509 91.260  31.862  1.00 101.07 ? 317  LEU A HB3  1 
ATOM   1828  H  HG   . LEU A  1 125 ? 199.109 88.969  32.287  1.00 99.57  ? 317  LEU A HG   1 
ATOM   1829  H  HD11 . LEU A  1 125 ? 200.536 87.796  33.706  1.00 97.77  ? 317  LEU A HD11 1 
ATOM   1830  H  HD12 . LEU A  1 125 ? 201.295 88.190  32.367  1.00 97.77  ? 317  LEU A HD12 1 
ATOM   1831  H  HD13 . LEU A  1 125 ? 201.550 89.020  33.698  1.00 97.77  ? 317  LEU A HD13 1 
ATOM   1832  H  HD21 . LEU A  1 125 ? 198.730 89.219  34.571  1.00 94.91  ? 317  LEU A HD21 1 
ATOM   1833  H  HD22 . LEU A  1 125 ? 199.666 90.502  34.582  1.00 94.91  ? 317  LEU A HD22 1 
ATOM   1834  H  HD23 . LEU A  1 125 ? 198.291 90.529  33.786  1.00 94.91  ? 317  LEU A HD23 1 
ATOM   1835  N  N    . LYS A  1 126 ? 198.751 90.136  29.322  1.00 106.49 ? 318  LYS A N    1 
ATOM   1836  C  CA   . LYS A  1 126 ? 197.710 89.397  28.613  1.00 111.58 ? 318  LYS A CA   1 
ATOM   1837  C  C    . LYS A  1 126 ? 198.281 88.656  27.410  1.00 114.86 ? 318  LYS A C    1 
ATOM   1838  O  O    . LYS A  1 126 ? 198.035 87.457  27.234  1.00 117.73 ? 318  LYS A O    1 
ATOM   1839  C  CB   . LYS A  1 126 ? 196.575 90.336  28.195  1.00 113.51 ? 318  LYS A CB   1 
ATOM   1840  C  CG   . LYS A  1 126 ? 195.400 89.591  27.569  1.00 116.56 ? 318  LYS A CG   1 
ATOM   1841  C  CD   . LYS A  1 126 ? 194.101 90.394  27.558  1.00 118.07 ? 318  LYS A CD   1 
ATOM   1842  C  CE   . LYS A  1 126 ? 194.065 91.475  26.493  1.00 120.39 ? 318  LYS A CE   1 
ATOM   1843  N  NZ   . LYS A  1 126 ? 192.707 92.092  26.424  1.00 121.25 ? 318  LYS A NZ   1 
ATOM   1844  H  H    . LYS A  1 126 ? 198.602 90.979  29.401  1.00 127.53 ? 318  LYS A H    1 
ATOM   1845  H  HA   . LYS A  1 126 ? 197.337 88.734  29.215  1.00 133.65 ? 318  LYS A HA   1 
ATOM   1846  H  HB2  . LYS A  1 126 ? 196.249 90.807  28.978  1.00 135.97 ? 318  LYS A HB2  1 
ATOM   1847  H  HB3  . LYS A  1 126 ? 196.912 90.969  27.542  1.00 135.97 ? 318  LYS A HB3  1 
ATOM   1848  H  HG2  . LYS A  1 126 ? 195.621 89.373  26.650  1.00 139.63 ? 318  LYS A HG2  1 
ATOM   1849  H  HG3  . LYS A  1 126 ? 195.241 88.777  28.072  1.00 139.63 ? 318  LYS A HG3  1 
ATOM   1850  H  HD2  . LYS A  1 126 ? 193.360 89.789  27.394  1.00 141.43 ? 318  LYS A HD2  1 
ATOM   1851  H  HD3  . LYS A  1 126 ? 193.991 90.823  28.421  1.00 141.43 ? 318  LYS A HD3  1 
ATOM   1852  H  HE2  . LYS A  1 126 ? 194.707 92.168  26.713  1.00 144.22 ? 318  LYS A HE2  1 
ATOM   1853  H  HE3  . LYS A  1 126 ? 194.270 91.085  25.628  1.00 144.22 ? 318  LYS A HE3  1 
ATOM   1854  H  HZ1  . LYS A  1 126 ? 192.692 92.725  25.798  1.00 145.25 ? 318  LYS A HZ1  1 
ATOM   1855  H  HZ2  . LYS A  1 126 ? 192.101 91.472  26.224  1.00 145.25 ? 318  LYS A HZ2  1 
ATOM   1856  H  HZ3  . LYS A  1 126 ? 192.499 92.457  27.209  1.00 145.25 ? 318  LYS A HZ3  1 
ATOM   1857  N  N    . ARG A  1 127 ? 199.047 89.350  26.565  1.00 112.17 ? 319  ARG A N    1 
ATOM   1858  C  CA   . ARG A  1 127 ? 199.602 88.692  25.387  1.00 114.91 ? 319  ARG A CA   1 
ATOM   1859  C  C    . ARG A  1 127 ? 200.510 87.531  25.781  1.00 111.02 ? 319  ARG A C    1 
ATOM   1860  O  O    . ARG A  1 127 ? 200.530 86.497  25.103  1.00 111.93 ? 319  ARG A O    1 
ATOM   1861  C  CB   . ARG A  1 127 ? 200.323 89.705  24.498  1.00 120.22 ? 319  ARG A CB   1 
ATOM   1862  C  CG   . ARG A  1 127 ? 199.364 90.757  23.946  1.00 126.01 ? 319  ARG A CG   1 
ATOM   1863  C  CD   . ARG A  1 127 ? 199.946 91.561  22.796  1.00 132.36 ? 319  ARG A CD   1 
ATOM   1864  N  NE   . ARG A  1 127 ? 200.037 92.985  23.105  1.00 136.66 ? 319  ARG A NE   1 
ATOM   1865  C  CZ   . ARG A  1 127 ? 199.009 93.827  23.113  1.00 139.33 ? 319  ARG A CZ   1 
ATOM   1866  N  NH1  . ARG A  1 127 ? 197.783 93.403  22.832  1.00 140.63 ? 319  ARG A NH1  1 
ATOM   1867  N  NH2  . ARG A  1 127 ? 199.211 95.105  23.405  1.00 139.28 ? 319  ARG A NH2  1 
ATOM   1868  H  H    . ARG A  1 127 ? 199.254 90.180  26.650  1.00 134.35 ? 319  ARG A H    1 
ATOM   1869  H  HA   . ARG A  1 127 ? 198.869 88.323  24.869  1.00 137.64 ? 319  ARG A HA   1 
ATOM   1870  H  HB2  . ARG A  1 127 ? 201.004 90.159  25.019  1.00 144.02 ? 319  ARG A HB2  1 
ATOM   1871  H  HB3  . ARG A  1 127 ? 200.728 89.241  23.748  1.00 144.02 ? 319  ARG A HB3  1 
ATOM   1872  H  HG2  . ARG A  1 127 ? 198.563 90.314  23.625  1.00 150.96 ? 319  ARG A HG2  1 
ATOM   1873  H  HG3  . ARG A  1 127 ? 199.136 91.377  24.657  1.00 150.96 ? 319  ARG A HG3  1 
ATOM   1874  H  HD2  . ARG A  1 127 ? 200.839 91.236  22.601  1.00 158.58 ? 319  ARG A HD2  1 
ATOM   1875  H  HD3  . ARG A  1 127 ? 199.376 91.457  22.017  1.00 158.58 ? 319  ARG A HD3  1 
ATOM   1876  H  HE   . ARG A  1 127 ? 200.813 93.302  23.296  1.00 163.75 ? 319  ARG A HE   1 
ATOM   1877  H  HH11 . ARG A  1 127 ? 197.648 92.575  22.641  1.00 168.50 ? 319  ARG A HH11 1 
ATOM   1878  H  HH12 . ARG A  1 127 ? 197.124 93.956  22.840  1.00 168.50 ? 319  ARG A HH12 1 
ATOM   1879  H  HH21 . ARG A  1 127 ? 200.003 95.384  23.589  1.00 166.89 ? 319  ARG A HH21 1 
ATOM   1880  H  HH22 . ARG A  1 127 ? 198.549 95.654  23.414  1.00 166.89 ? 319  ARG A HH22 1 
ATOM   1881  N  N    . HIS A  1 128 ? 201.278 87.678  26.865  1.00 108.68 ? 320  HIS A N    1 
ATOM   1882  C  CA   . HIS A  1 128 ? 202.054 86.544  27.358  1.00 106.92 ? 320  HIS A CA   1 
ATOM   1883  C  C    . HIS A  1 128 ? 201.144 85.394  27.768  1.00 108.09 ? 320  HIS A C    1 
ATOM   1884  O  O    . HIS A  1 128 ? 201.429 84.229  27.466  1.00 109.62 ? 320  HIS A O    1 
ATOM   1885  C  CB   . HIS A  1 128 ? 202.935 86.955  28.537  1.00 102.23 ? 320  HIS A CB   1 
ATOM   1886  C  CG   . HIS A  1 128 ? 203.574 85.792  29.231  1.00 101.17 ? 320  HIS A CG   1 
ATOM   1887  N  ND1  . HIS A  1 128 ? 202.994 85.163  30.312  1.00 100.78 ? 320  HIS A ND1  1 
ATOM   1888  C  CD2  . HIS A  1 128 ? 204.724 85.121  28.980  1.00 100.51 ? 320  HIS A CD2  1 
ATOM   1889  C  CE1  . HIS A  1 128 ? 203.768 84.169  30.709  1.00 98.92  ? 320  HIS A CE1  1 
ATOM   1890  N  NE2  . HIS A  1 128 ? 204.824 84.122  29.918  1.00 99.34  ? 320  HIS A NE2  1 
ATOM   1891  H  H    . HIS A  1 128 ? 201.363 88.403  27.319  1.00 130.16 ? 320  HIS A H    1 
ATOM   1892  H  HA   . HIS A  1 128 ? 202.634 86.227  26.648  1.00 128.05 ? 320  HIS A HA   1 
ATOM   1893  H  HB2  . HIS A  1 128 ? 203.642 87.535  28.214  1.00 122.42 ? 320  HIS A HB2  1 
ATOM   1894  H  HB3  . HIS A  1 128 ? 202.390 87.427  29.186  1.00 122.42 ? 320  HIS A HB3  1 
ATOM   1895  H  HD2  . HIS A  1 128 ? 205.337 85.310  28.306  1.00 120.37 ? 320  HIS A HD2  1 
ATOM   1896  H  HE1  . HIS A  1 128 ? 203.597 83.597  31.423  1.00 118.46 ? 320  HIS A HE1  1 
ATOM   1897  H  HE2  . HIS A  1 128 ? 205.469 83.556  29.978  1.00 118.96 ? 320  HIS A HE2  1 
ATOM   1898  N  N    . LEU A  1 129 ? 200.044 85.700  28.458  1.00 102.52 ? 321  LEU A N    1 
ATOM   1899  C  CA   . LEU A  1 129 ? 199.146 84.646  28.915  1.00 103.53 ? 321  LEU A CA   1 
ATOM   1900  C  C    . LEU A  1 129 ? 198.303 84.099  27.772  1.00 109.29 ? 321  LEU A C    1 
ATOM   1901  O  O    . LEU A  1 129 ? 197.891 82.933  27.811  1.00 111.19 ? 321  LEU A O    1 
ATOM   1902  C  CB   . LEU A  1 129 ? 198.246 85.171  30.036  1.00 100.91 ? 321  LEU A CB   1 
ATOM   1903  C  CG   . LEU A  1 129 ? 198.960 85.619  31.315  1.00 98.04  ? 321  LEU A CG   1 
ATOM   1904  C  CD1  . LEU A  1 129 ? 197.977 86.257  32.283  1.00 94.04  ? 321  LEU A CD1  1 
ATOM   1905  C  CD2  . LEU A  1 129 ? 199.671 84.448  31.976  1.00 99.06  ? 321  LEU A CD2  1 
ATOM   1906  H  H    . LEU A  1 129 ? 199.801 86.497  28.670  1.00 122.78 ? 321  LEU A H    1 
ATOM   1907  H  HA   . LEU A  1 129 ? 199.675 83.916  29.273  1.00 123.99 ? 321  LEU A HA   1 
ATOM   1908  H  HB2  . LEU A  1 129 ? 197.752 85.934  29.699  1.00 120.85 ? 321  LEU A HB2  1 
ATOM   1909  H  HB3  . LEU A  1 129 ? 197.625 84.468  30.283  1.00 120.85 ? 321  LEU A HB3  1 
ATOM   1910  H  HG   . LEU A  1 129 ? 199.629 86.283  31.086  1.00 117.40 ? 321  LEU A HG   1 
ATOM   1911  H  HD11 . LEU A  1 129 ? 198.454 86.531  33.082  1.00 112.59 ? 321  LEU A HD11 1 
ATOM   1912  H  HD12 . LEU A  1 129 ? 197.572 87.030  31.858  1.00 112.59 ? 321  LEU A HD12 1 
ATOM   1913  H  HD13 . LEU A  1 129 ? 197.293 85.609  32.512  1.00 112.59 ? 321  LEU A HD13 1 
ATOM   1914  H  HD21 . LEU A  1 129 ? 200.112 84.761  32.781  1.00 118.63 ? 321  LEU A HD21 1 
ATOM   1915  H  HD22 . LEU A  1 129 ? 199.016 83.768  32.200  1.00 118.63 ? 321  LEU A HD22 1 
ATOM   1916  H  HD23 . LEU A  1 129 ? 200.325 84.086  31.358  1.00 118.63 ? 321  LEU A HD23 1 
ATOM   1917  N  N    . GLN A  1 130 ? 198.032 84.916  26.755  1.00 112.62 ? 322  GLN A N    1 
ATOM   1918  C  CA   . GLN A  1 130 ? 197.257 84.487  25.600  1.00 115.10 ? 322  GLN A CA   1 
ATOM   1919  C  C    . GLN A  1 130 ? 198.054 83.623  24.621  1.00 116.78 ? 322  GLN A C    1 
ATOM   1920  O  O    . GLN A  1 130 ? 197.615 83.458  23.475  1.00 117.03 ? 322  GLN A O    1 
ATOM   1921  C  CB   . GLN A  1 130 ? 196.677 85.702  24.874  1.00 117.01 ? 322  GLN A CB   1 
ATOM   1922  C  CG   . GLN A  1 130 ? 195.509 86.340  25.602  1.00 115.52 ? 322  GLN A CG   1 
ATOM   1923  C  CD   . GLN A  1 130 ? 194.927 87.517  24.849  1.00 118.06 ? 322  GLN A CD   1 
ATOM   1924  O  OE1  . GLN A  1 130 ? 195.575 88.091  23.972  1.00 118.35 ? 322  GLN A OE1  1 
ATOM   1925  N  NE2  . GLN A  1 130 ? 193.701 87.891  25.193  1.00 118.67 ? 322  GLN A NE2  1 
ATOM   1926  H  H    . GLN A  1 130 ? 198.292 85.735  26.713  1.00 134.89 ? 322  GLN A H    1 
ATOM   1927  H  HA   . GLN A  1 130 ? 196.510 83.953  25.914  1.00 137.88 ? 322  GLN A HA   1 
ATOM   1928  H  HB2  . GLN A  1 130 ? 197.372 86.373  24.781  1.00 140.17 ? 322  GLN A HB2  1 
ATOM   1929  H  HB3  . GLN A  1 130 ? 196.367 85.426  23.997  1.00 140.17 ? 322  GLN A HB3  1 
ATOM   1930  H  HG2  . GLN A  1 130 ? 194.808 85.679  25.715  1.00 138.37 ? 322  GLN A HG2  1 
ATOM   1931  H  HG3  . GLN A  1 130 ? 195.810 86.656  26.468  1.00 138.37 ? 322  GLN A HG3  1 
ATOM   1932  H  HE21 . GLN A  1 130 ? 193.279 87.467  25.811  1.00 142.15 ? 322  GLN A HE21 1 
ATOM   1933  H  HE22 . GLN A  1 130 ? 193.326 88.556  24.795  1.00 142.15 ? 322  GLN A HE22 1 
ATOM   1934  N  N    . GLU A  1 131 ? 199.192 83.066  25.028  1.00 120.60 ? 323  GLU A N    1 
ATOM   1935  C  CA   . GLU A  1 131 ? 199.932 82.129  24.197  1.00 123.39 ? 323  GLU A CA   1 
ATOM   1936  C  C    . GLU A  1 131 ? 199.519 80.729  24.628  1.00 124.49 ? 323  GLU A C    1 
ATOM   1937  O  O    . GLU A  1 131 ? 199.374 80.459  25.825  1.00 120.94 ? 323  GLU A O    1 
ATOM   1938  C  CB   . GLU A  1 131 ? 201.448 82.309  24.349  1.00 123.45 ? 323  GLU A CB   1 
ATOM   1939  C  CG   . GLU A  1 131 ? 201.994 83.640  23.832  1.00 125.22 ? 323  GLU A CG   1 
ATOM   1940  C  CD   . GLU A  1 131 ? 203.453 83.858  24.196  1.00 124.75 ? 323  GLU A CD   1 
ATOM   1941  O  OE1  . GLU A  1 131 ? 204.081 82.924  24.738  1.00 124.76 ? 323  GLU A OE1  1 
ATOM   1942  O  OE2  . GLU A  1 131 ? 203.972 84.965  23.938  1.00 124.09 ? 323  GLU A OE2  1 
ATOM   1943  H  H    . GLU A  1 131 ? 199.558 83.218  25.792  1.00 144.48 ? 323  GLU A H    1 
ATOM   1944  H  HA   . GLU A  1 131 ? 199.693 82.254  23.265  1.00 147.82 ? 323  GLU A HA   1 
ATOM   1945  H  HB2  . GLU A  1 131 ? 201.673 82.246  25.290  1.00 147.89 ? 323  GLU A HB2  1 
ATOM   1946  H  HB3  . GLU A  1 131 ? 201.894 81.600  23.859  1.00 147.89 ? 323  GLU A HB3  1 
ATOM   1947  H  HG2  . GLU A  1 131 ? 201.920 83.658  22.865  1.00 150.02 ? 323  GLU A HG2  1 
ATOM   1948  H  HG3  . GLU A  1 131 ? 201.477 84.365  24.218  1.00 150.02 ? 323  GLU A HG3  1 
ATOM   1949  N  N    . LYS A  1 132 ? 199.328 79.835  23.655  1.00 133.00 ? 324  LYS A N    1 
ATOM   1950  C  CA   . LYS A  1 132 ? 198.861 78.496  23.997  1.00 135.33 ? 324  LYS A CA   1 
ATOM   1951  C  C    . LYS A  1 132 ? 199.818 77.776  24.938  1.00 135.17 ? 324  LYS A C    1 
ATOM   1952  O  O    . LYS A  1 132 ? 199.394 76.860  25.653  1.00 134.17 ? 324  LYS A O    1 
ATOM   1953  C  CB   . LYS A  1 132 ? 198.610 77.672  22.729  1.00 139.52 ? 324  LYS A CB   1 
ATOM   1954  C  CG   . LYS A  1 132 ? 197.514 78.271  21.845  1.00 141.08 ? 324  LYS A CG   1 
ATOM   1955  C  CD   . LYS A  1 132 ? 197.036 77.331  20.739  1.00 144.75 ? 324  LYS A CD   1 
ATOM   1956  C  CE   . LYS A  1 132 ? 198.057 77.089  19.644  1.00 146.61 ? 324  LYS A CE   1 
ATOM   1957  N  NZ   . LYS A  1 132 ? 197.487 76.182  18.604  1.00 149.87 ? 324  LYS A NZ   1 
ATOM   1958  H  H    . LYS A  1 132 ? 199.457 79.975  22.817  1.00 159.35 ? 324  LYS A H    1 
ATOM   1959  H  HA   . LYS A  1 132 ? 198.012 78.579  24.459  1.00 162.15 ? 324  LYS A HA   1 
ATOM   1960  H  HB2  . LYS A  1 132 ? 199.428 77.634  22.209  1.00 167.18 ? 324  LYS A HB2  1 
ATOM   1961  H  HB3  . LYS A  1 132 ? 198.335 76.777  22.982  1.00 167.18 ? 324  LYS A HB3  1 
ATOM   1962  H  HG2  . LYS A  1 132 ? 196.750 78.491  22.400  1.00 169.05 ? 324  LYS A HG2  1 
ATOM   1963  H  HG3  . LYS A  1 132 ? 197.857 79.075  21.423  1.00 169.05 ? 324  LYS A HG3  1 
ATOM   1964  H  HD2  . LYS A  1 132 ? 196.817 76.472  21.134  1.00 173.45 ? 324  LYS A HD2  1 
ATOM   1965  H  HD3  . LYS A  1 132 ? 196.245 77.712  20.327  1.00 173.45 ? 324  LYS A HD3  1 
ATOM   1966  H  HE2  . LYS A  1 132 ? 198.289 77.932  19.225  1.00 175.68 ? 324  LYS A HE2  1 
ATOM   1967  H  HE3  . LYS A  1 132 ? 198.845 76.669  20.022  1.00 175.68 ? 324  LYS A HE3  1 
ATOM   1968  H  HZ1  . LYS A  1 132 ? 198.087 76.040  17.962  1.00 179.59 ? 324  LYS A HZ1  1 
ATOM   1969  H  HZ2  . LYS A  1 132 ? 197.266 75.401  18.970  1.00 179.59 ? 324  LYS A HZ2  1 
ATOM   1970  H  HZ3  . LYS A  1 132 ? 196.760 76.549  18.245  1.00 179.59 ? 324  LYS A HZ3  1 
ATOM   1971  N  N    . GLN A  1 133 ? 201.093 78.163  24.956  1.00 133.90 ? 325  GLN A N    1 
ATOM   1972  C  CA   . GLN A  1 133 ? 202.071 77.525  25.828  1.00 134.12 ? 325  GLN A CA   1 
ATOM   1973  C  C    . GLN A  1 133 ? 201.909 77.931  27.291  1.00 129.10 ? 325  GLN A C    1 
ATOM   1974  O  O    . GLN A  1 133 ? 202.311 77.173  28.180  1.00 125.97 ? 325  GLN A O    1 
ATOM   1975  C  CB   . GLN A  1 133 ? 203.480 77.849  25.327  1.00 136.54 ? 325  GLN A CB   1 
ATOM   1976  C  CG   . GLN A  1 133 ? 203.883 79.304  25.485  1.00 135.82 ? 325  GLN A CG   1 
ATOM   1977  C  CD   . GLN A  1 133 ? 205.242 79.595  24.880  1.00 138.80 ? 325  GLN A CD   1 
ATOM   1978  O  OE1  . GLN A  1 133 ? 206.176 79.991  25.578  1.00 137.19 ? 325  GLN A OE1  1 
ATOM   1979  N  NE2  . GLN A  1 133 ? 205.355 79.408  23.568  1.00 142.46 ? 325  GLN A NE2  1 
ATOM   1980  H  H    . GLN A  1 133 ? 201.416 78.795  24.470  1.00 160.43 ? 325  GLN A H    1 
ATOM   1981  H  HA   . GLN A  1 133 ? 201.953 76.564  25.776  1.00 160.69 ? 325  GLN A HA   1 
ATOM   1982  H  HB2  . GLN A  1 133 ? 204.117 77.311  25.823  1.00 163.60 ? 325  GLN A HB2  1 
ATOM   1983  H  HB3  . GLN A  1 133 ? 203.532 77.630  24.383  1.00 163.60 ? 325  GLN A HB3  1 
ATOM   1984  H  HG2  . GLN A  1 133 ? 203.229 79.865  25.040  1.00 162.74 ? 325  GLN A HG2  1 
ATOM   1985  H  HG3  . GLN A  1 133 ? 203.921 79.522  26.430  1.00 162.74 ? 325  GLN A HG3  1 
ATOM   1986  H  HE21 . GLN A  1 133 ? 204.680 79.132  23.113  1.00 170.71 ? 325  GLN A HE21 1 
ATOM   1987  H  HE22 . GLN A  1 133 ? 206.105 79.560  23.176  1.00 170.71 ? 325  GLN A HE22 1 
ATOM   1988  N  N    . ASN A  1 134 ? 201.327 79.103  27.554  1.00 135.90 ? 326  ASN A N    1 
ATOM   1989  C  CA   . ASN A  1 134 ? 201.088 79.606  28.901  1.00 134.71 ? 326  ASN A CA   1 
ATOM   1990  C  C    . ASN A  1 134 ? 199.633 79.439  29.327  1.00 134.65 ? 326  ASN A C    1 
ATOM   1991  O  O    . ASN A  1 134 ? 199.174 80.130  30.244  1.00 132.18 ? 326  ASN A O    1 
ATOM   1992  C  CB   . ASN A  1 134 ? 201.498 81.077  28.994  1.00 135.01 ? 326  ASN A CB   1 
ATOM   1993  C  CG   . ASN A  1 134 ? 202.989 81.278  28.814  1.00 137.72 ? 326  ASN A CG   1 
ATOM   1994  O  OD1  . ASN A  1 134 ? 203.799 80.658  29.504  1.00 138.33 ? 326  ASN A OD1  1 
ATOM   1995  N  ND2  . ASN A  1 134 ? 203.361 82.145  27.881  1.00 139.57 ? 326  ASN A ND2  1 
ATOM   1996  H  H    . ASN A  1 134 ? 201.052 79.641  26.942  1.00 162.83 ? 326  ASN A H    1 
ATOM   1997  H  HA   . ASN A  1 134 ? 201.638 79.105  29.524  1.00 161.40 ? 326  ASN A HA   1 
ATOM   1998  H  HB2  . ASN A  1 134 ? 201.041 81.577  28.299  1.00 161.76 ? 326  ASN A HB2  1 
ATOM   1999  H  HB3  . ASN A  1 134 ? 201.251 81.420  29.867  1.00 161.76 ? 326  ASN A HB3  1 
ATOM   2000  H  HD21 . ASN A  1 134 ? 204.196 82.294  27.740  1.00 167.24 ? 326  ASN A HD21 1 
ATOM   2001  H  HD22 . ASN A  1 134 ? 202.766 82.560  27.418  1.00 167.24 ? 326  ASN A HD22 1 
ATOM   2002  N  N    . ASN A  1 135 ? 198.901 78.533  28.677  1.00 129.12 ? 327  ASN A N    1 
ATOM   2003  C  CA   . ASN A  1 135 ? 197.454 78.462  28.845  1.00 128.94 ? 327  ASN A CA   1 
ATOM   2004  C  C    . ASN A  1 135 ? 197.042 78.010  30.243  1.00 125.25 ? 327  ASN A C    1 
ATOM   2005  O  O    . ASN A  1 135 ? 195.936 78.333  30.690  1.00 122.68 ? 327  ASN A O    1 
ATOM   2006  C  CB   . ASN A  1 135 ? 196.877 77.512  27.794  1.00 132.17 ? 327  ASN A CB   1 
ATOM   2007  C  CG   . ASN A  1 135 ? 195.384 77.318  27.934  1.00 134.10 ? 327  ASN A CG   1 
ATOM   2008  O  OD1  . ASN A  1 135 ? 194.921 76.263  28.368  1.00 135.29 ? 327  ASN A OD1  1 
ATOM   2009  N  ND2  . ASN A  1 135 ? 194.619 78.338  27.568  1.00 133.79 ? 327  ASN A ND2  1 
ATOM   2010  H  H    . ASN A  1 135 ? 199.221 77.948  28.133  1.00 154.69 ? 327  ASN A H    1 
ATOM   2011  H  HA   . ASN A  1 135 ? 197.076 79.342  28.692  1.00 154.47 ? 327  ASN A HA   1 
ATOM   2012  H  HB2  . ASN A  1 135 ? 197.050 77.875  26.911  1.00 158.36 ? 327  ASN A HB2  1 
ATOM   2013  H  HB3  . ASN A  1 135 ? 197.302 76.645  27.885  1.00 158.36 ? 327  ASN A HB3  1 
ATOM   2014  H  HD21 . ASN A  1 135 ? 193.763 78.278  27.629  1.00 160.30 ? 327  ASN A HD21 1 
ATOM   2015  H  HD22 . ASN A  1 135 ? 194.979 79.060  27.269  1.00 160.30 ? 327  ASN A HD22 1 
ATOM   2016  N  N    . GLN A  1 136 ? 197.901 77.274  30.949  1.00 123.56 ? 328  GLN A N    1 
ATOM   2017  C  CA   . GLN A  1 136 ? 197.498 76.714  32.236  1.00 119.75 ? 328  GLN A CA   1 
ATOM   2018  C  C    . GLN A  1 136 ? 197.544 77.754  33.347  1.00 114.04 ? 328  GLN A C    1 
ATOM   2019  O  O    . GLN A  1 136 ? 196.642 77.803  34.191  1.00 112.58 ? 328  GLN A O    1 
ATOM   2020  C  CB   . GLN A  1 136 ? 198.379 75.509  32.569  1.00 122.83 ? 328  GLN A CB   1 
ATOM   2021  C  CG   . GLN A  1 136 ? 198.317 74.486  31.457  1.00 129.23 ? 328  GLN A CG   1 
ATOM   2022  C  CD   . GLN A  1 136 ? 196.910 73.968  31.235  1.00 132.12 ? 328  GLN A CD   1 
ATOM   2023  O  OE1  . GLN A  1 136 ? 196.041 74.106  32.098  1.00 129.62 ? 328  GLN A OE1  1 
ATOM   2024  N  NE2  . GLN A  1 136 ? 196.644 73.501  30.022  1.00 134.81 ? 328  GLN A NE2  1 
ATOM   2025  H  H    . GLN A  1 136 ? 198.705 77.087  30.710  1.00 148.02 ? 328  GLN A H    1 
ATOM   2026  H  HA   . GLN A  1 136 ? 196.583 76.399  32.165  1.00 143.45 ? 328  GLN A HA   1 
ATOM   2027  H  HB2  . GLN A  1 136 ? 199.299 75.799  32.669  1.00 147.14 ? 328  GLN A HB2  1 
ATOM   2028  H  HB3  . GLN A  1 136 ? 198.064 75.094  33.387  1.00 147.14 ? 328  GLN A HB3  1 
ATOM   2029  H  HG2  . GLN A  1 136 ? 198.622 74.894  30.632  1.00 154.83 ? 328  GLN A HG2  1 
ATOM   2030  H  HG3  . GLN A  1 136 ? 198.883 73.732  31.686  1.00 154.83 ? 328  GLN A HG3  1 
ATOM   2031  H  HE21 . GLN A  1 136 ? 197.272 73.442  29.437  1.00 161.52 ? 328  GLN A HE21 1 
ATOM   2032  H  HE22 . GLN A  1 136 ? 195.858 73.205  29.838  1.00 161.52 ? 328  GLN A HE22 1 
ATOM   2033  N  N    . ILE A  1 137 ? 198.581 78.593  33.368  1.00 116.49 ? 329  ILE A N    1 
ATOM   2034  C  CA   . ILE A  1 137 ? 198.645 79.647  34.374  1.00 114.55 ? 329  ILE A CA   1 
ATOM   2035  C  C    . ILE A  1 137 ? 197.591 80.714  34.103  1.00 112.26 ? 329  ILE A C    1 
ATOM   2036  O  O    . ILE A  1 137 ? 197.144 81.401  35.031  1.00 108.55 ? 329  ILE A O    1 
ATOM   2037  C  CB   . ILE A  1 137 ? 200.066 80.242  34.422  1.00 113.72 ? 329  ILE A CB   1 
ATOM   2038  C  CG1  . ILE A  1 137 ? 200.280 81.022  35.722  1.00 109.87 ? 329  ILE A CG1  1 
ATOM   2039  C  CG2  . ILE A  1 137 ? 200.337 81.127  33.208  1.00 116.25 ? 329  ILE A CG2  1 
ATOM   2040  C  CD1  . ILE A  1 137 ? 200.629 80.146  36.906  1.00 109.01 ? 329  ILE A CD1  1 
ATOM   2041  H  H    . ILE A  1 137 ? 199.245 78.573  32.822  1.00 139.54 ? 329  ILE A H    1 
ATOM   2042  H  HA   . ILE A  1 137 ? 198.457 79.259  35.243  1.00 137.21 ? 329  ILE A HA   1 
ATOM   2043  H  HB   . ILE A  1 137 ? 200.700 79.508  34.405  1.00 136.21 ? 329  ILE A HB   1 
ATOM   2044  H  HG12 . ILE A  1 137 ? 201.007 81.651  35.594  1.00 131.60 ? 329  ILE A HG12 1 
ATOM   2045  H  HG13 . ILE A  1 137 ? 199.464 81.501  35.938  1.00 131.60 ? 329  ILE A HG13 1 
ATOM   2046  H  HG21 . ILE A  1 137 ? 201.237 81.483  33.271  1.00 139.25 ? 329  ILE A HG21 1 
ATOM   2047  H  HG22 . ILE A  1 137 ? 200.248 80.593  32.402  1.00 139.25 ? 329  ILE A HG22 1 
ATOM   2048  H  HG23 . ILE A  1 137 ? 199.694 81.853  33.197  1.00 139.25 ? 329  ILE A HG23 1 
ATOM   2049  H  HD11 . ILE A  1 137 ? 200.749 80.706  37.689  1.00 130.57 ? 329  ILE A HD11 1 
ATOM   2050  H  HD12 . ILE A  1 137 ? 199.906 79.516  37.056  1.00 130.57 ? 329  ILE A HD12 1 
ATOM   2051  H  HD13 . ILE A  1 137 ? 201.450 79.667  36.712  1.00 130.57 ? 329  ILE A HD13 1 
ATOM   2052  N  N    . TRP A  1 138 ? 197.177 80.879  32.843  1.00 109.88 ? 330  TRP A N    1 
ATOM   2053  C  CA   . TRP A  1 138 ? 196.120 81.838  32.529  1.00 110.78 ? 330  TRP A CA   1 
ATOM   2054  C  C    . TRP A  1 138 ? 194.787 81.419  33.139  1.00 110.76 ? 330  TRP A C    1 
ATOM   2055  O  O    . TRP A  1 138 ? 194.012 82.271  33.588  1.00 110.01 ? 330  TRP A O    1 
ATOM   2056  C  CB   . TRP A  1 138 ? 196.018 82.026  31.012  1.00 112.89 ? 330  TRP A CB   1 
ATOM   2057  C  CG   . TRP A  1 138 ? 195.088 83.137  30.597  1.00 113.82 ? 330  TRP A CG   1 
ATOM   2058  C  CD1  . TRP A  1 138 ? 194.764 84.247  31.323  1.00 111.60 ? 330  TRP A CD1  1 
ATOM   2059  C  CD2  . TRP A  1 138 ? 194.421 83.277  29.335  1.00 119.64 ? 330  TRP A CD2  1 
ATOM   2060  N  NE1  . TRP A  1 138 ? 193.912 85.051  30.606  1.00 112.66 ? 330  TRP A NE1  1 
ATOM   2061  C  CE2  . TRP A  1 138 ? 193.690 84.482  29.381  1.00 118.29 ? 330  TRP A CE2  1 
ATOM   2062  C  CE3  . TRP A  1 138 ? 194.367 82.500  28.172  1.00 126.45 ? 330  TRP A CE3  1 
ATOM   2063  C  CZ2  . TRP A  1 138 ? 192.907 84.922  28.315  1.00 123.57 ? 330  TRP A CZ2  1 
ATOM   2064  C  CZ3  . TRP A  1 138 ? 193.584 82.938  27.116  1.00 129.64 ? 330  TRP A CZ3  1 
ATOM   2065  C  CH2  . TRP A  1 138 ? 192.867 84.139  27.195  1.00 127.75 ? 330  TRP A CH2  1 
ATOM   2066  H  H    . TRP A  1 138 ? 197.488 80.453  32.164  1.00 131.61 ? 330  TRP A H    1 
ATOM   2067  H  HA   . TRP A  1 138 ? 196.359 82.695  32.914  1.00 132.69 ? 330  TRP A HA   1 
ATOM   2068  H  HB2  . TRP A  1 138 ? 196.900 82.232  30.663  1.00 135.22 ? 330  TRP A HB2  1 
ATOM   2069  H  HB3  . TRP A  1 138 ? 195.692 81.203  30.616  1.00 135.22 ? 330  TRP A HB3  1 
ATOM   2070  H  HD1  . TRP A  1 138 ? 195.062 84.423  32.186  1.00 133.67 ? 330  TRP A HD1  1 
ATOM   2071  H  HE1  . TRP A  1 138 ? 193.577 85.794  30.880  1.00 134.95 ? 330  TRP A HE1  1 
ATOM   2072  H  HE3  . TRP A  1 138 ? 194.837 81.700  28.115  1.00 151.49 ? 330  TRP A HE3  1 
ATOM   2073  H  HZ2  . TRP A  1 138 ? 192.429 85.718  28.364  1.00 148.04 ? 330  TRP A HZ2  1 
ATOM   2074  H  HZ3  . TRP A  1 138 ? 193.537 82.428  26.340  1.00 155.32 ? 330  TRP A HZ3  1 
ATOM   2075  H  HH2  . TRP A  1 138 ? 192.352 84.409  26.469  1.00 153.05 ? 330  TRP A HH2  1 
ATOM   2076  N  N    . ASN A  1 139 ? 194.500 80.115  33.170  1.00 108.95 ? 331  ASN A N    1 
ATOM   2077  C  CA   . ASN A  1 139 ? 193.268 79.658  33.802  1.00 106.58 ? 331  ASN A CA   1 
ATOM   2078  C  C    . ASN A  1 139 ? 193.274 79.962  35.295  1.00 103.50 ? 331  ASN A C    1 
ATOM   2079  O  O    . ASN A  1 139 ? 192.245 80.348  35.861  1.00 105.84 ? 331  ASN A O    1 
ATOM   2080  C  CB   . ASN A  1 139 ? 193.077 78.160  33.568  1.00 109.40 ? 331  ASN A CB   1 
ATOM   2081  C  CG   . ASN A  1 139 ? 192.810 77.825  32.113  1.00 115.33 ? 331  ASN A CG   1 
ATOM   2082  O  OD1  . ASN A  1 139 ? 192.212 78.615  31.381  1.00 116.06 ? 331  ASN A OD1  1 
ATOM   2083  N  ND2  . ASN A  1 139 ? 193.250 76.647  31.688  1.00 117.34 ? 331  ASN A ND2  1 
ATOM   2084  H  H    . ASN A  1 139 ? 194.991 79.491  32.840  1.00 130.49 ? 331  ASN A H    1 
ATOM   2085  H  HA   . ASN A  1 139 ? 192.516 80.123  33.403  1.00 127.65 ? 331  ASN A HA   1 
ATOM   2086  H  HB2  . ASN A  1 139 ? 193.882 77.693  33.841  1.00 131.03 ? 331  ASN A HB2  1 
ATOM   2087  H  HB3  . ASN A  1 139 ? 192.320 77.853  34.091  1.00 131.03 ? 331  ASN A HB3  1 
ATOM   2088  H  HD21 . ASN A  1 139 ? 193.122 76.410  30.871  1.00 140.56 ? 331  ASN A HD21 1 
ATOM   2089  H  HD22 . ASN A  1 139 ? 193.663 76.121  32.229  1.00 140.56 ? 331  ASN A HD22 1 
ATOM   2090  N  N    . ILE A  1 140 ? 194.427 79.804  35.947  1.00 97.85  ? 332  ILE A N    1 
ATOM   2091  C  CA   . ILE A  1 140 ? 194.528 80.120  37.368  1.00 95.13  ? 332  ILE A CA   1 
ATOM   2092  C  C    . ILE A  1 140 ? 194.320 81.612  37.595  1.00 89.73  ? 332  ILE A C    1 
ATOM   2093  O  O    . ILE A  1 140 ? 193.654 82.022  38.554  1.00 84.41  ? 332  ILE A O    1 
ATOM   2094  C  CB   . ILE A  1 140 ? 195.885 79.643  37.918  1.00 95.54  ? 332  ILE A CB   1 
ATOM   2095  C  CG1  . ILE A  1 140 ? 195.995 78.120  37.804  1.00 97.76  ? 332  ILE A CG1  1 
ATOM   2096  C  CG2  . ILE A  1 140 ? 196.064 80.075  39.373  1.00 93.15  ? 332  ILE A CG2  1 
ATOM   2097  C  CD1  . ILE A  1 140 ? 197.401 77.590  37.987  1.00 99.67  ? 332  ILE A CD1  1 
ATOM   2098  H  H    . ILE A  1 140 ? 195.157 79.519  35.592  1.00 117.17 ? 332  ILE A H    1 
ATOM   2099  H  HA   . ILE A  1 140 ? 193.829 79.646  37.845  1.00 113.90 ? 332  ILE A HA   1 
ATOM   2100  H  HB   . ILE A  1 140 ? 196.591 80.044  37.388  1.00 114.40 ? 332  ILE A HB   1 
ATOM   2101  H  HG12 . ILE A  1 140 ? 195.435 77.715  38.485  1.00 117.07 ? 332  ILE A HG12 1 
ATOM   2102  H  HG13 . ILE A  1 140 ? 195.689 77.850  36.924  1.00 117.07 ? 332  ILE A HG13 1 
ATOM   2103  H  HG21 . ILE A  1 140 ? 196.924 79.761  39.692  1.00 111.53 ? 332  ILE A HG21 1 
ATOM   2104  H  HG22 . ILE A  1 140 ? 196.025 81.043  39.421  1.00 111.53 ? 332  ILE A HG22 1 
ATOM   2105  H  HG23 . ILE A  1 140 ? 195.352 79.688  39.906  1.00 111.53 ? 332  ILE A HG23 1 
ATOM   2106  H  HD11 . ILE A  1 140 ? 197.388 76.624  37.901  1.00 119.36 ? 332  ILE A HD11 1 
ATOM   2107  H  HD12 . ILE A  1 140 ? 197.974 77.975  37.306  1.00 119.36 ? 332  ILE A HD12 1 
ATOM   2108  H  HD13 . ILE A  1 140 ? 197.720 77.840  38.868  1.00 119.36 ? 332  ILE A HD13 1 
ATOM   2109  N  N    . VAL A  1 141 ? 194.881 82.447  36.718  1.00 88.68  ? 333  VAL A N    1 
ATOM   2110  C  CA   . VAL A  1 141 ? 194.699 83.892  36.834  1.00 85.53  ? 333  VAL A CA   1 
ATOM   2111  C  C    . VAL A  1 141 ? 193.227 84.253  36.676  1.00 86.35  ? 333  VAL A C    1 
ATOM   2112  O  O    . VAL A  1 141 ? 192.658 84.989  37.490  1.00 85.68  ? 333  VAL A O    1 
ATOM   2113  C  CB   . VAL A  1 141 ? 195.575 84.624  35.801  1.00 84.73  ? 333  VAL A CB   1 
ATOM   2114  C  CG1  . VAL A  1 141 ? 195.164 86.093  35.672  1.00 83.51  ? 333  VAL A CG1  1 
ATOM   2115  C  CG2  . VAL A  1 141 ? 197.046 84.506  36.178  1.00 83.38  ? 333  VAL A CG2  1 
ATOM   2116  H  H    . VAL A  1 141 ? 195.368 82.203  36.053  1.00 106.16 ? 333  VAL A H    1 
ATOM   2117  H  HA   . VAL A  1 141 ? 194.981 84.174  37.718  1.00 102.39 ? 333  VAL A HA   1 
ATOM   2118  H  HB   . VAL A  1 141 ? 195.456 84.205  34.934  1.00 101.43 ? 333  VAL A HB   1 
ATOM   2119  H  HG11 . VAL A  1 141 ? 195.734 86.524  35.016  1.00 99.97  ? 333  VAL A HG11 1 
ATOM   2120  H  HG12 . VAL A  1 141 ? 194.238 86.137  35.387  1.00 99.97  ? 333  VAL A HG12 1 
ATOM   2121  H  HG13 . VAL A  1 141 ? 195.266 86.525  36.535  1.00 99.97  ? 333  VAL A HG13 1 
ATOM   2122  H  HG21 . VAL A  1 141 ? 197.580 84.973  35.516  1.00 99.81  ? 333  VAL A HG21 1 
ATOM   2123  H  HG22 . VAL A  1 141 ? 197.180 84.904  37.052  1.00 99.81  ? 333  VAL A HG22 1 
ATOM   2124  H  HG23 . VAL A  1 141 ? 197.292 83.568  36.200  1.00 99.81  ? 333  VAL A HG23 1 
ATOM   2125  N  N    . GLN A  1 142 ? 192.590 83.743  35.619  1.00 92.91  ? 334  GLN A N    1 
ATOM   2126  C  CA   . GLN A  1 142 ? 191.184 84.051  35.380  1.00 97.04  ? 334  GLN A CA   1 
ATOM   2127  C  C    . GLN A  1 142 ? 190.303 83.596  36.535  1.00 97.89  ? 334  GLN A C    1 
ATOM   2128  O  O    . GLN A  1 142 ? 189.296 84.244  36.843  1.00 97.65  ? 334  GLN A O    1 
ATOM   2129  C  CB   . GLN A  1 142 ? 190.720 83.392  34.081  1.00 100.13 ? 334  GLN A CB   1 
ATOM   2130  C  CG   . GLN A  1 142 ? 191.304 83.999  32.818  1.00 102.92 ? 334  GLN A CG   1 
ATOM   2131  C  CD   . GLN A  1 142 ? 190.730 83.373  31.561  1.00 109.91 ? 334  GLN A CD   1 
ATOM   2132  O  OE1  . GLN A  1 142 ? 190.263 82.234  31.580  1.00 113.15 ? 334  GLN A OE1  1 
ATOM   2133  N  NE2  . GLN A  1 142 ? 190.757 84.117  30.463  1.00 112.55 ? 334  GLN A NE2  1 
ATOM   2134  H  H    . GLN A  1 142 ? 192.946 83.224  35.034  1.00 111.24 ? 334  GLN A H    1 
ATOM   2135  H  HA   . GLN A  1 142 ? 191.082 85.011  35.284  1.00 116.20 ? 334  GLN A HA   1 
ATOM   2136  H  HB2  . GLN A  1 142 ? 190.975 82.456  34.101  1.00 119.90 ? 334  GLN A HB2  1 
ATOM   2137  H  HB3  . GLN A  1 142 ? 189.755 83.466  34.023  1.00 119.90 ? 334  GLN A HB3  1 
ATOM   2138  H  HG2  . GLN A  1 142 ? 191.104 84.948  32.800  1.00 123.25 ? 334  GLN A HG2  1 
ATOM   2139  H  HG3  . GLN A  1 142 ? 192.264 83.861  32.813  1.00 123.25 ? 334  GLN A HG3  1 
ATOM   2140  H  HE21 . GLN A  1 142 ? 191.091 84.909  30.488  1.00 134.81 ? 334  GLN A HE21 1 
ATOM   2141  H  HE22 . GLN A  1 142 ? 190.443 83.805  29.725  1.00 134.81 ? 334  GLN A HE22 1 
ATOM   2142  N  N    . GLU A  1 143 ? 190.660 82.487  37.182  1.00 99.05  ? 335  GLU A N    1 
ATOM   2143  C  CA   . GLU A  1 143 ? 189.801 81.899  38.203  1.00 99.64  ? 335  GLU A CA   1 
ATOM   2144  C  C    . GLU A  1 143 ? 189.906 82.639  39.532  1.00 94.38  ? 335  GLU A C    1 
ATOM   2145  O  O    . GLU A  1 143 ? 188.886 82.957  40.154  1.00 92.87  ? 335  GLU A O    1 
ATOM   2146  C  CB   . GLU A  1 143 ? 190.161 80.423  38.391  1.00 106.81 ? 335  GLU A CB   1 
ATOM   2147  C  CG   . GLU A  1 143 ? 189.318 79.688  39.429  1.00 111.30 ? 335  GLU A CG   1 
ATOM   2148  C  CD   . GLU A  1 143 ? 187.850 79.623  39.057  1.00 117.02 ? 335  GLU A CD   1 
ATOM   2149  O  OE1  . GLU A  1 143 ? 187.543 79.508  37.852  1.00 120.61 ? 335  GLU A OE1  1 
ATOM   2150  O  OE2  . GLU A  1 143 ? 187.002 79.682  39.972  1.00 117.81 ? 335  GLU A OE2  1 
ATOM   2151  H  H    . GLU A  1 143 ? 191.393 82.058  37.046  1.00 118.61 ? 335  GLU A H    1 
ATOM   2152  H  HA   . GLU A  1 143 ? 188.879 81.947  37.905  1.00 119.32 ? 335  GLU A HA   1 
ATOM   2153  H  HB2  . GLU A  1 143 ? 190.047 79.966  37.543  1.00 127.93 ? 335  GLU A HB2  1 
ATOM   2154  H  HB3  . GLU A  1 143 ? 191.088 80.364  38.670  1.00 127.93 ? 335  GLU A HB3  1 
ATOM   2155  H  HG2  . GLU A  1 143 ? 189.646 78.779  39.514  1.00 133.32 ? 335  GLU A HG2  1 
ATOM   2156  H  HG3  . GLU A  1 143 ? 189.392 80.148  40.279  1.00 133.32 ? 335  GLU A HG3  1 
ATOM   2157  N  N    . HIS A  1 144 ? 191.129 82.925  39.981  1.00 92.24  ? 336  HIS A N    1 
ATOM   2158  C  CA   . HIS A  1 144 ? 191.362 83.343  41.355  1.00 90.00  ? 336  HIS A CA   1 
ATOM   2159  C  C    . HIS A  1 144 ? 191.746 84.808  41.520  1.00 86.12  ? 336  HIS A C    1 
ATOM   2160  O  O    . HIS A  1 144 ? 191.837 85.272  42.662  1.00 83.53  ? 336  HIS A O    1 
ATOM   2161  C  CB   . HIS A  1 144 ? 192.458 82.466  41.976  1.00 93.58  ? 336  HIS A CB   1 
ATOM   2162  C  CG   . HIS A  1 144 ? 192.093 81.016  42.053  1.00 100.62 ? 336  HIS A CG   1 
ATOM   2163  N  ND1  . HIS A  1 144 ? 191.162 80.527  42.945  1.00 102.65 ? 336  HIS A ND1  1 
ATOM   2164  C  CD2  . HIS A  1 144 ? 192.531 79.948  41.345  1.00 104.40 ? 336  HIS A CD2  1 
ATOM   2165  C  CE1  . HIS A  1 144 ? 191.045 79.221  42.785  1.00 103.84 ? 336  HIS A CE1  1 
ATOM   2166  N  NE2  . HIS A  1 144 ? 191.865 78.844  41.820  1.00 104.55 ? 336  HIS A NE2  1 
ATOM   2167  H  H    . HIS A  1 144 ? 191.842 82.882  39.502  1.00 110.44 ? 336  HIS A H    1 
ATOM   2168  H  HA   . HIS A  1 144 ? 190.549 83.197  41.862  1.00 107.75 ? 336  HIS A HA   1 
ATOM   2169  H  HB2  . HIS A  1 144 ? 193.263 82.542  41.439  1.00 112.05 ? 336  HIS A HB2  1 
ATOM   2170  H  HB3  . HIS A  1 144 ? 192.634 82.777  42.878  1.00 112.05 ? 336  HIS A HB3  1 
ATOM   2171  H  HD2  . HIS A  1 144 ? 193.166 79.959  40.665  1.00 125.03 ? 336  HIS A HD2  1 
ATOM   2172  H  HE1  . HIS A  1 144 ? 190.481 78.662  43.269  1.00 124.36 ? 336  HIS A HE1  1 
ATOM   2173  H  HE2  . HIS A  1 144 ? 191.965 78.039  41.536  1.00 125.21 ? 336  HIS A HE2  1 
ATOM   2174  N  N    . LEU A  1 145 ? 191.981 85.544  40.438  1.00 83.11  ? 337  LEU A N    1 
ATOM   2175  C  CA   . LEU A  1 145 ? 192.417 86.930  40.526  1.00 79.78  ? 337  LEU A CA   1 
ATOM   2176  C  C    . LEU A  1 145 ? 191.428 87.855  39.830  1.00 78.25  ? 337  LEU A C    1 
ATOM   2177  O  O    . LEU A  1 145 ? 190.754 87.469  38.870  1.00 81.22  ? 337  LEU A O    1 
ATOM   2178  C  CB   . LEU A  1 145 ? 193.802 87.134  39.895  1.00 80.07  ? 337  LEU A CB   1 
ATOM   2179  C  CG   . LEU A  1 145 ? 194.955 86.231  40.335  1.00 79.13  ? 337  LEU A CG   1 
ATOM   2180  C  CD1  . LEU A  1 145 ? 196.238 86.693  39.660  1.00 81.89  ? 337  LEU A CD1  1 
ATOM   2181  C  CD2  . LEU A  1 145 ? 195.119 86.220  41.845  1.00 77.30  ? 337  LEU A CD2  1 
ATOM   2182  H  H    . LEU A  1 145 ? 191.893 85.258  39.631  1.00 99.48  ? 337  LEU A H    1 
ATOM   2183  H  HA   . LEU A  1 145 ? 192.469 87.189  41.459  1.00 95.49  ? 337  LEU A HA   1 
ATOM   2184  H  HB2  . LEU A  1 145 ? 193.709 87.020  38.937  1.00 95.84  ? 337  LEU A HB2  1 
ATOM   2185  H  HB3  . LEU A  1 145 ? 194.078 88.046  40.078  1.00 95.84  ? 337  LEU A HB3  1 
ATOM   2186  H  HG   . LEU A  1 145 ? 194.773 85.323  40.046  1.00 94.71  ? 337  LEU A HG   1 
ATOM   2187  H  HD11 . LEU A  1 145 ? 196.967 86.118  39.941  1.00 98.02  ? 337  LEU A HD11 1 
ATOM   2188  H  HD12 . LEU A  1 145 ? 196.125 86.639  38.698  1.00 98.02  ? 337  LEU A HD12 1 
ATOM   2189  H  HD13 . LEU A  1 145 ? 196.419 87.610  39.921  1.00 98.02  ? 337  LEU A HD13 1 
ATOM   2190  H  HD21 . LEU A  1 145 ? 195.858 85.636  42.078  1.00 92.51  ? 337  LEU A HD21 1 
ATOM   2191  H  HD22 . LEU A  1 145 ? 195.302 87.122  42.149  1.00 92.51  ? 337  LEU A HD22 1 
ATOM   2192  H  HD23 . LEU A  1 145 ? 194.300 85.893  42.249  1.00 92.51  ? 337  LEU A HD23 1 
ATOM   2193  N  N    . TYR A  1 146 ? 191.349 89.086  40.333  1.00 76.31  ? 338  TYR A N    1 
ATOM   2194  C  CA   . TYR A  1 146 ? 190.677 90.184  39.650  1.00 83.44  ? 338  TYR A CA   1 
ATOM   2195  C  C    . TYR A  1 146 ? 191.708 91.276  39.410  1.00 79.98  ? 338  TYR A C    1 
ATOM   2196  O  O    . TYR A  1 146 ? 192.265 91.826  40.366  1.00 80.06  ? 338  TYR A O    1 
ATOM   2197  C  CB   . TYR A  1 146 ? 189.501 90.730  40.464  1.00 86.92  ? 338  TYR A CB   1 
ATOM   2198  C  CG   . TYR A  1 146 ? 188.825 91.927  39.821  1.00 90.96  ? 338  TYR A CG   1 
ATOM   2199  C  CD1  . TYR A  1 146 ? 189.265 93.221  40.075  1.00 92.46  ? 338  TYR A CD1  1 
ATOM   2200  C  CD2  . TYR A  1 146 ? 187.754 91.760  38.953  1.00 94.13  ? 338  TYR A CD2  1 
ATOM   2201  C  CE1  . TYR A  1 146 ? 188.653 94.314  39.486  1.00 94.70  ? 338  TYR A CE1  1 
ATOM   2202  C  CE2  . TYR A  1 146 ? 187.136 92.847  38.360  1.00 95.83  ? 338  TYR A CE2  1 
ATOM   2203  C  CZ   . TYR A  1 146 ? 187.590 94.121  38.630  1.00 97.66  ? 338  TYR A CZ   1 
ATOM   2204  O  OH   . TYR A  1 146 ? 186.978 95.205  38.041  1.00 102.44 ? 338  TYR A OH   1 
ATOM   2205  H  H    . TYR A  1 146 ? 191.688 89.313  41.090  1.00 91.33  ? 338  TYR A H    1 
ATOM   2206  H  HA   . TYR A  1 146 ? 190.344 89.879  38.791  1.00 99.89  ? 338  TYR A HA   1 
ATOM   2207  H  HB2  . TYR A  1 146 ? 188.836 90.030  40.563  1.00 104.05 ? 338  TYR A HB2  1 
ATOM   2208  H  HB3  . TYR A  1 146 ? 189.824 91.004  41.337  1.00 104.05 ? 338  TYR A HB3  1 
ATOM   2209  H  HD1  . TYR A  1 146 ? 189.982 93.355  40.652  1.00 110.70 ? 338  TYR A HD1  1 
ATOM   2210  H  HD2  . TYR A  1 146 ? 187.445 90.903  38.768  1.00 112.71 ? 338  TYR A HD2  1 
ATOM   2211  H  HE1  . TYR A  1 146 ? 188.957 95.174  39.667  1.00 113.39 ? 338  TYR A HE1  1 
ATOM   2212  H  HE2  . TYR A  1 146 ? 186.419 92.719  37.782  1.00 114.75 ? 338  TYR A HE2  1 
ATOM   2213  H  HH   . TYR A  1 146 ? 186.349 94.947  37.547  1.00 122.68 ? 338  TYR A HH   1 
ATOM   2214  N  N    . ILE A  1 147 ? 191.959 91.587  38.144  1.00 73.87  ? 339  ILE A N    1 
ATOM   2215  C  CA   . ILE A  1 147 ? 192.950 92.586  37.768  1.00 75.39  ? 339  ILE A CA   1 
ATOM   2216  C  C    . ILE A  1 147 ? 192.204 93.888  37.514  1.00 73.78  ? 339  ILE A C    1 
ATOM   2217  O  O    . ILE A  1 147 ? 191.464 94.015  36.533  1.00 75.90  ? 339  ILE A O    1 
ATOM   2218  C  CB   . ILE A  1 147 ? 193.768 92.149  36.546  1.00 79.76  ? 339  ILE A CB   1 
ATOM   2219  C  CG1  . ILE A  1 147 ? 194.443 90.803  36.836  1.00 75.37  ? 339  ILE A CG1  1 
ATOM   2220  C  CG2  . ILE A  1 147 ? 194.802 93.221  36.193  1.00 85.06  ? 339  ILE A CG2  1 
ATOM   2221  C  CD1  . ILE A  1 147 ? 195.381 90.309  35.746  1.00 77.53  ? 339  ILE A CD1  1 
ATOM   2222  H  H    . ILE A  1 147 ? 191.562 91.226  37.472  1.00 88.40  ? 339  ILE A H    1 
ATOM   2223  H  HA   . ILE A  1 147 ? 193.562 92.725  38.509  1.00 90.22  ? 339  ILE A HA   1 
ATOM   2224  H  HB   . ILE A  1 147 ? 193.166 92.039  35.793  1.00 95.46  ? 339  ILE A HB   1 
ATOM   2225  H  HG12 . ILE A  1 147 ? 194.961 90.886  37.652  1.00 90.19  ? 339  ILE A HG12 1 
ATOM   2226  H  HG13 . ILE A  1 147 ? 193.754 90.131  36.955  1.00 90.19  ? 339  ILE A HG13 1 
ATOM   2227  H  HG21 . ILE A  1 147 ? 195.309 92.928  35.419  1.00 101.82 ? 339  ILE A HG21 1 
ATOM   2228  H  HG22 . ILE A  1 147 ? 194.341 94.050  35.993  1.00 101.82 ? 339  ILE A HG22 1 
ATOM   2229  H  HG23 . ILE A  1 147 ? 195.396 93.347  36.950  1.00 101.82 ? 339  ILE A HG23 1 
ATOM   2230  H  HD11 . ILE A  1 147 ? 195.758 89.457  36.016  1.00 92.79  ? 339  ILE A HD11 1 
ATOM   2231  H  HD12 . ILE A  1 147 ? 194.880 90.203  34.922  1.00 92.79  ? 339  ILE A HD12 1 
ATOM   2232  H  HD13 . ILE A  1 147 ? 196.090 90.960  35.621  1.00 92.79  ? 339  ILE A HD13 1 
ATOM   2233  N  N    . ASP A  1 148 ? 192.399 94.855  38.406  1.00 76.63  ? 340  ASP A N    1 
ATOM   2234  C  CA   . ASP A  1 148 ? 191.748 96.160  38.315  1.00 80.79  ? 340  ASP A CA   1 
ATOM   2235  C  C    . ASP A  1 148 ? 192.672 97.081  37.528  1.00 83.61  ? 340  ASP A C    1 
ATOM   2236  O  O    . ASP A  1 148 ? 193.607 97.665  38.081  1.00 84.53  ? 340  ASP A O    1 
ATOM   2237  C  CB   . ASP A  1 148 ? 191.453 96.706  39.707  1.00 78.95  ? 340  ASP A CB   1 
ATOM   2238  C  CG   . ASP A  1 148 ? 190.589 97.950  39.677  1.00 78.96  ? 340  ASP A CG   1 
ATOM   2239  O  OD1  . ASP A  1 148 ? 189.815 98.115  38.710  1.00 81.12  ? 340  ASP A OD1  1 
ATOM   2240  O  OD2  . ASP A  1 148 ? 190.683 98.763  40.622  1.00 76.32  ? 340  ASP A OD2  1 
ATOM   2241  H  H    . ASP A  1 148 ? 192.916 94.778  39.089  1.00 91.71  ? 340  ASP A H    1 
ATOM   2242  H  HA   . ASP A  1 148 ? 190.912 96.073  37.832  1.00 96.70  ? 340  ASP A HA   1 
ATOM   2243  H  HB2  . ASP A  1 148 ? 190.986 96.028  40.220  1.00 94.49  ? 340  ASP A HB2  1 
ATOM   2244  H  HB3  . ASP A  1 148 ? 192.290 96.933  40.142  1.00 94.49  ? 340  ASP A HB3  1 
ATOM   2245  N  N    . ILE A  1 149 ? 192.413 97.209  36.232  1.00 86.20  ? 341  ILE A N    1 
ATOM   2246  C  CA   . ILE A  1 149 ? 193.285 97.976  35.351  1.00 88.50  ? 341  ILE A CA   1 
ATOM   2247  C  C    . ILE A  1 149 ? 192.991 99.458  35.521  1.00 88.87  ? 341  ILE A C    1 
ATOM   2248  O  O    . ILE A  1 149 ? 191.828 99.871  35.606  1.00 90.21  ? 341  ILE A O    1 
ATOM   2249  C  CB   . ILE A  1 149 ? 193.090 97.538  33.888  1.00 91.47  ? 341  ILE A CB   1 
ATOM   2250  C  CG1  . ILE A  1 149 ? 193.377 96.042  33.732  1.00 92.37  ? 341  ILE A CG1  1 
ATOM   2251  C  CG2  . ILE A  1 149 ? 194.001 98.339  32.966  1.00 94.59  ? 341  ILE A CG2  1 
ATOM   2252  C  CD1  . ILE A  1 149 ? 192.621 95.400  32.594  1.00 94.39  ? 341  ILE A CD1  1 
ATOM   2253  H  H    . ILE A  1 149 ? 191.735 96.859  35.837  1.00 103.20 ? 341  ILE A H    1 
ATOM   2254  H  HA   . ILE A  1 149 ? 194.210 97.818  35.596  1.00 105.95 ? 341  ILE A HA   1 
ATOM   2255  H  HB   . ILE A  1 149 ? 192.169 97.704  33.635  1.00 109.52 ? 341  ILE A HB   1 
ATOM   2256  H  HG12 . ILE A  1 149 ? 194.325 95.921  33.565  1.00 110.60 ? 341  ILE A HG12 1 
ATOM   2257  H  HG13 . ILE A  1 149 ? 193.125 95.587  34.551  1.00 110.60 ? 341  ILE A HG13 1 
ATOM   2258  H  HG21 . ILE A  1 149 ? 193.861 98.045  32.052  1.00 113.26 ? 341  ILE A HG21 1 
ATOM   2259  H  HG22 . ILE A  1 149 ? 193.784 99.281  33.048  1.00 113.26 ? 341  ILE A HG22 1 
ATOM   2260  H  HG23 . ILE A  1 149 ? 194.924 98.187  33.224  1.00 113.26 ? 341  ILE A HG23 1 
ATOM   2261  H  HD11 . ILE A  1 149 ? 192.850 94.459  32.555  1.00 113.01 ? 341  ILE A HD11 1 
ATOM   2262  H  HD12 . ILE A  1 149 ? 191.669 95.503  32.751  1.00 113.01 ? 341  ILE A HD12 1 
ATOM   2263  H  HD13 . ILE A  1 149 ? 192.869 95.837  31.764  1.00 113.01 ? 341  ILE A HD13 1 
ATOM   2264  N  N    . PHE A  1 150 ? 194.045 100.267 35.572  1.00 88.67  ? 342  PHE A N    1 
ATOM   2265  C  CA   . PHE A  1 150 ? 193.910 101.715 35.590  1.00 89.79  ? 342  PHE A CA   1 
ATOM   2266  C  C    . PHE A  1 150 ? 194.682 102.318 34.427  1.00 91.69  ? 342  PHE A C    1 
ATOM   2267  O  O    . PHE A  1 150 ? 195.790 101.878 34.104  1.00 90.12  ? 342  PHE A O    1 
ATOM   2268  C  CB   . PHE A  1 150 ? 194.392 102.316 36.926  1.00 87.29  ? 342  PHE A CB   1 
ATOM   2269  C  CG   . PHE A  1 150 ? 195.839 102.041 37.253  1.00 83.93  ? 342  PHE A CG   1 
ATOM   2270  C  CD1  . PHE A  1 150 ? 196.856 102.775 36.661  1.00 85.20  ? 342  PHE A CD1  1 
ATOM   2271  C  CD2  . PHE A  1 150 ? 196.178 101.067 38.179  1.00 82.13  ? 342  PHE A CD2  1 
ATOM   2272  C  CE1  . PHE A  1 150 ? 198.182 102.528 36.973  1.00 84.53  ? 342  PHE A CE1  1 
ATOM   2273  C  CE2  . PHE A  1 150 ? 197.502 100.817 38.494  1.00 79.84  ? 342  PHE A CE2  1 
ATOM   2274  C  CZ   . PHE A  1 150 ? 198.504 101.548 37.890  1.00 81.17  ? 342  PHE A CZ   1 
ATOM   2275  H  H    . PHE A  1 150 ? 194.861 99.994  35.596  1.00 106.16 ? 342  PHE A H    1 
ATOM   2276  H  HA   . PHE A  1 150 ? 192.974 101.945 35.479  1.00 107.50 ? 342  PHE A HA   1 
ATOM   2277  H  HB2  . PHE A  1 150 ? 194.275 103.278 36.893  1.00 104.50 ? 342  PHE A HB2  1 
ATOM   2278  H  HB3  . PHE A  1 150 ? 193.853 101.947 37.644  1.00 104.50 ? 342  PHE A HB3  1 
ATOM   2279  H  HD1  . PHE A  1 150 ? 196.646 103.436 36.041  1.00 101.99 ? 342  PHE A HD1  1 
ATOM   2280  H  HD2  . PHE A  1 150 ? 195.507 100.570 38.588  1.00 98.30  ? 342  PHE A HD2  1 
ATOM   2281  H  HE1  . PHE A  1 150 ? 198.856 103.022 36.565  1.00 101.19 ? 342  PHE A HE1  1 
ATOM   2282  H  HE2  . PHE A  1 150 ? 197.716 100.156 39.112  1.00 95.56  ? 342  PHE A HE2  1 
ATOM   2283  H  HZ   . PHE A  1 150 ? 199.394 101.380 38.101  1.00 97.16  ? 342  PHE A HZ   1 
ATOM   2284  N  N    . ASP A  1 151 ? 194.080 103.321 33.795  1.00 100.90 ? 343  ASP A N    1 
ATOM   2285  C  CA   . ASP A  1 151 ? 194.719 104.041 32.705  1.00 106.81 ? 343  ASP A CA   1 
ATOM   2286  C  C    . ASP A  1 151 ? 195.747 105.006 33.281  1.00 106.47 ? 343  ASP A C    1 
ATOM   2287  O  O    . ASP A  1 151 ? 195.404 105.899 34.063  1.00 106.39 ? 343  ASP A O    1 
ATOM   2288  C  CB   . ASP A  1 151 ? 193.667 104.779 31.882  1.00 110.05 ? 343  ASP A CB   1 
ATOM   2289  C  CG   . ASP A  1 151 ? 192.766 103.833 31.111  1.00 114.61 ? 343  ASP A CG   1 
ATOM   2290  O  OD1  . ASP A  1 151 ? 192.997 102.605 31.183  1.00 113.84 ? 343  ASP A OD1  1 
ATOM   2291  O  OD2  . ASP A  1 151 ? 191.816 104.316 30.454  1.00 119.03 ? 343  ASP A OD2  1 
ATOM   2292  H  H    . ASP A  1 151 ? 193.290 103.604 33.984  1.00 120.83 ? 343  ASP A H    1 
ATOM   2293  H  HA   . ASP A  1 151 ? 195.178 103.412 32.126  1.00 127.93 ? 343  ASP A HA   1 
ATOM   2294  H  HB2  . ASP A  1 151 ? 193.112 105.306 32.477  1.00 131.81 ? 343  ASP A HB2  1 
ATOM   2295  H  HB3  . ASP A  1 151 ? 194.113 105.357 31.243  1.00 131.81 ? 343  ASP A HB3  1 
ATOM   2296  N  N    . GLY A  1 152 ? 197.001 104.820 32.900  1.00 107.40 ? 344  GLY A N    1 
ATOM   2297  C  CA   . GLY A  1 152 ? 198.072 105.661 33.388  1.00 104.80 ? 344  GLY A CA   1 
ATOM   2298  C  C    . GLY A  1 152 ? 199.400 104.941 33.260  1.00 106.27 ? 344  GLY A C    1 
ATOM   2299  O  O    . GLY A  1 152 ? 199.507 103.903 32.608  1.00 106.09 ? 344  GLY A O    1 
ATOM   2300  H  H    . GLY A  1 152 ? 197.257 104.206 32.355  1.00 128.63 ? 344  GLY A H    1 
ATOM   2301  H  HA2  . GLY A  1 152 ? 198.108 106.482 32.873  1.00 125.52 ? 344  GLY A HA2  1 
ATOM   2302  H  HA3  . GLY A  1 152 ? 197.922 105.881 34.320  1.00 125.52 ? 344  GLY A HA3  1 
ATOM   2303  N  N    . MET A  1 153 ? 200.395 105.512 33.903  1.00 117.62 ? 345  MET A N    1 
ATOM   2304  C  CA   . MET A  1 153 ? 201.712 104.903 33.854  1.00 119.90 ? 345  MET A CA   1 
ATOM   2305  C  C    . MET A  1 153 ? 201.910 103.946 35.029  1.00 110.69 ? 345  MET A C    1 
ATOM   2306  O  O    . MET A  1 153 ? 201.278 104.101 36.080  1.00 110.01 ? 345  MET A O    1 
ATOM   2307  C  CB   . MET A  1 153 ? 202.807 105.963 33.879  1.00 126.70 ? 345  MET A CB   1 
ATOM   2308  C  CG   . MET A  1 153 ? 202.818 106.835 35.124  1.00 132.68 ? 345  MET A CG   1 
ATOM   2309  S  SD   . MET A  1 153 ? 204.057 108.149 35.029  1.00 141.53 ? 345  MET A SD   1 
ATOM   2310  C  CE   . MET A  1 153 ? 203.345 109.231 33.778  1.00 143.77 ? 345  MET A CE   1 
ATOM   2311  H  H    . MET A  1 153 ? 200.342 106.235 34.365  1.00 140.90 ? 345  MET A H    1 
ATOM   2312  H  HA   . MET A  1 153 ? 201.798 104.405 33.026  1.00 143.63 ? 345  MET A HA   1 
ATOM   2313  H  HB2  . MET A  1 153 ? 203.668 105.521 33.822  1.00 151.79 ? 345  MET A HB2  1 
ATOM   2314  H  HB3  . MET A  1 153 ? 202.690 106.547 33.113  1.00 151.79 ? 345  MET A HB3  1 
ATOM   2315  H  HG2  . MET A  1 153 ? 201.947 107.248 35.231  1.00 158.97 ? 345  MET A HG2  1 
ATOM   2316  H  HG3  . MET A  1 153 ? 203.022 106.283 35.896  1.00 158.97 ? 345  MET A HG3  1 
ATOM   2317  H  HE1  . MET A  1 153 ? 203.937 109.987 33.641  1.00 172.27 ? 345  MET A HE1  1 
ATOM   2318  H  HE2  . MET A  1 153 ? 203.246 108.734 32.951  1.00 172.27 ? 345  MET A HE2  1 
ATOM   2319  H  HE3  . MET A  1 153 ? 202.478 109.540 34.085  1.00 172.27 ? 345  MET A HE3  1 
ATOM   2320  N  N    . PRO A  1 154 ? 202.792 102.962 34.873  1.00 88.14  ? 346  PRO A N    1 
ATOM   2321  C  CA   . PRO A  1 154 ? 203.058 102.018 35.967  1.00 82.15  ? 346  PRO A CA   1 
ATOM   2322  C  C    . PRO A  1 154 ? 203.445 102.708 37.268  1.00 79.95  ? 346  PRO A C    1 
ATOM   2323  O  O    . PRO A  1 154 ? 204.265 103.629 37.288  1.00 84.63  ? 346  PRO A O    1 
ATOM   2324  C  CB   . PRO A  1 154 ? 204.213 101.171 35.425  1.00 83.51  ? 346  PRO A CB   1 
ATOM   2325  C  CG   . PRO A  1 154 ? 204.130 101.285 33.955  1.00 84.14  ? 346  PRO A CG   1 
ATOM   2326  C  CD   . PRO A  1 154 ? 203.578 102.648 33.666  1.00 84.42  ? 346  PRO A CD   1 
ATOM   2327  H  HA   . PRO A  1 154 ? 202.286 101.451 36.120  1.00 98.33  ? 346  PRO A HA   1 
ATOM   2328  H  HB2  . PRO A  1 154 ? 205.057 101.525 35.749  1.00 99.97  ? 346  PRO A HB2  1 
ATOM   2329  H  HB3  . PRO A  1 154 ? 204.099 100.249 35.704  1.00 99.97  ? 346  PRO A HB3  1 
ATOM   2330  H  HG2  . PRO A  1 154 ? 205.016 101.191 33.573  1.00 100.72 ? 346  PRO A HG2  1 
ATOM   2331  H  HG3  . PRO A  1 154 ? 203.537 100.600 33.611  1.00 100.72 ? 346  PRO A HG3  1 
ATOM   2332  H  HD2  . PRO A  1 154 ? 204.299 103.288 33.556  1.00 101.05 ? 346  PRO A HD2  1 
ATOM   2333  H  HD3  . PRO A  1 154 ? 203.004 102.621 32.886  1.00 101.05 ? 346  PRO A HD3  1 
ATOM   2334  N  N    . ARG A  1 155 ? 202.828 102.265 38.361  1.00 80.80  ? 347  ARG A N    1 
ATOM   2335  C  CA   . ARG A  1 155 ? 203.205 102.745 39.682  1.00 81.27  ? 347  ARG A CA   1 
ATOM   2336  C  C    . ARG A  1 155 ? 204.637 102.341 40.013  1.00 81.35  ? 347  ARG A C    1 
ATOM   2337  O  O    . ARG A  1 155 ? 205.145 101.318 39.544  1.00 78.65  ? 347  ARG A O    1 
ATOM   2338  C  CB   . ARG A  1 155 ? 202.264 102.176 40.746  1.00 81.55  ? 347  ARG A CB   1 
ATOM   2339  C  CG   . ARG A  1 155 ? 200.866 102.757 40.737  1.00 84.20  ? 347  ARG A CG   1 
ATOM   2340  C  CD   . ARG A  1 155 ? 200.087 102.303 41.962  1.00 84.14  ? 347  ARG A CD   1 
ATOM   2341  N  NE   . ARG A  1 155 ? 199.769 100.878 41.907  1.00 83.84  ? 347  ARG A NE   1 
ATOM   2342  C  CZ   . ARG A  1 155 ? 199.098 100.222 42.849  1.00 84.04  ? 347  ARG A CZ   1 
ATOM   2343  N  NH1  . ARG A  1 155 ? 198.671 100.856 43.932  1.00 85.33  ? 347  ARG A NH1  1 
ATOM   2344  N  NH2  . ARG A  1 155 ? 198.857 98.926  42.708  1.00 84.99  ? 347  ARG A NH2  1 
ATOM   2345  H  H    . ARG A  1 155 ? 202.191 101.688 38.362  1.00 96.71  ? 347  ARG A H    1 
ATOM   2346  H  HA   . ARG A  1 155 ? 203.145 103.713 39.704  1.00 97.27  ? 347  ARG A HA   1 
ATOM   2347  H  HB2  . ARG A  1 155 ? 202.184 101.219 40.608  1.00 97.61  ? 347  ARG A HB2  1 
ATOM   2348  H  HB3  . ARG A  1 155 ? 202.647 102.348 41.621  1.00 97.61  ? 347  ARG A HB3  1 
ATOM   2349  H  HG2  . ARG A  1 155 ? 200.920 103.726 40.750  1.00 100.79 ? 347  ARG A HG2  1 
ATOM   2350  H  HG3  . ARG A  1 155 ? 200.396 102.455 39.944  1.00 100.79 ? 347  ARG A HG3  1 
ATOM   2351  H  HD2  . ARG A  1 155 ? 200.619 102.464 42.757  1.00 100.71 ? 347  ARG A HD2  1 
ATOM   2352  H  HD3  . ARG A  1 155 ? 199.253 102.797 42.011  1.00 100.71 ? 347  ARG A HD3  1 
ATOM   2353  H  HE   . ARG A  1 155 ? 200.033 100.435 41.219  1.00 100.36 ? 347  ARG A HE   1 
ATOM   2354  H  HH11 . ARG A  1 155 ? 198.825 101.697 44.028  1.00 102.14 ? 347  ARG A HH11 1 
ATOM   2355  H  HH12 . ARG A  1 155 ? 198.238 100.427 44.539  1.00 102.14 ? 347  ARG A HH12 1 
ATOM   2356  H  HH21 . ARG A  1 155 ? 199.133 98.511  42.007  1.00 101.74 ? 347  ARG A HH21 1 
ATOM   2357  H  HH22 . ARG A  1 155 ? 198.424 98.500  43.317  1.00 101.74 ? 347  ARG A HH22 1 
ATOM   2358  N  N    . SER A  1 156 ? 205.289 103.160 40.833  1.00 85.34  ? 348  SER A N    1 
ATOM   2359  C  CA   . SER A  1 156 ? 206.631 102.852 41.299  1.00 85.47  ? 348  SER A CA   1 
ATOM   2360  C  C    . SER A  1 156 ? 206.580 101.743 42.345  1.00 86.76  ? 348  SER A C    1 
ATOM   2361  O  O    . SER A  1 156 ? 205.531 101.443 42.921  1.00 86.75  ? 348  SER A O    1 
ATOM   2362  C  CB   . SER A  1 156 ? 207.291 104.093 41.897  1.00 90.43  ? 348  SER A CB   1 
ATOM   2363  O  OG   . SER A  1 156 ? 206.580 104.539 43.038  1.00 91.00  ? 348  SER A OG   1 
ATOM   2364  H  H    . SER A  1 156 ? 204.973 103.901 41.134  1.00 102.16 ? 348  SER A H    1 
ATOM   2365  H  HA   . SER A  1 156 ? 207.170 102.547 40.553  1.00 102.31 ? 348  SER A HA   1 
ATOM   2366  H  HB2  . SER A  1 156 ? 208.200 103.873 42.156  1.00 108.27 ? 348  SER A HB2  1 
ATOM   2367  H  HB3  . SER A  1 156 ? 207.297 104.799 41.232  1.00 108.27 ? 348  SER A HB3  1 
ATOM   2368  H  HG   . SER A  1 156 ? 206.951 105.221 43.359  1.00 108.95 ? 348  SER A HG   1 
ATOM   2369  N  N    . LYS A  1 157 ? 207.737 101.124 42.588  1.00 89.57  ? 349  LYS A N    1 
ATOM   2370  C  CA   . LYS A  1 157 ? 207.792 100.097 43.621  1.00 91.58  ? 349  LYS A CA   1 
ATOM   2371  C  C    . LYS A  1 157 ? 207.453 100.678 44.987  1.00 86.61  ? 349  LYS A C    1 
ATOM   2372  O  O    . LYS A  1 157 ? 206.859 99.988  45.824  1.00 81.37  ? 349  LYS A O    1 
ATOM   2373  C  CB   . LYS A  1 157 ? 209.172 99.434  43.643  1.00 96.36  ? 349  LYS A CB   1 
ATOM   2374  C  CG   . LYS A  1 157 ? 209.257 98.186  44.526  1.00 99.78  ? 349  LYS A CG   1 
ATOM   2375  C  CD   . LYS A  1 157 ? 208.291 97.094  44.067  1.00 103.39 ? 349  LYS A CD   1 
ATOM   2376  C  CE   . LYS A  1 157 ? 208.454 95.813  44.875  1.00 105.65 ? 349  LYS A CE   1 
ATOM   2377  N  NZ   . LYS A  1 157 ? 207.445 94.780  44.497  1.00 104.99 ? 349  LYS A NZ   1 
ATOM   2378  H  H    . LYS A  1 157 ? 208.480 101.276 42.183  1.00 107.24 ? 349  LYS A H    1 
ATOM   2379  H  HA   . LYS A  1 157 ? 207.136 99.412  43.417  1.00 109.65 ? 349  LYS A HA   1 
ATOM   2380  H  HB2  . LYS A  1 157 ? 209.406 99.171  42.739  1.00 115.39 ? 349  LYS A HB2  1 
ATOM   2381  H  HB3  . LYS A  1 157 ? 209.820 100.075 43.976  1.00 115.39 ? 349  LYS A HB3  1 
ATOM   2382  H  HG2  . LYS A  1 157 ? 210.158 97.828  44.488  1.00 119.49 ? 349  LYS A HG2  1 
ATOM   2383  H  HG3  . LYS A  1 157 ? 209.031 98.425  45.439  1.00 119.49 ? 349  LYS A HG3  1 
ATOM   2384  H  HD2  . LYS A  1 157 ? 207.380 97.407  44.178  1.00 123.82 ? 349  LYS A HD2  1 
ATOM   2385  H  HD3  . LYS A  1 157 ? 208.463 96.888  43.135  1.00 123.82 ? 349  LYS A HD3  1 
ATOM   2386  H  HE2  . LYS A  1 157 ? 209.337 95.446  44.714  1.00 126.53 ? 349  LYS A HE2  1 
ATOM   2387  H  HE3  . LYS A  1 157 ? 208.342 96.015  45.817  1.00 126.53 ? 349  LYS A HE3  1 
ATOM   2388  H  HZ1  . LYS A  1 157 ? 207.566 94.045  44.985  1.00 125.74 ? 349  LYS A HZ1  1 
ATOM   2389  H  HZ2  . LYS A  1 157 ? 206.624 95.091  44.640  1.00 125.74 ? 349  LYS A HZ2  1 
ATOM   2390  H  HZ3  . LYS A  1 157 ? 207.530 94.572  43.636  1.00 125.74 ? 349  LYS A HZ3  1 
ATOM   2391  N  N    . GLN A  1 158 ? 207.815 101.940 45.232  1.00 89.82  ? 350  GLN A N    1 
ATOM   2392  C  CA   . GLN A  1 158 ? 207.466 102.581 46.496  1.00 92.81  ? 350  GLN A CA   1 
ATOM   2393  C  C    . GLN A  1 158 ? 205.953 102.703 46.651  1.00 89.91  ? 350  GLN A C    1 
ATOM   2394  O  O    . GLN A  1 158 ? 205.398 102.350 47.698  1.00 90.15  ? 350  GLN A O    1 
ATOM   2395  C  CB   . GLN A  1 158 ? 208.128 103.956 46.598  1.00 101.26 ? 350  GLN A CB   1 
ATOM   2396  C  CG   . GLN A  1 158 ? 207.800 104.694 47.895  1.00 107.59 ? 350  GLN A CG   1 
ATOM   2397  C  CD   . GLN A  1 158 ? 208.295 106.125 47.909  1.00 115.21 ? 350  GLN A CD   1 
ATOM   2398  O  OE1  . GLN A  1 158 ? 207.562 107.040 48.283  1.00 119.08 ? 350  GLN A OE1  1 
ATOM   2399  N  NE2  . GLN A  1 158 ? 209.545 106.326 47.510  1.00 116.04 ? 350  GLN A NE2  1 
ATOM   2400  H  H    . GLN A  1 158 ? 208.258 102.439 44.689  1.00 107.54 ? 350  GLN A H    1 
ATOM   2401  H  HA   . GLN A  1 158 ? 207.797 102.036 47.227  1.00 111.12 ? 350  GLN A HA   1 
ATOM   2402  H  HB2  . GLN A  1 158 ? 209.091 103.845 46.554  1.00 121.26 ? 350  GLN A HB2  1 
ATOM   2403  H  HB3  . GLN A  1 158 ? 207.826 104.506 45.858  1.00 121.26 ? 350  GLN A HB3  1 
ATOM   2404  H  HG2  . GLN A  1 158 ? 206.838 104.710 48.012  1.00 128.86 ? 350  GLN A HG2  1 
ATOM   2405  H  HG3  . GLN A  1 158 ? 208.216 104.227 48.636  1.00 128.86 ? 350  GLN A HG3  1 
ATOM   2406  H  HE21 . GLN A  1 158 ? 210.029 105.662 47.256  1.00 139.00 ? 350  GLN A HE21 1 
ATOM   2407  H  HE22 . GLN A  1 158 ? 209.871 107.122 47.501  1.00 139.00 ? 350  GLN A HE22 1 
ATOM   2408  N  N    . GLN A  1 159 ? 205.266 103.210 45.622  1.00 89.32  ? 351  GLN A N    1 
ATOM   2409  C  CA   . GLN A  1 159 ? 203.815 103.352 45.713  1.00 89.95  ? 351  GLN A CA   1 
ATOM   2410  C  C    . GLN A  1 159 ? 203.135 101.998 45.864  1.00 85.78  ? 351  GLN A C    1 
ATOM   2411  O  O    . GLN A  1 159 ? 202.168 101.862 46.621  1.00 84.62  ? 351  GLN A O    1 
ATOM   2412  C  CB   . GLN A  1 159 ? 203.260 104.070 44.481  1.00 97.98  ? 351  GLN A CB   1 
ATOM   2413  C  CG   . GLN A  1 159 ? 203.595 105.548 44.368  1.00 105.53 ? 351  GLN A CG   1 
ATOM   2414  C  CD   . GLN A  1 159 ? 203.106 106.143 43.058  1.00 110.77 ? 351  GLN A CD   1 
ATOM   2415  O  OE1  . GLN A  1 159 ? 203.801 106.092 42.041  1.00 113.67 ? 351  GLN A OE1  1 
ATOM   2416  N  NE2  . GLN A  1 159 ? 201.899 106.701 43.074  1.00 111.34 ? 351  GLN A NE2  1 
ATOM   2417  H  H    . GLN A  1 159 ? 205.609 103.472 44.878  1.00 106.93 ? 351  GLN A H    1 
ATOM   2418  H  HA   . GLN A  1 159 ? 203.598 103.885 46.494  1.00 107.69 ? 351  GLN A HA   1 
ATOM   2419  H  HB2  . GLN A  1 159 ? 203.610 103.633 43.689  1.00 117.33 ? 351  GLN A HB2  1 
ATOM   2420  H  HB3  . GLN A  1 159 ? 202.293 103.993 44.491  1.00 117.33 ? 351  GLN A HB3  1 
ATOM   2421  H  HG2  . GLN A  1 159 ? 203.170 106.027 45.095  1.00 126.39 ? 351  GLN A HG2  1 
ATOM   2422  H  HG3  . GLN A  1 159 ? 204.558 105.660 44.410  1.00 126.39 ? 351  GLN A HG3  1 
ATOM   2423  H  HE21 . GLN A  1 159 ? 201.442 106.716 43.802  1.00 133.36 ? 351  GLN A HE21 1 
ATOM   2424  H  HE22 . GLN A  1 159 ? 201.578 107.051 42.357  1.00 133.36 ? 351  GLN A HE22 1 
ATOM   2425  N  N    . ILE A  1 160 ? 203.628 100.983 45.154  1.00 77.46  ? 352  ILE A N    1 
ATOM   2426  C  CA   . ILE A  1 160 ? 203.029 99.654  45.246  1.00 74.07  ? 352  ILE A CA   1 
ATOM   2427  C  C    . ILE A  1 160 ? 203.179 99.102  46.658  1.00 74.06  ? 352  ILE A C    1 
ATOM   2428  O  O    . ILE A  1 160 ? 202.202 98.675  47.282  1.00 74.05  ? 352  ILE A O    1 
ATOM   2429  C  CB   . ILE A  1 160 ? 203.646 98.712  44.195  1.00 75.45  ? 352  ILE A CB   1 
ATOM   2430  C  CG1  . ILE A  1 160 ? 203.139 99.083  42.800  1.00 75.50  ? 352  ILE A CG1  1 
ATOM   2431  C  CG2  . ILE A  1 160 ? 203.319 97.250  44.506  1.00 73.57  ? 352  ILE A CG2  1 
ATOM   2432  C  CD1  . ILE A  1 160 ? 203.968 98.510  41.676  1.00 77.55  ? 352  ILE A CD1  1 
ATOM   2433  H  H    . ILE A  1 160 ? 204.299 101.037 44.618  1.00 92.70  ? 352  ILE A H    1 
ATOM   2434  H  HA   . ILE A  1 160 ? 202.081 99.726  45.057  1.00 88.63  ? 352  ILE A HA   1 
ATOM   2435  H  HB   . ILE A  1 160 ? 204.609 98.822  44.212  1.00 90.29  ? 352  ILE A HB   1 
ATOM   2436  H  HG12 . ILE A  1 160 ? 202.233 98.751  42.699  1.00 90.35  ? 352  ILE A HG12 1 
ATOM   2437  H  HG13 . ILE A  1 160 ? 203.148 100.048 42.711  1.00 90.35  ? 352  ILE A HG13 1 
ATOM   2438  H  HG21 . ILE A  1 160 ? 203.721 96.686  43.827  1.00 88.04  ? 352  ILE A HG21 1 
ATOM   2439  H  HG22 . ILE A  1 160 ? 203.678 97.025  45.378  1.00 88.04  ? 352  ILE A HG22 1 
ATOM   2440  H  HG23 . ILE A  1 160 ? 202.356 97.135  44.504  1.00 88.04  ? 352  ILE A HG23 1 
ATOM   2441  H  HD11 . ILE A  1 160 ? 203.585 98.787  40.829  1.00 92.81  ? 352  ILE A HD11 1 
ATOM   2442  H  HD12 . ILE A  1 160 ? 204.876 98.840  41.754  1.00 92.81  ? 352  ILE A HD12 1 
ATOM   2443  H  HD13 . ILE A  1 160 ? 203.961 97.542  41.741  1.00 92.81  ? 352  ILE A HD13 1 
ATOM   2444  N  N    . ASP A  1 161 ? 204.407 99.096  47.181  1.00 78.80  ? 353  ASP A N    1 
ATOM   2445  C  CA   . ASP A  1 161 ? 204.643 98.489  48.487  1.00 82.20  ? 353  ASP A CA   1 
ATOM   2446  C  C    . ASP A  1 161 ? 203.824 99.162  49.580  1.00 79.77  ? 353  ASP A C    1 
ATOM   2447  O  O    . ASP A  1 161 ? 203.425 98.505  50.548  1.00 79.93  ? 353  ASP A O    1 
ATOM   2448  C  CB   . ASP A  1 161 ? 206.131 98.544  48.838  1.00 85.59  ? 353  ASP A CB   1 
ATOM   2449  C  CG   . ASP A  1 161 ? 206.946 97.504  48.093  1.00 88.47  ? 353  ASP A CG   1 
ATOM   2450  O  OD1  . ASP A  1 161 ? 206.361 96.495  47.643  1.00 86.15  ? 353  ASP A OD1  1 
ATOM   2451  O  OD2  . ASP A  1 161 ? 208.175 97.691  47.967  1.00 88.61  ? 353  ASP A OD2  1 
ATOM   2452  H  H    . ASP A  1 161 ? 205.106 99.430  46.807  1.00 94.31  ? 353  ASP A H    1 
ATOM   2453  H  HA   . ASP A  1 161 ? 204.380 97.556  48.451  1.00 98.39  ? 353  ASP A HA   1 
ATOM   2454  H  HB2  . ASP A  1 161 ? 206.478 99.420  48.606  1.00 102.46 ? 353  ASP A HB2  1 
ATOM   2455  H  HB3  . ASP A  1 161 ? 206.238 98.384  49.788  1.00 102.46 ? 353  ASP A HB3  1 
ATOM   2456  N  N    . ALA A  1 162 ? 203.556 100.462 49.447  1.00 75.64  ? 354  ALA A N    1 
ATOM   2457  C  CA   . ALA A  1 162 ? 202.777 101.154 50.467  1.00 76.32  ? 354  ALA A CA   1 
ATOM   2458  C  C    . ALA A  1 162 ? 201.321 100.714 50.450  1.00 73.97  ? 354  ALA A C    1 
ATOM   2459  O  O    . ALA A  1 162 ? 200.675 100.679 51.503  1.00 69.87  ? 354  ALA A O    1 
ATOM   2460  C  CB   . ALA A  1 162 ? 202.872 102.668 50.273  1.00 78.76  ? 354  ALA A CB   1 
ATOM   2461  H  H    . ALA A  1 162 ? 203.810 100.955 48.790  1.00 90.51  ? 354  ALA A H    1 
ATOM   2462  H  HA   . ALA A  1 162 ? 203.143 100.941 51.340  1.00 91.34  ? 354  ALA A HA   1 
ATOM   2463  H  HB1  . ALA A  1 162 ? 202.347 103.107 50.961  1.00 94.26  ? 354  ALA A HB1  1 
ATOM   2464  H  HB2  . ALA A  1 162 ? 203.801 102.938 50.342  1.00 94.26  ? 354  ALA A HB2  1 
ATOM   2465  H  HB3  . ALA A  1 162 ? 202.525 102.896 49.396  1.00 94.26  ? 354  ALA A HB3  1 
ATOM   2466  N  N    . MET A  1 163 ? 200.794 100.359 49.277  1.00 77.47  ? 355  MET A N    1 
ATOM   2467  C  CA   . MET A  1 163 ? 199.370 100.102 49.115  1.00 82.58  ? 355  MET A CA   1 
ATOM   2468  C  C    . MET A  1 163 ? 198.991 98.628  49.209  1.00 79.23  ? 355  MET A C    1 
ATOM   2469  O  O    . MET A  1 163 ? 197.824 98.327  49.484  1.00 79.15  ? 355  MET A O    1 
ATOM   2470  C  CB   . MET A  1 163 ? 198.895 100.649 47.761  1.00 91.31  ? 355  MET A CB   1 
ATOM   2471  C  CG   . MET A  1 163 ? 198.553 102.137 47.767  1.00 98.53  ? 355  MET A CG   1 
ATOM   2472  S  SD   . MET A  1 163 ? 197.250 102.592 48.935  1.00 109.81 ? 355  MET A SD   1 
ATOM   2473  C  CE   . MET A  1 163 ? 195.983 101.377 48.563  1.00 105.20 ? 355  MET A CE   1 
ATOM   2474  H  H    . MET A  1 163 ? 201.249 100.260 48.554  1.00 92.71  ? 355  MET A H    1 
ATOM   2475  H  HA   . MET A  1 163 ? 198.892 100.584 49.807  1.00 98.84  ? 355  MET A HA   1 
ATOM   2476  H  HB2  . MET A  1 163 ? 199.597 100.511 47.106  1.00 109.33 ? 355  MET A HB2  1 
ATOM   2477  H  HB3  . MET A  1 163 ? 198.098 100.165 47.493  1.00 109.33 ? 355  MET A HB3  1 
ATOM   2478  H  HG2  . MET A  1 163 ? 199.349 102.638 48.002  1.00 117.99 ? 355  MET A HG2  1 
ATOM   2479  H  HG3  . MET A  1 163 ? 198.256 102.391 46.879  1.00 117.99 ? 355  MET A HG3  1 
ATOM   2480  H  HE1  . MET A  1 163 ? 195.220 101.528 49.143  1.00 125.99 ? 355  MET A HE1  1 
ATOM   2481  H  HE2  . MET A  1 163 ? 195.718 101.471 47.635  1.00 125.99 ? 355  MET A HE2  1 
ATOM   2482  H  HE3  . MET A  1 163 ? 196.343 100.489 48.715  1.00 125.99 ? 355  MET A HE3  1 
ATOM   2483  N  N    . VAL A  1 164 ? 199.929 97.706  48.995  1.00 73.96  ? 356  VAL A N    1 
ATOM   2484  C  CA   . VAL A  1 164 ? 199.616 96.279  49.019  1.00 72.62  ? 356  VAL A CA   1 
ATOM   2485  C  C    . VAL A  1 164 ? 199.871 95.715  50.410  1.00 70.08  ? 356  VAL A C    1 
ATOM   2486  O  O    . VAL A  1 164 ? 200.326 96.430  51.310  1.00 70.85  ? 356  VAL A O    1 
ATOM   2487  C  CB   . VAL A  1 164 ? 200.432 95.503  47.966  1.00 72.30  ? 356  VAL A CB   1 
ATOM   2488  C  CG1  . VAL A  1 164 ? 200.186 96.063  46.572  1.00 72.44  ? 356  VAL A CG1  1 
ATOM   2489  C  CG2  . VAL A  1 164 ? 201.924 95.529  48.304  1.00 73.31  ? 356  VAL A CG2  1 
ATOM   2490  H  H    . VAL A  1 164 ? 200.756 97.882  48.834  1.00 88.50  ? 356  VAL A H    1 
ATOM   2491  H  HA   . VAL A  1 164 ? 198.675 96.159  48.816  1.00 86.90  ? 356  VAL A HA   1 
ATOM   2492  H  HB   . VAL A  1 164 ? 200.144 94.576  47.968  1.00 86.51  ? 356  VAL A HB   1 
ATOM   2493  H  HG11 . VAL A  1 164 ? 200.711 95.557  45.932  1.00 86.68  ? 356  VAL A HG11 1 
ATOM   2494  H  HG12 . VAL A  1 164 ? 199.242 95.985  46.362  1.00 86.68  ? 356  VAL A HG12 1 
ATOM   2495  H  HG13 . VAL A  1 164 ? 200.453 96.996  46.556  1.00 86.68  ? 356  VAL A HG13 1 
ATOM   2496  H  HG21 . VAL A  1 164 ? 202.409 95.034  47.625  1.00 87.73  ? 356  VAL A HG21 1 
ATOM   2497  H  HG22 . VAL A  1 164 ? 202.227 96.450  48.322  1.00 87.73  ? 356  VAL A HG22 1 
ATOM   2498  H  HG23 . VAL A  1 164 ? 202.058 95.119  49.172  1.00 87.73  ? 356  VAL A HG23 1 
ATOM   2499  N  N    . GLY A  1 165 ? 199.575 94.429  50.595  1.00 72.59  ? 357  GLY A N    1 
ATOM   2500  C  CA   . GLY A  1 165 ? 199.917 93.744  51.827  1.00 75.00  ? 357  GLY A CA   1 
ATOM   2501  C  C    . GLY A  1 165 ? 198.824 92.874  52.415  1.00 72.53  ? 357  GLY A C    1 
ATOM   2502  O  O    . GLY A  1 165 ? 199.118 91.960  53.192  1.00 74.98  ? 357  GLY A O    1 
ATOM   2503  H  H    . GLY A  1 165 ? 199.175 93.933  50.016  1.00 86.86  ? 357  GLY A H    1 
ATOM   2504  H  HA2  . GLY A  1 165 ? 200.690 93.181  51.667  1.00 89.76  ? 357  GLY A HA2  1 
ATOM   2505  H  HA3  . GLY A  1 165 ? 200.161 94.405  52.494  1.00 89.76  ? 357  GLY A HA3  1 
ATOM   2506  N  N    . SER A  1 166 ? 197.567 93.135  52.065  1.00 70.69  ? 358  SER A N    1 
ATOM   2507  C  CA   . SER A  1 166 ? 196.457 92.475  52.736  1.00 71.70  ? 358  SER A CA   1 
ATOM   2508  C  C    . SER A  1 166 ? 196.191 91.092  52.140  1.00 72.24  ? 358  SER A C    1 
ATOM   2509  O  O    . SER A  1 166 ? 196.708 90.721  51.083  1.00 70.57  ? 358  SER A O    1 
ATOM   2510  C  CB   . SER A  1 166 ? 195.197 93.335  52.654  1.00 73.48  ? 358  SER A CB   1 
ATOM   2511  O  OG   . SER A  1 166 ? 194.690 93.383  51.333  1.00 77.55  ? 358  SER A OG   1 
ATOM   2512  H  H    . SER A  1 166 ? 197.334 93.687  51.448  1.00 84.58  ? 358  SER A H    1 
ATOM   2513  H  HA   . SER A  1 166 ? 196.680 92.359  53.673  1.00 85.79  ? 358  SER A HA   1 
ATOM   2514  H  HB2  . SER A  1 166 ? 194.520 92.955  53.237  1.00 87.92  ? 358  SER A HB2  1 
ATOM   2515  H  HB3  . SER A  1 166 ? 195.412 94.236  52.941  1.00 87.92  ? 358  SER A HB3  1 
ATOM   2516  H  HG   . SER A  1 166 ? 193.998 93.859  51.308  1.00 92.81  ? 358  SER A HG   1 
ATOM   2517  N  N    . LEU A  1 167 ? 195.359 90.324  52.850  1.00 77.12  ? 359  LEU A N    1 
ATOM   2518  C  CA   . LEU A  1 167 ? 194.982 88.991  52.388  1.00 80.96  ? 359  LEU A CA   1 
ATOM   2519  C  C    . LEU A  1 167 ? 194.045 89.063  51.191  1.00 82.47  ? 359  LEU A C    1 
ATOM   2520  O  O    . LEU A  1 167 ? 194.115 88.221  50.290  1.00 85.84  ? 359  LEU A O    1 
ATOM   2521  C  CB   . LEU A  1 167 ? 194.319 88.215  53.524  1.00 84.27  ? 359  LEU A CB   1 
ATOM   2522  C  CG   . LEU A  1 167 ? 195.220 87.810  54.689  1.00 85.74  ? 359  LEU A CG   1 
ATOM   2523  C  CD1  . LEU A  1 167 ? 194.375 87.471  55.905  1.00 83.11  ? 359  LEU A CD1  1 
ATOM   2524  C  CD2  . LEU A  1 167 ? 196.097 86.633  54.292  1.00 84.78  ? 359  LEU A CD2  1 
ATOM   2525  H  H    . LEU A  1 167 ? 195.003 90.553  53.599  1.00 92.30  ? 359  LEU A H    1 
ATOM   2526  H  HA   . LEU A  1 167 ? 195.780 88.510  52.119  1.00 96.90  ? 359  LEU A HA   1 
ATOM   2527  H  HB2  . LEU A  1 167 ? 193.606 88.762  53.890  1.00 100.88 ? 359  LEU A HB2  1 
ATOM   2528  H  HB3  . LEU A  1 167 ? 193.942 87.401  53.156  1.00 100.88 ? 359  LEU A HB3  1 
ATOM   2529  H  HG   . LEU A  1 167 ? 195.798 88.555  54.919  1.00 102.64 ? 359  LEU A HG   1 
ATOM   2530  H  HD11 . LEU A  1 167 ? 194.961 87.217  56.635  1.00 99.48  ? 359  LEU A HD11 1 
ATOM   2531  H  HD12 . LEU A  1 167 ? 193.855 88.251  56.155  1.00 99.48  ? 359  LEU A HD12 1 
ATOM   2532  H  HD13 . LEU A  1 167 ? 193.784 86.736  55.683  1.00 99.48  ? 359  LEU A HD13 1 
ATOM   2533  H  HD21 . LEU A  1 167 ? 196.661 86.392  55.044  1.00 101.49 ? 359  LEU A HD21 1 
ATOM   2534  H  HD22 . LEU A  1 167 ? 195.530 85.884  54.050  1.00 101.49 ? 359  LEU A HD22 1 
ATOM   2535  H  HD23 . LEU A  1 167 ? 196.647 86.890  53.535  1.00 101.49 ? 359  LEU A HD23 1 
ATOM   2536  N  N    . ALA A  1 168 ? 193.152 90.048  51.174  1.00 84.17  ? 360  ALA A N    1 
ATOM   2537  C  CA   . ALA A  1 168 ? 192.186 90.201  50.096  1.00 84.57  ? 360  ALA A CA   1 
ATOM   2538  C  C    . ALA A  1 168 ? 192.763 90.903  48.876  1.00 83.66  ? 360  ALA A C    1 
ATOM   2539  O  O    . ALA A  1 168 ? 192.056 91.047  47.873  1.00 84.73  ? 360  ALA A O    1 
ATOM   2540  C  CB   . ALA A  1 168 ? 190.967 90.978  50.598  1.00 87.51  ? 360  ALA A CB   1 
ATOM   2541  H  H    . ALA A  1 168 ? 193.087 90.650  51.785  1.00 100.75 ? 360  ALA A H    1 
ATOM   2542  H  HA   . ALA A  1 168 ? 191.885 89.321  49.818  1.00 101.24 ? 360  ALA A HA   1 
ATOM   2543  H  HB1  . ALA A  1 168 ? 190.332 91.073  49.871  1.00 104.76 ? 360  ALA A HB1  1 
ATOM   2544  H  HB2  . ALA A  1 168 ? 190.561 90.489  51.331  1.00 104.76 ? 360  ALA A HB2  1 
ATOM   2545  H  HB3  . ALA A  1 168 ? 191.255 91.853  50.902  1.00 104.76 ? 360  ALA A HB3  1 
ATOM   2546  N  N    . GLY A  1 169 ? 194.015 91.338  48.934  1.00 81.48  ? 361  GLY A N    1 
ATOM   2547  C  CA   . GLY A  1 169 ? 194.559 92.185  47.901  1.00 81.14  ? 361  GLY A CA   1 
ATOM   2548  C  C    . GLY A  1 169 ? 194.121 93.621  48.107  1.00 82.79  ? 361  GLY A C    1 
ATOM   2549  O  O    . GLY A  1 169 ? 193.564 93.995  49.142  1.00 83.70  ? 361  GLY A O    1 
ATOM   2550  H  H    . GLY A  1 169 ? 194.567 91.153  49.567  1.00 97.53  ? 361  GLY A H    1 
ATOM   2551  H  HA2  . GLY A  1 169 ? 195.528 92.147  47.920  1.00 97.12  ? 361  GLY A HA2  1 
ATOM   2552  H  HA3  . GLY A  1 169 ? 194.250 91.885  47.032  1.00 97.12  ? 361  GLY A HA3  1 
ATOM   2553  N  N    . GLU A  1 170 ? 194.376 94.440  47.092  1.00 89.22  ? 362  GLU A N    1 
ATOM   2554  C  CA   . GLU A  1 170 ? 193.953 95.829  47.152  1.00 87.41  ? 362  GLU A CA   1 
ATOM   2555  C  C    . GLU A  1 170 ? 192.434 95.917  47.028  1.00 85.31  ? 362  GLU A C    1 
ATOM   2556  O  O    . GLU A  1 170 ? 191.729 94.915  46.877  1.00 83.70  ? 362  GLU A O    1 
ATOM   2557  C  CB   . GLU A  1 170 ? 194.633 96.647  46.056  1.00 86.92  ? 362  GLU A CB   1 
ATOM   2558  C  CG   . GLU A  1 170 ? 196.094 96.946  46.325  1.00 89.97  ? 362  GLU A CG   1 
ATOM   2559  C  CD   . GLU A  1 170 ? 196.683 97.914  45.318  1.00 92.89  ? 362  GLU A CD   1 
ATOM   2560  O  OE1  . GLU A  1 170 ? 196.417 99.130  45.440  1.00 92.19  ? 362  GLU A OE1  1 
ATOM   2561  O  OE2  . GLU A  1 170 ? 197.409 97.457  44.406  1.00 91.17  ? 362  GLU A OE2  1 
ATOM   2562  H  H    . GLU A  1 170 ? 194.785 94.219  46.369  1.00 106.82 ? 362  GLU A H    1 
ATOM   2563  H  HA   . GLU A  1 170 ? 194.209 96.203  48.010  1.00 104.64 ? 362  GLU A HA   1 
ATOM   2564  H  HB2  . GLU A  1 170 ? 194.581 96.155  45.222  1.00 104.06 ? 362  GLU A HB2  1 
ATOM   2565  H  HB3  . GLU A  1 170 ? 194.170 97.494  45.967  1.00 104.06 ? 362  GLU A HB3  1 
ATOM   2566  H  HG2  . GLU A  1 170 ? 196.180 97.341  47.207  1.00 107.72 ? 362  GLU A HG2  1 
ATOM   2567  H  HG3  . GLU A  1 170 ? 196.600 96.120  46.280  1.00 107.72 ? 362  GLU A HG3  1 
ATOM   2568  N  N    . ALA A  1 171 ? 191.924 97.138  47.120  1.00 72.78  ? 363  ALA A N    1 
ATOM   2569  C  CA   . ALA A  1 171 ? 190.517 97.401  46.875  1.00 75.17  ? 363  ALA A CA   1 
ATOM   2570  C  C    . ALA A  1 171 ? 190.329 97.817  45.425  1.00 76.02  ? 363  ALA A C    1 
ATOM   2571  O  O    . ALA A  1 171 ? 191.108 98.610  44.890  1.00 79.33  ? 363  ALA A O    1 
ATOM   2572  C  CB   . ALA A  1 171 ? 190.000 98.501  47.803  1.00 77.40  ? 363  ALA A CB   1 
ATOM   2573  H  H    . ALA A  1 171 ? 192.379 97.838  47.326  1.00 87.09  ? 363  ALA A H    1 
ATOM   2574  H  HA   . ALA A  1 171 ? 190.002 96.595  47.034  1.00 89.95  ? 363  ALA A HA   1 
ATOM   2575  H  HB1  . ALA A  1 171 ? 189.061 98.655  47.617  1.00 92.64  ? 363  ALA A HB1  1 
ATOM   2576  H  HB2  . ALA A  1 171 ? 190.113 98.216  48.723  1.00 92.64  ? 363  ALA A HB2  1 
ATOM   2577  H  HB3  . ALA A  1 171 ? 190.507 99.313  47.643  1.00 92.64  ? 363  ALA A HB3  1 
ATOM   2578  N  N    . LYS A  1 172 ? 189.297 97.271  44.787  1.00 80.65  ? 364  LYS A N    1 
ATOM   2579  C  CA   . LYS A  1 172 ? 188.899 97.782  43.486  1.00 80.55  ? 364  LYS A CA   1 
ATOM   2580  C  C    . LYS A  1 172 ? 188.612 99.268  43.615  1.00 84.27  ? 364  LYS A C    1 
ATOM   2581  O  O    . LYS A  1 172 ? 188.034 99.719  44.607  1.00 87.40  ? 364  LYS A O    1 
ATOM   2582  C  CB   . LYS A  1 172 ? 187.661 97.054  42.972  1.00 79.19  ? 364  LYS A CB   1 
ATOM   2583  C  CG   . LYS A  1 172 ? 187.796 95.551  42.919  1.00 81.30  ? 364  LYS A CG   1 
ATOM   2584  C  CD   . LYS A  1 172 ? 186.545 94.929  42.335  1.00 85.64  ? 364  LYS A CD   1 
ATOM   2585  C  CE   . LYS A  1 172 ? 186.472 93.445  42.631  1.00 89.21  ? 364  LYS A CE   1 
ATOM   2586  N  NZ   . LYS A  1 172 ? 185.419 92.779  41.819  1.00 94.93  ? 364  LYS A NZ   1 
ATOM   2587  H  H    . LYS A  1 172 ? 188.822 96.617  45.081  1.00 96.54  ? 364  LYS A H    1 
ATOM   2588  H  HA   . LYS A  1 172 ? 189.621 97.658  42.849  1.00 96.41  ? 364  LYS A HA   1 
ATOM   2589  H  HB2  . LYS A  1 172 ? 186.915 97.262  43.555  1.00 94.78  ? 364  LYS A HB2  1 
ATOM   2590  H  HB3  . LYS A  1 172 ? 187.470 97.364  42.073  1.00 94.78  ? 364  LYS A HB3  1 
ATOM   2591  H  HG2  . LYS A  1 172 ? 188.549 95.313  42.355  1.00 97.31  ? 364  LYS A HG2  1 
ATOM   2592  H  HG3  . LYS A  1 172 ? 187.921 95.205  43.816  1.00 97.31  ? 364  LYS A HG3  1 
ATOM   2593  H  HD2  . LYS A  1 172 ? 185.765 95.355  42.723  1.00 102.52 ? 364  LYS A HD2  1 
ATOM   2594  H  HD3  . LYS A  1 172 ? 186.549 95.047  41.372  1.00 102.52 ? 364  LYS A HD3  1 
ATOM   2595  H  HE2  . LYS A  1 172 ? 187.324 93.034  42.420  1.00 106.81 ? 364  LYS A HE2  1 
ATOM   2596  H  HE3  . LYS A  1 172 ? 186.259 93.316  43.569  1.00 106.81 ? 364  LYS A HE3  1 
ATOM   2597  H  HZ1  . LYS A  1 172 ? 185.394 91.910  42.008  1.00 113.66 ? 364  LYS A HZ1  1 
ATOM   2598  H  HZ2  . LYS A  1 172 ? 184.625 93.138  41.998  1.00 113.66 ? 364  LYS A HZ2  1 
ATOM   2599  H  HZ3  . LYS A  1 172 ? 185.594 92.881  40.952  1.00 113.66 ? 364  LYS A HZ3  1 
ATOM   2600  N  N    . ARG A  1 173 ? 189.030 100.042 42.616  1.00 84.86  ? 365  ARG A N    1 
ATOM   2601  C  CA   . ARG A  1 173 ? 188.903 101.484 42.757  1.00 89.52  ? 365  ARG A CA   1 
ATOM   2602  C  C    . ARG A  1 173 ? 187.441 101.890 42.912  1.00 88.34  ? 365  ARG A C    1 
ATOM   2603  O  O    . ARG A  1 173 ? 187.143 102.873 43.599  1.00 89.32  ? 365  ARG A O    1 
ATOM   2604  C  CB   . ARG A  1 173 ? 189.570 102.199 41.576  1.00 95.91  ? 365  ARG A CB   1 
ATOM   2605  C  CG   . ARG A  1 173 ? 189.643 103.721 41.716  1.00 101.81 ? 365  ARG A CG   1 
ATOM   2606  C  CD   . ARG A  1 173 ? 190.125 104.141 43.134  1.00 107.43 ? 365  ARG A CD   1 
ATOM   2607  N  NE   . ARG A  1 173 ? 190.166 105.593 43.348  1.00 114.96 ? 365  ARG A NE   1 
ATOM   2608  C  CZ   . ARG A  1 173 ? 190.131 106.182 44.547  1.00 118.08 ? 365  ARG A CZ   1 
ATOM   2609  N  NH1  . ARG A  1 173 ? 190.048 105.455 45.655  1.00 118.51 ? 365  ARG A NH1  1 
ATOM   2610  N  NH2  . ARG A  1 173 ? 190.189 107.506 44.648  1.00 120.12 ? 365  ARG A NH2  1 
ATOM   2611  H  H    . ARG A  1 173 ? 189.375 99.769  41.877  1.00 101.59 ? 365  ARG A H    1 
ATOM   2612  H  HA   . ARG A  1 173 ? 189.368 101.757 43.563  1.00 107.18 ? 365  ARG A HA   1 
ATOM   2613  H  HB2  . ARG A  1 173 ? 190.477 101.868 41.485  1.00 114.85 ? 365  ARG A HB2  1 
ATOM   2614  H  HB3  . ARG A  1 173 ? 189.068 102.001 40.770  1.00 114.85 ? 365  ARG A HB3  1 
ATOM   2615  H  HG2  . ARG A  1 173 ? 190.271 104.072 41.065  1.00 121.93 ? 365  ARG A HG2  1 
ATOM   2616  H  HG3  . ARG A  1 173 ? 188.762 104.098 41.570  1.00 121.93 ? 365  ARG A HG3  1 
ATOM   2617  H  HD2  . ARG A  1 173 ? 189.522 103.763 43.793  1.00 128.66 ? 365  ARG A HD2  1 
ATOM   2618  H  HD3  . ARG A  1 173 ? 191.021 103.797 43.274  1.00 128.66 ? 365  ARG A HD3  1 
ATOM   2619  H  HE   . ARG A  1 173 ? 190.216 106.099 42.654  1.00 137.70 ? 365  ARG A HE   1 
ATOM   2620  H  HH11 . ARG A  1 173 ? 190.015 104.597 45.604  1.00 141.96 ? 365  ARG A HH11 1 
ATOM   2621  H  HH12 . ARG A  1 173 ? 190.025 105.842 46.422  1.00 141.96 ? 365  ARG A HH12 1 
ATOM   2622  H  HH21 . ARG A  1 173 ? 190.241 107.990 43.939  1.00 143.90 ? 365  ARG A HH21 1 
ATOM   2623  H  HH22 . ARG A  1 173 ? 190.161 107.880 45.422  1.00 143.90 ? 365  ARG A HH22 1 
ATOM   2624  N  N    . GLU A  1 174 ? 186.515 101.138 42.309  1.00 93.72  ? 366  GLU A N    1 
ATOM   2625  C  CA   . GLU A  1 174 ? 185.099 101.447 42.480  1.00 100.83 ? 366  GLU A CA   1 
ATOM   2626  C  C    . GLU A  1 174 ? 184.668 101.291 43.931  1.00 95.81  ? 366  GLU A C    1 
ATOM   2627  O  O    . GLU A  1 174 ? 183.714 101.945 44.367  1.00 100.45 ? 366  GLU A O    1 
ATOM   2628  C  CB   . GLU A  1 174 ? 184.240 100.542 41.594  1.00 108.53 ? 366  GLU A CB   1 
ATOM   2629  C  CG   . GLU A  1 174 ? 184.228 100.915 40.122  1.00 118.00 ? 366  GLU A CG   1 
ATOM   2630  C  CD   . GLU A  1 174 ? 183.540 102.241 39.859  1.00 126.26 ? 366  GLU A CD   1 
ATOM   2631  O  OE1  . GLU A  1 174 ? 182.534 102.538 40.538  1.00 129.23 ? 366  GLU A OE1  1 
ATOM   2632  O  OE2  . GLU A  1 174 ? 184.002 102.984 38.968  1.00 128.11 ? 366  GLU A OE2  1 
ATOM   2633  H  H    . GLU A  1 174 ? 186.678 100.460 41.807  1.00 112.21 ? 366  GLU A H    1 
ATOM   2634  H  HA   . GLU A  1 174 ? 184.940 102.367 42.215  1.00 120.75 ? 366  GLU A HA   1 
ATOM   2635  H  HB2  . GLU A  1 174 ? 184.575 99.634  41.664  1.00 129.99 ? 366  GLU A HB2  1 
ATOM   2636  H  HB3  . GLU A  1 174 ? 183.324 100.576 41.913  1.00 129.99 ? 366  GLU A HB3  1 
ATOM   2637  H  HG2  . GLU A  1 174 ? 185.142 100.983 39.805  1.00 141.35 ? 366  GLU A HG2  1 
ATOM   2638  H  HG3  . GLU A  1 174 ? 183.756 100.228 39.626  1.00 141.35 ? 366  GLU A HG3  1 
ATOM   2639  N  N    . ALA A  1 175 ? 185.359 100.440 44.695  1.00 87.63  ? 367  ALA A N    1 
ATOM   2640  C  CA   . ALA A  1 175 ? 185.002 100.251 46.096  1.00 87.67  ? 367  ALA A CA   1 
ATOM   2641  C  C    . ALA A  1 175 ? 185.084 101.556 46.875  1.00 88.86  ? 367  ALA A C    1 
ATOM   2642  O  O    . ALA A  1 175 ? 184.359 101.735 47.861  1.00 91.58  ? 367  ALA A O    1 
ATOM   2643  C  CB   . ALA A  1 175 ? 185.910 99.201  46.737  1.00 87.09  ? 367  ALA A CB   1 
ATOM   2644  H  H    . ALA A  1 175 ? 186.027 99.969  44.428  1.00 104.91 ? 367  ALA A H    1 
ATOM   2645  H  HA   . ALA A  1 175 ? 184.089 99.929  46.148  1.00 104.96 ? 367  ALA A HA   1 
ATOM   2646  H  HB1  . ALA A  1 175 ? 185.657 99.090  47.667  1.00 104.27 ? 367  ALA A HB1  1 
ATOM   2647  H  HB2  . ALA A  1 175 ? 185.804 98.361  46.263  1.00 104.27 ? 367  ALA A HB2  1 
ATOM   2648  H  HB3  . ALA A  1 175 ? 186.830 99.501  46.677  1.00 104.27 ? 367  ALA A HB3  1 
ATOM   2649  N  N    . ASN A  1 176 ? 185.957 102.473 46.454  1.00 79.61  ? 368  ASN A N    1 
ATOM   2650  C  CA   . ASN A  1 176 ? 186.209 103.706 47.185  1.00 80.11  ? 368  ASN A CA   1 
ATOM   2651  C  C    . ASN A  1 176 ? 185.723 104.947 46.438  1.00 84.02  ? 368  ASN A C    1 
ATOM   2652  O  O    . ASN A  1 176 ? 186.193 106.055 46.720  1.00 83.62  ? 368  ASN A O    1 
ATOM   2653  C  CB   . ASN A  1 176 ? 187.701 103.827 47.494  1.00 76.72  ? 368  ASN A CB   1 
ATOM   2654  C  CG   . ASN A  1 176 ? 188.210 102.693 48.365  1.00 74.73  ? 368  ASN A CG   1 
ATOM   2655  O  OD1  . ASN A  1 176 ? 187.617 102.376 49.395  1.00 77.67  ? 368  ASN A OD1  1 
ATOM   2656  N  ND2  . ASN A  1 176 ? 189.310 102.072 47.952  1.00 74.33  ? 368  ASN A ND2  1 
ATOM   2657  H  H    . ASN A  1 176 ? 186.422 102.398 45.734  1.00 95.28  ? 368  ASN A H    1 
ATOM   2658  H  HA   . ASN A  1 176 ? 185.735 103.668 48.031  1.00 95.89  ? 368  ASN A HA   1 
ATOM   2659  H  HB2  . ASN A  1 176 ? 188.198 103.814 46.662  1.00 91.82  ? 368  ASN A HB2  1 
ATOM   2660  H  HB3  . ASN A  1 176 ? 187.860 104.661 47.963  1.00 91.82  ? 368  ASN A HB3  1 
ATOM   2661  H  HD21 . ASN A  1 176 ? 189.636 101.423 48.412  1.00 88.95  ? 368  ASN A HD21 1 
ATOM   2662  H  HD22 . ASN A  1 176 ? 189.697 102.321 47.225  1.00 88.95  ? 368  ASN A HD22 1 
ATOM   2663  N  N    . LYS A  1 177 ? 184.784 104.792 45.495  1.00 92.99  ? 369  LYS A N    1 
ATOM   2664  C  CA   . LYS A  1 177 ? 184.275 105.929 44.739  1.00 99.31  ? 369  LYS A CA   1 
ATOM   2665  C  C    . LYS A  1 177 ? 182.867 106.342 45.132  1.00 97.06  ? 369  LYS A C    1 
ATOM   2666  O  O    . LYS A  1 177 ? 182.448 107.448 44.774  1.00 99.39  ? 369  LYS A O    1 
ATOM   2667  C  CB   . LYS A  1 177 ? 184.269 105.620 43.241  1.00 106.66 ? 369  LYS A CB   1 
ATOM   2668  C  CG   . LYS A  1 177 ? 185.630 105.488 42.639  1.00 112.16 ? 369  LYS A CG   1 
ATOM   2669  C  CD   . LYS A  1 177 ? 186.386 106.790 42.687  1.00 117.63 ? 369  LYS A CD   1 
ATOM   2670  C  CE   . LYS A  1 177 ? 187.692 106.573 42.039  1.00 119.05 ? 369  LYS A CE   1 
ATOM   2671  N  NZ   . LYS A  1 177 ? 188.553 107.781 42.161  1.00 120.12 ? 369  LYS A NZ   1 
ATOM   2672  H  H    . LYS A  1 177 ? 184.431 104.039 45.279  1.00 111.34 ? 369  LYS A H    1 
ATOM   2673  H  HA   . LYS A  1 177 ? 184.860 106.689 44.885  1.00 118.93 ? 369  LYS A HA   1 
ATOM   2674  H  HB2  . LYS A  1 177 ? 183.801 104.782 43.097  1.00 127.75 ? 369  LYS A HB2  1 
ATOM   2675  H  HB3  . LYS A  1 177 ? 183.809 106.336 42.777  1.00 127.75 ? 369  LYS A HB3  1 
ATOM   2676  H  HG2  . LYS A  1 177 ? 186.136 104.825 43.134  1.00 134.35 ? 369  LYS A HG2  1 
ATOM   2677  H  HG3  . LYS A  1 177 ? 185.545 105.221 41.710  1.00 134.35 ? 369  LYS A HG3  1 
ATOM   2678  H  HD2  . LYS A  1 177 ? 185.901 107.474 42.199  1.00 140.90 ? 369  LYS A HD2  1 
ATOM   2679  H  HD3  . LYS A  1 177 ? 186.531 107.057 43.608  1.00 140.90 ? 369  LYS A HD3  1 
ATOM   2680  H  HE2  . LYS A  1 177 ? 188.144 105.830 42.468  1.00 142.61 ? 369  LYS A HE2  1 
ATOM   2681  H  HE3  . LYS A  1 177 ? 187.557 106.387 41.096  1.00 142.61 ? 369  LYS A HE3  1 
ATOM   2682  H  HZ1  . LYS A  1 177 ? 189.337 107.637 41.766  1.00 143.89 ? 369  LYS A HZ1  1 
ATOM   2683  H  HZ2  . LYS A  1 177 ? 188.157 108.477 41.772  1.00 143.89 ? 369  LYS A HZ2  1 
ATOM   2684  H  HZ3  . LYS A  1 177 ? 188.692 107.970 43.019  1.00 143.89 ? 369  LYS A HZ3  1 
ATOM   2685  N  N    . SER A  1 178 ? 182.131 105.501 45.852  1.00 91.89  ? 370  SER A N    1 
ATOM   2686  C  CA   . SER A  1 178 ? 180.797 105.880 46.292  1.00 91.10  ? 370  SER A CA   1 
ATOM   2687  C  C    . SER A  1 178 ? 180.876 107.151 47.125  1.00 90.11  ? 370  SER A C    1 
ATOM   2688  O  O    . SER A  1 178 ? 181.855 107.396 47.836  1.00 87.45  ? 370  SER A O    1 
ATOM   2689  C  CB   . SER A  1 178 ? 180.154 104.750 47.093  1.00 92.83  ? 370  SER A CB   1 
ATOM   2690  O  OG   . SER A  1 178 ? 181.105 104.068 47.894  1.00 92.76  ? 370  SER A OG   1 
ATOM   2691  H  H    . SER A  1 178 ? 182.379 104.715 46.096  1.00 110.02 ? 370  SER A H    1 
ATOM   2692  H  HA   . SER A  1 178 ? 180.243 106.058 45.516  1.00 109.08 ? 370  SER A HA   1 
ATOM   2693  H  HB2  . SER A  1 178 ? 179.470 105.126 47.670  1.00 111.14 ? 370  SER A HB2  1 
ATOM   2694  H  HB3  . SER A  1 178 ? 179.753 104.118 46.476  1.00 111.14 ? 370  SER A HB3  1 
ATOM   2695  H  HG   . SER A  1 178 ? 180.729 103.453 48.325  1.00 111.07 ? 370  SER A HG   1 
ATOM   2696  N  N    . LYS A  1 179 ? 179.832 107.967 47.036  1.00 95.17  ? 371  LYS A N    1 
ATOM   2697  C  CA   . LYS A  1 179 ? 179.810 109.209 47.792  1.00 97.21  ? 371  LYS A CA   1 
ATOM   2698  C  C    . LYS A  1 179 ? 179.603 108.915 49.271  1.00 94.23  ? 371  LYS A C    1 
ATOM   2699  O  O    . LYS A  1 179 ? 178.716 108.144 49.647  1.00 92.69  ? 371  LYS A O    1 
ATOM   2700  C  CB   . LYS A  1 179 ? 178.709 110.139 47.285  1.00 100.18 ? 371  LYS A CB   1 
ATOM   2701  C  CG   . LYS A  1 179 ? 178.742 111.513 47.943  1.00 104.61 ? 371  LYS A CG   1 
ATOM   2702  C  CD   . LYS A  1 179 ? 177.496 112.324 47.644  1.00 113.82 ? 371  LYS A CD   1 
ATOM   2703  C  CE   . LYS A  1 179 ? 177.202 113.305 48.768  1.00 116.82 ? 371  LYS A CE   1 
ATOM   2704  N  NZ   . LYS A  1 179 ? 178.279 114.322 48.932  1.00 116.75 ? 371  LYS A NZ   1 
ATOM   2705  H  H    . LYS A  1 179 ? 179.134 107.827 46.552  1.00 113.96 ? 371  LYS A H    1 
ATOM   2706  H  HA   . LYS A  1 179 ? 180.661 109.662 47.688  1.00 116.40 ? 371  LYS A HA   1 
ATOM   2707  H  HB2  . LYS A  1 179 ? 178.816 110.263 46.329  1.00 119.97 ? 371  LYS A HB2  1 
ATOM   2708  H  HB3  . LYS A  1 179 ? 177.846 109.738 47.473  1.00 119.97 ? 371  LYS A HB3  1 
ATOM   2709  H  HG2  . LYS A  1 179 ? 178.806 111.403 48.905  1.00 125.28 ? 371  LYS A HG2  1 
ATOM   2710  H  HG3  . LYS A  1 179 ? 179.509 112.005 47.612  1.00 125.28 ? 371  LYS A HG3  1 
ATOM   2711  H  HD2  . LYS A  1 179 ? 177.628 112.827 46.825  1.00 136.34 ? 371  LYS A HD2  1 
ATOM   2712  H  HD3  . LYS A  1 179 ? 176.737 111.726 47.553  1.00 136.34 ? 371  LYS A HD3  1 
ATOM   2713  H  HE2  . LYS A  1 179 ? 176.374 113.772 48.573  1.00 139.93 ? 371  LYS A HE2  1 
ATOM   2714  H  HE3  . LYS A  1 179 ? 177.119 112.817 49.602  1.00 139.93 ? 371  LYS A HE3  1 
ATOM   2715  H  HZ1  . LYS A  1 179 ? 178.073 114.877 49.597  1.00 139.85 ? 371  LYS A HZ1  1 
ATOM   2716  H  HZ2  . LYS A  1 179 ? 179.050 113.920 49.120  1.00 139.85 ? 371  LYS A HZ2  1 
ATOM   2717  H  HZ3  . LYS A  1 179 ? 178.371 114.791 48.182  1.00 139.85 ? 371  LYS A HZ3  1 
ATOM   2718  N  N    . VAL A  1 180 ? 180.433 109.532 50.106  1.00 86.78  ? 372  VAL A N    1 
ATOM   2719  C  CA   . VAL A  1 180 ? 180.370 109.380 51.552  1.00 84.22  ? 372  VAL A CA   1 
ATOM   2720  C  C    . VAL A  1 180 ? 180.072 110.749 52.148  1.00 85.29  ? 372  VAL A C    1 
ATOM   2721  O  O    . VAL A  1 180 ? 180.685 111.749 51.755  1.00 87.41  ? 372  VAL A O    1 
ATOM   2722  C  CB   . VAL A  1 180 ? 181.682 108.799 52.115  1.00 82.42  ? 372  VAL A CB   1 
ATOM   2723  C  CG1  . VAL A  1 180 ? 181.699 108.850 53.639  1.00 81.08  ? 372  VAL A CG1  1 
ATOM   2724  C  CG2  . VAL A  1 180 ? 181.883 107.370 51.624  1.00 77.12  ? 372  VAL A CG2  1 
ATOM   2725  H  H    . VAL A  1 180 ? 181.061 110.060 49.848  1.00 103.88 ? 372  VAL A H    1 
ATOM   2726  H  HA   . VAL A  1 180 ? 179.644 108.780 51.783  1.00 100.81 ? 372  VAL A HA   1 
ATOM   2727  H  HB   . VAL A  1 180 ? 182.425 109.332 51.791  1.00 98.66  ? 372  VAL A HB   1 
ATOM   2728  H  HG11 . VAL A  1 180 ? 182.536 108.478 53.958  1.00 97.05  ? 372  VAL A HG11 1 
ATOM   2729  H  HG12 . VAL A  1 180 ? 181.617 109.774 53.925  1.00 97.05  ? 372  VAL A HG12 1 
ATOM   2730  H  HG13 . VAL A  1 180 ? 180.954 108.331 53.981  1.00 97.05  ? 372  VAL A HG13 1 
ATOM   2731  H  HG21 . VAL A  1 180 ? 182.712 107.025 51.989  1.00 92.30  ? 372  VAL A HG21 1 
ATOM   2732  H  HG22 . VAL A  1 180 ? 181.137 106.826 51.923  1.00 92.30  ? 372  VAL A HG22 1 
ATOM   2733  H  HG23 . VAL A  1 180 ? 181.923 107.372 50.655  1.00 92.30  ? 372  VAL A HG23 1 
ATOM   2734  N  N    . PHE A  1 181 ? 179.125 110.793 53.087  1.00 83.42  ? 373  PHE A N    1 
ATOM   2735  C  CA   . PHE A  1 181 ? 178.783 112.030 53.789  1.00 85.58  ? 373  PHE A CA   1 
ATOM   2736  C  C    . PHE A  1 181 ? 179.706 112.163 54.996  1.00 84.86  ? 373  PHE A C    1 
ATOM   2737  O  O    . PHE A  1 181 ? 179.332 111.905 56.142  1.00 84.94  ? 373  PHE A O    1 
ATOM   2738  C  CB   . PHE A  1 181 ? 177.321 112.030 54.215  1.00 87.58  ? 373  PHE A CB   1 
ATOM   2739  C  CG   . PHE A  1 181 ? 176.348 112.089 53.076  1.00 89.12  ? 373  PHE A CG   1 
ATOM   2740  C  CD1  . PHE A  1 181 ? 176.042 113.296 52.469  1.00 93.32  ? 373  PHE A CD1  1 
ATOM   2741  C  CD2  . PHE A  1 181 ? 175.712 110.942 52.634  1.00 89.20  ? 373  PHE A CD2  1 
ATOM   2742  C  CE1  . PHE A  1 181 ? 175.135 113.354 51.427  1.00 94.41  ? 373  PHE A CE1  1 
ATOM   2743  C  CE2  . PHE A  1 181 ? 174.805 110.992 51.593  1.00 93.15  ? 373  PHE A CE2  1 
ATOM   2744  C  CZ   . PHE A  1 181 ? 174.515 112.200 50.990  1.00 95.17  ? 373  PHE A CZ   1 
ATOM   2745  H  H    . PHE A  1 181 ? 178.662 110.113 53.338  1.00 99.86  ? 373  PHE A H    1 
ATOM   2746  H  HA   . PHE A  1 181 ? 178.933 112.788 53.202  1.00 102.44 ? 373  PHE A HA   1 
ATOM   2747  H  HB2  . PHE A  1 181 ? 177.142 111.217 54.714  1.00 104.84 ? 373  PHE A HB2  1 
ATOM   2748  H  HB3  . PHE A  1 181 ? 177.161 112.802 54.780  1.00 104.84 ? 373  PHE A HB3  1 
ATOM   2749  H  HD1  . PHE A  1 181 ? 176.458 114.076 52.760  1.00 111.73 ? 373  PHE A HD1  1 
ATOM   2750  H  HD2  . PHE A  1 181 ? 175.905 110.126 53.036  1.00 106.79 ? 373  PHE A HD2  1 
ATOM   2751  H  HE1  . PHE A  1 181 ? 174.942 114.168 51.022  1.00 113.04 ? 373  PHE A HE1  1 
ATOM   2752  H  HE2  . PHE A  1 181 ? 174.389 110.214 51.300  1.00 111.53 ? 373  PHE A HE2  1 
ATOM   2753  H  HZ   . PHE A  1 181 ? 173.905 112.236 50.288  1.00 113.95 ? 373  PHE A HZ   1 
ATOM   2754  N  N    . PHE A  1 182 ? 180.939 112.581 54.727  1.00 72.86  ? 374  PHE A N    1 
ATOM   2755  C  CA   . PHE A  1 182 ? 181.949 112.708 55.770  1.00 74.28  ? 374  PHE A CA   1 
ATOM   2756  C  C    . PHE A  1 182 ? 181.901 114.051 56.489  1.00 76.35  ? 374  PHE A C    1 
ATOM   2757  O  O    . PHE A  1 182 ? 182.665 114.254 57.439  1.00 76.51  ? 374  PHE A O    1 
ATOM   2758  C  CB   . PHE A  1 182 ? 183.345 112.493 55.176  1.00 75.58  ? 374  PHE A CB   1 
ATOM   2759  C  CG   . PHE A  1 182 ? 183.663 113.404 54.023  1.00 76.98  ? 374  PHE A CG   1 
ATOM   2760  C  CD1  . PHE A  1 182 ? 184.197 114.662 54.239  1.00 78.95  ? 374  PHE A CD1  1 
ATOM   2761  C  CD2  . PHE A  1 182 ? 183.431 112.994 52.720  1.00 79.05  ? 374  PHE A CD2  1 
ATOM   2762  C  CE1  . PHE A  1 182 ? 184.489 115.497 53.175  1.00 80.12  ? 374  PHE A CE1  1 
ATOM   2763  C  CE2  . PHE A  1 182 ? 183.720 113.823 51.655  1.00 79.04  ? 374  PHE A CE2  1 
ATOM   2764  C  CZ   . PHE A  1 182 ? 184.250 115.076 51.882  1.00 77.49  ? 374  PHE A CZ   1 
ATOM   2765  H  H    . PHE A  1 182 ? 181.216 112.799 53.943  1.00 87.18  ? 374  PHE A H    1 
ATOM   2766  H  HA   . PHE A  1 182 ? 181.800 112.015 56.432  1.00 88.88  ? 374  PHE A HA   1 
ATOM   2767  H  HB2  . PHE A  1 182 ? 184.006 112.650 55.868  1.00 90.45  ? 374  PHE A HB2  1 
ATOM   2768  H  HB3  . PHE A  1 182 ? 183.412 111.579 54.859  1.00 90.45  ? 374  PHE A HB3  1 
ATOM   2769  H  HD1  . PHE A  1 182 ? 184.359 114.951 55.108  1.00 94.50  ? 374  PHE A HD1  1 
ATOM   2770  H  HD2  . PHE A  1 182 ? 183.073 112.151 52.561  1.00 94.61  ? 374  PHE A HD2  1 
ATOM   2771  H  HE1  . PHE A  1 182 ? 184.847 116.341 53.331  1.00 95.89  ? 374  PHE A HE1  1 
ATOM   2772  H  HE2  . PHE A  1 182 ? 183.559 113.537 50.785  1.00 94.60  ? 374  PHE A HE2  1 
ATOM   2773  H  HZ   . PHE A  1 182 ? 184.447 115.635 51.166  1.00 92.74  ? 374  PHE A HZ   1 
ATOM   2774  N  N    . GLY A  1 183 ? 181.019 114.959 56.077  1.00 71.67  ? 375  GLY A N    1 
ATOM   2775  C  CA   . GLY A  1 183 ? 180.882 116.222 56.770  1.00 74.89  ? 375  GLY A CA   1 
ATOM   2776  C  C    . GLY A  1 183 ? 180.274 116.063 58.151  1.00 76.70  ? 375  GLY A C    1 
ATOM   2777  O  O    . GLY A  1 183 ? 179.652 115.053 58.487  1.00 70.97  ? 375  GLY A O    1 
ATOM   2778  H  H    . GLY A  1 183 ? 180.495 114.863 55.403  1.00 85.76  ? 375  GLY A H    1 
ATOM   2779  H  HA2  . GLY A  1 183 ? 181.755 116.635 56.864  1.00 89.62  ? 375  GLY A HA2  1 
ATOM   2780  H  HA3  . GLY A  1 183 ? 180.316 116.814 56.251  1.00 89.62  ? 375  GLY A HA3  1 
ATOM   2781  N  N    . LEU A  1 184 ? 180.468 117.090 58.972  1.00 78.99  ? 376  LEU A N    1 
ATOM   2782  C  CA   . LEU A  1 184 ? 179.952 117.099 60.332  1.00 78.43  ? 376  LEU A CA   1 
ATOM   2783  C  C    . LEU A  1 184 ? 178.513 117.597 60.356  1.00 81.73  ? 376  LEU A C    1 
ATOM   2784  O  O    . LEU A  1 184 ? 178.073 118.335 59.470  1.00 83.63  ? 376  LEU A O    1 
ATOM   2785  C  CB   . LEU A  1 184 ? 180.814 117.981 61.236  1.00 72.29  ? 376  LEU A CB   1 
ATOM   2786  C  CG   . LEU A  1 184 ? 182.307 117.657 61.283  1.00 72.30  ? 376  LEU A CG   1 
ATOM   2787  C  CD1  . LEU A  1 184 ? 183.008 118.534 62.309  1.00 71.57  ? 376  LEU A CD1  1 
ATOM   2788  C  CD2  . LEU A  1 184 ? 182.538 116.183 61.585  1.00 70.97  ? 376  LEU A CD2  1 
ATOM   2789  H  H    . LEU A  1 184 ? 180.901 117.803 58.760  1.00 94.54  ? 376  LEU A H    1 
ATOM   2790  H  HA   . LEU A  1 184 ? 179.967 116.195 60.685  1.00 93.86  ? 376  LEU A HA   1 
ATOM   2791  H  HB2  . LEU A  1 184 ? 180.728 118.899 60.935  1.00 86.50  ? 376  LEU A HB2  1 
ATOM   2792  H  HB3  . LEU A  1 184 ? 180.475 117.909 62.142  1.00 86.50  ? 376  LEU A HB3  1 
ATOM   2793  H  HG   . LEU A  1 184 ? 182.695 117.847 60.415  1.00 86.51  ? 376  LEU A HG   1 
ATOM   2794  H  HD11 . LEU A  1 184 ? 183.952 118.311 62.321  1.00 85.63  ? 376  LEU A HD11 1 
ATOM   2795  H  HD12 . LEU A  1 184 ? 182.890 119.464 62.061  1.00 85.63  ? 376  LEU A HD12 1 
ATOM   2796  H  HD13 . LEU A  1 184 ? 182.618 118.371 63.182  1.00 85.63  ? 376  LEU A HD13 1 
ATOM   2797  H  HD21 . LEU A  1 184 ? 183.493 116.012 61.607  1.00 84.92  ? 376  LEU A HD21 1 
ATOM   2798  H  HD22 . LEU A  1 184 ? 182.143 115.972 62.445  1.00 84.92  ? 376  LEU A HD22 1 
ATOM   2799  H  HD23 . LEU A  1 184 ? 182.122 115.650 60.890  1.00 84.92  ? 376  LEU A HD23 1 
ATOM   2800  N  N    . LEU A  1 185 ? 177.779 117.177 61.382  1.00 75.77  ? 377  LEU A N    1 
ATOM   2801  C  CA   . LEU A  1 185 ? 176.420 117.655 61.572  1.00 78.94  ? 377  LEU A CA   1 
ATOM   2802  C  C    . LEU A  1 185 ? 176.436 119.092 62.080  1.00 85.10  ? 377  LEU A C    1 
ATOM   2803  O  O    . LEU A  1 185 ? 177.344 119.509 62.804  1.00 83.34  ? 377  LEU A O    1 
ATOM   2804  C  CB   . LEU A  1 185 ? 175.675 116.760 62.564  1.00 76.54  ? 377  LEU A CB   1 
ATOM   2805  C  CG   . LEU A  1 185 ? 175.562 115.276 62.208  1.00 73.59  ? 377  LEU A CG   1 
ATOM   2806  C  CD1  . LEU A  1 185 ? 174.818 114.527 63.303  1.00 71.77  ? 377  LEU A CD1  1 
ATOM   2807  C  CD2  . LEU A  1 185 ? 174.865 115.083 60.869  1.00 74.16  ? 377  LEU A CD2  1 
ATOM   2808  H  H    . LEU A  1 185 ? 178.046 116.617 61.978  1.00 90.67  ? 377  LEU A H    1 
ATOM   2809  H  HA   . LEU A  1 185 ? 175.948 117.634 60.724  1.00 94.49  ? 377  LEU A HA   1 
ATOM   2810  H  HB2  . LEU A  1 185 ? 176.129 116.815 63.420  1.00 91.60  ? 377  LEU A HB2  1 
ATOM   2811  H  HB3  . LEU A  1 185 ? 174.772 117.101 62.659  1.00 91.60  ? 377  LEU A HB3  1 
ATOM   2812  H  HG   . LEU A  1 185 ? 176.453 114.899 62.139  1.00 88.06  ? 377  LEU A HG   1 
ATOM   2813  H  HD11 . LEU A  1 185 ? 174.756 113.590 63.059  1.00 85.88  ? 377  LEU A HD11 1 
ATOM   2814  H  HD12 . LEU A  1 185 ? 175.305 114.620 64.136  1.00 85.88  ? 377  LEU A HD12 1 
ATOM   2815  H  HD13 . LEU A  1 185 ? 173.929 114.904 63.395  1.00 85.88  ? 377  LEU A HD13 1 
ATOM   2816  H  HD21 . LEU A  1 185 ? 174.811 114.135 60.676  1.00 88.74  ? 377  LEU A HD21 1 
ATOM   2817  H  HD22 . LEU A  1 185 ? 173.974 115.463 60.920  1.00 88.74  ? 377  LEU A HD22 1 
ATOM   2818  H  HD23 . LEU A  1 185 ? 175.378 115.533 60.180  1.00 88.74  ? 377  LEU A HD23 1 
ATOM   2819  N  N    . LYS A  1 186 ? 175.414 119.852 61.694  1.00 105.17 ? 378  LYS A N    1 
ATOM   2820  C  CA   . LYS A  1 186 ? 175.307 121.236 62.131  1.00 112.60 ? 378  LYS A CA   1 
ATOM   2821  C  C    . LYS A  1 186 ? 175.035 121.316 63.622  1.00 113.28 ? 378  LYS A C    1 
ATOM   2822  O  O    . LYS A  1 186 ? 174.262 120.529 64.175  1.00 110.35 ? 378  LYS A O    1 
ATOM   2823  C  CB   . LYS A  1 186 ? 174.205 121.959 61.365  1.00 118.28 ? 378  LYS A CB   1 
ATOM   2824  C  CG   . LYS A  1 186 ? 174.519 122.151 59.903  1.00 124.83 ? 378  LYS A CG   1 
ATOM   2825  C  CD   . LYS A  1 186 ? 173.409 122.897 59.189  1.00 130.83 ? 378  LYS A CD   1 
ATOM   2826  C  CE   . LYS A  1 186 ? 173.865 123.332 57.814  1.00 133.39 ? 378  LYS A CE   1 
ATOM   2827  N  NZ   . LYS A  1 186 ? 174.023 122.216 56.840  1.00 133.01 ? 378  LYS A NZ   1 
ATOM   2828  H  H    . LYS A  1 186 ? 174.775 119.589 61.182  1.00 125.95 ? 378  LYS A H    1 
ATOM   2829  H  HA   . LYS A  1 186 ? 176.145 121.691 61.953  1.00 134.88 ? 378  LYS A HA   1 
ATOM   2830  H  HB2  . LYS A  1 186 ? 173.387 121.442 61.428  1.00 141.68 ? 378  LYS A HB2  1 
ATOM   2831  H  HB3  . LYS A  1 186 ? 174.072 122.836 61.758  1.00 141.68 ? 378  LYS A HB3  1 
ATOM   2832  H  HG2  . LYS A  1 186 ? 175.337 122.666 59.816  1.00 149.55 ? 378  LYS A HG2  1 
ATOM   2833  H  HG3  . LYS A  1 186 ? 174.623 121.284 59.481  1.00 149.55 ? 378  LYS A HG3  1 
ATOM   2834  H  HD2  . LYS A  1 186 ? 172.641 122.314 59.088  1.00 156.74 ? 378  LYS A HD2  1 
ATOM   2835  H  HD3  . LYS A  1 186 ? 173.171 123.687 59.698  1.00 156.74 ? 378  LYS A HD3  1 
ATOM   2836  H  HE2  . LYS A  1 186 ? 173.211 123.950 57.451  1.00 159.82 ? 378  LYS A HE2  1 
ATOM   2837  H  HE3  . LYS A  1 186 ? 174.723 123.776 57.896  1.00 159.82 ? 378  LYS A HE3  1 
ATOM   2838  H  HZ1  . LYS A  1 186 ? 174.291 122.535 56.053  1.00 159.36 ? 378  LYS A HZ1  1 
ATOM   2839  H  HZ2  . LYS A  1 186 ? 174.628 121.636 57.139  1.00 159.36 ? 378  LYS A HZ2  1 
ATOM   2840  H  HZ3  . LYS A  1 186 ? 173.247 121.795 56.732  1.00 159.36 ? 378  LYS A HZ3  1 
ATOM   2841  N  N    . GLU A  1 187 ? 175.674 122.276 64.270  1.00 124.03 ? 379  GLU A N    1 
ATOM   2842  C  CA   . GLU A  1 187 ? 175.441 122.412 65.694  1.00 131.80 ? 379  GLU A CA   1 
ATOM   2843  C  C    . GLU A  1 187 ? 174.114 123.136 65.924  1.00 134.69 ? 379  GLU A C    1 
ATOM   2844  O  O    . GLU A  1 187 ? 173.767 124.047 65.168  1.00 136.67 ? 379  GLU A O    1 
ATOM   2845  C  CB   . GLU A  1 187 ? 176.584 123.195 66.338  1.00 136.80 ? 379  GLU A CB   1 
ATOM   2846  C  CG   . GLU A  1 187 ? 177.914 122.449 66.324  1.00 137.00 ? 379  GLU A CG   1 
ATOM   2847  C  CD   . GLU A  1 187 ? 178.028 121.401 67.430  1.00 136.40 ? 379  GLU A CD   1 
ATOM   2848  O  OE1  . GLU A  1 187 ? 176.997 120.784 67.778  1.00 136.04 ? 379  GLU A OE1  1 
ATOM   2849  O  OE2  . GLU A  1 187 ? 179.151 121.182 67.941  1.00 136.02 ? 379  GLU A OE2  1 
ATOM   2850  H  H    . GLU A  1 187 ? 176.225 122.839 63.925  1.00 148.59 ? 379  GLU A H    1 
ATOM   2851  H  HA   . GLU A  1 187 ? 175.394 121.535 66.104  1.00 157.91 ? 379  GLU A HA   1 
ATOM   2852  H  HB2  . GLU A  1 187 ? 176.704 124.028 65.855  1.00 163.91 ? 379  GLU A HB2  1 
ATOM   2853  H  HB3  . GLU A  1 187 ? 176.355 123.380 67.262  1.00 163.91 ? 379  GLU A HB3  1 
ATOM   2854  H  HG2  . GLU A  1 187 ? 178.011 121.996 65.472  1.00 164.15 ? 379  GLU A HG2  1 
ATOM   2855  H  HG3  . GLU A  1 187 ? 178.634 123.088 66.443  1.00 164.15 ? 379  GLU A HG3  1 
ATOM   2856  N  N    . PRO A  1 188 ? 173.352 122.761 66.962  1.00 139.68 ? 380  PRO A N    1 
ATOM   2857  C  CA   . PRO A  1 188 ? 172.095 123.467 67.244  1.00 141.90 ? 380  PRO A CA   1 
ATOM   2858  C  C    . PRO A  1 188 ? 172.286 124.788 67.988  1.00 145.20 ? 380  PRO A C    1 
ATOM   2859  O  O    . PRO A  1 188 ? 173.381 125.348 67.964  1.00 146.07 ? 380  PRO A O    1 
ATOM   2860  C  CB   . PRO A  1 188 ? 171.310 122.458 68.086  1.00 139.79 ? 380  PRO A CB   1 
ATOM   2861  C  CG   . PRO A  1 188 ? 172.333 121.597 68.714  1.00 136.77 ? 380  PRO A CG   1 
ATOM   2862  C  CD   . PRO A  1 188 ? 173.515 121.557 67.796  1.00 134.71 ? 380  PRO A CD   1 
ATOM   2863  H  HA   . PRO A  1 188 ? 171.614 123.633 66.418  1.00 170.03 ? 380  PRO A HA   1 
ATOM   2864  H  HB2  . PRO A  1 188 ? 170.796 122.927 68.762  1.00 167.51 ? 380  PRO A HB2  1 
ATOM   2865  H  HB3  . PRO A  1 188 ? 170.728 121.936 67.512  1.00 167.51 ? 380  PRO A HB3  1 
ATOM   2866  H  HG2  . PRO A  1 188 ? 172.586 121.975 69.571  1.00 163.88 ? 380  PRO A HG2  1 
ATOM   2867  H  HG3  . PRO A  1 188 ? 171.970 120.706 68.833  1.00 163.88 ? 380  PRO A HG3  1 
ATOM   2868  H  HD2  . PRO A  1 188 ? 174.339 121.608 68.305  1.00 161.40 ? 380  PRO A HD2  1 
ATOM   2869  H  HD3  . PRO A  1 188 ? 173.487 120.759 67.245  1.00 161.40 ? 380  PRO A HD3  1 
ATOM   2870  N  N    . GLN A  1 225 ? 176.166 124.409 56.172  1.00 132.77 ? 417  GLN A N    1 
ATOM   2871  C  CA   . GLN A  1 225 ? 176.710 124.791 54.879  1.00 134.11 ? 417  GLN A CA   1 
ATOM   2872  C  C    . GLN A  1 225 ? 177.499 123.670 54.216  1.00 130.92 ? 417  GLN A C    1 
ATOM   2873  O  O    . GLN A  1 225 ? 177.723 123.699 53.006  1.00 132.79 ? 417  GLN A O    1 
ATOM   2874  C  CB   . GLN A  1 225 ? 177.618 126.012 55.024  1.00 137.08 ? 417  GLN A CB   1 
ATOM   2875  C  CG   . GLN A  1 225 ? 176.903 127.321 55.280  1.00 140.87 ? 417  GLN A CG   1 
ATOM   2876  C  CD   . GLN A  1 225 ? 177.866 128.490 55.289  1.00 145.74 ? 417  GLN A CD   1 
ATOM   2877  O  OE1  . GLN A  1 225 ? 178.173 129.051 56.340  1.00 148.18 ? 417  GLN A OE1  1 
ATOM   2878  N  NE2  . GLN A  1 225 ? 178.385 128.834 54.116  1.00 146.29 ? 417  GLN A NE2  1 
ATOM   2879  H  HA   . GLN A  1 225 ? 175.979 125.031 54.289  1.00 160.68 ? 417  GLN A HA   1 
ATOM   2880  H  HB2  . GLN A  1 225 ? 178.223 125.859 55.767  1.00 164.25 ? 417  GLN A HB2  1 
ATOM   2881  H  HB3  . GLN A  1 225 ? 178.130 126.113 54.206  1.00 164.25 ? 417  GLN A HB3  1 
ATOM   2882  H  HG2  . GLN A  1 225 ? 176.251 127.472 54.578  1.00 168.79 ? 417  GLN A HG2  1 
ATOM   2883  H  HG3  . GLN A  1 225 ? 176.464 127.283 56.144  1.00 168.79 ? 417  GLN A HG3  1 
ATOM   2884  H  HE21 . GLN A  1 225 ? 178.153 128.413 53.403  1.00 175.30 ? 417  GLN A HE21 1 
ATOM   2885  H  HE22 . GLN A  1 225 ? 178.941 129.489 54.066  1.00 175.30 ? 417  GLN A HE22 1 
ATOM   2886  N  N    . ASP A  1 226 ? 177.917 122.684 54.996  1.00 116.26 ? 418  ASP A N    1 
ATOM   2887  C  CA   . ASP A  1 226 ? 178.772 121.639 54.450  1.00 109.50 ? 418  ASP A CA   1 
ATOM   2888  C  C    . ASP A  1 226 ? 177.962 120.747 53.517  1.00 105.92 ? 418  ASP A C    1 
ATOM   2889  O  O    . ASP A  1 226 ? 177.014 120.094 53.971  1.00 103.76 ? 418  ASP A O    1 
ATOM   2890  C  CB   . ASP A  1 226 ? 179.390 120.813 55.573  1.00 107.56 ? 418  ASP A CB   1 
ATOM   2891  C  CG   . ASP A  1 226 ? 180.545 119.950 55.093  1.00 106.63 ? 418  ASP A CG   1 
ATOM   2892  O  OD1  . ASP A  1 226 ? 180.638 119.697 53.873  1.00 104.38 ? 418  ASP A OD1  1 
ATOM   2893  O  OD2  . ASP A  1 226 ? 181.364 119.531 55.938  1.00 104.19 ? 418  ASP A OD2  1 
ATOM   2894  H  H    . ASP A  1 226 ? 177.725 122.595 55.829  1.00 139.26 ? 418  ASP A H    1 
ATOM   2895  H  HA   . ASP A  1 226 ? 179.489 122.045 53.938  1.00 131.16 ? 418  ASP A HA   1 
ATOM   2896  H  HB2  . ASP A  1 226 ? 179.726 121.411 56.258  1.00 128.82 ? 418  ASP A HB2  1 
ATOM   2897  H  HB3  . ASP A  1 226 ? 178.712 120.228 55.945  1.00 128.82 ? 418  ASP A HB3  1 
ATOM   2898  N  N    . PRO A  1 227 ? 178.291 120.682 52.223  1.00 102.32 ? 419  PRO A N    1 
ATOM   2899  C  CA   . PRO A  1 227 ? 177.527 119.802 51.326  1.00 101.11 ? 419  PRO A CA   1 
ATOM   2900  C  C    . PRO A  1 227 ? 177.804 118.330 51.562  1.00 98.10  ? 419  PRO A C    1 
ATOM   2901  O  O    . PRO A  1 227 ? 176.947 117.492 51.253  1.00 96.04  ? 419  PRO A O    1 
ATOM   2902  C  CB   . PRO A  1 227 ? 177.979 120.247 49.930  1.00 103.18 ? 419  PRO A CB   1 
ATOM   2903  C  CG   . PRO A  1 227 ? 179.353 120.785 50.139  1.00 104.32 ? 419  PRO A CG   1 
ATOM   2904  C  CD   . PRO A  1 227 ? 179.388 121.371 51.523  1.00 103.38 ? 419  PRO A CD   1 
ATOM   2905  H  HA   . PRO A  1 227 ? 176.576 119.968 51.423  1.00 121.09 ? 419  PRO A HA   1 
ATOM   2906  H  HB2  . PRO A  1 227 ? 177.995 119.485 49.330  1.00 123.57 ? 419  PRO A HB2  1 
ATOM   2907  H  HB3  . PRO A  1 227 ? 177.385 120.937 49.596  1.00 123.57 ? 419  PRO A HB3  1 
ATOM   2908  H  HG2  . PRO A  1 227 ? 179.996 120.064 50.062  1.00 124.94 ? 419  PRO A HG2  1 
ATOM   2909  H  HG3  . PRO A  1 227 ? 179.534 121.471 49.478  1.00 124.94 ? 419  PRO A HG3  1 
ATOM   2910  H  HD2  . PRO A  1 227 ? 180.237 121.175 51.950  1.00 123.80 ? 419  PRO A HD2  1 
ATOM   2911  H  HD3  . PRO A  1 227 ? 179.220 122.326 51.489  1.00 123.80 ? 419  PRO A HD3  1 
ATOM   2912  N  N    . ASN A  1 228 ? 178.976 117.991 52.093  1.00 96.66  ? 420  ASN A N    1 
ATOM   2913  C  CA   . ASN A  1 228 ? 179.311 116.610 52.410  1.00 91.49  ? 420  ASN A CA   1 
ATOM   2914  C  C    . ASN A  1 228 ? 178.695 116.141 53.719  1.00 88.86  ? 420  ASN A C    1 
ATOM   2915  O  O    . ASN A  1 228 ? 178.848 114.967 54.070  1.00 88.33  ? 420  ASN A O    1 
ATOM   2916  C  CB   . ASN A  1 228 ? 180.830 116.445 52.484  1.00 93.78  ? 420  ASN A CB   1 
ATOM   2917  C  CG   . ASN A  1 228 ? 181.523 116.887 51.215  1.00 98.45  ? 420  ASN A CG   1 
ATOM   2918  O  OD1  . ASN A  1 228 ? 181.144 116.487 50.114  1.00 99.61  ? 420  ASN A OD1  1 
ATOM   2919  N  ND2  . ASN A  1 228 ? 182.543 117.722 51.361  1.00 100.38 ? 420  ASN A ND2  1 
ATOM   2920  H  H    . ASN A  1 228 ? 179.601 118.551 52.281  1.00 115.75 ? 420  ASN A H    1 
ATOM   2921  H  HA   . ASN A  1 228 ? 178.981 116.035 51.702  1.00 109.54 ? 420  ASN A HA   1 
ATOM   2922  H  HB2  . ASN A  1 228 ? 181.171 116.982 53.215  1.00 112.29 ? 420  ASN A HB2  1 
ATOM   2923  H  HB3  . ASN A  1 228 ? 181.040 115.510 52.631  1.00 112.29 ? 420  ASN A HB3  1 
ATOM   2924  H  HD21 . ASN A  1 228 ? 182.971 118.004 50.670  1.00 120.21 ? 420  ASN A HD21 1 
ATOM   2925  H  HD22 . ASN A  1 228 ? 182.778 117.981 52.147  1.00 120.21 ? 420  ASN A HD22 1 
ATOM   2926  N  N    . ALA A  1 229 ? 178.016 117.014 54.447  1.00 84.72  ? 421  ALA A N    1 
ATOM   2927  C  CA   . ALA A  1 229 ? 177.409 116.582 55.694  1.00 80.75  ? 421  ALA A CA   1 
ATOM   2928  C  C    . ALA A  1 229 ? 176.078 115.892 55.406  1.00 78.12  ? 421  ALA A C    1 
ATOM   2929  O  O    . ALA A  1 229 ? 175.313 116.350 54.554  1.00 80.37  ? 421  ALA A O    1 
ATOM   2930  C  CB   . ALA A  1 229 ? 177.186 117.769 56.627  1.00 84.27  ? 421  ALA A CB   1 
ATOM   2931  H  H    . ALA A  1 229 ? 177.894 117.842 54.248  1.00 101.41 ? 421  ALA A H    1 
ATOM   2932  H  HA   . ALA A  1 229 ? 177.995 115.949 56.137  1.00 96.65  ? 421  ALA A HA   1 
ATOM   2933  H  HB1  . ALA A  1 229 ? 176.781 117.452 57.449  1.00 100.88 ? 421  ALA A HB1  1 
ATOM   2934  H  HB2  . ALA A  1 229 ? 178.041 118.185 56.818  1.00 100.88 ? 421  ALA A HB2  1 
ATOM   2935  H  HB3  . ALA A  1 229 ? 176.598 118.406 56.191  1.00 100.88 ? 421  ALA A HB3  1 
ATOM   2936  N  N    . PRO A  1 230 ? 175.771 114.798 56.094  1.00 75.77  ? 422  PRO A N    1 
ATOM   2937  C  CA   . PRO A  1 230 ? 174.476 114.159 55.906  1.00 77.30  ? 422  PRO A CA   1 
ATOM   2938  C  C    . PRO A  1 230 ? 173.395 114.937 56.630  1.00 80.23  ? 422  PRO A C    1 
ATOM   2939  O  O    . PRO A  1 230 ? 173.686 115.655 57.599  1.00 82.97  ? 422  PRO A O    1 
ATOM   2940  C  CB   . PRO A  1 230 ? 174.678 112.770 56.526  1.00 78.93  ? 422  PRO A CB   1 
ATOM   2941  C  CG   . PRO A  1 230 ? 175.662 113.011 57.615  1.00 77.43  ? 422  PRO A CG   1 
ATOM   2942  C  CD   . PRO A  1 230 ? 176.570 114.119 57.130  1.00 77.53  ? 422  PRO A CD   1 
ATOM   2943  H  HA   . PRO A  1 230 ? 174.258 114.077 54.964  1.00 92.51  ? 422  PRO A HA   1 
ATOM   2944  H  HB2  . PRO A  1 230 ? 173.839 112.442 56.883  1.00 94.46  ? 422  PRO A HB2  1 
ATOM   2945  H  HB3  . PRO A  1 230 ? 175.037 112.161 55.862  1.00 94.46  ? 422  PRO A HB3  1 
ATOM   2946  H  HG2  . PRO A  1 230 ? 175.194 113.283 58.420  1.00 92.67  ? 422  PRO A HG2  1 
ATOM   2947  H  HG3  . PRO A  1 230 ? 176.171 112.201 57.776  1.00 92.67  ? 422  PRO A HG3  1 
ATOM   2948  H  HD2  . PRO A  1 230 ? 176.773 114.731 57.855  1.00 92.79  ? 422  PRO A HD2  1 
ATOM   2949  H  HD3  . PRO A  1 230 ? 177.378 113.748 56.743  1.00 92.79  ? 422  PRO A HD3  1 
ATOM   2950  N  N    . PRO A  1 231 ? 172.142 114.838 56.193  1.00 84.23  ? 423  PRO A N    1 
ATOM   2951  C  CA   . PRO A  1 231 ? 171.060 115.458 56.964  1.00 86.03  ? 423  PRO A CA   1 
ATOM   2952  C  C    . PRO A  1 231 ? 171.049 114.940 58.393  1.00 83.72  ? 423  PRO A C    1 
ATOM   2953  O  O    . PRO A  1 231 ? 171.513 113.834 58.683  1.00 83.18  ? 423  PRO A O    1 
ATOM   2954  C  CB   . PRO A  1 231 ? 169.794 115.046 56.204  1.00 87.37  ? 423  PRO A CB   1 
ATOM   2955  C  CG   . PRO A  1 231 ? 170.261 114.736 54.823  1.00 89.20  ? 423  PRO A CG   1 
ATOM   2956  C  CD   . PRO A  1 231 ? 171.652 114.199 54.961  1.00 84.89  ? 423  PRO A CD   1 
ATOM   2957  H  HA   . PRO A  1 231 ? 171.145 116.424 56.963  1.00 102.99 ? 423  PRO A HA   1 
ATOM   2958  H  HB2  . PRO A  1 231 ? 169.404 114.261 56.619  1.00 104.60 ? 423  PRO A HB2  1 
ATOM   2959  H  HB3  . PRO A  1 231 ? 169.163 115.782 56.196  1.00 104.60 ? 423  PRO A HB3  1 
ATOM   2960  H  HG2  . PRO A  1 231 ? 169.678 114.070 54.426  1.00 106.79 ? 423  PRO A HG2  1 
ATOM   2961  H  HG3  . PRO A  1 231 ? 170.262 115.547 54.291  1.00 106.79 ? 423  PRO A HG3  1 
ATOM   2962  H  HD2  . PRO A  1 231 ? 171.634 113.234 55.064  1.00 101.62 ? 423  PRO A HD2  1 
ATOM   2963  H  HD3  . PRO A  1 231 ? 172.195 114.466 54.202  1.00 101.62 ? 423  PRO A HD3  1 
ATOM   2964  N  N    . GLN A  1 232 ? 170.518 115.764 59.297  1.00 83.67  ? 424  GLN A N    1 
ATOM   2965  C  CA   . GLN A  1 232 ? 170.413 115.357 60.694  1.00 83.62  ? 424  GLN A CA   1 
ATOM   2966  C  C    . GLN A  1 232 ? 169.571 114.097 60.838  1.00 80.72  ? 424  GLN A C    1 
ATOM   2967  O  O    . GLN A  1 232 ? 169.781 113.310 61.769  1.00 75.69  ? 424  GLN A O    1 
ATOM   2968  C  CB   . GLN A  1 232 ? 169.814 116.496 61.520  1.00 84.42  ? 424  GLN A CB   1 
ATOM   2969  C  CG   . GLN A  1 232 ? 169.789 116.257 63.024  1.00 84.12  ? 424  GLN A CG   1 
ATOM   2970  C  CD   . GLN A  1 232 ? 171.155 116.391 63.667  1.00 85.63  ? 424  GLN A CD   1 
ATOM   2971  O  OE1  . GLN A  1 232 ? 171.984 117.193 63.235  1.00 87.34  ? 424  GLN A OE1  1 
ATOM   2972  N  NE2  . GLN A  1 232 ? 171.393 115.609 64.715  1.00 83.14  ? 424  GLN A NE2  1 
ATOM   2973  H  H    . GLN A  1 232 ? 170.217 116.552 59.129  1.00 100.16 ? 424  GLN A H    1 
ATOM   2974  H  HA   . GLN A  1 232 ? 171.300 115.168 61.038  1.00 100.09 ? 424  GLN A HA   1 
ATOM   2975  H  HB2  . GLN A  1 232 ? 170.334 117.299 61.360  1.00 101.06 ? 424  GLN A HB2  1 
ATOM   2976  H  HB3  . GLN A  1 232 ? 168.899 116.638 61.231  1.00 101.06 ? 424  GLN A HB3  1 
ATOM   2977  H  HG2  . GLN A  1 232 ? 169.199 116.907 63.437  1.00 100.69 ? 424  GLN A HG2  1 
ATOM   2978  H  HG3  . GLN A  1 232 ? 169.464 115.359 63.195  1.00 100.69 ? 424  GLN A HG3  1 
ATOM   2979  H  HE21 . GLN A  1 232 ? 170.789 115.062 64.990  1.00 99.52  ? 424  GLN A HE21 1 
ATOM   2980  H  HE22 . GLN A  1 232 ? 172.153 115.647 65.116  1.00 99.52  ? 424  GLN A HE22 1 
ATOM   2981  N  N    . ASN A  1 233 ? 168.626 113.885 59.921  1.00 82.20  ? 425  ASN A N    1 
ATOM   2982  C  CA   . ASN A  1 233 ? 167.684 112.777 59.988  1.00 83.82  ? 425  ASN A CA   1 
ATOM   2983  C  C    . ASN A  1 233 ? 168.007 111.666 58.994  1.00 83.93  ? 425  ASN A C    1 
ATOM   2984  O  O    . ASN A  1 233 ? 167.150 110.815 58.733  1.00 81.62  ? 425  ASN A O    1 
ATOM   2985  C  CB   . ASN A  1 233 ? 166.267 113.292 59.747  1.00 86.68  ? 425  ASN A CB   1 
ATOM   2986  C  CG   . ASN A  1 233 ? 166.110 113.933 58.382  1.00 91.57  ? 425  ASN A CG   1 
ATOM   2987  O  OD1  . ASN A  1 233 ? 167.097 114.213 57.701  1.00 91.64  ? 425  ASN A OD1  1 
ATOM   2988  N  ND2  . ASN A  1 233 ? 164.869 114.176 57.979  1.00 94.32  ? 425  ASN A ND2  1 
ATOM   2989  H  H    . ASN A  1 233 ? 168.511 114.387 59.232  1.00 98.39  ? 425  ASN A H    1 
ATOM   2990  H  HA   . ASN A  1 233 ? 167.714 112.395 60.879  1.00 100.33 ? 425  ASN A HA   1 
ATOM   2991  H  HB2  . ASN A  1 233 ? 165.645 112.550 59.805  1.00 103.77 ? 425  ASN A HB2  1 
ATOM   2992  H  HB3  . ASN A  1 233 ? 166.053 113.959 60.419  1.00 103.77 ? 425  ASN A HB3  1 
ATOM   2993  H  HD21 . ASN A  1 233 ? 164.730 114.539 57.212  1.00 112.93 ? 425  ASN A HD21 1 
ATOM   2994  H  HD22 . ASN A  1 233 ? 164.205 113.967 58.483  1.00 112.93 ? 425  ASN A HD22 1 
ATOM   2995  N  N    . ARG A  1 234 ? 169.217 111.654 58.429  1.00 83.91  ? 426  ARG A N    1 
ATOM   2996  C  CA   . ARG A  1 234 ? 169.602 110.547 57.560  1.00 79.88  ? 426  ARG A CA   1 
ATOM   2997  C  C    . ARG A  1 234 ? 169.509 109.225 58.307  1.00 78.79  ? 426  ARG A C    1 
ATOM   2998  O  O    . ARG A  1 234 ? 168.966 108.242 57.792  1.00 78.20  ? 426  ARG A O    1 
ATOM   2999  C  CB   . ARG A  1 234 ? 171.015 110.758 57.020  1.00 81.63  ? 426  ARG A CB   1 
ATOM   3000  C  CG   . ARG A  1 234 ? 171.379 109.785 55.914  1.00 81.63  ? 426  ARG A CG   1 
ATOM   3001  C  CD   . ARG A  1 234 ? 172.757 110.060 55.346  1.00 80.15  ? 426  ARG A CD   1 
ATOM   3002  N  NE   . ARG A  1 234 ? 173.167 109.006 54.421  1.00 75.24  ? 426  ARG A NE   1 
ATOM   3003  C  CZ   . ARG A  1 234 ? 173.892 107.943 54.758  1.00 75.31  ? 426  ARG A CZ   1 
ATOM   3004  N  NH1  . ARG A  1 234 ? 174.305 107.771 56.009  1.00 72.31  ? 426  ARG A NH1  1 
ATOM   3005  N  NH2  . ARG A  1 234 ? 174.207 107.042 53.838  1.00 78.68  ? 426  ARG A NH2  1 
ATOM   3006  H  H    . ARG A  1 234 ? 169.819 112.260 58.532  1.00 100.45 ? 426  ARG A H    1 
ATOM   3007  H  HA   . ARG A  1 234 ? 168.993 110.510 56.805  1.00 95.61  ? 426  ARG A HA   1 
ATOM   3008  H  HB2  . ARG A  1 234 ? 171.084 111.657 56.662  1.00 97.71  ? 426  ARG A HB2  1 
ATOM   3009  H  HB3  . ARG A  1 234 ? 171.650 110.640 57.743  1.00 97.71  ? 426  ARG A HB3  1 
ATOM   3010  H  HG2  . ARG A  1 234 ? 171.373 108.883 56.269  1.00 97.71  ? 426  ARG A HG2  1 
ATOM   3011  H  HG3  . ARG A  1 234 ? 170.734 109.866 55.194  1.00 97.71  ? 426  ARG A HG3  1 
ATOM   3012  H  HD2  . ARG A  1 234 ? 172.744 110.901 54.864  1.00 95.94  ? 426  ARG A HD2  1 
ATOM   3013  H  HD3  . ARG A  1 234 ? 173.401 110.097 56.071  1.00 95.94  ? 426  ARG A HD3  1 
ATOM   3014  H  HE   . ARG A  1 234 ? 172.922 109.078 53.600  1.00 90.05  ? 426  ARG A HE   1 
ATOM   3015  H  HH11 . ARG A  1 234 ? 174.105 108.350 56.612  1.00 86.52  ? 426  ARG A HH11 1 
ATOM   3016  H  HH12 . ARG A  1 234 ? 174.774 107.080 56.216  1.00 86.52  ? 426  ARG A HH12 1 
ATOM   3017  H  HH21 . ARG A  1 234 ? 173.943 107.147 53.026  1.00 94.17  ? 426  ARG A HH21 1 
ATOM   3018  H  HH22 . ARG A  1 234 ? 174.676 106.355 54.052  1.00 94.17  ? 426  ARG A HH22 1 
ATOM   3019  N  N    . ILE A  1 235 ? 170.040 109.185 59.525  1.00 82.06  ? 427  ILE A N    1 
ATOM   3020  C  CA   . ILE A  1 235 ? 169.768 108.093 60.452  1.00 83.56  ? 427  ILE A CA   1 
ATOM   3021  C  C    . ILE A  1 235 ? 169.131 108.719 61.687  1.00 84.37  ? 427  ILE A C    1 
ATOM   3022  O  O    . ILE A  1 235 ? 169.411 109.886 61.994  1.00 87.18  ? 427  ILE A O    1 
ATOM   3023  C  CB   . ILE A  1 235 ? 171.042 107.304 60.796  1.00 77.74  ? 427  ILE A CB   1 
ATOM   3024  C  CG1  . ILE A  1 235 ? 172.048 108.165 61.565  1.00 77.10  ? 427  ILE A CG1  1 
ATOM   3025  C  CG2  . ILE A  1 235 ? 171.701 106.796 59.523  1.00 73.97  ? 427  ILE A CG2  1 
ATOM   3026  C  CD1  . ILE A  1 235 ? 173.019 107.350 62.378  1.00 75.78  ? 427  ILE A CD1  1 
ATOM   3027  H  H    . ILE A  1 235 ? 170.567 109.787 59.841  1.00 98.22  ? 427  ILE A H    1 
ATOM   3028  H  HA   . ILE A  1 235 ? 169.128 107.483 60.052  1.00 100.02 ? 427  ILE A HA   1 
ATOM   3029  H  HB   . ILE A  1 235 ? 170.798 106.543 61.346  1.00 93.04  ? 427  ILE A HB   1 
ATOM   3030  H  HG12 . ILE A  1 235 ? 172.558 108.695 60.933  1.00 92.27  ? 427  ILE A HG12 1 
ATOM   3031  H  HG13 . ILE A  1 235 ? 171.566 108.748 62.172  1.00 92.27  ? 427  ILE A HG13 1 
ATOM   3032  H  HG21 . ILE A  1 235 ? 172.501 106.301 59.759  1.00 88.52  ? 427  ILE A HG21 1 
ATOM   3033  H  HG22 . ILE A  1 235 ? 171.079 106.216 59.056  1.00 88.52  ? 427  ILE A HG22 1 
ATOM   3034  H  HG23 . ILE A  1 235 ? 171.932 107.554 58.964  1.00 88.52  ? 427  ILE A HG23 1 
ATOM   3035  H  HD11 . ILE A  1 235 ? 173.627 107.950 62.839  1.00 90.69  ? 427  ILE A HD11 1 
ATOM   3036  H  HD12 . ILE A  1 235 ? 172.524 106.820 63.022  1.00 90.69  ? 427  ILE A HD12 1 
ATOM   3037  H  HD13 . ILE A  1 235 ? 173.517 106.767 61.783  1.00 90.69  ? 427  ILE A HD13 1 
ATOM   3038  N  N    . PRO A  1 236 ? 168.274 108.008 62.419  1.00 80.57  ? 428  PRO A N    1 
ATOM   3039  C  CA   . PRO A  1 236 ? 167.685 108.600 63.628  1.00 79.88  ? 428  PRO A CA   1 
ATOM   3040  C  C    . PRO A  1 236 ? 168.733 108.786 64.715  1.00 76.92  ? 428  PRO A C    1 
ATOM   3041  O  O    . PRO A  1 236 ? 169.451 107.850 65.072  1.00 73.26  ? 428  PRO A O    1 
ATOM   3042  C  CB   . PRO A  1 236 ? 166.615 107.583 64.042  1.00 79.44  ? 428  PRO A CB   1 
ATOM   3043  C  CG   . PRO A  1 236 ? 166.410 106.715 62.840  1.00 80.93  ? 428  PRO A CG   1 
ATOM   3044  C  CD   . PRO A  1 236 ? 167.725 106.671 62.148  1.00 81.06  ? 428  PRO A CD   1 
ATOM   3045  H  HA   . PRO A  1 236 ? 167.267 109.451 63.425  1.00 95.60  ? 428  PRO A HA   1 
ATOM   3046  H  HB2  . PRO A  1 236 ? 166.935 107.059 64.792  1.00 95.07  ? 428  PRO A HB2  1 
ATOM   3047  H  HB3  . PRO A  1 236 ? 165.795 108.047 64.273  1.00 95.07  ? 428  PRO A HB3  1 
ATOM   3048  H  HG2  . PRO A  1 236 ? 166.144 105.826 63.122  1.00 96.86  ? 428  PRO A HG2  1 
ATOM   3049  H  HG3  . PRO A  1 236 ? 165.735 107.108 62.266  1.00 96.86  ? 428  PRO A HG3  1 
ATOM   3050  H  HD2  . PRO A  1 236 ? 168.291 105.986 62.535  1.00 97.02  ? 428  PRO A HD2  1 
ATOM   3051  H  HD3  . PRO A  1 236 ? 167.604 106.540 61.194  1.00 97.02  ? 428  PRO A HD3  1 
ATOM   3052  N  N    . LEU A  1 237 ? 168.821 110.010 65.232  1.00 78.78  ? 429  LEU A N    1 
ATOM   3053  C  CA   . LEU A  1 237 ? 169.728 110.324 66.321  1.00 77.02  ? 429  LEU A CA   1 
ATOM   3054  C  C    . LEU A  1 237 ? 168.951 110.865 67.517  1.00 78.04  ? 429  LEU A C    1 
ATOM   3055  O  O    . LEU A  1 237 ? 167.918 111.519 67.344  1.00 78.47  ? 429  LEU A O    1 
ATOM   3056  C  CB   . LEU A  1 237 ? 170.782 111.349 65.881  1.00 79.89  ? 429  LEU A CB   1 
ATOM   3057  C  CG   . LEU A  1 237 ? 171.777 110.821 64.844  1.00 80.94  ? 429  LEU A CG   1 
ATOM   3058  C  CD1  . LEU A  1 237 ? 172.599 111.952 64.252  1.00 83.16  ? 429  LEU A CD1  1 
ATOM   3059  C  CD2  . LEU A  1 237 ? 172.691 109.766 65.456  1.00 77.77  ? 429  LEU A CD2  1 
ATOM   3060  H  H    . LEU A  1 237 ? 168.356 110.682 64.963  1.00 94.28  ? 429  LEU A H    1 
ATOM   3061  H  HA   . LEU A  1 237 ? 170.188 109.516 66.597  1.00 92.17  ? 429  LEU A HA   1 
ATOM   3062  H  HB2  . LEU A  1 237 ? 170.329 112.114 65.492  1.00 95.62  ? 429  LEU A HB2  1 
ATOM   3063  H  HB3  . LEU A  1 237 ? 171.287 111.629 66.660  1.00 95.62  ? 429  LEU A HB3  1 
ATOM   3064  H  HG   . LEU A  1 237 ? 171.284 110.402 64.121  1.00 96.88  ? 429  LEU A HG   1 
ATOM   3065  H  HD11 . LEU A  1 237 ? 173.217 111.585 63.601  1.00 99.55  ? 429  LEU A HD11 1 
ATOM   3066  H  HD12 . LEU A  1 237 ? 172.001 112.584 63.822  1.00 99.55  ? 429  LEU A HD12 1 
ATOM   3067  H  HD13 . LEU A  1 237 ? 173.089 112.392 64.964  1.00 99.55  ? 429  LEU A HD13 1 
ATOM   3068  H  HD21 . LEU A  1 237 ? 173.309 109.452 64.777  1.00 93.07  ? 429  LEU A HD21 1 
ATOM   3069  H  HD22 . LEU A  1 237 ? 173.183 110.164 66.192  1.00 93.07  ? 429  LEU A HD22 1 
ATOM   3070  H  HD23 . LEU A  1 237 ? 172.150 109.029 65.779  1.00 93.07  ? 429  LEU A HD23 1 
ATOM   3071  N  N    . PRO A  1 238 ? 169.417 110.609 68.741  1.00 71.48  ? 430  PRO A N    1 
ATOM   3072  C  CA   . PRO A  1 238 ? 168.660 111.055 69.916  1.00 70.71  ? 430  PRO A CA   1 
ATOM   3073  C  C    . PRO A  1 238 ? 168.554 112.570 69.966  1.00 79.95  ? 430  PRO A C    1 
ATOM   3074  O  O    . PRO A  1 238 ? 169.457 113.294 69.543  1.00 83.72  ? 430  PRO A O    1 
ATOM   3075  C  CB   . PRO A  1 238 ? 169.476 110.516 71.099  1.00 68.77  ? 430  PRO A CB   1 
ATOM   3076  C  CG   . PRO A  1 238 ? 170.430 109.529 70.525  1.00 69.99  ? 430  PRO A CG   1 
ATOM   3077  C  CD   . PRO A  1 238 ? 170.673 109.940 69.117  1.00 70.15  ? 430  PRO A CD   1 
ATOM   3078  H  HA   . PRO A  1 238 ? 167.773 110.662 69.922  1.00 84.60  ? 430  PRO A HA   1 
ATOM   3079  H  HB2  . PRO A  1 238 ? 169.954 111.246 71.522  1.00 82.27  ? 430  PRO A HB2  1 
ATOM   3080  H  HB3  . PRO A  1 238 ? 168.881 110.085 71.733  1.00 82.27  ? 430  PRO A HB3  1 
ATOM   3081  H  HG2  . PRO A  1 238 ? 171.257 109.548 71.031  1.00 83.74  ? 430  PRO A HG2  1 
ATOM   3082  H  HG3  . PRO A  1 238 ? 170.035 108.644 70.555  1.00 83.74  ? 430  PRO A HG3  1 
ATOM   3083  H  HD2  . PRO A  1 238 ? 171.416 110.562 69.069  1.00 83.93  ? 430  PRO A HD2  1 
ATOM   3084  H  HD3  . PRO A  1 238 ? 170.824 109.162 68.558  1.00 83.93  ? 430  PRO A HD3  1 
ATOM   3085  N  N    . GLU A  1 239 ? 167.433 113.048 70.495  1.00 88.71  ? 431  GLU A N    1 
ATOM   3086  C  CA   . GLU A  1 239 ? 167.279 114.477 70.702  1.00 92.99  ? 431  GLU A CA   1 
ATOM   3087  C  C    . GLU A  1 239 ? 168.086 114.917 71.920  1.00 90.99  ? 431  GLU A C    1 
ATOM   3088  O  O    . GLU A  1 239 ? 168.442 114.116 72.789  1.00 88.41  ? 431  GLU A O    1 
ATOM   3089  C  CB   . GLU A  1 239 ? 165.800 114.856 70.853  1.00 95.28  ? 431  GLU A CB   1 
ATOM   3090  C  CG   . GLU A  1 239 ? 165.149 114.531 72.200  1.00 101.06 ? 431  GLU A CG   1 
ATOM   3091  C  CD   . GLU A  1 239 ? 164.937 113.044 72.419  1.00 101.59 ? 431  GLU A CD   1 
ATOM   3092  O  OE1  . GLU A  1 239 ? 165.252 112.251 71.505  1.00 100.14 ? 431  GLU A OE1  1 
ATOM   3093  O  OE2  . GLU A  1 239 ? 164.438 112.671 73.503  1.00 100.12 ? 431  GLU A OE2  1 
ATOM   3094  H  H    . GLU A  1 239 ? 166.758 112.573 70.739  1.00 106.20 ? 431  GLU A H    1 
ATOM   3095  H  HA   . GLU A  1 239 ? 167.629 114.945 69.928  1.00 111.34 ? 431  GLU A HA   1 
ATOM   3096  H  HB2  . GLU A  1 239 ? 165.717 115.812 70.717  1.00 114.09 ? 431  GLU A HB2  1 
ATOM   3097  H  HB3  . GLU A  1 239 ? 165.295 114.388 70.170  1.00 114.09 ? 431  GLU A HB3  1 
ATOM   3098  H  HG2  . GLU A  1 239 ? 165.720 114.859 72.913  1.00 121.02 ? 431  GLU A HG2  1 
ATOM   3099  H  HG3  . GLU A  1 239 ? 164.283 114.966 72.244  1.00 121.02 ? 431  GLU A HG3  1 
ATOM   3100  N  N    . LEU A  1 240 ? 168.387 116.210 71.965  1.00 94.62  ? 432  LEU A N    1 
ATOM   3101  C  CA   . LEU A  1 240 ? 169.244 116.756 73.007  1.00 94.49  ? 432  LEU A CA   1 
ATOM   3102  C  C    . LEU A  1 240 ? 168.466 116.938 74.303  1.00 94.49  ? 432  LEU A C    1 
ATOM   3103  O  O    . LEU A  1 240 ? 167.425 117.602 74.327  1.00 94.85  ? 432  LEU A O    1 
ATOM   3104  C  CB   . LEU A  1 240 ? 169.836 118.092 72.560  1.00 99.60  ? 432  LEU A CB   1 
ATOM   3105  C  CG   . LEU A  1 240 ? 171.097 118.006 71.700  1.00 100.63 ? 432  LEU A CG   1 
ATOM   3106  C  CD1  . LEU A  1 240 ? 171.329 119.322 70.982  1.00 102.81 ? 432  LEU A CD1  1 
ATOM   3107  C  CD2  . LEU A  1 240 ? 172.308 117.638 72.545  1.00 99.02  ? 432  LEU A CD2  1 
ATOM   3108  H  H    . LEU A  1 240 ? 168.105 116.795 71.401  1.00 113.29 ? 432  LEU A H    1 
ATOM   3109  H  HA   . LEU A  1 240 ? 169.975 116.140 73.175  1.00 113.14 ? 432  LEU A HA   1 
ATOM   3110  H  HB2  . LEU A  1 240 ? 169.165 118.566 72.044  1.00 119.27 ? 432  LEU A HB2  1 
ATOM   3111  H  HB3  . LEU A  1 240 ? 170.059 118.607 73.351  1.00 119.27 ? 432  LEU A HB3  1 
ATOM   3112  H  HG   . LEU A  1 240 ? 170.977 117.315 71.030  1.00 120.51 ? 432  LEU A HG   1 
ATOM   3113  H  HD11 . LEU A  1 240 ? 172.132 119.249 70.442  1.00 123.13 ? 432  LEU A HD11 1 
ATOM   3114  H  HD12 . LEU A  1 240 ? 170.565 119.511 70.415  1.00 123.13 ? 432  LEU A HD12 1 
ATOM   3115  H  HD13 . LEU A  1 240 ? 171.436 120.026 71.641  1.00 123.13 ? 432  LEU A HD13 1 
ATOM   3116  H  HD21 . LEU A  1 240 ? 173.089 117.592 71.972  1.00 118.58 ? 432  LEU A HD21 1 
ATOM   3117  H  HD22 . LEU A  1 240 ? 172.436 118.317 73.225  1.00 118.58 ? 432  LEU A HD22 1 
ATOM   3118  H  HD23 . LEU A  1 240 ? 172.151 116.776 72.962  1.00 118.58 ? 432  LEU A HD23 1 
ATOM   3119  N  N    . LYS A  1 241 ? 168.973 116.346 75.378  1.00 94.31  ? 433  LYS A N    1 
ATOM   3120  C  CA   . LYS A  1 241 ? 168.403 116.559 76.696  1.00 96.74  ? 433  LYS A CA   1 
ATOM   3121  C  C    . LYS A  1 241 ? 168.889 117.887 77.267  1.00 100.06 ? 433  LYS A C    1 
ATOM   3122  O  O    . LYS A  1 241 ? 169.903 118.446 76.840  1.00 100.01 ? 433  LYS A O    1 
ATOM   3123  C  CB   . LYS A  1 241 ? 168.781 115.413 77.634  1.00 94.85  ? 433  LYS A CB   1 
ATOM   3124  C  CG   . LYS A  1 241 ? 168.333 114.041 77.150  1.00 95.02  ? 433  LYS A CG   1 
ATOM   3125  C  CD   . LYS A  1 241 ? 169.018 112.917 77.915  1.00 96.55  ? 433  LYS A CD   1 
ATOM   3126  C  CE   . LYS A  1 241 ? 170.504 112.856 77.592  1.00 99.41  ? 433  LYS A CE   1 
ATOM   3127  N  NZ   . LYS A  1 241 ? 171.044 111.472 77.642  1.00 97.09  ? 433  LYS A NZ   1 
ATOM   3128  H  H    . LYS A  1 241 ? 169.650 115.816 75.368  1.00 112.92 ? 433  LYS A H    1 
ATOM   3129  H  HA   . LYS A  1 241 ? 167.436 116.591 76.627  1.00 115.84 ? 433  LYS A HA   1 
ATOM   3130  H  HB2  . LYS A  1 241 ? 169.747 115.392 77.728  1.00 113.58 ? 433  LYS A HB2  1 
ATOM   3131  H  HB3  . LYS A  1 241 ? 168.371 115.569 78.499  1.00 113.58 ? 433  LYS A HB3  1 
ATOM   3132  H  HG2  . LYS A  1 241 ? 167.375 113.955 77.278  1.00 113.78 ? 433  LYS A HG2  1 
ATOM   3133  H  HG3  . LYS A  1 241 ? 168.555 113.947 76.210  1.00 113.78 ? 433  LYS A HG3  1 
ATOM   3134  H  HD2  . LYS A  1 241 ? 168.919 113.070 78.867  1.00 115.61 ? 433  LYS A HD2  1 
ATOM   3135  H  HD3  . LYS A  1 241 ? 168.617 112.069 77.666  1.00 115.61 ? 433  LYS A HD3  1 
ATOM   3136  H  HE2  . LYS A  1 241 ? 170.648 113.203 76.698  1.00 119.05 ? 433  LYS A HE2  1 
ATOM   3137  H  HE3  . LYS A  1 241 ? 170.990 113.392 78.238  1.00 119.05 ? 433  LYS A HE3  1 
ATOM   3138  H  HZ1  . LYS A  1 241 ? 171.913 111.477 77.448  1.00 116.25 ? 433  LYS A HZ1  1 
ATOM   3139  H  HZ2  . LYS A  1 241 ? 170.931 111.131 78.456  1.00 116.25 ? 433  LYS A HZ2  1 
ATOM   3140  H  HZ3  . LYS A  1 241 ? 170.619 110.958 77.052  1.00 116.25 ? 433  LYS A HZ3  1 
ATOM   3141  N  N    . ASP A  1 242 ? 168.147 118.395 78.252  1.00 110.17 ? 434  ASP A N    1 
ATOM   3142  C  CA   . ASP A  1 242 ? 168.538 119.650 78.881  1.00 114.07 ? 434  ASP A CA   1 
ATOM   3143  C  C    . ASP A  1 242 ? 169.870 119.510 79.606  1.00 112.86 ? 434  ASP A C    1 
ATOM   3144  O  O    . ASP A  1 242 ? 170.621 120.486 79.717  1.00 114.57 ? 434  ASP A O    1 
ATOM   3145  C  CB   . ASP A  1 242 ? 167.445 120.122 79.839  1.00 119.59 ? 434  ASP A CB   1 
ATOM   3146  C  CG   . ASP A  1 242 ? 166.258 120.728 79.112  1.00 126.62 ? 434  ASP A CG   1 
ATOM   3147  O  OD1  . ASP A  1 242 ? 166.185 120.591 77.872  1.00 128.14 ? 434  ASP A OD1  1 
ATOM   3148  O  OD2  . ASP A  1 242 ? 165.401 121.345 79.779  1.00 129.78 ? 434  ASP A OD2  1 
ATOM   3149  H  H    . ASP A  1 242 ? 167.429 118.040 78.566  1.00 131.95 ? 434  ASP A H    1 
ATOM   3150  H  HA   . ASP A  1 242 ? 168.644 120.326 78.193  1.00 136.63 ? 434  ASP A HA   1 
ATOM   3151  H  HB2  . ASP A  1 242 ? 167.127 119.365 80.355  1.00 143.25 ? 434  ASP A HB2  1 
ATOM   3152  H  HB3  . ASP A  1 242 ? 167.812 120.798 80.430  1.00 143.25 ? 434  ASP A HB3  1 
ATOM   3153  N  N    . SER A  1 243 ? 170.182 118.311 80.105  1.00 107.82 ? 435  SER A N    1 
ATOM   3154  C  CA   . SER A  1 243 ? 171.486 118.084 80.717  1.00 107.80 ? 435  SER A CA   1 
ATOM   3155  C  C    . SER A  1 243 ? 172.604 118.127 79.683  1.00 107.87 ? 435  SER A C    1 
ATOM   3156  O  O    . SER A  1 243 ? 173.709 118.590 79.988  1.00 108.16 ? 435  SER A O    1 
ATOM   3157  C  CB   . SER A  1 243 ? 171.499 116.741 81.446  1.00 107.32 ? 435  SER A CB   1 
ATOM   3158  O  OG   . SER A  1 243 ? 171.235 115.675 80.551  1.00 106.59 ? 435  SER A OG   1 
ATOM   3159  H  H    . SER A  1 243 ? 169.663 117.625 80.100  1.00 129.14 ? 435  SER A H    1 
ATOM   3160  H  HA   . SER A  1 243 ? 171.654 118.782 81.370  1.00 129.12 ? 435  SER A HA   1 
ATOM   3161  H  HB2  . SER A  1 243 ? 172.372 116.608 81.846  1.00 128.53 ? 435  SER A HB2  1 
ATOM   3162  H  HB3  . SER A  1 243 ? 170.816 116.750 82.135  1.00 128.53 ? 435  SER A HB3  1 
ATOM   3163  H  HG   . SER A  1 243 ? 171.244 114.943 80.964  1.00 127.66 ? 435  SER A HG   1 
ATOM   3164  N  N    . ASP A  1 244 ? 172.342 117.650 78.463  1.00 114.04 ? 436  ASP A N    1 
ATOM   3165  C  CA   . ASP A  1 244 ? 173.347 117.732 77.409  1.00 115.37 ? 436  ASP A CA   1 
ATOM   3166  C  C    . ASP A  1 244 ? 173.649 119.176 77.035  1.00 116.65 ? 436  ASP A C    1 
ATOM   3167  O  O    . ASP A  1 244 ? 174.789 119.498 76.682  1.00 115.45 ? 436  ASP A O    1 
ATOM   3168  C  CB   . ASP A  1 244 ? 172.888 116.955 76.174  1.00 117.30 ? 436  ASP A CB   1 
ATOM   3169  C  CG   . ASP A  1 244 ? 172.669 115.484 76.458  1.00 118.54 ? 436  ASP A CG   1 
ATOM   3170  O  OD1  . ASP A  1 244 ? 173.150 114.998 77.503  1.00 118.34 ? 436  ASP A OD1  1 
ATOM   3171  O  OD2  . ASP A  1 244 ? 172.021 114.812 75.627  1.00 118.67 ? 436  ASP A OD2  1 
ATOM   3172  H  H    . ASP A  1 244 ? 171.602 117.282 78.227  1.00 136.60 ? 436  ASP A H    1 
ATOM   3173  H  HA   . ASP A  1 244 ? 174.169 117.328 77.727  1.00 138.19 ? 436  ASP A HA   1 
ATOM   3174  H  HB2  . ASP A  1 244 ? 172.049 117.329 75.860  1.00 140.52 ? 436  ASP A HB2  1 
ATOM   3175  H  HB3  . ASP A  1 244 ? 173.565 117.031 75.483  1.00 140.52 ? 436  ASP A HB3  1 
ATOM   3176  N  N    . LYS A  1 245 ? 172.647 120.056 77.100  1.00 117.31 ? 437  LYS A N    1 
ATOM   3177  C  CA   . LYS A  1 245 ? 172.854 121.447 76.715  1.00 119.72 ? 437  LYS A CA   1 
ATOM   3178  C  C    . LYS A  1 245 ? 173.765 122.165 77.701  1.00 116.21 ? 437  LYS A C    1 
ATOM   3179  O  O    . LYS A  1 245 ? 174.527 123.055 77.307  1.00 116.17 ? 437  LYS A O    1 
ATOM   3180  C  CB   . LYS A  1 245 ? 171.507 122.164 76.609  1.00 123.84 ? 437  LYS A CB   1 
ATOM   3181  C  CG   . LYS A  1 245 ? 170.603 121.599 75.520  1.00 123.83 ? 437  LYS A CG   1 
ATOM   3182  C  CD   . LYS A  1 245 ? 169.167 122.089 75.648  1.00 127.55 ? 437  LYS A CD   1 
ATOM   3183  C  CE   . LYS A  1 245 ? 168.210 121.168 74.903  1.00 127.63 ? 437  LYS A CE   1 
ATOM   3184  N  NZ   . LYS A  1 245 ? 166.784 121.575 75.049  1.00 130.16 ? 437  LYS A NZ   1 
ATOM   3185  H  H    . LYS A  1 245 ? 171.848 119.873 77.360  1.00 140.52 ? 437  LYS A H    1 
ATOM   3186  H  HA   . LYS A  1 245 ? 173.277 121.474 75.842  1.00 143.41 ? 437  LYS A HA   1 
ATOM   3187  H  HB2  . LYS A  1 245 ? 171.041 122.081 77.455  1.00 148.36 ? 437  LYS A HB2  1 
ATOM   3188  H  HB3  . LYS A  1 245 ? 171.665 123.100 76.409  1.00 148.36 ? 437  LYS A HB3  1 
ATOM   3189  H  HG2  . LYS A  1 245 ? 170.939 121.875 74.653  1.00 148.34 ? 437  LYS A HG2  1 
ATOM   3190  H  HG3  . LYS A  1 245 ? 170.598 120.631 75.582  1.00 148.34 ? 437  LYS A HG3  1 
ATOM   3191  H  HD2  . LYS A  1 245 ? 168.913 122.101 76.584  1.00 152.81 ? 437  LYS A HD2  1 
ATOM   3192  H  HD3  . LYS A  1 245 ? 169.095 122.978 75.267  1.00 152.81 ? 437  LYS A HD3  1 
ATOM   3193  H  HE2  . LYS A  1 245 ? 168.430 121.181 73.958  1.00 152.90 ? 437  LYS A HE2  1 
ATOM   3194  H  HE3  . LYS A  1 245 ? 168.302 120.268 75.252  1.00 152.90 ? 437  LYS A HE3  1 
ATOM   3195  H  HZ1  . LYS A  1 245 ? 166.260 121.012 74.600  1.00 155.94 ? 437  LYS A HZ1  1 
ATOM   3196  H  HZ2  . LYS A  1 245 ? 166.552 121.564 75.908  1.00 155.94 ? 437  LYS A HZ2  1 
ATOM   3197  H  HZ3  . LYS A  1 245 ? 166.668 122.397 74.728  1.00 155.94 ? 437  LYS A HZ3  1 
ATOM   3198  N  N    . LEU A  1 246 ? 173.705 121.792 78.980  1.00 113.20 ? 438  LEU A N    1 
ATOM   3199  C  CA   . LEU A  1 246 ? 174.597 122.388 79.967  1.00 115.38 ? 438  LEU A CA   1 
ATOM   3200  C  C    . LEU A  1 246 ? 176.043 121.979 79.714  1.00 111.37 ? 438  LEU A C    1 
ATOM   3201  O  O    . LEU A  1 246 ? 176.955 122.806 79.817  1.00 110.87 ? 438  LEU A O    1 
ATOM   3202  C  CB   . LEU A  1 246 ? 174.163 121.980 81.376  1.00 119.18 ? 438  LEU A CB   1 
ATOM   3203  C  CG   . LEU A  1 246 ? 175.108 122.353 82.523  1.00 124.19 ? 438  LEU A CG   1 
ATOM   3204  C  CD1  . LEU A  1 246 ? 175.415 123.845 82.533  1.00 127.34 ? 438  LEU A CD1  1 
ATOM   3205  C  CD2  . LEU A  1 246 ? 174.515 121.919 83.851  1.00 123.35 ? 438  LEU A CD2  1 
ATOM   3206  H  H    . LEU A  1 246 ? 173.163 121.204 79.296  1.00 135.60 ? 438  LEU A H    1 
ATOM   3207  H  HA   . LEU A  1 246 ? 174.541 123.354 79.903  1.00 138.21 ? 438  LEU A HA   1 
ATOM   3208  H  HB2  . LEU A  1 246 ? 173.308 122.398 81.562  1.00 142.77 ? 438  LEU A HB2  1 
ATOM   3209  H  HB3  . LEU A  1 246 ? 174.058 121.015 81.392  1.00 142.77 ? 438  LEU A HB3  1 
ATOM   3210  H  HG   . LEU A  1 246 ? 175.946 121.879 82.404  1.00 148.78 ? 438  LEU A HG   1 
ATOM   3211  H  HD11 . LEU A  1 246 ? 176.014 124.038 83.271  1.00 152.56 ? 438  LEU A HD11 1 
ATOM   3212  H  HD12 . LEU A  1 246 ? 175.836 124.085 81.692  1.00 152.56 ? 438  LEU A HD12 1 
ATOM   3213  H  HD13 . LEU A  1 246 ? 174.586 124.336 82.641  1.00 152.56 ? 438  LEU A HD13 1 
ATOM   3214  H  HD21 . LEU A  1 246 ? 175.126 122.163 84.564  1.00 147.77 ? 438  LEU A HD21 1 
ATOM   3215  H  HD22 . LEU A  1 246 ? 173.663 122.366 83.978  1.00 147.77 ? 438  LEU A HD22 1 
ATOM   3216  H  HD23 . LEU A  1 246 ? 174.386 120.957 83.840  1.00 147.77 ? 438  LEU A HD23 1 
ATOM   3217  N  N    . ASP A  1 247 ? 176.276 120.703 79.411  1.00 111.64 ? 439  ASP A N    1 
ATOM   3218  C  CA   . ASP A  1 247 ? 177.635 120.258 79.136  1.00 113.88 ? 439  ASP A CA   1 
ATOM   3219  C  C    . ASP A  1 247 ? 178.184 120.871 77.852  1.00 111.22 ? 439  ASP A C    1 
ATOM   3220  O  O    . ASP A  1 247 ? 179.392 121.110 77.749  1.00 109.90 ? 439  ASP A O    1 
ATOM   3221  C  CB   . ASP A  1 247 ? 177.676 118.726 79.079  1.00 117.42 ? 439  ASP A CB   1 
ATOM   3222  C  CG   . ASP A  1 247 ? 179.091 118.180 79.035  1.00 122.63 ? 439  ASP A CG   1 
ATOM   3223  O  OD1  . ASP A  1 247 ? 179.944 118.680 79.799  1.00 124.83 ? 439  ASP A OD1  1 
ATOM   3224  O  OD2  . ASP A  1 247 ? 179.347 117.246 78.247  1.00 121.93 ? 439  ASP A OD2  1 
ATOM   3225  H  H    . ASP A  1 247 ? 175.677 120.088 79.360  1.00 133.72 ? 439  ASP A H    1 
ATOM   3226  H  HA   . ASP A  1 247 ? 178.208 120.542 79.865  1.00 136.41 ? 439  ASP A HA   1 
ATOM   3227  H  HB2  . ASP A  1 247 ? 177.240 118.368 79.869  1.00 140.65 ? 439  ASP A HB2  1 
ATOM   3228  H  HB3  . ASP A  1 247 ? 177.214 118.426 78.280  1.00 140.65 ? 439  ASP A HB3  1 
ATOM   3229  N  N    . LYS A  1 248 ? 177.315 121.142 76.871  1.00 105.59 ? 440  LYS A N    1 
ATOM   3230  C  CA   . LYS A  1 248 ? 177.764 121.744 75.619  1.00 104.76 ? 440  LYS A CA   1 
ATOM   3231  C  C    . LYS A  1 248 ? 178.248 123.175 75.805  1.00 102.92 ? 440  LYS A C    1 
ATOM   3232  O  O    . LYS A  1 248 ? 179.238 123.582 75.185  1.00 101.63 ? 440  LYS A O    1 
ATOM   3233  C  CB   . LYS A  1 248 ? 176.634 121.707 74.581  1.00 111.31 ? 440  LYS A CB   1 
ATOM   3234  C  CG   . LYS A  1 248 ? 176.346 120.316 74.067  1.00 117.83 ? 440  LYS A CG   1 
ATOM   3235  C  CD   . LYS A  1 248 ? 177.418 119.898 73.068  1.00 122.70 ? 440  LYS A CD   1 
ATOM   3236  C  CE   . LYS A  1 248 ? 177.121 118.539 72.445  1.00 126.40 ? 440  LYS A CE   1 
ATOM   3237  N  NZ   . LYS A  1 248 ? 175.953 118.546 71.514  1.00 129.53 ? 440  LYS A NZ   1 
ATOM   3238  H  H    . LYS A  1 248 ? 176.470 120.988 76.909  1.00 126.46 ? 440  LYS A H    1 
ATOM   3239  H  HA   . LYS A  1 248 ? 178.505 121.223 75.270  1.00 125.46 ? 440  LYS A HA   1 
ATOM   3240  H  HB2  . LYS A  1 248 ? 175.823 122.049 74.987  1.00 133.32 ? 440  LYS A HB2  1 
ATOM   3241  H  HB3  . LYS A  1 248 ? 176.884 122.259 73.824  1.00 133.32 ? 440  LYS A HB3  1 
ATOM   3242  H  HG2  . LYS A  1 248 ? 176.351 119.688 74.807  1.00 141.14 ? 440  LYS A HG2  1 
ATOM   3243  H  HG3  . LYS A  1 248 ? 175.486 120.307 73.619  1.00 141.14 ? 440  LYS A HG3  1 
ATOM   3244  H  HD2  . LYS A  1 248 ? 177.462 120.554 72.355  1.00 147.00 ? 440  LYS A HD2  1 
ATOM   3245  H  HD3  . LYS A  1 248 ? 178.273 119.842 73.523  1.00 147.00 ? 440  LYS A HD3  1 
ATOM   3246  H  HE2  . LYS A  1 248 ? 177.899 118.248 71.943  1.00 151.44 ? 440  LYS A HE2  1 
ATOM   3247  H  HE3  . LYS A  1 248 ? 176.932 117.904 73.154  1.00 151.44 ? 440  LYS A HE3  1 
ATOM   3248  H  HZ1  . LYS A  1 248 ? 175.825 117.731 71.180  1.00 155.19 ? 440  LYS A HZ1  1 
ATOM   3249  H  HZ2  . LYS A  1 248 ? 175.219 118.799 71.949  1.00 155.19 ? 440  LYS A HZ2  1 
ATOM   3250  H  HZ3  . LYS A  1 248 ? 176.102 119.113 70.844  1.00 155.19 ? 440  LYS A HZ3  1 
ATOM   3251  N  N    . ILE A  1 249 ? 177.586 123.955 76.657  1.00 112.12 ? 441  ILE A N    1 
ATOM   3252  C  CA   . ILE A  1 249 ? 178.092 125.300 76.904  1.00 117.85 ? 441  ILE A CA   1 
ATOM   3253  C  C    . ILE A  1 249 ? 179.358 125.217 77.748  1.00 118.59 ? 441  ILE A C    1 
ATOM   3254  O  O    . ILE A  1 249 ? 180.301 125.984 77.537  1.00 119.79 ? 441  ILE A O    1 
ATOM   3255  C  CB   . ILE A  1 249 ? 177.014 126.220 77.526  1.00 120.10 ? 441  ILE A CB   1 
ATOM   3256  C  CG1  . ILE A  1 249 ? 176.734 125.869 78.985  1.00 120.24 ? 441  ILE A CG1  1 
ATOM   3257  C  CG2  . ILE A  1 249 ? 175.733 126.171 76.699  1.00 118.49 ? 441  ILE A CG2  1 
ATOM   3258  C  CD1  . ILE A  1 249 ? 177.396 126.807 79.970  1.00 121.67 ? 441  ILE A CD1  1 
ATOM   3259  H  H    . ILE A  1 249 ? 176.873 123.741 77.087  1.00 134.29 ? 441  ILE A H    1 
ATOM   3260  H  HA   . ILE A  1 249 ? 178.341 125.690 76.052  1.00 141.17 ? 441  ILE A HA   1 
ATOM   3261  H  HB   . ILE A  1 249 ? 177.350 127.130 77.499  1.00 143.87 ? 441  ILE A HB   1 
ATOM   3262  H  HG12 . ILE A  1 249 ? 175.777 125.905 79.138  1.00 144.05 ? 441  ILE A HG12 1 
ATOM   3263  H  HG13 . ILE A  1 249 ? 177.063 124.973 79.160  1.00 144.05 ? 441  ILE A HG13 1 
ATOM   3264  H  HG21 . ILE A  1 249 ? 175.072 126.753 77.105  1.00 141.94 ? 441  ILE A HG21 1 
ATOM   3265  H  HG22 . ILE A  1 249 ? 175.928 126.470 75.797  1.00 141.94 ? 441  ILE A HG22 1 
ATOM   3266  H  HG23 . ILE A  1 249 ? 175.404 125.258 76.681  1.00 141.94 ? 441  ILE A HG23 1 
ATOM   3267  H  HD11 . ILE A  1 249 ? 177.175 126.525 80.871  1.00 145.76 ? 441  ILE A HD11 1 
ATOM   3268  H  HD12 . ILE A  1 249 ? 178.356 126.776 79.839  1.00 145.76 ? 441  ILE A HD12 1 
ATOM   3269  H  HD13 . ILE A  1 249 ? 177.069 127.707 79.816  1.00 145.76 ? 441  ILE A HD13 1 
ATOM   3270  N  N    . MET A  1 250 ? 179.441 124.251 78.667  1.00 115.09 ? 442  MET A N    1 
ATOM   3271  C  CA   . MET A  1 250 ? 180.687 124.079 79.406  1.00 117.49 ? 442  MET A CA   1 
ATOM   3272  C  C    . MET A  1 250 ? 181.830 123.750 78.458  1.00 116.12 ? 442  MET A C    1 
ATOM   3273  O  O    . MET A  1 250 ? 182.940 124.273 78.605  1.00 118.74 ? 442  MET A O    1 
ATOM   3274  C  CB   . MET A  1 250 ? 180.545 122.985 80.461  1.00 120.45 ? 442  MET A CB   1 
ATOM   3275  C  CG   . MET A  1 250 ? 179.544 123.285 81.558  1.00 126.68 ? 442  MET A CG   1 
ATOM   3276  S  SD   . MET A  1 250 ? 180.263 124.363 82.814  1.00 136.27 ? 442  MET A SD   1 
ATOM   3277  C  CE   . MET A  1 250 ? 181.431 123.252 83.599  1.00 130.92 ? 442  MET A CE   1 
ATOM   3278  H  H    . MET A  1 250 ? 178.813 123.701 78.874  1.00 137.86 ? 442  MET A H    1 
ATOM   3279  H  HA   . MET A  1 250 ? 180.893 124.908 79.866  1.00 140.74 ? 442  MET A HA   1 
ATOM   3280  H  HB2  . MET A  1 250 ? 180.263 122.167 80.023  1.00 144.29 ? 442  MET A HB2  1 
ATOM   3281  H  HB3  . MET A  1 250 ? 181.408 122.848 80.882  1.00 144.29 ? 442  MET A HB3  1 
ATOM   3282  H  HG2  . MET A  1 250 ? 178.773 123.733 81.176  1.00 151.76 ? 442  MET A HG2  1 
ATOM   3283  H  HG3  . MET A  1 250 ? 179.276 122.456 81.984  1.00 151.76 ? 442  MET A HG3  1 
ATOM   3284  H  HE1  . MET A  1 250 ? 181.891 123.728 84.309  1.00 156.86 ? 442  MET A HE1  1 
ATOM   3285  H  HE2  . MET A  1 250 ? 180.949 122.495 83.966  1.00 156.86 ? 442  MET A HE2  1 
ATOM   3286  H  HE3  . MET A  1 250 ? 182.071 122.947 82.936  1.00 156.86 ? 442  MET A HE3  1 
ATOM   3287  N  N    . ASN A  1 251 ? 181.578 122.878 77.480  1.00 118.63 ? 443  ASN A N    1 
ATOM   3288  C  CA   . ASN A  1 251 ? 182.600 122.571 76.487  1.00 119.04 ? 443  ASN A CA   1 
ATOM   3289  C  C    . ASN A  1 251 ? 182.964 123.819 75.692  1.00 122.28 ? 443  ASN A C    1 
ATOM   3290  O  O    . ASN A  1 251 ? 184.145 124.076 75.425  1.00 124.24 ? 443  ASN A O    1 
ATOM   3291  C  CB   . ASN A  1 251 ? 182.100 121.467 75.554  1.00 117.48 ? 443  ASN A CB   1 
ATOM   3292  C  CG   . ASN A  1 251 ? 183.205 120.879 74.695  1.00 118.96 ? 443  ASN A CG   1 
ATOM   3293  O  OD1  . ASN A  1 251 ? 184.262 121.485 74.517  1.00 120.21 ? 443  ASN A OD1  1 
ATOM   3294  N  ND2  . ASN A  1 251 ? 182.957 119.696 74.145  1.00 116.64 ? 443  ASN A ND2  1 
ATOM   3295  H  H    . ASN A  1 251 ? 180.835 122.459 77.373  1.00 142.11 ? 443  ASN A H    1 
ATOM   3296  H  HA   . ASN A  1 251 ? 183.398 122.252 76.937  1.00 142.60 ? 443  ASN A HA   1 
ATOM   3297  H  HB2  . ASN A  1 251 ? 181.721 120.751 76.086  1.00 140.72 ? 443  ASN A HB2  1 
ATOM   3298  H  HB3  . ASN A  1 251 ? 181.425 121.835 74.962  1.00 140.72 ? 443  ASN A HB3  1 
ATOM   3299  H  HD21 . ASN A  1 251 ? 183.549 119.319 73.648  1.00 139.72 ? 443  ASN A HD21 1 
ATOM   3300  H  HD22 . ASN A  1 251 ? 182.205 119.303 74.290  1.00 139.72 ? 443  ASN A HD22 1 
ATOM   3301  N  N    . MET A  1 252 ? 181.956 124.609 75.309  1.00 120.69 ? 444  MET A N    1 
ATOM   3302  C  CA   . MET A  1 252 ? 182.200 125.835 74.553  1.00 121.27 ? 444  MET A CA   1 
ATOM   3303  C  C    . MET A  1 252 ? 183.082 126.798 75.336  1.00 121.36 ? 444  MET A C    1 
ATOM   3304  O  O    . MET A  1 252 ? 183.969 127.446 74.769  1.00 122.56 ? 444  MET A O    1 
ATOM   3305  C  CB   . MET A  1 252 ? 180.867 126.493 74.204  1.00 126.47 ? 444  MET A CB   1 
ATOM   3306  C  CG   . MET A  1 252 ? 180.773 127.005 72.783  1.00 133.40 ? 444  MET A CG   1 
ATOM   3307  S  SD   . MET A  1 252 ? 179.118 127.626 72.433  1.00 142.15 ? 444  MET A SD   1 
ATOM   3308  C  CE   . MET A  1 252 ? 179.231 127.938 70.675  1.00 140.10 ? 444  MET A CE   1 
ATOM   3309  H  H    . MET A  1 252 ? 181.127 124.456 75.476  1.00 144.58 ? 444  MET A H    1 
ATOM   3310  H  HA   . MET A  1 252 ? 182.645 125.607 73.722  1.00 145.27 ? 444  MET A HA   1 
ATOM   3311  H  HB2  . MET A  1 252 ? 180.158 125.843 74.330  1.00 151.52 ? 444  MET A HB2  1 
ATOM   3312  H  HB3  . MET A  1 252 ? 180.728 127.247 74.798  1.00 151.52 ? 444  MET A HB3  1 
ATOM   3313  H  HG2  . MET A  1 252 ? 181.404 127.731 72.660  1.00 159.83 ? 444  MET A HG2  1 
ATOM   3314  H  HG3  . MET A  1 252 ? 180.965 126.282 72.166  1.00 159.83 ? 444  MET A HG3  1 
ATOM   3315  H  HE1  . MET A  1 252 ? 178.381 128.284 70.361  1.00 167.87 ? 444  MET A HE1  1 
ATOM   3316  H  HE2  . MET A  1 252 ? 179.932 128.589 70.515  1.00 167.87 ? 444  MET A HE2  1 
ATOM   3317  H  HE3  . MET A  1 252 ? 179.439 127.107 70.220  1.00 167.87 ? 444  MET A HE3  1 
ATOM   3318  N  N    . LYS A  1 253 ? 182.852 126.904 76.646  1.00 122.65 ? 445  LYS A N    1 
ATOM   3319  C  CA   . LYS A  1 253 ? 183.672 127.767 77.490  1.00 127.64 ? 445  LYS A CA   1 
ATOM   3320  C  C    . LYS A  1 253 ? 185.084 127.217 77.614  1.00 124.67 ? 445  LYS A C    1 
ATOM   3321  O  O    . LYS A  1 253 ? 186.045 127.990 77.695  1.00 127.59 ? 445  LYS A O    1 
ATOM   3322  C  CB   . LYS A  1 253 ? 183.011 127.925 78.860  1.00 131.77 ? 445  LYS A CB   1 
ATOM   3323  C  CG   . LYS A  1 253 ? 181.906 128.985 78.928  1.00 137.70 ? 445  LYS A CG   1 
ATOM   3324  C  CD   . LYS A  1 253 ? 180.980 128.922 77.727  1.00 141.45 ? 445  LYS A CD   1 
ATOM   3325  C  CE   . LYS A  1 253 ? 179.857 129.927 77.776  1.00 146.67 ? 445  LYS A CE   1 
ATOM   3326  N  NZ   . LYS A  1 253 ? 179.116 129.912 76.484  1.00 148.34 ? 445  LYS A NZ   1 
ATOM   3327  H  H    . LYS A  1 253 ? 182.229 126.487 77.067  1.00 146.93 ? 445  LYS A H    1 
ATOM   3328  H  HA   . LYS A  1 253 ? 183.728 128.645 77.082  1.00 152.92 ? 445  LYS A HA   1 
ATOM   3329  H  HB2  . LYS A  1 253 ? 182.616 127.076 79.113  1.00 157.87 ? 445  LYS A HB2  1 
ATOM   3330  H  HB3  . LYS A  1 253 ? 183.692 128.172 79.505  1.00 157.87 ? 445  LYS A HB3  1 
ATOM   3331  H  HG2  . LYS A  1 253 ? 181.375 128.841 79.727  1.00 164.99 ? 445  LYS A HG2  1 
ATOM   3332  H  HG3  . LYS A  1 253 ? 182.312 129.866 78.951  1.00 164.99 ? 445  LYS A HG3  1 
ATOM   3333  H  HD2  . LYS A  1 253 ? 181.497 129.092 76.924  1.00 169.49 ? 445  LYS A HD2  1 
ATOM   3334  H  HD3  . LYS A  1 253 ? 180.585 128.037 77.683  1.00 169.49 ? 445  LYS A HD3  1 
ATOM   3335  H  HE2  . LYS A  1 253 ? 179.242 129.695 78.489  1.00 175.76 ? 445  LYS A HE2  1 
ATOM   3336  H  HE3  . LYS A  1 253 ? 180.221 130.816 77.913  1.00 175.76 ? 445  LYS A HE3  1 
ATOM   3337  H  HZ1  . LYS A  1 253 ? 178.452 130.504 76.508  1.00 177.76 ? 445  LYS A HZ1  1 
ATOM   3338  H  HZ2  . LYS A  1 253 ? 179.665 130.120 75.816  1.00 177.76 ? 445  LYS A HZ2  1 
ATOM   3339  H  HZ3  . LYS A  1 253 ? 178.776 129.102 76.338  1.00 177.76 ? 445  LYS A HZ3  1 
ATOM   3340  N  N    . GLU A  1 254 ? 185.233 125.890 77.628  1.00 117.99 ? 446  GLU A N    1 
ATOM   3341  C  CA   . GLU A  1 254 ? 186.564 125.298 77.689  1.00 117.33 ? 446  GLU A CA   1 
ATOM   3342  C  C    . GLU A  1 254 ? 187.354 125.532 76.406  1.00 117.34 ? 446  GLU A C    1 
ATOM   3343  O  O    . GLU A  1 254 ? 188.589 125.580 76.449  1.00 117.36 ? 446  GLU A O    1 
ATOM   3344  C  CB   . GLU A  1 254 ? 186.461 123.797 77.968  1.00 116.30 ? 446  GLU A CB   1 
ATOM   3345  C  CG   . GLU A  1 254 ? 186.325 123.427 79.439  1.00 118.74 ? 446  GLU A CG   1 
ATOM   3346  C  CD   . GLU A  1 254 ? 187.585 123.701 80.242  1.00 122.54 ? 446  GLU A CD   1 
ATOM   3347  O  OE1  . GLU A  1 254 ? 188.446 124.474 79.772  1.00 126.58 ? 446  GLU A OE1  1 
ATOM   3348  O  OE2  . GLU A  1 254 ? 187.718 123.135 81.347  1.00 121.81 ? 446  GLU A OE2  1 
ATOM   3349  H  H    . GLU A  1 254 ? 184.589 125.322 77.603  1.00 141.33 ? 446  GLU A H    1 
ATOM   3350  H  HA   . GLU A  1 254 ? 187.056 125.704 78.420  1.00 140.55 ? 446  GLU A HA   1 
ATOM   3351  H  HB2  . GLU A  1 254 ? 185.682 123.450 77.505  1.00 139.31 ? 446  GLU A HB2  1 
ATOM   3352  H  HB3  . GLU A  1 254 ? 187.261 123.364 77.630  1.00 139.31 ? 446  GLU A HB3  1 
ATOM   3353  H  HG2  . GLU A  1 254 ? 185.604 123.947 79.829  1.00 142.24 ? 446  GLU A HG2  1 
ATOM   3354  H  HG3  . GLU A  1 254 ? 186.126 122.481 79.509  1.00 142.24 ? 446  GLU A HG3  1 
ATOM   3355  N  N    . THR A  1 255 ? 186.680 125.683 75.260  1.00 114.67 ? 447  THR A N    1 
ATOM   3356  C  CA   . THR A  1 255 ? 187.411 125.939 74.021  1.00 111.46 ? 447  THR A CA   1 
ATOM   3357  C  C    . THR A  1 255 ? 188.163 127.260 74.096  1.00 118.04 ? 447  THR A C    1 
ATOM   3358  O  O    . THR A  1 255 ? 189.342 127.339 73.732  1.00 120.29 ? 447  THR A O    1 
ATOM   3359  C  CB   . THR A  1 255 ? 186.449 125.954 72.830  1.00 107.36 ? 447  THR A CB   1 
ATOM   3360  O  OG1  . THR A  1 255 ? 185.866 124.656 72.657  1.00 102.56 ? 447  THR A OG1  1 
ATOM   3361  C  CG2  . THR A  1 255 ? 187.166 126.385 71.543  1.00 106.99 ? 447  THR A CG2  1 
ATOM   3362  H  H    . THR A  1 255 ? 185.825 125.642 75.177  1.00 137.36 ? 447  THR A H    1 
ATOM   3363  H  HA   . THR A  1 255 ? 188.057 125.230 73.880  1.00 133.50 ? 447  THR A HA   1 
ATOM   3364  H  HB   . THR A  1 255 ? 185.742 126.594 73.006  1.00 128.59 ? 447  THR A HB   1 
ATOM   3365  H  HG1  . THR A  1 255 ? 185.338 124.663 72.004  1.00 122.83 ? 447  THR A HG1  1 
ATOM   3366  H  HG21 . THR A  1 255 ? 186.541 126.388 70.801  1.00 128.13 ? 447  THR A HG21 1 
ATOM   3367  H  HG22 . THR A  1 255 ? 187.531 127.277 71.651  1.00 128.13 ? 447  THR A HG22 1 
ATOM   3368  H  HG23 . THR A  1 255 ? 187.889 125.770 71.345  1.00 128.13 ? 447  THR A HG23 1 
ATOM   3369  N  N    . THR A  1 256 ? 187.501 128.309 74.582  1.00 123.59 ? 448  THR A N    1 
ATOM   3370  C  CA   . THR A  1 256 ? 188.147 129.606 74.772  1.00 130.14 ? 448  THR A CA   1 
ATOM   3371  C  C    . THR A  1 256 ? 189.061 129.503 75.987  1.00 131.04 ? 448  THR A C    1 
ATOM   3372  O  O    . THR A  1 256 ? 188.750 129.979 77.080  1.00 134.40 ? 448  THR A O    1 
ATOM   3373  C  CB   . THR A  1 256 ? 187.121 130.716 74.932  1.00 135.00 ? 448  THR A CB   1 
ATOM   3374  O  OG1  . THR A  1 256 ? 186.420 130.546 76.169  1.00 135.95 ? 448  THR A OG1  1 
ATOM   3375  C  CG2  . THR A  1 256 ? 186.126 130.691 73.777  1.00 133.09 ? 448  THR A CG2  1 
ATOM   3376  H  H    . THR A  1 256 ? 186.672 128.295 74.810  1.00 148.06 ? 448  THR A H    1 
ATOM   3377  H  HA   . THR A  1 256 ? 188.694 129.808 73.997  1.00 155.92 ? 448  THR A HA   1 
ATOM   3378  H  HB   . THR A  1 256 ? 187.571 131.575 74.931  1.00 161.75 ? 448  THR A HB   1 
ATOM   3379  H  HG1  . THR A  1 256 ? 186.960 130.575 76.812  1.00 162.89 ? 448  THR A HG1  1 
ATOM   3380  H  HG21 . THR A  1 256 ? 185.474 131.402 73.886  1.00 159.46 ? 448  THR A HG21 1 
ATOM   3381  H  HG22 . THR A  1 256 ? 186.591 130.817 72.936  1.00 159.46 ? 448  THR A HG22 1 
ATOM   3382  H  HG23 . THR A  1 256 ? 185.662 129.839 73.758  1.00 159.46 ? 448  THR A HG23 1 
ATOM   3383  N  N    . LYS A  1 257 ? 190.210 128.872 75.764  1.00 129.42 ? 449  LYS A N    1 
ATOM   3384  C  CA   . LYS A  1 257 ? 191.259 128.628 76.754  1.00 130.35 ? 449  LYS A CA   1 
ATOM   3385  C  C    . LYS A  1 257 ? 192.067 127.407 76.332  1.00 123.18 ? 449  LYS A C    1 
ATOM   3386  O  O    . LYS A  1 257 ? 193.030 127.022 77.004  1.00 122.44 ? 449  LYS A O    1 
ATOM   3387  C  CB   . LYS A  1 257 ? 190.699 128.394 78.162  1.00 133.03 ? 449  LYS A CB   1 
ATOM   3388  C  CG   . LYS A  1 257 ? 191.748 128.426 79.224  1.00 136.11 ? 449  LYS A CG   1 
ATOM   3389  C  CD   . LYS A  1 257 ? 191.131 128.421 80.586  1.00 135.71 ? 449  LYS A CD   1 
ATOM   3390  C  CE   . LYS A  1 257 ? 191.207 129.755 81.269  1.00 140.09 ? 449  LYS A CE   1 
ATOM   3391  N  NZ   . LYS A  1 257 ? 190.283 130.746 80.684  1.00 143.70 ? 449  LYS A NZ   1 
ATOM   3392  H  H    . LYS A  1 257 ? 190.417 128.554 74.993  1.00 155.05 ? 449  LYS A H    1 
ATOM   3393  H  HA   . LYS A  1 257 ? 191.855 129.392 76.785  1.00 156.17 ? 449  LYS A HA   1 
ATOM   3394  H  HB2  . LYS A  1 257 ? 190.051 129.088 78.362  1.00 159.39 ? 449  LYS A HB2  1 
ATOM   3395  H  HB3  . LYS A  1 257 ? 190.272 127.524 78.190  1.00 159.39 ? 449  LYS A HB3  1 
ATOM   3396  H  HG2  . LYS A  1 257 ? 192.312 127.641 79.141  1.00 163.08 ? 449  LYS A HG2  1 
ATOM   3397  H  HG3  . LYS A  1 257 ? 192.276 129.234 79.130  1.00 163.08 ? 449  LYS A HG3  1 
ATOM   3398  H  HD2  . LYS A  1 257 ? 190.195 128.179 80.508  1.00 162.60 ? 449  LYS A HD2  1 
ATOM   3399  H  HD3  . LYS A  1 257 ? 191.595 127.774 81.140  1.00 162.60 ? 449  LYS A HD3  1 
ATOM   3400  H  HE2  . LYS A  1 257 ? 190.978 129.646 82.205  1.00 167.86 ? 449  LYS A HE2  1 
ATOM   3401  H  HE3  . LYS A  1 257 ? 192.110 130.101 81.186  1.00 167.86 ? 449  LYS A HE3  1 
ATOM   3402  H  HZ1  . LYS A  1 257 ? 190.357 131.521 81.114  1.00 172.19 ? 449  LYS A HZ1  1 
ATOM   3403  H  HZ2  . LYS A  1 257 ? 190.476 130.871 79.825  1.00 172.19 ? 449  LYS A HZ2  1 
ATOM   3404  H  HZ3  . LYS A  1 257 ? 189.444 130.456 80.753  1.00 172.19 ? 449  LYS A HZ3  1 
ATOM   3405  N  N    . ARG A  1 258 ? 191.670 126.788 75.227  1.00 108.14 ? 450  ARG A N    1 
ATOM   3406  C  CA   . ARG A  1 258 ? 192.426 125.698 74.644  1.00 105.35 ? 450  ARG A CA   1 
ATOM   3407  C  C    . ARG A  1 258 ? 193.642 126.279 73.940  1.00 110.67 ? 450  ARG A C    1 
ATOM   3408  O  O    . ARG A  1 258 ? 193.539 127.276 73.221  1.00 110.93 ? 450  ARG A O    1 
ATOM   3409  C  CB   . ARG A  1 258 ? 191.541 124.929 73.666  1.00 98.55  ? 450  ARG A CB   1 
ATOM   3410  C  CG   . ARG A  1 258 ? 192.182 123.737 73.002  1.00 95.87  ? 450  ARG A CG   1 
ATOM   3411  C  CD   . ARG A  1 258 ? 191.237 123.175 71.963  1.00 95.94  ? 450  ARG A CD   1 
ATOM   3412  N  NE   . ARG A  1 258 ? 190.002 122.698 72.584  1.00 95.69  ? 450  ARG A NE   1 
ATOM   3413  C  CZ   . ARG A  1 258 ? 188.860 122.489 71.937  1.00 94.08  ? 450  ARG A CZ   1 
ATOM   3414  N  NH1  . ARG A  1 258 ? 188.771 122.719 70.634  1.00 95.21  ? 450  ARG A NH1  1 
ATOM   3415  N  NH2  . ARG A  1 258 ? 187.796 122.055 72.601  1.00 92.60  ? 450  ARG A NH2  1 
ATOM   3416  H  H    . ARG A  1 258 ? 190.954 126.986 74.793  1.00 129.52 ? 450  ARG A H    1 
ATOM   3417  H  HA   . ARG A  1 258 ? 192.724 125.093 75.341  1.00 126.18 ? 450  ARG A HA   1 
ATOM   3418  H  HB2  . ARG A  1 258 ? 190.761 124.609 74.145  1.00 118.01 ? 450  ARG A HB2  1 
ATOM   3419  H  HB3  . ARG A  1 258 ? 191.262 125.537 72.963  1.00 118.01 ? 450  ARG A HB3  1 
ATOM   3420  H  HG2  . ARG A  1 258 ? 193.002 124.009 72.561  1.00 114.80 ? 450  ARG A HG2  1 
ATOM   3421  H  HG3  . ARG A  1 258 ? 192.361 123.050 73.664  1.00 114.80 ? 450  ARG A HG3  1 
ATOM   3422  H  HD2  . ARG A  1 258 ? 191.009 123.870 71.326  1.00 114.88 ? 450  ARG A HD2  1 
ATOM   3423  H  HD3  . ARG A  1 258 ? 191.661 122.429 71.512  1.00 114.88 ? 450  ARG A HD3  1 
ATOM   3424  H  HE   . ARG A  1 258 ? 190.016 122.541 73.430  1.00 114.57 ? 450  ARG A HE   1 
ATOM   3425  H  HH11 . ARG A  1 258 ? 189.458 123.002 70.199  1.00 114.01 ? 450  ARG A HH11 1 
ATOM   3426  H  HH12 . ARG A  1 258 ? 188.029 122.583 70.222  1.00 114.01 ? 450  ARG A HH12 1 
ATOM   3427  H  HH21 . ARG A  1 258 ? 187.848 121.905 73.446  1.00 110.87 ? 450  ARG A HH21 1 
ATOM   3428  H  HH22 . ARG A  1 258 ? 187.056 121.920 72.185  1.00 110.87 ? 450  ARG A HH22 1 
ATOM   3429  N  N    . VAL A  1 259 ? 194.791 125.660 74.139  1.00 124.99 ? 451  VAL A N    1 
ATOM   3430  C  CA   . VAL A  1 259 ? 196.001 126.174 73.516  1.00 127.41 ? 451  VAL A CA   1 
ATOM   3431  C  C    . VAL A  1 259 ? 196.035 125.675 72.083  1.00 123.82 ? 451  VAL A C    1 
ATOM   3432  O  O    . VAL A  1 259 ? 195.713 124.513 71.805  1.00 121.86 ? 451  VAL A O    1 
ATOM   3433  C  CB   . VAL A  1 259 ? 197.257 125.742 74.301  1.00 128.19 ? 451  VAL A CB   1 
ATOM   3434  C  CG1  . VAL A  1 259 ? 197.046 125.896 75.806  1.00 128.65 ? 451  VAL A CG1  1 
ATOM   3435  C  CG2  . VAL A  1 259 ? 197.661 124.311 73.961  1.00 125.88 ? 451  VAL A CG2  1 
ATOM   3436  H  H    . VAL A  1 259 ? 194.900 124.955 74.619  1.00 149.73 ? 451  VAL A H    1 
ATOM   3437  H  HA   . VAL A  1 259 ? 195.969 127.144 73.502  1.00 152.65 ? 451  VAL A HA   1 
ATOM   3438  H  HB   . VAL A  1 259 ? 197.993 126.321 74.049  1.00 153.58 ? 451  VAL A HB   1 
ATOM   3439  H  HG11 . VAL A  1 259 ? 197.852 125.616 76.268  1.00 154.14 ? 451  VAL A HG11 1 
ATOM   3440  H  HG12 . VAL A  1 259 ? 196.856 126.826 76.004  1.00 154.14 ? 451  VAL A HG12 1 
ATOM   3441  H  HG13 . VAL A  1 259 ? 196.299 125.341 76.078  1.00 154.14 ? 451  VAL A HG13 1 
ATOM   3442  H  HG21 . VAL A  1 259 ? 198.451 124.077 74.472  1.00 150.81 ? 451  VAL A HG21 1 
ATOM   3443  H  HG22 . VAL A  1 259 ? 196.930 123.715 74.189  1.00 150.81 ? 451  VAL A HG22 1 
ATOM   3444  H  HG23 . VAL A  1 259 ? 197.851 124.255 73.012  1.00 150.81 ? 451  VAL A HG23 1 
ATOM   3445  N  N    . ARG A  1 260 ? 196.410 126.553 71.160  1.00 115.59 ? 452  ARG A N    1 
ATOM   3446  C  CA   . ARG A  1 260 ? 196.519 126.160 69.765  1.00 112.91 ? 452  ARG A CA   1 
ATOM   3447  C  C    . ARG A  1 260 ? 197.861 125.465 69.584  1.00 109.38 ? 452  ARG A C    1 
ATOM   3448  O  O    . ARG A  1 260 ? 198.917 126.085 69.752  1.00 110.88 ? 452  ARG A O    1 
ATOM   3449  C  CB   . ARG A  1 260 ? 196.383 127.382 68.857  1.00 119.76 ? 452  ARG A CB   1 
ATOM   3450  C  CG   . ARG A  1 260 ? 196.438 127.086 67.364  1.00 123.13 ? 452  ARG A CG   1 
ATOM   3451  C  CD   . ARG A  1 260 ? 195.149 126.463 66.842  1.00 125.43 ? 452  ARG A CD   1 
ATOM   3452  N  NE   . ARG A  1 260 ? 195.311 125.986 65.470  1.00 128.62 ? 452  ARG A NE   1 
ATOM   3453  C  CZ   . ARG A  1 260 ? 194.376 125.344 64.775  1.00 129.56 ? 452  ARG A CZ   1 
ATOM   3454  N  NH1  . ARG A  1 260 ? 193.190 125.089 65.315  1.00 128.17 ? 452  ARG A NH1  1 
ATOM   3455  N  NH2  . ARG A  1 260 ? 194.629 124.955 63.533  1.00 129.74 ? 452  ARG A NH2  1 
ATOM   3456  H  H    . ARG A  1 260 ? 196.605 127.375 71.316  1.00 138.45 ? 452  ARG A H    1 
ATOM   3457  H  HA   . ARG A  1 260 ? 195.813 125.532 69.547  1.00 135.24 ? 452  ARG A HA   1 
ATOM   3458  H  HB2  . ARG A  1 260 ? 195.530 127.807 69.039  1.00 143.46 ? 452  ARG A HB2  1 
ATOM   3459  H  HB3  . ARG A  1 260 ? 197.104 127.998 69.060  1.00 143.46 ? 452  ARG A HB3  1 
ATOM   3460  H  HG2  . ARG A  1 260 ? 196.588 127.915 66.882  1.00 147.51 ? 452  ARG A HG2  1 
ATOM   3461  H  HG3  . ARG A  1 260 ? 197.164 126.466 67.190  1.00 147.51 ? 452  ARG A HG3  1 
ATOM   3462  H  HD2  . ARG A  1 260 ? 194.908 125.708 67.401  1.00 150.27 ? 452  ARG A HD2  1 
ATOM   3463  H  HD3  . ARG A  1 260 ? 194.443 127.128 66.852  1.00 150.27 ? 452  ARG A HD3  1 
ATOM   3464  H  HE   . ARG A  1 260 ? 196.065 126.132 65.083  1.00 154.09 ? 452  ARG A HE   1 
ATOM   3465  H  HH11 . ARG A  1 260 ? 193.022 125.339 66.120  1.00 153.56 ? 452  ARG A HH11 1 
ATOM   3466  H  HH12 . ARG A  1 260 ? 192.591 124.673 64.859  1.00 153.56 ? 452  ARG A HH12 1 
ATOM   3467  H  HH21 . ARG A  1 260 ? 195.395 125.119 63.179  1.00 155.45 ? 452  ARG A HH21 1 
ATOM   3468  H  HH22 . ARG A  1 260 ? 194.026 124.540 63.081  1.00 155.45 ? 452  ARG A HH22 1 
ATOM   3469  N  N    . LEU A  1 261 ? 197.819 124.181 69.245  1.00 101.45 ? 453  LEU A N    1 
ATOM   3470  C  CA   . LEU A  1 261 ? 199.028 123.381 69.142  1.00 97.79  ? 453  LEU A CA   1 
ATOM   3471  C  C    . LEU A  1 261 ? 199.632 123.476 67.746  1.00 99.61  ? 453  LEU A C    1 
ATOM   3472  O  O    . LEU A  1 261 ? 198.973 123.849 66.773  1.00 101.62 ? 453  LEU A O    1 
ATOM   3473  C  CB   . LEU A  1 261 ? 198.739 121.921 69.487  1.00 90.67  ? 453  LEU A CB   1 
ATOM   3474  C  CG   . LEU A  1 261 ? 198.080 121.648 70.839  1.00 87.19  ? 453  LEU A CG   1 
ATOM   3475  C  CD1  . LEU A  1 261 ? 197.712 120.181 70.946  1.00 84.78  ? 453  LEU A CD1  1 
ATOM   3476  C  CD2  . LEU A  1 261 ? 199.019 122.035 71.971  1.00 86.94  ? 453  LEU A CD2  1 
ATOM   3477  H  H    . LEU A  1 261 ? 197.097 123.749 69.070  1.00 121.49 ? 453  LEU A H    1 
ATOM   3478  H  HA   . LEU A  1 261 ? 199.683 123.715 69.775  1.00 117.10 ? 453  LEU A HA   1 
ATOM   3479  H  HB2  . LEU A  1 261 ? 198.151 121.561 68.805  1.00 108.56 ? 453  LEU A HB2  1 
ATOM   3480  H  HB3  . LEU A  1 261 ? 199.578 121.436 69.475  1.00 108.56 ? 453  LEU A HB3  1 
ATOM   3481  H  HG   . LEU A  1 261 ? 197.270 122.175 70.917  1.00 104.38 ? 453  LEU A HG   1 
ATOM   3482  H  HD11 . LEU A  1 261 ? 197.296 120.022 71.808  1.00 101.49 ? 453  LEU A HD11 1 
ATOM   3483  H  HD12 . LEU A  1 261 ? 197.093 119.958 70.233  1.00 101.49 ? 453  LEU A HD12 1 
ATOM   3484  H  HD13 . LEU A  1 261 ? 198.518 119.647 70.863  1.00 101.49 ? 453  LEU A HD13 1 
ATOM   3485  H  HD21 . LEU A  1 261 ? 198.583 121.854 72.819  1.00 104.08 ? 453  LEU A HD21 1 
ATOM   3486  H  HD22 . LEU A  1 261 ? 199.833 121.512 71.899  1.00 104.08 ? 453  LEU A HD22 1 
ATOM   3487  H  HD23 . LEU A  1 261 ? 199.226 122.980 71.900  1.00 104.08 ? 453  LEU A HD23 1 
ATOM   3488  N  N    . GLY A  1 262 ? 200.912 123.130 67.666  1.00 98.97  ? 454  GLY A N    1 
ATOM   3489  C  CA   . GLY A  1 262 ? 201.638 123.169 66.423  1.00 99.77  ? 454  GLY A CA   1 
ATOM   3490  C  C    . GLY A  1 262 ? 203.109 122.871 66.623  1.00 101.98 ? 454  GLY A C    1 
ATOM   3491  O  O    . GLY A  1 262 ? 203.550 122.495 67.713  1.00 101.93 ? 454  GLY A O    1 
ATOM   3492  H  H    . GLY A  1 262 ? 201.383 122.865 68.335  1.00 118.52 ? 454  GLY A H    1 
ATOM   3493  H  HA2  . GLY A  1 262 ? 201.269 122.514 65.810  1.00 119.48 ? 454  GLY A HA2  1 
ATOM   3494  H  HA3  . GLY A  1 262 ? 201.552 124.049 66.024  1.00 119.48 ? 454  GLY A HA3  1 
ATOM   3495  N  N    . PRO A  1 263 ? 203.899 123.030 65.560  1.00 102.18 ? 455  PRO A N    1 
ATOM   3496  C  CA   . PRO A  1 263 ? 205.333 122.715 65.665  1.00 105.19 ? 455  PRO A CA   1 
ATOM   3497  C  C    . PRO A  1 263 ? 206.062 123.533 66.718  1.00 107.92 ? 455  PRO A C    1 
ATOM   3498  O  O    . PRO A  1 263 ? 207.066 123.062 67.267  1.00 107.73 ? 455  PRO A O    1 
ATOM   3499  C  CB   . PRO A  1 263 ? 205.858 123.011 64.252  1.00 107.03 ? 455  PRO A CB   1 
ATOM   3500  C  CG   . PRO A  1 263 ? 204.653 122.930 63.365  1.00 104.50 ? 455  PRO A CG   1 
ATOM   3501  C  CD   . PRO A  1 263 ? 203.510 123.416 64.194  1.00 102.86 ? 455  PRO A CD   1 
ATOM   3502  H  HA   . PRO A  1 263 ? 205.454 121.772 65.857  1.00 125.98 ? 455  PRO A HA   1 
ATOM   3503  H  HB2  . PRO A  1 263 ? 206.245 123.900 64.226  1.00 128.19 ? 455  PRO A HB2  1 
ATOM   3504  H  HB3  . PRO A  1 263 ? 206.515 122.343 64.001  1.00 128.19 ? 455  PRO A HB3  1 
ATOM   3505  H  HG2  . PRO A  1 263 ? 204.780 123.500 62.591  1.00 125.15 ? 455  PRO A HG2  1 
ATOM   3506  H  HG3  . PRO A  1 263 ? 204.511 122.010 63.093  1.00 125.15 ? 455  PRO A HG3  1 
ATOM   3507  H  HD2  . PRO A  1 263 ? 203.427 124.380 64.125  1.00 123.18 ? 455  PRO A HD2  1 
ATOM   3508  H  HD3  . PRO A  1 263 ? 202.689 122.968 63.936  1.00 123.18 ? 455  PRO A HD3  1 
ATOM   3509  N  N    . ASP A  1 264 ? 205.595 124.745 67.015  1.00 113.87 ? 456  ASP A N    1 
ATOM   3510  C  CA   . ASP A  1 264 ? 206.227 125.605 68.007  1.00 116.93 ? 456  ASP A CA   1 
ATOM   3511  C  C    . ASP A  1 264 ? 205.471 125.634 69.330  1.00 114.60 ? 456  ASP A C    1 
ATOM   3512  O  O    . ASP A  1 264 ? 205.775 126.472 70.184  1.00 117.49 ? 456  ASP A O    1 
ATOM   3513  C  CB   . ASP A  1 264 ? 206.365 127.027 67.459  1.00 124.27 ? 456  ASP A CB   1 
ATOM   3514  C  CG   . ASP A  1 264 ? 207.269 127.100 66.244  1.00 131.25 ? 456  ASP A CG   1 
ATOM   3515  O  OD1  . ASP A  1 264 ? 208.425 126.636 66.335  1.00 133.50 ? 456  ASP A OD1  1 
ATOM   3516  O  OD2  . ASP A  1 264 ? 206.824 127.620 65.199  1.00 132.98 ? 456  ASP A OD2  1 
ATOM   3517  H  H    . ASP A  1 264 ? 204.901 125.096 66.648  1.00 136.40 ? 456  ASP A H    1 
ATOM   3518  H  HA   . ASP A  1 264 ? 207.120 125.269 68.185  1.00 140.06 ? 456  ASP A HA   1 
ATOM   3519  H  HB2  . ASP A  1 264 ? 205.488 127.353 67.201  1.00 148.87 ? 456  ASP A HB2  1 
ATOM   3520  H  HB3  . ASP A  1 264 ? 206.741 127.597 68.148  1.00 148.87 ? 456  ASP A HB3  1 
ATOM   3521  N  N    . CYS A  1 265 ? 204.497 124.744 69.521  1.00 113.34 ? 457  CYS A N    1 
ATOM   3522  C  CA   . CYS A  1 265 ? 203.748 124.682 70.779  1.00 115.62 ? 457  CYS A CA   1 
ATOM   3523  C  C    . CYS A  1 265 ? 203.237 123.248 70.940  1.00 112.62 ? 457  CYS A C    1 
ATOM   3524  O  O    . CYS A  1 265 ? 202.109 122.931 70.555  1.00 108.94 ? 457  CYS A O    1 
ATOM   3525  C  CB   . CYS A  1 265 ? 202.610 125.690 70.798  1.00 119.84 ? 457  CYS A CB   1 
ATOM   3526  S  SG   . CYS A  1 265 ? 201.613 125.647 72.304  1.00 127.01 ? 457  CYS A SG   1 
ATOM   3527  H  H    . CYS A  1 265 ? 204.249 124.163 68.936  1.00 135.76 ? 457  CYS A H    1 
ATOM   3528  H  HA   . CYS A  1 265 ? 204.344 124.879 71.518  1.00 138.49 ? 457  CYS A HA   1 
ATOM   3529  H  HB2  . CYS A  1 265 ? 202.982 126.582 70.715  1.00 143.56 ? 457  CYS A HB2  1 
ATOM   3530  H  HB3  . CYS A  1 265 ? 202.021 125.509 70.048  1.00 143.56 ? 457  CYS A HB3  1 
ATOM   3531  H  HG   . CYS A  1 265 ? 200.746 126.473 72.223  1.00 152.16 ? 457  CYS A HG   1 
ATOM   3532  N  N    . LEU A  1 266 ? 204.091 122.381 71.523  1.00 105.04 ? 458  LEU A N    1 
ATOM   3533  C  CA   . LEU A  1 266 ? 203.683 120.998 71.701  1.00 100.92 ? 458  LEU A CA   1 
ATOM   3534  C  C    . LEU A  1 266 ? 202.900 120.828 73.003  1.00 96.83  ? 458  LEU A C    1 
ATOM   3535  O  O    . LEU A  1 266 ? 203.144 121.542 73.981  1.00 96.92  ? 458  LEU A O    1 
ATOM   3536  C  CB   . LEU A  1 266 ? 204.904 120.079 71.708  1.00 103.14 ? 458  LEU A CB   1 
ATOM   3537  C  CG   . LEU A  1 266 ? 205.789 120.102 70.454  1.00 100.69 ? 458  LEU A CG   1 
ATOM   3538  C  CD1  . LEU A  1 266 ? 206.903 119.069 70.573  1.00 98.52  ? 458  LEU A CD1  1 
ATOM   3539  C  CD2  . LEU A  1 266 ? 204.975 119.865 69.185  1.00 99.96  ? 458  LEU A CD2  1 
ATOM   3540  H  H    . LEU A  1 266 ? 204.879 122.571 71.809  1.00 125.79 ? 458  LEU A H    1 
ATOM   3541  H  HA   . LEU A  1 266 ? 203.109 120.736 70.964  1.00 120.86 ? 458  LEU A HA   1 
ATOM   3542  H  HB2  . LEU A  1 266 ? 205.466 120.327 72.459  1.00 123.52 ? 458  LEU A HB2  1 
ATOM   3543  H  HB3  . LEU A  1 266 ? 204.597 119.167 71.825  1.00 123.52 ? 458  LEU A HB3  1 
ATOM   3544  H  HG   . LEU A  1 266 ? 206.203 120.976 70.380  1.00 120.58 ? 458  LEU A HG   1 
ATOM   3545  H  HD11 . LEU A  1 266 ? 207.449 119.100 69.772  1.00 117.97 ? 458  LEU A HD11 1 
ATOM   3546  H  HD12 . LEU A  1 266 ? 207.444 119.277 71.351  1.00 117.97 ? 458  LEU A HD12 1 
ATOM   3547  H  HD13 . LEU A  1 266 ? 206.507 118.189 70.670  1.00 117.97 ? 458  LEU A HD13 1 
ATOM   3548  H  HD21 . LEU A  1 266 ? 205.571 119.887 68.419  1.00 119.70 ? 458  LEU A HD21 1 
ATOM   3549  H  HD22 . LEU A  1 266 ? 204.544 118.998 69.244  1.00 119.70 ? 458  LEU A HD22 1 
ATOM   3550  H  HD23 . LEU A  1 266 ? 204.306 120.563 69.104  1.00 119.70 ? 458  LEU A HD23 1 
ATOM   3551  N  N    . PRO A  1 267 ? 201.961 119.885 73.037  1.00 91.61  ? 459  PRO A N    1 
ATOM   3552  C  CA   . PRO A  1 267 ? 201.160 119.672 74.248  1.00 91.64  ? 459  PRO A CA   1 
ATOM   3553  C  C    . PRO A  1 267 ? 201.977 119.017 75.354  1.00 93.47  ? 459  PRO A C    1 
ATOM   3554  O  O    . PRO A  1 267 ? 203.099 118.545 75.153  1.00 92.89  ? 459  PRO A O    1 
ATOM   3555  C  CB   . PRO A  1 267 ? 200.038 118.753 73.763  1.00 89.48  ? 459  PRO A CB   1 
ATOM   3556  C  CG   . PRO A  1 267 ? 200.683 117.962 72.678  1.00 89.05  ? 459  PRO A CG   1 
ATOM   3557  C  CD   . PRO A  1 267 ? 201.601 118.930 71.976  1.00 91.75  ? 459  PRO A CD   1 
ATOM   3558  H  HA   . PRO A  1 267 ? 200.786 120.508 74.565  1.00 109.72 ? 459  PRO A HA   1 
ATOM   3559  H  HB2  . PRO A  1 267 ? 199.745 118.177 74.486  1.00 107.13 ? 459  PRO A HB2  1 
ATOM   3560  H  HB3  . PRO A  1 267 ? 199.302 119.282 73.418  1.00 107.13 ? 459  PRO A HB3  1 
ATOM   3561  H  HG2  . PRO A  1 267 ? 201.188 117.229 73.063  1.00 106.62 ? 459  PRO A HG2  1 
ATOM   3562  H  HG3  . PRO A  1 267 ? 200.005 117.630 72.069  1.00 106.62 ? 459  PRO A HG3  1 
ATOM   3563  H  HD2  . PRO A  1 267 ? 202.391 118.472 71.651  1.00 109.85 ? 459  PRO A HD2  1 
ATOM   3564  H  HD3  . PRO A  1 267 ? 201.131 119.383 71.258  1.00 109.85 ? 459  PRO A HD3  1 
ATOM   3565  N  N    . SER A  1 268 ? 201.391 119.005 76.550  1.00 104.94 ? 460  SER A N    1 
ATOM   3566  C  CA   . SER A  1 268 ? 201.985 118.343 77.705  1.00 103.60 ? 460  SER A CA   1 
ATOM   3567  C  C    . SER A  1 268 ? 201.551 116.882 77.731  1.00 100.89 ? 460  SER A C    1 
ATOM   3568  O  O    . SER A  1 268 ? 200.352 116.583 77.711  1.00 105.14 ? 460  SER A O    1 
ATOM   3569  C  CB   . SER A  1 268 ? 201.574 119.057 78.991  1.00 108.14 ? 460  SER A CB   1 
ATOM   3570  O  OG   . SER A  1 268 ? 202.044 120.393 78.978  1.00 114.92 ? 460  SER A OG   1 
ATOM   3571  H  H    . SER A  1 268 ? 200.636 119.380 76.719  1.00 125.69 ? 460  SER A H    1 
ATOM   3572  H  HA   . SER A  1 268 ? 202.952 118.374 77.632  1.00 124.07 ? 460  SER A HA   1 
ATOM   3573  H  HB2  . SER A  1 268 ? 200.607 119.060 79.058  1.00 129.53 ? 460  SER A HB2  1 
ATOM   3574  H  HB3  . SER A  1 268 ? 201.960 118.592 79.750  1.00 129.53 ? 460  SER A HB3  1 
ATOM   3575  H  HG   . SER A  1 268 ? 201.817 120.785 79.686  1.00 137.65 ? 460  SER A HG   1 
ATOM   3576  N  N    . ILE A  1 269 ? 202.524 115.982 77.793  1.00 88.70  ? 461  ILE A N    1 
ATOM   3577  C  CA   . ILE A  1 269 ? 202.285 114.543 77.821  1.00 88.95  ? 461  ILE A CA   1 
ATOM   3578  C  C    . ILE A  1 269 ? 202.359 114.101 79.278  1.00 86.99  ? 461  ILE A C    1 
ATOM   3579  O  O    . ILE A  1 269 ? 203.434 114.121 79.888  1.00 86.37  ? 461  ILE A O    1 
ATOM   3580  C  CB   . ILE A  1 269 ? 203.310 113.792 76.962  1.00 87.13  ? 461  ILE A CB   1 
ATOM   3581  C  CG1  . ILE A  1 269 ? 203.507 114.494 75.611  1.00 88.23  ? 461  ILE A CG1  1 
ATOM   3582  C  CG2  . ILE A  1 269 ? 202.891 112.339 76.764  1.00 85.55  ? 461  ILE A CG2  1 
ATOM   3583  C  CD1  . ILE A  1 269 ? 202.238 114.694 74.817  1.00 89.06  ? 461  ILE A CD1  1 
ATOM   3584  H  H    . ILE A  1 269 ? 203.359 116.187 77.821  1.00 106.19 ? 461  ILE A H    1 
ATOM   3585  H  HA   . ILE A  1 269 ? 201.396 114.353 77.483  1.00 106.49 ? 461  ILE A HA   1 
ATOM   3586  H  HB   . ILE A  1 269 ? 204.159 113.799 77.431  1.00 104.31 ? 461  ILE A HB   1 
ATOM   3587  H  HG12 . ILE A  1 269 ? 203.895 115.368 75.770  1.00 105.63 ? 461  ILE A HG12 1 
ATOM   3588  H  HG13 . ILE A  1 269 ? 204.111 113.962 75.070  1.00 105.63 ? 461  ILE A HG13 1 
ATOM   3589  H  HG21 . ILE A  1 269 ? 203.556 111.890 76.218  1.00 102.41 ? 461  ILE A HG21 1 
ATOM   3590  H  HG22 . ILE A  1 269 ? 202.828 111.908 77.630  1.00 102.41 ? 461  ILE A HG22 1 
ATOM   3591  H  HG23 . ILE A  1 269 ? 202.029 112.317 76.320  1.00 102.41 ? 461  ILE A HG23 1 
ATOM   3592  H  HD11 . ILE A  1 269 ? 202.454 115.141 73.984  1.00 106.63 ? 461  ILE A HD11 1 
ATOM   3593  H  HD12 . ILE A  1 269 ? 201.840 113.828 74.634  1.00 106.63 ? 461  ILE A HD12 1 
ATOM   3594  H  HD13 . ILE A  1 269 ? 201.624 115.238 75.335  1.00 106.63 ? 461  ILE A HD13 1 
ATOM   3595  N  N    . CYS A  1 270 ? 201.224 113.696 79.844  1.00 88.24  ? 462  CYS A N    1 
ATOM   3596  C  CA   . CYS A  1 270 ? 201.164 113.223 81.226  1.00 87.85  ? 462  CYS A CA   1 
ATOM   3597  C  C    . CYS A  1 270 ? 200.979 111.709 81.209  1.00 86.40  ? 462  CYS A C    1 
ATOM   3598  O  O    . CYS A  1 270 ? 199.874 111.205 80.986  1.00 81.85  ? 462  CYS A O    1 
ATOM   3599  C  CB   . CYS A  1 270 ? 200.049 113.927 81.990  1.00 92.17  ? 462  CYS A CB   1 
ATOM   3600  S  SG   . CYS A  1 270 ? 200.373 115.684 82.254  1.00 97.90  ? 462  CYS A SG   1 
ATOM   3601  H  H    . CYS A  1 270 ? 200.464 113.685 79.442  1.00 105.64 ? 462  CYS A H    1 
ATOM   3602  H  HA   . CYS A  1 270 ? 202.005 113.421 81.667  1.00 105.17 ? 462  CYS A HA   1 
ATOM   3603  H  HB2  . CYS A  1 270 ? 199.224 113.848 81.487  1.00 110.36 ? 462  CYS A HB2  1 
ATOM   3604  H  HB3  . CYS A  1 270 ? 199.949 113.508 82.859  1.00 110.36 ? 462  CYS A HB3  1 
ATOM   3605  H  HG   . CYS A  1 270 ? 201.386 115.804 82.886  1.00 117.23 ? 462  CYS A HG   1 
ATOM   3606  N  N    . PHE A  1 271 ? 202.074 110.993 81.447  1.00 87.14  ? 463  PHE A N    1 
ATOM   3607  C  CA   . PHE A  1 271 ? 202.071 109.538 81.436  1.00 85.33  ? 463  PHE A CA   1 
ATOM   3608  C  C    . PHE A  1 271 ? 201.626 109.006 82.794  1.00 81.65  ? 463  PHE A C    1 
ATOM   3609  O  O    . PHE A  1 271 ? 201.997 109.549 83.838  1.00 82.69  ? 463  PHE A O    1 
ATOM   3610  C  CB   . PHE A  1 271 ? 203.476 109.040 81.089  1.00 84.37  ? 463  PHE A CB   1 
ATOM   3611  C  CG   . PHE A  1 271 ? 203.672 107.563 81.258  1.00 83.33  ? 463  PHE A CG   1 
ATOM   3612  C  CD1  . PHE A  1 271 ? 203.431 106.698 80.206  1.00 82.64  ? 463  PHE A CD1  1 
ATOM   3613  C  CD2  . PHE A  1 271 ? 204.130 107.045 82.456  1.00 81.65  ? 463  PHE A CD2  1 
ATOM   3614  C  CE1  . PHE A  1 271 ? 203.625 105.341 80.352  1.00 82.15  ? 463  PHE A CE1  1 
ATOM   3615  C  CE2  . PHE A  1 271 ? 204.325 105.689 82.609  1.00 82.66  ? 463  PHE A CE2  1 
ATOM   3616  C  CZ   . PHE A  1 271 ? 204.073 104.835 81.555  1.00 84.04  ? 463  PHE A CZ   1 
ATOM   3617  H  H    . PHE A  1 271 ? 202.844 111.335 81.619  1.00 104.32 ? 463  PHE A H    1 
ATOM   3618  H  HA   . PHE A  1 271 ? 201.453 109.219 80.761  1.00 102.15 ? 463  PHE A HA   1 
ATOM   3619  H  HB2  . PHE A  1 271 ? 203.661 109.257 80.161  1.00 101.00 ? 463  PHE A HB2  1 
ATOM   3620  H  HB3  . PHE A  1 271 ? 204.115 109.489 81.663  1.00 101.00 ? 463  PHE A HB3  1 
ATOM   3621  H  HD1  . PHE A  1 271 ? 203.129 107.034 79.394  1.00 98.92  ? 463  PHE A HD1  1 
ATOM   3622  H  HD2  . PHE A  1 271 ? 204.301 107.617 83.169  1.00 97.73  ? 463  PHE A HD2  1 
ATOM   3623  H  HE1  . PHE A  1 271 ? 203.454 104.767 79.641  1.00 98.33  ? 463  PHE A HE1  1 
ATOM   3624  H  HE2  . PHE A  1 271 ? 204.627 105.350 83.420  1.00 98.94  ? 463  PHE A HE2  1 
ATOM   3625  H  HZ   . PHE A  1 271 ? 204.203 103.920 81.656  1.00 100.59 ? 463  PHE A HZ   1 
ATOM   3626  N  N    . TYR A  1 272 ? 200.820 107.944 82.778  1.00 72.78  ? 464  TYR A N    1 
ATOM   3627  C  CA   . TYR A  1 272 ? 200.367 107.331 84.020  1.00 74.87  ? 464  TYR A CA   1 
ATOM   3628  C  C    . TYR A  1 272 ? 200.157 105.837 83.824  1.00 72.83  ? 464  TYR A C    1 
ATOM   3629  O  O    . TYR A  1 272 ? 199.698 105.396 82.766  1.00 67.86  ? 464  TYR A O    1 
ATOM   3630  C  CB   . TYR A  1 272 ? 199.068 107.975 84.529  1.00 75.40  ? 464  TYR A CB   1 
ATOM   3631  C  CG   . TYR A  1 272 ? 197.854 107.768 83.644  1.00 70.35  ? 464  TYR A CG   1 
ATOM   3632  C  CD1  . TYR A  1 272 ? 197.693 108.486 82.466  1.00 69.94  ? 464  TYR A CD1  1 
ATOM   3633  C  CD2  . TYR A  1 272 ? 196.857 106.868 84.002  1.00 69.64  ? 464  TYR A CD2  1 
ATOM   3634  C  CE1  . TYR A  1 272 ? 196.580 108.304 81.662  1.00 69.28  ? 464  TYR A CE1  1 
ATOM   3635  C  CE2  . TYR A  1 272 ? 195.740 106.681 83.205  1.00 65.57  ? 464  TYR A CE2  1 
ATOM   3636  C  CZ   . TYR A  1 272 ? 195.606 107.403 82.038  1.00 68.12  ? 464  TYR A CZ   1 
ATOM   3637  O  OH   . TYR A  1 272 ? 194.500 107.223 81.239  1.00 62.09  ? 464  TYR A OH   1 
ATOM   3638  H  H    . TYR A  1 272 ? 200.524 107.565 82.066  1.00 87.09  ? 464  TYR A H    1 
ATOM   3639  H  HA   . TYR A  1 272 ? 201.048 107.452 84.699  1.00 89.60  ? 464  TYR A HA   1 
ATOM   3640  H  HB2  . TYR A  1 272 ? 198.862 107.602 85.400  1.00 90.24  ? 464  TYR A HB2  1 
ATOM   3641  H  HB3  . TYR A  1 272 ? 199.210 108.931 84.611  1.00 90.24  ? 464  TYR A HB3  1 
ATOM   3642  H  HD1  . TYR A  1 272 ? 198.347 109.096 82.210  1.00 83.68  ? 464  TYR A HD1  1 
ATOM   3643  H  HD2  . TYR A  1 272 ? 196.943 106.380 84.789  1.00 83.32  ? 464  TYR A HD2  1 
ATOM   3644  H  HE1  . TYR A  1 272 ? 196.488 108.790 80.875  1.00 82.88  ? 464  TYR A HE1  1 
ATOM   3645  H  HE2  . TYR A  1 272 ? 195.083 106.072 83.456  1.00 78.44  ? 464  TYR A HE2  1 
ATOM   3646  H  HH   . TYR A  1 272 ? 193.989 106.650 81.580  1.00 74.26  ? 464  TYR A HH   1 
ATOM   3647  N  N    . THR A  1 273 ? 200.489 105.071 84.861  1.00 76.24  ? 465  THR A N    1 
ATOM   3648  C  CA   . THR A  1 273 ? 200.182 103.647 84.932  1.00 76.46  ? 465  THR A CA   1 
ATOM   3649  C  C    . THR A  1 273 ? 199.007 103.476 85.888  1.00 73.88  ? 465  THR A C    1 
ATOM   3650  O  O    . THR A  1 273 ? 199.157 103.621 87.106  1.00 75.46  ? 465  THR A O    1 
ATOM   3651  C  CB   . THR A  1 273 ? 201.398 102.844 85.390  1.00 79.79  ? 465  THR A CB   1 
ATOM   3652  O  OG1  . THR A  1 273 ? 202.027 103.508 86.494  1.00 83.56  ? 465  THR A OG1  1 
ATOM   3653  C  CG2  . THR A  1 273 ? 202.398 102.699 84.249  1.00 80.27  ? 465  THR A CG2  1 
ATOM   3654  H  H    . THR A  1 273 ? 200.904 105.364 85.555  1.00 91.24  ? 465  THR A H    1 
ATOM   3655  H  HA   . THR A  1 273 ? 199.916 103.328 84.056  1.00 91.51  ? 465  THR A HA   1 
ATOM   3656  H  HB   . THR A  1 273 ? 201.115 101.958 85.664  1.00 95.50  ? 465  THR A HB   1 
ATOM   3657  H  HG1  . THR A  1 273 ? 201.486 103.576 87.134  1.00 100.02 ? 465  THR A HG1  1 
ATOM   3658  H  HG21 . THR A  1 273 ? 203.167 102.188 84.546  1.00 96.08  ? 465  THR A HG21 1 
ATOM   3659  H  HG22 . THR A  1 273 ? 201.983 102.238 83.502  1.00 96.08  ? 465  THR A HG22 1 
ATOM   3660  H  HG23 . THR A  1 273 ? 202.694 103.574 83.954  1.00 96.08  ? 465  THR A HG23 1 
ATOM   3661  N  N    . PHE A  1 274 ? 197.841 103.166 85.328  1.00 72.76  ? 466  PHE A N    1 
ATOM   3662  C  CA   . PHE A  1 274 ? 196.583 103.276 86.056  1.00 72.76  ? 466  PHE A CA   1 
ATOM   3663  C  C    . PHE A  1 274 ? 196.579 102.419 87.318  1.00 73.80  ? 466  PHE A C    1 
ATOM   3664  O  O    . PHE A  1 274 ? 196.930 101.236 87.286  1.00 74.25  ? 466  PHE A O    1 
ATOM   3665  C  CB   . PHE A  1 274 ? 195.434 102.871 85.129  1.00 72.19  ? 466  PHE A CB   1 
ATOM   3666  C  CG   . PHE A  1 274 ? 194.067 103.211 85.652  1.00 69.84  ? 466  PHE A CG   1 
ATOM   3667  C  CD1  . PHE A  1 274 ? 193.808 104.442 86.232  1.00 71.24  ? 466  PHE A CD1  1 
ATOM   3668  C  CD2  . PHE A  1 274 ? 193.029 102.302 85.532  1.00 66.99  ? 466  PHE A CD2  1 
ATOM   3669  C  CE1  . PHE A  1 274 ? 192.546 104.750 86.703  1.00 72.73  ? 466  PHE A CE1  1 
ATOM   3670  C  CE2  . PHE A  1 274 ? 191.766 102.604 86.001  1.00 69.83  ? 466  PHE A CE2  1 
ATOM   3671  C  CZ   . PHE A  1 274 ? 191.523 103.829 86.586  1.00 71.26  ? 466  PHE A CZ   1 
ATOM   3672  H  H    . PHE A  1 274 ? 197.752 102.888 84.520  1.00 87.06  ? 466  PHE A H    1 
ATOM   3673  H  HA   . PHE A  1 274 ? 196.447 104.200 86.319  1.00 87.07  ? 466  PHE A HA   1 
ATOM   3674  H  HB2  . PHE A  1 274 ? 195.545 103.326 84.279  1.00 86.38  ? 466  PHE A HB2  1 
ATOM   3675  H  HB3  . PHE A  1 274 ? 195.467 101.911 84.993  1.00 86.38  ? 466  PHE A HB3  1 
ATOM   3676  H  HD1  . PHE A  1 274 ? 194.495 105.064 86.315  1.00 85.24  ? 466  PHE A HD1  1 
ATOM   3677  H  HD2  . PHE A  1 274 ? 193.187 101.473 85.140  1.00 80.15  ? 466  PHE A HD2  1 
ATOM   3678  H  HE1  . PHE A  1 274 ? 192.385 105.577 87.097  1.00 87.03  ? 466  PHE A HE1  1 
ATOM   3679  H  HE2  . PHE A  1 274 ? 191.078 101.983 85.920  1.00 83.54  ? 466  PHE A HE2  1 
ATOM   3680  H  HZ   . PHE A  1 274 ? 190.672 104.035 86.901  1.00 85.26  ? 466  PHE A HZ   1 
ATOM   3681  N  N    . LEU A  1 275 ? 196.182 103.036 88.434  1.00 73.16  ? 467  LEU A N    1 
ATOM   3682  C  CA   . LEU A  1 275 ? 195.934 102.342 89.700  1.00 72.26  ? 467  LEU A CA   1 
ATOM   3683  C  C    . LEU A  1 275 ? 197.202 101.666 90.229  1.00 73.03  ? 467  LEU A C    1 
ATOM   3684  O  O    . LEU A  1 275 ? 197.246 100.457 90.465  1.00 71.20  ? 467  LEU A O    1 
ATOM   3685  C  CB   . LEU A  1 275 ? 194.790 101.334 89.547  1.00 70.30  ? 467  LEU A CB   1 
ATOM   3686  C  CG   . LEU A  1 275 ? 193.460 101.925 89.063  1.00 73.40  ? 467  LEU A CG   1 
ATOM   3687  C  CD1  . LEU A  1 275 ? 192.373 100.857 89.014  1.00 68.49  ? 467  LEU A CD1  1 
ATOM   3688  C  CD2  . LEU A  1 275 ? 193.012 103.109 89.921  1.00 74.05  ? 467  LEU A CD2  1 
ATOM   3689  H  H    . LEU A  1 275 ? 196.045 103.883 88.483  1.00 87.54  ? 467  LEU A H    1 
ATOM   3690  H  HA   . LEU A  1 275 ? 195.658 102.997 90.359  1.00 86.46  ? 467  LEU A HA   1 
ATOM   3691  H  HB2  . LEU A  1 275 ? 195.059 100.657 88.906  1.00 84.12  ? 467  LEU A HB2  1 
ATOM   3692  H  HB3  . LEU A  1 275 ? 194.628 100.918 90.408  1.00 84.12  ? 467  LEU A HB3  1 
ATOM   3693  H  HG   . LEU A  1 275 ? 193.583 102.254 88.158  1.00 87.83  ? 467  LEU A HG   1 
ATOM   3694  H  HD11 . LEU A  1 275 ? 191.547 101.261 88.705  1.00 81.94  ? 467  LEU A HD11 1 
ATOM   3695  H  HD12 . LEU A  1 275 ? 192.648 100.155 88.403  1.00 81.94  ? 467  LEU A HD12 1 
ATOM   3696  H  HD13 . LEU A  1 275 ? 192.251 100.491 89.904  1.00 81.94  ? 467  LEU A HD13 1 
ATOM   3697  H  HD21 . LEU A  1 275 ? 192.170 103.447 89.577  1.00 88.61  ? 467  LEU A HD21 1 
ATOM   3698  H  HD22 . LEU A  1 275 ? 192.899 102.809 90.836  1.00 88.61  ? 467  LEU A HD22 1 
ATOM   3699  H  HD23 . LEU A  1 275 ? 193.689 103.802 89.880  1.00 88.61  ? 467  LEU A HD23 1 
ATOM   3700  N  N    . ASN A  1 276 ? 198.234 102.484 90.436  1.00 78.95  ? 468  ASN A N    1 
ATOM   3701  C  CA   . ASN A  1 276 ? 199.518 102.004 90.949  1.00 80.95  ? 468  ASN A CA   1 
ATOM   3702  C  C    . ASN A  1 276 ? 200.070 100.881 90.075  1.00 82.39  ? 468  ASN A C    1 
ATOM   3703  O  O    . ASN A  1 276 ? 200.581 99.876  90.573  1.00 82.27  ? 468  ASN A O    1 
ATOM   3704  C  CB   . ASN A  1 276 ? 199.398 101.546 92.404  1.00 77.18  ? 468  ASN A CB   1 
ATOM   3705  C  CG   . ASN A  1 276 ? 200.751 101.326 93.060  1.00 81.68  ? 468  ASN A CG   1 
ATOM   3706  O  OD1  . ASN A  1 276 ? 201.744 101.948 92.682  1.00 86.17  ? 468  ASN A OD1  1 
ATOM   3707  N  ND2  . ASN A  1 276 ? 200.795 100.436 94.045  1.00 81.10  ? 468  ASN A ND2  1 
ATOM   3708  H  H    . ASN A  1 276 ? 198.216 103.331 90.285  1.00 94.49  ? 468  ASN A H    1 
ATOM   3709  H  HA   . ASN A  1 276 ? 200.155 102.736 90.923  1.00 96.89  ? 468  ASN A HA   1 
ATOM   3710  H  HB2  . ASN A  1 276 ? 198.924 102.223 92.912  1.00 92.37  ? 468  ASN A HB2  1 
ATOM   3711  H  HB3  . ASN A  1 276 ? 198.911 100.707 92.433  1.00 92.37  ? 468  ASN A HB3  1 
ATOM   3712  H  HD21 . ASN A  1 276 ? 201.538 100.277 94.447  1.00 97.07  ? 468  ASN A HD21 1 
ATOM   3713  H  HD22 . ASN A  1 276 ? 200.080 100.020 94.281  1.00 97.07  ? 468  ASN A HD22 1 
ATOM   3714  N  N    . ALA A  1 277 ? 199.966 101.056 88.759  1.00 81.69  ? 469  ALA A N    1 
ATOM   3715  C  CA   . ALA A  1 277 ? 200.457 100.068 87.801  1.00 82.87  ? 469  ALA A CA   1 
ATOM   3716  C  C    . ALA A  1 277 ? 199.881 98.684  88.092  1.00 80.80  ? 469  ALA A C    1 
ATOM   3717  O  O    . ALA A  1 277 ? 200.584 97.672  88.058  1.00 79.13  ? 469  ALA A O    1 
ATOM   3718  C  CB   . ALA A  1 277 ? 201.985 100.026 87.797  1.00 81.30  ? 469  ALA A CB   1 
ATOM   3719  H  H    . ALA A  1 277 ? 199.611 101.748 88.391  1.00 97.79  ? 469  ALA A H    1 
ATOM   3720  H  HA   . ALA A  1 277 ? 200.168 100.326 86.912  1.00 99.19  ? 469  ALA A HA   1 
ATOM   3721  H  HB1  . ALA A  1 277 ? 202.281 99.363  87.154  1.00 97.31  ? 469  ALA A HB1  1 
ATOM   3722  H  HB2  . ALA A  1 277 ? 202.324 100.901 87.551  1.00 97.31  ? 469  ALA A HB2  1 
ATOM   3723  H  HB3  . ALA A  1 277 ? 202.296 99.789  88.685  1.00 97.31  ? 469  ALA A HB3  1 
ATOM   3724  N  N    . TYR A  1 278 ? 198.582 98.642  88.380  1.00 81.21  ? 470  TYR A N    1 
ATOM   3725  C  CA   . TYR A  1 278 ? 197.898 97.372  88.577  1.00 83.31  ? 470  TYR A CA   1 
ATOM   3726  C  C    . TYR A  1 278 ? 198.105 96.494  87.349  1.00 86.30  ? 470  TYR A C    1 
ATOM   3727  O  O    . TYR A  1 278 ? 197.931 96.939  86.210  1.00 83.22  ? 470  TYR A O    1 
ATOM   3728  C  CB   . TYR A  1 278 ? 196.408 97.600  88.834  1.00 83.02  ? 470  TYR A CB   1 
ATOM   3729  C  CG   . TYR A  1 278 ? 195.677 96.372  89.334  1.00 84.45  ? 470  TYR A CG   1 
ATOM   3730  C  CD1  . TYR A  1 278 ? 195.825 95.942  90.648  1.00 85.89  ? 470  TYR A CD1  1 
ATOM   3731  C  CD2  . TYR A  1 278 ? 194.839 95.645  88.500  1.00 85.25  ? 470  TYR A CD2  1 
ATOM   3732  C  CE1  . TYR A  1 278 ? 195.164 94.819  91.112  1.00 89.60  ? 470  TYR A CE1  1 
ATOM   3733  C  CE2  . TYR A  1 278 ? 194.174 94.521  88.957  1.00 88.67  ? 470  TYR A CE2  1 
ATOM   3734  C  CZ   . TYR A  1 278 ? 194.340 94.113  90.266  1.00 92.20  ? 470  TYR A CZ   1 
ATOM   3735  O  OH   . TYR A  1 278 ? 193.682 92.997  90.730  1.00 92.34  ? 470  TYR A OH   1 
ATOM   3736  H  H    . TYR A  1 278 ? 198.077 99.333  88.466  1.00 97.21  ? 470  TYR A H    1 
ATOM   3737  H  HA   . TYR A  1 278 ? 198.276 96.918  89.346  1.00 99.73  ? 470  TYR A HA   1 
ATOM   3738  H  HB2  . TYR A  1 278 ? 196.309 98.297  89.502  1.00 99.38  ? 470  TYR A HB2  1 
ATOM   3739  H  HB3  . TYR A  1 278 ? 195.987 97.878  88.005  1.00 99.38  ? 470  TYR A HB3  1 
ATOM   3740  H  HD1  . TYR A  1 278 ? 196.382 96.414  91.223  1.00 102.82 ? 470  TYR A HD1  1 
ATOM   3741  H  HD2  . TYR A  1 278 ? 194.726 95.915  87.617  1.00 102.05 ? 470  TYR A HD2  1 
ATOM   3742  H  HE1  . TYR A  1 278 ? 195.274 94.544  91.994  1.00 107.28 ? 470  TYR A HE1  1 
ATOM   3743  H  HE2  . TYR A  1 278 ? 193.617 94.042  88.386  1.00 106.15 ? 470  TYR A HE2  1 
ATOM   3744  H  HH   . TYR A  1 278 ? 193.216 92.662  90.116  1.00 110.56 ? 470  TYR A HH   1 
ATOM   3745  N  N    . GLN A  1 279 ? 198.473 95.239  87.589  1.00 95.98  ? 471  GLN A N    1 
ATOM   3746  C  CA   . GLN A  1 279 ? 198.860 94.335  86.513  1.00 98.67  ? 471  GLN A CA   1 
ATOM   3747  C  C    . GLN A  1 279 ? 197.646 93.963  85.668  1.00 91.00  ? 471  GLN A C    1 
ATOM   3748  O  O    . GLN A  1 279 ? 196.530 93.807  86.185  1.00 87.35  ? 471  GLN A O    1 
ATOM   3749  C  CB   . GLN A  1 279 ? 199.501 93.084  87.110  1.00 109.41 ? 471  GLN A CB   1 
ATOM   3750  C  CG   . GLN A  1 279 ? 198.538 92.197  87.895  1.00 119.21 ? 471  GLN A CG   1 
ATOM   3751  C  CD   . GLN A  1 279 ? 199.254 91.068  88.608  1.00 127.28 ? 471  GLN A CD   1 
ATOM   3752  O  OE1  . GLN A  1 279 ? 200.456 90.873  88.438  1.00 130.40 ? 471  GLN A OE1  1 
ATOM   3753  N  NE2  . GLN A  1 279 ? 198.528 90.363  89.474  1.00 127.35 ? 471  GLN A NE2  1 
ATOM   3754  H  H    . GLN A  1 279 ? 198.507 94.885  88.372  1.00 114.92 ? 471  GLN A H    1 
ATOM   3755  H  HA   . GLN A  1 279 ? 199.510 94.771  85.942  1.00 118.15 ? 471  GLN A HA   1 
ATOM   3756  H  HB2  . GLN A  1 279 ? 199.872 92.551  86.390  1.00 131.04 ? 471  GLN A HB2  1 
ATOM   3757  H  HB3  . GLN A  1 279 ? 200.209 93.356  87.714  1.00 131.04 ? 471  GLN A HB3  1 
ATOM   3758  H  HG2  . GLN A  1 279 ? 198.081 92.734  88.561  1.00 142.81 ? 471  GLN A HG2  1 
ATOM   3759  H  HG3  . GLN A  1 279 ? 197.894 91.807  87.283  1.00 142.81 ? 471  GLN A HG3  1 
ATOM   3760  H  HE21 . GLN A  1 279 ? 197.692 90.537  89.575  1.00 152.58 ? 471  GLN A HE21 1 
ATOM   3761  H  HE22 . GLN A  1 279 ? 198.889 89.715  89.909  1.00 152.58 ? 471  GLN A HE22 1 
ATOM   3762  N  N    . GLY A  1 280 ? 197.861 93.835  84.362  1.00 73.47  ? 472  GLY A N    1 
ATOM   3763  C  CA   . GLY A  1 280 ? 196.844 93.334  83.462  1.00 64.94  ? 472  GLY A CA   1 
ATOM   3764  C  C    . GLY A  1 280 ? 195.983 94.384  82.795  1.00 64.93  ? 472  GLY A C    1 
ATOM   3765  O  O    . GLY A  1 280 ? 194.897 94.039  82.315  1.00 61.96  ? 472  GLY A O    1 
ATOM   3766  H  H    . GLY A  1 280 ? 198.601 94.035  83.972  1.00 87.92  ? 472  GLY A H    1 
ATOM   3767  H  HA2  . GLY A  1 280 ? 197.273 92.815  82.764  1.00 77.68  ? 472  GLY A HA2  1 
ATOM   3768  H  HA3  . GLY A  1 280 ? 196.256 92.741  83.956  1.00 77.68  ? 472  GLY A HA3  1 
ATOM   3769  N  N    . LEU A  1 281 ? 196.424 95.639  82.736  1.00 67.90  ? 473  LEU A N    1 
ATOM   3770  C  CA   . LEU A  1 281 ? 195.638 96.652  82.042  1.00 66.35  ? 473  LEU A CA   1 
ATOM   3771  C  C    . LEU A  1 281 ? 195.465 96.257  80.580  1.00 66.08  ? 473  LEU A C    1 
ATOM   3772  O  O    . LEU A  1 281 ? 196.447 96.066  79.856  1.00 60.92  ? 473  LEU A O    1 
ATOM   3773  C  CB   . LEU A  1 281 ? 196.302 98.021  82.152  1.00 66.44  ? 473  LEU A CB   1 
ATOM   3774  C  CG   . LEU A  1 281 ? 195.461 99.194  81.619  1.00 66.06  ? 473  LEU A CG   1 
ATOM   3775  C  CD1  . LEU A  1 281 ? 194.215 99.407  82.468  1.00 59.96  ? 473  LEU A CD1  1 
ATOM   3776  C  CD2  . LEU A  1 281 ? 196.285 100.469 81.549  1.00 68.30  ? 473  LEU A CD2  1 
ATOM   3777  H  H    . LEU A  1 281 ? 197.158 95.925  83.081  1.00 81.23  ? 473  LEU A H    1 
ATOM   3778  H  HA   . LEU A  1 281 ? 194.759 96.707  82.447  1.00 79.37  ? 473  LEU A HA   1 
ATOM   3779  H  HB2  . LEU A  1 281 ? 196.491 98.197  83.087  1.00 79.48  ? 473  LEU A HB2  1 
ATOM   3780  H  HB3  . LEU A  1 281 ? 197.131 98.003  81.649  1.00 79.48  ? 473  LEU A HB3  1 
ATOM   3781  H  HG   . LEU A  1 281 ? 195.170 98.982  80.718  1.00 79.02  ? 473  LEU A HG   1 
ATOM   3782  H  HD11 . LEU A  1 281 ? 193.709 100.151 82.105  1.00 71.71  ? 473  LEU A HD11 1 
ATOM   3783  H  HD12 . LEU A  1 281 ? 193.677 98.600  82.447  1.00 71.71  ? 473  LEU A HD12 1 
ATOM   3784  H  HD13 . LEU A  1 281 ? 194.484 99.602  83.379  1.00 71.71  ? 473  LEU A HD13 1 
ATOM   3785  H  HD21 . LEU A  1 281 ? 195.728 101.187 81.210  1.00 81.71  ? 473  LEU A HD21 1 
ATOM   3786  H  HD22 . LEU A  1 281 ? 196.603 100.689 82.439  1.00 81.71  ? 473  LEU A HD22 1 
ATOM   3787  H  HD23 . LEU A  1 281 ? 197.038 100.326 80.954  1.00 81.71  ? 473  LEU A HD23 1 
ATOM   3788  N  N    . THR A  1 282 ? 194.206 96.139  80.152  1.00 64.31  ? 474  THR A N    1 
ATOM   3789  C  CA   . THR A  1 282 ? 193.874 95.704  78.802  1.00 69.12  ? 474  THR A CA   1 
ATOM   3790  C  C    . THR A  1 282 ? 192.959 96.664  78.059  1.00 71.10  ? 474  THR A C    1 
ATOM   3791  O  O    . THR A  1 282 ? 192.718 96.452  76.865  1.00 71.96  ? 474  THR A O    1 
ATOM   3792  C  CB   . THR A  1 282 ? 193.205 94.319  78.833  1.00 73.04  ? 474  THR A CB   1 
ATOM   3793  O  OG1  . THR A  1 282 ? 192.223 94.281  79.876  1.00 72.01  ? 474  THR A OG1  1 
ATOM   3794  C  CG2  . THR A  1 282 ? 194.236 93.230  79.073  1.00 74.84  ? 474  THR A CG2  1 
ATOM   3795  H  H    . THR A  1 282 ? 193.516 96.309  80.638  1.00 76.93  ? 474  THR A H    1 
ATOM   3796  H  HA   . THR A  1 282 ? 194.695 95.625  78.292  1.00 82.70  ? 474  THR A HA   1 
ATOM   3797  H  HB   . THR A  1 282 ? 192.775 94.151  77.980  1.00 87.39  ? 474  THR A HB   1 
ATOM   3798  H  HG1  . THR A  1 282 ? 191.636 94.867  79.740  1.00 86.16  ? 474  THR A HG1  1 
ATOM   3799  H  HG21 . THR A  1 282 ? 193.803 92.362  79.090  1.00 89.56  ? 474  THR A HG21 1 
ATOM   3800  H  HG22 . THR A  1 282 ? 194.898 93.239  78.364  1.00 89.56  ? 474  THR A HG22 1 
ATOM   3801  H  HG23 . THR A  1 282 ? 194.681 93.377  79.922  1.00 89.56  ? 474  THR A HG23 1 
ATOM   3802  N  N    . ALA A  1 283 ? 192.441 97.699  78.716  1.00 73.54  ? 475  ALA A N    1 
ATOM   3803  C  CA   . ALA A  1 283 ? 191.538 98.641  78.075  1.00 69.48  ? 475  ALA A CA   1 
ATOM   3804  C  C    . ALA A  1 283 ? 191.472 99.906  78.915  1.00 66.98  ? 475  ALA A C    1 
ATOM   3805  O  O    . ALA A  1 283 ? 191.545 99.851  80.146  1.00 67.50  ? 475  ALA A O    1 
ATOM   3806  C  CB   . ALA A  1 283 ? 190.139 98.043  77.902  1.00 68.36  ? 475  ALA A CB   1 
ATOM   3807  H  H    . ALA A  1 283 ? 192.601 97.876  79.542  1.00 88.00  ? 475  ALA A H    1 
ATOM   3808  H  HA   . ALA A  1 283 ? 191.883 98.873  77.199  1.00 83.12  ? 475  ALA A HA   1 
ATOM   3809  H  HB1  . ALA A  1 283 ? 189.567 98.698  77.473  1.00 81.78  ? 475  ALA A HB1  1 
ATOM   3810  H  HB2  . ALA A  1 283 ? 190.203 97.247  77.351  1.00 81.78  ? 475  ALA A HB2  1 
ATOM   3811  H  HB3  . ALA A  1 283 ? 189.784 97.814  78.775  1.00 81.78  ? 475  ALA A HB3  1 
ATOM   3812  N  N    . VAL A  1 284 ? 191.340 101.044 78.235  1.00 61.53  ? 476  VAL A N    1 
ATOM   3813  C  CA   . VAL A  1 284 ? 191.194 102.334 78.897  1.00 62.26  ? 476  VAL A CA   1 
ATOM   3814  C  C    . VAL A  1 284 ? 190.204 103.188 78.120  1.00 61.29  ? 476  VAL A C    1 
ATOM   3815  O  O    . VAL A  1 284 ? 190.107 103.106 76.892  1.00 58.06  ? 476  VAL A O    1 
ATOM   3816  C  CB   . VAL A  1 284 ? 192.539 103.084 79.026  1.00 64.99  ? 476  VAL A CB   1 
ATOM   3817  C  CG1  . VAL A  1 284 ? 192.350 104.393 79.787  1.00 66.33  ? 476  VAL A CG1  1 
ATOM   3818  C  CG2  . VAL A  1 284 ? 193.584 102.217 79.706  1.00 66.05  ? 476  VAL A CG2  1 
ATOM   3819  H  H    . VAL A  1 284 ? 191.332 101.094 77.377  1.00 73.58  ? 476  VAL A H    1 
ATOM   3820  H  HA   . VAL A  1 284 ? 190.840 102.195 79.789  1.00 74.46  ? 476  VAL A HA   1 
ATOM   3821  H  HB   . VAL A  1 284 ? 192.865 103.301 78.138  1.00 77.74  ? 476  VAL A HB   1 
ATOM   3822  H  HG11 . VAL A  1 284 ? 193.205 104.845 79.856  1.00 79.34  ? 476  VAL A HG11 1 
ATOM   3823  H  HG12 . VAL A  1 284 ? 191.718 104.950 79.305  1.00 79.34  ? 476  VAL A HG12 1 
ATOM   3824  H  HG13 . VAL A  1 284 ? 192.008 104.195 80.673  1.00 79.34  ? 476  VAL A HG13 1 
ATOM   3825  H  HG21 . VAL A  1 284 ? 194.413 102.715 79.772  1.00 79.02  ? 476  VAL A HG21 1 
ATOM   3826  H  HG22 . VAL A  1 284 ? 193.268 101.980 80.593  1.00 79.02  ? 476  VAL A HG22 1 
ATOM   3827  H  HG23 . VAL A  1 284 ? 193.720 101.415 79.178  1.00 79.02  ? 476  VAL A HG23 1 
ATOM   3828  N  N    . ASP A  1 285 ? 189.463 104.015 78.853  1.00 67.93  ? 477  ASP A N    1 
ATOM   3829  C  CA   . ASP A  1 285 ? 188.769 105.148 78.264  1.00 70.67  ? 477  ASP A CA   1 
ATOM   3830  C  C    . ASP A  1 285 ? 188.764 106.302 79.254  1.00 67.46  ? 477  ASP A C    1 
ATOM   3831  O  O    . ASP A  1 285 ? 188.858 106.104 80.468  1.00 65.62  ? 477  ASP A O    1 
ATOM   3832  C  CB   . ASP A  1 285 ? 187.324 104.819 77.865  1.00 71.69  ? 477  ASP A CB   1 
ATOM   3833  C  CG   . ASP A  1 285 ? 186.750 105.828 76.884  1.00 75.90  ? 477  ASP A CG   1 
ATOM   3834  O  OD1  . ASP A  1 285 ? 187.543 106.526 76.215  1.00 76.91  ? 477  ASP A OD1  1 
ATOM   3835  O  OD2  . ASP A  1 285 ? 185.509 105.932 76.789  1.00 73.49  ? 477  ASP A OD2  1 
ATOM   3836  H  H    . ASP A  1 285 ? 189.347 103.937 79.702  1.00 81.27  ? 477  ASP A H    1 
ATOM   3837  H  HA   . ASP A  1 285 ? 189.245 105.434 77.468  1.00 84.56  ? 477  ASP A HA   1 
ATOM   3838  H  HB2  . ASP A  1 285 ? 187.302 103.945 77.446  1.00 85.79  ? 477  ASP A HB2  1 
ATOM   3839  H  HB3  . ASP A  1 285 ? 186.767 104.822 78.660  1.00 85.79  ? 477  ASP A HB3  1 
ATOM   3840  N  N    . VAL A  1 286 ? 188.671 107.511 78.712  1.00 67.71  ? 478  VAL A N    1 
ATOM   3841  C  CA   . VAL A  1 286 ? 188.555 108.730 79.497  1.00 71.19  ? 478  VAL A CA   1 
ATOM   3842  C  C    . VAL A  1 286 ? 187.362 109.509 78.966  1.00 71.09  ? 478  VAL A C    1 
ATOM   3843  O  O    . VAL A  1 286 ? 187.190 109.638 77.749  1.00 71.38  ? 478  VAL A O    1 
ATOM   3844  C  CB   . VAL A  1 286 ? 189.841 109.581 79.423  1.00 74.74  ? 478  VAL A CB   1 
ATOM   3845  C  CG1  . VAL A  1 286 ? 189.728 110.808 80.320  1.00 74.89  ? 478  VAL A CG1  1 
ATOM   3846  C  CG2  . VAL A  1 286 ? 191.059 108.745 79.799  1.00 72.76  ? 478  VAL A CG2  1 
ATOM   3847  H  H    . VAL A  1 286 ? 188.672 107.653 77.864  1.00 81.00  ? 478  VAL A H    1 
ATOM   3848  H  HA   . VAL A  1 286 ? 188.387 108.504 80.426  1.00 85.18  ? 478  VAL A HA   1 
ATOM   3849  H  HB   . VAL A  1 286 ? 189.961 109.889 78.511  1.00 89.43  ? 478  VAL A HB   1 
ATOM   3850  H  HG11 . VAL A  1 286 ? 190.548 111.323 80.254  1.00 89.62  ? 478  VAL A HG11 1 
ATOM   3851  H  HG12 . VAL A  1 286 ? 188.975 111.345 80.027  1.00 89.62  ? 478  VAL A HG12 1 
ATOM   3852  H  HG13 . VAL A  1 286 ? 189.592 110.518 81.235  1.00 89.62  ? 478  VAL A HG13 1 
ATOM   3853  H  HG21 . VAL A  1 286 ? 191.852 109.302 79.745  1.00 87.06  ? 478  VAL A HG21 1 
ATOM   3854  H  HG22 . VAL A  1 286 ? 190.948 108.415 80.705  1.00 87.06  ? 478  VAL A HG22 1 
ATOM   3855  H  HG23 . VAL A  1 286 ? 191.134 108.001 79.182  1.00 87.06  ? 478  VAL A HG23 1 
ATOM   3856  N  N    . THR A  1 287 ? 186.540 110.031 79.872  1.00 66.23  ? 479  THR A N    1 
ATOM   3857  C  CA   . THR A  1 287 ? 185.406 110.831 79.442  1.00 63.06  ? 479  THR A CA   1 
ATOM   3858  C  C    . THR A  1 287 ? 185.891 112.092 78.733  1.00 62.27  ? 479  THR A C    1 
ATOM   3859  O  O    . THR A  1 287 ? 187.010 112.567 78.942  1.00 62.58  ? 479  THR A O    1 
ATOM   3860  C  CB   . THR A  1 287 ? 184.520 111.203 80.631  1.00 70.93  ? 479  THR A CB   1 
ATOM   3861  O  OG1  . THR A  1 287 ? 185.309 111.837 81.645  1.00 74.21  ? 479  THR A OG1  1 
ATOM   3862  C  CG2  . THR A  1 287 ? 183.844 109.966 81.204  1.00 70.13  ? 479  THR A CG2  1 
ATOM   3863  H  H    . THR A  1 287 ? 186.617 109.939 80.723  1.00 79.23  ? 479  THR A H    1 
ATOM   3864  H  HA   . THR A  1 287 ? 184.873 110.317 78.815  1.00 75.42  ? 479  THR A HA   1 
ATOM   3865  H  HB   . THR A  1 287 ? 183.829 111.816 80.334  1.00 84.86  ? 479  THR A HB   1 
ATOM   3866  H  HG1  . THR A  1 287 ? 184.825 112.043 82.300  1.00 88.80  ? 479  THR A HG1  1 
ATOM   3867  H  HG21 . THR A  1 287 ? 183.284 110.214 81.957  1.00 83.91  ? 479  THR A HG21 1 
ATOM   3868  H  HG22 . THR A  1 287 ? 183.292 109.546 80.526  1.00 83.91  ? 479  THR A HG22 1 
ATOM   3869  H  HG23 . THR A  1 287 ? 184.513 109.332 81.504  1.00 83.91  ? 479  THR A HG23 1 
ATOM   3870  N  N    . ASP A  1 288 ? 185.025 112.630 77.873  1.00 70.37  ? 480  ASP A N    1 
ATOM   3871  C  CA   . ASP A  1 288 ? 185.381 113.815 77.100  1.00 73.62  ? 480  ASP A CA   1 
ATOM   3872  C  C    . ASP A  1 288 ? 185.785 114.969 78.010  1.00 77.37  ? 480  ASP A C    1 
ATOM   3873  O  O    . ASP A  1 288 ? 186.700 115.734 77.684  1.00 83.28  ? 480  ASP A O    1 
ATOM   3874  C  CB   . ASP A  1 288 ? 184.211 114.218 76.204  1.00 81.28  ? 480  ASP A CB   1 
ATOM   3875  C  CG   . ASP A  1 288 ? 184.612 115.206 75.129  1.00 88.90  ? 480  ASP A CG   1 
ATOM   3876  O  OD1  . ASP A  1 288 ? 185.316 114.798 74.179  1.00 89.76  ? 480  ASP A OD1  1 
ATOM   3877  O  OD2  . ASP A  1 288 ? 184.223 116.390 75.232  1.00 91.79  ? 480  ASP A OD2  1 
ATOM   3878  H  H    . ASP A  1 288 ? 184.233 112.330 77.722  1.00 84.19  ? 480  ASP A H    1 
ATOM   3879  H  HA   . ASP A  1 288 ? 186.136 113.604 76.530  1.00 88.10  ? 480  ASP A HA   1 
ATOM   3880  H  HB2  . ASP A  1 288 ? 183.859 113.426 75.767  1.00 97.29  ? 480  ASP A HB2  1 
ATOM   3881  H  HB3  . ASP A  1 288 ? 183.522 114.630 76.748  1.00 97.29  ? 480  ASP A HB3  1 
ATOM   3882  N  N    . ASP A  1 289 ? 185.118 115.113 79.153  1.00 73.76  ? 481  ASP A N    1 
ATOM   3883  C  CA   . ASP A  1 289 ? 185.417 116.182 80.097  1.00 73.76  ? 481  ASP A CA   1 
ATOM   3884  C  C    . ASP A  1 289 ? 186.481 115.787 81.117  1.00 73.77  ? 481  ASP A C    1 
ATOM   3885  O  O    . ASP A  1 289 ? 186.693 116.519 82.089  1.00 75.71  ? 481  ASP A O    1 
ATOM   3886  C  CB   . ASP A  1 289 ? 184.135 116.624 80.816  1.00 76.37  ? 481  ASP A CB   1 
ATOM   3887  C  CG   . ASP A  1 289 ? 183.627 115.590 81.805  1.00 79.89  ? 481  ASP A CG   1 
ATOM   3888  O  OD1  . ASP A  1 289 ? 184.002 114.405 81.681  1.00 82.10  ? 481  ASP A OD1  1 
ATOM   3889  O  OD2  . ASP A  1 289 ? 182.847 115.966 82.707  1.00 80.99  ? 481  ASP A OD2  1 
ATOM   3890  H  H    . ASP A  1 289 ? 184.480 114.596 79.407  1.00 88.26  ? 481  ASP A H    1 
ATOM   3891  H  HA   . ASP A  1 289 ? 185.754 116.945 79.602  1.00 88.26  ? 481  ASP A HA   1 
ATOM   3892  H  HB2  . ASP A  1 289 ? 184.313 117.443 81.303  1.00 91.39  ? 481  ASP A HB2  1 
ATOM   3893  H  HB3  . ASP A  1 289 ? 183.440 116.775 80.156  1.00 91.39  ? 481  ASP A HB3  1 
ATOM   3894  N  N    . SER A  1 290 ? 187.149 114.650 80.917  1.00 76.80  ? 482  SER A N    1 
ATOM   3895  C  CA   . SER A  1 290 ? 188.289 114.241 81.740  1.00 77.55  ? 482  SER A CA   1 
ATOM   3896  C  C    . SER A  1 290 ? 187.912 114.103 83.211  1.00 77.29  ? 482  SER A C    1 
ATOM   3897  O  O    . SER A  1 290 ? 188.752 114.293 84.094  1.00 80.74  ? 482  SER A O    1 
ATOM   3898  C  CB   . SER A  1 290 ? 189.454 115.225 81.600  1.00 78.84  ? 482  SER A CB   1 
ATOM   3899  O  OG   . SER A  1 290 ? 189.601 115.667 80.266  1.00 81.72  ? 482  SER A OG   1 
ATOM   3900  H  H    . SER A  1 290 ? 186.957 114.087 80.296  1.00 91.91  ? 482  SER A H    1 
ATOM   3901  H  HA   . SER A  1 290 ? 188.597 113.374 81.432  1.00 92.81  ? 482  SER A HA   1 
ATOM   3902  H  HB2  . SER A  1 290 ? 189.286 115.993 82.168  1.00 94.35  ? 482  SER A HB2  1 
ATOM   3903  H  HB3  . SER A  1 290 ? 190.272 114.783 81.876  1.00 94.35  ? 482  SER A HB3  1 
ATOM   3904  H  HG   . SER A  1 290 ? 189.749 115.012 79.761  1.00 97.81  ? 482  SER A HG   1 
ATOM   3905  N  N    . SER A  1 291 ? 186.659 113.754 83.497  1.00 73.81  ? 483  SER A N    1 
ATOM   3906  C  CA   . SER A  1 291 ? 186.214 113.628 84.879  1.00 74.59  ? 483  SER A CA   1 
ATOM   3907  C  C    . SER A  1 291 ? 186.293 112.202 85.407  1.00 74.15  ? 483  SER A C    1 
ATOM   3908  O  O    . SER A  1 291 ? 186.319 112.013 86.629  1.00 73.51  ? 483  SER A O    1 
ATOM   3909  C  CB   . SER A  1 291 ? 184.776 114.136 85.019  1.00 76.22  ? 483  SER A CB   1 
ATOM   3910  O  OG   . SER A  1 291 ? 183.889 113.389 84.205  1.00 78.99  ? 483  SER A OG   1 
ATOM   3911  H  H    . SER A  1 291 ? 186.051 113.586 82.912  1.00 88.33  ? 483  SER A H    1 
ATOM   3912  H  HA   . SER A  1 291 ? 186.780 114.182 85.439  1.00 89.26  ? 483  SER A HA   1 
ATOM   3913  H  HB2  . SER A  1 291 ? 184.501 114.051 85.945  1.00 91.22  ? 483  SER A HB2  1 
ATOM   3914  H  HB3  . SER A  1 291 ? 184.744 115.067 84.748  1.00 91.22  ? 483  SER A HB3  1 
ATOM   3915  H  HG   . SER A  1 291 ? 184.115 113.454 83.398  1.00 94.54  ? 483  SER A HG   1 
ATOM   3916  N  N    . LEU A  1 292 ? 186.346 111.201 84.530  1.00 68.64  ? 484  LEU A N    1 
ATOM   3917  C  CA   . LEU A  1 292 ? 186.455 109.814 84.954  1.00 70.46  ? 484  LEU A CA   1 
ATOM   3918  C  C    . LEU A  1 292 ? 187.394 109.065 84.026  1.00 67.54  ? 484  LEU A C    1 
ATOM   3919  O  O    . LEU A  1 292 ? 187.436 109.317 82.819  1.00 68.89  ? 484  LEU A O    1 
ATOM   3920  C  CB   . LEU A  1 292 ? 185.104 109.088 84.955  1.00 72.73  ? 484  LEU A CB   1 
ATOM   3921  C  CG   . LEU A  1 292 ? 183.911 109.701 85.682  1.00 71.30  ? 484  LEU A CG   1 
ATOM   3922  C  CD1  . LEU A  1 292 ? 182.643 109.023 85.196  1.00 72.25  ? 484  LEU A CD1  1 
ATOM   3923  C  CD2  . LEU A  1 292 ? 184.056 109.546 87.184  1.00 73.30  ? 484  LEU A CD2  1 
ATOM   3924  H  H    . LEU A  1 292 ? 186.319 111.304 83.677  1.00 82.12  ? 484  LEU A H    1 
ATOM   3925  H  HA   . LEU A  1 292 ? 186.821 109.781 85.852  1.00 84.30  ? 484  LEU A HA   1 
ATOM   3926  H  HB2  . LEU A  1 292 ? 184.834 108.975 84.030  1.00 87.03  ? 484  LEU A HB2  1 
ATOM   3927  H  HB3  . LEU A  1 292 ? 185.245 108.212 85.347  1.00 87.03  ? 484  LEU A HB3  1 
ATOM   3928  H  HG   . LEU A  1 292 ? 183.855 110.647 85.473  1.00 85.31  ? 484  LEU A HG   1 
ATOM   3929  H  HD11 . LEU A  1 292 ? 181.882 109.410 85.657  1.00 86.45  ? 484  LEU A HD11 1 
ATOM   3930  H  HD12 . LEU A  1 292 ? 182.557 109.162 84.240  1.00 86.45  ? 484  LEU A HD12 1 
ATOM   3931  H  HD13 . LEU A  1 292 ? 182.699 108.074 85.390  1.00 86.45  ? 484  LEU A HD13 1 
ATOM   3932  H  HD21 . LEU A  1 292 ? 183.286 109.944 87.618  1.00 87.71  ? 484  LEU A HD21 1 
ATOM   3933  H  HD22 . LEU A  1 292 ? 184.108 108.602 87.400  1.00 87.71  ? 484  LEU A HD22 1 
ATOM   3934  H  HD23 . LEU A  1 292 ? 184.867 109.996 87.471  1.00 87.71  ? 484  LEU A HD23 1 
ATOM   3935  N  N    . ILE A  1 293 ? 188.135 108.126 84.604  1.00 66.21  ? 485  ILE A N    1 
ATOM   3936  C  CA   . ILE A  1 293 ? 188.932 107.171 83.849  1.00 65.87  ? 485  ILE A CA   1 
ATOM   3937  C  C    . ILE A  1 293 ? 188.440 105.774 84.185  1.00 67.73  ? 485  ILE A C    1 
ATOM   3938  O  O    . ILE A  1 293 ? 188.209 105.451 85.355  1.00 71.72  ? 485  ILE A O    1 
ATOM   3939  C  CB   . ILE A  1 293 ? 190.438 107.310 84.152  1.00 67.78  ? 485  ILE A CB   1 
ATOM   3940  C  CG1  . ILE A  1 293 ? 190.880 108.755 83.895  1.00 68.32  ? 485  ILE A CG1  1 
ATOM   3941  C  CG2  . ILE A  1 293 ? 191.235 106.302 83.323  1.00 69.03  ? 485  ILE A CG2  1 
ATOM   3942  C  CD1  . ILE A  1 293 ? 192.377 108.980 83.941  1.00 72.23  ? 485  ILE A CD1  1 
ATOM   3943  H  H    . ILE A  1 293 ? 188.192 108.021 85.456  1.00 79.21  ? 485  ILE A H    1 
ATOM   3944  H  HA   . ILE A  1 293 ? 188.798 107.322 82.900  1.00 78.80  ? 485  ILE A HA   1 
ATOM   3945  H  HB   . ILE A  1 293 ? 190.579 107.111 85.091  1.00 81.08  ? 485  ILE A HB   1 
ATOM   3946  H  HG12 . ILE A  1 293 ? 190.571 109.021 83.015  1.00 81.74  ? 485  ILE A HG12 1 
ATOM   3947  H  HG13 . ILE A  1 293 ? 190.477 109.326 84.569  1.00 81.74  ? 485  ILE A HG13 1 
ATOM   3948  H  HG21 . ILE A  1 293 ? 192.178 106.403 83.526  1.00 82.59  ? 485  ILE A HG21 1 
ATOM   3949  H  HG22 . ILE A  1 293 ? 190.942 105.406 83.550  1.00 82.59  ? 485  ILE A HG22 1 
ATOM   3950  H  HG23 . ILE A  1 293 ? 191.078 106.474 82.382  1.00 82.59  ? 485  ILE A HG23 1 
ATOM   3951  H  HD11 . ILE A  1 293 ? 192.561 109.916 83.769  1.00 86.43  ? 485  ILE A HD11 1 
ATOM   3952  H  HD12 . ILE A  1 293 ? 192.706 108.734 84.820  1.00 86.43  ? 485  ILE A HD12 1 
ATOM   3953  H  HD13 . ILE A  1 293 ? 192.800 108.429 83.264  1.00 86.43  ? 485  ILE A HD13 1 
ATOM   3954  N  N    . ALA A  1 294 ? 188.284 104.948 83.155  1.00 67.69  ? 486  ALA A N    1 
ATOM   3955  C  CA   . ALA A  1 294 ? 187.898 103.557 83.314  1.00 65.61  ? 486  ALA A CA   1 
ATOM   3956  C  C    . ALA A  1 294 ? 189.012 102.663 82.795  1.00 65.89  ? 486  ALA A C    1 
ATOM   3957  O  O    . ALA A  1 294 ? 189.595 102.928 81.738  1.00 63.15  ? 486  ALA A O    1 
ATOM   3958  C  CB   . ALA A  1 294 ? 186.599 103.247 82.571  1.00 67.44  ? 486  ALA A CB   1 
ATOM   3959  H  H    . ALA A  1 294 ? 188.400 105.180 82.335  1.00 80.98  ? 486  ALA A H    1 
ATOM   3960  H  HA   . ALA A  1 294 ? 187.766 103.365 84.256  1.00 78.48  ? 486  ALA A HA   1 
ATOM   3961  H  HB1  . ALA A  1 294 ? 186.376 102.312 82.702  1.00 80.68  ? 486  ALA A HB1  1 
ATOM   3962  H  HB2  . ALA A  1 294 ? 185.892 103.809 82.926  1.00 80.68  ? 486  ALA A HB2  1 
ATOM   3963  H  HB3  . ALA A  1 294 ? 186.725 103.429 81.627  1.00 80.68  ? 486  ALA A HB3  1 
ATOM   3964  N  N    . GLY A  1 295 ? 189.310 101.612 83.549  1.00 69.13  ? 487  GLY A N    1 
ATOM   3965  C  CA   . GLY A  1 295 ? 190.288 100.633 83.131  1.00 68.51  ? 487  GLY A CA   1 
ATOM   3966  C  C    . GLY A  1 295 ? 189.719 99.231  83.138  1.00 73.00  ? 487  GLY A C    1 
ATOM   3967  O  O    . GLY A  1 295 ? 189.094 98.812  84.117  1.00 77.13  ? 487  GLY A O    1 
ATOM   3968  H  H    . GLY A  1 295 ? 188.953 101.446 84.314  1.00 82.71  ? 487  GLY A H    1 
ATOM   3969  H  HA2  . GLY A  1 295 ? 190.591 100.839 82.232  1.00 81.96  ? 487  GLY A HA2  1 
ATOM   3970  H  HA3  . GLY A  1 295 ? 191.051 100.660 83.728  1.00 81.96  ? 487  GLY A HA3  1 
ATOM   3971  N  N    . GLY A  1 296 ? 189.909 98.508  82.041  1.00 68.87  ? 488  GLY A N    1 
ATOM   3972  C  CA   . GLY A  1 296 ? 189.591 97.096  81.978  1.00 67.25  ? 488  GLY A CA   1 
ATOM   3973  C  C    . GLY A  1 296 ? 190.854 96.284  82.187  1.00 69.23  ? 488  GLY A C    1 
ATOM   3974  O  O    . GLY A  1 296 ? 191.941 96.696  81.789  1.00 72.19  ? 488  GLY A O    1 
ATOM   3975  H  H    . GLY A  1 296 ? 190.228 98.822  81.307  1.00 82.40  ? 488  GLY A H    1 
ATOM   3976  H  HA2  . GLY A  1 296 ? 188.949 96.868  82.669  1.00 80.46  ? 488  GLY A HA2  1 
ATOM   3977  H  HA3  . GLY A  1 296 ? 189.213 96.878  81.111  1.00 80.46  ? 488  GLY A HA3  1 
ATOM   3978  N  N    . PHE A  1 297 ? 190.707 95.121  82.819  1.00 68.36  ? 489  PHE A N    1 
ATOM   3979  C  CA   . PHE A  1 297 ? 191.862 94.350  83.252  1.00 71.68  ? 489  PHE A CA   1 
ATOM   3980  C  C    . PHE A  1 297 ? 191.704 92.879  82.895  1.00 70.52  ? 489  PHE A C    1 
ATOM   3981  O  O    . PHE A  1 297 ? 190.599 92.383  82.662  1.00 69.52  ? 489  PHE A O    1 
ATOM   3982  C  CB   . PHE A  1 297 ? 192.082 94.511  84.759  1.00 65.09  ? 489  PHE A CB   1 
ATOM   3983  C  CG   . PHE A  1 297 ? 192.455 95.906  85.160  1.00 66.07  ? 489  PHE A CG   1 
ATOM   3984  C  CD1  . PHE A  1 297 ? 191.477 96.838  85.460  1.00 65.38  ? 489  PHE A CD1  1 
ATOM   3985  C  CD2  . PHE A  1 297 ? 193.782 96.294  85.217  1.00 72.29  ? 489  PHE A CD2  1 
ATOM   3986  C  CE1  . PHE A  1 297 ? 191.816 98.127  85.822  1.00 66.45  ? 489  PHE A CE1  1 
ATOM   3987  C  CE2  . PHE A  1 297 ? 194.128 97.581  85.580  1.00 70.31  ? 489  PHE A CE2  1 
ATOM   3988  C  CZ   . PHE A  1 297 ? 193.143 98.499  85.882  1.00 66.95  ? 489  PHE A CZ   1 
ATOM   3989  H  H    . PHE A  1 297 ? 189.950 94.759  83.007  1.00 81.79  ? 489  PHE A H    1 
ATOM   3990  H  HA   . PHE A  1 297 ? 192.651 94.684  82.798  1.00 85.77  ? 489  PHE A HA   1 
ATOM   3991  H  HB2  . PHE A  1 297 ? 191.263 94.276  85.223  1.00 77.87  ? 489  PHE A HB2  1 
ATOM   3992  H  HB3  . PHE A  1 297 ? 192.799 93.919  85.037  1.00 77.87  ? 489  PHE A HB3  1 
ATOM   3993  H  HD1  . PHE A  1 297 ? 190.580 96.592  85.422  1.00 78.21  ? 489  PHE A HD1  1 
ATOM   3994  H  HD2  . PHE A  1 297 ? 194.450 95.678  85.015  1.00 86.50  ? 489  PHE A HD2  1 
ATOM   3995  H  HE1  . PHE A  1 297 ? 191.150 98.743  86.026  1.00 79.49  ? 489  PHE A HE1  1 
ATOM   3996  H  HE2  . PHE A  1 297 ? 195.023 97.829  85.619  1.00 84.12  ? 489  PHE A HE2  1 
ATOM   3997  H  HZ   . PHE A  1 297 ? 193.373 99.366  86.126  1.00 80.09  ? 489  PHE A HZ   1 
ATOM   3998  N  N    . ALA A  1 298 ? 192.848 92.188  82.859  1.00 72.78  ? 490  ALA A N    1 
ATOM   3999  C  CA   . ALA A  1 298 ? 192.876 90.763  82.553  1.00 70.51  ? 490  ALA A CA   1 
ATOM   4000  C  C    . ALA A  1 298 ? 192.225 89.925  83.643  1.00 69.70  ? 490  ALA A C    1 
ATOM   4001  O  O    . ALA A  1 298 ? 191.825 88.788  83.374  1.00 67.96  ? 490  ALA A O    1 
ATOM   4002  C  CB   . ALA A  1 298 ? 194.316 90.301  82.332  1.00 71.79  ? 490  ALA A CB   1 
ATOM   4003  H  H    . ALA A  1 298 ? 193.623 92.527  83.009  1.00 87.08  ? 490  ALA A H    1 
ATOM   4004  H  HA   . ALA A  1 298 ? 192.386 90.611  81.730  1.00 84.36  ? 490  ALA A HA   1 
ATOM   4005  H  HB1  . ALA A  1 298 ? 194.315 89.352  82.130  1.00 85.89  ? 490  ALA A HB1  1 
ATOM   4006  H  HB2  . ALA A  1 298 ? 194.696 90.797  81.590  1.00 85.89  ? 490  ALA A HB2  1 
ATOM   4007  H  HB3  . ALA A  1 298 ? 194.827 90.467  83.139  1.00 85.89  ? 490  ALA A HB3  1 
ATOM   4008  N  N    . ASP A  1 299 ? 192.126 90.448  84.863  1.00 65.47  ? 491  ASP A N    1 
ATOM   4009  C  CA   . ASP A  1 299 ? 191.372 89.767  85.907  1.00 66.81  ? 491  ASP A CA   1 
ATOM   4010  C  C    . ASP A  1 299 ? 189.866 89.917  85.729  1.00 69.02  ? 491  ASP A C    1 
ATOM   4011  O  O    . ASP A  1 299 ? 189.106 89.423  86.571  1.00 68.01  ? 491  ASP A O    1 
ATOM   4012  C  CB   . ASP A  1 299 ? 191.793 90.279  87.289  1.00 69.14  ? 491  ASP A CB   1 
ATOM   4013  C  CG   . ASP A  1 299 ? 191.304 91.690  87.575  1.00 72.44  ? 491  ASP A CG   1 
ATOM   4014  O  OD1  . ASP A  1 299 ? 190.736 92.337  86.672  1.00 73.47  ? 491  ASP A OD1  1 
ATOM   4015  O  OD2  . ASP A  1 299 ? 191.490 92.155  88.721  1.00 73.97  ? 491  ASP A OD2  1 
ATOM   4016  H  H    . ASP A  1 299 ? 192.484 91.190  85.109  1.00 78.31  ? 491  ASP A H    1 
ATOM   4017  H  HA   . ASP A  1 299 ? 191.578 88.820  85.870  1.00 79.92  ? 491  ASP A HA   1 
ATOM   4018  H  HB2  . ASP A  1 299 ? 191.426 89.691  87.968  1.00 82.72  ? 491  ASP A HB2  1 
ATOM   4019  H  HB3  . ASP A  1 299 ? 192.762 90.282  87.342  1.00 82.72  ? 491  ASP A HB3  1 
ATOM   4020  N  N    . SER A  1 300 ? 189.423 90.603  84.676  1.00 69.44  ? 492  SER A N    1 
ATOM   4021  C  CA   . SER A  1 300 ? 188.039 90.696  84.237  1.00 68.19  ? 492  SER A CA   1 
ATOM   4022  C  C    . SER A  1 300 ? 187.285 91.808  84.962  1.00 62.85  ? 492  SER A C    1 
ATOM   4023  O  O    . SER A  1 300 ? 186.075 91.943  84.745  1.00 58.98  ? 492  SER A O    1 
ATOM   4024  C  CB   . SER A  1 300 ? 187.270 89.375  84.416  1.00 71.61  ? 492  SER A CB   1 
ATOM   4025  O  OG   . SER A  1 300 ? 186.712 89.296  85.713  1.00 77.71  ? 492  SER A OG   1 
ATOM   4026  H  H    . SER A  1 300 ? 189.951 91.053  84.168  1.00 83.08  ? 492  SER A H    1 
ATOM   4027  H  HA   . SER A  1 300 ? 188.032 90.910  83.291  1.00 81.58  ? 492  SER A HA   1 
ATOM   4028  H  HB2  . SER A  1 300 ? 186.556 89.333  83.761  1.00 85.68  ? 492  SER A HB2  1 
ATOM   4029  H  HB3  . SER A  1 300 ? 187.881 88.632  84.290  1.00 85.68  ? 492  SER A HB3  1 
ATOM   4030  H  HG   . SER A  1 300 ? 187.321 89.333  86.290  1.00 93.01  ? 492  SER A HG   1 
ATOM   4031  N  N    . THR A  1 301 ? 187.941 92.611  85.797  1.00 61.74  ? 493  THR A N    1 
ATOM   4032  C  CA   . THR A  1 301 ? 187.272 93.708  86.478  1.00 64.61  ? 493  THR A CA   1 
ATOM   4033  C  C    . THR A  1 301 ? 187.326 94.975  85.631  1.00 64.94  ? 493  THR A C    1 
ATOM   4034  O  O    . THR A  1 301 ? 188.175 95.131  84.750  1.00 67.44  ? 493  THR A O    1 
ATOM   4035  C  CB   . THR A  1 301 ? 187.913 93.977  87.843  1.00 66.48  ? 493  THR A CB   1 
ATOM   4036  O  OG1  . THR A  1 301 ? 189.281 94.357  87.666  1.00 60.87  ? 493  THR A OG1  1 
ATOM   4037  C  CG2  . THR A  1 301 ? 187.835 92.744  88.735  1.00 67.59  ? 493  THR A CG2  1 
ATOM   4038  H  H    . THR A  1 301 ? 188.777 92.539  85.984  1.00 73.83  ? 493  THR A H    1 
ATOM   4039  H  HA   . THR A  1 301 ? 186.341 93.477  86.620  1.00 77.28  ? 493  THR A HA   1 
ATOM   4040  H  HB   . THR A  1 301 ? 187.437 94.699  88.283  1.00 79.52  ? 493  THR A HB   1 
ATOM   4041  H  HG1  . THR A  1 301 ? 189.703 93.740  87.281  1.00 72.80  ? 493  THR A HG1  1 
ATOM   4042  H  HG21 . THR A  1 301 ? 188.244 92.930  89.594  1.00 80.86  ? 493  THR A HG21 1 
ATOM   4043  H  HG22 . THR A  1 301 ? 186.908 92.495  88.874  1.00 80.86  ? 493  THR A HG22 1 
ATOM   4044  H  HG23 . THR A  1 301 ? 188.301 92.003  88.317  1.00 80.86  ? 493  THR A HG23 1 
ATOM   4045  N  N    . VAL A  1 302 ? 186.409 95.890  85.926  1.00 65.28  ? 494  VAL A N    1 
ATOM   4046  C  CA   . VAL A  1 302 ? 186.400 97.228  85.348  1.00 66.73  ? 494  VAL A CA   1 
ATOM   4047  C  C    . VAL A  1 302 ? 186.436 98.216  86.503  1.00 66.64  ? 494  VAL A C    1 
ATOM   4048  O  O    . VAL A  1 302 ? 185.642 98.106  87.444  1.00 70.70  ? 494  VAL A O    1 
ATOM   4049  C  CB   . VAL A  1 302 ? 185.160 97.464  84.465  1.00 66.27  ? 494  VAL A CB   1 
ATOM   4050  C  CG1  . VAL A  1 302 ? 185.201 98.855  83.849  1.00 68.20  ? 494  VAL A CG1  1 
ATOM   4051  C  CG2  . VAL A  1 302 ? 185.060 96.394  83.389  1.00 65.49  ? 494  VAL A CG2  1 
ATOM   4052  H  H    . VAL A  1 302 ? 185.763 95.754  86.476  1.00 78.09  ? 494  VAL A H    1 
ATOM   4053  H  HA   . VAL A  1 302 ? 187.194 97.355  84.807  1.00 79.83  ? 494  VAL A HA   1 
ATOM   4054  H  HB   . VAL A  1 302 ? 184.365 97.406  85.018  1.00 79.28  ? 494  VAL A HB   1 
ATOM   4055  H  HG11 . VAL A  1 302 ? 184.413 98.980  83.299  1.00 81.59  ? 494  VAL A HG11 1 
ATOM   4056  H  HG12 . VAL A  1 302 ? 185.216 99.515  84.561  1.00 81.59  ? 494  VAL A HG12 1 
ATOM   4057  H  HG13 . VAL A  1 302 ? 186.001 98.936  83.306  1.00 81.59  ? 494  VAL A HG13 1 
ATOM   4058  H  HG21 . VAL A  1 302 ? 184.273 96.565  82.848  1.00 78.34  ? 494  VAL A HG21 1 
ATOM   4059  H  HG22 . VAL A  1 302 ? 185.856 96.428  82.836  1.00 78.34  ? 494  VAL A HG22 1 
ATOM   4060  H  HG23 . VAL A  1 302 ? 184.988 95.525  83.814  1.00 78.34  ? 494  VAL A HG23 1 
ATOM   4061  N  N    . ARG A  1 303 ? 187.349 99.180  86.431  1.00 68.90  ? 495  ARG A N    1 
ATOM   4062  C  CA   . ARG A  1 303 ? 187.617 100.074 87.550  1.00 71.57  ? 495  ARG A CA   1 
ATOM   4063  C  C    . ARG A  1 303 ? 187.480 101.515 87.090  1.00 70.37  ? 495  ARG A C    1 
ATOM   4064  O  O    . ARG A  1 303 ? 188.154 101.937 86.145  1.00 73.04  ? 495  ARG A O    1 
ATOM   4065  C  CB   . ARG A  1 303 ? 189.010 99.796  88.116  1.00 76.08  ? 495  ARG A CB   1 
ATOM   4066  C  CG   . ARG A  1 303 ? 189.189 98.320  88.404  1.00 77.70  ? 495  ARG A CG   1 
ATOM   4067  C  CD   . ARG A  1 303 ? 190.467 97.980  89.122  1.00 80.04  ? 495  ARG A CD   1 
ATOM   4068  N  NE   . ARG A  1 303 ? 190.519 96.539  89.355  1.00 79.58  ? 495  ARG A NE   1 
ATOM   4069  C  CZ   . ARG A  1 303 ? 191.083 95.955  90.406  1.00 80.03  ? 495  ARG A CZ   1 
ATOM   4070  N  NH1  . ARG A  1 303 ? 191.670 96.679  91.351  1.00 81.81  ? 495  ARG A NH1  1 
ATOM   4071  N  NH2  . ARG A  1 303 ? 191.059 94.633  90.509  1.00 80.73  ? 495  ARG A NH2  1 
ATOM   4072  H  H    . ARG A  1 303 ? 187.831 99.338  85.736  1.00 82.43  ? 495  ARG A H    1 
ATOM   4073  H  HA   . ARG A  1 303 ? 186.966 99.915  88.251  1.00 85.64  ? 495  ARG A HA   1 
ATOM   4074  H  HB2  . ARG A  1 303 ? 189.680 100.065 87.470  1.00 91.04  ? 495  ARG A HB2  1 
ATOM   4075  H  HB3  . ARG A  1 303 ? 189.124 100.286 88.946  1.00 91.04  ? 495  ARG A HB3  1 
ATOM   4076  H  HG2  . ARG A  1 303 ? 188.451 98.020  88.957  1.00 92.99  ? 495  ARG A HG2  1 
ATOM   4077  H  HG3  . ARG A  1 303 ? 189.185 97.837  87.563  1.00 92.99  ? 495  ARG A HG3  1 
ATOM   4078  H  HD2  . ARG A  1 303 ? 191.227 98.234  88.576  1.00 95.81  ? 495  ARG A HD2  1 
ATOM   4079  H  HD3  . ARG A  1 303 ? 190.493 98.435  89.979  1.00 95.81  ? 495  ARG A HD3  1 
ATOM   4080  H  HE   . ARG A  1 303 ? 190.156 96.029  88.766  1.00 95.25  ? 495  ARG A HE   1 
ATOM   4081  H  HH11 . ARG A  1 303 ? 191.686 97.536  91.288  1.00 97.93  ? 495  ARG A HH11 1 
ATOM   4082  H  HH12 . ARG A  1 303 ? 192.033 96.290  92.027  1.00 97.93  ? 495  ARG A HH12 1 
ATOM   4083  H  HH21 . ARG A  1 303 ? 190.681 94.161  89.898  1.00 96.63  ? 495  ARG A HH21 1 
ATOM   4084  H  HH22 . ARG A  1 303 ? 191.425 94.247  91.185  1.00 96.63  ? 495  ARG A HH22 1 
ATOM   4085  N  N    . VAL A  1 304 ? 186.610 102.262 87.763  1.00 63.80  ? 496  VAL A N    1 
ATOM   4086  C  CA   . VAL A  1 304 ? 186.293 103.637 87.406  1.00 63.15  ? 496  VAL A CA   1 
ATOM   4087  C  C    . VAL A  1 304 ? 186.874 104.540 88.482  1.00 64.56  ? 496  VAL A C    1 
ATOM   4088  O  O    . VAL A  1 304 ? 186.520 104.422 89.662  1.00 63.27  ? 496  VAL A O    1 
ATOM   4089  C  CB   . VAL A  1 304 ? 184.778 103.851 87.262  1.00 66.08  ? 496  VAL A CB   1 
ATOM   4090  C  CG1  . VAL A  1 304 ? 184.478 105.292 86.857  1.00 69.89  ? 496  VAL A CG1  1 
ATOM   4091  C  CG2  . VAL A  1 304 ? 184.200 102.873 86.248  1.00 62.26  ? 496  VAL A CG2  1 
ATOM   4092  H  H    . VAL A  1 304 ? 186.179 101.983 88.453  1.00 76.31  ? 496  VAL A H    1 
ATOM   4093  H  HA   . VAL A  1 304 ? 186.715 103.857 86.560  1.00 75.53  ? 496  VAL A HA   1 
ATOM   4094  H  HB   . VAL A  1 304 ? 184.352 103.684 88.117  1.00 79.05  ? 496  VAL A HB   1 
ATOM   4095  H  HG11 . VAL A  1 304 ? 183.518 105.402 86.773  1.00 83.62  ? 496  VAL A HG11 1 
ATOM   4096  H  HG12 . VAL A  1 304 ? 184.821 105.889 87.541  1.00 83.62  ? 496  VAL A HG12 1 
ATOM   4097  H  HG13 . VAL A  1 304 ? 184.909 105.477 86.008  1.00 83.62  ? 496  VAL A HG13 1 
ATOM   4098  H  HG21 . VAL A  1 304 ? 183.244 103.025 86.173  1.00 74.46  ? 496  VAL A HG21 1 
ATOM   4099  H  HG22 . VAL A  1 304 ? 184.627 103.019 85.390  1.00 74.46  ? 496  VAL A HG22 1 
ATOM   4100  H  HG23 . VAL A  1 304 ? 184.368 101.967 86.552  1.00 74.46  ? 496  VAL A HG23 1 
ATOM   4101  N  N    . TRP A  1 305 ? 187.750 105.449 88.070  1.00 69.05  ? 497  TRP A N    1 
ATOM   4102  C  CA   . TRP A  1 305 ? 188.412 106.381 88.968  1.00 69.71  ? 497  TRP A CA   1 
ATOM   4103  C  C    . TRP A  1 305 ? 187.949 107.794 88.644  1.00 70.13  ? 497  TRP A C    1 
ATOM   4104  O  O    . TRP A  1 305 ? 187.909 108.185 87.472  1.00 70.11  ? 497  TRP A O    1 
ATOM   4105  C  CB   . TRP A  1 305 ? 189.931 106.262 88.829  1.00 72.76  ? 497  TRP A CB   1 
ATOM   4106  C  CG   . TRP A  1 305 ? 190.709 107.121 89.768  1.00 73.82  ? 497  TRP A CG   1 
ATOM   4107  C  CD1  . TRP A  1 305 ? 190.756 107.017 91.127  1.00 76.51  ? 497  TRP A CD1  1 
ATOM   4108  C  CD2  . TRP A  1 305 ? 191.567 108.212 89.417  1.00 70.82  ? 497  TRP A CD2  1 
ATOM   4109  N  NE1  . TRP A  1 305 ? 191.589 107.979 91.645  1.00 76.26  ? 497  TRP A NE1  1 
ATOM   4110  C  CE2  . TRP A  1 305 ? 192.099 108.726 90.615  1.00 73.40  ? 497  TRP A CE2  1 
ATOM   4111  C  CE3  . TRP A  1 305 ? 191.936 108.804 88.206  1.00 72.20  ? 497  TRP A CE3  1 
ATOM   4112  C  CZ2  . TRP A  1 305 ? 192.979 109.807 90.638  1.00 74.59  ? 497  TRP A CZ2  1 
ATOM   4113  C  CZ3  . TRP A  1 305 ? 192.809 109.876 88.231  1.00 74.78  ? 497  TRP A CZ3  1 
ATOM   4114  C  CH2  . TRP A  1 305 ? 193.319 110.367 89.438  1.00 74.13  ? 497  TRP A CH2  1 
ATOM   4115  H  H    . TRP A  1 305 ? 187.984 105.545 87.248  1.00 82.61  ? 497  TRP A H    1 
ATOM   4116  H  HA   . TRP A  1 305 ? 188.169 106.179 89.885  1.00 83.40  ? 497  TRP A HA   1 
ATOM   4117  H  HB2  . TRP A  1 305 ? 190.186 105.341 88.994  1.00 87.07  ? 497  TRP A HB2  1 
ATOM   4118  H  HB3  . TRP A  1 305 ? 190.180 106.513 87.926  1.00 87.07  ? 497  TRP A HB3  1 
ATOM   4119  H  HD1  . TRP A  1 305 ? 190.293 106.387 91.630  1.00 91.57  ? 497  TRP A HD1  1 
ATOM   4120  H  HE1  . TRP A  1 305 ? 191.760 108.095 92.480  1.00 91.26  ? 497  TRP A HE1  1 
ATOM   4121  H  HE3  . TRP A  1 305 ? 191.600 108.484 87.400  1.00 86.39  ? 497  TRP A HE3  1 
ATOM   4122  H  HZ2  . TRP A  1 305 ? 193.320 110.135 91.439  1.00 89.26  ? 497  TRP A HZ2  1 
ATOM   4123  H  HZ3  . TRP A  1 305 ? 193.061 110.279 87.431  1.00 89.49  ? 497  TRP A HZ3  1 
ATOM   4124  H  HH2  . TRP A  1 305 ? 193.906 111.089 89.424  1.00 88.71  ? 497  TRP A HH2  1 
ATOM   4125  N  N    . SER A  1 306 ? 187.601 108.555 89.677  1.00 73.77  ? 498  SER A N    1 
ATOM   4126  C  CA   . SER A  1 306 ? 187.173 109.936 89.505  1.00 78.54  ? 498  SER A CA   1 
ATOM   4127  C  C    . SER A  1 306 ? 188.397 110.839 89.468  1.00 78.29  ? 498  SER A C    1 
ATOM   4128  O  O    . SER A  1 306 ? 189.361 110.626 90.210  1.00 78.72  ? 498  SER A O    1 
ATOM   4129  C  CB   . SER A  1 306 ? 186.231 110.364 90.631  1.00 82.12  ? 498  SER A CB   1 
ATOM   4130  O  OG   . SER A  1 306 ? 186.808 110.122 91.902  1.00 84.60  ? 498  SER A OG   1 
ATOM   4131  H  H    . SER A  1 306 ? 187.606 108.291 90.495  1.00 88.27  ? 498  SER A H    1 
ATOM   4132  H  HA   . SER A  1 306 ? 186.702 110.024 88.661  1.00 93.99  ? 498  SER A HA   1 
ATOM   4133  H  HB2  . SER A  1 306 ? 186.047 111.313 90.544  1.00 98.30  ? 498  SER A HB2  1 
ATOM   4134  H  HB3  . SER A  1 306 ? 185.405 109.860 90.559  1.00 98.30  ? 498  SER A HB3  1 
ATOM   4135  H  HG   . SER A  1 306 ? 186.971 109.303 91.992  1.00 101.27 ? 498  SER A HG   1 
ATOM   4136  N  N    . VAL A  1 307 ? 188.357 111.846 88.596  1.00 75.79  ? 499  VAL A N    1 
ATOM   4137  C  CA   . VAL A  1 307 ? 189.510 112.715 88.388  1.00 77.07  ? 499  VAL A CA   1 
ATOM   4138  C  C    . VAL A  1 307 ? 189.276 114.106 88.967  1.00 88.13  ? 499  VAL A C    1 
ATOM   4139  O  O    . VAL A  1 307 ? 189.617 114.356 90.128  1.00 83.74  ? 499  VAL A O    1 
ATOM   4140  C  CB   . VAL A  1 307 ? 189.874 112.801 86.894  1.00 68.87  ? 499  VAL A CB   1 
ATOM   4141  C  CG1  . VAL A  1 307 ? 191.174 113.575 86.716  1.00 69.55  ? 499  VAL A CG1  1 
ATOM   4142  C  CG2  . VAL A  1 307 ? 190.008 111.408 86.298  1.00 64.80  ? 499  VAL A CG2  1 
ATOM   4143  H  H    . VAL A  1 307 ? 187.673 112.046 88.114  1.00 90.70  ? 499  VAL A H    1 
ATOM   4144  H  HA   . VAL A  1 307 ? 190.271 112.331 88.851  1.00 92.23  ? 499  VAL A HA   1 
ATOM   4145  H  HB   . VAL A  1 307 ? 189.171 113.271 86.418  1.00 82.40  ? 499  VAL A HB   1 
ATOM   4146  H  HG11 . VAL A  1 307 ? 191.387 113.619 85.771  1.00 83.21  ? 499  VAL A HG11 1 
ATOM   4147  H  HG12 . VAL A  1 307 ? 191.059 114.470 87.072  1.00 83.21  ? 499  VAL A HG12 1 
ATOM   4148  H  HG13 . VAL A  1 307 ? 191.882 113.116 87.194  1.00 83.21  ? 499  VAL A HG13 1 
ATOM   4149  H  HG21 . VAL A  1 307 ? 190.237 111.488 85.358  1.00 77.51  ? 499  VAL A HG21 1 
ATOM   4150  H  HG22 . VAL A  1 307 ? 190.707 110.929 86.770  1.00 77.51  ? 499  VAL A HG22 1 
ATOM   4151  H  HG23 . VAL A  1 307 ? 189.163 110.941 86.394  1.00 77.51  ? 499  VAL A HG23 1 
ATOM   4152  N  N    . THR A  1 308 ? 188.687 115.029 88.182  1.00 134.23 ? 500  THR A N    1 
ATOM   4153  C  CA   . THR A  1 308 ? 188.678 116.425 88.621  1.00 150.35 ? 500  THR A CA   1 
ATOM   4154  C  C    . THR A  1 308 ? 187.751 116.622 89.810  1.00 151.00 ? 500  THR A C    1 
ATOM   4155  O  O    . THR A  1 308 ? 188.220 117.088 90.863  1.00 165.75 ? 500  THR A O    1 
ATOM   4156  C  CB   . THR A  1 308 ? 188.331 117.343 87.449  1.00 161.48 ? 500  THR A CB   1 
ATOM   4157  O  OG1  . THR A  1 308 ? 189.353 117.241 86.453  1.00 168.38 ? 500  THR A OG1  1 
ATOM   4158  C  CG2  . THR A  1 308 ? 188.222 118.784 87.930  1.00 166.31 ? 500  THR A CG2  1 
ATOM   4159  H  H    . THR A  1 308 ? 188.304 114.876 87.427  1.00 160.82 ? 500  THR A H    1 
ATOM   4160  H  HA   . THR A  1 308 ? 189.573 116.657 88.913  1.00 180.17 ? 500  THR A HA   1 
ATOM   4161  H  HB   . THR A  1 308 ? 187.479 117.078 87.069  1.00 193.53 ? 500  THR A HB   1 
ATOM   4162  H  HG1  . THR A  1 308 ? 189.409 116.450 86.178  1.00 201.80 ? 500  THR A HG1  1 
ATOM   4163  H  HG21 . THR A  1 308 ? 188.002 119.365 87.185  1.00 199.33 ? 500  THR A HG21 1 
ATOM   4164  H  HG22 . THR A  1 308 ? 187.527 118.856 88.603  1.00 199.33 ? 500  THR A HG22 1 
ATOM   4165  H  HG23 . THR A  1 308 ? 189.065 119.069 88.315  1.00 199.33 ? 500  THR A HG23 1 
ATOM   4166  N  N    . PRO A  1 309 ? 186.458 116.291 89.741  1.00 110.87 ? 501  PRO A N    1 
ATOM   4167  C  CA   . PRO A  1 309 ? 185.724 116.150 91.002  1.00 103.18 ? 501  PRO A CA   1 
ATOM   4168  C  C    . PRO A  1 309 ? 186.113 114.811 91.607  1.00 100.25 ? 501  PRO A C    1 
ATOM   4169  O  O    . PRO A  1 309 ? 185.948 113.761 90.982  1.00 99.55  ? 501  PRO A O    1 
ATOM   4170  C  CB   . PRO A  1 309 ? 184.249 116.190 90.577  1.00 99.85  ? 501  PRO A CB   1 
ATOM   4171  C  CG   . PRO A  1 309 ? 184.246 116.331 89.089  1.00 103.62 ? 501  PRO A CG   1 
ATOM   4172  C  CD   . PRO A  1 309 ? 185.597 115.915 88.608  1.00 103.81 ? 501  PRO A CD   1 
ATOM   4173  H  HA   . PRO A  1 309 ? 185.924 116.875 91.614  1.00 123.57 ? 501  PRO A HA   1 
ATOM   4174  H  HB2  . PRO A  1 309 ? 183.814 115.365 90.841  1.00 119.57 ? 501  PRO A HB2  1 
ATOM   4175  H  HB3  . PRO A  1 309 ? 183.814 116.952 90.991  1.00 119.57 ? 501  PRO A HB3  1 
ATOM   4176  H  HG2  . PRO A  1 309 ? 183.562 115.754 88.713  1.00 124.10 ? 501  PRO A HG2  1 
ATOM   4177  H  HG3  . PRO A  1 309 ? 184.073 117.256 88.854  1.00 124.10 ? 501  PRO A HG3  1 
ATOM   4178  H  HD2  . PRO A  1 309 ? 185.627 114.957 88.459  1.00 124.32 ? 501  PRO A HD2  1 
ATOM   4179  H  HD3  . PRO A  1 309 ? 185.843 116.412 87.812  1.00 124.32 ? 501  PRO A HD3  1 
ATOM   4180  N  N    . LYS A  1 310 ? 186.647 114.848 92.818  1.00 95.95  ? 502  LYS A N    1 
ATOM   4181  C  CA   . LYS A  1 310 ? 187.136 113.654 93.499  1.00 92.45  ? 502  LYS A CA   1 
ATOM   4182  C  C    . LYS A  1 310 ? 185.984 112.768 93.971  1.00 94.22  ? 502  LYS A C    1 
ATOM   4183  O  O    . LYS A  1 310 ? 186.138 111.992 94.923  1.00 93.58  ? 502  LYS A O    1 
ATOM   4184  C  CB   . LYS A  1 310 ? 188.044 114.093 94.642  1.00 90.50  ? 502  LYS A CB   1 
ATOM   4185  C  CG   . LYS A  1 310 ? 189.046 115.129 94.144  1.00 88.60  ? 502  LYS A CG   1 
ATOM   4186  C  CD   . LYS A  1 310 ? 190.312 115.233 94.957  1.00 90.70  ? 502  LYS A CD   1 
ATOM   4187  C  CE   . LYS A  1 310 ? 190.901 116.632 94.794  1.00 95.22  ? 502  LYS A CE   1 
ATOM   4188  N  NZ   . LYS A  1 310 ? 190.195 117.653 95.620  1.00 97.51  ? 502  LYS A NZ   1 
ATOM   4189  H  H    . LYS A  1 310 ? 186.740 115.569 93.279  1.00 114.89 ? 502  LYS A H    1 
ATOM   4190  H  HA   . LYS A  1 310 ? 187.671 113.137 92.877  1.00 110.69 ? 502  LYS A HA   1 
ATOM   4191  H  HB2  . LYS A  1 310 ? 187.510 114.494 95.346  1.00 108.35 ? 502  LYS A HB2  1 
ATOM   4192  H  HB3  . LYS A  1 310 ? 188.534 113.327 94.980  1.00 108.35 ? 502  LYS A HB3  1 
ATOM   4193  H  HG2  . LYS A  1 310 ? 189.299 114.902 93.235  1.00 106.08 ? 502  LYS A HG2  1 
ATOM   4194  H  HG3  . LYS A  1 310 ? 188.619 116.001 94.154  1.00 106.08 ? 502  LYS A HG3  1 
ATOM   4195  H  HD2  . LYS A  1 310 ? 190.112 115.087 95.895  1.00 108.59 ? 502  LYS A HD2  1 
ATOM   4196  H  HD3  . LYS A  1 310 ? 190.959 114.584 94.639  1.00 108.59 ? 502  LYS A HD3  1 
ATOM   4197  H  HE2  . LYS A  1 310 ? 191.831 116.616 95.067  1.00 114.02 ? 502  LYS A HE2  1 
ATOM   4198  H  HE3  . LYS A  1 310 ? 190.831 116.898 93.864  1.00 114.02 ? 502  LYS A HE3  1 
ATOM   4199  H  HZ1  . LYS A  1 310 ? 190.566 118.452 95.498  1.00 116.76 ? 502  LYS A HZ1  1 
ATOM   4200  H  HZ2  . LYS A  1 310 ? 189.337 117.694 95.386  1.00 116.76 ? 502  LYS A HZ2  1 
ATOM   4201  H  HZ3  . LYS A  1 310 ? 190.249 117.437 96.482  1.00 116.76 ? 502  LYS A HZ3  1 
ATOM   4202  N  N    . LYS A  1 311 ? 184.835 112.874 93.293  1.00 98.69  ? 503  LYS A N    1 
ATOM   4203  C  CA   . LYS A  1 311 ? 183.609 112.180 93.642  1.00 97.35  ? 503  LYS A CA   1 
ATOM   4204  C  C    . LYS A  1 311 ? 183.078 111.445 92.417  1.00 95.88  ? 503  LYS A C    1 
ATOM   4205  O  O    . LYS A  1 311 ? 183.042 112.000 91.312  1.00 95.35  ? 503  LYS A O    1 
ATOM   4206  C  CB   . LYS A  1 311 ? 182.568 113.204 94.100  1.00 99.14  ? 503  LYS A CB   1 
ATOM   4207  C  CG   . LYS A  1 311 ? 182.944 113.967 95.357  1.00 102.07 ? 503  LYS A CG   1 
ATOM   4208  C  CD   . LYS A  1 311 ? 181.875 114.998 95.696  1.00 108.14 ? 503  LYS A CD   1 
ATOM   4209  C  CE   . LYS A  1 311 ? 182.093 115.643 97.064  1.00 112.03 ? 503  LYS A CE   1 
ATOM   4210  N  NZ   . LYS A  1 311 ? 183.465 116.197 97.271  1.00 116.51 ? 503  LYS A NZ   1 
ATOM   4211  H  H    . LYS A  1 311 ? 184.747 113.369 92.595  1.00 118.17 ? 503  LYS A H    1 
ATOM   4212  H  HA   . LYS A  1 311 ? 183.772 111.544 94.356  1.00 116.57 ? 503  LYS A HA   1 
ATOM   4213  H  HB2  . LYS A  1 311 ? 182.438 113.853 93.391  1.00 118.72 ? 503  LYS A HB2  1 
ATOM   4214  H  HB3  . LYS A  1 311 ? 181.734 112.741 94.276  1.00 118.72 ? 503  LYS A HB3  1 
ATOM   4215  H  HG2  . LYS A  1 311 ? 183.020 113.349 96.100  1.00 122.23 ? 503  LYS A HG2  1 
ATOM   4216  H  HG3  . LYS A  1 311 ? 183.784 114.431 95.214  1.00 122.23 ? 503  LYS A HG3  1 
ATOM   4217  H  HD2  . LYS A  1 311 ? 181.889 115.701 95.028  1.00 129.52 ? 503  LYS A HD2  1 
ATOM   4218  H  HD3  . LYS A  1 311 ? 181.008 114.564 95.704  1.00 129.52 ? 503  LYS A HD3  1 
ATOM   4219  H  HE2  . LYS A  1 311 ? 181.462 116.371 97.169  1.00 134.19 ? 503  LYS A HE2  1 
ATOM   4220  H  HE3  . LYS A  1 311 ? 181.939 114.975 97.751  1.00 134.19 ? 503  LYS A HE3  1 
ATOM   4221  H  HZ1  . LYS A  1 311 ? 183.528 116.557 98.082  1.00 139.56 ? 503  LYS A HZ1  1 
ATOM   4222  H  HZ2  . LYS A  1 311 ? 184.070 115.549 97.193  1.00 139.56 ? 503  LYS A HZ2  1 
ATOM   4223  H  HZ3  . LYS A  1 311 ? 183.634 116.825 96.662  1.00 139.56 ? 503  LYS A HZ3  1 
ATOM   4224  N  N    . LEU A  1 312 ? 182.682 110.181 92.611  1.00 91.98  ? 504  LEU A N    1 
ATOM   4225  C  CA   . LEU A  1 312 ? 182.175 109.399 91.486  1.00 88.45  ? 504  LEU A CA   1 
ATOM   4226  C  C    . LEU A  1 312 ? 180.912 109.997 90.893  1.00 86.19  ? 504  LEU A C    1 
ATOM   4227  O  O    . LEU A  1 312 ? 180.680 109.880 89.687  1.00 82.29  ? 504  LEU A O    1 
ATOM   4228  C  CB   . LEU A  1 312 ? 181.920 107.953 91.915  1.00 89.28  ? 504  LEU A CB   1 
ATOM   4229  C  CG   . LEU A  1 312 ? 183.156 107.095 92.151  1.00 92.10  ? 504  LEU A CG   1 
ATOM   4230  C  CD1  . LEU A  1 312 ? 182.781 105.813 92.882  1.00 91.57  ? 504  LEU A CD1  1 
ATOM   4231  C  CD2  . LEU A  1 312 ? 183.854 106.788 90.828  1.00 91.02  ? 504  LEU A CD2  1 
ATOM   4232  H  H    . LEU A  1 312 ? 182.696 109.766 93.364  1.00 110.13 ? 504  LEU A H    1 
ATOM   4233  H  HA   . LEU A  1 312 ? 182.850 109.385 90.789  1.00 105.89 ? 504  LEU A HA   1 
ATOM   4234  H  HB2  . LEU A  1 312 ? 181.415 107.966 92.743  1.00 106.88 ? 504  LEU A HB2  1 
ATOM   4235  H  HB3  . LEU A  1 312 ? 181.394 107.519 91.225  1.00 106.88 ? 504  LEU A HB3  1 
ATOM   4236  H  HG   . LEU A  1 312 ? 183.778 107.586 92.709  1.00 110.27 ? 504  LEU A HG   1 
ATOM   4237  H  HD11 . LEU A  1 312 ? 183.582 105.284 93.021  1.00 109.64 ? 504  LEU A HD11 1 
ATOM   4238  H  HD12 . LEU A  1 312 ? 182.383 106.043 93.736  1.00 109.64 ? 504  LEU A HD12 1 
ATOM   4239  H  HD13 . LEU A  1 312 ? 182.145 105.317 92.343  1.00 109.64 ? 504  LEU A HD13 1 
ATOM   4240  H  HD21 . LEU A  1 312 ? 184.636 106.241 91.004  1.00 108.97 ? 504  LEU A HD21 1 
ATOM   4241  H  HD22 . LEU A  1 312 ? 183.239 106.309 90.250  1.00 108.97 ? 504  LEU A HD22 1 
ATOM   4242  H  HD23 . LEU A  1 312 ? 184.120 107.622 90.410  1.00 108.97 ? 504  LEU A HD23 1 
ATOM   4243  N  N    . ARG A  1 313 ? 180.080 110.618 91.721  1.00 87.15  ? 505  ARG A N    1 
ATOM   4244  C  CA   . ARG A  1 313 ? 178.833 111.222 91.278  1.00 89.83  ? 505  ARG A CA   1 
ATOM   4245  C  C    . ARG A  1 313 ? 178.867 112.704 91.612  1.00 93.74  ? 505  ARG A C    1 
ATOM   4246  O  O    . ARG A  1 313 ? 179.079 113.084 92.769  1.00 92.44  ? 505  ARG A O    1 
ATOM   4247  C  CB   . ARG A  1 313 ? 177.622 110.547 91.935  1.00 90.36  ? 505  ARG A CB   1 
ATOM   4248  C  CG   . ARG A  1 313 ? 177.399 109.127 91.442  1.00 88.13  ? 505  ARG A CG   1 
ATOM   4249  C  CD   . ARG A  1 313 ? 176.025 108.611 91.825  1.00 86.88  ? 505  ARG A CD   1 
ATOM   4250  N  NE   . ARG A  1 313 ? 175.837 108.557 93.272  1.00 87.50  ? 505  ARG A NE   1 
ATOM   4251  C  CZ   . ARG A  1 313 ? 174.705 108.192 93.866  1.00 86.39  ? 505  ARG A CZ   1 
ATOM   4252  N  NH1  . ARG A  1 313 ? 173.649 107.846 93.141  1.00 88.25  ? 505  ARG A NH1  1 
ATOM   4253  N  NH2  . ARG A  1 313 ? 174.627 108.175 95.189  1.00 84.39  ? 505  ARG A NH2  1 
ATOM   4254  H  H    . ARG A  1 313 ? 180.220 110.704 92.565  1.00 104.33 ? 505  ARG A H    1 
ATOM   4255  H  HA   . ARG A  1 313 ? 178.752 111.127 90.316  1.00 107.55 ? 505  ARG A HA   1 
ATOM   4256  H  HB2  . ARG A  1 313 ? 177.762 110.513 92.894  1.00 108.19 ? 505  ARG A HB2  1 
ATOM   4257  H  HB3  . ARG A  1 313 ? 176.826 111.063 91.735  1.00 108.19 ? 505  ARG A HB3  1 
ATOM   4258  H  HG2  . ARG A  1 313 ? 177.471 109.110 90.475  1.00 105.51 ? 505  ARG A HG2  1 
ATOM   4259  H  HG3  . ARG A  1 313 ? 178.064 108.543 91.839  1.00 105.51 ? 505  ARG A HG3  1 
ATOM   4260  H  HD2  . ARG A  1 313 ? 175.349 109.200 91.455  1.00 104.01 ? 505  ARG A HD2  1 
ATOM   4261  H  HD3  . ARG A  1 313 ? 175.913 107.714 91.474  1.00 104.01 ? 505  ARG A HD3  1 
ATOM   4262  H  HE   . ARG A  1 313 ? 176.501 108.776 93.772  1.00 104.75 ? 505  ARG A HE   1 
ATOM   4263  H  HH11 . ARG A  1 313 ? 173.696 107.856 92.282  1.00 105.65 ? 505  ARG A HH11 1 
ATOM   4264  H  HH12 . ARG A  1 313 ? 172.919 107.611 93.529  1.00 105.65 ? 505  ARG A HH12 1 
ATOM   4265  H  HH21 . ARG A  1 313 ? 175.309 108.399 95.663  1.00 101.02 ? 505  ARG A HH21 1 
ATOM   4266  H  HH22 . ARG A  1 313 ? 173.895 107.939 95.574  1.00 101.02 ? 505  ARG A HH22 1 
ATOM   4267  N  N    . SER A  1 314 ? 178.673 113.534 90.592  1.00 107.83 ? 506  SER A N    1 
ATOM   4268  C  CA   . SER A  1 314 ? 178.697 114.978 90.737  1.00 112.76 ? 506  SER A CA   1 
ATOM   4269  C  C    . SER A  1 314 ? 177.874 115.561 89.603  1.00 116.54 ? 506  SER A C    1 
ATOM   4270  O  O    . SER A  1 314 ? 177.761 114.960 88.531  1.00 115.21 ? 506  SER A O    1 
ATOM   4271  C  CB   . SER A  1 314 ? 180.131 115.516 90.704  1.00 113.24 ? 506  SER A CB   1 
ATOM   4272  O  OG   . SER A  1 314 ? 180.815 115.058 89.548  1.00 111.29 ? 506  SER A OG   1 
ATOM   4273  H  H    . SER A  1 314 ? 178.522 113.273 89.787  1.00 129.14 ? 506  SER A H    1 
ATOM   4274  H  HA   . SER A  1 314 ? 178.289 115.230 91.580  1.00 135.06 ? 506  SER A HA   1 
ATOM   4275  H  HB2  . SER A  1 314 ? 180.105 116.485 90.692  1.00 135.64 ? 506  SER A HB2  1 
ATOM   4276  H  HB3  . SER A  1 314 ? 180.603 115.206 91.493  1.00 135.64 ? 506  SER A HB3  1 
ATOM   4277  H  HG   . SER A  1 314 ? 181.599 115.359 89.540  1.00 133.30 ? 506  SER A HG   1 
ATOM   4278  N  N    . VAL A  1 315 ? 177.299 116.732 89.849  1.00 117.25 ? 507  VAL A N    1 
ATOM   4279  C  CA   . VAL A  1 315 ? 176.487 117.425 88.858  1.00 119.81 ? 507  VAL A CA   1 
ATOM   4280  C  C    . VAL A  1 315 ? 177.053 118.822 88.659  1.00 128.10 ? 507  VAL A C    1 
ATOM   4281  O  O    . VAL A  1 315 ? 177.548 119.443 89.606  1.00 129.95 ? 507  VAL A O    1 
ATOM   4282  C  CB   . VAL A  1 315 ? 175.002 117.475 89.276  1.00 118.66 ? 507  VAL A CB   1 
ATOM   4283  C  CG1  . VAL A  1 315 ? 174.431 116.062 89.348  1.00 114.46 ? 507  VAL A CG1  1 
ATOM   4284  C  CG2  . VAL A  1 315 ? 174.835 118.187 90.615  1.00 120.40 ? 507  VAL A CG2  1 
ATOM   4285  H  H    . VAL A  1 315 ? 177.366 117.153 90.596  1.00 140.45 ? 507  VAL A H    1 
ATOM   4286  H  HA   . VAL A  1 315 ? 176.546 116.952 88.013  1.00 143.53 ? 507  VAL A HA   1 
ATOM   4287  H  HB   . VAL A  1 315 ? 174.501 117.969 88.608  1.00 142.15 ? 507  VAL A HB   1 
ATOM   4288  H  HG11 . VAL A  1 315 ? 173.498 116.112 89.612  1.00 137.10 ? 507  VAL A HG11 1 
ATOM   4289  H  HG12 . VAL A  1 315 ? 174.506 115.647 88.475  1.00 137.10 ? 507  VAL A HG12 1 
ATOM   4290  H  HG13 . VAL A  1 315 ? 174.933 115.552 90.003  1.00 137.10 ? 507  VAL A HG13 1 
ATOM   4291  H  HG21 . VAL A  1 315 ? 173.893 118.202 90.848  1.00 144.24 ? 507  VAL A HG21 1 
ATOM   4292  H  HG22 . VAL A  1 315 ? 175.336 117.707 91.292  1.00 144.24 ? 507  VAL A HG22 1 
ATOM   4293  H  HG23 . VAL A  1 315 ? 175.170 119.094 90.534  1.00 144.24 ? 507  VAL A HG23 1 
ATOM   4294  N  N    . LYS A  1 316 ? 176.974 119.313 87.426  1.00 141.39 ? 508  LYS A N    1 
ATOM   4295  C  CA   . LYS A  1 316 ? 177.397 120.665 87.097  1.00 144.94 ? 508  LYS A CA   1 
ATOM   4296  C  C    . LYS A  1 316 ? 176.159 121.552 87.073  1.00 150.15 ? 508  LYS A C    1 
ATOM   4297  O  O    . LYS A  1 316 ? 175.077 121.106 86.681  1.00 150.05 ? 508  LYS A O    1 
ATOM   4298  C  CB   . LYS A  1 316 ? 178.084 120.700 85.729  1.00 143.10 ? 508  LYS A CB   1 
ATOM   4299  C  CG   . LYS A  1 316 ? 179.269 119.745 85.562  1.00 139.20 ? 508  LYS A CG   1 
ATOM   4300  C  CD   . LYS A  1 316 ? 179.615 119.582 84.079  1.00 135.99 ? 508  LYS A CD   1 
ATOM   4301  C  CE   . LYS A  1 316 ? 180.877 118.757 83.855  1.00 133.17 ? 508  LYS A CE   1 
ATOM   4302  N  NZ   . LYS A  1 316 ? 181.240 118.670 82.408  1.00 130.51 ? 508  LYS A NZ   1 
ATOM   4303  H  H    . LYS A  1 316 ? 176.672 118.873 86.752  1.00 169.42 ? 508  LYS A H    1 
ATOM   4304  H  HA   . LYS A  1 316 ? 178.012 120.995 87.771  1.00 173.68 ? 508  LYS A HA   1 
ATOM   4305  H  HB2  . LYS A  1 316 ? 177.429 120.472 85.051  1.00 171.48 ? 508  LYS A HB2  1 
ATOM   4306  H  HB3  . LYS A  1 316 ? 178.412 121.600 85.573  1.00 171.48 ? 508  LYS A HB3  1 
ATOM   4307  H  HG2  . LYS A  1 316 ? 180.044 120.106 86.021  1.00 166.80 ? 508  LYS A HG2  1 
ATOM   4308  H  HG3  . LYS A  1 316 ? 179.037 118.875 85.921  1.00 166.80 ? 508  LYS A HG3  1 
ATOM   4309  H  HD2  . LYS A  1 316 ? 178.881 119.134 83.631  1.00 162.94 ? 508  LYS A HD2  1 
ATOM   4310  H  HD3  . LYS A  1 316 ? 179.757 120.459 83.690  1.00 162.94 ? 508  LYS A HD3  1 
ATOM   4311  H  HE2  . LYS A  1 316 ? 181.616 119.170 84.328  1.00 159.56 ? 508  LYS A HE2  1 
ATOM   4312  H  HE3  . LYS A  1 316 ? 180.731 117.856 84.184  1.00 159.56 ? 508  LYS A HE3  1 
ATOM   4313  H  HZ1  . LYS A  1 316 ? 181.979 118.184 82.308  1.00 156.37 ? 508  LYS A HZ1  1 
ATOM   4314  H  HZ2  . LYS A  1 316 ? 180.579 118.289 81.951  1.00 156.37 ? 508  LYS A HZ2  1 
ATOM   4315  H  HZ3  . LYS A  1 316 ? 181.384 119.485 82.081  1.00 156.37 ? 508  LYS A HZ3  1 
ATOM   4316  N  N    . GLN A  1 317 ? 176.311 122.802 87.506  1.00 163.18 ? 509  GLN A N    1 
ATOM   4317  C  CA   . GLN A  1 317 ? 175.194 123.738 87.525  1.00 166.25 ? 509  GLN A CA   1 
ATOM   4318  C  C    . GLN A  1 317 ? 175.697 125.120 87.133  1.00 166.34 ? 509  GLN A C    1 
ATOM   4319  O  O    . GLN A  1 317 ? 176.871 125.307 86.795  1.00 167.16 ? 509  GLN A O    1 
ATOM   4320  C  CB   . GLN A  1 317 ? 174.492 123.756 88.892  1.00 167.53 ? 509  GLN A CB   1 
ATOM   4321  C  CG   . GLN A  1 317 ? 175.287 124.362 90.043  1.00 171.02 ? 509  GLN A CG   1 
ATOM   4322  C  CD   . GLN A  1 317 ? 176.237 123.376 90.688  1.00 170.61 ? 509  GLN A CD   1 
ATOM   4323  O  OE1  . GLN A  1 317 ? 176.821 122.524 90.017  1.00 168.82 ? 509  GLN A OE1  1 
ATOM   4324  N  NE2  . GLN A  1 317 ? 176.391 123.481 92.003  1.00 171.37 ? 509  GLN A NE2  1 
ATOM   4325  H  H    . GLN A  1 317 ? 177.051 123.132 87.794  1.00 195.57 ? 509  GLN A H    1 
ATOM   4326  H  HA   . GLN A  1 317 ? 174.542 123.461 86.862  1.00 199.26 ? 509  GLN A HA   1 
ATOM   4327  H  HB2  . GLN A  1 317 ? 173.672 124.267 88.806  1.00 200.79 ? 509  GLN A HB2  1 
ATOM   4328  H  HB3  . GLN A  1 317 ? 174.278 122.842 89.137  1.00 200.79 ? 509  GLN A HB3  1 
ATOM   4329  H  HG2  . GLN A  1 317 ? 175.811 125.106 89.708  1.00 204.98 ? 509  GLN A HG2  1 
ATOM   4330  H  HG3  . GLN A  1 317 ? 174.670 124.671 90.724  1.00 204.98 ? 509  GLN A HG3  1 
ATOM   4331  H  HE21 . GLN A  1 317 ? 175.965 124.088 92.438  1.00 205.39 ? 509  GLN A HE21 1 
ATOM   4332  H  HE22 . GLN A  1 317 ? 176.920 122.944 92.418  1.00 205.39 ? 509  GLN A HE22 1 
ATOM   4333  N  N    . ALA A  1 318 ? 174.788 126.098 87.174  1.00 156.06 ? 510  ALA A N    1 
ATOM   4334  C  CA   . ALA A  1 318 ? 175.159 127.465 86.827  1.00 156.78 ? 510  ALA A CA   1 
ATOM   4335  C  C    . ALA A  1 318 ? 176.197 128.015 87.796  1.00 160.51 ? 510  ALA A C    1 
ATOM   4336  O  O    . ALA A  1 318 ? 177.050 128.817 87.401  1.00 160.02 ? 510  ALA A O    1 
ATOM   4337  C  CB   . ALA A  1 318 ? 173.917 128.357 86.808  1.00 157.50 ? 510  ALA A CB   1 
ATOM   4338  H  H    . ALA A  1 318 ? 173.963 125.995 87.396  1.00 187.03 ? 510  ALA A H    1 
ATOM   4339  H  HA   . ALA A  1 318 ? 175.546 127.471 85.938  1.00 187.89 ? 510  ALA A HA   1 
ATOM   4340  H  HB1  . ALA A  1 318 ? 174.182 129.261 86.576  1.00 188.75 ? 510  ALA A HB1  1 
ATOM   4341  H  HB2  . ALA A  1 318 ? 173.293 128.015 86.149  1.00 188.75 ? 510  ALA A HB2  1 
ATOM   4342  H  HB3  . ALA A  1 318 ? 173.508 128.347 87.688  1.00 188.75 ? 510  ALA A HB3  1 
ATOM   4343  N  N    . SER A  1 319 ? 176.125 127.624 89.070  1.00 170.08 ? 511  SER A N    1 
ATOM   4344  C  CA   . SER A  1 319 ? 177.128 128.072 90.028  1.00 176.15 ? 511  SER A CA   1 
ATOM   4345  C  C    . SER A  1 319 ? 178.517 127.603 89.606  1.00 183.32 ? 511  SER A C    1 
ATOM   4346  O  O    . SER A  1 319 ? 179.498 128.348 89.726  1.00 185.96 ? 511  SER A O    1 
ATOM   4347  C  CB   . SER A  1 319 ? 176.777 127.557 91.425  1.00 171.90 ? 511  SER A CB   1 
ATOM   4348  O  OG   . SER A  1 319 ? 175.386 127.295 91.528  1.00 170.68 ? 511  SER A OG   1 
ATOM   4349  H  H    . SER A  1 319 ? 175.518 127.110 89.396  1.00 203.85 ? 511  SER A H    1 
ATOM   4350  H  HA   . SER A  1 319 ? 177.132 129.042 90.056  1.00 211.13 ? 511  SER A HA   1 
ATOM   4351  H  HB2  . SER A  1 319 ? 177.266 126.736 91.592  1.00 206.04 ? 511  SER A HB2  1 
ATOM   4352  H  HB3  . SER A  1 319 ? 177.022 128.228 92.081  1.00 206.04 ? 511  SER A HB3  1 
ATOM   4353  H  HG   . SER A  1 319 ? 175.203 127.013 92.298  1.00 204.57 ? 511  SER A HG   1 
ATOM   4354  N  N    . ASP A  1 320 ? 178.617 126.363 89.117  1.00 212.87 ? 512  ASP A N    1 
ATOM   4355  C  CA   . ASP A  1 320 ? 179.886 125.833 88.621  1.00 217.16 ? 512  ASP A CA   1 
ATOM   4356  C  C    . ASP A  1 320 ? 180.373 126.583 87.384  1.00 219.50 ? 512  ASP A C    1 
ATOM   4357  O  O    . ASP A  1 320 ? 181.584 126.713 87.172  1.00 221.47 ? 512  ASP A O    1 
ATOM   4358  C  CB   . ASP A  1 320 ? 179.747 124.340 88.313  1.00 214.95 ? 512  ASP A CB   1 
ATOM   4359  C  CG   . ASP A  1 320 ? 179.653 123.489 89.566  1.00 215.75 ? 512  ASP A CG   1 
ATOM   4360  O  OD1  . ASP A  1 320 ? 179.858 124.031 90.674  1.00 219.22 ? 512  ASP A OD1  1 
ATOM   4361  O  OD2  . ASP A  1 320 ? 179.381 122.277 89.439  1.00 213.99 ? 512  ASP A OD2  1 
ATOM   4362  H  H    . ASP A  1 320 ? 177.962 125.809 89.062  1.00 255.20 ? 512  ASP A H    1 
ATOM   4363  H  HA   . ASP A  1 320 ? 180.559 125.933 89.313  1.00 260.34 ? 512  ASP A HA   1 
ATOM   4364  H  HB2  . ASP A  1 320 ? 178.940 124.199 87.793  1.00 257.69 ? 512  ASP A HB2  1 
ATOM   4365  H  HB3  . ASP A  1 320 ? 180.522 124.048 87.809  1.00 257.69 ? 512  ASP A HB3  1 
ATOM   4366  N  N    . LEU A  1 321 ? 179.445 127.066 86.555  1.00 204.17 ? 513  LEU A N    1 
ATOM   4367  C  CA   . LEU A  1 321 ? 179.789 127.722 85.294  1.00 198.19 ? 513  LEU A CA   1 
ATOM   4368  C  C    . LEU A  1 321 ? 180.787 128.865 85.472  1.00 197.72 ? 513  LEU A C    1 
ATOM   4369  O  O    . LEU A  1 321 ? 181.771 128.961 84.731  1.00 201.46 ? 513  LEU A O    1 
ATOM   4370  C  CB   . LEU A  1 321 ? 178.498 128.224 84.641  1.00 193.57 ? 513  LEU A CB   1 
ATOM   4371  C  CG   . LEU A  1 321 ? 178.452 129.223 83.477  1.00 190.60 ? 513  LEU A CG   1 
ATOM   4372  C  CD1  . LEU A  1 321 ? 178.281 130.613 84.090  1.00 194.93 ? 513  LEU A CD1  1 
ATOM   4373  C  CD2  . LEU A  1 321 ? 179.648 129.197 82.525  1.00 186.12 ? 513  LEU A CD2  1 
ATOM   4374  H  H    . LEU A  1 321 ? 178.599 127.025 86.704  1.00 244.76 ? 513  LEU A H    1 
ATOM   4375  H  HA   . LEU A  1 321 ? 180.190 127.068 84.700  1.00 237.58 ? 513  LEU A HA   1 
ATOM   4376  H  HB2  . LEU A  1 321 ? 178.026 127.437 84.325  1.00 232.03 ? 513  LEU A HB2  1 
ATOM   4377  H  HB3  . LEU A  1 321 ? 177.971 128.627 85.348  1.00 232.03 ? 513  LEU A HB3  1 
ATOM   4378  H  HG   . LEU A  1 321 ? 177.660 129.039 82.949  1.00 228.47 ? 513  LEU A HG   1 
ATOM   4379  H  HD11 . LEU A  1 321 ? 178.248 131.269 83.377  1.00 233.67 ? 513  LEU A HD11 1 
ATOM   4380  H  HD12 . LEU A  1 321 ? 177.454 130.633 84.597  1.00 233.67 ? 513  LEU A HD12 1 
ATOM   4381  H  HD13 . LEU A  1 321 ? 179.033 130.795 84.674  1.00 233.67 ? 513  LEU A HD13 1 
ATOM   4382  H  HD21 . LEU A  1 321 ? 179.515 129.863 81.833  1.00 223.10 ? 513  LEU A HD21 1 
ATOM   4383  H  HD22 . LEU A  1 321 ? 180.454 129.396 83.026  1.00 223.10 ? 513  LEU A HD22 1 
ATOM   4384  H  HD23 . LEU A  1 321 ? 179.715 128.315 82.127  1.00 223.10 ? 513  LEU A HD23 1 
ATOM   4385  N  N    . SER A  1 322 ? 180.581 129.722 86.472  1.00 164.12 ? 514  SER A N    1 
ATOM   4386  C  CA   . SER A  1 322 ? 181.461 130.878 86.635  1.00 159.34 ? 514  SER A CA   1 
ATOM   4387  C  C    . SER A  1 322 ? 182.909 130.487 86.913  1.00 162.41 ? 514  SER A C    1 
ATOM   4388  O  O    . SER A  1 322 ? 183.808 131.305 86.690  1.00 163.10 ? 514  SER A O    1 
ATOM   4389  C  CB   . SER A  1 322 ? 180.952 131.798 87.742  1.00 156.83 ? 514  SER A CB   1 
ATOM   4390  O  OG   . SER A  1 322 ? 181.902 132.815 88.020  1.00 157.51 ? 514  SER A OG   1 
ATOM   4391  H  H    . SER A  1 322 ? 179.954 129.659 87.058  1.00 196.69 ? 514  SER A H    1 
ATOM   4392  H  HA   . SER A  1 322 ? 181.452 131.386 85.809  1.00 190.97 ? 514  SER A HA   1 
ATOM   4393  H  HB2  . SER A  1 322 ? 180.122 132.209 87.455  1.00 187.95 ? 514  SER A HB2  1 
ATOM   4394  H  HB3  . SER A  1 322 ? 180.803 131.275 88.545  1.00 187.95 ? 514  SER A HB3  1 
ATOM   4395  H  HG   . SER A  1 322 ? 181.615 133.317 88.630  1.00 188.76 ? 514  SER A HG   1 
ATOM   4396  N  N    . LEU A  1 323 ? 183.158 129.265 87.385  1.00 194.62 ? 515  LEU A N    1 
ATOM   4397  C  CA   . LEU A  1 323 ? 184.518 128.852 87.718  1.00 197.29 ? 515  LEU A CA   1 
ATOM   4398  C  C    . LEU A  1 323 ? 185.399 128.676 86.487  1.00 194.98 ? 515  LEU A C    1 
ATOM   4399  O  O    . LEU A  1 323 ? 186.627 128.694 86.616  1.00 199.24 ? 515  LEU A O    1 
ATOM   4400  C  CB   . LEU A  1 323 ? 184.492 127.545 88.515  1.00 195.46 ? 515  LEU A CB   1 
ATOM   4401  C  CG   . LEU A  1 323 ? 184.886 127.635 89.993  1.00 197.44 ? 515  LEU A CG   1 
ATOM   4402  C  CD1  . LEU A  1 323 ? 183.814 127.017 90.875  1.00 195.75 ? 515  LEU A CD1  1 
ATOM   4403  C  CD2  . LEU A  1 323 ? 186.231 126.963 90.228  1.00 196.26 ? 515  LEU A CD2  1 
ATOM   4404  H  H    . LEU A  1 323 ? 182.561 128.661 87.519  1.00 233.29 ? 515  LEU A H    1 
ATOM   4405  H  HA   . LEU A  1 323 ? 184.923 129.534 88.278  1.00 236.50 ? 515  LEU A HA   1 
ATOM   4406  H  HB2  . LEU A  1 323 ? 183.591 127.187 88.479  1.00 234.30 ? 515  LEU A HB2  1 
ATOM   4407  H  HB3  . LEU A  1 323 ? 185.102 126.921 88.092  1.00 234.30 ? 515  LEU A HB3  1 
ATOM   4408  H  HG   . LEU A  1 323 ? 184.972 128.569 90.239  1.00 236.68 ? 515  LEU A HG   1 
ATOM   4409  H  HD11 . LEU A  1 323 ? 184.090 127.087 91.803  1.00 234.66 ? 515  LEU A HD11 1 
ATOM   4410  H  HD12 . LEU A  1 323 ? 182.981 127.494 90.740  1.00 234.66 ? 515  LEU A HD12 1 
ATOM   4411  H  HD13 . LEU A  1 323 ? 183.705 126.084 90.633  1.00 234.66 ? 515  LEU A HD13 1 
ATOM   4412  H  HD21 . LEU A  1 323 ? 186.458 127.033 91.169  1.00 235.27 ? 515  LEU A HD21 1 
ATOM   4413  H  HD22 . LEU A  1 323 ? 186.167 126.030 89.971  1.00 235.27 ? 515  LEU A HD22 1 
ATOM   4414  H  HD23 . LEU A  1 323 ? 186.905 127.409 89.691  1.00 235.27 ? 515  LEU A HD23 1 
ATOM   4415  N  N    . ILE A  1 324 ? 184.808 128.508 85.299  1.00 164.81 ? 516  ILE A N    1 
ATOM   4416  C  CA   . ILE A  1 324 ? 185.599 128.287 84.091  1.00 157.45 ? 516  ILE A CA   1 
ATOM   4417  C  C    . ILE A  1 324 ? 186.522 129.472 83.811  1.00 162.26 ? 516  ILE A C    1 
ATOM   4418  O  O    . ILE A  1 324 ? 187.644 129.281 83.319  1.00 161.12 ? 516  ILE A O    1 
ATOM   4419  C  CB   . ILE A  1 324 ? 184.688 128.007 82.881  1.00 151.84 ? 516  ILE A CB   1 
ATOM   4420  C  CG1  . ILE A  1 324 ? 183.663 126.896 83.179  1.00 147.51 ? 516  ILE A CG1  1 
ATOM   4421  C  CG2  . ILE A  1 324 ? 185.535 127.627 81.672  1.00 148.88 ? 516  ILE A CG2  1 
ATOM   4422  C  CD1  . ILE A  1 324 ? 184.123 125.806 84.139  1.00 143.64 ? 516  ILE A CD1  1 
ATOM   4423  H  H    . ILE A  1 324 ? 183.958 128.519 85.170  1.00 197.52 ? 516  ILE A H    1 
ATOM   4424  H  HA   . ILE A  1 324 ? 186.157 127.505 84.226  1.00 188.69 ? 516  ILE A HA   1 
ATOM   4425  H  HB   . ILE A  1 324 ? 184.204 128.821 82.670  1.00 181.96 ? 516  ILE A HB   1 
ATOM   4426  H  HG12 . ILE A  1 324 ? 182.872 127.306 83.564  1.00 176.76 ? 516  ILE A HG12 1 
ATOM   4427  H  HG13 . ILE A  1 324 ? 183.427 126.465 82.342  1.00 176.76 ? 516  ILE A HG13 1 
ATOM   4428  H  HG21 . ILE A  1 324 ? 184.949 127.454 80.918  1.00 178.40 ? 516  ILE A HG21 1 
ATOM   4429  H  HG22 . ILE A  1 324 ? 186.135 128.360 81.463  1.00 178.40 ? 516  ILE A HG22 1 
ATOM   4430  H  HG23 . ILE A  1 324 ? 186.046 126.830 81.883  1.00 178.40 ? 516  ILE A HG23 1 
ATOM   4431  H  HD11 . ILE A  1 324 ? 183.405 125.164 84.254  1.00 172.12 ? 516  ILE A HD11 1 
ATOM   4432  H  HD12 . ILE A  1 324 ? 184.903 125.366 83.766  1.00 172.12 ? 516  ILE A HD12 1 
ATOM   4433  H  HD13 . ILE A  1 324 ? 184.346 126.210 84.992  1.00 172.12 ? 516  ILE A HD13 1 
ATOM   4434  N  N    . ASP A  1 325 ? 186.085 130.702 84.096  1.00 188.51 ? 517  ASP A N    1 
ATOM   4435  C  CA   . ASP A  1 325 ? 186.910 131.852 83.740  1.00 195.34 ? 517  ASP A CA   1 
ATOM   4436  C  C    . ASP A  1 325 ? 188.261 131.873 84.431  1.00 204.90 ? 517  ASP A C    1 
ATOM   4437  O  O    . ASP A  1 325 ? 189.176 132.529 83.918  1.00 211.31 ? 517  ASP A O    1 
ATOM   4438  C  CB   . ASP A  1 325 ? 186.185 133.162 84.050  1.00 194.21 ? 517  ASP A CB   1 
ATOM   4439  C  CG   . ASP A  1 325 ? 185.084 133.470 83.071  1.00 191.62 ? 517  ASP A CG   1 
ATOM   4440  O  OD1  . ASP A  1 325 ? 185.142 132.951 81.935  1.00 188.96 ? 517  ASP A OD1  1 
ATOM   4441  O  OD2  . ASP A  1 325 ? 184.168 134.238 83.431  1.00 191.84 ? 517  ASP A OD2  1 
ATOM   4442  H  H    . ASP A  1 325 ? 185.339 130.890 84.481  1.00 225.96 ? 517  ASP A H    1 
ATOM   4443  H  HA   . ASP A  1 325 ? 187.072 131.828 82.784  1.00 234.16 ? 517  ASP A HA   1 
ATOM   4444  H  HB2  . ASP A  1 325 ? 185.790 133.102 84.935  1.00 232.80 ? 517  ASP A HB2  1 
ATOM   4445  H  HB3  . ASP A  1 325 ? 186.824 133.891 84.021  1.00 232.80 ? 517  ASP A HB3  1 
ATOM   4446  N  N    . LYS A  1 326 ? 188.432 131.205 85.571  1.00 207.91 ? 518  LYS A N    1 
ATOM   4447  C  CA   . LYS A  1 326 ? 189.766 131.209 86.154  1.00 202.73 ? 518  LYS A CA   1 
ATOM   4448  C  C    . LYS A  1 326 ? 190.764 130.609 85.179  1.00 197.63 ? 518  LYS A C    1 
ATOM   4449  O  O    . LYS A  1 326 ? 190.454 129.670 84.448  1.00 194.51 ? 518  LYS A O    1 
ATOM   4450  C  CB   . LYS A  1 326 ? 189.810 130.440 87.477  1.00 197.15 ? 518  LYS A CB   1 
ATOM   4451  C  CG   . LYS A  1 326 ? 189.779 128.923 87.334  1.00 190.60 ? 518  LYS A CG   1 
ATOM   4452  C  CD   . LYS A  1 326 ? 189.844 128.264 88.702  1.00 187.80 ? 518  LYS A CD   1 
ATOM   4453  C  CE   . LYS A  1 326 ? 189.737 126.760 88.598  1.00 180.70 ? 518  LYS A CE   1 
ATOM   4454  N  NZ   . LYS A  1 326 ? 189.757 126.119 89.938  1.00 177.81 ? 518  LYS A NZ   1 
ATOM   4455  H  H    . LYS A  1 326 ? 187.830 130.768 86.002  1.00 249.25 ? 518  LYS A H    1 
ATOM   4456  H  HA   . LYS A  1 326 ? 190.032 132.125 86.330  1.00 243.03 ? 518  LYS A HA   1 
ATOM   4457  H  HB2  . LYS A  1 326 ? 190.627 130.675 87.944  1.00 236.34 ? 518  LYS A HB2  1 
ATOM   4458  H  HB3  . LYS A  1 326 ? 189.043 130.701 88.011  1.00 236.34 ? 518  LYS A HB3  1 
ATOM   4459  H  HG2  . LYS A  1 326 ? 188.953 128.655 86.903  1.00 228.48 ? 518  LYS A HG2  1 
ATOM   4460  H  HG3  . LYS A  1 326 ? 190.544 128.631 86.815  1.00 228.48 ? 518  LYS A HG3  1 
ATOM   4461  H  HD2  . LYS A  1 326 ? 190.692 128.480 89.122  1.00 225.12 ? 518  LYS A HD2  1 
ATOM   4462  H  HD3  . LYS A  1 326 ? 189.109 128.584 89.247  1.00 225.12 ? 518  LYS A HD3  1 
ATOM   4463  H  HE2  . LYS A  1 326 ? 188.902 126.528 88.162  1.00 216.60 ? 518  LYS A HE2  1 
ATOM   4464  H  HE3  . LYS A  1 326 ? 190.489 126.420 88.087  1.00 216.60 ? 518  LYS A HE3  1 
ATOM   4465  H  HZ1  . LYS A  1 326 ? 189.692 125.236 89.853  1.00 213.13 ? 518  LYS A HZ1  1 
ATOM   4466  H  HZ2  . LYS A  1 326 ? 190.517 126.315 90.357  1.00 213.13 ? 518  LYS A HZ2  1 
ATOM   4467  H  HZ3  . LYS A  1 326 ? 189.073 126.413 90.425  1.00 213.13 ? 518  LYS A HZ3  1 
ATOM   4468  N  N    . GLU A  1 327 ? 191.980 131.156 85.181  1.00 186.42 ? 519  GLU A N    1 
ATOM   4469  C  CA   . GLU A  1 327 ? 192.996 130.650 84.275  1.00 181.49 ? 519  GLU A CA   1 
ATOM   4470  C  C    . GLU A  1 327 ? 193.428 129.232 84.635  1.00 170.37 ? 519  GLU A C    1 
ATOM   4471  O  O    . GLU A  1 327 ? 193.810 128.456 83.750  1.00 168.29 ? 519  GLU A O    1 
ATOM   4472  C  CB   . GLU A  1 327 ? 194.193 131.596 84.268  1.00 186.04 ? 519  GLU A CB   1 
ATOM   4473  C  CG   . GLU A  1 327 ? 195.270 131.195 83.300  1.00 186.99 ? 519  GLU A CG   1 
ATOM   4474  C  CD   . GLU A  1 327 ? 194.854 131.416 81.867  1.00 188.21 ? 519  GLU A CD   1 
ATOM   4475  O  OE1  . GLU A  1 327 ? 194.202 132.442 81.574  1.00 191.00 ? 519  GLU A OE1  1 
ATOM   4476  O  OE2  . GLU A  1 327 ? 195.156 130.537 81.039  1.00 185.97 ? 519  GLU A OE2  1 
ATOM   4477  H  H    . GLU A  1 327 ? 192.232 131.805 85.686  1.00 223.45 ? 519  GLU A H    1 
ATOM   4478  H  HA   . GLU A  1 327 ? 192.630 130.628 83.377  1.00 217.54 ? 519  GLU A HA   1 
ATOM   4479  H  HB2  . GLU A  1 327 ? 193.889 132.484 84.024  1.00 223.00 ? 519  GLU A HB2  1 
ATOM   4480  H  HB3  . GLU A  1 327 ? 194.583 131.613 85.156  1.00 223.00 ? 519  GLU A HB3  1 
ATOM   4481  H  HG2  . GLU A  1 327 ? 196.064 131.726 83.469  1.00 224.14 ? 519  GLU A HG2  1 
ATOM   4482  H  HG3  . GLU A  1 327 ? 195.467 130.253 83.415  1.00 224.14 ? 519  GLU A HG3  1 
ATOM   4483  N  N    . SER A  1 328 ? 193.365 128.876 85.912  1.00 152.93 ? 520  SER A N    1 
ATOM   4484  C  CA   . SER A  1 328 ? 193.825 127.572 86.373  1.00 144.38 ? 520  SER A CA   1 
ATOM   4485  C  C    . SER A  1 328 ? 192.971 126.431 85.825  1.00 139.06 ? 520  SER A C    1 
ATOM   4486  O  O    . SER A  1 328 ? 191.739 126.461 85.907  1.00 135.27 ? 520  SER A O    1 
ATOM   4487  C  CB   . SER A  1 328 ? 193.826 127.536 87.901  1.00 143.39 ? 520  SER A CB   1 
ATOM   4488  O  OG   . SER A  1 328 ? 194.150 126.242 88.377  1.00 140.31 ? 520  SER A OG   1 
ATOM   4489  H  H    . SER A  1 328 ? 193.056 129.378 86.538  1.00 183.27 ? 520  SER A H    1 
ATOM   4490  H  HA   . SER A  1 328 ? 194.736 127.435 86.071  1.00 173.00 ? 520  SER A HA   1 
ATOM   4491  H  HB2  . SER A  1 328 ? 194.484 128.167 88.231  1.00 171.83 ? 520  SER A HB2  1 
ATOM   4492  H  HB3  . SER A  1 328 ? 192.943 127.778 88.223  1.00 171.83 ? 520  SER A HB3  1 
ATOM   4493  H  HG   . SER A  1 328 ? 194.147 126.237 89.217  1.00 168.13 ? 520  SER A HG   1 
ATOM   4494  N  N    . ASP A  1 329 ? 193.641 125.423 85.264  1.00 133.77 ? 521  ASP A N    1 
ATOM   4495  C  CA   . ASP A  1 329 ? 192.982 124.228 84.747  1.00 131.31 ? 521  ASP A CA   1 
ATOM   4496  C  C    . ASP A  1 329 ? 192.773 123.238 85.887  1.00 126.65 ? 521  ASP A C    1 
ATOM   4497  O  O    . ASP A  1 329 ? 193.741 122.778 86.502  1.00 127.96 ? 521  ASP A O    1 
ATOM   4498  C  CB   . ASP A  1 329 ? 193.824 123.596 83.639  1.00 131.26 ? 521  ASP A CB   1 
ATOM   4499  C  CG   . ASP A  1 329 ? 193.191 122.343 83.064  1.00 131.17 ? 521  ASP A CG   1 
ATOM   4500  O  OD1  . ASP A  1 329 ? 192.022 122.052 83.398  1.00 131.57 ? 521  ASP A OD1  1 
ATOM   4501  O  OD2  . ASP A  1 329 ? 193.866 121.647 82.277  1.00 130.22 ? 521  ASP A OD2  1 
ATOM   4502  H  H    . ASP A  1 329 ? 194.496 125.410 85.171  1.00 160.28 ? 521  ASP A H    1 
ATOM   4503  H  HA   . ASP A  1 329 ? 192.117 124.466 84.380  1.00 157.32 ? 521  ASP A HA   1 
ATOM   4504  H  HB2  . ASP A  1 329 ? 193.931 124.236 82.919  1.00 157.26 ? 521  ASP A HB2  1 
ATOM   4505  H  HB3  . ASP A  1 329 ? 194.692 123.354 84.001  1.00 157.26 ? 521  ASP A HB3  1 
ATOM   4506  N  N    . ASP A  1 330 ? 191.511 122.910 86.171  1.00 118.65 ? 522  ASP A N    1 
ATOM   4507  C  CA   . ASP A  1 330 ? 191.217 121.998 87.272  1.00 116.22 ? 522  ASP A CA   1 
ATOM   4508  C  C    . ASP A  1 330 ? 191.782 120.602 87.025  1.00 109.95 ? 522  ASP A C    1 
ATOM   4509  O  O    . ASP A  1 330 ? 192.237 119.940 87.964  1.00 109.05 ? 522  ASP A O    1 
ATOM   4510  C  CB   . ASP A  1 330 ? 189.707 121.927 87.506  1.00 116.93 ? 522  ASP A CB   1 
ATOM   4511  C  CG   . ASP A  1 330 ? 189.178 123.120 88.277  1.00 122.88 ? 522  ASP A CG   1 
ATOM   4512  O  OD1  . ASP A  1 330 ? 189.993 123.876 88.846  1.00 127.12 ? 522  ASP A OD1  1 
ATOM   4513  O  OD2  . ASP A  1 330 ? 187.941 123.295 88.324  1.00 123.34 ? 522  ASP A OD2  1 
ATOM   4514  H  H    . ASP A  1 330 ? 190.819 123.197 85.748  1.00 142.13 ? 522  ASP A H    1 
ATOM   4515  H  HA   . ASP A  1 330 ? 191.626 122.343 88.081  1.00 139.22 ? 522  ASP A HA   1 
ATOM   4516  H  HB2  . ASP A  1 330 ? 189.256 121.899 86.648  1.00 140.07 ? 522  ASP A HB2  1 
ATOM   4517  H  HB3  . ASP A  1 330 ? 189.503 121.126 88.014  1.00 140.07 ? 522  ASP A HB3  1 
ATOM   4518  N  N    . VAL A  1 331 ? 191.771 120.132 85.773  1.00 102.14 ? 523  VAL A N    1 
ATOM   4519  C  CA   . VAL A  1 331 ? 192.321 118.807 85.487  1.00 98.73  ? 523  VAL A CA   1 
ATOM   4520  C  C    . VAL A  1 331 ? 193.810 118.784 85.793  1.00 97.63  ? 523  VAL A C    1 
ATOM   4521  O  O    . VAL A  1 331 ? 194.301 117.931 86.543  1.00 97.38  ? 523  VAL A O    1 
ATOM   4522  C  CB   . VAL A  1 331 ? 192.058 118.408 84.023  1.00 98.52  ? 523  VAL A CB   1 
ATOM   4523  C  CG1  . VAL A  1 331 ? 192.738 117.070 83.707  1.00 95.41  ? 523  VAL A CG1  1 
ATOM   4524  C  CG2  . VAL A  1 331 ? 190.571 118.322 83.741  1.00 97.37  ? 523  VAL A CG2  1 
ATOM   4525  H  H    . VAL A  1 331 ? 191.459 120.550 85.090  1.00 122.32 ? 523  VAL A H    1 
ATOM   4526  H  HA   . VAL A  1 331 ? 191.887 118.154 86.058  1.00 118.23 ? 523  VAL A HA   1 
ATOM   4527  H  HB   . VAL A  1 331 ? 192.437 119.083 83.438  1.00 117.97 ? 523  VAL A HB   1 
ATOM   4528  H  HG11 . VAL A  1 331 ? 192.561 116.838 82.782  1.00 114.24 ? 523  VAL A HG11 1 
ATOM   4529  H  HG12 . VAL A  1 331 ? 193.694 117.161 83.848  1.00 114.24 ? 523  VAL A HG12 1 
ATOM   4530  H  HG13 . VAL A  1 331 ? 192.380 116.387 84.295  1.00 114.24 ? 523  VAL A HG13 1 
ATOM   4531  H  HG21 . VAL A  1 331 ? 190.440 118.069 82.813  1.00 116.60 ? 523  VAL A HG21 1 
ATOM   4532  H  HG22 . VAL A  1 331 ? 190.177 117.654 84.324  1.00 116.60 ? 523  VAL A HG22 1 
ATOM   4533  H  HG23 . VAL A  1 331 ? 190.167 119.188 83.908  1.00 116.60 ? 523  VAL A HG23 1 
ATOM   4534  N  N    . LEU A  1 332 ? 194.550 119.724 85.210  1.00 96.62  ? 524  LEU A N    1 
ATOM   4535  C  CA   . LEU A  1 332 ? 195.989 119.785 85.431  1.00 95.81  ? 524  LEU A CA   1 
ATOM   4536  C  C    . LEU A  1 332 ? 196.309 119.987 86.905  1.00 98.58  ? 524  LEU A C    1 
ATOM   4537  O  O    . LEU A  1 332 ? 197.232 119.362 87.441  1.00 97.84  ? 524  LEU A O    1 
ATOM   4538  C  CB   . LEU A  1 332 ? 196.589 120.882 84.550  1.00 97.38  ? 524  LEU A CB   1 
ATOM   4539  C  CG   . LEU A  1 332 ? 198.087 121.147 84.633  1.00 99.76  ? 524  LEU A CG   1 
ATOM   4540  C  CD1  . LEU A  1 332 ? 198.876 119.862 84.530  1.00 95.61  ? 524  LEU A CD1  1 
ATOM   4541  C  CD2  . LEU A  1 332 ? 198.455 122.048 83.470  1.00 101.49 ? 524  LEU A CD2  1 
ATOM   4542  H  H    . LEU A  1 332 ? 194.245 120.334 84.686  1.00 115.70 ? 524  LEU A H    1 
ATOM   4543  H  HA   . LEU A  1 332 ? 196.381 118.941 85.158  1.00 114.72 ? 524  LEU A HA   1 
ATOM   4544  H  HB2  . LEU A  1 332 ? 196.395 120.658 83.626  1.00 116.60 ? 524  LEU A HB2  1 
ATOM   4545  H  HB3  . LEU A  1 332 ? 196.144 121.715 84.771  1.00 116.60 ? 524  LEU A HB3  1 
ATOM   4546  H  HG   . LEU A  1 332 ? 198.306 121.593 85.466  1.00 119.46 ? 524  LEU A HG   1 
ATOM   4547  H  HD11 . LEU A  1 332 ? 199.822 120.068 84.586  1.00 114.49 ? 524  LEU A HD11 1 
ATOM   4548  H  HD12 . LEU A  1 332 ? 198.620 119.276 85.259  1.00 114.49 ? 524  LEU A HD12 1 
ATOM   4549  H  HD13 . LEU A  1 332 ? 198.679 119.439 83.679  1.00 114.49 ? 524  LEU A HD13 1 
ATOM   4550  H  HD21 . LEU A  1 332 ? 199.407 122.232 83.502  1.00 121.54 ? 524  LEU A HD21 1 
ATOM   4551  H  HD22 . LEU A  1 332 ? 198.232 121.599 82.640  1.00 121.54 ? 524  LEU A HD22 1 
ATOM   4552  H  HD23 . LEU A  1 332 ? 197.955 122.877 83.543  1.00 121.54 ? 524  LEU A HD23 1 
ATOM   4553  N  N    . GLU A  1 333 ? 195.558 120.859 87.577  1.00 108.24 ? 525  GLU A N    1 
ATOM   4554  C  CA   . GLU A  1 333 ? 195.773 121.081 89.002  1.00 114.22 ? 525  GLU A CA   1 
ATOM   4555  C  C    . GLU A  1 333 ? 195.523 119.805 89.800  1.00 111.35 ? 525  GLU A C    1 
ATOM   4556  O  O    . GLU A  1 333 ? 196.243 119.515 90.763  1.00 111.07 ? 525  GLU A O    1 
ATOM   4557  C  CB   . GLU A  1 333 ? 194.870 122.219 89.481  1.00 121.34 ? 525  GLU A CB   1 
ATOM   4558  C  CG   . GLU A  1 333 ? 195.227 122.799 90.837  1.00 127.11 ? 525  GLU A CG   1 
ATOM   4559  C  CD   . GLU A  1 333 ? 194.422 124.046 91.152  1.00 133.27 ? 525  GLU A CD   1 
ATOM   4560  O  OE1  . GLU A  1 333 ? 193.428 124.307 90.440  1.00 133.50 ? 525  GLU A OE1  1 
ATOM   4561  O  OE2  . GLU A  1 333 ? 194.791 124.772 92.100  1.00 137.47 ? 525  GLU A OE2  1 
ATOM   4562  H  H    . GLU A  1 333 ? 194.925 121.330 87.234  1.00 129.64 ? 525  GLU A H    1 
ATOM   4563  H  HA   . GLU A  1 333 ? 196.694 121.348 89.145  1.00 136.82 ? 525  GLU A HA   1 
ATOM   4564  H  HB2  . GLU A  1 333 ? 194.914 122.940 88.833  1.00 145.36 ? 525  GLU A HB2  1 
ATOM   4565  H  HB3  . GLU A  1 333 ? 193.960 121.887 89.535  1.00 145.36 ? 525  GLU A HB3  1 
ATOM   4566  H  HG2  . GLU A  1 333 ? 195.044 122.139 91.524  1.00 152.29 ? 525  GLU A HG2  1 
ATOM   4567  H  HG3  . GLU A  1 333 ? 196.167 123.037 90.844  1.00 152.29 ? 525  GLU A HG3  1 
ATOM   4568  N  N    . ARG A  1 334 ? 194.506 119.030 89.413  1.00 106.46 ? 526  ARG A N    1 
ATOM   4569  C  CA   . ARG A  1 334 ? 194.209 117.775 90.102  1.00 103.13 ? 526  ARG A CA   1 
ATOM   4570  C  C    . ARG A  1 334 ? 195.335 116.761 89.936  1.00 103.58 ? 526  ARG A C    1 
ATOM   4571  O  O    . ARG A  1 334 ? 195.857 116.233 90.925  1.00 103.01 ? 526  ARG A O    1 
ATOM   4572  C  CB   . ARG A  1 334 ? 192.890 117.193 89.585  1.00 98.59  ? 526  ARG A CB   1 
ATOM   4573  C  CG   . ARG A  1 334 ? 192.629 115.728 89.961  1.00 97.14  ? 526  ARG A CG   1 
ATOM   4574  C  CD   . ARG A  1 334 ? 192.222 115.599 91.418  1.00 99.30  ? 526  ARG A CD   1 
ATOM   4575  N  NE   . ARG A  1 334 ? 192.235 114.211 91.877  1.00 97.64  ? 526  ARG A NE   1 
ATOM   4576  C  CZ   . ARG A  1 334 ? 193.262 113.622 92.485  1.00 99.37  ? 526  ARG A CZ   1 
ATOM   4577  N  NH1  . ARG A  1 334 ? 194.386 114.289 92.712  1.00 101.41 ? 526  ARG A NH1  1 
ATOM   4578  N  NH2  . ARG A  1 334 ? 193.166 112.355 92.865  1.00 100.18 ? 526  ARG A NH2  1 
ATOM   4579  H  H    . ARG A  1 334 ? 193.977 119.208 88.758  1.00 127.51 ? 526  ARG A H    1 
ATOM   4580  H  HA   . ARG A  1 334 ? 194.105 117.954 91.050  1.00 123.51 ? 526  ARG A HA   1 
ATOM   4581  H  HB2  . ARG A  1 334 ? 192.159 117.721 89.943  1.00 118.06 ? 526  ARG A HB2  1 
ATOM   4582  H  HB3  . ARG A  1 334 ? 192.887 117.251 88.616  1.00 118.06 ? 526  ARG A HB3  1 
ATOM   4583  H  HG2  . ARG A  1 334 ? 191.910 115.379 89.412  1.00 116.32 ? 526  ARG A HG2  1 
ATOM   4584  H  HG3  . ARG A  1 334 ? 193.439 115.213 89.824  1.00 116.32 ? 526  ARG A HG3  1 
ATOM   4585  H  HD2  . ARG A  1 334 ? 192.842 116.104 91.967  1.00 118.91 ? 526  ARG A HD2  1 
ATOM   4586  H  HD3  . ARG A  1 334 ? 191.322 115.944 91.529  1.00 118.91 ? 526  ARG A HD3  1 
ATOM   4587  H  HE   . ARG A  1 334 ? 191.527 113.740 91.744  1.00 116.92 ? 526  ARG A HE   1 
ATOM   4588  H  HH11 . ARG A  1 334 ? 194.455 115.111 92.469  1.00 121.44 ? 526  ARG A HH11 1 
ATOM   4589  H  HH12 . ARG A  1 334 ? 195.045 113.899 93.105  1.00 121.44 ? 526  ARG A HH12 1 
ATOM   4590  H  HH21 . ARG A  1 334 ? 192.441 111.915 92.720  1.00 119.97 ? 526  ARG A HH21 1 
ATOM   4591  H  HH22 . ARG A  1 334 ? 193.830 111.972 93.256  1.00 119.97 ? 526  ARG A HH22 1 
ATOM   4592  N  N    . ILE A  1 335 ? 195.719 116.468 88.691  1.00 108.84 ? 527  ILE A N    1 
ATOM   4593  C  CA   . ILE A  1 335 ? 196.693 115.406 88.450  1.00 110.66 ? 527  ILE A CA   1 
ATOM   4594  C  C    . ILE A  1 335 ? 198.017 115.720 89.129  1.00 113.51 ? 527  ILE A C    1 
ATOM   4595  O  O    . ILE A  1 335 ? 198.761 114.805 89.504  1.00 114.65 ? 527  ILE A O    1 
ATOM   4596  C  CB   . ILE A  1 335 ? 196.868 115.154 86.937  1.00 111.37 ? 527  ILE A CB   1 
ATOM   4597  C  CG1  . ILE A  1 335 ? 197.367 116.410 86.222  1.00 117.15 ? 527  ILE A CG1  1 
ATOM   4598  C  CG2  . ILE A  1 335 ? 195.559 114.668 86.329  1.00 106.82 ? 527  ILE A CG2  1 
ATOM   4599  C  CD1  . ILE A  1 335 ? 197.914 116.136 84.838  1.00 117.14 ? 527  ILE A CD1  1 
ATOM   4600  H  H    . ILE A  1 335 ? 195.435 116.862 87.982  1.00 130.36 ? 527  ILE A H    1 
ATOM   4601  H  HA   . ILE A  1 335 ? 196.354 114.586 88.842  1.00 132.55 ? 527  ILE A HA   1 
ATOM   4602  H  HB   . ILE A  1 335 ? 197.532 114.457 86.822  1.00 133.39 ? 527  ILE A HB   1 
ATOM   4603  H  HG12 . ILE A  1 335 ? 196.629 117.034 86.133  1.00 140.34 ? 527  ILE A HG12 1 
ATOM   4604  H  HG13 . ILE A  1 335 ? 198.076 116.811 86.749  1.00 140.34 ? 527  ILE A HG13 1 
ATOM   4605  H  HG21 . ILE A  1 335 ? 195.689 114.516 85.380  1.00 127.94 ? 527  ILE A HG21 1 
ATOM   4606  H  HG22 . ILE A  1 335 ? 195.296 113.842 86.764  1.00 127.94 ? 527  ILE A HG22 1 
ATOM   4607  H  HG23 . ILE A  1 335 ? 194.877 115.345 86.465  1.00 127.94 ? 527  ILE A HG23 1 
ATOM   4608  H  HD11 . ILE A  1 335 ? 198.211 116.972 84.445  1.00 140.32 ? 527  ILE A HD11 1 
ATOM   4609  H  HD12 . ILE A  1 335 ? 198.661 115.521 84.910  1.00 140.32 ? 527  ILE A HD12 1 
ATOM   4610  H  HD13 . ILE A  1 335 ? 197.214 115.745 84.293  1.00 140.32 ? 527  ILE A HD13 1 
ATOM   4611  N  N    . MET A  1 336 ? 198.344 117.001 89.295  1.00 119.75 ? 528  MET A N    1 
ATOM   4612  C  CA   . MET A  1 336 ? 199.584 117.362 89.970  1.00 122.92 ? 528  MET A CA   1 
ATOM   4613  C  C    . MET A  1 336 ? 199.471 117.278 91.485  1.00 120.94 ? 528  MET A C    1 
ATOM   4614  O  O    . MET A  1 336 ? 200.490 117.413 92.173  1.00 122.87 ? 528  MET A O    1 
ATOM   4615  C  CB   . MET A  1 336 ? 200.008 118.783 89.581  1.00 129.76 ? 528  MET A CB   1 
ATOM   4616  C  CG   . MET A  1 336 ? 201.290 118.863 88.763  1.00 136.14 ? 528  MET A CG   1 
ATOM   4617  S  SD   . MET A  1 336 ? 201.003 119.514 87.108  1.00 142.30 ? 528  MET A SD   1 
ATOM   4618  C  CE   . MET A  1 336 ? 200.808 121.260 87.463  1.00 141.48 ? 528  MET A CE   1 
ATOM   4619  H  H    . MET A  1 336 ? 197.871 117.669 89.030  1.00 143.45 ? 528  MET A H    1 
ATOM   4620  H  HA   . MET A  1 336 ? 200.282 116.757 89.677  1.00 147.26 ? 528  MET A HA   1 
ATOM   4621  H  HB2  . MET A  1 336 ? 199.298 119.185 89.056  1.00 155.47 ? 528  MET A HB2  1 
ATOM   4622  H  HB3  . MET A  1 336 ? 200.144 119.298 90.392  1.00 155.47 ? 528  MET A HB3  1 
ATOM   4623  H  HG2  . MET A  1 336 ? 201.918 119.449 89.213  1.00 163.12 ? 528  MET A HG2  1 
ATOM   4624  H  HG3  . MET A  1 336 ? 201.667 117.974 88.676  1.00 163.12 ? 528  MET A HG3  1 
ATOM   4625  H  HE1  . MET A  1 336 ? 200.644 121.734 86.632  1.00 169.53 ? 528  MET A HE1  1 
ATOM   4626  H  HE2  . MET A  1 336 ? 200.057 121.378 88.065  1.00 169.53 ? 528  MET A HE2  1 
ATOM   4627  H  HE3  . MET A  1 336 ? 201.620 121.590 87.878  1.00 169.53 ? 528  MET A HE3  1 
ATOM   4628  N  N    . ASP A  1 337 ? 198.270 117.060 92.015  1.00 105.63 ? 529  ASP A N    1 
ATOM   4629  C  CA   . ASP A  1 337 ? 198.085 116.768 93.431  1.00 103.83 ? 529  ASP A CA   1 
ATOM   4630  C  C    . ASP A  1 337 ? 197.954 115.255 93.606  1.00 101.84 ? 529  ASP A C    1 
ATOM   4631  O  O    . ASP A  1 337 ? 196.912 114.717 93.991  1.00 98.26  ? 529  ASP A O    1 
ATOM   4632  C  CB   . ASP A  1 337 ? 196.863 117.509 93.968  1.00 107.19 ? 529  ASP A CB   1 
ATOM   4633  C  CG   . ASP A  1 337 ? 196.644 117.278 95.448  1.00 108.70 ? 529  ASP A CG   1 
ATOM   4634  O  OD1  . ASP A  1 337 ? 197.561 116.746 96.108  1.00 109.77 ? 529  ASP A OD1  1 
ATOM   4635  O  OD2  . ASP A  1 337 ? 195.553 117.628 95.948  1.00 107.75 ? 529  ASP A OD2  1 
ATOM   4636  H  H    . ASP A  1 337 ? 197.536 117.077 91.566  1.00 126.51 ? 529  ASP A H    1 
ATOM   4637  H  HA   . ASP A  1 337 ? 198.864 117.067 93.926  1.00 124.35 ? 529  ASP A HA   1 
ATOM   4638  H  HB2  . ASP A  1 337 ? 196.983 118.461 93.828  1.00 128.38 ? 529  ASP A HB2  1 
ATOM   4639  H  HB3  . ASP A  1 337 ? 196.073 117.201 93.496  1.00 128.38 ? 529  ASP A HB3  1 
ATOM   4640  N  N    . GLU A  1 338 ? 199.062 114.568 93.324  1.00 114.85 ? 530  GLU A N    1 
ATOM   4641  C  CA   . GLU A  1 338 ? 199.084 113.113 93.260  1.00 115.59 ? 530  GLU A CA   1 
ATOM   4642  C  C    . GLU A  1 338 ? 198.916 112.461 94.625  1.00 113.96 ? 530  GLU A C    1 
ATOM   4643  O  O    . GLU A  1 338 ? 198.797 111.232 94.679  1.00 113.72 ? 530  GLU A O    1 
ATOM   4644  C  CB   . GLU A  1 338 ? 200.391 112.638 92.631  1.00 121.92 ? 530  GLU A CB   1 
ATOM   4645  C  CG   . GLU A  1 338 ? 200.587 113.107 91.203  1.00 127.21 ? 530  GLU A CG   1 
ATOM   4646  C  CD   . GLU A  1 338 ? 202.042 113.093 90.773  1.00 134.06 ? 530  GLU A CD   1 
ATOM   4647  O  OE1  . GLU A  1 338 ? 202.875 112.499 91.493  1.00 136.66 ? 530  GLU A OE1  1 
ATOM   4648  O  OE2  . GLU A  1 338 ? 202.352 113.673 89.711  1.00 137.07 ? 530  GLU A OE2  1 
ATOM   4649  H  H    . GLU A  1 338 ? 199.824 114.931 93.164  1.00 137.58 ? 530  GLU A H    1 
ATOM   4650  H  HA   . GLU A  1 338 ? 198.354 112.813 92.695  1.00 138.46 ? 530  GLU A HA   1 
ATOM   4651  H  HB2  . GLU A  1 338 ? 201.132 112.975 93.158  1.00 146.05 ? 530  GLU A HB2  1 
ATOM   4652  H  HB3  . GLU A  1 338 ? 200.403 111.668 92.628  1.00 146.05 ? 530  GLU A HB3  1 
ATOM   4653  H  HG2  . GLU A  1 338 ? 200.093 112.522 90.608  1.00 152.41 ? 530  GLU A HG2  1 
ATOM   4654  H  HG3  . GLU A  1 338 ? 200.260 114.016 91.122  1.00 152.41 ? 530  GLU A HG3  1 
ATOM   4655  N  N    . LYS A  1 339 ? 198.938 113.217 95.726  1.00 111.58 ? 531  LYS A N    1 
ATOM   4656  C  CA   . LYS A  1 339 ? 198.869 112.600 97.044  1.00 113.65 ? 531  LYS A CA   1 
ATOM   4657  C  C    . LYS A  1 339 ? 197.473 112.584 97.639  1.00 111.37 ? 531  LYS A C    1 
ATOM   4658  O  O    . LYS A  1 339 ? 197.219 111.789 98.551  1.00 111.07 ? 531  LYS A O    1 
ATOM   4659  C  CB   . LYS A  1 339 ? 199.807 113.307 98.029  1.00 119.59 ? 531  LYS A CB   1 
ATOM   4660  C  CG   . LYS A  1 339 ? 201.292 113.156 97.750  1.00 123.05 ? 531  LYS A CG   1 
ATOM   4661  C  CD   . LYS A  1 339 ? 201.764 111.734 97.918  1.00 124.25 ? 531  LYS A CD   1 
ATOM   4662  C  CE   . LYS A  1 339 ? 203.262 111.628 97.668  1.00 125.42 ? 531  LYS A CE   1 
ATOM   4663  N  NZ   . LYS A  1 339 ? 203.615 111.917 96.269  1.00 124.06 ? 531  LYS A NZ   1 
ATOM   4664  H  H    . LYS A  1 339 ? 198.991 114.075 95.734  1.00 133.65 ? 531  LYS A H    1 
ATOM   4665  H  HA   . LYS A  1 339 ? 199.165 111.679 96.968  1.00 136.13 ? 531  LYS A HA   1 
ATOM   4666  H  HB2  . LYS A  1 339 ? 199.604 114.255 98.017  1.00 143.26 ? 531  LYS A HB2  1 
ATOM   4667  H  HB3  . LYS A  1 339 ? 199.641 112.953 98.917  1.00 143.26 ? 531  LYS A HB3  1 
ATOM   4668  H  HG2  . LYS A  1 339 ? 201.473 113.428 96.837  1.00 147.41 ? 531  LYS A HG2  1 
ATOM   4669  H  HG3  . LYS A  1 339 ? 201.790 113.714 98.369  1.00 147.41 ? 531  LYS A HG3  1 
ATOM   4670  H  HD2  . LYS A  1 339 ? 201.583 111.439 98.824  1.00 148.86 ? 531  LYS A HD2  1 
ATOM   4671  H  HD3  . LYS A  1 339 ? 201.305 111.165 97.280  1.00 148.86 ? 531  LYS A HD3  1 
ATOM   4672  H  HE2  . LYS A  1 339 ? 203.725 112.266 98.233  1.00 150.26 ? 531  LYS A HE2  1 
ATOM   4673  H  HE3  . LYS A  1 339 ? 203.556 110.726 97.873  1.00 150.26 ? 531  LYS A HE3  1 
ATOM   4674  H  HZ1  . LYS A  1 339 ? 204.495 111.847 96.157  1.00 148.62 ? 531  LYS A HZ1  1 
ATOM   4675  H  HZ2  . LYS A  1 339 ? 203.208 111.340 95.727  1.00 148.62 ? 531  LYS A HZ2  1 
ATOM   4676  H  HZ3  . LYS A  1 339 ? 203.361 112.743 96.056  1.00 148.62 ? 531  LYS A HZ3  1 
ATOM   4677  N  N    . THR A  1 340 ? 196.559 113.426 97.161  1.00 113.18 ? 532  THR A N    1 
ATOM   4678  C  CA   . THR A  1 340 ? 195.184 113.384 97.641  1.00 113.41 ? 532  THR A CA   1 
ATOM   4679  C  C    . THR A  1 340 ? 194.397 112.411 96.780  1.00 105.45 ? 532  THR A C    1 
ATOM   4680  O  O    . THR A  1 340 ? 194.443 112.480 95.549  1.00 102.15 ? 532  THR A O    1 
ATOM   4681  C  CB   . THR A  1 340 ? 194.536 114.765 97.611  1.00 116.94 ? 532  THR A CB   1 
ATOM   4682  O  OG1  . THR A  1 340 ? 194.639 115.309 96.291  1.00 118.08 ? 532  THR A OG1  1 
ATOM   4683  C  CG2  . THR A  1 340 ? 195.215 115.707 98.601  1.00 119.52 ? 532  THR A CG2  1 
ATOM   4684  H  H    . THR A  1 340 ? 196.709 114.026 96.563  1.00 135.56 ? 532  THR A H    1 
ATOM   4685  H  HA   . THR A  1 340 ? 195.173 113.061 98.556  1.00 135.85 ? 532  THR A HA   1 
ATOM   4686  H  HB   . THR A  1 340 ? 193.600 114.687 97.855  1.00 140.08 ? 532  THR A HB   1 
ATOM   4687  H  HG1  . THR A  1 340 ? 194.284 116.070 96.266  1.00 141.45 ? 532  THR A HG1  1 
ATOM   4688  H  HG21 . THR A  1 340 ? 194.792 116.580 98.570  1.00 143.17 ? 532  THR A HG21 1 
ATOM   4689  H  HG22 . THR A  1 340 ? 195.141 115.353 99.501  1.00 143.17 ? 532  THR A HG22 1 
ATOM   4690  H  HG23 . THR A  1 340 ? 196.154 115.804 98.376  1.00 143.17 ? 532  THR A HG23 1 
ATOM   4691  N  N    . ALA A  1 341 ? 193.682 111.505 97.435  1.00 87.32  ? 533  ALA A N    1 
ATOM   4692  C  CA   . ALA A  1 341 ? 192.969 110.439 96.758  1.00 83.07  ? 533  ALA A CA   1 
ATOM   4693  C  C    . ALA A  1 341 ? 191.576 110.890 96.342  1.00 81.48  ? 533  ALA A C    1 
ATOM   4694  O  O    . ALA A  1 341 ? 191.031 111.874 96.846  1.00 83.14  ? 533  ALA A O    1 
ATOM   4695  C  CB   . ALA A  1 341 ? 192.866 109.208 97.663  1.00 79.14  ? 533  ALA A CB   1 
ATOM   4696  H  H    . ALA A  1 341 ? 193.594 111.489 98.291  1.00 104.53 ? 533  ALA A H    1 
ATOM   4697  H  HA   . ALA A  1 341 ? 193.457 110.187 95.958  1.00 99.44  ? 533  ALA A HA   1 
ATOM   4698  H  HB1  . ALA A  1 341 ? 192.387 108.509 97.191  1.00 94.72  ? 533  ALA A HB1  1 
ATOM   4699  H  HB2  . ALA A  1 341 ? 193.760 108.905 97.885  1.00 94.72  ? 533  ALA A HB2  1 
ATOM   4700  H  HB3  . ALA A  1 341 ? 192.388 109.451 98.471  1.00 94.72  ? 533  ALA A HB3  1 
ATOM   4701  N  N    . SER A  1 342 ? 191.012 110.156 95.388  1.00 80.82  ? 534  SER A N    1 
ATOM   4702  C  CA   . SER A  1 342 ? 189.663 110.378 94.900  1.00 78.15  ? 534  SER A CA   1 
ATOM   4703  C  C    . SER A  1 342 ? 188.958 109.030 94.846  1.00 77.53  ? 534  SER A C    1 
ATOM   4704  O  O    . SER A  1 342 ? 189.586 107.972 94.939  1.00 73.01  ? 534  SER A O    1 
ATOM   4705  C  CB   . SER A  1 342 ? 189.664 111.063 93.526  1.00 79.80  ? 534  SER A CB   1 
ATOM   4706  O  OG   . SER A  1 342 ? 190.448 110.344 92.591  1.00 81.87  ? 534  SER A OG   1 
ATOM   4707  H  H    . SER A  1 342 ? 191.410 109.501 94.996  1.00 96.74  ? 534  SER A H    1 
ATOM   4708  H  HA   . SER A  1 342 ? 189.186 110.947 95.523  1.00 93.53  ? 534  SER A HA   1 
ATOM   4709  H  HB2  . SER A  1 342 ? 188.752 111.112 93.199  1.00 95.51  ? 534  SER A HB2  1 
ATOM   4710  H  HB3  . SER A  1 342 ? 190.029 111.956 93.621  1.00 95.51  ? 534  SER A HB3  1 
ATOM   4711  H  HG   . SER A  1 342 ? 190.437 110.734 91.847  1.00 98.00  ? 534  SER A HG   1 
ATOM   4712  N  N    . GLU A  1 343 ? 187.640 109.069 94.686  1.00 76.17  ? 535  GLU A N    1 
ATOM   4713  C  CA   . GLU A  1 343 ? 186.842 107.859 94.823  1.00 75.61  ? 535  GLU A CA   1 
ATOM   4714  C  C    . GLU A  1 343 ? 187.104 106.891 93.675  1.00 72.46  ? 535  GLU A C    1 
ATOM   4715  O  O    . GLU A  1 343 ? 187.292 107.294 92.524  1.00 74.64  ? 535  GLU A O    1 
ATOM   4716  C  CB   . GLU A  1 343 ? 185.358 108.215 94.890  1.00 75.69  ? 535  GLU A CB   1 
ATOM   4717  C  CG   . GLU A  1 343 ? 184.985 109.007 96.132  1.00 77.28  ? 535  GLU A CG   1 
ATOM   4718  C  CD   . GLU A  1 343 ? 183.508 109.342 96.198  1.00 78.91  ? 535  GLU A CD   1 
ATOM   4719  O  OE1  . GLU A  1 343 ? 182.761 108.934 95.284  1.00 77.80  ? 535  GLU A OE1  1 
ATOM   4720  O  OE2  . GLU A  1 343 ? 183.093 110.016 97.165  1.00 78.95  ? 535  GLU A OE2  1 
ATOM   4721  H  H    . GLU A  1 343 ? 187.188 109.777 94.501  1.00 91.15  ? 535  GLU A H    1 
ATOM   4722  H  HA   . GLU A  1 343 ? 187.081 107.414 95.651  1.00 90.48  ? 535  GLU A HA   1 
ATOM   4723  H  HB2  . GLU A  1 343 ? 185.127 108.751 94.115  1.00 90.57  ? 535  GLU A HB2  1 
ATOM   4724  H  HB3  . GLU A  1 343 ? 184.838 107.396 94.892  1.00 90.57  ? 535  GLU A HB3  1 
ATOM   4725  H  HG2  . GLU A  1 343 ? 185.209 108.485 96.919  1.00 92.49  ? 535  GLU A HG2  1 
ATOM   4726  H  HG3  . GLU A  1 343 ? 185.482 109.840 96.136  1.00 92.49  ? 535  GLU A HG3  1 
ATOM   4727  N  N    . LEU A  1 344 ? 187.123 105.601 94.008  1.00 71.52  ? 536  LEU A N    1 
ATOM   4728  C  CA   . LEU A  1 344 ? 187.372 104.524 93.061  1.00 67.70  ? 536  LEU A CA   1 
ATOM   4729  C  C    . LEU A  1 344 ? 186.316 103.447 93.247  1.00 66.95  ? 536  LEU A C    1 
ATOM   4730  O  O    . LEU A  1 344 ? 185.914 103.148 94.376  1.00 67.65  ? 536  LEU A O    1 
ATOM   4731  C  CB   . LEU A  1 344 ? 188.770 103.920 93.262  1.00 69.48  ? 536  LEU A CB   1 
ATOM   4732  C  CG   . LEU A  1 344 ? 189.085 102.627 92.503  1.00 66.61  ? 536  LEU A CG   1 
ATOM   4733  C  CD1  . LEU A  1 344 ? 189.177 102.886 91.009  1.00 68.15  ? 536  LEU A CD1  1 
ATOM   4734  C  CD2  . LEU A  1 344 ? 190.371 102.015 93.027  1.00 67.12  ? 536  LEU A CD2  1 
ATOM   4735  H  H    . LEU A  1 344 ? 186.988 105.319 94.809  1.00 85.58  ? 536  LEU A H    1 
ATOM   4736  H  HA   . LEU A  1 344 ? 187.310 104.866 92.155  1.00 80.99  ? 536  LEU A HA   1 
ATOM   4737  H  HB2  . LEU A  1 344 ? 189.425 104.580 92.986  1.00 83.12  ? 536  LEU A HB2  1 
ATOM   4738  H  HB3  . LEU A  1 344 ? 188.884 103.732 94.206  1.00 83.12  ? 536  LEU A HB3  1 
ATOM   4739  H  HG   . LEU A  1 344 ? 188.368 101.991 92.653  1.00 79.68  ? 536  LEU A HG   1 
ATOM   4740  H  HD11 . LEU A  1 344 ? 189.377 102.051 90.557  1.00 81.53  ? 536  LEU A HD11 1 
ATOM   4741  H  HD12 . LEU A  1 344 ? 188.328 103.237 90.697  1.00 81.53  ? 536  LEU A HD12 1 
ATOM   4742  H  HD13 . LEU A  1 344 ? 189.882 103.530 90.843  1.00 81.53  ? 536  LEU A HD13 1 
ATOM   4743  H  HD21 . LEU A  1 344 ? 190.554 101.198 92.536  1.00 80.30  ? 536  LEU A HD21 1 
ATOM   4744  H  HD22 . LEU A  1 344 ? 191.096 102.647 92.901  1.00 80.30  ? 536  LEU A HD22 1 
ATOM   4745  H  HD23 . LEU A  1 344 ? 190.265 101.817 93.970  1.00 80.30  ? 536  LEU A HD23 1 
ATOM   4746  N  N    . LYS A  1 345 ? 185.869 102.864 92.138  1.00 64.71  ? 537  LYS A N    1 
ATOM   4747  C  CA   . LYS A  1 345 ? 184.863 101.813 92.165  1.00 65.40  ? 537  LYS A CA   1 
ATOM   4748  C  C    . LYS A  1 345 ? 185.308 100.672 91.267  1.00 66.78  ? 537  LYS A C    1 
ATOM   4749  O  O    . LYS A  1 345 ? 185.711 100.901 90.123  1.00 68.35  ? 537  LYS A O    1 
ATOM   4750  C  CB   . LYS A  1 345 ? 183.497 102.343 91.714  1.00 70.42  ? 537  LYS A CB   1 
ATOM   4751  C  CG   . LYS A  1 345 ? 182.398 101.286 91.673  1.00 73.69  ? 537  LYS A CG   1 
ATOM   4752  C  CD   . LYS A  1 345 ? 182.186 100.650 93.037  1.00 75.06  ? 537  LYS A CD   1 
ATOM   4753  C  CE   . LYS A  1 345 ? 180.956 99.759  93.051  1.00 75.68  ? 537  LYS A CE   1 
ATOM   4754  N  NZ   . LYS A  1 345 ? 180.701 99.192  94.403  1.00 75.53  ? 537  LYS A NZ   1 
ATOM   4755  H  H    . LYS A  1 345 ? 186.139 103.065 91.346  1.00 77.41  ? 537  LYS A H    1 
ATOM   4756  H  HA   . LYS A  1 345 ? 184.776 101.474 93.070  1.00 78.23  ? 537  LYS A HA   1 
ATOM   4757  H  HB2  . LYS A  1 345 ? 183.215 103.038 92.329  1.00 84.26  ? 537  LYS A HB2  1 
ATOM   4758  H  HB3  . LYS A  1 345 ? 183.586 102.711 90.821  1.00 84.26  ? 537  LYS A HB3  1 
ATOM   4759  H  HG2  . LYS A  1 345 ? 181.566 101.701 91.398  1.00 88.17  ? 537  LYS A HG2  1 
ATOM   4760  H  HG3  . LYS A  1 345 ? 182.649 100.588 91.048  1.00 88.17  ? 537  LYS A HG3  1 
ATOM   4761  H  HD2  . LYS A  1 345 ? 182.957 100.107 93.260  1.00 89.82  ? 537  LYS A HD2  1 
ATOM   4762  H  HD3  . LYS A  1 345 ? 182.063 101.348 93.699  1.00 89.82  ? 537  LYS A HD3  1 
ATOM   4763  H  HE2  . LYS A  1 345 ? 180.180 100.281 92.790  1.00 90.57  ? 537  LYS A HE2  1 
ATOM   4764  H  HE3  . LYS A  1 345 ? 181.088 99.023  92.433  1.00 90.57  ? 537  LYS A HE3  1 
ATOM   4765  H  HZ1  . LYS A  1 345 ? 179.976 98.675  94.385  1.00 90.39  ? 537  LYS A HZ1  1 
ATOM   4766  H  HZ2  . LYS A  1 345 ? 181.398 98.704  94.665  1.00 90.39  ? 537  LYS A HZ2  1 
ATOM   4767  H  HZ3  . LYS A  1 345 ? 180.572 99.849  94.989  1.00 90.39  ? 537  LYS A HZ3  1 
ATOM   4768  N  N    . ILE A  1 346 ? 185.228 99.450  91.786  1.00 67.04  ? 538  ILE A N    1 
ATOM   4769  C  CA   . ILE A  1 346 ? 185.558 98.244  91.035  1.00 65.01  ? 538  ILE A CA   1 
ATOM   4770  C  C    . ILE A  1 346 ? 184.262 97.560  90.628  1.00 62.22  ? 538  ILE A C    1 
ATOM   4771  O  O    . ILE A  1 346 ? 183.386 97.319  91.468  1.00 66.09  ? 538  ILE A O    1 
ATOM   4772  C  CB   . ILE A  1 346 ? 186.446 97.300  91.861  1.00 66.61  ? 538  ILE A CB   1 
ATOM   4773  C  CG1  . ILE A  1 346 ? 187.743 98.014  92.249  1.00 69.61  ? 538  ILE A CG1  1 
ATOM   4774  C  CG2  . ILE A  1 346 ? 186.745 96.032  91.069  1.00 67.17  ? 538  ILE A CG2  1 
ATOM   4775  C  CD1  . ILE A  1 346 ? 188.597 97.249  93.229  1.00 75.87  ? 538  ILE A CD1  1 
ATOM   4776  H  H    . ILE A  1 346 ? 184.979 99.290  92.594  1.00 80.19  ? 538  ILE A H    1 
ATOM   4777  H  HA   . ILE A  1 346 ? 186.040 98.490  90.229  1.00 77.77  ? 538  ILE A HA   1 
ATOM   4778  H  HB   . ILE A  1 346 ? 185.971 97.056  92.671  1.00 79.68  ? 538  ILE A HB   1 
ATOM   4779  H  HG12 . ILE A  1 346 ? 188.271 98.159  91.448  1.00 83.28  ? 538  ILE A HG12 1 
ATOM   4780  H  HG13 . ILE A  1 346 ? 187.521 98.867  92.653  1.00 83.28  ? 538  ILE A HG13 1 
ATOM   4781  H  HG21 . ILE A  1 346 ? 187.305 95.450  91.606  1.00 80.36  ? 538  ILE A HG21 1 
ATOM   4782  H  HG22 . ILE A  1 346 ? 185.909 95.587  90.860  1.00 80.36  ? 538  ILE A HG22 1 
ATOM   4783  H  HG23 . ILE A  1 346 ? 187.206 96.273  90.251  1.00 80.36  ? 538  ILE A HG23 1 
ATOM   4784  H  HD11 . ILE A  1 346 ? 189.395 97.766  93.422  1.00 90.79  ? 538  ILE A HD11 1 
ATOM   4785  H  HD12 . ILE A  1 346 ? 188.090 97.106  94.044  1.00 90.79  ? 538  ILE A HD12 1 
ATOM   4786  H  HD13 . ILE A  1 346 ? 188.841 96.397  92.837  1.00 90.79  ? 538  ILE A HD13 1 
ATOM   4787  N  N    . LEU A  1 347 ? 184.140 97.246  89.343  1.00 64.87  ? 539  LEU A N    1 
ATOM   4788  C  CA   . LEU A  1 347 ? 182.935 96.648  88.782  1.00 63.37  ? 539  LEU A CA   1 
ATOM   4789  C  C    . LEU A  1 347 ? 183.219 95.186  88.465  1.00 66.66  ? 539  LEU A C    1 
ATOM   4790  O  O    . LEU A  1 347 ? 184.011 94.882  87.568  1.00 70.15  ? 539  LEU A O    1 
ATOM   4791  C  CB   . LEU A  1 347 ? 182.487 97.401  87.532  1.00 63.71  ? 539  LEU A CB   1 
ATOM   4792  C  CG   . LEU A  1 347 ? 182.175 98.881  87.741  1.00 64.39  ? 539  LEU A CG   1 
ATOM   4793  C  CD1  . LEU A  1 347 ? 181.976 99.575  86.405  1.00 66.42  ? 539  LEU A CD1  1 
ATOM   4794  C  CD2  . LEU A  1 347 ? 180.946 99.038  88.621  1.00 66.37  ? 539  LEU A CD2  1 
ATOM   4795  H  H    . LEU A  1 347 ? 184.760 97.374  88.760  1.00 77.60  ? 539  LEU A H    1 
ATOM   4796  H  HA   . LEU A  1 347 ? 182.220 96.687  89.436  1.00 75.80  ? 539  LEU A HA   1 
ATOM   4797  H  HB2  . LEU A  1 347 ? 183.192 97.342  86.869  1.00 76.20  ? 539  LEU A HB2  1 
ATOM   4798  H  HB3  . LEU A  1 347 ? 181.684 96.979  87.190  1.00 76.20  ? 539  LEU A HB3  1 
ATOM   4799  H  HG   . LEU A  1 347 ? 182.923 99.302  88.191  1.00 77.02  ? 539  LEU A HG   1 
ATOM   4800  H  HD11 . LEU A  1 347 ? 181.779 100.512 86.562  1.00 79.45  ? 539  LEU A HD11 1 
ATOM   4801  H  HD12 . LEU A  1 347 ? 182.789 99.491  85.882  1.00 79.45  ? 539  LEU A HD12 1 
ATOM   4802  H  HD13 . LEU A  1 347 ? 181.237 99.155  85.938  1.00 79.45  ? 539  LEU A HD13 1 
ATOM   4803  H  HD21 . LEU A  1 347 ? 180.764 99.983  88.741  1.00 79.40  ? 539  LEU A HD21 1 
ATOM   4804  H  HD22 . LEU A  1 347 ? 180.192 98.607  88.188  1.00 79.40  ? 539  LEU A HD22 1 
ATOM   4805  H  HD23 . LEU A  1 347 ? 181.118 98.621  89.479  1.00 79.40  ? 539  LEU A HD23 1 
ATOM   4806  N  N    . TYR A  1 348 ? 182.577 94.289  89.205  1.00 68.24  ? 540  TYR A N    1 
ATOM   4807  C  CA   . TYR A  1 348 ? 182.699 92.857  88.983  1.00 65.72  ? 540  TYR A CA   1 
ATOM   4808  C  C    . TYR A  1 348 ? 181.531 92.375  88.132  1.00 61.87  ? 540  TYR A C    1 
ATOM   4809  O  O    . TYR A  1 348 ? 180.384 92.772  88.353  1.00 64.73  ? 540  TYR A O    1 
ATOM   4810  C  CB   . TYR A  1 348 ? 182.725 92.098  90.312  1.00 66.19  ? 540  TYR A CB   1 
ATOM   4811  C  CG   . TYR A  1 348 ? 183.895 92.452  91.203  1.00 66.03  ? 540  TYR A CG   1 
ATOM   4812  C  CD1  . TYR A  1 348 ? 185.146 91.886  90.996  1.00 68.82  ? 540  TYR A CD1  1 
ATOM   4813  C  CD2  . TYR A  1 348 ? 183.746 93.344  92.256  1.00 65.84  ? 540  TYR A CD2  1 
ATOM   4814  C  CE1  . TYR A  1 348 ? 186.217 92.205  91.808  1.00 70.59  ? 540  TYR A CE1  1 
ATOM   4815  C  CE2  . TYR A  1 348 ? 184.812 93.669  93.074  1.00 68.65  ? 540  TYR A CE2  1 
ATOM   4816  C  CZ   . TYR A  1 348 ? 186.044 93.096  92.846  1.00 72.16  ? 540  TYR A CZ   1 
ATOM   4817  O  OH   . TYR A  1 348 ? 187.107 93.416  93.659  1.00 78.15  ? 540  TYR A OH   1 
ATOM   4818  H  H    . TYR A  1 348 ? 182.053 94.492  89.856  1.00 81.64  ? 540  TYR A H    1 
ATOM   4819  H  HA   . TYR A  1 348 ? 183.524 92.672  88.507  1.00 78.61  ? 540  TYR A HA   1 
ATOM   4820  H  HB2  . TYR A  1 348 ? 181.910 92.297  90.800  1.00 79.18  ? 540  TYR A HB2  1 
ATOM   4821  H  HB3  . TYR A  1 348 ? 182.771 91.147  90.127  1.00 79.18  ? 540  TYR A HB3  1 
ATOM   4822  H  HD1  . TYR A  1 348 ? 185.265 91.285  90.296  1.00 82.34  ? 540  TYR A HD1  1 
ATOM   4823  H  HD2  . TYR A  1 348 ? 182.916 93.733  92.412  1.00 78.76  ? 540  TYR A HD2  1 
ATOM   4824  H  HE1  . TYR A  1 348 ? 187.050 91.819  91.656  1.00 84.46  ? 540  TYR A HE1  1 
ATOM   4825  H  HE2  . TYR A  1 348 ? 184.697 94.270  93.775  1.00 82.14  ? 540  TYR A HE2  1 
ATOM   4826  H  HH   . TYR A  1 348 ? 186.865 93.966  94.246  1.00 93.53  ? 540  TYR A HH   1 
ATOM   4827  N  N    . GLY A  1 349 ? 181.826 91.515  87.161  1.00 67.55  ? 541  GLY A N    1 
ATOM   4828  C  CA   . GLY A  1 349 ? 180.783 90.983  86.307  1.00 65.91  ? 541  GLY A CA   1 
ATOM   4829  C  C    . GLY A  1 349 ? 181.295 90.086  85.198  1.00 65.37  ? 541  GLY A C    1 
ATOM   4830  O  O    . GLY A  1 349 ? 180.781 88.980  85.006  1.00 64.83  ? 541  GLY A O    1 
ATOM   4831  H  H    . GLY A  1 349 ? 182.617 91.230  86.981  1.00 80.81  ? 541  GLY A H    1 
ATOM   4832  H  HA2  . GLY A  1 349 ? 180.161 90.470  86.846  1.00 78.85  ? 541  GLY A HA2  1 
ATOM   4833  H  HA3  . GLY A  1 349 ? 180.298 91.718  85.901  1.00 78.85  ? 541  GLY A HA3  1 
ATOM   4834  N  N    . HIS A  1 350 ? 182.294 90.553  84.454  1.00 62.19  ? 542  HIS A N    1 
ATOM   4835  C  CA   . HIS A  1 350 ? 182.855 89.755  83.376  1.00 64.23  ? 542  HIS A CA   1 
ATOM   4836  C  C    . HIS A  1 350 ? 183.543 88.510  83.928  1.00 64.24  ? 542  HIS A C    1 
ATOM   4837  O  O    . HIS A  1 350 ? 183.905 88.431  85.106  1.00 65.97  ? 542  HIS A O    1 
ATOM   4838  C  CB   . HIS A  1 350 ? 183.853 90.573  82.557  1.00 65.66  ? 542  HIS A CB   1 
ATOM   4839  C  CG   . HIS A  1 350 ? 183.216 91.590  81.662  1.00 62.67  ? 542  HIS A CG   1 
ATOM   4840  N  ND1  . HIS A  1 350 ? 182.484 91.245  80.547  1.00 60.16  ? 542  HIS A ND1  1 
ATOM   4841  C  CD2  . HIS A  1 350 ? 183.219 92.943  81.706  1.00 64.62  ? 542  HIS A CD2  1 
ATOM   4842  C  CE1  . HIS A  1 350 ? 182.056 92.341  79.948  1.00 62.00  ? 542  HIS A CE1  1 
ATOM   4843  N  NE2  . HIS A  1 350 ? 182.489 93.386  80.630  1.00 62.52  ? 542  HIS A NE2  1 
ATOM   4844  H  H    . HIS A  1 350 ? 182.661 91.325  84.554  1.00 74.38  ? 542  HIS A H    1 
ATOM   4845  H  HA   . HIS A  1 350 ? 182.140 89.470  82.785  1.00 76.83  ? 542  HIS A HA   1 
ATOM   4846  H  HB2  . HIS A  1 350 ? 184.445 91.043  83.165  1.00 78.54  ? 542  HIS A HB2  1 
ATOM   4847  H  HB3  . HIS A  1 350 ? 184.368 89.969  81.999  1.00 78.54  ? 542  HIS A HB3  1 
ATOM   4848  H  HD1  . HIS A  1 350 ? 182.328 90.441  80.284  1.00 71.95  ? 542  HIS A HD1  1 
ATOM   4849  H  HD2  . HIS A  1 350 ? 183.635 93.474  82.347  1.00 77.29  ? 542  HIS A HD2  1 
ATOM   4850  H  HE1  . HIS A  1 350 ? 181.538 92.372  79.176  1.00 74.15  ? 542  HIS A HE1  1 
ATOM   4851  N  N    . SER A  1 351 ? 183.723 87.525  83.046  1.00 62.01  ? 543  SER A N    1 
ATOM   4852  C  CA   . SER A  1 351 ? 184.407 86.282  83.380  1.00 61.31  ? 543  SER A CA   1 
ATOM   4853  C  C    . SER A  1 351 ? 185.702 86.113  82.596  1.00 58.42  ? 543  SER A C    1 
ATOM   4854  O  O    . SER A  1 351 ? 186.266 85.013  82.579  1.00 62.99  ? 543  SER A O    1 
ATOM   4855  C  CB   . SER A  1 351 ? 183.483 85.084  83.137  1.00 65.42  ? 543  SER A CB   1 
ATOM   4856  O  OG   . SER A  1 351 ? 182.741 85.248  81.944  1.00 71.22  ? 543  SER A OG   1 
ATOM   4857  H  H    . SER A  1 351 ? 183.451 87.558  82.231  1.00 74.16  ? 543  SER A H    1 
ATOM   4858  H  HA   . SER A  1 351 ? 184.633 86.295  84.323  1.00 73.32  ? 543  SER A HA   1 
ATOM   4859  H  HB2  . SER A  1 351 ? 184.021 84.280  83.065  1.00 78.25  ? 543  SER A HB2  1 
ATOM   4860  H  HB3  . SER A  1 351 ? 182.867 85.005  83.882  1.00 78.25  ? 543  SER A HB3  1 
ATOM   4861  H  HG   . SER A  1 351 ? 182.239 84.584  81.824  1.00 85.22  ? 543  SER A HG   1 
ATOM   4862  N  N    . GLY A  1 352 ? 186.179 87.167  81.940  1.00 60.12  ? 544  GLY A N    1 
ATOM   4863  C  CA   . GLY A  1 352 ? 187.443 87.135  81.247  1.00 59.62  ? 544  GLY A CA   1 
ATOM   4864  C  C    . GLY A  1 352 ? 187.987 88.532  81.026  1.00 59.64  ? 544  GLY A C    1 
ATOM   4865  O  O    . GLY A  1 352 ? 187.330 89.533  81.329  1.00 62.46  ? 544  GLY A O    1 
ATOM   4866  H  H    . GLY A  1 352 ? 185.774 87.924  81.886  1.00 71.89  ? 544  GLY A H    1 
ATOM   4867  H  HA2  . GLY A  1 352 ? 188.088 86.629  81.766  1.00 71.30  ? 544  GLY A HA2  1 
ATOM   4868  H  HA3  . GLY A  1 352 ? 187.332 86.705  80.385  1.00 71.30  ? 544  GLY A HA3  1 
ATOM   4869  N  N    . PRO A  1 353 ? 189.209 88.624  80.504  1.00 69.50  ? 545  PRO A N    1 
ATOM   4870  C  CA   . PRO A  1 353 ? 189.835 89.936  80.304  1.00 67.05  ? 545  PRO A CA   1 
ATOM   4871  C  C    . PRO A  1 353 ? 188.910 90.915  79.594  1.00 64.40  ? 545  PRO A C    1 
ATOM   4872  O  O    . PRO A  1 353 ? 188.121 90.537  78.726  1.00 66.82  ? 545  PRO A O    1 
ATOM   4873  C  CB   . PRO A  1 353 ? 191.067 89.608  79.455  1.00 70.58  ? 545  PRO A CB   1 
ATOM   4874  C  CG   . PRO A  1 353 ? 191.411 88.207  79.820  1.00 73.02  ? 545  PRO A CG   1 
ATOM   4875  C  CD   . PRO A  1 353 ? 190.123 87.515  80.179  1.00 73.11  ? 545  PRO A CD   1 
ATOM   4876  H  HA   . PRO A  1 353 ? 190.117 90.312  81.153  1.00 80.22  ? 545  PRO A HA   1 
ATOM   4877  H  HB2  . PRO A  1 353 ? 190.844 89.674  78.514  1.00 84.45  ? 545  PRO A HB2  1 
ATOM   4878  H  HB3  . PRO A  1 353 ? 191.792 90.211  79.682  1.00 84.45  ? 545  PRO A HB3  1 
ATOM   4879  H  HG2  . PRO A  1 353 ? 191.828 87.771  79.061  1.00 87.38  ? 545  PRO A HG2  1 
ATOM   4880  H  HG3  . PRO A  1 353 ? 192.015 88.212  80.579  1.00 87.38  ? 545  PRO A HG3  1 
ATOM   4881  H  HD2  . PRO A  1 353 ? 189.787 87.012  79.421  1.00 87.49  ? 545  PRO A HD2  1 
ATOM   4882  H  HD3  . PRO A  1 353 ? 190.250 86.946  80.954  1.00 87.49  ? 545  PRO A HD3  1 
ATOM   4883  N  N    . VAL A  1 354 ? 189.011 92.183  79.980  1.00 59.43  ? 546  VAL A N    1 
ATOM   4884  C  CA   . VAL A  1 354 ? 188.215 93.260  79.403  1.00 62.40  ? 546  VAL A CA   1 
ATOM   4885  C  C    . VAL A  1 354 ? 189.082 93.972  78.372  1.00 65.09  ? 546  VAL A C    1 
ATOM   4886  O  O    . VAL A  1 354 ? 190.091 94.595  78.718  1.00 72.47  ? 546  VAL A O    1 
ATOM   4887  C  CB   . VAL A  1 354 ? 187.717 94.232  80.482  1.00 64.01  ? 546  VAL A CB   1 
ATOM   4888  C  CG1  . VAL A  1 354 ? 186.947 95.393  79.852  1.00 61.38  ? 546  VAL A CG1  1 
ATOM   4889  C  CG2  . VAL A  1 354 ? 186.845 93.500  81.494  1.00 64.81  ? 546  VAL A CG2  1 
ATOM   4890  H  H    . VAL A  1 354 ? 189.551 92.451  80.594  1.00 71.07  ? 546  VAL A H    1 
ATOM   4891  H  HA   . VAL A  1 354 ? 187.444 92.885  78.949  1.00 74.63  ? 546  VAL A HA   1 
ATOM   4892  H  HB   . VAL A  1 354 ? 188.481 94.600  80.953  1.00 76.57  ? 546  VAL A HB   1 
ATOM   4893  H  HG11 . VAL A  1 354 ? 186.645 95.989  80.555  1.00 73.41  ? 546  VAL A HG11 1 
ATOM   4894  H  HG12 . VAL A  1 354 ? 187.534 95.868  79.244  1.00 73.41  ? 546  VAL A HG12 1 
ATOM   4895  H  HG13 . VAL A  1 354 ? 186.184 95.039  79.368  1.00 73.41  ? 546  VAL A HG13 1 
ATOM   4896  H  HG21 . VAL A  1 354 ? 186.542 94.132  82.164  1.00 77.53  ? 546  VAL A HG21 1 
ATOM   4897  H  HG22 . VAL A  1 354 ? 186.083 93.115  81.033  1.00 77.53  ? 546  VAL A HG22 1 
ATOM   4898  H  HG23 . VAL A  1 354 ? 187.369 92.799  81.912  1.00 77.53  ? 546  VAL A HG23 1 
ATOM   4899  N  N    . TYR A  1 355 ? 188.688 93.887  77.100  1.00 62.25  ? 547  TYR A N    1 
ATOM   4900  C  CA   . TYR A  1 355 ? 189.476 94.439  76.006  1.00 60.02  ? 547  TYR A CA   1 
ATOM   4901  C  C    . TYR A  1 355 ? 188.955 95.772  75.494  1.00 63.25  ? 547  TYR A C    1 
ATOM   4902  O  O    . TYR A  1 355 ? 189.686 96.469  74.781  1.00 68.13  ? 547  TYR A O    1 
ATOM   4903  C  CB   . TYR A  1 355 ? 189.515 93.454  74.832  1.00 59.33  ? 547  TYR A CB   1 
ATOM   4904  C  CG   . TYR A  1 355 ? 190.158 92.135  75.166  1.00 62.10  ? 547  TYR A CG   1 
ATOM   4905  C  CD1  . TYR A  1 355 ? 191.498 92.064  75.518  1.00 59.11  ? 547  TYR A CD1  1 
ATOM   4906  C  CD2  . TYR A  1 355 ? 189.423 90.959  75.140  1.00 60.78  ? 547  TYR A CD2  1 
ATOM   4907  C  CE1  . TYR A  1 355 ? 192.092 90.857  75.824  1.00 62.18  ? 547  TYR A CE1  1 
ATOM   4908  C  CE2  . TYR A  1 355 ? 190.005 89.749  75.446  1.00 60.37  ? 547  TYR A CE2  1 
ATOM   4909  C  CZ   . TYR A  1 355 ? 191.340 89.701  75.787  1.00 60.36  ? 547  TYR A CZ   1 
ATOM   4910  O  OH   . TYR A  1 355 ? 191.924 88.494  76.095  1.00 63.33  ? 547  TYR A OH   1 
ATOM   4911  H  H    . TYR A  1 355 ? 187.958 93.510  76.846  1.00 74.45  ? 547  TYR A H    1 
ATOM   4912  H  HA   . TYR A  1 355 ? 190.386 94.573  76.312  1.00 71.77  ? 547  TYR A HA   1 
ATOM   4913  H  HB2  . TYR A  1 355 ? 188.606 93.277  74.544  1.00 70.95  ? 547  TYR A HB2  1 
ATOM   4914  H  HB3  . TYR A  1 355 ? 190.018 93.854  74.106  1.00 70.95  ? 547  TYR A HB3  1 
ATOM   4915  H  HD1  . TYR A  1 355 ? 192.006 92.842  75.541  1.00 70.69  ? 547  TYR A HD1  1 
ATOM   4916  H  HD2  . TYR A  1 355 ? 188.523 90.987  74.908  1.00 72.69  ? 547  TYR A HD2  1 
ATOM   4917  H  HE1  . TYR A  1 355 ? 192.991 90.823  76.056  1.00 74.37  ? 547  TYR A HE1  1 
ATOM   4918  H  HE2  . TYR A  1 355 ? 189.501 88.968  75.422  1.00 72.20  ? 547  TYR A HE2  1 
ATOM   4919  H  HH   . TYR A  1 355 ? 191.358 87.877  76.033  1.00 75.74  ? 547  TYR A HH   1 
ATOM   4920  N  N    . GLY A  1 356 ? 187.724 96.144  75.837  1.00 60.22  ? 548  GLY A N    1 
ATOM   4921  C  CA   . GLY A  1 356 ? 187.153 97.387  75.362  1.00 58.61  ? 548  GLY A CA   1 
ATOM   4922  C  C    . GLY A  1 356 ? 186.437 98.150  76.455  1.00 61.96  ? 548  GLY A C    1 
ATOM   4923  O  O    . GLY A  1 356 ? 185.828 97.550  77.344  1.00 62.20  ? 548  GLY A O    1 
ATOM   4924  H  H    . GLY A  1 356 ? 187.201 95.688  76.345  1.00 72.02  ? 548  GLY A H    1 
ATOM   4925  H  HA2  . GLY A  1 356 ? 187.858 97.951  75.006  1.00 70.08  ? 548  GLY A HA2  1 
ATOM   4926  H  HA3  . GLY A  1 356 ? 186.519 97.201  74.652  1.00 70.08  ? 548  GLY A HA3  1 
ATOM   4927  N  N    . ALA A  1 357 ? 186.516 99.477  76.400  1.00 63.16  ? 549  ALA A N    1 
ATOM   4928  C  CA   . ALA A  1 357 ? 185.852 100.339 77.367  1.00 62.82  ? 549  ALA A CA   1 
ATOM   4929  C  C    . ALA A  1 357 ? 185.449 101.624 76.661  1.00 63.37  ? 549  ALA A C    1 
ATOM   4930  O  O    . ALA A  1 357 ? 186.255 102.205 75.928  1.00 66.65  ? 549  ALA A O    1 
ATOM   4931  C  CB   . ALA A  1 357 ? 186.766 100.640 78.560  1.00 63.80  ? 549  ALA A CB   1 
ATOM   4932  H  H    . ALA A  1 357 ? 186.957 99.908  75.800  1.00 75.54  ? 549  ALA A H    1 
ATOM   4933  H  HA   . ALA A  1 357 ? 185.050 99.902  77.695  1.00 75.13  ? 549  ALA A HA   1 
ATOM   4934  H  HB1  . ALA A  1 357 ? 186.293 101.215 79.182  1.00 76.31  ? 549  ALA A HB1  1 
ATOM   4935  H  HB2  . ALA A  1 357 ? 187.003 99.806  78.994  1.00 76.31  ? 549  ALA A HB2  1 
ATOM   4936  H  HB3  . ALA A  1 357 ? 187.566 101.086 78.240  1.00 76.31  ? 549  ALA A HB3  1 
ATOM   4937  N  N    . SER A  1 358 ? 184.210 102.063 76.876  1.00 63.74  ? 550  SER A N    1 
ATOM   4938  C  CA   . SER A  1 358 ? 183.704 103.255 76.202  1.00 63.19  ? 550  SER A CA   1 
ATOM   4939  C  C    . SER A  1 358 ? 182.687 103.955 77.088  1.00 62.91  ? 550  SER A C    1 
ATOM   4940  O  O    . SER A  1 358 ? 181.658 103.367 77.431  1.00 62.74  ? 550  SER A O    1 
ATOM   4941  C  CB   . SER A  1 358 ? 183.074 102.889 74.860  1.00 65.49  ? 550  SER A CB   1 
ATOM   4942  O  OG   . SER A  1 358 ? 182.668 104.047 74.154  1.00 71.22  ? 550  SER A OG   1 
ATOM   4943  H  H    . SER A  1 358 ? 183.644 101.689 77.405  1.00 76.24  ? 550  SER A H    1 
ATOM   4944  H  HA   . SER A  1 358 ? 184.439 103.867 76.038  1.00 75.58  ? 550  SER A HA   1 
ATOM   4945  H  HB2  . SER A  1 358 ? 183.727 102.408 74.327  1.00 78.34  ? 550  SER A HB2  1 
ATOM   4946  H  HB3  . SER A  1 358 ? 182.299 102.328 75.019  1.00 78.34  ? 550  SER A HB3  1 
ATOM   4947  H  HG   . SER A  1 358 ? 183.330 104.543 74.009  1.00 85.22  ? 550  SER A HG   1 
ATOM   4948  N  N    . PHE A  1 359 ? 182.970 105.209 77.436  1.00 64.77  ? 551  PHE A N    1 
ATOM   4949  C  CA   . PHE A  1 359 ? 182.014 106.046 78.148  1.00 64.55  ? 551  PHE A CA   1 
ATOM   4950  C  C    . PHE A  1 359 ? 180.968 106.602 77.191  1.00 67.29  ? 551  PHE A C    1 
ATOM   4951  O  O    . PHE A  1 359 ? 181.252 106.893 76.026  1.00 68.31  ? 551  PHE A O    1 
ATOM   4952  C  CB   . PHE A  1 359 ? 182.713 107.218 78.836  1.00 62.62  ? 551  PHE A CB   1 
ATOM   4953  C  CG   . PHE A  1 359 ? 183.428 106.853 80.100  1.00 60.85  ? 551  PHE A CG   1 
ATOM   4954  C  CD1  . PHE A  1 359 ? 182.717 106.560 81.251  1.00 63.12  ? 551  PHE A CD1  1 
ATOM   4955  C  CD2  . PHE A  1 359 ? 184.810 106.847 80.150  1.00 64.49  ? 551  PHE A CD2  1 
ATOM   4956  C  CE1  . PHE A  1 359 ? 183.373 106.237 82.423  1.00 65.49  ? 551  PHE A CE1  1 
ATOM   4957  C  CE2  . PHE A  1 359 ? 185.473 106.525 81.318  1.00 67.02  ? 551  PHE A CE2  1 
ATOM   4958  C  CZ   . PHE A  1 359 ? 184.753 106.224 82.458  1.00 65.17  ? 551  PHE A CZ   1 
ATOM   4959  H  H    . PHE A  1 359 ? 183.717 105.600 77.268  1.00 77.48  ? 551  PHE A H    1 
ATOM   4960  H  HA   . PHE A  1 359 ? 181.562 105.517 78.824  1.00 77.21  ? 551  PHE A HA   1 
ATOM   4961  H  HB2  . PHE A  1 359 ? 183.367 107.592 78.225  1.00 74.90  ? 551  PHE A HB2  1 
ATOM   4962  H  HB3  . PHE A  1 359 ? 182.049 107.890 79.056  1.00 74.90  ? 551  PHE A HB3  1 
ATOM   4963  H  HD1  . PHE A  1 359 ? 181.787 106.568 81.232  1.00 75.49  ? 551  PHE A HD1  1 
ATOM   4964  H  HD2  . PHE A  1 359 ? 185.299 107.049 79.385  1.00 77.14  ? 551  PHE A HD2  1 
ATOM   4965  H  HE1  . PHE A  1 359 ? 182.885 106.034 83.188  1.00 78.34  ? 551  PHE A HE1  1 
ATOM   4966  H  HE2  . PHE A  1 359 ? 186.402 106.516 81.339  1.00 80.18  ? 551  PHE A HE2  1 
ATOM   4967  H  HZ   . PHE A  1 359 ? 185.197 106.006 83.246  1.00 77.96  ? 551  PHE A HZ   1 
ATOM   4968  N  N    . SER A  1 360 ? 179.750 106.761 77.697  1.00 71.13  ? 552  SER A N    1 
ATOM   4969  C  CA   . SER A  1 360 ? 178.743 107.464 76.921  1.00 73.58  ? 552  SER A CA   1 
ATOM   4970  C  C    . SER A  1 360 ? 178.999 108.970 76.978  1.00 73.35  ? 552  SER A C    1 
ATOM   4971  O  O    . SER A  1 360 ? 179.602 109.468 77.934  1.00 76.55  ? 552  SER A O    1 
ATOM   4972  C  CB   . SER A  1 360 ? 177.345 107.157 77.449  1.00 73.69  ? 552  SER A CB   1 
ATOM   4973  O  OG   . SER A  1 360 ? 177.186 107.622 78.776  1.00 71.27  ? 552  SER A OG   1 
ATOM   4974  H  H    . SER A  1 360 ? 179.488 106.480 78.466  1.00 85.11  ? 552  SER A H    1 
ATOM   4975  H  HA   . SER A  1 360 ? 178.791 107.179 75.995  1.00 88.05  ? 552  SER A HA   1 
ATOM   4976  H  HB2  . SER A  1 360 ? 176.692 107.595 76.881  1.00 88.18  ? 552  SER A HB2  1 
ATOM   4977  H  HB3  . SER A  1 360 ? 177.207 106.197 77.433  1.00 88.18  ? 552  SER A HB3  1 
ATOM   4978  H  HG   . SER A  1 360 ? 176.412 107.446 79.052  1.00 85.28  ? 552  SER A HG   1 
ATOM   4979  N  N    . PRO A  1 361 ? 178.553 109.722 75.969  1.00 68.13  ? 553  PRO A N    1 
ATOM   4980  C  CA   . PRO A  1 361 ? 178.816 111.170 75.981  1.00 66.39  ? 553  PRO A CA   1 
ATOM   4981  C  C    . PRO A  1 361 ? 178.243 111.879 77.192  1.00 71.62  ? 553  PRO A C    1 
ATOM   4982  O  O    . PRO A  1 361 ? 178.843 112.851 77.668  1.00 77.00  ? 553  PRO A O    1 
ATOM   4983  C  CB   . PRO A  1 361 ? 178.162 111.654 74.679  1.00 66.89  ? 553  PRO A CB   1 
ATOM   4984  C  CG   . PRO A  1 361 ? 178.134 110.453 73.801  1.00 69.36  ? 553  PRO A CG   1 
ATOM   4985  C  CD   . PRO A  1 361 ? 177.885 109.300 74.726  1.00 70.67  ? 553  PRO A CD   1 
ATOM   4986  H  HA   . PRO A  1 361 ? 179.771 111.336 75.938  1.00 79.42  ? 553  PRO A HA   1 
ATOM   4987  H  HB2  . PRO A  1 361 ? 177.263 111.969 74.861  1.00 80.02  ? 553  PRO A HB2  1 
ATOM   4988  H  HB3  . PRO A  1 361 ? 178.701 112.357 74.283  1.00 80.02  ? 553  PRO A HB3  1 
ATOM   4989  H  HG2  . PRO A  1 361 ? 177.415 110.536 73.155  1.00 82.99  ? 553  PRO A HG2  1 
ATOM   4990  H  HG3  . PRO A  1 361 ? 178.989 110.355 73.353  1.00 82.99  ? 553  PRO A HG3  1 
ATOM   4991  H  HD2  . PRO A  1 361 ? 176.933 109.183 74.875  1.00 84.55  ? 553  PRO A HD2  1 
ATOM   4992  H  HD3  . PRO A  1 361 ? 178.294 108.491 74.379  1.00 84.55  ? 553  PRO A HD3  1 
ATOM   4993  N  N    . ASP A  1 362 ? 177.098 111.430 77.702  1.00 77.00  ? 554  ASP A N    1 
ATOM   4994  C  CA   . ASP A  1 362 ? 176.486 112.031 78.879  1.00 80.47  ? 554  ASP A CA   1 
ATOM   4995  C  C    . ASP A  1 362 ? 177.040 111.470 80.182  1.00 76.37  ? 554  ASP A C    1 
ATOM   4996  O  O    . ASP A  1 362 ? 176.645 111.931 81.257  1.00 79.80  ? 554  ASP A O    1 
ATOM   4997  C  CB   . ASP A  1 362 ? 174.964 111.840 78.842  1.00 83.04  ? 554  ASP A CB   1 
ATOM   4998  C  CG   . ASP A  1 362 ? 174.555 110.379 78.811  1.00 89.32  ? 554  ASP A CG   1 
ATOM   4999  O  OD1  . ASP A  1 362 ? 175.449 109.506 78.805  1.00 92.30  ? 554  ASP A OD1  1 
ATOM   5000  O  OD2  . ASP A  1 362 ? 173.337 110.103 78.795  1.00 90.07  ? 554  ASP A OD2  1 
ATOM   5001  H  H    . ASP A  1 362 ? 176.652 110.769 77.378  1.00 92.15  ? 554  ASP A H    1 
ATOM   5002  H  HA   . ASP A  1 362 ? 176.664 112.984 78.869  1.00 96.31  ? 554  ASP A HA   1 
ATOM   5003  H  HB2  . ASP A  1 362 ? 174.575 112.244 79.634  1.00 99.40  ? 554  ASP A HB2  1 
ATOM   5004  H  HB3  . ASP A  1 362 ? 174.611 112.267 78.045  1.00 99.40  ? 554  ASP A HB3  1 
ATOM   5005  N  N    . ARG A  1 363 ? 177.942 110.492 80.111  1.00 71.89  ? 555  ARG A N    1 
ATOM   5006  C  CA   . ARG A  1 363 ? 178.586 109.908 81.285  1.00 73.74  ? 555  ARG A CA   1 
ATOM   5007  C  C    . ARG A  1 363 ? 177.598 109.177 82.189  1.00 74.41  ? 555  ARG A C    1 
ATOM   5008  O  O    . ARG A  1 363 ? 177.883 108.961 83.370  1.00 76.68  ? 555  ARG A O    1 
ATOM   5009  C  CB   . ARG A  1 363 ? 179.340 110.970 82.092  1.00 79.25  ? 555  ARG A CB   1 
ATOM   5010  C  CG   . ARG A  1 363 ? 180.321 111.794 81.271  1.00 83.78  ? 555  ARG A CG   1 
ATOM   5011  C  CD   . ARG A  1 363 ? 181.064 112.804 82.133  1.00 84.83  ? 555  ARG A CD   1 
ATOM   5012  N  NE   . ARG A  1 363 ? 180.165 113.796 82.716  1.00 86.62  ? 555  ARG A NE   1 
ATOM   5013  C  CZ   . ARG A  1 363 ? 179.700 114.859 82.067  1.00 89.99  ? 555  ARG A CZ   1 
ATOM   5014  N  NH1  . ARG A  1 363 ? 180.042 115.078 80.804  1.00 90.67  ? 555  ARG A NH1  1 
ATOM   5015  N  NH2  . ARG A  1 363 ? 178.885 115.707 82.681  1.00 90.93  ? 555  ARG A NH2  1 
ATOM   5016  H  H    . ARG A  1 363 ? 178.203 110.140 79.371  1.00 86.02  ? 555  ARG A H    1 
ATOM   5017  H  HA   . ARG A  1 363 ? 179.238 109.257 80.983  1.00 88.24  ? 555  ARG A HA   1 
ATOM   5018  H  HB2  . ARG A  1 363 ? 178.696 111.581 82.482  1.00 94.86  ? 555  ARG A HB2  1 
ATOM   5019  H  HB3  . ARG A  1 363 ? 179.842 110.529 82.796  1.00 94.86  ? 555  ARG A HB3  1 
ATOM   5020  H  HG2  . ARG A  1 363 ? 180.974 111.202 80.865  1.00 100.29 ? 555  ARG A HG2  1 
ATOM   5021  H  HG3  . ARG A  1 363 ? 179.836 112.279 80.585  1.00 100.29 ? 555  ARG A HG3  1 
ATOM   5022  H  HD2  . ARG A  1 363 ? 181.509 112.337 82.857  1.00 101.54 ? 555  ARG A HD2  1 
ATOM   5023  H  HD3  . ARG A  1 363 ? 181.715 113.271 81.586  1.00 101.54 ? 555  ARG A HD3  1 
ATOM   5024  H  HE   . ARG A  1 363 ? 179.920 113.684 83.532  1.00 103.69 ? 555  ARG A HE   1 
ATOM   5025  H  HH11 . ARG A  1 363 ? 180.570 114.531 80.401  1.00 108.55 ? 555  ARG A HH11 1 
ATOM   5026  H  HH12 . ARG A  1 363 ? 179.738 115.767 80.389  1.00 108.55 ? 555  ARG A HH12 1 
ATOM   5027  H  HH21 . ARG A  1 363 ? 178.659 115.570 83.500  1.00 108.87 ? 555  ARG A HH21 1 
ATOM   5028  H  HH22 . ARG A  1 363 ? 178.584 116.395 82.262  1.00 108.87 ? 555  ARG A HH22 1 
ATOM   5029  N  N    . ASN A  1 364 ? 176.439 108.782 81.660  1.00 76.40  ? 556  ASN A N    1 
ATOM   5030  C  CA   . ASN A  1 364 ? 175.512 107.953 82.417  1.00 78.99  ? 556  ASN A CA   1 
ATOM   5031  C  C    . ASN A  1 364 ? 175.805 106.464 82.297  1.00 76.79  ? 556  ASN A C    1 
ATOM   5032  O  O    . ASN A  1 364 ? 175.355 105.692 83.152  1.00 78.20  ? 556  ASN A O    1 
ATOM   5033  C  CB   . ASN A  1 364 ? 174.070 108.205 81.965  1.00 84.73  ? 556  ASN A CB   1 
ATOM   5034  C  CG   . ASN A  1 364 ? 173.489 109.481 82.541  1.00 92.25  ? 556  ASN A CG   1 
ATOM   5035  O  OD1  . ASN A  1 364 ? 174.030 110.056 83.487  1.00 96.31  ? 556  ASN A OD1  1 
ATOM   5036  N  ND2  . ASN A  1 364 ? 172.364 109.919 81.987  1.00 94.89  ? 556  ASN A ND2  1 
ATOM   5037  H  H    . ASN A  1 364 ? 176.170 108.981 80.868  1.00 91.44  ? 556  ASN A H    1 
ATOM   5038  H  HA   . ASN A  1 364 ? 175.574 108.193 83.355  1.00 94.54  ? 556  ASN A HA   1 
ATOM   5039  H  HB2  . ASN A  1 364 ? 174.050 108.277 80.998  1.00 101.43 ? 556  ASN A HB2  1 
ATOM   5040  H  HB3  . ASN A  1 364 ? 173.514 107.465 82.254  1.00 101.43 ? 556  ASN A HB3  1 
ATOM   5041  H  HD21 . ASN A  1 364 ? 171.992 110.637 82.278  1.00 113.62 ? 556  ASN A HD21 1 
ATOM   5042  H  HD22 . ASN A  1 364 ? 172.012 109.489 81.331  1.00 113.62 ? 556  ASN A HD22 1 
ATOM   5043  N  N    . TYR A  1 365 ? 176.547 106.043 81.274  1.00 67.03  ? 557  TYR A N    1 
ATOM   5044  C  CA   . TYR A  1 365 ? 176.814 104.633 81.046  1.00 61.81  ? 557  TYR A CA   1 
ATOM   5045  C  C    . TYR A  1 365 ? 178.285 104.416 80.726  1.00 65.26  ? 557  TYR A C    1 
ATOM   5046  O  O    . TYR A  1 365 ? 179.005 105.332 80.321  1.00 66.91  ? 557  TYR A O    1 
ATOM   5047  C  CB   . TYR A  1 365 ? 175.976 104.058 79.895  1.00 60.93  ? 557  TYR A CB   1 
ATOM   5048  C  CG   . TYR A  1 365 ? 174.484 104.268 80.013  1.00 61.79  ? 557  TYR A CG   1 
ATOM   5049  C  CD1  . TYR A  1 365 ? 173.753 103.678 81.037  1.00 63.28  ? 557  TYR A CD1  1 
ATOM   5050  C  CD2  . TYR A  1 365 ? 173.800 105.029 79.077  1.00 62.58  ? 557  TYR A CD2  1 
ATOM   5051  C  CE1  . TYR A  1 365 ? 172.385 103.864 81.136  1.00 65.56  ? 557  TYR A CE1  1 
ATOM   5052  C  CE2  . TYR A  1 365 ? 172.436 105.219 79.166  1.00 66.03  ? 557  TYR A CE2  1 
ATOM   5053  C  CZ   . TYR A  1 365 ? 171.731 104.633 80.195  1.00 69.46  ? 557  TYR A CZ   1 
ATOM   5054  O  OH   . TYR A  1 365 ? 170.370 104.824 80.282  1.00 69.98  ? 557  TYR A OH   1 
ATOM   5055  H  H    . TYR A  1 365 ? 176.909 106.564 80.694  1.00 80.19  ? 557  TYR A H    1 
ATOM   5056  H  HA   . TYR A  1 365 ? 176.603 104.135 81.851  1.00 73.93  ? 557  TYR A HA   1 
ATOM   5057  H  HB2  . TYR A  1 365 ? 176.263 104.474 79.067  1.00 72.87  ? 557  TYR A HB2  1 
ATOM   5058  H  HB3  . TYR A  1 365 ? 176.133 103.102 79.848  1.00 72.87  ? 557  TYR A HB3  1 
ATOM   5059  H  HD1  . TYR A  1 365 ? 174.191 103.160 81.673  1.00 75.68  ? 557  TYR A HD1  1 
ATOM   5060  H  HD2  . TYR A  1 365 ? 174.271 105.427 78.381  1.00 74.85  ? 557  TYR A HD2  1 
ATOM   5061  H  HE1  . TYR A  1 365 ? 171.908 103.469 81.830  1.00 78.43  ? 557  TYR A HE1  1 
ATOM   5062  H  HE2  . TYR A  1 365 ? 171.993 105.738 78.534  1.00 78.99  ? 557  TYR A HE2  1 
ATOM   5063  H  HH   . TYR A  1 365 ? 170.108 105.309 79.648  1.00 83.73  ? 557  TYR A HH   1 
ATOM   5064  N  N    . LEU A  1 366 ? 178.714 103.170 80.908  1.00 76.47  ? 558  LEU A N    1 
ATOM   5065  C  CA   . LEU A  1 366 ? 180.033 102.711 80.496  1.00 74.74  ? 558  LEU A CA   1 
ATOM   5066  C  C    . LEU A  1 366 ? 179.876 101.337 79.865  1.00 72.17  ? 558  LEU A C    1 
ATOM   5067  O  O    . LEU A  1 366 ? 179.273 100.442 80.465  1.00 68.94  ? 558  LEU A O    1 
ATOM   5068  C  CB   . LEU A  1 366 ? 181.000 102.654 81.687  1.00 68.79  ? 558  LEU A CB   1 
ATOM   5069  C  CG   . LEU A  1 366 ? 182.352 101.957 81.490  1.00 68.66  ? 558  LEU A CG   1 
ATOM   5070  C  CD1  . LEU A  1 366 ? 183.284 102.752 80.588  1.00 68.19  ? 558  LEU A CD1  1 
ATOM   5071  C  CD2  . LEU A  1 366 ? 182.996 101.719 82.846  1.00 71.03  ? 558  LEU A CD2  1 
ATOM   5072  H  H    . LEU A  1 366 ? 178.242 102.555 81.280  1.00 91.51  ? 558  LEU A H    1 
ATOM   5073  H  HA   . LEU A  1 366 ? 180.396 103.317 79.831  1.00 89.44  ? 558  LEU A HA   1 
ATOM   5074  H  HB2  . LEU A  1 366 ? 181.191 103.566 81.958  1.00 82.31  ? 558  LEU A HB2  1 
ATOM   5075  H  HB3  . LEU A  1 366 ? 180.550 102.195 82.413  1.00 82.31  ? 558  LEU A HB3  1 
ATOM   5076  H  HG   . LEU A  1 366 ? 182.202 101.093 81.076  1.00 82.14  ? 558  LEU A HG   1 
ATOM   5077  H  HD11 . LEU A  1 366 ? 184.121 102.270 80.497  1.00 81.58  ? 558  LEU A HD11 1 
ATOM   5078  H  HD12 . LEU A  1 366 ? 182.867 102.859 79.719  1.00 81.58  ? 558  LEU A HD12 1 
ATOM   5079  H  HD13 . LEU A  1 366 ? 183.445 103.621 80.988  1.00 81.58  ? 558  LEU A HD13 1 
ATOM   5080  H  HD21 . LEU A  1 366 ? 183.850 101.279 82.716  1.00 84.99  ? 558  LEU A HD21 1 
ATOM   5081  H  HD22 . LEU A  1 366 ? 183.128 102.573 83.287  1.00 84.99  ? 558  LEU A HD22 1 
ATOM   5082  H  HD23 . LEU A  1 366 ? 182.411 101.158 83.379  1.00 84.99  ? 558  LEU A HD23 1 
ATOM   5083  N  N    . LEU A  1 367 ? 180.405 101.178 78.656  1.00 62.64  ? 559  LEU A N    1 
ATOM   5084  C  CA   . LEU A  1 367 ? 180.410 99.897  77.966  1.00 60.36  ? 559  LEU A CA   1 
ATOM   5085  C  C    . LEU A  1 367 ? 181.735 99.192  78.208  1.00 60.54  ? 559  LEU A C    1 
ATOM   5086  O  O    . LEU A  1 367 ? 182.782 99.838  78.307  1.00 59.38  ? 559  LEU A O    1 
ATOM   5087  C  CB   . LEU A  1 367 ? 180.203 100.078 76.462  1.00 57.74  ? 559  LEU A CB   1 
ATOM   5088  C  CG   . LEU A  1 367 ? 178.824 100.524 75.980  1.00 62.18  ? 559  LEU A CG   1 
ATOM   5089  C  CD1  . LEU A  1 367 ? 178.928 101.048 74.555  1.00 61.51  ? 559  LEU A CD1  1 
ATOM   5090  C  CD2  . LEU A  1 367 ? 177.819 99.387  76.058  1.00 63.86  ? 559  LEU A CD2  1 
ATOM   5091  H  H    . LEU A  1 367 ? 180.774 101.812 78.207  1.00 74.92  ? 559  LEU A H    1 
ATOM   5092  H  HA   . LEU A  1 367 ? 179.695 99.339  78.312  1.00 72.19  ? 559  LEU A HA   1 
ATOM   5093  H  HB2  . LEU A  1 367 ? 180.839 100.741 76.150  1.00 69.04  ? 559  LEU A HB2  1 
ATOM   5094  H  HB3  . LEU A  1 367 ? 180.392 99.230  76.030  1.00 69.04  ? 559  LEU A HB3  1 
ATOM   5095  H  HG   . LEU A  1 367 ? 178.508 101.246 76.546  1.00 74.36  ? 559  LEU A HG   1 
ATOM   5096  H  HD11 . LEU A  1 367 ? 178.048 101.329 74.258  1.00 73.57  ? 559  LEU A HD11 1 
ATOM   5097  H  HD12 . LEU A  1 367 ? 179.539 101.801 74.540  1.00 73.57  ? 559  LEU A HD12 1 
ATOM   5098  H  HD13 . LEU A  1 367 ? 179.261 100.340 73.982  1.00 73.57  ? 559  LEU A HD13 1 
ATOM   5099  H  HD21 . LEU A  1 367 ? 176.958 99.706  75.746  1.00 76.38  ? 559  LEU A HD21 1 
ATOM   5100  H  HD22 . LEU A  1 367 ? 178.125 98.657  75.498  1.00 76.38  ? 559  LEU A HD22 1 
ATOM   5101  H  HD23 . LEU A  1 367 ? 177.748 99.091  76.979  1.00 76.38  ? 559  LEU A HD23 1 
ATOM   5102  N  N    . SER A  1 368 ? 181.684 97.867  78.307  1.00 66.41  ? 560  SER A N    1 
ATOM   5103  C  CA   . SER A  1 368 ? 182.893 97.062  78.365  1.00 65.92  ? 560  SER A CA   1 
ATOM   5104  C  C    . SER A  1 368 ? 182.679 95.783  77.571  1.00 64.26  ? 560  SER A C    1 
ATOM   5105  O  O    . SER A  1 368 ? 181.597 95.192  77.609  1.00 68.28  ? 560  SER A O    1 
ATOM   5106  C  CB   . SER A  1 368 ? 183.290 96.735  79.810  1.00 63.26  ? 560  SER A CB   1 
ATOM   5107  O  OG   . SER A  1 368 ? 182.254 96.072  80.500  1.00 63.46  ? 560  SER A OG   1 
ATOM   5108  H  H    . SER A  1 368 ? 180.957 97.411  78.341  1.00 79.44  ? 560  SER A H    1 
ATOM   5109  H  HA   . SER A  1 368 ? 183.622 97.553  77.956  1.00 78.86  ? 560  SER A HA   1 
ATOM   5110  H  HB2  . SER A  1 368 ? 184.073 96.163  79.797  1.00 75.67  ? 560  SER A HB2  1 
ATOM   5111  H  HB3  . SER A  1 368 ? 183.495 97.562  80.273  1.00 75.67  ? 560  SER A HB3  1 
ATOM   5112  H  HG   . SER A  1 368 ? 182.066 95.351  80.112  1.00 75.91  ? 560  SER A HG   1 
ATOM   5113  N  N    . SER A  1 369 ? 183.719 95.368  76.855  1.00 63.25  ? 561  SER A N    1 
ATOM   5114  C  CA   . SER A  1 369 ? 183.700 94.164  76.042  1.00 63.41  ? 561  SER A CA   1 
ATOM   5115  C  C    . SER A  1 369 ? 184.815 93.238  76.510  1.00 66.04  ? 561  SER A C    1 
ATOM   5116  O  O    . SER A  1 369 ? 185.885 93.694  76.925  1.00 65.54  ? 561  SER A O    1 
ATOM   5117  C  CB   . SER A  1 369 ? 183.863 94.502  74.556  1.00 64.20  ? 561  SER A CB   1 
ATOM   5118  O  OG   . SER A  1 369 ? 185.178 94.940  74.266  1.00 66.08  ? 561  SER A OG   1 
ATOM   5119  H  H    . SER A  1 369 ? 184.471 95.784  76.826  1.00 75.65  ? 561  SER A H    1 
ATOM   5120  H  HA   . SER A  1 369 ? 182.852 93.707  76.161  1.00 75.84  ? 561  SER A HA   1 
ATOM   5121  H  HB2  . SER A  1 369 ? 183.673 93.708  74.031  1.00 76.79  ? 561  SER A HB2  1 
ATOM   5122  H  HB3  . SER A  1 369 ? 183.239 95.207  74.324  1.00 76.79  ? 561  SER A HB3  1 
ATOM   5123  H  HG   . SER A  1 369 ? 185.731 94.338  74.461  1.00 79.05  ? 561  SER A HG   1 
ATOM   5124  N  N    . SER A  1 370 ? 184.561 91.933  76.444  1.00 65.28  ? 562  SER A N    1 
ATOM   5125  C  CA   . SER A  1 370 ? 185.377 90.977  77.175  1.00 60.84  ? 562  SER A CA   1 
ATOM   5126  C  C    . SER A  1 370 ? 185.668 89.741  76.337  1.00 61.13  ? 562  SER A C    1 
ATOM   5127  O  O    . SER A  1 370 ? 184.993 89.450  75.347  1.00 60.32  ? 562  SER A O    1 
ATOM   5128  C  CB   . SER A  1 370 ? 184.688 90.557  78.479  1.00 62.22  ? 562  SER A CB   1 
ATOM   5129  O  OG   . SER A  1 370 ? 185.422 89.546  79.144  1.00 65.98  ? 562  SER A OG   1 
ATOM   5130  H  H    . SER A  1 370 ? 183.925 91.580  75.984  1.00 78.09  ? 562  SER A H    1 
ATOM   5131  H  HA   . SER A  1 370 ? 186.224 91.392  77.403  1.00 72.76  ? 562  SER A HA   1 
ATOM   5132  H  HB2  . SER A  1 370 ? 184.619 91.330  79.061  1.00 74.41  ? 562  SER A HB2  1 
ATOM   5133  H  HB3  . SER A  1 370 ? 183.803 90.219  78.272  1.00 74.41  ? 562  SER A HB3  1 
ATOM   5134  H  HG   . SER A  1 370 ? 186.192 89.825  79.330  1.00 78.93  ? 562  SER A HG   1 
ATOM   5135  N  N    . GLU A  1 371 ? 186.706 89.017  76.767  1.00 57.56  ? 563  GLU A N    1 
ATOM   5136  C  CA   . GLU A  1 371 ? 186.970 87.674  76.263  1.00 54.07  ? 563  GLU A CA   1 
ATOM   5137  C  C    . GLU A  1 371 ? 185.752 86.771  76.399  1.00 56.28  ? 563  GLU A C    1 
ATOM   5138  O  O    . GLU A  1 371 ? 185.582 85.836  75.608  1.00 54.93  ? 563  GLU A O    1 
ATOM   5139  C  CB   . GLU A  1 371 ? 188.161 87.072  77.020  1.00 61.96  ? 563  GLU A CB   1 
ATOM   5140  C  CG   . GLU A  1 371 ? 188.495 85.620  76.678  1.00 66.57  ? 563  GLU A CG   1 
ATOM   5141  C  CD   . GLU A  1 371 ? 187.622 84.613  77.408  1.00 69.42  ? 563  GLU A CD   1 
ATOM   5142  O  OE1  . GLU A  1 371 ? 187.093 84.948  78.490  1.00 68.89  ? 563  GLU A OE1  1 
ATOM   5143  O  OE2  . GLU A  1 371 ? 187.469 83.482  76.901  1.00 70.68  ? 563  GLU A OE2  1 
ATOM   5144  H  H    . GLU A  1 371 ? 187.274 89.286  77.355  1.00 68.82  ? 563  GLU A H    1 
ATOM   5145  H  HA   . GLU A  1 371 ? 187.205 87.727  75.324  1.00 64.64  ? 563  GLU A HA   1 
ATOM   5146  H  HB2  . GLU A  1 371 ? 188.948 87.605  76.827  1.00 74.10  ? 563  GLU A HB2  1 
ATOM   5147  H  HB3  . GLU A  1 371 ? 187.971 87.110  77.971  1.00 74.10  ? 563  GLU A HB3  1 
ATOM   5148  H  HG2  . GLU A  1 371 ? 188.371 85.486  75.725  1.00 79.63  ? 563  GLU A HG2  1 
ATOM   5149  H  HG3  . GLU A  1 371 ? 189.418 85.445  76.918  1.00 79.63  ? 563  GLU A HG3  1 
ATOM   5150  N  N    . ASP A  1 372 ? 184.900 87.025  77.395  1.00 58.79  ? 564  ASP A N    1 
ATOM   5151  C  CA   . ASP A  1 372 ? 183.760 86.154  77.660  1.00 58.82  ? 564  ASP A CA   1 
ATOM   5152  C  C    . ASP A  1 372 ? 182.670 86.251  76.599  1.00 62.87  ? 564  ASP A C    1 
ATOM   5153  O  O    . ASP A  1 372 ? 181.659 85.549  76.717  1.00 65.67  ? 564  ASP A O    1 
ATOM   5154  C  CB   . ASP A  1 372 ? 183.180 86.454  79.048  1.00 63.19  ? 564  ASP A CB   1 
ATOM   5155  C  CG   . ASP A  1 372 ? 182.574 87.845  79.156  1.00 67.80  ? 564  ASP A CG   1 
ATOM   5156  O  OD1  . ASP A  1 372 ? 182.213 88.440  78.119  1.00 71.73  ? 564  ASP A OD1  1 
ATOM   5157  O  OD2  . ASP A  1 372 ? 182.454 88.344  80.297  1.00 66.21  ? 564  ASP A OD2  1 
ATOM   5158  H  H    . ASP A  1 372 ? 184.963 87.696  77.929  1.00 70.30  ? 564  ASP A H    1 
ATOM   5159  H  HA   . ASP A  1 372 ? 184.073 85.236  77.669  1.00 70.33  ? 564  ASP A HA   1 
ATOM   5160  H  HB2  . ASP A  1 372 ? 182.483 85.809  79.244  1.00 75.58  ? 564  ASP A HB2  1 
ATOM   5161  H  HB3  . ASP A  1 372 ? 183.889 86.386  79.706  1.00 75.58  ? 564  ASP A HB3  1 
ATOM   5162  N  N    . GLY A  1 373 ? 182.831 87.100  75.586  1.00 59.59  ? 565  GLY A N    1 
ATOM   5163  C  CA   . GLY A  1 373 ? 181.901 87.146  74.480  1.00 57.75  ? 565  GLY A CA   1 
ATOM   5164  C  C    . GLY A  1 373 ? 180.765 88.132  74.626  1.00 59.70  ? 565  GLY A C    1 
ATOM   5165  O  O    . GLY A  1 373 ? 179.883 88.163  73.758  1.00 61.85  ? 565  GLY A O    1 
ATOM   5166  H  H    . GLY A  1 373 ? 183.478 87.663  75.523  1.00 71.26  ? 565  GLY A H    1 
ATOM   5167  H  HA2  . GLY A  1 373 ? 182.388 87.371  73.672  1.00 69.06  ? 565  GLY A HA2  1 
ATOM   5168  H  HA3  . GLY A  1 373 ? 181.515 86.264  74.360  1.00 69.06  ? 565  GLY A HA3  1 
ATOM   5169  N  N    . THR A  1 374 ? 180.747 88.929  75.688  1.00 62.15  ? 566  THR A N    1 
ATOM   5170  C  CA   . THR A  1 374 ? 179.642 89.834  75.954  1.00 65.05  ? 566  THR A CA   1 
ATOM   5171  C  C    . THR A  1 374 ? 180.117 91.279  75.961  1.00 63.36  ? 566  THR A C    1 
ATOM   5172  O  O    . THR A  1 374 ? 181.293 91.574  76.196  1.00 61.76  ? 566  THR A O    1 
ATOM   5173  C  CB   . THR A  1 374 ? 178.977 89.514  77.300  1.00 65.20  ? 566  THR A CB   1 
ATOM   5174  O  OG1  . THR A  1 374 ? 179.849 89.898  78.372  1.00 70.29  ? 566  THR A OG1  1 
ATOM   5175  C  CG2  . THR A  1 374 ? 178.676 88.028  77.408  1.00 63.12  ? 566  THR A CG2  1 
ATOM   5176  H  H    . THR A  1 374 ? 181.374 88.964  76.275  1.00 74.33  ? 566  THR A H    1 
ATOM   5177  H  HA   . THR A  1 374 ? 178.976 89.737  75.256  1.00 77.81  ? 566  THR A HA   1 
ATOM   5178  H  HB   . THR A  1 374 ? 178.142 90.003  77.371  1.00 77.99  ? 566  THR A HB   1 
ATOM   5179  H  HG1  . THR A  1 374 ? 180.574 89.477  78.317  1.00 84.10  ? 566  THR A HG1  1 
ATOM   5180  H  HG21 . THR A  1 374 ? 178.256 87.836  78.261  1.00 75.50  ? 566  THR A HG21 1 
ATOM   5181  H  HG22 . THR A  1 374 ? 178.077 87.759  76.694  1.00 75.50  ? 566  THR A HG22 1 
ATOM   5182  H  HG23 . THR A  1 374 ? 179.498 87.518  77.339  1.00 75.50  ? 566  THR A HG23 1 
ATOM   5183  N  N    . VAL A  1 375 ? 179.174 92.178  75.691  1.00 65.05  ? 567  VAL A N    1 
ATOM   5184  C  CA   . VAL A  1 375 ? 179.326 93.604  75.956  1.00 62.23  ? 567  VAL A CA   1 
ATOM   5185  C  C    . VAL A  1 375 ? 178.400 93.940  77.114  1.00 65.48  ? 567  VAL A C    1 
ATOM   5186  O  O    . VAL A  1 375 ? 177.190 93.691  77.042  1.00 65.80  ? 567  VAL A O    1 
ATOM   5187  C  CB   . VAL A  1 375 ? 179.000 94.463  74.726  1.00 61.30  ? 567  VAL A CB   1 
ATOM   5188  C  CG1  . VAL A  1 375 ? 179.198 95.941  75.050  1.00 64.11  ? 567  VAL A CG1  1 
ATOM   5189  C  CG2  . VAL A  1 375 ? 179.859 94.054  73.546  1.00 59.07  ? 567  VAL A CG2  1 
ATOM   5190  H  H    . VAL A  1 375 ? 178.414 91.978  75.343  1.00 77.81  ? 567  VAL A H    1 
ATOM   5191  H  HA   . VAL A  1 375 ? 180.239 93.788  76.228  1.00 74.42  ? 567  VAL A HA   1 
ATOM   5192  H  HB   . VAL A  1 375 ? 178.070 94.329  74.484  1.00 73.32  ? 567  VAL A HB   1 
ATOM   5193  H  HG11 . VAL A  1 375 ? 178.988 96.467  74.263  1.00 76.68  ? 567  VAL A HG11 1 
ATOM   5194  H  HG12 . VAL A  1 375 ? 178.609 96.186  75.780  1.00 76.68  ? 567  VAL A HG12 1 
ATOM   5195  H  HG13 . VAL A  1 375 ? 180.122 96.085  75.308  1.00 76.68  ? 567  VAL A HG13 1 
ATOM   5196  H  HG21 . VAL A  1 375 ? 179.634 94.610  72.784  1.00 70.64  ? 567  VAL A HG21 1 
ATOM   5197  H  HG22 . VAL A  1 375 ? 180.793 94.174  73.780  1.00 70.64  ? 567  VAL A HG22 1 
ATOM   5198  H  HG23 . VAL A  1 375 ? 179.687 93.122  73.339  1.00 70.64  ? 567  VAL A HG23 1 
ATOM   5199  N  N    . ARG A  1 376 ? 178.964 94.488  78.182  1.00 66.05  ? 568  ARG A N    1 
ATOM   5200  C  CA   . ARG A  1 376 ? 178.195 94.854  79.362  1.00 67.79  ? 568  ARG A CA   1 
ATOM   5201  C  C    . ARG A  1 376 ? 177.982 96.361  79.392  1.00 67.55  ? 568  ARG A C    1 
ATOM   5202  O  O    . ARG A  1 376 ? 178.899 97.134  79.103  1.00 68.82  ? 568  ARG A O    1 
ATOM   5203  C  CB   . ARG A  1 376 ? 178.910 94.399  80.635  1.00 69.30  ? 568  ARG A CB   1 
ATOM   5204  C  CG   . ARG A  1 376 ? 178.701 92.932  80.972  1.00 70.27  ? 568  ARG A CG   1 
ATOM   5205  C  CD   . ARG A  1 376 ? 179.527 92.529  82.180  1.00 74.43  ? 568  ARG A CD   1 
ATOM   5206  N  NE   . ARG A  1 376 ? 178.707 92.039  83.284  1.00 80.47  ? 568  ARG A NE   1 
ATOM   5207  C  CZ   . ARG A  1 376 ? 178.280 90.786  83.403  1.00 82.12  ? 568  ARG A CZ   1 
ATOM   5208  N  NH1  . ARG A  1 376 ? 178.581 89.882  82.478  1.00 81.37  ? 568  ARG A NH1  1 
ATOM   5209  N  NH2  . ARG A  1 376 ? 177.544 90.437  84.449  1.00 81.98  ? 568  ARG A NH2  1 
ATOM   5210  H  H    . ARG A  1 376 ? 179.804 94.659  78.249  1.00 79.01  ? 568  ARG A H    1 
ATOM   5211  H  HA   . ARG A  1 376 ? 177.327 94.423  79.327  1.00 81.09  ? 568  ARG A HA   1 
ATOM   5212  H  HB2  . ARG A  1 376 ? 179.863 94.544  80.526  1.00 82.91  ? 568  ARG A HB2  1 
ATOM   5213  H  HB3  . ARG A  1 376 ? 178.581 94.923  81.381  1.00 82.91  ? 568  ARG A HB3  1 
ATOM   5214  H  HG2  . ARG A  1 376 ? 177.766 92.779  81.176  1.00 84.08  ? 568  ARG A HG2  1 
ATOM   5215  H  HG3  . ARG A  1 376 ? 178.976 92.386  80.218  1.00 84.08  ? 568  ARG A HG3  1 
ATOM   5216  H  HD2  . ARG A  1 376 ? 180.139 91.822  81.923  1.00 89.06  ? 568  ARG A HD2  1 
ATOM   5217  H  HD3  . ARG A  1 376 ? 180.024 93.300  82.495  1.00 89.06  ? 568  ARG A HD3  1 
ATOM   5218  H  HE   . ARG A  1 376 ? 178.486 92.598  83.898  1.00 96.31  ? 568  ARG A HE   1 
ATOM   5219  H  HH11 . ARG A  1 376 ? 179.059 90.104  81.799  1.00 97.39  ? 568  ARG A HH11 1 
ATOM   5220  H  HH12 . ARG A  1 376 ? 178.300 89.073  82.560  1.00 97.39  ? 568  ARG A HH12 1 
ATOM   5221  H  HH21 . ARG A  1 376 ? 177.345 91.021  85.049  1.00 98.13  ? 568  ARG A HH21 1 
ATOM   5222  H  HH22 . ARG A  1 376 ? 177.263 89.628  84.527  1.00 98.13  ? 568  ARG A HH22 1 
ATOM   5223  N  N    . LEU A  1 377 ? 176.761 96.767  79.727  1.00 66.52  ? 569  LEU A N    1 
ATOM   5224  C  CA   . LEU A  1 377 ? 176.418 98.171  79.913  1.00 61.46  ? 569  LEU A CA   1 
ATOM   5225  C  C    . LEU A  1 377 ? 176.316 98.443  81.409  1.00 62.09  ? 569  LEU A C    1 
ATOM   5226  O  O    . LEU A  1 377 ? 175.463 97.863  82.090  1.00 64.54  ? 569  LEU A O    1 
ATOM   5227  C  CB   . LEU A  1 377 ? 175.100 98.510  79.215  1.00 61.77  ? 569  LEU A CB   1 
ATOM   5228  C  CG   . LEU A  1 377 ? 174.652 99.974  79.249  1.00 62.31  ? 569  LEU A CG   1 
ATOM   5229  C  CD1  . LEU A  1 377 ? 175.550 100.831 78.372  1.00 62.70  ? 569  LEU A CD1  1 
ATOM   5230  C  CD2  . LEU A  1 377 ? 173.196 100.115 78.828  1.00 61.58  ? 569  LEU A CD2  1 
ATOM   5231  H  H    . LEU A  1 377 ? 176.099 96.234  79.855  1.00 79.58  ? 569  LEU A H    1 
ATOM   5232  H  HA   . LEU A  1 377 ? 177.118 98.731  79.542  1.00 73.50  ? 569  LEU A HA   1 
ATOM   5233  H  HB2  . LEU A  1 377 ? 175.180 98.257  78.282  1.00 73.87  ? 569  LEU A HB2  1 
ATOM   5234  H  HB3  . LEU A  1 377 ? 174.397 97.986  79.629  1.00 73.87  ? 569  LEU A HB3  1 
ATOM   5235  H  HG   . LEU A  1 377 ? 174.728 100.302 80.158  1.00 74.53  ? 569  LEU A HG   1 
ATOM   5236  H  HD11 . LEU A  1 377 ? 175.244 101.751 78.411  1.00 74.99  ? 569  LEU A HD11 1 
ATOM   5237  H  HD12 . LEU A  1 377 ? 176.461 100.771 78.700  1.00 74.99  ? 569  LEU A HD12 1 
ATOM   5238  H  HD13 . LEU A  1 377 ? 175.504 100.506 77.460  1.00 74.99  ? 569  LEU A HD13 1 
ATOM   5239  H  HD21 . LEU A  1 377 ? 172.948 101.052 78.861  1.00 73.64  ? 569  LEU A HD21 1 
ATOM   5240  H  HD22 . LEU A  1 377 ? 173.096 99.777  77.924  1.00 73.64  ? 569  LEU A HD22 1 
ATOM   5241  H  HD23 . LEU A  1 377 ? 172.641 99.604  79.436  1.00 73.64  ? 569  LEU A HD23 1 
ATOM   5242  N  N    . TRP A  1 378 ? 177.192 99.304  81.920  1.00 66.76  ? 570  TRP A N    1 
ATOM   5243  C  CA   . TRP A  1 378 ? 177.186 99.675  83.328  1.00 66.90  ? 570  TRP A CA   1 
ATOM   5244  C  C    . TRP A  1 378 ? 176.555 101.049 83.497  1.00 60.16  ? 570  TRP A C    1 
ATOM   5245  O  O    . TRP A  1 378 ? 176.730 101.929 82.651  1.00 61.39  ? 570  TRP A O    1 
ATOM   5246  C  CB   . TRP A  1 378 ? 178.603 99.704  83.903  1.00 69.72  ? 570  TRP A CB   1 
ATOM   5247  C  CG   . TRP A  1 378 ? 179.399 98.475  83.632  1.00 69.80  ? 570  TRP A CG   1 
ATOM   5248  C  CD1  . TRP A  1 378 ? 180.142 98.217  82.521  1.00 67.67  ? 570  TRP A CD1  1 
ATOM   5249  C  CD2  . TRP A  1 378 ? 179.556 97.342  84.494  1.00 66.93  ? 570  TRP A CD2  1 
ATOM   5250  N  NE1  . TRP A  1 378 ? 180.745 96.992  82.630  1.00 66.30  ? 570  TRP A NE1  1 
ATOM   5251  C  CE2  . TRP A  1 378 ? 180.403 96.433  83.832  1.00 64.73  ? 570  TRP A CE2  1 
ATOM   5252  C  CE3  . TRP A  1 378 ? 179.061 97.005  85.757  1.00 66.46  ? 570  TRP A CE3  1 
ATOM   5253  C  CZ2  . TRP A  1 378 ? 180.765 95.209  84.389  1.00 65.35  ? 570  TRP A CZ2  1 
ATOM   5254  C  CZ3  . TRP A  1 378 ? 179.422 95.788  86.308  1.00 65.84  ? 570  TRP A CZ3  1 
ATOM   5255  C  CH2  . TRP A  1 378 ? 180.266 94.905  85.624  1.00 64.73  ? 570  TRP A CH2  1 
ATOM   5256  H  H    . TRP A  1 378 ? 177.808 99.691  81.462  1.00 79.86  ? 570  TRP A H    1 
ATOM   5257  H  HA   . TRP A  1 378 ? 176.662 99.032  83.831  1.00 80.03  ? 570  TRP A HA   1 
ATOM   5258  H  HB2  . TRP A  1 378 ? 179.079 100.455 83.517  1.00 83.42  ? 570  TRP A HB2  1 
ATOM   5259  H  HB3  . TRP A  1 378 ? 178.545 99.812  84.865  1.00 83.42  ? 570  TRP A HB3  1 
ATOM   5260  H  HD1  . TRP A  1 378 ? 180.225 98.789  81.793  1.00 80.96  ? 570  TRP A HD1  1 
ATOM   5261  H  HE1  . TRP A  1 378 ? 181.257 96.633  82.039  1.00 79.31  ? 570  TRP A HE1  1 
ATOM   5262  H  HE3  . TRP A  1 378 ? 178.499 97.586  86.217  1.00 79.50  ? 570  TRP A HE3  1 
ATOM   5263  H  HZ2  . TRP A  1 378 ? 181.325 94.620  83.936  1.00 78.17  ? 570  TRP A HZ2  1 
ATOM   5264  H  HZ3  . TRP A  1 378 ? 179.098 95.553  87.147  1.00 78.76  ? 570  TRP A HZ3  1 
ATOM   5265  H  HH2  . TRP A  1 378 ? 180.492 94.093  86.019  1.00 77.43  ? 570  TRP A HH2  1 
ATOM   5266  N  N    . SER A  1 379 ? 175.822 101.227 84.590  1.00 64.26  ? 571  SER A N    1 
ATOM   5267  C  CA   . SER A  1 379 ? 175.314 102.539 84.966  1.00 65.47  ? 571  SER A CA   1 
ATOM   5268  C  C    . SER A  1 379 ? 176.343 103.250 85.829  1.00 67.18  ? 571  SER A C    1 
ATOM   5269  O  O    . SER A  1 379 ? 176.870 102.668 86.781  1.00 67.35  ? 571  SER A O    1 
ATOM   5270  C  CB   . SER A  1 379 ? 173.998 102.430 85.732  1.00 65.50  ? 571  SER A CB   1 
ATOM   5271  O  OG   . SER A  1 379 ? 173.547 103.716 86.125  1.00 67.53  ? 571  SER A OG   1 
ATOM   5272  H  H    . SER A  1 379 ? 175.604 100.599 85.135  1.00 76.86  ? 571  SER A H    1 
ATOM   5273  H  HA   . SER A  1 379 ? 175.162 103.068 84.168  1.00 78.32  ? 571  SER A HA   1 
ATOM   5274  H  HB2  . SER A  1 379 ? 173.330 102.021 85.159  1.00 78.35  ? 571  SER A HB2  1 
ATOM   5275  H  HB3  . SER A  1 379 ? 174.136 101.886 86.524  1.00 78.35  ? 571  SER A HB3  1 
ATOM   5276  H  HG   . SER A  1 379 ? 172.823 103.651 86.545  1.00 80.79  ? 571  SER A HG   1 
ATOM   5277  N  N    . LEU A  1 380 ? 176.617 104.507 85.504  1.00 70.58  ? 572  LEU A N    1 
ATOM   5278  C  CA   . LEU A  1 380 ? 177.459 105.346 86.341  1.00 69.91  ? 572  LEU A CA   1 
ATOM   5279  C  C    . LEU A  1 380 ? 176.642 106.182 87.318  1.00 70.20  ? 572  LEU A C    1 
ATOM   5280  O  O    . LEU A  1 380 ? 177.171 107.133 87.906  1.00 70.78  ? 572  LEU A O    1 
ATOM   5281  C  CB   . LEU A  1 380 ? 178.340 106.230 85.458  1.00 67.23  ? 572  LEU A CB   1 
ATOM   5282  C  CG   . LEU A  1 380 ? 179.191 105.415 84.475  1.00 67.55  ? 572  LEU A CG   1 
ATOM   5283  C  CD1  . LEU A  1 380 ? 180.041 106.322 83.599  1.00 68.54  ? 572  LEU A CD1  1 
ATOM   5284  C  CD2  . LEU A  1 380 ? 180.066 104.383 85.192  1.00 67.71  ? 572  LEU A CD2  1 
ATOM   5285  H  H    . LEU A  1 380 ? 176.324 104.900 84.798  1.00 84.45  ? 572  LEU A H    1 
ATOM   5286  H  HA   . LEU A  1 380 ? 178.045 104.774 86.862  1.00 83.64  ? 572  LEU A HA   1 
ATOM   5287  H  HB2  . LEU A  1 380 ? 177.774 106.826 84.942  1.00 80.42  ? 572  LEU A HB2  1 
ATOM   5288  H  HB3  . LEU A  1 380 ? 178.939 106.744 86.021  1.00 80.42  ? 572  LEU A HB3  1 
ATOM   5289  H  HG   . LEU A  1 380 ? 178.593 104.926 83.888  1.00 80.81  ? 572  LEU A HG   1 
ATOM   5290  H  HD11 . LEU A  1 380 ? 180.564 105.774 82.993  1.00 82.00  ? 572  LEU A HD11 1 
ATOM   5291  H  HD12 . LEU A  1 380 ? 179.457 106.910 83.095  1.00 82.00  ? 572  LEU A HD12 1 
ATOM   5292  H  HD13 . LEU A  1 380 ? 180.630 106.845 84.165  1.00 82.00  ? 572  LEU A HD13 1 
ATOM   5293  H  HD21 . LEU A  1 380 ? 180.584 103.895 84.532  1.00 81.00  ? 572  LEU A HD21 1 
ATOM   5294  H  HD22 . LEU A  1 380 ? 180.661 104.845 85.804  1.00 81.00  ? 572  LEU A HD22 1 
ATOM   5295  H  HD23 . LEU A  1 380 ? 179.495 103.772 85.683  1.00 81.00  ? 572  LEU A HD23 1 
ATOM   5296  N  N    . GLN A  1 381 ? 175.368 105.838 87.501  1.00 77.04  ? 573  GLN A N    1 
ATOM   5297  C  CA   . GLN A  1 381 ? 174.546 106.309 88.608  1.00 80.30  ? 573  GLN A CA   1 
ATOM   5298  C  C    . GLN A  1 381 ? 174.441 105.276 89.720  1.00 75.22  ? 573  GLN A C    1 
ATOM   5299  O  O    . GLN A  1 381 ? 174.566 105.623 90.898  1.00 77.48  ? 573  GLN A O    1 
ATOM   5300  C  CB   . GLN A  1 381 ? 173.137 106.659 88.114  1.00 83.42  ? 573  GLN A CB   1 
ATOM   5301  C  CG   . GLN A  1 381 ? 173.088 107.734 87.044  1.00 87.44  ? 573  GLN A CG   1 
ATOM   5302  C  CD   . GLN A  1 381 ? 173.722 109.034 87.499  1.00 92.70  ? 573  GLN A CD   1 
ATOM   5303  O  OE1  . GLN A  1 381 ? 173.647 109.397 88.674  1.00 90.84  ? 573  GLN A OE1  1 
ATOM   5304  N  NE2  . GLN A  1 381 ? 174.349 109.744 86.568  1.00 94.41  ? 573  GLN A NE2  1 
ATOM   5305  H  H    . GLN A  1 381 ? 174.943 105.309 86.972  1.00 92.20  ? 573  GLN A H    1 
ATOM   5306  H  HA   . GLN A  1 381 ? 174.944 107.112 88.979  1.00 96.11  ? 573  GLN A HA   1 
ATOM   5307  H  HB2  . GLN A  1 381 ? 172.732 105.859 87.745  1.00 99.86  ? 573  GLN A HB2  1 
ATOM   5308  H  HB3  . GLN A  1 381 ? 172.614 106.971 88.869  1.00 99.86  ? 573  GLN A HB3  1 
ATOM   5309  H  HG2  . GLN A  1 381 ? 173.567 107.424 86.260  1.00 104.68 ? 573  GLN A HG2  1 
ATOM   5310  H  HG3  . GLN A  1 381 ? 172.162 107.915 86.818  1.00 104.68 ? 573  GLN A HG3  1 
ATOM   5311  H  HE21 . GLN A  1 381 ? 174.380 109.458 85.758  1.00 113.05 ? 573  GLN A HE21 1 
ATOM   5312  H  HE22 . GLN A  1 381 ? 174.725 110.489 86.777  1.00 113.05 ? 573  GLN A HE22 1 
ATOM   5313  N  N    . THR A  1 382 ? 174.214 104.012 89.361  1.00 67.23  ? 574  THR A N    1 
ATOM   5314  C  CA   . THR A  1 382 ? 174.123 102.922 90.322  1.00 68.40  ? 574  THR A CA   1 
ATOM   5315  C  C    . THR A  1 382 ? 175.398 102.096 90.403  1.00 64.98  ? 574  THR A C    1 
ATOM   5316  O  O    . THR A  1 382 ? 175.573 101.349 91.371  1.00 63.77  ? 574  THR A O    1 
ATOM   5317  C  CB   . THR A  1 382 ? 172.965 101.984 89.955  1.00 68.85  ? 574  THR A CB   1 
ATOM   5318  O  OG1  . THR A  1 382 ? 173.211 101.395 88.672  1.00 69.02  ? 574  THR A OG1  1 
ATOM   5319  C  CG2  . THR A  1 382 ? 171.652 102.748 89.907  1.00 60.85  ? 574  THR A CG2  1 
ATOM   5320  H  H    . THR A  1 382 ? 174.106 103.759 88.546  1.00 80.43  ? 574  THR A H    1 
ATOM   5321  H  HA   . THR A  1 382 ? 173.947 103.290 91.202  1.00 81.83  ? 574  THR A HA   1 
ATOM   5322  H  HB   . THR A  1 382 ? 172.890 101.285 90.624  1.00 82.38  ? 574  THR A HB   1 
ATOM   5323  H  HG1  . THR A  1 382 ? 173.927 100.955 88.690  1.00 82.57  ? 574  THR A HG1  1 
ATOM   5324  H  HG21 . THR A  1 382 ? 170.927 102.146 89.675  1.00 72.77  ? 574  THR A HG21 1 
ATOM   5325  H  HG22 . THR A  1 382 ? 171.467 103.144 90.773  1.00 72.77  ? 574  THR A HG22 1 
ATOM   5326  H  HG23 . THR A  1 382 ? 171.702 103.452 89.243  1.00 72.77  ? 574  THR A HG23 1 
ATOM   5327  N  N    . PHE A  1 383 ? 176.283 102.212 89.412  1.00 64.94  ? 575  PHE A N    1 
ATOM   5328  C  CA   . PHE A  1 383 ? 177.510 101.419 89.353  1.00 65.52  ? 575  PHE A CA   1 
ATOM   5329  C  C    . PHE A  1 383 ? 177.194 99.931  89.462  1.00 65.05  ? 575  PHE A C    1 
ATOM   5330  O  O    . PHE A  1 383 ? 177.860 99.171  90.168  1.00 62.93  ? 575  PHE A O    1 
ATOM   5331  C  CB   . PHE A  1 383 ? 178.502 101.884 90.416  1.00 68.70  ? 575  PHE A CB   1 
ATOM   5332  C  CG   . PHE A  1 383 ? 179.164 103.186 90.065  1.00 71.45  ? 575  PHE A CG   1 
ATOM   5333  C  CD1  . PHE A  1 383 ? 178.555 104.393 90.369  1.00 72.38  ? 575  PHE A CD1  1 
ATOM   5334  C  CD2  . PHE A  1 383 ? 180.370 103.203 89.385  1.00 70.70  ? 575  PHE A CD2  1 
ATOM   5335  C  CE1  . PHE A  1 383 ? 179.152 105.592 90.028  1.00 72.16  ? 575  PHE A CE1  1 
ATOM   5336  C  CE2  . PHE A  1 383 ? 180.971 104.397 89.041  1.00 72.35  ? 575  PHE A CE2  1 
ATOM   5337  C  CZ   . PHE A  1 383 ? 180.362 105.593 89.362  1.00 71.78  ? 575  PHE A CZ   1 
ATOM   5338  H  H    . PHE A  1 383 ? 176.192 102.754 88.750  1.00 77.68  ? 575  PHE A H    1 
ATOM   5339  H  HA   . PHE A  1 383 ? 177.925 101.564 88.488  1.00 78.38  ? 575  PHE A HA   1 
ATOM   5340  H  HB2  . PHE A  1 383 ? 178.032 102.004 91.256  1.00 82.19  ? 575  PHE A HB2  1 
ATOM   5341  H  HB3  . PHE A  1 383 ? 179.195 101.213 90.517  1.00 82.19  ? 575  PHE A HB3  1 
ATOM   5342  H  HD1  . PHE A  1 383 ? 177.741 104.397 90.819  1.00 86.61  ? 575  PHE A HD1  1 
ATOM   5343  H  HD2  . PHE A  1 383 ? 180.785 102.400 89.166  1.00 84.60  ? 575  PHE A HD2  1 
ATOM   5344  H  HE1  . PHE A  1 383 ? 178.740 106.396 90.246  1.00 86.35  ? 575  PHE A HE1  1 
ATOM   5345  H  HE2  . PHE A  1 383 ? 181.786 104.396 88.593  1.00 86.58  ? 575  PHE A HE2  1 
ATOM   5346  H  HZ   . PHE A  1 383 ? 180.766 106.399 89.133  1.00 85.89  ? 575  PHE A HZ   1 
ATOM   5347  N  N    . THR A  1 384 ? 176.155 99.522  88.738  1.00 65.62  ? 576  THR A N    1 
ATOM   5348  C  CA   . THR A  1 384 ? 175.769 98.131  88.579  1.00 63.53  ? 576  THR A CA   1 
ATOM   5349  C  C    . THR A  1 384 ? 175.610 97.846  87.092  1.00 63.43  ? 576  THR A C    1 
ATOM   5350  O  O    . THR A  1 384 ? 175.462 98.761  86.278  1.00 62.64  ? 576  THR A O    1 
ATOM   5351  C  CB   . THR A  1 384 ? 174.458 97.815  89.313  1.00 65.88  ? 576  THR A CB   1 
ATOM   5352  O  OG1  . THR A  1 384 ? 173.408 98.638  88.791  1.00 70.67  ? 576  THR A OG1  1 
ATOM   5353  C  CG2  . THR A  1 384 ? 174.603 98.062  90.805  1.00 71.49  ? 576  THR A CG2  1 
ATOM   5354  H  H    . THR A  1 384 ? 175.638 100.062 88.312  1.00 78.49  ? 576  THR A H    1 
ATOM   5355  H  HA   . THR A  1 384 ? 176.467 97.557  88.932  1.00 75.99  ? 576  THR A HA   1 
ATOM   5356  H  HB   . THR A  1 384 ? 174.232 96.882  89.179  1.00 78.81  ? 576  THR A HB   1 
ATOM   5357  H  HG1  . THR A  1 384 ? 172.687 98.471  89.188  1.00 84.55  ? 576  THR A HG1  1 
ATOM   5358  H  HG21 . THR A  1 384 ? 173.769 97.859  91.257  1.00 85.54  ? 576  THR A HG21 1 
ATOM   5359  H  HG22 . THR A  1 384 ? 175.304 97.498  91.168  1.00 85.54  ? 576  THR A HG22 1 
ATOM   5360  H  HG23 . THR A  1 384 ? 174.831 98.991  90.967  1.00 85.54  ? 576  THR A HG23 1 
ATOM   5361  N  N    . CYS A  1 385 ? 175.648 96.565  86.739  1.00 64.63  ? 577  CYS A N    1 
ATOM   5362  C  CA   . CYS A  1 385 ? 175.473 96.170  85.348  1.00 65.13  ? 577  CYS A CA   1 
ATOM   5363  C  C    . CYS A  1 385 ? 173.992 96.177  84.991  1.00 66.77  ? 577  CYS A C    1 
ATOM   5364  O  O    . CYS A  1 385 ? 173.172 95.576  85.691  1.00 64.76  ? 577  CYS A O    1 
ATOM   5365  C  CB   . CYS A  1 385 ? 176.072 94.787  85.102  1.00 66.79  ? 577  CYS A CB   1 
ATOM   5366  S  SG   . CYS A  1 385 ? 176.040 94.277  83.373  1.00 68.01  ? 577  CYS A SG   1 
ATOM   5367  H  H    . CYS A  1 385 ? 175.772 95.910  87.282  1.00 77.31  ? 577  CYS A H    1 
ATOM   5368  H  HA   . CYS A  1 385 ? 175.928 96.806  84.775  1.00 77.91  ? 577  CYS A HA   1 
ATOM   5369  H  HB2  . CYS A  1 385 ? 176.998 94.791  85.393  1.00 79.90  ? 577  CYS A HB2  1 
ATOM   5370  H  HB3  . CYS A  1 385 ? 175.570 94.133  85.614  1.00 79.90  ? 577  CYS A HB3  1 
ATOM   5371  H  HG   . CYS A  1 385 ? 174.902 94.249  82.994  1.00 81.37  ? 577  CYS A HG   1 
ATOM   5372  N  N    . LEU A  1 386 ? 173.654 96.858  83.895  1.00 62.80  ? 578  LEU A N    1 
ATOM   5373  C  CA   . LEU A  1 386 ? 172.270 96.963  83.451  1.00 58.75  ? 578  LEU A CA   1 
ATOM   5374  C  C    . LEU A  1 386 ? 171.917 95.908  82.410  1.00 58.06  ? 578  LEU A C    1 
ATOM   5375  O  O    . LEU A  1 386 ? 170.852 95.289  82.488  1.00 62.03  ? 578  LEU A O    1 
ATOM   5376  C  CB   . LEU A  1 386 ? 172.003 98.355  82.873  1.00 58.91  ? 578  LEU A CB   1 
ATOM   5377  C  CG   . LEU A  1 386 ? 172.197 99.547  83.804  1.00 63.24  ? 578  LEU A CG   1 
ATOM   5378  C  CD1  . LEU A  1 386 ? 171.934 100.821 83.022  1.00 69.23  ? 578  LEU A CD1  1 
ATOM   5379  C  CD2  . LEU A  1 386 ? 171.284 99.449  85.010  1.00 67.85  ? 578  LEU A CD2  1 
ATOM   5380  H  H    . LEU A  1 386 ? 174.215 97.270  83.389  1.00 75.11  ? 578  LEU A H    1 
ATOM   5381  H  HA   . LEU A  1 386 ? 171.684 96.838  84.214  1.00 70.25  ? 578  LEU A HA   1 
ATOM   5382  H  HB2  . LEU A  1 386 ? 172.596 98.485  82.116  1.00 70.45  ? 578  LEU A HB2  1 
ATOM   5383  H  HB3  . LEU A  1 386 ? 171.083 98.381  82.565  1.00 70.45  ? 578  LEU A HB3  1 
ATOM   5384  H  HG   . LEU A  1 386 ? 173.115 99.564  84.116  1.00 75.64  ? 578  LEU A HG   1 
ATOM   5385  H  HD11 . LEU A  1 386 ? 172.056 101.583 83.611  1.00 82.83  ? 578  LEU A HD11 1 
ATOM   5386  H  HD12 . LEU A  1 386 ? 172.558 100.872 82.281  1.00 82.83  ? 578  LEU A HD12 1 
ATOM   5387  H  HD13 . LEU A  1 386 ? 171.023 100.804 82.688  1.00 82.83  ? 578  LEU A HD13 1 
ATOM   5388  H  HD21 . LEU A  1 386 ? 171.432 100.220 85.580  1.00 81.18  ? 578  LEU A HD21 1 
ATOM   5389  H  HD22 . LEU A  1 386 ? 170.363 99.432  84.708  1.00 81.18  ? 578  LEU A HD22 1 
ATOM   5390  H  HD23 . LEU A  1 386 ? 171.489 98.634  85.495  1.00 81.18  ? 578  LEU A HD23 1 
ATOM   5391  N  N    . VAL A  1 387 ? 172.787 95.706  81.422  1.00 62.02  ? 579  VAL A N    1 
ATOM   5392  C  CA   . VAL A  1 387 ? 172.492 94.828  80.298  1.00 62.57  ? 579  VAL A CA   1 
ATOM   5393  C  C    . VAL A  1 387 ? 173.761 94.100  79.882  1.00 62.63  ? 579  VAL A C    1 
ATOM   5394  O  O    . VAL A  1 387 ? 174.865 94.647  79.948  1.00 67.18  ? 579  VAL A O    1 
ATOM   5395  C  CB   . VAL A  1 387 ? 171.913 95.604  79.091  1.00 62.93  ? 579  VAL A CB   1 
ATOM   5396  C  CG1  . VAL A  1 387 ? 171.393 94.638  78.039  1.00 63.74  ? 579  VAL A CG1  1 
ATOM   5397  C  CG2  . VAL A  1 387 ? 170.817 96.562  79.533  1.00 64.40  ? 579  VAL A CG2  1 
ATOM   5398  H  H    . VAL A  1 387 ? 173.564 96.072  81.381  1.00 74.18  ? 579  VAL A H    1 
ATOM   5399  H  HA   . VAL A  1 387 ? 171.839 94.166  80.573  1.00 74.83  ? 579  VAL A HA   1 
ATOM   5400  H  HB   . VAL A  1 387 ? 172.621 96.129  78.688  1.00 75.27  ? 579  VAL A HB   1 
ATOM   5401  H  HG11 . VAL A  1 387 ? 171.036 95.146  77.294  1.00 76.24  ? 579  VAL A HG11 1 
ATOM   5402  H  HG12 . VAL A  1 387 ? 172.125 94.077  77.737  1.00 76.24  ? 579  VAL A HG12 1 
ATOM   5403  H  HG13 . VAL A  1 387 ? 170.696 94.090  78.431  1.00 76.24  ? 579  VAL A HG13 1 
ATOM   5404  H  HG21 . VAL A  1 387 ? 170.476 97.031  78.755  1.00 77.03  ? 579  VAL A HG21 1 
ATOM   5405  H  HG22 . VAL A  1 387 ? 170.104 96.054  79.952  1.00 77.03  ? 579  VAL A HG22 1 
ATOM   5406  H  HG23 . VAL A  1 387 ? 171.188 97.196  80.166  1.00 77.03  ? 579  VAL A HG23 1 
ATOM   5407  N  N    . GLY A  1 388 ? 173.590 92.853  79.451  1.00 62.04  ? 580  GLY A N    1 
ATOM   5408  C  CA   . GLY A  1 388 ? 174.646 92.116  78.789  1.00 61.17  ? 580  GLY A CA   1 
ATOM   5409  C  C    . GLY A  1 388 ? 174.233 91.753  77.379  1.00 61.26  ? 580  GLY A C    1 
ATOM   5410  O  O    . GLY A  1 388 ? 173.280 90.994  77.185  1.00 71.75  ? 580  GLY A O    1 
ATOM   5411  H  H    . GLY A  1 388 ? 172.857 92.411  79.534  1.00 74.20  ? 580  GLY A H    1 
ATOM   5412  H  HA2  . GLY A  1 388 ? 175.451 92.656  78.751  1.00 73.15  ? 580  GLY A HA2  1 
ATOM   5413  H  HA3  . GLY A  1 388 ? 174.837 91.301  79.280  1.00 73.15  ? 580  GLY A HA3  1 
ATOM   5414  N  N    . TYR A  1 389 ? 174.932 92.291  76.387  1.00 56.01  ? 581  TYR A N    1 
ATOM   5415  C  CA   . TYR A  1 389 ? 174.563 92.100  74.990  1.00 58.30  ? 581  TYR A CA   1 
ATOM   5416  C  C    . TYR A  1 389 ? 175.346 90.925  74.424  1.00 62.00  ? 581  TYR A C    1 
ATOM   5417  O  O    . TYR A  1 389 ? 176.581 90.952  74.392  1.00 61.40  ? 581  TYR A O    1 
ATOM   5418  C  CB   . TYR A  1 389 ? 174.826 93.371  74.187  1.00 59.11  ? 581  TYR A CB   1 
ATOM   5419  C  CG   . TYR A  1 389 ? 174.057 94.568  74.697  1.00 62.02  ? 581  TYR A CG   1 
ATOM   5420  C  CD1  . TYR A  1 389 ? 174.606 95.414  75.648  1.00 62.21  ? 581  TYR A CD1  1 
ATOM   5421  C  CD2  . TYR A  1 389 ? 172.778 94.845  74.233  1.00 62.25  ? 581  TYR A CD2  1 
ATOM   5422  C  CE1  . TYR A  1 389 ? 173.907 96.506  76.121  1.00 64.45  ? 581  TYR A CE1  1 
ATOM   5423  C  CE2  . TYR A  1 389 ? 172.071 95.935  74.698  1.00 60.72  ? 581  TYR A CE2  1 
ATOM   5424  C  CZ   . TYR A  1 389 ? 172.640 96.762  75.643  1.00 61.84  ? 581  TYR A CZ   1 
ATOM   5425  O  OH   . TYR A  1 389 ? 171.941 97.849  76.112  1.00 66.86  ? 581  TYR A OH   1 
ATOM   5426  H  H    . TYR A  1 389 ? 175.634 92.775  76.498  1.00 66.97  ? 581  TYR A H    1 
ATOM   5427  H  HA   . TYR A  1 389 ? 173.617 91.893  74.933  1.00 69.71  ? 581  TYR A HA   1 
ATOM   5428  H  HB2  . TYR A  1 389 ? 175.771 93.582  74.233  1.00 70.68  ? 581  TYR A HB2  1 
ATOM   5429  H  HB3  . TYR A  1 389 ? 174.565 93.220  73.265  1.00 70.68  ? 581  TYR A HB3  1 
ATOM   5430  H  HD1  . TYR A  1 389 ? 175.461 95.243  75.973  1.00 74.40  ? 581  TYR A HD1  1 
ATOM   5431  H  HD2  . TYR A  1 389 ? 172.392 94.288  73.595  1.00 74.45  ? 581  TYR A HD2  1 
ATOM   5432  H  HE1  . TYR A  1 389 ? 174.288 97.066  76.758  1.00 77.09  ? 581  TYR A HE1  1 
ATOM   5433  H  HE2  . TYR A  1 389 ? 171.215 96.110  74.378  1.00 72.62  ? 581  TYR A HE2  1 
ATOM   5434  H  HH   . TYR A  1 389 ? 171.188 97.888  75.741  1.00 79.99  ? 581  TYR A HH   1 
ATOM   5435  N  N    . LYS A  1 390 ? 174.626 89.900  73.981  1.00 64.21  ? 582  LYS A N    1 
ATOM   5436  C  CA   . LYS A  1 390 ? 175.221 88.658  73.518  1.00 65.72  ? 582  LYS A CA   1 
ATOM   5437  C  C    . LYS A  1 390 ? 174.987 88.487  72.023  1.00 65.76  ? 582  LYS A C    1 
ATOM   5438  O  O    . LYS A  1 390 ? 173.969 88.926  71.481  1.00 70.83  ? 582  LYS A O    1 
ATOM   5439  C  CB   . LYS A  1 390 ? 174.639 87.469  74.287  1.00 70.83  ? 582  LYS A CB   1 
ATOM   5440  C  CG   . LYS A  1 390 ? 175.031 87.471  75.757  1.00 79.97  ? 582  LYS A CG   1 
ATOM   5441  C  CD   . LYS A  1 390 ? 174.078 86.661  76.620  1.00 87.32  ? 582  LYS A CD   1 
ATOM   5442  C  CE   . LYS A  1 390 ? 174.329 86.923  78.102  1.00 95.21  ? 582  LYS A CE   1 
ATOM   5443  N  NZ   . LYS A  1 390 ? 173.619 88.140  78.601  1.00 100.28 ? 582  LYS A NZ   1 
ATOM   5444  H  H    . LYS A  1 390 ? 173.767 89.903  73.938  1.00 76.81  ? 582  LYS A H    1 
ATOM   5445  H  HA   . LYS A  1 390 ? 176.178 88.683  73.675  1.00 78.62  ? 582  LYS A HA   1 
ATOM   5446  H  HB2  . LYS A  1 390 ? 173.671 87.502  74.234  1.00 84.75  ? 582  LYS A HB2  1 
ATOM   5447  H  HB3  . LYS A  1 390 ? 174.966 86.646  73.891  1.00 84.75  ? 582  LYS A HB3  1 
ATOM   5448  H  HG2  . LYS A  1 390 ? 175.918 87.088  75.849  1.00 95.71  ? 582  LYS A HG2  1 
ATOM   5449  H  HG3  . LYS A  1 390 ? 175.029 88.385  76.084  1.00 95.71  ? 582  LYS A HG3  1 
ATOM   5450  H  HD2  . LYS A  1 390 ? 173.164 86.915  76.415  1.00 104.53 ? 582  LYS A HD2  1 
ATOM   5451  H  HD3  . LYS A  1 390 ? 174.213 85.716  76.449  1.00 104.53 ? 582  LYS A HD3  1 
ATOM   5452  H  HE2  . LYS A  1 390 ? 174.016 86.162  78.615  1.00 114.00 ? 582  LYS A HE2  1 
ATOM   5453  H  HE3  . LYS A  1 390 ? 175.280 87.051  78.244  1.00 114.00 ? 582  LYS A HE3  1 
ATOM   5454  H  HZ1  . LYS A  1 390 ? 173.790 88.258  79.467  1.00 120.09 ? 582  LYS A HZ1  1 
ATOM   5455  H  HZ2  . LYS A  1 390 ? 173.893 88.857  78.152  1.00 120.09 ? 582  LYS A HZ2  1 
ATOM   5456  H  HZ3  . LYS A  1 390 ? 172.741 88.047  78.490  1.00 120.09 ? 582  LYS A HZ3  1 
ATOM   5457  N  N    . GLY A  1 391 ? 175.946 87.848  71.361  1.00 69.31  ? 583  GLY A N    1 
ATOM   5458  C  CA   . GLY A  1 391 ? 175.866 87.651  69.928  1.00 74.19  ? 583  GLY A CA   1 
ATOM   5459  C  C    . GLY A  1 391 ? 177.178 87.199  69.322  1.00 75.98  ? 583  GLY A C    1 
ATOM   5460  O  O    . GLY A  1 391 ? 177.200 86.323  68.451  1.00 77.88  ? 583  GLY A O    1 
ATOM   5461  H  H    . GLY A  1 391 ? 176.653 87.519  71.723  1.00 82.92  ? 583  GLY A H    1 
ATOM   5462  H  HA2  . GLY A  1 391 ? 175.192 86.981  69.732  1.00 88.78  ? 583  GLY A HA2  1 
ATOM   5463  H  HA3  . GLY A  1 391 ? 175.603 88.482  69.503  1.00 88.78  ? 583  GLY A HA3  1 
ATOM   5464  N  N    . HIS A  1 392 ? 178.283 87.797  69.772  1.00 74.78  ? 584  HIS A N    1 
ATOM   5465  C  CA   . HIS A  1 392 ? 179.594 87.419  69.254  1.00 75.04  ? 584  HIS A CA   1 
ATOM   5466  C  C    . HIS A  1 392 ? 179.941 85.979  69.616  1.00 77.99  ? 584  HIS A C    1 
ATOM   5467  O  O    . HIS A  1 392 ? 180.466 85.234  68.781  1.00 80.52  ? 584  HIS A O    1 
ATOM   5468  C  CB   . HIS A  1 392 ? 180.654 88.382  69.787  1.00 77.01  ? 584  HIS A CB   1 
ATOM   5469  C  CG   . HIS A  1 392 ? 180.571 89.755  69.198  1.00 69.84  ? 584  HIS A CG   1 
ATOM   5470  N  ND1  . HIS A  1 392 ? 181.250 90.117  68.054  1.00 73.86  ? 584  HIS A ND1  1 
ATOM   5471  C  CD2  . HIS A  1 392 ? 179.883 90.853  69.591  1.00 73.81  ? 584  HIS A CD2  1 
ATOM   5472  C  CE1  . HIS A  1 392 ? 180.990 91.381  67.772  1.00 69.14  ? 584  HIS A CE1  1 
ATOM   5473  N  NE2  . HIS A  1 392 ? 180.162 91.850  68.687  1.00 75.20  ? 584  HIS A NE2  1 
ATOM   5474  H  H    . HIS A  1 392 ? 178.299 88.416  70.369  1.00 89.49  ? 584  HIS A H    1 
ATOM   5475  H  HA   . HIS A  1 392 ? 179.584 87.491  68.287  1.00 89.80  ? 584  HIS A HA   1 
ATOM   5476  H  HB2  . HIS A  1 392 ? 180.547 88.464  70.748  1.00 92.16  ? 584  HIS A HB2  1 
ATOM   5477  H  HB3  . HIS A  1 392 ? 181.532 88.024  69.583  1.00 92.16  ? 584  HIS A HB3  1 
ATOM   5478  H  HD1  . HIS A  1 392 ? 181.767 89.602  67.599  1.00 88.39  ? 584  HIS A HD1  1 
ATOM   5479  H  HD2  . HIS A  1 392 ? 179.329 90.921  70.334  1.00 88.32  ? 584  HIS A HD2  1 
ATOM   5480  H  HE1  . HIS A  1 392 ? 181.329 91.858  67.049  1.00 82.73  ? 584  HIS A HE1  1 
ATOM   5481  N  N    . ASN A  1 393 ? 179.663 85.575  70.857  1.00 74.37  ? 585  ASN A N    1 
ATOM   5482  C  CA   . ASN A  1 393 ? 179.954 84.227  71.342  1.00 77.99  ? 585  ASN A CA   1 
ATOM   5483  C  C    . ASN A  1 393 ? 181.447 83.915  71.352  1.00 75.40  ? 585  ASN A C    1 
ATOM   5484  O  O    . ASN A  1 393 ? 181.846 82.789  71.668  1.00 76.65  ? 585  ASN A O    1 
ATOM   5485  C  CB   . ASN A  1 393 ? 179.224 83.182  70.494  1.00 80.92  ? 585  ASN A CB   1 
ATOM   5486  C  CG   . ASN A  1 393 ? 177.740 83.464  70.369  1.00 90.07  ? 585  ASN A CG   1 
ATOM   5487  O  OD1  . ASN A  1 393 ? 177.178 83.415  69.273  1.00 92.97  ? 585  ASN A OD1  1 
ATOM   5488  N  ND2  . ASN A  1 393 ? 177.096 83.770  71.489  1.00 94.48  ? 585  ASN A ND2  1 
ATOM   5489  H  H    . ASN A  1 393 ? 179.295 86.077  71.450  1.00 88.99  ? 585  ASN A H    1 
ATOM   5490  H  HA   . ASN A  1 393 ? 179.630 84.148  72.253  1.00 93.33  ? 585  ASN A HA   1 
ATOM   5491  H  HB2  . ASN A  1 393 ? 179.605 83.176  69.603  1.00 96.86  ? 585  ASN A HB2  1 
ATOM   5492  H  HB3  . ASN A  1 393 ? 179.330 82.310  70.907  1.00 96.86  ? 585  ASN A HB3  1 
ATOM   5493  H  HD21 . ASN A  1 393 ? 176.253 83.939  71.469  1.00 113.13 ? 585  ASN A HD21 1 
ATOM   5494  H  HD22 . ASN A  1 393 ? 177.522 83.796  72.236  1.00 113.13 ? 585  ASN A HD22 1 
ATOM   5495  N  N    . TYR A  1 394 ? 182.276 84.898  71.017  1.00 69.14  ? 586  TYR A N    1 
ATOM   5496  C  CA   . TYR A  1 394 ? 183.725 84.756  71.022  1.00 64.91  ? 586  TYR A CA   1 
ATOM   5497  C  C    . TYR A  1 394 ? 184.300 86.066  71.542  1.00 62.73  ? 586  TYR A C    1 
ATOM   5498  O  O    . TYR A  1 394 ? 183.556 87.047  71.672  1.00 63.75  ? 586  TYR A O    1 
ATOM   5499  C  CB   . TYR A  1 394 ? 184.254 84.430  69.623  1.00 68.41  ? 586  TYR A CB   1 
ATOM   5500  C  CG   . TYR A  1 394 ? 183.845 83.071  69.101  1.00 70.53  ? 586  TYR A CG   1 
ATOM   5501  C  CD1  . TYR A  1 394 ? 184.573 81.934  69.425  1.00 70.77  ? 586  TYR A CD1  1 
ATOM   5502  C  CD2  . TYR A  1 394 ? 182.749 82.929  68.262  1.00 73.72  ? 586  TYR A CD2  1 
ATOM   5503  C  CE1  . TYR A  1 394 ? 184.210 80.692  68.945  1.00 74.80  ? 586  TYR A CE1  1 
ATOM   5504  C  CE2  . TYR A  1 394 ? 182.378 81.690  67.775  1.00 75.13  ? 586  TYR A CE2  1 
ATOM   5505  C  CZ   . TYR A  1 394 ? 183.113 80.576  68.119  1.00 79.52  ? 586  TYR A CZ   1 
ATOM   5506  O  OH   . TYR A  1 394 ? 182.748 79.338  67.636  1.00 89.94  ? 586  TYR A OH   1 
ATOM   5507  H  H    . TYR A  1 394 ? 182.013 85.680  70.775  1.00 82.72  ? 586  TYR A H    1 
ATOM   5508  H  HA   . TYR A  1 394 ? 183.982 84.041  71.626  1.00 77.64  ? 586  TYR A HA   1 
ATOM   5509  H  HB2  . TYR A  1 394 ? 183.921 85.096  69.002  1.00 81.85  ? 586  TYR A HB2  1 
ATOM   5510  H  HB3  . TYR A  1 394 ? 185.223 84.457  69.643  1.00 81.85  ? 586  TYR A HB3  1 
ATOM   5511  H  HD1  . TYR A  1 394 ? 185.313 82.009  69.983  1.00 84.67  ? 586  TYR A HD1  1 
ATOM   5512  H  HD2  . TYR A  1 394 ? 182.251 83.680  68.030  1.00 88.22  ? 586  TYR A HD2  1 
ATOM   5513  H  HE1  . TYR A  1 394 ? 184.704 79.938  69.175  1.00 89.51  ? 586  TYR A HE1  1 
ATOM   5514  H  HE2  . TYR A  1 394 ? 181.638 81.609  67.218  1.00 89.91  ? 586  TYR A HE2  1 
ATOM   5515  H  HH   . TYR A  1 394 ? 182.068 79.409  67.149  1.00 107.68 ? 586  TYR A HH   1 
ATOM   5516  N  N    . PRO A  1 395 ? 185.593 86.138  71.848  1.00 62.79  ? 587  PRO A N    1 
ATOM   5517  C  CA   . PRO A  1 395 ? 186.138 87.372  72.425  1.00 58.90  ? 587  PRO A CA   1 
ATOM   5518  C  C    . PRO A  1 395 ? 185.733 88.602  71.627  1.00 55.75  ? 587  PRO A C    1 
ATOM   5519  O  O    . PRO A  1 395 ? 185.842 88.635  70.400  1.00 57.43  ? 587  PRO A O    1 
ATOM   5520  C  CB   . PRO A  1 395 ? 187.649 87.135  72.378  1.00 61.36  ? 587  PRO A CB   1 
ATOM   5521  C  CG   . PRO A  1 395 ? 187.779 85.661  72.528  1.00 62.88  ? 587  PRO A CG   1 
ATOM   5522  C  CD   . PRO A  1 395 ? 186.622 85.085  71.754  1.00 61.07  ? 587  PRO A CD   1 
ATOM   5523  H  HA   . PRO A  1 395 ? 185.853 87.472  73.346  1.00 70.44  ? 587  PRO A HA   1 
ATOM   5524  H  HB2  . PRO A  1 395 ? 188.004 87.430  71.525  1.00 73.39  ? 587  PRO A HB2  1 
ATOM   5525  H  HB3  . PRO A  1 395 ? 188.080 87.598  73.113  1.00 73.39  ? 587  PRO A HB3  1 
ATOM   5526  H  HG2  . PRO A  1 395 ? 188.623 85.367  72.152  1.00 75.21  ? 587  PRO A HG2  1 
ATOM   5527  H  HG3  . PRO A  1 395 ? 187.718 85.421  73.466  1.00 75.21  ? 587  PRO A HG3  1 
ATOM   5528  H  HD2  . PRO A  1 395 ? 186.873 84.939  70.829  1.00 73.04  ? 587  PRO A HD2  1 
ATOM   5529  H  HD3  . PRO A  1 395 ? 186.309 84.268  72.172  1.00 73.04  ? 587  PRO A HD3  1 
ATOM   5530  N  N    . VAL A  1 396 ? 185.252 89.616  72.338  1.00 58.19  ? 588  VAL A N    1 
ATOM   5531  C  CA   . VAL A  1 396 ? 184.887 90.899  71.751  1.00 58.01  ? 588  VAL A CA   1 
ATOM   5532  C  C    . VAL A  1 396 ? 186.045 91.854  72.012  1.00 61.43  ? 588  VAL A C    1 
ATOM   5533  O  O    . VAL A  1 396 ? 186.241 92.315  73.143  1.00 55.03  ? 588  VAL A O    1 
ATOM   5534  C  CB   . VAL A  1 396 ? 183.573 91.436  72.332  1.00 59.48  ? 588  VAL A CB   1 
ATOM   5535  C  CG1  . VAL A  1 396 ? 183.119 92.667  71.563  1.00 58.75  ? 588  VAL A CG1  1 
ATOM   5536  C  CG2  . VAL A  1 396 ? 182.495 90.360  72.309  1.00 63.86  ? 588  VAL A CG2  1 
ATOM   5537  H  H    . VAL A  1 396 ? 185.124 89.582  73.188  1.00 69.58  ? 588  VAL A H    1 
ATOM   5538  H  HA   . VAL A  1 396 ? 184.782 90.798  70.792  1.00 69.36  ? 588  VAL A HA   1 
ATOM   5539  H  HB   . VAL A  1 396 ? 183.719 91.695  73.255  1.00 71.13  ? 588  VAL A HB   1 
ATOM   5540  H  HG11 . VAL A  1 396 ? 182.289 92.989  71.946  1.00 70.25  ? 588  VAL A HG11 1 
ATOM   5541  H  HG12 . VAL A  1 396 ? 183.804 93.351  71.632  1.00 70.25  ? 588  VAL A HG12 1 
ATOM   5542  H  HG13 . VAL A  1 396 ? 182.984 92.426  70.634  1.00 70.25  ? 588  VAL A HG13 1 
ATOM   5543  H  HG21 . VAL A  1 396 ? 181.677 90.726  72.681  1.00 76.38  ? 588  VAL A HG21 1 
ATOM   5544  H  HG22 . VAL A  1 396 ? 182.346 90.083  71.392  1.00 76.38  ? 588  VAL A HG22 1 
ATOM   5545  H  HG23 . VAL A  1 396 ? 182.791 89.605  72.840  1.00 76.38  ? 588  VAL A HG23 1 
ATOM   5546  N  N    . TRP A  1 397 ? 186.817 92.157  70.966  1.00 62.39  ? 589  TRP A N    1 
ATOM   5547  C  CA   . TRP A  1 397 ? 188.061 92.894  71.143  1.00 60.05  ? 589  TRP A CA   1 
ATOM   5548  C  C    . TRP A  1 397 ? 187.858 94.385  71.394  1.00 61.67  ? 589  TRP A C    1 
ATOM   5549  O  O    . TRP A  1 397 ? 188.729 95.012  72.005  1.00 70.86  ? 589  TRP A O    1 
ATOM   5550  C  CB   . TRP A  1 397 ? 188.961 92.730  69.915  1.00 62.80  ? 589  TRP A CB   1 
ATOM   5551  C  CG   . TRP A  1 397 ? 189.328 91.311  69.555  1.00 62.28  ? 589  TRP A CG   1 
ATOM   5552  C  CD1  . TRP A  1 397 ? 189.206 90.727  68.327  1.00 60.70  ? 589  TRP A CD1  1 
ATOM   5553  C  CD2  . TRP A  1 397 ? 189.889 90.310  70.419  1.00 59.83  ? 589  TRP A CD2  1 
ATOM   5554  N  NE1  . TRP A  1 397 ? 189.652 89.428  68.371  1.00 59.49  ? 589  TRP A NE1  1 
ATOM   5555  C  CE2  . TRP A  1 397 ? 190.077 89.147  69.643  1.00 57.66  ? 589  TRP A CE2  1 
ATOM   5556  C  CE3  . TRP A  1 397 ? 190.249 90.282  71.770  1.00 62.16  ? 589  TRP A CE3  1 
ATOM   5557  C  CZ2  . TRP A  1 397 ? 190.606 87.972  70.173  1.00 58.29  ? 589  TRP A CZ2  1 
ATOM   5558  C  CZ3  . TRP A  1 397 ? 190.777 89.111  72.293  1.00 62.55  ? 589  TRP A CZ3  1 
ATOM   5559  C  CH2  . TRP A  1 397 ? 190.950 87.974  71.495  1.00 59.52  ? 589  TRP A CH2  1 
ATOM   5560  H  H    . TRP A  1 397 ? 186.640 91.948  70.151  1.00 74.62  ? 589  TRP A H    1 
ATOM   5561  H  HA   . TRP A  1 397 ? 188.533 92.527  71.907  1.00 71.82  ? 589  TRP A HA   1 
ATOM   5562  H  HB2  . TRP A  1 397 ? 188.507 93.116  69.150  1.00 75.12  ? 589  TRP A HB2  1 
ATOM   5563  H  HB3  . TRP A  1 397 ? 189.788 93.212  70.076  1.00 75.12  ? 589  TRP A HB3  1 
ATOM   5564  H  HD1  . TRP A  1 397 ? 188.872 91.148  67.568  1.00 72.60  ? 589  TRP A HD1  1 
ATOM   5565  H  HE1  . TRP A  1 397 ? 189.662 88.880  67.709  1.00 71.14  ? 589  TRP A HE1  1 
ATOM   5566  H  HE3  . TRP A  1 397 ? 190.140 91.034  72.306  1.00 74.35  ? 589  TRP A HE3  1 
ATOM   5567  H  HZ2  . TRP A  1 397 ? 190.720 87.214  69.646  1.00 69.70  ? 589  TRP A HZ2  1 
ATOM   5568  H  HZ3  . TRP A  1 397 ? 191.021 89.080  73.190  1.00 74.81  ? 589  TRP A HZ3  1 
ATOM   5569  H  HH2  . TRP A  1 397 ? 191.304 87.202  71.874  1.00 71.17  ? 589  TRP A HH2  1 
ATOM   5570  N  N    . ASP A  1 398 ? 186.745 94.972  70.955  1.00 60.13  ? 590  ASP A N    1 
ATOM   5571  C  CA   . ASP A  1 398 ? 186.577 96.414  71.073  1.00 62.02  ? 590  ASP A CA   1 
ATOM   5572  C  C    . ASP A  1 398 ? 185.097 96.765  71.129  1.00 60.84  ? 590  ASP A C    1 
ATOM   5573  O  O    . ASP A  1 398 ? 184.235 95.993  70.699  1.00 59.90  ? 590  ASP A O    1 
ATOM   5574  C  CB   . ASP A  1 398 ? 187.248 97.146  69.902  1.00 67.13  ? 590  ASP A CB   1 
ATOM   5575  C  CG   . ASP A  1 398 ? 187.506 98.614  70.196  1.00 72.88  ? 590  ASP A CG   1 
ATOM   5576  O  OD1  . ASP A  1 398 ? 187.511 98.995  71.385  1.00 77.10  ? 590  ASP A OD1  1 
ATOM   5577  O  OD2  . ASP A  1 398 ? 187.705 99.388  69.236  1.00 73.55  ? 590  ASP A OD2  1 
ATOM   5578  H  H    . ASP A  1 398 ? 186.083 94.562  70.590  1.00 71.91  ? 590  ASP A H    1 
ATOM   5579  H  HA   . ASP A  1 398 ? 186.991 96.717  71.897  1.00 74.17  ? 590  ASP A HA   1 
ATOM   5580  H  HB2  . ASP A  1 398 ? 188.100 96.724  69.712  1.00 80.31  ? 590  ASP A HB2  1 
ATOM   5581  H  HB3  . ASP A  1 398 ? 186.671 97.093  69.124  1.00 80.31  ? 590  ASP A HB3  1 
ATOM   5582  N  N    . THR A  1 399 ? 184.816 97.950  71.669  1.00 63.06  ? 591  THR A N    1 
ATOM   5583  C  CA   . THR A  1 399 ? 183.469 98.501  71.686  1.00 69.94  ? 591  THR A CA   1 
ATOM   5584  C  C    . THR A  1 399 ? 183.569 100.009 71.864  1.00 68.12  ? 591  THR A C    1 
ATOM   5585  O  O    . THR A  1 399 ? 184.500 100.509 72.500  1.00 72.92  ? 591  THR A O    1 
ATOM   5586  C  CB   . THR A  1 399 ? 182.609 97.886  72.801  1.00 66.23  ? 591  THR A CB   1 
ATOM   5587  O  OG1  . THR A  1 399 ? 181.257 98.344  72.674  1.00 68.12  ? 591  THR A OG1  1 
ATOM   5588  C  CG2  . THR A  1 399 ? 183.142 98.261  74.184  1.00 65.80  ? 591  THR A CG2  1 
ATOM   5589  H  H    . THR A  1 399 ? 185.402 98.460  72.038  1.00 75.42  ? 591  THR A H    1 
ATOM   5590  H  HA   . THR A  1 399 ? 183.038 98.322  70.836  1.00 83.68  ? 591  THR A HA   1 
ATOM   5591  H  HB   . THR A  1 399 ? 182.627 96.919  72.721  1.00 79.23  ? 591  THR A HB   1 
ATOM   5592  H  HG1  . THR A  1 399 ? 180.946 98.116  71.928  1.00 81.50  ? 591  THR A HG1  1 
ATOM   5593  H  HG21 . THR A  1 399 ? 182.586 97.863  74.872  1.00 78.71  ? 591  THR A HG21 1 
ATOM   5594  H  HG22 . THR A  1 399 ? 184.050 97.938  74.287  1.00 78.71  ? 591  THR A HG22 1 
ATOM   5595  H  HG23 . THR A  1 399 ? 183.135 99.225  74.291  1.00 78.71  ? 591  THR A HG23 1 
ATOM   5596  N  N    . GLN A  1 400 ? 182.602 100.728 71.297  1.00 62.52  ? 592  GLN A N    1 
ATOM   5597  C  CA   . GLN A  1 400 ? 182.602 102.182 71.375  1.00 61.40  ? 592  GLN A CA   1 
ATOM   5598  C  C    . GLN A  1 400 ? 181.180 102.709 71.262  1.00 62.65  ? 592  GLN A C    1 
ATOM   5599  O  O    . GLN A  1 400 ? 180.380 102.202 70.470  1.00 65.43  ? 592  GLN A O    1 
ATOM   5600  C  CB   . GLN A  1 400 ? 183.467 102.805 70.277  1.00 67.77  ? 592  GLN A CB   1 
ATOM   5601  C  CG   . GLN A  1 400 ? 183.828 104.258 70.540  1.00 67.33  ? 592  GLN A CG   1 
ATOM   5602  C  CD   . GLN A  1 400 ? 183.902 105.083 69.272  1.00 75.07  ? 592  GLN A CD   1 
ATOM   5603  O  OE1  . GLN A  1 400 ? 183.250 104.772 68.276  1.00 80.16  ? 592  GLN A OE1  1 
ATOM   5604  N  NE2  . GLN A  1 400 ? 184.707 106.137 69.299  1.00 79.89  ? 592  GLN A NE2  1 
ATOM   5605  H  H    . GLN A  1 400 ? 181.937 100.397 70.862  1.00 74.78  ? 592  GLN A H    1 
ATOM   5606  H  HA   . GLN A  1 400 ? 182.959 102.455 72.235  1.00 73.44  ? 592  GLN A HA   1 
ATOM   5607  H  HB2  . GLN A  1 400 ? 184.294 102.302 70.206  1.00 81.07  ? 592  GLN A HB2  1 
ATOM   5608  H  HB3  . GLN A  1 400 ? 182.984 102.765 69.437  1.00 81.07  ? 592  GLN A HB3  1 
ATOM   5609  H  HG2  . GLN A  1 400 ? 183.153 104.652 71.114  1.00 80.54  ? 592  GLN A HG2  1 
ATOM   5610  H  HG3  . GLN A  1 400 ? 184.695 104.296 70.973  1.00 80.54  ? 592  GLN A HG3  1 
ATOM   5611  H  HE21 . GLN A  1 400 ? 185.148 106.323 70.013  1.00 95.62  ? 592  GLN A HE21 1 
ATOM   5612  H  HE22 . GLN A  1 400 ? 184.784 106.637 68.604  1.00 95.62  ? 592  GLN A HE22 1 
ATOM   5613  N  N    . PHE A  1 401 ? 180.883 103.730 72.059  1.00 64.38  ? 593  PHE A N    1 
ATOM   5614  C  CA   . PHE A  1 401 ? 179.619 104.443 71.974  1.00 63.70  ? 593  PHE A CA   1 
ATOM   5615  C  C    . PHE A  1 401 ? 179.606 105.369 70.765  1.00 67.33  ? 593  PHE A C    1 
ATOM   5616  O  O    . PHE A  1 401 ? 180.648 105.856 70.316  1.00 69.59  ? 593  PHE A O    1 
ATOM   5617  C  CB   . PHE A  1 401 ? 179.382 105.276 73.237  1.00 65.45  ? 593  PHE A CB   1 
ATOM   5618  C  CG   . PHE A  1 401 ? 178.346 104.710 74.163  1.00 67.61  ? 593  PHE A CG   1 
ATOM   5619  C  CD1  . PHE A  1 401 ? 177.019 104.626 73.775  1.00 64.81  ? 593  PHE A CD1  1 
ATOM   5620  C  CD2  . PHE A  1 401 ? 178.694 104.291 75.435  1.00 66.78  ? 593  PHE A CD2  1 
ATOM   5621  C  CE1  . PHE A  1 401 ? 176.064 104.115 74.631  1.00 67.80  ? 593  PHE A CE1  1 
ATOM   5622  C  CE2  . PHE A  1 401 ? 177.742 103.780 76.295  1.00 67.44  ? 593  PHE A CE2  1 
ATOM   5623  C  CZ   . PHE A  1 401 ? 176.426 103.692 75.893  1.00 67.31  ? 593  PHE A CZ   1 
ATOM   5624  H  H    . PHE A  1 401 ? 181.409 104.033 72.668  1.00 77.01  ? 593  PHE A H    1 
ATOM   5625  H  HA   . PHE A  1 401 ? 178.892 103.807 71.883  1.00 76.20  ? 593  PHE A HA   1 
ATOM   5626  H  HB2  . PHE A  1 401 ? 180.215 105.338 73.729  1.00 78.29  ? 593  PHE A HB2  1 
ATOM   5627  H  HB3  . PHE A  1 401 ? 179.090 106.163 72.974  1.00 78.29  ? 593  PHE A HB3  1 
ATOM   5628  H  HD1  . PHE A  1 401 ? 176.771 104.908 72.924  1.00 77.53  ? 593  PHE A HD1  1 
ATOM   5629  H  HD2  . PHE A  1 401 ? 179.580 104.346 75.711  1.00 79.89  ? 593  PHE A HD2  1 
ATOM   5630  H  HE1  . PHE A  1 401 ? 175.177 104.058 74.357  1.00 81.11  ? 593  PHE A HE1  1 
ATOM   5631  H  HE2  . PHE A  1 401 ? 177.989 103.496 77.146  1.00 80.69  ? 593  PHE A HE2  1 
ATOM   5632  H  HZ   . PHE A  1 401 ? 175.784 103.348 76.472  1.00 80.52  ? 593  PHE A HZ   1 
ATOM   5633  N  N    . SER A  1 402 ? 178.411 105.612 70.237  1.00 69.34  ? 594  SER A N    1 
ATOM   5634  C  CA   . SER A  1 402 ? 178.259 106.654 69.242  1.00 70.42  ? 594  SER A CA   1 
ATOM   5635  C  C    . SER A  1 402 ? 178.544 108.008 69.889  1.00 69.22  ? 594  SER A C    1 
ATOM   5636  O  O    . SER A  1 402 ? 178.226 108.221 71.062  1.00 69.05  ? 594  SER A O    1 
ATOM   5637  C  CB   . SER A  1 402 ? 176.846 106.641 68.661  1.00 74.39  ? 594  SER A CB   1 
ATOM   5638  O  OG   . SER A  1 402 ? 176.524 107.881 68.050  1.00 74.27  ? 594  SER A OG   1 
ATOM   5639  H  H    . SER A  1 402 ? 177.687 105.193 70.436  1.00 82.96  ? 594  SER A H    1 
ATOM   5640  H  HA   . SER A  1 402 ? 178.893 106.514 68.521  1.00 84.25  ? 594  SER A HA   1 
ATOM   5641  H  HB2  . SER A  1 402 ? 176.787 105.939 67.995  1.00 89.01  ? 594  SER A HB2  1 
ATOM   5642  H  HB3  . SER A  1 402 ? 176.214 106.471 69.377  1.00 89.01  ? 594  SER A HB3  1 
ATOM   5643  H  HG   . SER A  1 402 ? 177.062 108.042 67.425  1.00 88.88  ? 594  SER A HG   1 
ATOM   5644  N  N    . PRO A  1 403 ? 179.133 108.951 69.148  1.00 73.94  ? 595  PRO A N    1 
ATOM   5645  C  CA   . PRO A  1 403 ? 179.387 110.276 69.735  1.00 76.69  ? 595  PRO A CA   1 
ATOM   5646  C  C    . PRO A  1 403 ? 178.122 110.986 70.186  1.00 75.76  ? 595  PRO A C    1 
ATOM   5647  O  O    . PRO A  1 403 ? 178.224 111.992 70.900  1.00 79.85  ? 595  PRO A O    1 
ATOM   5648  C  CB   . PRO A  1 403 ? 180.097 111.043 68.609  1.00 76.99  ? 595  PRO A CB   1 
ATOM   5649  C  CG   . PRO A  1 403 ? 179.841 110.270 67.364  1.00 78.53  ? 595  PRO A CG   1 
ATOM   5650  C  CD   . PRO A  1 403 ? 179.641 108.846 67.769  1.00 75.83  ? 595  PRO A CD   1 
ATOM   5651  H  HA   . PRO A  1 403 ? 179.990 110.194 70.491  1.00 91.78  ? 595  PRO A HA   1 
ATOM   5652  H  HB2  . PRO A  1 403 ? 179.723 111.935 68.538  1.00 92.14  ? 595  PRO A HB2  1 
ATOM   5653  H  HB3  . PRO A  1 403 ? 181.048 111.086 68.794  1.00 92.14  ? 595  PRO A HB3  1 
ATOM   5654  H  HG2  . PRO A  1 403 ? 179.044 110.613 66.931  1.00 93.99  ? 595  PRO A HG2  1 
ATOM   5655  H  HG3  . PRO A  1 403 ? 180.607 110.348 66.774  1.00 93.99  ? 595  PRO A HG3  1 
ATOM   5656  H  HD2  . PRO A  1 403 ? 178.982 108.422 67.197  1.00 90.75  ? 595  PRO A HD2  1 
ATOM   5657  H  HD3  . PRO A  1 403 ? 180.485 108.369 67.755  1.00 90.75  ? 595  PRO A HD3  1 
ATOM   5658  N  N    . TYR A  1 404 ? 176.944 110.505 69.790  1.00 73.08  ? 596  TYR A N    1 
ATOM   5659  C  CA   . TYR A  1 404 ? 175.675 111.056 70.245  1.00 74.33  ? 596  TYR A CA   1 
ATOM   5660  C  C    . TYR A  1 404 ? 174.909 110.097 71.151  1.00 72.68  ? 596  TYR A C    1 
ATOM   5661  O  O    . TYR A  1 404 ? 173.741 110.352 71.460  1.00 74.64  ? 596  TYR A O    1 
ATOM   5662  C  CB   . TYR A  1 404 ? 174.818 111.453 69.042  1.00 74.41  ? 596  TYR A CB   1 
ATOM   5663  C  CG   . TYR A  1 404 ? 175.522 112.421 68.122  1.00 74.76  ? 596  TYR A CG   1 
ATOM   5664  C  CD1  . TYR A  1 404 ? 175.782 113.724 68.523  1.00 73.76  ? 596  TYR A CD1  1 
ATOM   5665  C  CD2  . TYR A  1 404 ? 175.923 112.035 66.852  1.00 75.90  ? 596  TYR A CD2  1 
ATOM   5666  C  CE1  . TYR A  1 404 ? 176.429 114.613 67.690  1.00 75.66  ? 596  TYR A CE1  1 
ATOM   5667  C  CE2  . TYR A  1 404 ? 176.570 112.919 66.008  1.00 78.42  ? 596  TYR A CE2  1 
ATOM   5668  C  CZ   . TYR A  1 404 ? 176.819 114.207 66.432  1.00 77.67  ? 596  TYR A CZ   1 
ATOM   5669  O  OH   . TYR A  1 404 ? 177.462 115.090 65.595  1.00 80.41  ? 596  TYR A OH   1 
ATOM   5670  H  H    . TYR A  1 404 ? 176.855 109.845 69.246  1.00 87.45  ? 596  TYR A H    1 
ATOM   5671  H  HA   . TYR A  1 404 ? 175.854 111.861 70.756  1.00 88.95  ? 596  TYR A HA   1 
ATOM   5672  H  HB2  . TYR A  1 404 ? 174.600 110.658 68.532  1.00 89.04  ? 596  TYR A HB2  1 
ATOM   5673  H  HB3  . TYR A  1 404 ? 174.005 111.878 69.359  1.00 89.04  ? 596  TYR A HB3  1 
ATOM   5674  H  HD1  . TYR A  1 404 ? 175.521 114.001 69.372  1.00 88.26  ? 596  TYR A HD1  1 
ATOM   5675  H  HD2  . TYR A  1 404 ? 175.757 111.166 66.564  1.00 90.84  ? 596  TYR A HD2  1 
ATOM   5676  H  HE1  . TYR A  1 404 ? 176.597 115.483 67.973  1.00 90.54  ? 596  TYR A HE1  1 
ATOM   5677  H  HE2  . TYR A  1 404 ? 176.835 112.646 65.159  1.00 93.85  ? 596  TYR A HE2  1 
ATOM   5678  H  HH   . TYR A  1 404 ? 177.643 114.715 64.866  1.00 96.25  ? 596  TYR A HH   1 
ATOM   5679  N  N    . GLY A  1 405 ? 175.534 109.002 71.576  1.00 71.36  ? 597  GLY A N    1 
ATOM   5680  C  CA   . GLY A  1 405 ? 174.895 108.054 72.464  1.00 71.40  ? 597  GLY A CA   1 
ATOM   5681  C  C    . GLY A  1 405 ? 173.915 107.122 71.773  1.00 70.02  ? 597  GLY A C    1 
ATOM   5682  O  O    . GLY A  1 405 ? 173.793 107.067 70.547  1.00 70.64  ? 597  GLY A O    1 
ATOM   5683  H  H    . GLY A  1 405 ? 176.338 108.789 71.358  1.00 85.38  ? 597  GLY A H    1 
ATOM   5684  H  HA2  . GLY A  1 405 ? 175.575 107.513 72.894  1.00 85.44  ? 597  GLY A HA2  1 
ATOM   5685  H  HA3  . GLY A  1 405 ? 174.415 108.539 73.154  1.00 85.44  ? 597  GLY A HA3  1 
ATOM   5686  N  N    . TYR A  1 406 ? 173.208 106.360 72.609  1.00 73.14  ? 598  TYR A N    1 
ATOM   5687  C  CA   . TYR A  1 406 ? 172.176 105.426 72.169  1.00 70.84  ? 598  TYR A CA   1 
ATOM   5688  C  C    . TYR A  1 406 ? 172.763 104.271 71.366  1.00 67.39  ? 598  TYR A C    1 
ATOM   5689  O  O    . TYR A  1 406 ? 172.631 103.108 71.762  1.00 69.21  ? 598  TYR A O    1 
ATOM   5690  C  CB   . TYR A  1 406 ? 171.106 106.138 71.343  1.00 65.82  ? 598  TYR A CB   1 
ATOM   5691  C  CG   . TYR A  1 406 ? 169.972 105.223 70.947  1.00 66.00  ? 598  TYR A CG   1 
ATOM   5692  C  CD1  . TYR A  1 406 ? 169.195 104.592 71.910  1.00 68.27  ? 598  TYR A CD1  1 
ATOM   5693  C  CD2  . TYR A  1 406 ? 169.685 104.978 69.612  1.00 68.13  ? 598  TYR A CD2  1 
ATOM   5694  C  CE1  . TYR A  1 406 ? 168.160 103.749 71.554  1.00 68.53  ? 598  TYR A CE1  1 
ATOM   5695  C  CE2  . TYR A  1 406 ? 168.651 104.137 69.246  1.00 70.51  ? 598  TYR A CE2  1 
ATOM   5696  C  CZ   . TYR A  1 406 ? 167.892 103.527 70.221  1.00 66.91  ? 598  TYR A CZ   1 
ATOM   5697  O  OH   . TYR A  1 406 ? 166.866 102.685 69.859  1.00 63.41  ? 598  TYR A OH   1 
ATOM   5698  H  H    . TYR A  1 406 ? 173.313 106.369 73.463  1.00 87.53  ? 598  TYR A H    1 
ATOM   5699  H  HA   . TYR A  1 406 ? 171.744 105.050 72.951  1.00 84.75  ? 598  TYR A HA   1 
ATOM   5700  H  HB2  . TYR A  1 406 ? 170.736 106.866 71.866  1.00 78.74  ? 598  TYR A HB2  1 
ATOM   5701  H  HB3  . TYR A  1 406 ? 171.510 106.483 70.531  1.00 78.74  ? 598  TYR A HB3  1 
ATOM   5702  H  HD1  . TYR A  1 406 ? 169.373 104.742 72.811  1.00 81.67  ? 598  TYR A HD1  1 
ATOM   5703  H  HD2  . TYR A  1 406 ? 170.195 105.389 68.952  1.00 81.51  ? 598  TYR A HD2  1 
ATOM   5704  H  HE1  . TYR A  1 406 ? 167.647 103.335 72.210  1.00 81.99  ? 598  TYR A HE1  1 
ATOM   5705  H  HE2  . TYR A  1 406 ? 168.469 103.984 68.347  1.00 84.37  ? 598  TYR A HE2  1 
ATOM   5706  H  HH   . TYR A  1 406 ? 166.491 102.378 70.545  1.00 75.84  ? 598  TYR A HH   1 
ATOM   5707  N  N    . TYR A  1 407 ? 173.399 104.570 70.238  1.00 63.09  ? 599  TYR A N    1 
ATOM   5708  C  CA   . TYR A  1 407 ? 174.032 103.532 69.440  1.00 57.72  ? 599  TYR A CA   1 
ATOM   5709  C  C    . TYR A  1 407 ? 175.421 103.225 69.981  1.00 57.59  ? 599  TYR A C    1 
ATOM   5710  O  O    . TYR A  1 407 ? 176.087 104.083 70.566  1.00 61.93  ? 599  TYR A O    1 
ATOM   5711  C  CB   . TYR A  1 407 ? 174.157 103.957 67.974  1.00 59.19  ? 599  TYR A CB   1 
ATOM   5712  C  CG   . TYR A  1 407 ? 172.860 104.300 67.276  1.00 61.35  ? 599  TYR A CG   1 
ATOM   5713  C  CD1  . TYR A  1 407 ? 171.936 103.314 66.953  1.00 61.41  ? 599  TYR A CD1  1 
ATOM   5714  C  CD2  . TYR A  1 407 ? 172.571 105.610 66.916  1.00 61.11  ? 599  TYR A CD2  1 
ATOM   5715  C  CE1  . TYR A  1 407 ? 170.755 103.626 66.304  1.00 64.05  ? 599  TYR A CE1  1 
ATOM   5716  C  CE2  . TYR A  1 407 ? 171.395 105.931 66.266  1.00 61.69  ? 599  TYR A CE2  1 
ATOM   5717  C  CZ   . TYR A  1 407 ? 170.491 104.936 65.962  1.00 65.17  ? 599  TYR A CZ   1 
ATOM   5718  O  OH   . TYR A  1 407 ? 169.317 105.249 65.317  1.00 65.94  ? 599  TYR A OH   1 
ATOM   5719  H  H    . TYR A  1 407 ? 173.478 105.364 69.915  1.00 75.46  ? 599  TYR A H    1 
ATOM   5720  H  HA   . TYR A  1 407 ? 173.499 102.722 69.481  1.00 69.02  ? 599  TYR A HA   1 
ATOM   5721  H  HB2  . TYR A  1 407 ? 174.726 104.741 67.931  1.00 70.78  ? 599  TYR A HB2  1 
ATOM   5722  H  HB3  . TYR A  1 407 ? 174.569 103.231 67.479  1.00 70.78  ? 599  TYR A HB3  1 
ATOM   5723  H  HD1  . TYR A  1 407 ? 172.113 102.430 67.182  1.00 73.44  ? 599  TYR A HD1  1 
ATOM   5724  H  HD2  . TYR A  1 407 ? 173.179 106.284 67.119  1.00 73.08  ? 599  TYR A HD2  1 
ATOM   5725  H  HE1  . TYR A  1 407 ? 170.143 102.956 66.098  1.00 76.61  ? 599  TYR A HE1  1 
ATOM   5726  H  HE2  . TYR A  1 407 ? 171.214 106.814 66.035  1.00 73.78  ? 599  TYR A HE2  1 
ATOM   5727  H  HH   . TYR A  1 407 ? 169.282 106.075 65.168  1.00 78.88  ? 599  TYR A HH   1 
ATOM   5728  N  N    . PHE A  1 408 ? 175.852 101.982 69.789  1.00 62.23  ? 600  PHE A N    1 
ATOM   5729  C  CA   . PHE A  1 408 ? 177.236 101.617 70.049  1.00 64.08  ? 600  PHE A CA   1 
ATOM   5730  C  C    . PHE A  1 408 ? 177.604 100.441 69.161  1.00 61.76  ? 600  PHE A C    1 
ATOM   5731  O  O    . PHE A  1 408 ? 176.742 99.703  68.679  1.00 64.87  ? 600  PHE A O    1 
ATOM   5732  C  CB   . PHE A  1 408 ? 177.494 101.292 71.529  1.00 62.81  ? 600  PHE A CB   1 
ATOM   5733  C  CG   . PHE A  1 408 ? 176.708 100.125 72.059  1.00 63.69  ? 600  PHE A CG   1 
ATOM   5734  C  CD1  . PHE A  1 408 ? 177.223 98.841  72.005  1.00 66.45  ? 600  PHE A CD1  1 
ATOM   5735  C  CD2  . PHE A  1 408 ? 175.457 100.314 72.623  1.00 64.79  ? 600  PHE A CD2  1 
ATOM   5736  C  CE1  . PHE A  1 408 ? 176.505 97.767  72.500  1.00 65.52  ? 600  PHE A CE1  1 
ATOM   5737  C  CE2  . PHE A  1 408 ? 174.736 99.244  73.120  1.00 64.55  ? 600  PHE A CE2  1 
ATOM   5738  C  CZ   . PHE A  1 408 ? 175.262 97.970  73.061  1.00 62.53  ? 600  PHE A CZ   1 
ATOM   5739  H  H    . PHE A  1 408 ? 175.362 101.333 69.510  1.00 74.43  ? 600  PHE A H    1 
ATOM   5740  H  HA   . PHE A  1 408 ? 177.806 102.362 69.805  1.00 76.65  ? 600  PHE A HA   1 
ATOM   5741  H  HB2  . PHE A  1 408 ? 178.435 101.089 71.642  1.00 75.13  ? 600  PHE A HB2  1 
ATOM   5742  H  HB3  . PHE A  1 408 ? 177.261 102.069 72.061  1.00 75.13  ? 600  PHE A HB3  1 
ATOM   5743  H  HD1  . PHE A  1 408 ? 178.063 98.699  71.631  1.00 79.49  ? 600  PHE A HD1  1 
ATOM   5744  H  HD2  . PHE A  1 408 ? 175.099 101.171 72.670  1.00 77.50  ? 600  PHE A HD2  1 
ATOM   5745  H  HE1  . PHE A  1 408 ? 176.861 96.910  72.457  1.00 78.37  ? 600  PHE A HE1  1 
ATOM   5746  H  HE2  . PHE A  1 408 ? 173.896 99.383  73.496  1.00 77.21  ? 600  PHE A HE2  1 
ATOM   5747  H  HZ   . PHE A  1 408 ? 174.776 97.249  73.391  1.00 74.78  ? 600  PHE A HZ   1 
ATOM   5748  N  N    . VAL A  1 409 ? 178.906 100.286 68.944  1.00 64.20  ? 601  VAL A N    1 
ATOM   5749  C  CA   . VAL A  1 409 ? 179.435 99.270  68.050  1.00 61.68  ? 601  VAL A CA   1 
ATOM   5750  C  C    . VAL A  1 409 ? 180.389 98.378  68.835  1.00 64.36  ? 601  VAL A C    1 
ATOM   5751  O  O    . VAL A  1 409 ? 180.957 98.774  69.855  1.00 64.52  ? 601  VAL A O    1 
ATOM   5752  C  CB   . VAL A  1 409 ? 180.134 99.902  66.826  1.00 62.88  ? 601  VAL A CB   1 
ATOM   5753  C  CG1  . VAL A  1 409 ? 181.345 100.720 67.258  1.00 62.30  ? 601  VAL A CG1  1 
ATOM   5754  C  CG2  . VAL A  1 409 ? 180.531 98.843  65.806  1.00 66.70  ? 601  VAL A CG2  1 
ATOM   5755  H  H    . VAL A  1 409 ? 179.515 100.769 69.313  1.00 76.79  ? 601  VAL A H    1 
ATOM   5756  H  HA   . VAL A  1 409 ? 178.704 98.719  67.727  1.00 73.77  ? 601  VAL A HA   1 
ATOM   5757  H  HB   . VAL A  1 409 ? 179.512 100.507 66.393  1.00 75.21  ? 601  VAL A HB   1 
ATOM   5758  H  HG11 . VAL A  1 409 ? 181.763 101.104 66.472  1.00 74.52  ? 601  VAL A HG11 1 
ATOM   5759  H  HG12 . VAL A  1 409 ? 181.052 101.425 67.856  1.00 74.52  ? 601  VAL A HG12 1 
ATOM   5760  H  HG13 . VAL A  1 409 ? 181.972 100.137 67.716  1.00 74.52  ? 601  VAL A HG13 1 
ATOM   5761  H  HG21 . VAL A  1 409 ? 180.965 99.276  65.054  1.00 79.79  ? 601  VAL A HG21 1 
ATOM   5762  H  HG22 . VAL A  1 409 ? 181.140 98.215  66.224  1.00 79.79  ? 601  VAL A HG22 1 
ATOM   5763  H  HG23 . VAL A  1 409 ? 179.733 98.380  65.505  1.00 79.79  ? 601  VAL A HG23 1 
ATOM   5764  N  N    . SER A  1 410 ? 180.551 97.150  68.347  1.00 62.37  ? 602  SER A N    1 
ATOM   5765  C  CA   . SER A  1 410 ? 181.486 96.203  68.933  1.00 61.02  ? 602  SER A CA   1 
ATOM   5766  C  C    . SER A  1 410 ? 182.052 95.329  67.823  1.00 57.92  ? 602  SER A C    1 
ATOM   5767  O  O    . SER A  1 410 ? 181.427 95.154  66.776  1.00 63.44  ? 602  SER A O    1 
ATOM   5768  C  CB   . SER A  1 410 ? 180.815 95.342  70.011  1.00 64.63  ? 602  SER A CB   1 
ATOM   5769  O  OG   . SER A  1 410 ? 179.805 94.521  69.458  1.00 61.69  ? 602  SER A OG   1 
ATOM   5770  H  H    . SER A  1 410 ? 180.123 96.841  67.667  1.00 74.60  ? 602  SER A H    1 
ATOM   5771  H  HA   . SER A  1 410 ? 182.219 96.688  69.343  1.00 72.98  ? 602  SER A HA   1 
ATOM   5772  H  HB2  . SER A  1 410 ? 181.486 94.778  70.426  1.00 77.30  ? 602  SER A HB2  1 
ATOM   5773  H  HB3  . SER A  1 410 ? 180.416 95.925  70.676  1.00 77.30  ? 602  SER A HB3  1 
ATOM   5774  H  HG   . SER A  1 410 ? 180.136 94.008  68.880  1.00 73.78  ? 602  SER A HG   1 
ATOM   5775  N  N    . GLY A  1 411 ? 183.242 94.796  68.060  1.00 59.92  ? 603  GLY A N    1 
ATOM   5776  C  CA   . GLY A  1 411 ? 183.892 93.926  67.097  1.00 63.15  ? 603  GLY A CA   1 
ATOM   5777  C  C    . GLY A  1 411 ? 184.672 92.851  67.820  1.00 68.04  ? 603  GLY A C    1 
ATOM   5778  O  O    . GLY A  1 411 ? 185.135 93.046  68.946  1.00 71.45  ? 603  GLY A O    1 
ATOM   5779  H  H    . GLY A  1 411 ? 183.697 94.924  68.778  1.00 71.66  ? 603  GLY A H    1 
ATOM   5780  H  HA2  . GLY A  1 411 ? 183.229 93.506  66.528  1.00 75.53  ? 603  GLY A HA2  1 
ATOM   5781  H  HA3  . GLY A  1 411 ? 184.502 94.440  66.544  1.00 75.53  ? 603  GLY A HA3  1 
ATOM   5782  N  N    . GLY A  1 412 ? 184.810 91.701  67.168  1.00 62.16  ? 604  GLY A N    1 
ATOM   5783  C  CA   . GLY A  1 412 ? 185.400 90.579  67.860  1.00 64.56  ? 604  GLY A CA   1 
ATOM   5784  C  C    . GLY A  1 412 ? 185.919 89.485  66.953  1.00 63.67  ? 604  GLY A C    1 
ATOM   5785  O  O    . GLY A  1 412 ? 186.025 89.647  65.735  1.00 61.52  ? 604  GLY A O    1 
ATOM   5786  H  H    . GLY A  1 412 ? 184.577 91.553  66.354  1.00 74.35  ? 604  GLY A H    1 
ATOM   5787  H  HA2  . GLY A  1 412 ? 186.140 90.895  68.402  1.00 77.22  ? 604  GLY A HA2  1 
ATOM   5788  H  HA3  . GLY A  1 412 ? 184.738 90.189  68.452  1.00 77.22  ? 604  GLY A HA3  1 
ATOM   5789  N  N    . HIS A  1 413 ? 186.239 88.357  67.592  1.00 62.60  ? 605  HIS A N    1 
ATOM   5790  C  CA   . HIS A  1 413 ? 186.874 87.220  66.938  1.00 64.96  ? 605  HIS A CA   1 
ATOM   5791  C  C    . HIS A  1 413 ? 185.985 86.572  65.884  1.00 66.07  ? 605  HIS A C    1 
ATOM   5792  O  O    . HIS A  1 413 ? 186.503 85.916  64.974  1.00 65.66  ? 605  HIS A O    1 
ATOM   5793  C  CB   . HIS A  1 413 ? 187.270 86.199  68.009  1.00 61.89  ? 605  HIS A CB   1 
ATOM   5794  C  CG   . HIS A  1 413 ? 187.974 84.988  67.479  1.00 64.89  ? 605  HIS A CG   1 
ATOM   5795  N  ND1  . HIS A  1 413 ? 189.279 85.017  67.036  1.00 67.33  ? 605  HIS A ND1  1 
ATOM   5796  C  CD2  . HIS A  1 413 ? 187.562 83.704  67.348  1.00 65.65  ? 605  HIS A CD2  1 
ATOM   5797  C  CE1  . HIS A  1 413 ? 189.636 83.808  66.643  1.00 67.19  ? 605  HIS A CE1  1 
ATOM   5798  N  NE2  . HIS A  1 413 ? 188.612 82.992  66.823  1.00 63.27  ? 605  HIS A NE2  1 
ATOM   5799  H  H    . HIS A  1 413 ? 186.092 88.228  68.430  1.00 74.88  ? 605  HIS A H    1 
ATOM   5800  H  HA   . HIS A  1 413 ? 187.684 87.522  66.499  1.00 77.70  ? 605  HIS A HA   1 
ATOM   5801  H  HB2  . HIS A  1 413 ? 187.863 86.629  68.645  1.00 74.02  ? 605  HIS A HB2  1 
ATOM   5802  H  HB3  . HIS A  1 413 ? 186.467 85.898  68.463  1.00 74.02  ? 605  HIS A HB3  1 
ATOM   5803  H  HD1  . HIS A  1 413 ? 189.780 85.716  67.015  1.00 80.54  ? 605  HIS A HD1  1 
ATOM   5804  H  HD2  . HIS A  1 413 ? 186.723 83.369  67.568  1.00 78.53  ? 605  HIS A HD2  1 
ATOM   5805  H  HE1  . HIS A  1 413 ? 190.466 83.571  66.299  1.00 80.39  ? 605  HIS A HE1  1 
ATOM   5806  N  N    . ASP A  1 414 ? 184.664 86.732  65.980  1.00 67.66  ? 606  ASP A N    1 
ATOM   5807  C  CA   . ASP A  1 414 ? 183.776 86.154  64.974  1.00 67.53  ? 606  ASP A CA   1 
ATOM   5808  C  C    . ASP A  1 414 ? 183.834 86.889  63.641  1.00 62.95  ? 606  ASP A C    1 
ATOM   5809  O  O    . ASP A  1 414 ? 183.081 86.531  62.730  1.00 63.77  ? 606  ASP A O    1 
ATOM   5810  C  CB   . ASP A  1 414 ? 182.334 86.114  65.492  1.00 70.29  ? 606  ASP A CB   1 
ATOM   5811  C  CG   . ASP A  1 414 ? 181.795 87.485  65.845  1.00 73.56  ? 606  ASP A CG   1 
ATOM   5812  O  OD1  . ASP A  1 414 ? 182.601 88.384  66.165  1.00 77.23  ? 606  ASP A OD1  1 
ATOM   5813  O  OD2  . ASP A  1 414 ? 180.559 87.662  65.803  1.00 72.70  ? 606  ASP A OD2  1 
ATOM   5814  H  H    . ASP A  1 414 ? 184.263 87.164  66.606  1.00 80.94  ? 606  ASP A H    1 
ATOM   5815  H  HA   . ASP A  1 414 ? 184.053 85.238  64.813  1.00 80.79  ? 606  ASP A HA   1 
ATOM   5816  H  HB2  . ASP A  1 414 ? 181.763 85.736  64.805  1.00 84.10  ? 606  ASP A HB2  1 
ATOM   5817  H  HB3  . ASP A  1 414 ? 182.301 85.564  66.290  1.00 84.10  ? 606  ASP A HB3  1 
ATOM   5818  N  N    . ARG A  1 415 ? 184.683 87.909  63.512  1.00 59.48  ? 607  ARG A N    1 
ATOM   5819  C  CA   . ARG A  1 415 ? 185.021 88.543  62.241  1.00 56.43  ? 607  ARG A CA   1 
ATOM   5820  C  C    . ARG A  1 415 ? 183.953 89.508  61.751  1.00 57.83  ? 607  ARG A C    1 
ATOM   5821  O  O    . ARG A  1 415 ? 183.927 89.839  60.560  1.00 56.86  ? 607  ARG A O    1 
ATOM   5822  C  CB   . ARG A  1 415 ? 185.295 87.508  61.145  1.00 52.75  ? 607  ARG A CB   1 
ATOM   5823  C  CG   . ARG A  1 415 ? 186.318 86.459  61.531  1.00 55.21  ? 607  ARG A CG   1 
ATOM   5824  C  CD   . ARG A  1 415 ? 186.693 85.611  60.335  1.00 57.80  ? 607  ARG A CD   1 
ATOM   5825  N  NE   . ARG A  1 415 ? 185.577 84.779  59.897  1.00 61.81  ? 607  ARG A NE   1 
ATOM   5826  C  CZ   . ARG A  1 415 ? 185.512 84.171  58.717  1.00 65.10  ? 607  ARG A CZ   1 
ATOM   5827  N  NH1  . ARG A  1 415 ? 186.497 84.305  57.839  1.00 67.93  ? 607  ARG A NH1  1 
ATOM   5828  N  NH2  . ARG A  1 415 ? 184.453 83.433  58.412  1.00 64.71  ? 607  ARG A NH2  1 
ATOM   5829  H  H    . ARG A  1 415 ? 185.092 88.265  64.180  1.00 71.13  ? 607  ARG A H    1 
ATOM   5830  H  HA   . ARG A  1 415 ? 185.836 89.055  62.365  1.00 67.47  ? 607  ARG A HA   1 
ATOM   5831  H  HB2  . ARG A  1 415 ? 184.466 87.050  60.935  1.00 63.05  ? 607  ARG A HB2  1 
ATOM   5832  H  HB3  . ARG A  1 415 ? 185.625 87.968  60.357  1.00 63.05  ? 607  ARG A HB3  1 
ATOM   5833  H  HG2  . ARG A  1 415 ? 187.120 86.895  61.860  1.00 66.00  ? 607  ARG A HG2  1 
ATOM   5834  H  HG3  . ARG A  1 415 ? 185.945 85.879  62.212  1.00 66.00  ? 607  ARG A HG3  1 
ATOM   5835  H  HD2  . ARG A  1 415 ? 186.946 86.191  59.599  1.00 69.11  ? 607  ARG A HD2  1 
ATOM   5836  H  HD3  . ARG A  1 415 ? 187.431 85.029  60.574  1.00 69.11  ? 607  ARG A HD3  1 
ATOM   5837  H  HE   . ARG A  1 415 ? 184.918 84.675  60.439  1.00 73.93  ? 607  ARG A HE   1 
ATOM   5838  H  HH11 . ARG A  1 415 ? 187.185 84.783  58.034  1.00 81.27  ? 607  ARG A HH11 1 
ATOM   5839  H  HH12 . ARG A  1 415 ? 186.450 83.911  57.076  1.00 81.27  ? 607  ARG A HH12 1 
ATOM   5840  H  HH21 . ARG A  1 415 ? 183.811 83.346  58.978  1.00 77.40  ? 607  ARG A HH21 1 
ATOM   5841  H  HH22 . ARG A  1 415 ? 184.408 83.041  57.648  1.00 77.40  ? 607  ARG A HH22 1 
ATOM   5842  N  N    . VAL A  1 416 ? 183.071 89.980  62.630  1.00 62.40  ? 608  VAL A N    1 
ATOM   5843  C  CA   . VAL A  1 416 ? 182.097 90.996  62.267  1.00 64.67  ? 608  VAL A CA   1 
ATOM   5844  C  C    . VAL A  1 416 ? 182.115 92.088  63.324  1.00 61.00  ? 608  VAL A C    1 
ATOM   5845  O  O    . VAL A  1 416 ? 182.595 91.901  64.445  1.00 59.36  ? 608  VAL A O    1 
ATOM   5846  C  CB   . VAL A  1 416 ? 180.666 90.427  62.112  1.00 62.89  ? 608  VAL A CB   1 
ATOM   5847  C  CG1  . VAL A  1 416 ? 180.681 89.156  61.280  1.00 65.05  ? 608  VAL A CG1  1 
ATOM   5848  C  CG2  . VAL A  1 416 ? 180.015 90.170  63.473  1.00 63.42  ? 608  VAL A CG2  1 
ATOM   5849  H  H    . VAL A  1 416 ? 183.019 89.723  63.450  1.00 74.63  ? 608  VAL A H    1 
ATOM   5850  H  HA   . VAL A  1 416 ? 182.354 91.393  61.420  1.00 77.36  ? 608  VAL A HA   1 
ATOM   5851  H  HB   . VAL A  1 416 ? 180.121 91.079  61.644  1.00 75.22  ? 608  VAL A HB   1 
ATOM   5852  H  HG11 . VAL A  1 416 ? 179.774 88.821  61.199  1.00 77.81  ? 608  VAL A HG11 1 
ATOM   5853  H  HG12 . VAL A  1 416 ? 181.039 89.359  60.401  1.00 77.81  ? 608  VAL A HG12 1 
ATOM   5854  H  HG13 . VAL A  1 416 ? 181.239 88.497  61.721  1.00 77.81  ? 608  VAL A HG13 1 
ATOM   5855  H  HG21 . VAL A  1 416 ? 179.123 89.815  63.334  1.00 75.85  ? 608  VAL A HG21 1 
ATOM   5856  H  HG22 . VAL A  1 416 ? 180.553 89.530  63.964  1.00 75.85  ? 608  VAL A HG22 1 
ATOM   5857  H  HG23 . VAL A  1 416 ? 179.966 91.007  63.962  1.00 75.85  ? 608  VAL A HG23 1 
ATOM   5858  N  N    . ALA A  1 417 ? 181.589 93.242  62.942  1.00 59.41  ? 609  ALA A N    1 
ATOM   5859  C  CA   . ALA A  1 417 ? 181.257 94.301  63.877  1.00 62.44  ? 609  ALA A CA   1 
ATOM   5860  C  C    . ALA A  1 417 ? 179.743 94.416  63.948  1.00 61.96  ? 609  ALA A C    1 
ATOM   5861  O  O    . ALA A  1 417 ? 179.049 94.227  62.944  1.00 63.91  ? 609  ALA A O    1 
ATOM   5862  C  CB   . ALA A  1 417 ? 181.875 95.637  63.457  1.00 63.86  ? 609  ALA A CB   1 
ATOM   5863  H  H    . ALA A  1 417 ? 181.410 93.439  62.124  1.00 71.04  ? 609  ALA A H    1 
ATOM   5864  H  HA   . ALA A  1 417 ? 181.591 94.071  64.759  1.00 74.67  ? 609  ALA A HA   1 
ATOM   5865  H  HB1  . ALA A  1 417 ? 181.630 96.315  64.106  1.00 76.38  ? 609  ALA A HB1  1 
ATOM   5866  H  HB2  . ALA A  1 417 ? 182.840 95.542  63.424  1.00 76.38  ? 609  ALA A HB2  1 
ATOM   5867  H  HB3  . ALA A  1 417 ? 181.536 95.879  62.581  1.00 76.38  ? 609  ALA A HB3  1 
ATOM   5868  N  N    . ARG A  1 418 ? 179.234 94.708  65.137  1.00 57.16  ? 610  ARG A N    1 
ATOM   5869  C  CA   . ARG A  1 418 ? 177.805 94.851  65.360  1.00 63.22  ? 610  ARG A CA   1 
ATOM   5870  C  C    . ARG A  1 418 ? 177.503 96.278  65.788  1.00 62.58  ? 610  ARG A C    1 
ATOM   5871  O  O    . ARG A  1 418 ? 178.209 96.844  66.625  1.00 59.03  ? 610  ARG A O    1 
ATOM   5872  C  CB   . ARG A  1 418 ? 177.310 93.871  66.433  1.00 59.32  ? 610  ARG A CB   1 
ATOM   5873  C  CG   . ARG A  1 418 ? 177.072 92.467  65.913  1.00 61.03  ? 610  ARG A CG   1 
ATOM   5874  C  CD   . ARG A  1 418 ? 176.684 91.501  67.021  1.00 62.84  ? 610  ARG A CD   1 
ATOM   5875  N  NE   . ARG A  1 418 ? 176.456 90.158  66.492  1.00 65.91  ? 610  ARG A NE   1 
ATOM   5876  C  CZ   . ARG A  1 418 ? 177.421 89.287  66.209  1.00 63.05  ? 610  ARG A CZ   1 
ATOM   5877  N  NH1  . ARG A  1 418 ? 178.693 89.604  66.409  1.00 63.13  ? 610  ARG A NH1  1 
ATOM   5878  N  NH2  . ARG A  1 418 ? 177.113 88.092  65.726  1.00 63.40  ? 610  ARG A NH2  1 
ATOM   5879  H  H    . ARG A  1 418 ? 179.707 94.829  65.845  1.00 68.34  ? 610  ARG A H    1 
ATOM   5880  H  HA   . ARG A  1 418 ? 177.329 94.670  64.535  1.00 75.61  ? 610  ARG A HA   1 
ATOM   5881  H  HB2  . ARG A  1 418 ? 177.974 93.817  67.138  1.00 70.93  ? 610  ARG A HB2  1 
ATOM   5882  H  HB3  . ARG A  1 418 ? 176.472 94.199  66.794  1.00 70.93  ? 610  ARG A HB3  1 
ATOM   5883  H  HG2  . ARG A  1 418 ? 176.351 92.486  65.264  1.00 72.98  ? 610  ARG A HG2  1 
ATOM   5884  H  HG3  . ARG A  1 418 ? 177.885 92.139  65.498  1.00 72.98  ? 610  ARG A HG3  1 
ATOM   5885  H  HD2  . ARG A  1 418 ? 177.402 91.455  67.672  1.00 75.17  ? 610  ARG A HD2  1 
ATOM   5886  H  HD3  . ARG A  1 418 ? 175.866 91.807  67.442  1.00 75.17  ? 610  ARG A HD3  1 
ATOM   5887  H  HE   . ARG A  1 418 ? 175.643 89.914  66.354  1.00 78.84  ? 610  ARG A HE   1 
ATOM   5888  H  HH11 . ARG A  1 418 ? 178.898 90.379  66.721  1.00 75.50  ? 610  ARG A HH11 1 
ATOM   5889  H  HH12 . ARG A  1 418 ? 179.312 89.036  66.225  1.00 75.50  ? 610  ARG A HH12 1 
ATOM   5890  H  HH21 . ARG A  1 418 ? 176.290 87.880  65.596  1.00 75.83  ? 610  ARG A HH21 1 
ATOM   5891  H  HH22 . ARG A  1 418 ? 177.737 87.528  65.546  1.00 75.83  ? 610  ARG A HH22 1 
ATOM   5892  N  N    . LEU A  1 419 ? 176.461 96.860  65.203  1.00 61.30  ? 611  LEU A N    1 
ATOM   5893  C  CA   . LEU A  1 419 ? 175.913 98.120  65.679  1.00 62.41  ? 611  LEU A CA   1 
ATOM   5894  C  C    . LEU A  1 419 ? 174.681 97.821  66.517  1.00 63.37  ? 611  LEU A C    1 
ATOM   5895  O  O    . LEU A  1 419 ? 173.755 97.146  66.053  1.00 65.08  ? 611  LEU A O    1 
ATOM   5896  C  CB   . LEU A  1 419 ? 175.550 99.058  64.529  1.00 65.77  ? 611  LEU A CB   1 
ATOM   5897  C  CG   . LEU A  1 419 ? 175.035 100.418 65.009  1.00 64.28  ? 611  LEU A CG   1 
ATOM   5898  C  CD1  . LEU A  1 419 ? 175.935 101.548 64.545  1.00 65.41  ? 611  LEU A CD1  1 
ATOM   5899  C  CD2  . LEU A  1 419 ? 173.609 100.640 64.531  1.00 64.40  ? 611  LEU A CD2  1 
ATOM   5900  H  H    . LEU A  1 419 ? 176.051 96.538  64.519  1.00 73.31  ? 611  LEU A H    1 
ATOM   5901  H  HA   . LEU A  1 419 ? 176.566 98.564  66.242  1.00 74.64  ? 611  LEU A HA   1 
ATOM   5902  H  HB2  . LEU A  1 419 ? 176.340 99.212  63.986  1.00 78.68  ? 611  LEU A HB2  1 
ATOM   5903  H  HB3  . LEU A  1 419 ? 174.855 98.646  63.993  1.00 78.68  ? 611  LEU A HB3  1 
ATOM   5904  H  HG   . LEU A  1 419 ? 175.027 100.425 65.979  1.00 76.88  ? 611  LEU A HG   1 
ATOM   5905  H  HD11 . LEU A  1 419 ? 175.577 102.390 64.868  1.00 78.25  ? 611  LEU A HD11 1 
ATOM   5906  H  HD12 . LEU A  1 419 ? 176.826 101.409 64.903  1.00 78.25  ? 611  LEU A HD12 1 
ATOM   5907  H  HD13 . LEU A  1 419 ? 175.964 101.550 63.575  1.00 78.25  ? 611  LEU A HD13 1 
ATOM   5908  H  HD21 . LEU A  1 419 ? 173.302 101.505 64.845  1.00 77.03  ? 611  LEU A HD21 1 
ATOM   5909  H  HD22 . LEU A  1 419 ? 173.594 100.615 63.561  1.00 77.03  ? 611  LEU A HD22 1 
ATOM   5910  H  HD23 . LEU A  1 419 ? 173.043 99.938  64.888  1.00 77.03  ? 611  LEU A HD23 1 
ATOM   5911  N  N    . TRP A  1 420 ? 174.676 98.322  67.742  1.00 65.03  ? 612  TRP A N    1 
ATOM   5912  C  CA   . TRP A  1 420 ? 173.606 98.070  68.690  1.00 66.04  ? 612  TRP A CA   1 
ATOM   5913  C  C    . TRP A  1 420 ? 172.865 99.358  69.009  1.00 67.50  ? 612  TRP A C    1 
ATOM   5914  O  O    . TRP A  1 420 ? 173.282 100.462 68.651  1.00 69.07  ? 612  TRP A O    1 
ATOM   5915  C  CB   . TRP A  1 420 ? 174.147 97.479  69.996  1.00 64.27  ? 612  TRP A CB   1 
ATOM   5916  C  CG   . TRP A  1 420 ? 175.124 96.359  69.860  1.00 63.74  ? 612  TRP A CG   1 
ATOM   5917  C  CD1  . TRP A  1 420 ? 176.443 96.453  69.524  1.00 65.73  ? 612  TRP A CD1  1 
ATOM   5918  C  CD2  . TRP A  1 420 ? 174.870 94.971  70.104  1.00 62.80  ? 612  TRP A CD2  1 
ATOM   5919  N  NE1  . TRP A  1 420 ? 177.022 95.206  69.530  1.00 68.08  ? 612  TRP A NE1  1 
ATOM   5920  C  CE2  . TRP A  1 420 ? 176.077 94.280  69.883  1.00 65.31  ? 612  TRP A CE2  1 
ATOM   5921  C  CE3  . TRP A  1 420 ? 173.737 94.246  70.481  1.00 62.92  ? 612  TRP A CE3  1 
ATOM   5922  C  CZ2  . TRP A  1 420 ? 176.180 92.899  70.024  1.00 63.91  ? 612  TRP A CZ2  1 
ATOM   5923  C  CZ3  . TRP A  1 420 ? 173.842 92.876  70.620  1.00 62.34  ? 612  TRP A CZ3  1 
ATOM   5924  C  CH2  . TRP A  1 420 ? 175.054 92.217  70.393  1.00 62.23  ? 612  TRP A CH2  1 
ATOM   5925  H  H    . TRP A  1 420 ? 175.300 98.825  68.055  1.00 77.78  ? 612  TRP A H    1 
ATOM   5926  H  HA   . TRP A  1 420 ? 172.976 97.441  68.306  1.00 79.00  ? 612  TRP A HA   1 
ATOM   5927  H  HB2  . TRP A  1 420 ? 174.587 98.187  70.491  1.00 76.87  ? 612  TRP A HB2  1 
ATOM   5928  H  HB3  . TRP A  1 420 ? 173.396 97.145  70.512  1.00 76.87  ? 612  TRP A HB3  1 
ATOM   5929  H  HD1  . TRP A  1 420 ? 176.885 97.245  69.320  1.00 78.63  ? 612  TRP A HD1  1 
ATOM   5930  H  HE1  . TRP A  1 420 ? 177.844 95.035  69.342  1.00 81.45  ? 612  TRP A HE1  1 
ATOM   5931  H  HE3  . TRP A  1 420 ? 172.928 94.677  70.635  1.00 75.26  ? 612  TRP A HE3  1 
ATOM   5932  H  HZ2  . TRP A  1 420 ? 176.984 92.457  69.871  1.00 76.44  ? 612  TRP A HZ2  1 
ATOM   5933  H  HZ3  . TRP A  1 420 ? 173.094 92.384  70.870  1.00 74.55  ? 612  TRP A HZ3  1 
ATOM   5934  H  HH2  . TRP A  1 420 ? 175.095 91.293  70.493  1.00 74.43  ? 612  TRP A HH2  1 
ATOM   5935  N  N    . ALA A  1 421 ? 171.742 99.184  69.693  1.00 67.98  ? 613  ALA A N    1 
ATOM   5936  C  CA   . ALA A  1 421 ? 171.056 100.260 70.384  1.00 63.68  ? 613  ALA A CA   1 
ATOM   5937  C  C    . ALA A  1 421 ? 170.808 99.794  71.809  1.00 59.59  ? 613  ALA A C    1 
ATOM   5938  O  O    . ALA A  1 421 ? 170.542 98.611  72.042  1.00 60.15  ? 613  ALA A O    1 
ATOM   5939  C  CB   . ALA A  1 421 ? 169.743 100.621 69.696  1.00 66.99  ? 613  ALA A CB   1 
ATOM   5940  H  H    . ALA A  1 421 ? 171.346 98.424  69.771  1.00 81.33  ? 613  ALA A H    1 
ATOM   5941  H  HA   . ALA A  1 421 ? 171.622 101.047 70.407  1.00 76.17  ? 613  ALA A HA   1 
ATOM   5942  H  HB1  . ALA A  1 421 ? 169.317 101.341 70.187  1.00 80.14  ? 613  ALA A HB1  1 
ATOM   5943  H  HB2  . ALA A  1 421 ? 169.930 100.905 68.788  1.00 80.14  ? 613  ALA A HB2  1 
ATOM   5944  H  HB3  . ALA A  1 421 ? 169.167 99.840  69.687  1.00 80.14  ? 613  ALA A HB3  1 
ATOM   5945  N  N    . THR A  1 422 ? 170.907 100.720 72.765  1.00 57.34  ? 614  THR A N    1 
ATOM   5946  C  CA   . THR A  1 422 ? 170.854 100.320 74.167  1.00 59.38  ? 614  THR A CA   1 
ATOM   5947  C  C    . THR A  1 422 ? 169.550 99.609  74.510  1.00 62.85  ? 614  THR A C    1 
ATOM   5948  O  O    . THR A  1 422 ? 169.525 98.784  75.430  1.00 65.13  ? 614  THR A O    1 
ATOM   5949  C  CB   . THR A  1 422 ? 171.051 101.535 75.077  1.00 61.16  ? 614  THR A CB   1 
ATOM   5950  O  OG1  . THR A  1 422 ? 170.248 102.628 74.614  1.00 65.64  ? 614  THR A OG1  1 
ATOM   5951  C  CG2  . THR A  1 422 ? 172.518 101.947 75.113  1.00 62.11  ? 614  THR A CG2  1 
ATOM   5952  H  H    . THR A  1 422 ? 171.002 101.564 72.631  1.00 68.56  ? 614  THR A H    1 
ATOM   5953  H  HA   . THR A  1 422 ? 171.580 99.701  74.340  1.00 71.01  ? 614  THR A HA   1 
ATOM   5954  H  HB   . THR A  1 422 ? 170.781 101.303 75.979  1.00 73.14  ? 614  THR A HB   1 
ATOM   5955  H  HG1  . THR A  1 422 ? 169.437 102.412 74.620  1.00 78.52  ? 614  THR A HG1  1 
ATOM   5956  H  HG21 . THR A  1 422 ? 172.632 102.717 75.692  1.00 74.29  ? 614  THR A HG21 1 
ATOM   5957  H  HG22 . THR A  1 422 ? 173.060 101.217 75.450  1.00 74.29  ? 614  THR A HG22 1 
ATOM   5958  H  HG23 . THR A  1 422 ? 172.820 102.177 74.220  1.00 74.29  ? 614  THR A HG23 1 
ATOM   5959  N  N    . ASP A  1 423 ? 168.464 99.895  73.789  1.00 67.15  ? 615  ASP A N    1 
ATOM   5960  C  CA   . ASP A  1 423 ? 167.159 99.332  74.114  1.00 71.84  ? 615  ASP A CA   1 
ATOM   5961  C  C    . ASP A  1 423 ? 166.778 98.152  73.221  1.00 71.22  ? 615  ASP A C    1 
ATOM   5962  O  O    . ASP A  1 423 ? 165.596 97.801  73.144  1.00 75.94  ? 615  ASP A O    1 
ATOM   5963  C  CB   . ASP A  1 423 ? 166.081 100.417 74.041  1.00 74.36  ? 615  ASP A CB   1 
ATOM   5964  C  CG   . ASP A  1 423 ? 165.952 101.028 72.659  1.00 71.08  ? 615  ASP A CG   1 
ATOM   5965  O  OD1  . ASP A  1 423 ? 166.749 100.672 71.766  1.00 70.63  ? 615  ASP A OD1  1 
ATOM   5966  O  OD2  . ASP A  1 423 ? 165.054 101.875 72.470  1.00 71.87  ? 615  ASP A OD2  1 
ATOM   5967  H  H    . ASP A  1 423 ? 168.460 100.416 73.104  1.00 80.33  ? 615  ASP A H    1 
ATOM   5968  H  HA   . ASP A  1 423 ? 167.184 99.008  75.028  1.00 85.95  ? 615  ASP A HA   1 
ATOM   5969  H  HB2  . ASP A  1 423 ? 165.224 100.028 74.277  1.00 88.99  ? 615  ASP A HB2  1 
ATOM   5970  H  HB3  . ASP A  1 423 ? 166.305 101.127 74.662  1.00 88.99  ? 615  ASP A HB3  1 
ATOM   5971  N  N    . HIS A  1 424 ? 167.749 97.531  72.551  1.00 63.57  ? 616  HIS A N    1 
ATOM   5972  C  CA   . HIS A  1 424 ? 167.518 96.310  71.787  1.00 66.28  ? 616  HIS A CA   1 
ATOM   5973  C  C    . HIS A  1 424 ? 168.545 95.266  72.194  1.00 65.39  ? 616  HIS A C    1 
ATOM   5974  O  O    . HIS A  1 424 ? 169.745 95.555  72.235  1.00 68.20  ? 616  HIS A O    1 
ATOM   5975  C  CB   . HIS A  1 424 ? 167.607 96.557  70.275  1.00 72.86  ? 616  HIS A CB   1 
ATOM   5976  C  CG   . HIS A  1 424 ? 166.487 97.382  69.721  1.00 82.46  ? 616  HIS A CG   1 
ATOM   5977  N  ND1  . HIS A  1 424 ? 166.602 98.737  69.493  1.00 86.36  ? 616  HIS A ND1  1 
ATOM   5978  C  CD2  . HIS A  1 424 ? 165.237 97.041  69.330  1.00 84.78  ? 616  HIS A CD2  1 
ATOM   5979  C  CE1  . HIS A  1 424 ? 165.468 99.196  68.994  1.00 85.24  ? 616  HIS A CE1  1 
ATOM   5980  N  NE2  . HIS A  1 424 ? 164.623 98.187  68.886  1.00 87.63  ? 616  HIS A NE2  1 
ATOM   5981  H  H    . HIS A  1 424 ? 168.564 97.804  72.526  1.00 76.04  ? 616  HIS A H    1 
ATOM   5982  H  HA   . HIS A  1 424 ? 166.634 95.966  71.989  1.00 79.28  ? 616  HIS A HA   1 
ATOM   5983  H  HB2  . HIS A  1 424 ? 168.438 97.019  70.083  1.00 87.18  ? 616  HIS A HB2  1 
ATOM   5984  H  HB3  . HIS A  1 424 ? 167.596 95.701  69.819  1.00 87.18  ? 616  HIS A HB3  1 
ATOM   5985  H  HD2  . HIS A  1 424 ? 164.862 96.190  69.361  1.00 101.49 ? 616  HIS A HD2  1 
ATOM   5986  H  HE1  . HIS A  1 424 ? 165.295 100.079 68.760  1.00 102.05 ? 616  HIS A HE1  1 
ATOM   5987  H  HE2  . HIS A  1 424 ? 163.819 98.239  68.586  1.00 104.91 ? 616  HIS A HE2  1 
ATOM   5988  N  N    . TYR A  1 425 ? 168.075 94.053  72.495  1.00 67.50  ? 617  TYR A N    1 
ATOM   5989  C  CA   . TYR A  1 425 ? 168.991 92.955  72.776  1.00 62.99  ? 617  TYR A CA   1 
ATOM   5990  C  C    . TYR A  1 425 ? 169.670 92.440  71.517  1.00 59.99  ? 617  TYR A C    1 
ATOM   5991  O  O    . TYR A  1 425 ? 170.721 91.798  71.618  1.00 62.56  ? 617  TYR A O    1 
ATOM   5992  C  CB   . TYR A  1 425 ? 168.257 91.805  73.465  1.00 63.06  ? 617  TYR A CB   1 
ATOM   5993  C  CG   . TYR A  1 425 ? 168.070 92.007  74.949  1.00 68.01  ? 617  TYR A CG   1 
ATOM   5994  C  CD1  . TYR A  1 425 ? 169.156 91.980  75.814  1.00 71.76  ? 617  TYR A CD1  1 
ATOM   5995  C  CD2  . TYR A  1 425 ? 166.810 92.221  75.486  1.00 72.13  ? 617  TYR A CD2  1 
ATOM   5996  C  CE1  . TYR A  1 425 ? 168.991 92.164  77.172  1.00 73.50  ? 617  TYR A CE1  1 
ATOM   5997  C  CE2  . TYR A  1 425 ? 166.635 92.403  76.843  1.00 76.97  ? 617  TYR A CE2  1 
ATOM   5998  C  CZ   . TYR A  1 425 ? 167.728 92.377  77.681  1.00 77.69  ? 617  TYR A CZ   1 
ATOM   5999  O  OH   . TYR A  1 425 ? 167.558 92.560  79.035  1.00 86.30  ? 617  TYR A OH   1 
ATOM   6000  H  H    . TYR A  1 425 ? 167.241 93.846  72.542  1.00 80.75  ? 617  TYR A H    1 
ATOM   6001  H  HA   . TYR A  1 425 ? 169.682 93.271  73.378  1.00 75.34  ? 617  TYR A HA   1 
ATOM   6002  H  HB2  . TYR A  1 425 ? 167.378 91.710  73.066  1.00 75.42  ? 617  TYR A HB2  1 
ATOM   6003  H  HB3  . TYR A  1 425 ? 168.766 90.989  73.339  1.00 75.42  ? 617  TYR A HB3  1 
ATOM   6004  H  HD1  . TYR A  1 425 ? 170.009 91.838  75.473  1.00 85.87  ? 617  TYR A HD1  1 
ATOM   6005  H  HD2  . TYR A  1 425 ? 166.070 92.241  74.923  1.00 86.31  ? 617  TYR A HD2  1 
ATOM   6006  H  HE1  . TYR A  1 425 ? 169.727 92.145  77.740  1.00 87.96  ? 617  TYR A HE1  1 
ATOM   6007  H  HE2  . TYR A  1 425 ? 165.784 92.548  77.189  1.00 92.11  ? 617  TYR A HE2  1 
ATOM   6008  H  HH   . TYR A  1 425 ? 166.744 92.679  79.209  1.00 103.31 ? 617  TYR A HH   1 
ATOM   6009  N  N    . GLN A  1 426 ? 169.096 92.691  70.341  1.00 56.60  ? 618  GLN A N    1 
ATOM   6010  C  CA   . GLN A  1 426 ? 169.704 92.250  69.100  1.00 61.90  ? 618  GLN A CA   1 
ATOM   6011  C  C    . GLN A  1 426 ? 170.271 93.439  68.330  1.00 61.59  ? 618  GLN A C    1 
ATOM   6012  O  O    . GLN A  1 426 ? 169.722 94.544  68.388  1.00 62.50  ? 618  GLN A O    1 
ATOM   6013  C  CB   . GLN A  1 426 ? 168.694 91.507  68.219  1.00 69.50  ? 618  GLN A CB   1 
ATOM   6014  C  CG   . GLN A  1 426 ? 168.097 90.282  68.895  1.00 79.69  ? 618  GLN A CG   1 
ATOM   6015  C  CD   . GLN A  1 426 ? 169.158 89.360  69.469  1.00 86.35  ? 618  GLN A CD   1 
ATOM   6016  O  OE1  . GLN A  1 426 ? 170.233 89.195  68.890  1.00 87.20  ? 618  GLN A OE1  1 
ATOM   6017  N  NE2  . GLN A  1 426 ? 168.863 88.760  70.617  1.00 86.48  ? 618  GLN A NE2  1 
ATOM   6018  H  H    . GLN A  1 426 ? 168.354 93.115  70.241  1.00 67.67  ? 618  GLN A H    1 
ATOM   6019  H  HA   . GLN A  1 426 ? 170.434 91.644  69.301  1.00 74.03  ? 618  GLN A HA   1 
ATOM   6020  H  HB2  . GLN A  1 426 ? 167.967 92.110  67.997  1.00 83.15  ? 618  GLN A HB2  1 
ATOM   6021  H  HB3  . GLN A  1 426 ? 169.139 91.214  67.409  1.00 83.15  ? 618  GLN A HB3  1 
ATOM   6022  H  HG2  . GLN A  1 426 ? 167.523 90.570  69.623  1.00 95.38  ? 618  GLN A HG2  1 
ATOM   6023  H  HG3  . GLN A  1 426 ? 167.582 89.781  68.244  1.00 95.38  ? 618  GLN A HG3  1 
ATOM   6024  H  HE21 . GLN A  1 426 ? 168.103 88.901  70.993  1.00 103.53 ? 618  GLN A HE21 1 
ATOM   6025  H  HE22 . GLN A  1 426 ? 169.432 88.228  70.982  1.00 103.53 ? 618  GLN A HE22 1 
ATOM   6026  N  N    . PRO A  1 427 ? 171.370 93.249  67.604  1.00 58.77  ? 619  PRO A N    1 
ATOM   6027  C  CA   . PRO A  1 427 ? 171.957 94.366  66.859  1.00 61.11  ? 619  PRO A CA   1 
ATOM   6028  C  C    . PRO A  1 427 ? 171.036 94.861  65.756  1.00 61.29  ? 619  PRO A C    1 
ATOM   6029  O  O    . PRO A  1 427 ? 170.191 94.127  65.239  1.00 63.45  ? 619  PRO A O    1 
ATOM   6030  C  CB   . PRO A  1 427 ? 173.245 93.768  66.281  1.00 63.43  ? 619  PRO A CB   1 
ATOM   6031  C  CG   . PRO A  1 427 ? 172.989 92.297  66.231  1.00 61.13  ? 619  PRO A CG   1 
ATOM   6032  C  CD   . PRO A  1 427 ? 172.129 92.001  67.417  1.00 57.28  ? 619  PRO A CD   1 
ATOM   6033  H  HA   . PRO A  1 427 ? 172.176 95.099  67.456  1.00 73.08  ? 619  PRO A HA   1 
ATOM   6034  H  HB2  . PRO A  1 427 ? 173.400 94.121  65.391  1.00 75.86  ? 619  PRO A HB2  1 
ATOM   6035  H  HB3  . PRO A  1 427 ? 173.991 93.967  66.867  1.00 75.86  ? 619  PRO A HB3  1 
ATOM   6036  H  HG2  . PRO A  1 427 ? 172.525 92.075  65.408  1.00 73.10  ? 619  PRO A HG2  1 
ATOM   6037  H  HG3  . PRO A  1 427 ? 173.830 91.818  66.290  1.00 73.10  ? 619  PRO A HG3  1 
ATOM   6038  H  HD2  . PRO A  1 427 ? 171.528 91.264  67.224  1.00 68.49  ? 619  PRO A HD2  1 
ATOM   6039  H  HD3  . PRO A  1 427 ? 172.678 91.818  68.196  1.00 68.49  ? 619  PRO A HD3  1 
ATOM   6040  N  N    . LEU A  1 428 ? 171.217 96.129  65.394  1.00 62.30  ? 620  LEU A N    1 
ATOM   6041  C  CA   . LEU A  1 428 ? 170.465 96.731  64.302  1.00 62.71  ? 620  LEU A CA   1 
ATOM   6042  C  C    . LEU A  1 428 ? 171.184 96.600  62.969  1.00 63.25  ? 620  LEU A C    1 
ATOM   6043  O  O    . LEU A  1 428 ? 170.529 96.476  61.928  1.00 60.99  ? 620  LEU A O    1 
ATOM   6044  C  CB   . LEU A  1 428 ? 170.212 98.215  64.585  1.00 67.51  ? 620  LEU A CB   1 
ATOM   6045  C  CG   . LEU A  1 428 ? 169.392 98.567  65.826  1.00 68.54  ? 620  LEU A CG   1 
ATOM   6046  C  CD1  . LEU A  1 428 ? 169.334 100.075 65.993  1.00 69.87  ? 620  LEU A CD1  1 
ATOM   6047  C  CD2  . LEU A  1 428 ? 167.991 97.992  65.732  1.00 71.18  ? 620  LEU A CD2  1 
ATOM   6048  H  H    . LEU A  1 428 ? 171.776 96.665  65.770  1.00 74.52  ? 620  LEU A H    1 
ATOM   6049  H  HA   . LEU A  1 428 ? 169.606 96.288  64.226  1.00 75.01  ? 620  LEU A HA   1 
ATOM   6050  H  HB2  . LEU A  1 428 ? 171.072 98.653  64.680  1.00 80.77  ? 620  LEU A HB2  1 
ATOM   6051  H  HB3  . LEU A  1 428 ? 169.747 98.591  63.822  1.00 80.77  ? 620  LEU A HB3  1 
ATOM   6052  H  HG   . LEU A  1 428 ? 169.822 98.192  66.610  1.00 82.00  ? 620  LEU A HG   1 
ATOM   6053  H  HD11 . LEU A  1 428 ? 168.812 100.285 66.783  1.00 83.59  ? 620  LEU A HD11 1 
ATOM   6054  H  HD12 . LEU A  1 428 ? 170.237 100.416 66.093  1.00 83.59  ? 620  LEU A HD12 1 
ATOM   6055  H  HD13 . LEU A  1 428 ? 168.918 100.464 65.208  1.00 83.59  ? 620  LEU A HD13 1 
ATOM   6056  H  HD21 . LEU A  1 428 ? 167.497 98.232  66.531  1.00 85.17  ? 620  LEU A HD21 1 
ATOM   6057  H  HD22 . LEU A  1 428 ? 167.552 98.358  64.948  1.00 85.17  ? 620  LEU A HD22 1 
ATOM   6058  H  HD23 . LEU A  1 428 ? 168.051 97.027  65.657  1.00 85.17  ? 620  LEU A HD23 1 
ATOM   6059  N  N    . ARG A  1 429 ? 172.514 96.623  62.984  1.00 60.98  ? 621  ARG A N    1 
ATOM   6060  C  CA   . ARG A  1 429 ? 173.317 96.420  61.792  1.00 60.33  ? 621  ARG A CA   1 
ATOM   6061  C  C    . ARG A  1 429 ? 174.417 95.418  62.101  1.00 63.84  ? 621  ARG A C    1 
ATOM   6062  O  O    . ARG A  1 429 ? 174.884 95.313  63.239  1.00 64.83  ? 621  ARG A O    1 
ATOM   6063  C  CB   . ARG A  1 429 ? 173.942 97.732  61.298  1.00 64.60  ? 621  ARG A CB   1 
ATOM   6064  C  CG   . ARG A  1 429 ? 172.939 98.776  60.848  1.00 64.88  ? 621  ARG A CG   1 
ATOM   6065  C  CD   . ARG A  1 429 ? 172.407 98.452  59.467  1.00 66.35  ? 621  ARG A CD   1 
ATOM   6066  N  NE   . ARG A  1 429 ? 171.345 99.367  59.051  1.00 67.71  ? 621  ARG A NE   1 
ATOM   6067  C  CZ   . ARG A  1 429 ? 170.043 99.130  59.179  1.00 65.98  ? 621  ARG A CZ   1 
ATOM   6068  N  NH1  . ARG A  1 429 ? 169.605 98.000  59.723  1.00 64.38  ? 621  ARG A NH1  1 
ATOM   6069  N  NH2  . ARG A  1 429 ? 169.167 100.031 58.759  1.00 66.71  ? 621  ARG A NH2  1 
ATOM   6070  H  H    . ARG A  1 429 ? 172.981 96.757  63.693  1.00 72.93  ? 621  ARG A H    1 
ATOM   6071  H  HA   . ARG A  1 429 ? 172.761 96.059  61.084  1.00 72.15  ? 621  ARG A HA   1 
ATOM   6072  H  HB2  . ARG A  1 429 ? 174.464 98.117  62.019  1.00 77.27  ? 621  ARG A HB2  1 
ATOM   6073  H  HB3  . ARG A  1 429 ? 174.520 97.535  60.545  1.00 77.27  ? 621  ARG A HB3  1 
ATOM   6074  H  HG2  . ARG A  1 429 ? 172.193 98.794  61.468  1.00 77.61  ? 621  ARG A HG2  1 
ATOM   6075  H  HG3  . ARG A  1 429 ? 173.371 99.644  60.814  1.00 77.61  ? 621  ARG A HG3  1 
ATOM   6076  H  HD2  . ARG A  1 429 ? 173.131 98.518  58.825  1.00 79.37  ? 621  ARG A HD2  1 
ATOM   6077  H  HD3  . ARG A  1 429 ? 172.045 97.552  59.470  1.00 79.37  ? 621  ARG A HD3  1 
ATOM   6078  H  HE   . ARG A  1 429 ? 171.581 100.115 58.697  1.00 81.00  ? 621  ARG A HE   1 
ATOM   6079  H  HH11 . ARG A  1 429 ? 170.167 97.409  59.997  1.00 77.01  ? 621  ARG A HH11 1 
ATOM   6080  H  HH12 . ARG A  1 429 ? 168.760 97.860  59.801  1.00 77.01  ? 621  ARG A HH12 1 
ATOM   6081  H  HH21 . ARG A  1 429 ? 169.442 100.766 58.406  1.00 79.81  ? 621  ARG A HH21 1 
ATOM   6082  H  HH22 . ARG A  1 429 ? 168.324 99.884  58.842  1.00 79.81  ? 621  ARG A HH22 1 
ATOM   6083  N  N    . ILE A  1 430 ? 174.820 94.675  61.076  1.00 65.55  ? 622  ILE A N    1 
ATOM   6084  C  CA   . ILE A  1 430 ? 175.946 93.754  61.165  1.00 65.77  ? 622  ILE A CA   1 
ATOM   6085  C  C    . ILE A  1 430 ? 176.868 94.056  59.999  1.00 62.30  ? 622  ILE A C    1 
ATOM   6086  O  O    . ILE A  1 430 ? 176.435 94.045  58.841  1.00 64.11  ? 622  ILE A O    1 
ATOM   6087  C  CB   . ILE A  1 430 ? 175.505 92.281  61.150  1.00 61.23  ? 622  ILE A CB   1 
ATOM   6088  C  CG1  . ILE A  1 430 ? 174.756 91.952  62.441  1.00 59.30  ? 622  ILE A CG1  1 
ATOM   6089  C  CG2  . ILE A  1 430 ? 176.715 91.361  61.005  1.00 62.25  ? 622  ILE A CG2  1 
ATOM   6090  C  CD1  . ILE A  1 430 ? 174.012 90.640  62.399  1.00 65.59  ? 622  ILE A CD1  1 
ATOM   6091  H  H    . ILE A  1 430 ? 174.448 94.687  60.301  1.00 78.41  ? 622  ILE A H    1 
ATOM   6092  H  HA   . ILE A  1 430 ? 176.431 93.919  61.989  1.00 78.68  ? 622  ILE A HA   1 
ATOM   6093  H  HB   . ILE A  1 430 ? 174.910 92.139  60.397  1.00 73.23  ? 622  ILE A HB   1 
ATOM   6094  H  HG12 . ILE A  1 430 ? 175.394 91.907  63.170  1.00 70.91  ? 622  ILE A HG12 1 
ATOM   6095  H  HG13 . ILE A  1 430 ? 174.109 92.654  62.614  1.00 70.91  ? 622  ILE A HG13 1 
ATOM   6096  H  HG21 . ILE A  1 430 ? 176.411 90.439  60.998  1.00 74.46  ? 622  ILE A HG21 1 
ATOM   6097  H  HG22 . ILE A  1 430 ? 177.169 91.566  60.173  1.00 74.46  ? 622  ILE A HG22 1 
ATOM   6098  H  HG23 . ILE A  1 430 ? 177.314 91.507  61.754  1.00 74.46  ? 622  ILE A HG23 1 
ATOM   6099  H  HD11 . ILE A  1 430 ? 173.565 90.504  63.249  1.00 78.46  ? 622  ILE A HD11 1 
ATOM   6100  H  HD12 . ILE A  1 430 ? 173.358 90.671  61.683  1.00 78.46  ? 622  ILE A HD12 1 
ATOM   6101  H  HD13 . ILE A  1 430 ? 174.645 89.923  62.239  1.00 78.46  ? 622  ILE A HD13 1 
ATOM   6102  N  N    . PHE A  1 431 ? 178.128 94.336  60.305  1.00 67.88  ? 623  PHE A N    1 
ATOM   6103  C  CA   . PHE A  1 431 ? 179.128 94.677  59.301  1.00 67.07  ? 623  PHE A CA   1 
ATOM   6104  C  C    . PHE A  1 431 ? 179.969 93.432  59.052  1.00 63.97  ? 623  PHE A C    1 
ATOM   6105  O  O    . PHE A  1 431 ? 180.919 93.151  59.786  1.00 65.42  ? 623  PHE A O    1 
ATOM   6106  C  CB   . PHE A  1 431 ? 179.963 95.859  59.779  1.00 66.61  ? 623  PHE A CB   1 
ATOM   6107  C  CG   . PHE A  1 431 ? 179.139 97.065  60.145  1.00 67.26  ? 623  PHE A CG   1 
ATOM   6108  C  CD1  . PHE A  1 431 ? 178.328 97.677  59.203  1.00 64.27  ? 623  PHE A CD1  1 
ATOM   6109  C  CD2  . PHE A  1 431 ? 179.159 97.574  61.433  1.00 64.80  ? 623  PHE A CD2  1 
ATOM   6110  C  CE1  . PHE A  1 431 ? 177.564 98.779  59.535  1.00 63.49  ? 623  PHE A CE1  1 
ATOM   6111  C  CE2  . PHE A  1 431 ? 178.398 98.678  61.769  1.00 62.70  ? 623  PHE A CE2  1 
ATOM   6112  C  CZ   . PHE A  1 431 ? 177.599 99.279  60.819  1.00 64.38  ? 623  PHE A CZ   1 
ATOM   6113  H  H    . PHE A  1 431 ? 178.436 94.334  61.108  1.00 81.21  ? 623  PHE A H    1 
ATOM   6114  H  HA   . PHE A  1 431 ? 178.688 94.925  58.473  1.00 80.23  ? 623  PHE A HA   1 
ATOM   6115  H  HB2  . PHE A  1 431 ? 180.464 95.591  60.566  1.00 79.69  ? 623  PHE A HB2  1 
ATOM   6116  H  HB3  . PHE A  1 431 ? 180.574 96.119  59.072  1.00 79.69  ? 623  PHE A HB3  1 
ATOM   6117  H  HD1  . PHE A  1 431 ? 178.301 97.345  58.335  1.00 76.87  ? 623  PHE A HD1  1 
ATOM   6118  H  HD2  . PHE A  1 431 ? 179.696 97.173  62.078  1.00 77.51  ? 623  PHE A HD2  1 
ATOM   6119  H  HE1  . PHE A  1 431 ? 177.027 99.184  58.893  1.00 75.94  ? 623  PHE A HE1  1 
ATOM   6120  H  HE2  . PHE A  1 431 ? 178.422 99.014  62.636  1.00 75.00  ? 623  PHE A HE2  1 
ATOM   6121  H  HZ   . PHE A  1 431 ? 177.086 100.021 61.044  1.00 77.01  ? 623  PHE A HZ   1 
ATOM   6122  N  N    . ALA A  1 432 ? 179.608 92.681  58.015  1.00 58.31  ? 624  ALA A N    1 
ATOM   6123  C  CA   . ALA A  1 432 ? 180.265 91.429  57.673  1.00 61.41  ? 624  ALA A CA   1 
ATOM   6124  C  C    . ALA A  1 432 ? 181.017 91.591  56.360  1.00 59.99  ? 624  ALA A C    1 
ATOM   6125  O  O    . ALA A  1 432 ? 180.509 92.201  55.414  1.00 60.03  ? 624  ALA A O    1 
ATOM   6126  C  CB   . ALA A  1 432 ? 179.248 90.290  57.560  1.00 65.15  ? 624  ALA A CB   1 
ATOM   6127  H  H    . ALA A  1 432 ? 178.965 92.885  57.481  1.00 69.72  ? 624  ALA A H    1 
ATOM   6128  H  HA   . ALA A  1 432 ? 180.904 91.201  58.366  1.00 73.44  ? 624  ALA A HA   1 
ATOM   6129  H  HB1  . ALA A  1 432 ? 179.715 89.471  57.332  1.00 77.93  ? 624  ALA A HB1  1 
ATOM   6130  H  HB2  . ALA A  1 432 ? 178.794 90.187  58.411  1.00 77.93  ? 624  ALA A HB2  1 
ATOM   6131  H  HB3  . ALA A  1 432 ? 178.605 90.509  56.867  1.00 77.93  ? 624  ALA A HB3  1 
ATOM   6132  N  N    . GLY A  1 433 ? 182.228 91.041  56.305  1.00 66.95  ? 625  GLY A N    1 
ATOM   6133  C  CA   . GLY A  1 433 ? 183.067 91.194  55.133  1.00 65.69  ? 625  GLY A CA   1 
ATOM   6134  C  C    . GLY A  1 433 ? 184.525 90.871  55.387  1.00 65.88  ? 625  GLY A C    1 
ATOM   6135  O  O    . GLY A  1 433 ? 185.205 90.321  54.515  1.00 67.48  ? 625  GLY A O    1 
ATOM   6136  H  H    . GLY A  1 433 ? 182.582 90.576  56.935  1.00 80.09  ? 625  GLY A H    1 
ATOM   6137  H  HA2  . GLY A  1 433 ? 182.744 90.608  54.430  1.00 78.57  ? 625  GLY A HA2  1 
ATOM   6138  H  HA3  . GLY A  1 433 ? 183.010 92.109  54.816  1.00 78.57  ? 625  GLY A HA3  1 
ATOM   6139  N  N    . HIS A  1 434 ? 185.021 91.218  56.572  1.00 63.22  ? 626  HIS A N    1 
ATOM   6140  C  CA   . HIS A  1 434 ? 186.410 90.938  56.910  1.00 67.21  ? 626  HIS A CA   1 
ATOM   6141  C  C    . HIS A  1 434 ? 186.683 89.438  56.876  1.00 71.38  ? 626  HIS A C    1 
ATOM   6142  O  O    . HIS A  1 434 ? 185.797 88.612  57.117  1.00 70.42  ? 626  HIS A O    1 
ATOM   6143  C  CB   . HIS A  1 434 ? 186.746 91.501  58.292  1.00 64.68  ? 626  HIS A CB   1 
ATOM   6144  C  CG   . HIS A  1 434 ? 187.011 92.973  58.297  1.00 63.97  ? 626  HIS A CG   1 
ATOM   6145  N  ND1  . HIS A  1 434 ? 188.109 93.529  57.677  1.00 63.85  ? 626  HIS A ND1  1 
ATOM   6146  C  CD2  . HIS A  1 434 ? 186.327 94.005  58.847  1.00 61.50  ? 626  HIS A CD2  1 
ATOM   6147  C  CE1  . HIS A  1 434 ? 188.092 94.839  57.846  1.00 62.01  ? 626  HIS A CE1  1 
ATOM   6148  N  NE2  . HIS A  1 434 ? 187.020 95.154  58.551  1.00 60.20  ? 626  HIS A NE2  1 
ATOM   6149  H  H    . HIS A  1 434 ? 184.577 91.615  57.193  1.00 75.62  ? 626  HIS A H    1 
ATOM   6150  H  HA   . HIS A  1 434 ? 186.988 91.366  56.260  1.00 80.41  ? 626  HIS A HA   1 
ATOM   6151  H  HB2  . HIS A  1 434 ? 185.999 91.333  58.888  1.00 77.37  ? 626  HIS A HB2  1 
ATOM   6152  H  HB3  . HIS A  1 434 ? 187.540 91.055  58.626  1.00 77.37  ? 626  HIS A HB3  1 
ATOM   6153  H  HD1  . HIS A  1 434 ? 188.713 93.091  57.249  1.00 76.38  ? 626  HIS A HD1  1 
ATOM   6154  H  HD2  . HIS A  1 434 ? 185.537 93.946  59.334  1.00 73.55  ? 626  HIS A HD2  1 
ATOM   6155  H  HE1  . HIS A  1 434 ? 188.724 95.438  57.520  1.00 74.17  ? 626  HIS A HE1  1 
ATOM   6156  N  N    . LEU A  1 435 ? 187.932 89.091  56.566  1.00 67.84  ? 627  LEU A N    1 
ATOM   6157  C  CA   . LEU A  1 435 ? 188.370 87.703  56.507  1.00 66.50  ? 627  LEU A CA   1 
ATOM   6158  C  C    . LEU A  1 435 ? 188.934 87.194  57.827  1.00 66.90  ? 627  LEU A C    1 
ATOM   6159  O  O    . LEU A  1 435 ? 189.259 86.006  57.925  1.00 63.43  ? 627  LEU A O    1 
ATOM   6160  C  CB   . LEU A  1 435 ? 189.427 87.529  55.411  1.00 65.93  ? 627  LEU A CB   1 
ATOM   6161  C  CG   . LEU A  1 435 ? 188.967 87.648  53.955  1.00 72.34  ? 627  LEU A CG   1 
ATOM   6162  C  CD1  . LEU A  1 435 ? 188.578 89.073  53.593  1.00 78.75  ? 627  LEU A CD1  1 
ATOM   6163  C  CD2  . LEU A  1 435 ? 190.060 87.145  53.026  1.00 74.43  ? 627  LEU A CD2  1 
ATOM   6164  H  H    . LEU A  1 435 ? 188.554 89.655  56.382  1.00 81.16  ? 627  LEU A H    1 
ATOM   6165  H  HA   . LEU A  1 435 ? 187.610 87.146  56.277  1.00 79.55  ? 627  LEU A HA   1 
ATOM   6166  H  HB2  . LEU A  1 435 ? 190.113 88.201  55.548  1.00 78.86  ? 627  LEU A HB2  1 
ATOM   6167  H  HB3  . LEU A  1 435 ? 189.821 86.648  55.513  1.00 78.86  ? 627  LEU A HB3  1 
ATOM   6168  H  HG   . LEU A  1 435 ? 188.187 87.086  53.827  1.00 86.56  ? 627  LEU A HG   1 
ATOM   6169  H  HD11 . LEU A  1 435 ? 188.295 89.097  52.665  1.00 94.25  ? 627  LEU A HD11 1 
ATOM   6170  H  HD12 . LEU A  1 435 ? 187.850 89.357  54.168  1.00 94.25  ? 627  LEU A HD12 1 
ATOM   6171  H  HD13 . LEU A  1 435 ? 189.346 89.652  53.720  1.00 94.25  ? 627  LEU A HD13 1 
ATOM   6172  H  HD21 . LEU A  1 435 ? 189.755 87.227  52.109  1.00 89.07  ? 627  LEU A HD21 1 
ATOM   6173  H  HD22 . LEU A  1 435 ? 190.858 87.681  53.159  1.00 89.07  ? 627  LEU A HD22 1 
ATOM   6174  H  HD23 . LEU A  1 435 ? 190.246 86.216  53.232  1.00 89.07  ? 627  LEU A HD23 1 
ATOM   6175  N  N    . ALA A  1 436 ? 189.058 88.049  58.836  1.00 67.44  ? 628  ALA A N    1 
ATOM   6176  C  CA   . ALA A  1 436 ? 189.646 87.658  60.111  1.00 60.78  ? 628  ALA A CA   1 
ATOM   6177  C  C    . ALA A  1 436 ? 189.110 88.594  61.189  1.00 57.09  ? 628  ALA A C    1 
ATOM   6178  O  O    . ALA A  1 436 ? 188.216 89.409  60.936  1.00 57.60  ? 628  ALA A O    1 
ATOM   6179  C  CB   . ALA A  1 436 ? 191.175 87.678  60.036  1.00 58.64  ? 628  ALA A CB   1 
ATOM   6180  H  H    . ALA A  1 436 ? 188.807 88.871  58.806  1.00 80.68  ? 628  ALA A H    1 
ATOM   6181  H  HA   . ALA A  1 436 ? 189.366 86.755  60.328  1.00 72.69  ? 628  ALA A HA   1 
ATOM   6182  H  HB1  . ALA A  1 436 ? 191.537 87.415  60.896  1.00 70.12  ? 628  ALA A HB1  1 
ATOM   6183  H  HB2  . ALA A  1 436 ? 191.465 87.057  59.350  1.00 70.12  ? 628  ALA A HB2  1 
ATOM   6184  H  HB3  . ALA A  1 436 ? 191.468 88.576  59.815  1.00 70.12  ? 628  ALA A HB3  1 
ATOM   6185  N  N    . ASP A  1 437 ? 189.657 88.469  62.399  1.00 57.36  ? 629  ASP A N    1 
ATOM   6186  C  CA   . ASP A  1 437 ? 189.181 89.226  63.552  1.00 58.44  ? 629  ASP A CA   1 
ATOM   6187  C  C    . ASP A  1 437 ? 188.951 90.691  63.208  1.00 57.33  ? 629  ASP A C    1 
ATOM   6188  O  O    . ASP A  1 437 ? 189.690 91.286  62.421  1.00 56.42  ? 629  ASP A O    1 
ATOM   6189  C  CB   . ASP A  1 437 ? 190.189 89.138  64.704  1.00 62.93  ? 629  ASP A CB   1 
ATOM   6190  C  CG   . ASP A  1 437 ? 190.457 87.717  65.147  1.00 67.72  ? 629  ASP A CG   1 
ATOM   6191  O  OD1  . ASP A  1 437 ? 190.853 86.891  64.297  1.00 72.11  ? 629  ASP A OD1  1 
ATOM   6192  O  OD2  . ASP A  1 437 ? 190.274 87.426  66.348  1.00 70.68  ? 629  ASP A OD2  1 
ATOM   6193  H  H    . ASP A  1 437 ? 190.315 87.944  62.578  1.00 68.58  ? 629  ASP A H    1 
ATOM   6194  H  HA   . ASP A  1 437 ? 188.340 88.849  63.856  1.00 69.88  ? 629  ASP A HA   1 
ATOM   6195  H  HB2  . ASP A  1 437 ? 191.030 89.526  64.416  1.00 75.26  ? 629  ASP A HB2  1 
ATOM   6196  H  HB3  . ASP A  1 437 ? 189.841 89.628  65.465  1.00 75.26  ? 629  ASP A HB3  1 
ATOM   6197  N  N    . VAL A  1 438 ? 187.913 91.264  63.808  1.00 54.78  ? 630  VAL A N    1 
ATOM   6198  C  CA   . VAL A  1 438 ? 187.709 92.707  63.832  1.00 56.80  ? 630  VAL A CA   1 
ATOM   6199  C  C    . VAL A  1 438 ? 188.289 93.210  65.147  1.00 59.03  ? 630  VAL A C    1 
ATOM   6200  O  O    . VAL A  1 438 ? 187.726 92.968  66.220  1.00 61.47  ? 630  VAL A O    1 
ATOM   6201  C  CB   . VAL A  1 438 ? 186.228 93.078  63.681  1.00 57.89  ? 630  VAL A CB   1 
ATOM   6202  C  CG1  . VAL A  1 438 ? 186.002 94.553  64.009  1.00 57.33  ? 630  VAL A CG1  1 
ATOM   6203  C  CG2  . VAL A  1 438 ? 185.754 92.777  62.265  1.00 56.75  ? 630  VAL A CG2  1 
ATOM   6204  H  H    . VAL A  1 438 ? 187.298 90.825  64.219  1.00 65.48  ? 630  VAL A H    1 
ATOM   6205  H  HA   . VAL A  1 438 ? 188.203 93.114  63.103  1.00 67.92  ? 630  VAL A HA   1 
ATOM   6206  H  HB   . VAL A  1 438 ? 185.701 92.546  64.297  1.00 69.22  ? 630  VAL A HB   1 
ATOM   6207  H  HG11 . VAL A  1 438 ? 185.060 94.758  63.905  1.00 68.55  ? 630  VAL A HG11 1 
ATOM   6208  H  HG12 . VAL A  1 438 ? 186.279 94.718  64.924  1.00 68.55  ? 630  VAL A HG12 1 
ATOM   6209  H  HG13 . VAL A  1 438 ? 186.528 95.095  63.400  1.00 68.55  ? 630  VAL A HG13 1 
ATOM   6210  H  HG21 . VAL A  1 438 ? 184.817 93.017  62.188  1.00 67.86  ? 630  VAL A HG21 1 
ATOM   6211  H  HG22 . VAL A  1 438 ? 186.281 93.296  61.639  1.00 67.86  ? 630  VAL A HG22 1 
ATOM   6212  H  HG23 . VAL A  1 438 ? 185.868 91.830  62.089  1.00 67.86  ? 630  VAL A HG23 1 
ATOM   6213  N  N    . ASN A  1 439 ? 189.423 93.906  65.064  1.00 60.48  ? 631  ASN A N    1 
ATOM   6214  C  CA   . ASN A  1 439 ? 190.155 94.339  66.247  1.00 60.17  ? 631  ASN A CA   1 
ATOM   6215  C  C    . ASN A  1 439 ? 189.713 95.702  66.766  1.00 60.90  ? 631  ASN A C    1 
ATOM   6216  O  O    . ASN A  1 439 ? 189.772 95.941  67.978  1.00 59.07  ? 631  ASN A O    1 
ATOM   6217  C  CB   . ASN A  1 439 ? 191.654 94.389  65.940  1.00 66.92  ? 631  ASN A CB   1 
ATOM   6218  C  CG   . ASN A  1 439 ? 192.242 93.018  65.665  1.00 67.65  ? 631  ASN A CG   1 
ATOM   6219  O  OD1  . ASN A  1 439 ? 191.660 91.994  66.025  1.00 67.87  ? 631  ASN A OD1  1 
ATOM   6220  N  ND2  . ASN A  1 439 ? 193.402 92.993  65.020  1.00 67.46  ? 631  ASN A ND2  1 
ATOM   6221  H  H    . ASN A  1 439 ? 189.792 94.141  64.323  1.00 72.33  ? 631  ASN A H    1 
ATOM   6222  H  HA   . ASN A  1 439 ? 190.017 93.692  66.956  1.00 71.96  ? 631  ASN A HA   1 
ATOM   6223  H  HB2  . ASN A  1 439 ? 191.797 94.939  65.154  1.00 80.05  ? 631  ASN A HB2  1 
ATOM   6224  H  HB3  . ASN A  1 439 ? 192.121 94.769  66.701  1.00 80.05  ? 631  ASN A HB3  1 
ATOM   6225  H  HD21 . ASN A  1 439 ? 193.777 92.241  64.839  1.00 80.71  ? 631  ASN A HD21 1 
ATOM   6226  H  HD22 . ASN A  1 439 ? 193.778 93.730  64.784  1.00 80.71  ? 631  ASN A HD22 1 
ATOM   6227  N  N    . CYS A  1 440 ? 189.277 96.601  65.883  1.00 63.14  ? 632  CYS A N    1 
ATOM   6228  C  CA   . CYS A  1 440 ? 188.933 97.964  66.261  1.00 64.90  ? 632  CYS A CA   1 
ATOM   6229  C  C    . CYS A  1 440 ? 187.616 98.374  65.618  1.00 64.63  ? 632  CYS A C    1 
ATOM   6230  O  O    . CYS A  1 440 ? 187.294 97.955  64.504  1.00 66.71  ? 632  CYS A O    1 
ATOM   6231  C  CB   . CYS A  1 440 ? 190.024 98.950  65.836  1.00 73.94  ? 632  CYS A CB   1 
ATOM   6232  S  SG   . CYS A  1 440 ? 191.706 98.407  66.183  1.00 80.52  ? 632  CYS A SG   1 
ATOM   6233  H  H    . CYS A  1 440 ? 189.172 96.439  65.045  1.00 75.52  ? 632  CYS A H    1 
ATOM   6234  H  HA   . CYS A  1 440 ? 188.832 98.015  67.225  1.00 77.63  ? 632  CYS A HA   1 
ATOM   6235  H  HB2  . CYS A  1 440 ? 189.954 99.096  64.879  1.00 88.48  ? 632  CYS A HB2  1 
ATOM   6236  H  HB3  . CYS A  1 440 ? 189.884 99.788  66.304  1.00 88.48  ? 632  CYS A HB3  1 
ATOM   6237  H  HG   . CYS A  1 440 ? 192.474 99.250  65.811  1.00 96.38  ? 632  CYS A HG   1 
ATOM   6238  N  N    . THR A  1 441 ? 186.861 99.207  66.331  1.00 67.74  ? 633  THR A N    1 
ATOM   6239  C  CA   . THR A  1 441 ? 185.590 99.723  65.828  1.00 67.53  ? 633  THR A CA   1 
ATOM   6240  C  C    . THR A  1 441 ? 185.415 101.145 66.339  1.00 69.96  ? 633  THR A C    1 
ATOM   6241  O  O    . THR A  1 441 ? 185.385 101.363 67.554  1.00 68.95  ? 633  THR A O    1 
ATOM   6242  C  CB   . THR A  1 441 ? 184.416 98.848  66.274  1.00 63.59  ? 633  THR A CB   1 
ATOM   6243  O  OG1  . THR A  1 441 ? 184.406 98.752  67.703  1.00 64.82  ? 633  THR A OG1  1 
ATOM   6244  C  CG2  . THR A  1 441 ? 184.520 97.449  65.674  1.00 62.53  ? 633  THR A CG2  1 
ATOM   6245  H  H    . THR A  1 441 ? 187.064 99.490  67.117  1.00 81.04  ? 633  THR A H    1 
ATOM   6246  H  HA   . THR A  1 441 ? 185.609 99.744  64.858  1.00 80.79  ? 633  THR A HA   1 
ATOM   6247  H  HB   . THR A  1 441 ? 183.585 99.247  65.973  1.00 76.05  ? 633  THR A HB   1 
ATOM   6248  H  HG1  . THR A  1 441 ? 184.325 99.516  68.042  1.00 77.53  ? 633  THR A HG1  1 
ATOM   6249  H  HG21 . THR A  1 441 ? 183.771 96.907  65.965  1.00 74.78  ? 633  THR A HG21 1 
ATOM   6250  H  HG22 . THR A  1 441 ? 184.513 97.503  64.705  1.00 74.78  ? 633  THR A HG22 1 
ATOM   6251  H  HG23 . THR A  1 441 ? 185.345 97.026  65.960  1.00 74.78  ? 633  THR A HG23 1 
ATOM   6252  N  N    . ARG A  1 442 ? 185.281 102.103 65.421  1.00 76.79  ? 634  ARG A N    1 
ATOM   6253  C  CA   . ARG A  1 442 ? 185.124 103.506 65.780  1.00 79.98  ? 634  ARG A CA   1 
ATOM   6254  C  C    . ARG A  1 442 ? 184.026 104.145 64.943  1.00 75.07  ? 634  ARG A C    1 
ATOM   6255  O  O    . ARG A  1 442 ? 183.869 103.830 63.760  1.00 74.52  ? 634  ARG A O    1 
ATOM   6256  C  CB   . ARG A  1 442 ? 186.414 104.306 65.565  1.00 88.28  ? 634  ARG A CB   1 
ATOM   6257  C  CG   . ARG A  1 442 ? 187.583 104.003 66.491  1.00 97.10  ? 634  ARG A CG   1 
ATOM   6258  C  CD   . ARG A  1 442 ? 187.426 104.690 67.840  1.00 106.76 ? 634  ARG A CD   1 
ATOM   6259  N  NE   . ARG A  1 442 ? 188.409 104.225 68.815  1.00 114.04 ? 634  ARG A NE   1 
ATOM   6260  C  CZ   . ARG A  1 442 ? 188.411 103.032 69.401  1.00 116.57 ? 634  ARG A CZ   1 
ATOM   6261  N  NH1  . ARG A  1 442 ? 187.472 102.138 69.125  1.00 116.69 ? 634  ARG A NH1  1 
ATOM   6262  N  NH2  . ARG A  1 442 ? 189.368 102.735 70.270  1.00 118.19 ? 634  ARG A NH2  1 
ATOM   6263  H  H    . ARG A  1 442 ? 185.278 101.960 64.573  1.00 91.89  ? 634  ARG A H    1 
ATOM   6264  H  HA   . ARG A  1 442 ? 184.875 103.573 66.715  1.00 95.73  ? 634  ARG A HA   1 
ATOM   6265  H  HB2  . ARG A  1 442 ? 186.720 104.146 64.659  1.00 105.69 ? 634  ARG A HB2  1 
ATOM   6266  H  HB3  . ARG A  1 442 ? 186.205 105.248 65.669  1.00 105.69 ? 634  ARG A HB3  1 
ATOM   6267  H  HG2  . ARG A  1 442 ? 187.631 103.046 66.642  1.00 116.27 ? 634  ARG A HG2  1 
ATOM   6268  H  HG3  . ARG A  1 442 ? 188.404 104.320 66.083  1.00 116.27 ? 634  ARG A HG3  1 
ATOM   6269  H  HD2  . ARG A  1 442 ? 187.543 105.646 67.725  1.00 127.87 ? 634  ARG A HD2  1 
ATOM   6270  H  HD3  . ARG A  1 442 ? 186.541 104.502 68.191  1.00 127.87 ? 634  ARG A HD3  1 
ATOM   6271  H  HE   . ARG A  1 442 ? 189.040 104.770 69.029  1.00 136.60 ? 634  ARG A HE   1 
ATOM   6272  H  HH11 . ARG A  1 442 ? 186.851 102.326 68.562  1.00 139.78 ? 634  ARG A HH11 1 
ATOM   6273  H  HH12 . ARG A  1 442 ? 187.484 101.369 69.511  1.00 139.78 ? 634  ARG A HH12 1 
ATOM   6274  H  HH21 . ARG A  1 442 ? 189.979 103.313 70.451  1.00 141.58 ? 634  ARG A HH21 1 
ATOM   6275  H  HH22 . ARG A  1 442 ? 189.377 101.966 70.654  1.00 141.58 ? 634  ARG A HH22 1 
ATOM   6276  N  N    . PHE A  1 443 ? 183.282 105.057 65.565  1.00 70.22  ? 635  PHE A N    1 
ATOM   6277  C  CA   . PHE A  1 443 ? 182.293 105.856 64.856  1.00 66.01  ? 635  PHE A CA   1 
ATOM   6278  C  C    . PHE A  1 443 ? 182.947 107.069 64.208  1.00 63.75  ? 635  PHE A C    1 
ATOM   6279  O  O    . PHE A  1 443 ? 183.880 107.662 64.759  1.00 59.69  ? 635  PHE A O    1 
ATOM   6280  C  CB   . PHE A  1 443 ? 181.200 106.339 65.811  1.00 67.02  ? 635  PHE A CB   1 
ATOM   6281  C  CG   . PHE A  1 443 ? 180.106 105.342 66.055  1.00 69.76  ? 635  PHE A CG   1 
ATOM   6282  C  CD1  . PHE A  1 443 ? 179.027 105.253 65.190  1.00 69.79  ? 635  PHE A CD1  1 
ATOM   6283  C  CD2  . PHE A  1 443 ? 180.136 104.519 67.168  1.00 67.20  ? 635  PHE A CD2  1 
ATOM   6284  C  CE1  . PHE A  1 443 ? 178.010 104.345 65.420  1.00 66.00  ? 635  PHE A CE1  1 
ATOM   6285  C  CE2  . PHE A  1 443 ? 179.122 103.613 67.403  1.00 66.21  ? 635  PHE A CE2  1 
ATOM   6286  C  CZ   . PHE A  1 443 ? 178.058 103.526 66.528  1.00 65.19  ? 635  PHE A CZ   1 
ATOM   6287  H  H    . PHE A  1 443 ? 183.333 105.231 66.406  1.00 84.01  ? 635  PHE A H    1 
ATOM   6288  H  HA   . PHE A  1 443 ? 181.881 105.320 64.161  1.00 78.97  ? 635  PHE A HA   1 
ATOM   6289  H  HB2  . PHE A  1 443 ? 181.605 106.548 66.667  1.00 80.18  ? 635  PHE A HB2  1 
ATOM   6290  H  HB3  . PHE A  1 443 ? 180.794 107.138 65.439  1.00 80.18  ? 635  PHE A HB3  1 
ATOM   6291  H  HD1  . PHE A  1 443 ? 178.991 105.803 64.441  1.00 83.50  ? 635  PHE A HD1  1 
ATOM   6292  H  HD2  . PHE A  1 443 ? 180.851 104.574 67.760  1.00 80.40  ? 635  PHE A HD2  1 
ATOM   6293  H  HE1  . PHE A  1 443 ? 177.294 104.289 64.829  1.00 78.95  ? 635  PHE A HE1  1 
ATOM   6294  H  HE2  . PHE A  1 443 ? 179.156 103.060 68.150  1.00 79.20  ? 635  PHE A HE2  1 
ATOM   6295  H  HZ   . PHE A  1 443 ? 177.376 102.914 66.685  1.00 77.98  ? 635  PHE A HZ   1 
ATOM   6296  N  N    . HIS A  1 444 ? 182.451 107.435 63.031  1.00 64.30  ? 636  HIS A N    1 
ATOM   6297  C  CA   . HIS A  1 444 ? 182.768 108.733 62.462  1.00 65.32  ? 636  HIS A CA   1 
ATOM   6298  C  C    . HIS A  1 444 ? 182.081 109.819 63.294  1.00 66.59  ? 636  HIS A C    1 
ATOM   6299  O  O    . HIS A  1 444 ? 181.016 109.582 63.870  1.00 64.55  ? 636  HIS A O    1 
ATOM   6300  C  CB   . HIS A  1 444 ? 182.305 108.791 61.005  1.00 66.51  ? 636  HIS A CB   1 
ATOM   6301  C  CG   . HIS A  1 444 ? 182.650 110.065 60.297  1.00 62.67  ? 636  HIS A CG   1 
ATOM   6302  N  ND1  . HIS A  1 444 ? 181.914 111.221 60.439  1.00 67.36  ? 636  HIS A ND1  1 
ATOM   6303  C  CD2  . HIS A  1 444 ? 183.642 110.358 59.422  1.00 62.67  ? 636  HIS A CD2  1 
ATOM   6304  C  CE1  . HIS A  1 444 ? 182.444 112.175 59.695  1.00 69.00  ? 636  HIS A CE1  1 
ATOM   6305  N  NE2  . HIS A  1 444 ? 183.493 111.677 59.066  1.00 69.33  ? 636  HIS A NE2  1 
ATOM   6306  H  H    . HIS A  1 444 ? 181.931 106.952 62.546  1.00 76.91  ? 636  HIS A H    1 
ATOM   6307  H  HA   . HIS A  1 444 ? 183.727 108.878 62.490  1.00 78.13  ? 636  HIS A HA   1 
ATOM   6308  H  HB2  . HIS A  1 444 ? 182.719 108.062 60.518  1.00 79.57  ? 636  HIS A HB2  1 
ATOM   6309  H  HB3  . HIS A  1 444 ? 181.340 108.694 60.982  1.00 79.57  ? 636  HIS A HB3  1 
ATOM   6310  H  HD2  . HIS A  1 444 ? 184.304 109.777 59.124  1.00 74.95  ? 636  HIS A HD2  1 
ATOM   6311  H  HE1  . HIS A  1 444 ? 182.130 113.047 59.623  1.00 82.55  ? 636  HIS A HE1  1 
ATOM   6312  H  HE2  . HIS A  1 444 ? 184.001 112.108 58.523  1.00 82.95  ? 636  HIS A HE2  1 
ATOM   6313  N  N    . PRO A  1 445 ? 182.674 111.013 63.395  1.00 68.31  ? 637  PRO A N    1 
ATOM   6314  C  CA   . PRO A  1 445 ? 182.064 112.055 64.241  1.00 68.02  ? 637  PRO A CA   1 
ATOM   6315  C  C    . PRO A  1 445 ? 180.579 112.288 63.999  1.00 73.28  ? 637  PRO A C    1 
ATOM   6316  O  O    . PRO A  1 445 ? 179.860 112.628 64.948  1.00 75.49  ? 637  PRO A O    1 
ATOM   6317  C  CB   . PRO A  1 445 ? 182.896 113.295 63.896  1.00 68.36  ? 637  PRO A CB   1 
ATOM   6318  C  CG   . PRO A  1 445 ? 184.243 112.748 63.607  1.00 71.09  ? 637  PRO A CG   1 
ATOM   6319  C  CD   . PRO A  1 445 ? 184.026 111.404 62.950  1.00 68.96  ? 637  PRO A CD   1 
ATOM   6320  H  HA   . PRO A  1 445 ? 182.198 111.838 65.177  1.00 81.38  ? 637  PRO A HA   1 
ATOM   6321  H  HB2  . PRO A  1 445 ? 182.526 113.735 63.115  1.00 81.78  ? 637  PRO A HB2  1 
ATOM   6322  H  HB3  . PRO A  1 445 ? 182.922 113.897 64.655  1.00 81.78  ? 637  PRO A HB3  1 
ATOM   6323  H  HG2  . PRO A  1 445 ? 184.713 113.347 63.007  1.00 85.06  ? 637  PRO A HG2  1 
ATOM   6324  H  HG3  . PRO A  1 445 ? 184.734 112.644 64.437  1.00 85.06  ? 637  PRO A HG3  1 
ATOM   6325  H  HD2  . PRO A  1 445 ? 184.051 111.493 61.984  1.00 82.51  ? 637  PRO A HD2  1 
ATOM   6326  H  HD3  . PRO A  1 445 ? 184.683 110.765 63.265  1.00 82.51  ? 637  PRO A HD3  1 
ATOM   6327  N  N    . ASN A  1 446 ? 180.091 112.126 62.770  1.00 73.23  ? 638  ASN A N    1 
ATOM   6328  C  CA   . ASN A  1 446 ? 178.679 112.348 62.478  1.00 77.00  ? 638  ASN A CA   1 
ATOM   6329  C  C    . ASN A  1 446 ? 177.811 111.120 62.733  1.00 72.47  ? 638  ASN A C    1 
ATOM   6330  O  O    . ASN A  1 446 ? 176.595 111.187 62.527  1.00 71.60  ? 638  ASN A O    1 
ATOM   6331  C  CB   . ASN A  1 446 ? 178.505 112.821 61.026  1.00 82.12  ? 638  ASN A CB   1 
ATOM   6332  C  CG   . ASN A  1 446 ? 178.881 111.760 60.003  1.00 81.32  ? 638  ASN A CG   1 
ATOM   6333  O  OD1  . ASN A  1 446 ? 178.919 110.567 60.300  1.00 79.90  ? 638  ASN A OD1  1 
ATOM   6334  N  ND2  . ASN A  1 446 ? 179.153 112.199 58.780  1.00 82.99  ? 638  ASN A ND2  1 
ATOM   6335  H  H    . ASN A  1 446 ? 180.557 111.887 62.089  1.00 87.62  ? 638  ASN A H    1 
ATOM   6336  H  HA   . ASN A  1 446 ? 178.355 113.057 63.056  1.00 92.16  ? 638  ASN A HA   1 
ATOM   6337  H  HB2  . ASN A  1 446 ? 177.576 113.059 60.882  1.00 98.30  ? 638  ASN A HB2  1 
ATOM   6338  H  HB3  . ASN A  1 446 ? 179.072 113.594 60.877  1.00 98.30  ? 638  ASN A HB3  1 
ATOM   6339  H  HD21 . ASN A  1 446 ? 179.370 111.642 58.162  1.00 99.35  ? 638  ASN A HD21 1 
ATOM   6340  H  HD22 . ASN A  1 446 ? 179.115 113.040 58.606  1.00 99.35  ? 638  ASN A HD22 1 
ATOM   6341  N  N    . SER A  1 447 ? 178.400 110.004 63.161  1.00 74.95  ? 639  SER A N    1 
ATOM   6342  C  CA   . SER A  1 447 ? 177.686 108.801 63.583  1.00 72.43  ? 639  SER A CA   1 
ATOM   6343  C  C    . SER A  1 447 ? 176.949 108.103 62.445  1.00 70.07  ? 639  SER A C    1 
ATOM   6344  O  O    . SER A  1 447 ? 176.221 107.135 62.696  1.00 72.12  ? 639  SER A O    1 
ATOM   6345  C  CB   . SER A  1 447 ? 176.691 109.112 64.707  1.00 71.59  ? 639  SER A CB   1 
ATOM   6346  O  OG   . SER A  1 447 ? 176.201 107.925 65.305  1.00 70.86  ? 639  SER A OG   1 
ATOM   6347  H  H    . SER A  1 447 ? 179.254 109.918 63.218  1.00 89.69  ? 639  SER A H    1 
ATOM   6348  H  HA   . SER A  1 447 ? 178.333 108.171 63.936  1.00 86.67  ? 639  SER A HA   1 
ATOM   6349  H  HB2  . SER A  1 447 ? 177.138 109.644 65.384  1.00 85.66  ? 639  SER A HB2  1 
ATOM   6350  H  HB3  . SER A  1 447 ? 175.944 109.609 64.338  1.00 85.66  ? 639  SER A HB3  1 
ATOM   6351  H  HG   . SER A  1 447 ? 175.810 107.454 64.730  1.00 84.78  ? 639  SER A HG   1 
ATOM   6352  N  N    . ASN A  1 448 ? 177.118 108.551 61.201  1.00 70.24  ? 640  ASN A N    1 
ATOM   6353  C  CA   . ASN A  1 448 ? 176.521 107.876 60.056  1.00 67.68  ? 640  ASN A CA   1 
ATOM   6354  C  C    . ASN A  1 448 ? 177.418 106.795 59.473  1.00 66.75  ? 640  ASN A C    1 
ATOM   6355  O  O    . ASN A  1 448 ? 176.970 106.045 58.599  1.00 65.15  ? 640  ASN A O    1 
ATOM   6356  C  CB   . ASN A  1 448 ? 176.190 108.888 58.950  1.00 70.49  ? 640  ASN A CB   1 
ATOM   6357  C  CG   . ASN A  1 448 ? 174.867 109.590 59.172  1.00 73.11  ? 640  ASN A CG   1 
ATOM   6358  O  OD1  . ASN A  1 448 ? 173.907 109.382 58.427  1.00 72.68  ? 640  ASN A OD1  1 
ATOM   6359  N  ND2  . ASN A  1 448 ? 174.809 110.432 60.197  1.00 71.61  ? 640  ASN A ND2  1 
ATOM   6360  H  H    . ASN A  1 448 ? 177.578 109.248 60.996  1.00 84.04  ? 640  ASN A H    1 
ATOM   6361  H  HA   . ASN A  1 448 ? 175.692 107.458 60.336  1.00 80.97  ? 640  ASN A HA   1 
ATOM   6362  H  HB2  . ASN A  1 448 ? 176.886 109.563 58.921  1.00 84.34  ? 640  ASN A HB2  1 
ATOM   6363  H  HB3  . ASN A  1 448 ? 176.143 108.422 58.100  1.00 84.34  ? 640  ASN A HB3  1 
ATOM   6364  H  HD21 . ASN A  1 448 ? 174.080 110.856 60.365  1.00 85.69  ? 640  ASN A HD21 1 
ATOM   6365  H  HD22 . ASN A  1 448 ? 175.501 110.552 60.694  1.00 85.69  ? 640  ASN A HD22 1 
ATOM   6366  N  N    . TYR A  1 449 ? 178.666 106.696 59.929  1.00 65.41  ? 641  TYR A N    1 
ATOM   6367  C  CA   . TYR A  1 449 ? 179.616 105.741 59.382  1.00 64.86  ? 641  TYR A CA   1 
ATOM   6368  C  C    . TYR A  1 449 ? 180.432 105.127 60.509  1.00 62.94  ? 641  TYR A C    1 
ATOM   6369  O  O    . TYR A  1 449 ? 180.682 105.763 61.536  1.00 63.78  ? 641  TYR A O    1 
ATOM   6370  C  CB   . TYR A  1 449 ? 180.543 106.411 58.357  1.00 64.16  ? 641  TYR A CB   1 
ATOM   6371  C  CG   . TYR A  1 449 ? 179.812 106.881 57.122  1.00 65.92  ? 641  TYR A CG   1 
ATOM   6372  C  CD1  . TYR A  1 449 ? 179.649 106.040 56.031  1.00 63.24  ? 641  TYR A CD1  1 
ATOM   6373  C  CD2  . TYR A  1 449 ? 179.264 108.155 57.056  1.00 68.01  ? 641  TYR A CD2  1 
ATOM   6374  C  CE1  . TYR A  1 449 ? 178.974 106.458 54.902  1.00 65.27  ? 641  TYR A CE1  1 
ATOM   6375  C  CE2  . TYR A  1 449 ? 178.586 108.584 55.929  1.00 65.71  ? 641  TYR A CE2  1 
ATOM   6376  C  CZ   . TYR A  1 449 ? 178.442 107.728 54.855  1.00 66.64  ? 641  TYR A CZ   1 
ATOM   6377  O  OH   . TYR A  1 449 ? 177.771 108.138 53.726  1.00 68.49  ? 641  TYR A OH   1 
ATOM   6378  H  H    . TYR A  1 449 ? 178.986 107.179 60.565  1.00 78.24  ? 641  TYR A H    1 
ATOM   6379  H  HA   . TYR A  1 449 ? 179.133 105.029 58.935  1.00 77.58  ? 641  TYR A HA   1 
ATOM   6380  H  HB2  . TYR A  1 449 ? 180.963 107.182 58.768  1.00 76.75  ? 641  TYR A HB2  1 
ATOM   6381  H  HB3  . TYR A  1 449 ? 181.219 105.773 58.079  1.00 76.75  ? 641  TYR A HB3  1 
ATOM   6382  H  HD1  . TYR A  1 449 ? 180.005 105.182 56.058  1.00 75.64  ? 641  TYR A HD1  1 
ATOM   6383  H  HD2  . TYR A  1 449 ? 179.360 108.732 57.780  1.00 81.37  ? 641  TYR A HD2  1 
ATOM   6384  H  HE1  . TYR A  1 449 ? 178.876 105.883 54.177  1.00 78.08  ? 641  TYR A HE1  1 
ATOM   6385  H  HE2  . TYR A  1 449 ? 178.227 109.441 55.896  1.00 78.60  ? 641  TYR A HE2  1 
ATOM   6386  H  HH   . TYR A  1 449 ? 177.498 108.926 53.824  1.00 81.94  ? 641  TYR A HH   1 
ATOM   6387  N  N    . VAL A  1 450 ? 180.844 103.880 60.299  1.00 63.43  ? 642  VAL A N    1 
ATOM   6388  C  CA   . VAL A  1 450 ? 181.653 103.135 61.254  1.00 63.63  ? 642  VAL A CA   1 
ATOM   6389  C  C    . VAL A  1 450 ? 182.877 102.595 60.533  1.00 69.05  ? 642  VAL A C    1 
ATOM   6390  O  O    . VAL A  1 450 ? 182.776 102.092 59.409  1.00 75.40  ? 642  VAL A O    1 
ATOM   6391  C  CB   . VAL A  1 450 ? 180.853 101.987 61.907  1.00 64.95  ? 642  VAL A CB   1 
ATOM   6392  C  CG1  . VAL A  1 450 ? 181.791 100.943 62.515  1.00 67.30  ? 642  VAL A CG1  1 
ATOM   6393  C  CG2  . VAL A  1 450 ? 179.920 102.538 62.969  1.00 69.22  ? 642  VAL A CG2  1 
ATOM   6394  H  H    . VAL A  1 450 ? 180.661 103.433 59.588  1.00 75.87  ? 642  VAL A H    1 
ATOM   6395  H  HA   . VAL A  1 450 ? 181.953 103.734 61.956  1.00 76.10  ? 642  VAL A HA   1 
ATOM   6396  H  HB   . VAL A  1 450 ? 180.314 101.550 61.229  1.00 77.70  ? 642  VAL A HB   1 
ATOM   6397  H  HG11 . VAL A  1 450 ? 181.260 100.237 62.916  1.00 80.52  ? 642  VAL A HG11 1 
ATOM   6398  H  HG12 . VAL A  1 450 ? 182.353 100.577 61.814  1.00 80.52  ? 642  VAL A HG12 1 
ATOM   6399  H  HG13 . VAL A  1 450 ? 182.340 101.369 63.192  1.00 80.52  ? 642  VAL A HG13 1 
ATOM   6400  H  HG21 . VAL A  1 450 ? 179.427 101.804 63.367  1.00 82.81  ? 642  VAL A HG21 1 
ATOM   6401  H  HG22 . VAL A  1 450 ? 180.447 102.990 63.647  1.00 82.81  ? 642  VAL A HG22 1 
ATOM   6402  H  HG23 . VAL A  1 450 ? 179.306 103.164 62.555  1.00 82.81  ? 642  VAL A HG23 1 
ATOM   6403  N  N    . ALA A  1 451 ? 184.030 102.694 61.183  1.00 65.51  ? 643  ALA A N    1 
ATOM   6404  C  CA   . ALA A  1 451 ? 185.276 102.169 60.651  1.00 66.81  ? 643  ALA A CA   1 
ATOM   6405  C  C    . ALA A  1 451 ? 185.719 100.967 61.473  1.00 65.23  ? 643  ALA A C    1 
ATOM   6406  O  O    . ALA A  1 451 ? 185.560 100.950 62.698  1.00 69.06  ? 643  ALA A O    1 
ATOM   6407  C  CB   . ALA A  1 451 ? 186.366 103.241 60.652  1.00 65.08  ? 643  ALA A CB   1 
ATOM   6408  H  H    . ALA A  1 451 ? 184.116 103.071 61.952  1.00 78.36  ? 643  ALA A H    1 
ATOM   6409  H  HA   . ALA A  1 451 ? 185.136 101.877 59.736  1.00 79.92  ? 643  ALA A HA   1 
ATOM   6410  H  HB1  . ALA A  1 451 ? 187.183 102.861 60.292  1.00 77.85  ? 643  ALA A HB1  1 
ATOM   6411  H  HB2  . ALA A  1 451 ? 186.077 103.986 60.101  1.00 77.85  ? 643  ALA A HB2  1 
ATOM   6412  H  HB3  . ALA A  1 451 ? 186.514 103.540 61.563  1.00 77.85  ? 643  ALA A HB3  1 
ATOM   6413  N  N    . THR A  1 452 ? 186.268 99.962  60.794  1.00 60.83  ? 644  THR A N    1 
ATOM   6414  C  CA   . THR A  1 452 ? 186.757 98.751  61.437  1.00 62.71  ? 644  THR A CA   1 
ATOM   6415  C  C    . THR A  1 452 ? 188.197 98.487  61.020  1.00 63.08  ? 644  THR A C    1 
ATOM   6416  O  O    . THR A  1 452 ? 188.578 98.744  59.874  1.00 63.08  ? 644  THR A O    1 
ATOM   6417  C  CB   . THR A  1 452 ? 185.896 97.527  61.079  1.00 64.34  ? 644  THR A CB   1 
ATOM   6418  O  OG1  . THR A  1 452 ? 185.905 97.326  59.660  1.00 62.03  ? 644  THR A OG1  1 
ATOM   6419  C  CG2  . THR A  1 452 ? 184.463 97.713  61.554  1.00 63.60  ? 644  THR A CG2  1 
ATOM   6420  H  H    . THR A  1 452 ? 186.370 99.961  59.940  1.00 72.75  ? 644  THR A H    1 
ATOM   6421  H  HA   . THR A  1 452 ? 186.735 98.867  62.400  1.00 75.01  ? 644  THR A HA   1 
ATOM   6422  H  HB   . THR A  1 452 ? 186.260 96.741  61.515  1.00 76.96  ? 644  THR A HB   1 
ATOM   6423  H  HG1  . THR A  1 452 ? 185.435 96.659  59.461  1.00 74.19  ? 644  THR A HG1  1 
ATOM   6424  H  HG21 . THR A  1 452 ? 183.933 96.935  61.321  1.00 76.08  ? 644  THR A HG21 1 
ATOM   6425  H  HG22 . THR A  1 452 ? 184.446 97.830  62.516  1.00 76.08  ? 644  THR A HG22 1 
ATOM   6426  H  HG23 . THR A  1 452 ? 184.074 98.497  61.134  1.00 76.08  ? 644  THR A HG23 1 
ATOM   6427  N  N    . GLY A  1 453 ? 188.992 97.981  61.961  1.00 63.70  ? 645  GLY A N    1 
ATOM   6428  C  CA   . GLY A  1 453 ? 190.325 97.496  61.662  1.00 61.26  ? 645  GLY A CA   1 
ATOM   6429  C  C    . GLY A  1 453 ? 190.414 96.012  61.956  1.00 64.31  ? 645  GLY A C    1 
ATOM   6430  O  O    . GLY A  1 453 ? 189.954 95.562  63.009  1.00 66.00  ? 645  GLY A O    1 
ATOM   6431  H  H    . GLY A  1 453 ? 188.773 97.909  62.790  1.00 76.19  ? 645  GLY A H    1 
ATOM   6432  H  HA2  . GLY A  1 453 ? 190.530 97.644  60.726  1.00 73.27  ? 645  GLY A HA2  1 
ATOM   6433  H  HA3  . GLY A  1 453 ? 190.978 97.964  62.206  1.00 73.27  ? 645  GLY A HA3  1 
ATOM   6434  N  N    . SER A  1 454 ? 191.007 95.240  61.048  1.00 59.49  ? 646  SER A N    1 
ATOM   6435  C  CA   . SER A  1 454 ? 190.906 93.789  61.096  1.00 61.99  ? 646  SER A CA   1 
ATOM   6436  C  C    . SER A  1 454 ? 192.281 93.138  61.043  1.00 62.83  ? 646  SER A C    1 
ATOM   6437  O  O    . SER A  1 454 ? 193.260 93.725  60.574  1.00 66.33  ? 646  SER A O    1 
ATOM   6438  C  CB   . SER A  1 454 ? 190.045 93.263  59.941  1.00 62.78  ? 646  SER A CB   1 
ATOM   6439  O  OG   . SER A  1 454 ? 190.150 91.855  59.822  1.00 63.14  ? 646  SER A OG   1 
ATOM   6440  H  H    . SER A  1 454 ? 191.475 95.536  60.390  1.00 71.14  ? 646  SER A H    1 
ATOM   6441  H  HA   . SER A  1 454 ? 190.483 93.529  61.929  1.00 74.13  ? 646  SER A HA   1 
ATOM   6442  H  HB2  . SER A  1 454 ? 189.119 93.497  60.107  1.00 75.08  ? 646  SER A HB2  1 
ATOM   6443  H  HB3  . SER A  1 454 ? 190.346 93.671  59.114  1.00 75.08  ? 646  SER A HB3  1 
ATOM   6444  H  HG   . SER A  1 454 ? 189.892 91.487  60.532  1.00 75.52  ? 646  SER A HG   1 
ATOM   6445  N  N    . ALA A  1 455 ? 192.328 91.892  61.519  1.00 61.56  ? 647  ALA A N    1 
ATOM   6446  C  CA   . ALA A  1 455 ? 193.520 91.064  61.404  1.00 63.45  ? 647  ALA A CA   1 
ATOM   6447  C  C    . ALA A  1 455 ? 193.818 90.666  59.966  1.00 67.42  ? 647  ALA A C    1 
ATOM   6448  O  O    . ALA A  1 455 ? 194.906 90.143  59.701  1.00 73.15  ? 647  ALA A O    1 
ATOM   6449  C  CB   . ALA A  1 455 ? 193.370 89.809  62.267  1.00 64.61  ? 647  ALA A CB   1 
ATOM   6450  H  H    . ALA A  1 455 ? 191.673 91.503  61.917  1.00 73.62  ? 647  ALA A H    1 
ATOM   6451  H  HA   . ALA A  1 455 ? 194.281 91.564  61.736  1.00 75.89  ? 647  ALA A HA   1 
ATOM   6452  H  HB1  . ALA A  1 455 ? 194.171 89.269  62.180  1.00 77.28  ? 647  ALA A HB1  1 
ATOM   6453  H  HB2  . ALA A  1 455 ? 193.250 90.076  63.192  1.00 77.28  ? 647  ALA A HB2  1 
ATOM   6454  H  HB3  . ALA A  1 455 ? 192.597 89.308  61.964  1.00 77.28  ? 647  ALA A HB3  1 
ATOM   6455  N  N    . ASP A  1 456 ? 192.883 90.877  59.042  1.00 63.01  ? 648  ASP A N    1 
ATOM   6456  C  CA   . ASP A  1 456 ? 193.173 90.700  57.627  1.00 63.21  ? 648  ASP A CA   1 
ATOM   6457  C  C    . ASP A  1 456 ? 193.960 91.868  57.043  1.00 63.03  ? 648  ASP A C    1 
ATOM   6458  O  O    . ASP A  1 456 ? 194.213 91.878  55.834  1.00 60.59  ? 648  ASP A O    1 
ATOM   6459  C  CB   . ASP A  1 456 ? 191.870 90.489  56.842  1.00 65.60  ? 648  ASP A CB   1 
ATOM   6460  C  CG   . ASP A  1 456 ? 190.964 91.712  56.845  1.00 68.14  ? 648  ASP A CG   1 
ATOM   6461  O  OD1  . ASP A  1 456 ? 191.428 92.818  57.197  1.00 70.61  ? 648  ASP A OD1  1 
ATOM   6462  O  OD2  . ASP A  1 456 ? 189.774 91.560  56.493  1.00 65.83  ? 648  ASP A OD2  1 
ATOM   6463  H  H    . ASP A  1 456 ? 192.076 91.123  59.211  1.00 75.36  ? 648  ASP A H    1 
ATOM   6464  H  HA   . ASP A  1 456 ? 193.712 89.902  57.520  1.00 75.61  ? 648  ASP A HA   1 
ATOM   6465  H  HB2  . ASP A  1 456 ? 192.089 90.281  55.920  1.00 78.47  ? 648  ASP A HB2  1 
ATOM   6466  H  HB3  . ASP A  1 456 ? 191.379 89.753  57.239  1.00 78.47  ? 648  ASP A HB3  1 
ATOM   6467  N  N    . ARG A  1 457 ? 194.341 92.846  57.870  1.00 62.67  ? 649  ARG A N    1 
ATOM   6468  C  CA   . ARG A  1 457 ? 195.224 93.949  57.497  1.00 66.87  ? 649  ARG A CA   1 
ATOM   6469  C  C    . ARG A  1 457 ? 194.533 95.009  56.655  1.00 66.12  ? 649  ARG A C    1 
ATOM   6470  O  O    . ARG A  1 457 ? 195.207 95.844  56.042  1.00 67.70  ? 649  ARG A O    1 
ATOM   6471  C  CB   . ARG A  1 457 ? 196.461 93.426  56.765  1.00 64.31  ? 649  ARG A CB   1 
ATOM   6472  C  CG   . ARG A  1 457 ? 197.121 92.323  57.546  1.00 67.68  ? 649  ARG A CG   1 
ATOM   6473  C  CD   . ARG A  1 457 ? 198.440 91.872  56.988  1.00 73.77  ? 649  ARG A CD   1 
ATOM   6474  N  NE   . ARG A  1 457 ? 198.398 90.416  56.975  1.00 80.00  ? 649  ARG A NE   1 
ATOM   6475  C  CZ   . ARG A  1 457 ? 198.438 89.652  55.890  1.00 84.20  ? 649  ARG A CZ   1 
ATOM   6476  N  NH1  . ARG A  1 457 ? 198.563 90.172  54.676  1.00 84.89  ? 649  ARG A NH1  1 
ATOM   6477  N  NH2  . ARG A  1 457 ? 198.357 88.342  56.030  1.00 86.40  ? 649  ARG A NH2  1 
ATOM   6478  H  H    . ARG A  1 457 ? 194.086 92.891  58.690  1.00 74.96  ? 649  ARG A H    1 
ATOM   6479  H  HA   . ARG A  1 457 ? 195.531 94.381  58.310  1.00 80.00  ? 649  ARG A HA   1 
ATOM   6480  H  HB2  . ARG A  1 457 ? 196.199 93.074  55.900  1.00 76.93  ? 649  ARG A HB2  1 
ATOM   6481  H  HB3  . ARG A  1 457 ? 197.100 94.148  56.656  1.00 76.93  ? 649  ARG A HB3  1 
ATOM   6482  H  HG2  . ARG A  1 457 ? 197.275 92.633  58.452  1.00 80.97  ? 649  ARG A HG2  1 
ATOM   6483  H  HG3  . ARG A  1 457 ? 196.529 91.555  57.559  1.00 80.97  ? 649  ARG A HG3  1 
ATOM   6484  H  HD2  . ARG A  1 457 ? 198.551 92.198  56.082  1.00 88.28  ? 649  ARG A HD2  1 
ATOM   6485  H  HD3  . ARG A  1 457 ? 199.166 92.166  57.561  1.00 88.28  ? 649  ARG A HD3  1 
ATOM   6486  H  HE   . ARG A  1 457 ? 198.343 90.017  57.735  1.00 95.75  ? 649  ARG A HE   1 
ATOM   6487  H  HH11 . ARG A  1 457 ? 198.608 91.025  54.576  1.00 101.61 ? 649  ARG A HH11 1 
ATOM   6488  H  HH12 . ARG A  1 457 ? 198.593 89.656  53.988  1.00 101.61 ? 649  ARG A HH12 1 
ATOM   6489  H  HH21 . ARG A  1 457 ? 198.284 87.996  56.814  1.00 103.43 ? 649  ARG A HH21 1 
ATOM   6490  H  HH22 . ARG A  1 457 ? 198.397 87.832  55.338  1.00 103.43 ? 649  ARG A HH22 1 
ATOM   6491  N  N    . THR A  1 458 ? 193.206 95.010  56.615  1.00 65.08  ? 650  THR A N    1 
ATOM   6492  C  CA   . THR A  1 458 ? 192.453 96.045  55.930  1.00 62.63  ? 650  THR A CA   1 
ATOM   6493  C  C    . THR A  1 458 ? 191.703 96.898  56.943  1.00 59.50  ? 650  THR A C    1 
ATOM   6494  O  O    . THR A  1 458 ? 191.452 96.489  58.080  1.00 57.19  ? 650  THR A O    1 
ATOM   6495  C  CB   . THR A  1 458 ? 191.455 95.452  54.928  1.00 65.42  ? 650  THR A CB   1 
ATOM   6496  O  OG1  . THR A  1 458 ? 190.371 94.829  55.630  1.00 62.10  ? 650  THR A OG1  1 
ATOM   6497  C  CG2  . THR A  1 458 ? 192.134 94.433  54.027  1.00 66.02  ? 650  THR A CG2  1 
ATOM   6498  H  H    . THR A  1 458 ? 192.713 94.409  56.983  1.00 77.84  ? 650  THR A H    1 
ATOM   6499  H  HA   . THR A  1 458 ? 193.066 96.619  55.445  1.00 74.90  ? 650  THR A HA   1 
ATOM   6500  H  HB   . THR A  1 458 ? 191.105 96.163  54.369  1.00 78.26  ? 650  THR A HB   1 
ATOM   6501  H  HG1  . THR A  1 458 ? 190.664 94.214  56.122  1.00 74.28  ? 650  THR A HG1  1 
ATOM   6502  H  HG21 . THR A  1 458 ? 191.492 94.067  53.398  1.00 78.98  ? 650  THR A HG21 1 
ATOM   6503  H  HG22 . THR A  1 458 ? 192.853 94.856  53.532  1.00 78.98  ? 650  THR A HG22 1 
ATOM   6504  H  HG23 . THR A  1 458 ? 192.500 93.711  54.560  1.00 78.98  ? 650  THR A HG23 1 
ATOM   6505  N  N    . VAL A  1 459 ? 191.355 98.101  56.505  1.00 63.83  ? 651  VAL A N    1 
ATOM   6506  C  CA   . VAL A  1 459 ? 190.488 99.007  57.246  1.00 63.21  ? 651  VAL A CA   1 
ATOM   6507  C  C    . VAL A  1 459 ? 189.285 99.288  56.362  1.00 65.42  ? 651  VAL A C    1 
ATOM   6508  O  O    . VAL A  1 459 ? 189.443 99.586  55.172  1.00 67.97  ? 651  VAL A O    1 
ATOM   6509  C  CB   . VAL A  1 459 ? 191.218 100.308 57.626  1.00 60.17  ? 651  VAL A CB   1 
ATOM   6510  C  CG1  . VAL A  1 459 ? 190.268 101.280 58.314  1.00 58.28  ? 651  VAL A CG1  1 
ATOM   6511  C  CG2  . VAL A  1 459 ? 192.412 99.995  58.514  1.00 59.38  ? 651  VAL A CG2  1 
ATOM   6512  H  H    . VAL A  1 459 ? 191.619 98.426  55.754  1.00 76.35  ? 651  VAL A H    1 
ATOM   6513  H  HA   . VAL A  1 459 ? 190.182 98.574  58.058  1.00 75.60  ? 651  VAL A HA   1 
ATOM   6514  H  HB   . VAL A  1 459 ? 191.548 100.733 56.819  1.00 71.96  ? 651  VAL A HB   1 
ATOM   6515  H  HG11 . VAL A  1 459 ? 190.753 102.088 58.541  1.00 69.69  ? 651  VAL A HG11 1 
ATOM   6516  H  HG12 . VAL A  1 459 ? 189.539 101.490 57.709  1.00 69.69  ? 651  VAL A HG12 1 
ATOM   6517  H  HG13 . VAL A  1 459 ? 189.921 100.865 59.119  1.00 69.69  ? 651  VAL A HG13 1 
ATOM   6518  H  HG21 . VAL A  1 459 ? 192.860 100.824 58.744  1.00 71.01  ? 651  VAL A HG21 1 
ATOM   6519  H  HG22 . VAL A  1 459 ? 192.099 99.554  59.319  1.00 71.01  ? 651  VAL A HG22 1 
ATOM   6520  H  HG23 . VAL A  1 459 ? 193.020 99.413  58.032  1.00 71.01  ? 651  VAL A HG23 1 
ATOM   6521  N  N    . ARG A  1 460 ? 188.090 99.167  56.927  1.00 67.85  ? 652  ARG A N    1 
ATOM   6522  C  CA   . ARG A  1 460 ? 186.870 99.359  56.161  1.00 70.68  ? 652  ARG A CA   1 
ATOM   6523  C  C    . ARG A  1 460 ? 185.994 100.406 56.825  1.00 66.40  ? 652  ARG A C    1 
ATOM   6524  O  O    . ARG A  1 460 ? 185.981 100.548 58.050  1.00 64.98  ? 652  ARG A O    1 
ATOM   6525  C  CB   . ARG A  1 460 ? 186.104 98.049  56.010  1.00 69.55  ? 652  ARG A CB   1 
ATOM   6526  C  CG   . ARG A  1 460 ? 186.949 96.991  55.362  1.00 74.50  ? 652  ARG A CG   1 
ATOM   6527  C  CD   . ARG A  1 460 ? 186.164 95.780  54.943  1.00 77.02  ? 652  ARG A CD   1 
ATOM   6528  N  NE   . ARG A  1 460 ? 187.079 94.731  54.508  1.00 82.60  ? 652  ARG A NE   1 
ATOM   6529  C  CZ   . ARG A  1 460 ? 186.767 93.752  53.668  1.00 86.01  ? 652  ARG A CZ   1 
ATOM   6530  N  NH1  . ARG A  1 460 ? 185.549 93.675  53.145  1.00 84.26  ? 652  ARG A NH1  1 
ATOM   6531  N  NH2  . ARG A  1 460 ? 187.686 92.851  53.346  1.00 88.22  ? 652  ARG A NH2  1 
ATOM   6532  H  H    . ARG A  1 460 ? 187.959 98.974  57.754  1.00 81.18  ? 652  ARG A H    1 
ATOM   6533  H  HA   . ARG A  1 460 ? 187.100 99.678  55.274  1.00 84.56  ? 652  ARG A HA   1 
ATOM   6534  H  HB2  . ARG A  1 460 ? 185.837 97.731  56.886  1.00 83.21  ? 652  ARG A HB2  1 
ATOM   6535  H  HB3  . ARG A  1 460 ? 185.323 98.197  55.454  1.00 83.21  ? 652  ARG A HB3  1 
ATOM   6536  H  HG2  . ARG A  1 460 ? 187.368 97.364  54.570  1.00 89.16  ? 652  ARG A HG2  1 
ATOM   6537  H  HG3  . ARG A  1 460 ? 187.629 96.703  55.991  1.00 89.16  ? 652  ARG A HG3  1 
ATOM   6538  H  HD2  . ARG A  1 460 ? 185.648 95.449  55.695  1.00 92.18  ? 652  ARG A HD2  1 
ATOM   6539  H  HD3  . ARG A  1 460 ? 185.581 96.009  54.202  1.00 92.18  ? 652  ARG A HD3  1 
ATOM   6540  H  HE   . ARG A  1 460 ? 187.881 94.748  54.820  1.00 98.87  ? 652  ARG A HE   1 
ATOM   6541  H  HH11 . ARG A  1 460 ? 184.954 94.259  53.353  1.00 100.86 ? 652  ARG A HH11 1 
ATOM   6542  H  HH12 . ARG A  1 460 ? 185.355 93.038  52.600  1.00 100.86 ? 652  ARG A HH12 1 
ATOM   6543  H  HH21 . ARG A  1 460 ? 188.476 92.902  53.684  1.00 105.61 ? 652  ARG A HH21 1 
ATOM   6544  H  HH22 . ARG A  1 460 ? 187.493 92.215  52.800  1.00 105.61 ? 652  ARG A HH22 1 
ATOM   6545  N  N    . LEU A  1 461 ? 185.268 101.141 55.992  1.00 59.63  ? 653  LEU A N    1 
ATOM   6546  C  CA   . LEU A  1 461 ? 184.289 102.116 56.442  1.00 58.62  ? 653  LEU A CA   1 
ATOM   6547  C  C    . LEU A  1 461 ? 182.912 101.629 56.020  1.00 62.90  ? 653  LEU A C    1 
ATOM   6548  O  O    . LEU A  1 461 ? 182.701 101.294 54.850  1.00 63.87  ? 653  LEU A O    1 
ATOM   6549  C  CB   . LEU A  1 461 ? 184.575 103.492 55.843  1.00 61.97  ? 653  LEU A CB   1 
ATOM   6550  C  CG   . LEU A  1 461 ? 183.800 104.664 56.435  1.00 67.10  ? 653  LEU A CG   1 
ATOM   6551  C  CD1  . LEU A  1 461 ? 184.343 104.997 57.812  1.00 66.23  ? 653  LEU A CD1  1 
ATOM   6552  C  CD2  . LEU A  1 461 ? 183.873 105.870 55.514  1.00 68.19  ? 653  LEU A CD2  1 
ATOM   6553  H  H    . LEU A  1 461 ? 185.328 101.089 55.136  1.00 71.31  ? 653  LEU A H    1 
ATOM   6554  H  HA   . LEU A  1 461 ? 184.314 102.184 57.409  1.00 70.10  ? 653  LEU A HA   1 
ATOM   6555  H  HB2  . LEU A  1 461 ? 185.519 103.683 55.960  1.00 74.12  ? 653  LEU A HB2  1 
ATOM   6556  H  HB3  . LEU A  1 461 ? 184.369 103.459 54.896  1.00 74.12  ? 653  LEU A HB3  1 
ATOM   6557  H  HG   . LEU A  1 461 ? 182.868 104.413 56.531  1.00 80.27  ? 653  LEU A HG   1 
ATOM   6558  H  HD11 . LEU A  1 461 ? 183.842 105.743 58.177  1.00 79.23  ? 653  LEU A HD11 1 
ATOM   6559  H  HD12 . LEU A  1 461 ? 184.246 104.221 58.386  1.00 79.23  ? 653  LEU A HD12 1 
ATOM   6560  H  HD13 . LEU A  1 461 ? 185.280 105.235 57.732  1.00 79.23  ? 653  LEU A HD13 1 
ATOM   6561  H  HD21 . LEU A  1 461 ? 183.374 106.601 55.910  1.00 81.58  ? 653  LEU A HD21 1 
ATOM   6562  H  HD22 . LEU A  1 461 ? 184.802 106.125 55.402  1.00 81.58  ? 653  LEU A HD22 1 
ATOM   6563  H  HD23 . LEU A  1 461 ? 183.489 105.634 54.655  1.00 81.58  ? 653  LEU A HD23 1 
ATOM   6564  N  N    . TRP A  1 462 ? 181.982 101.597 56.967  1.00 65.59  ? 654  TRP A N    1 
ATOM   6565  C  CA   . TRP A  1 462 ? 180.656 101.052 56.734  1.00 66.79  ? 654  TRP A CA   1 
ATOM   6566  C  C    . TRP A  1 462 ? 179.609 102.141 56.911  1.00 69.31  ? 654  TRP A C    1 
ATOM   6567  O  O    . TRP A  1 462 ? 179.785 103.076 57.698  1.00 72.30  ? 654  TRP A O    1 
ATOM   6568  C  CB   . TRP A  1 462 ? 180.358 99.893  57.689  1.00 65.66  ? 654  TRP A CB   1 
ATOM   6569  C  CG   . TRP A  1 462 ? 181.451 98.873  57.766  1.00 66.29  ? 654  TRP A CG   1 
ATOM   6570  C  CD1  . TRP A  1 462 ? 182.624 98.984  58.452  1.00 67.36  ? 654  TRP A CD1  1 
ATOM   6571  C  CD2  . TRP A  1 462 ? 181.470 97.581  57.145  1.00 63.69  ? 654  TRP A CD2  1 
ATOM   6572  N  NE1  . TRP A  1 462 ? 183.373 97.844  58.296  1.00 63.48  ? 654  TRP A NE1  1 
ATOM   6573  C  CE2  . TRP A  1 462 ? 182.687 96.966  57.500  1.00 63.76  ? 654  TRP A CE2  1 
ATOM   6574  C  CE3  . TRP A  1 462 ? 180.575 96.883  56.329  1.00 66.33  ? 654  TRP A CE3  1 
ATOM   6575  C  CZ2  . TRP A  1 462 ? 183.033 95.689  57.063  1.00 65.91  ? 654  TRP A CZ2  1 
ATOM   6576  C  CZ3  . TRP A  1 462 ? 180.922 95.613  55.896  1.00 65.45  ? 654  TRP A CZ3  1 
ATOM   6577  C  CH2  . TRP A  1 462 ? 182.140 95.031  56.264  1.00 65.85  ? 654  TRP A CH2  1 
ATOM   6578  H  H    . TRP A  1 462 ? 182.100 101.891 57.767  1.00 78.45  ? 654  TRP A H    1 
ATOM   6579  H  HA   . TRP A  1 462 ? 180.600 100.720 55.824  1.00 79.90  ? 654  TRP A HA   1 
ATOM   6580  H  HB2  . TRP A  1 462 ? 180.222 100.250 58.580  1.00 78.55  ? 654  TRP A HB2  1 
ATOM   6581  H  HB3  . TRP A  1 462 ? 179.553 99.442  57.390  1.00 78.55  ? 654  TRP A HB3  1 
ATOM   6582  H  HD1  . TRP A  1 462 ? 182.881 99.725  58.952  1.00 80.58  ? 654  TRP A HD1  1 
ATOM   6583  H  HE1  . TRP A  1 462 ? 184.148 97.704  58.642  1.00 75.92  ? 654  TRP A HE1  1 
ATOM   6584  H  HE3  . TRP A  1 462 ? 179.763 97.263  56.082  1.00 79.35  ? 654  TRP A HE3  1 
ATOM   6585  H  HZ2  . TRP A  1 462 ? 183.843 95.300  57.305  1.00 78.84  ? 654  TRP A HZ2  1 
ATOM   6586  H  HZ3  . TRP A  1 462 ? 180.335 95.140  55.351  1.00 78.29  ? 654  TRP A HZ3  1 
ATOM   6587  H  HH2  . TRP A  1 462 ? 182.347 94.178  55.957  1.00 78.77  ? 654  TRP A HH2  1 
ATOM   6588  N  N    . ASP A  1 463 ? 178.520 102.012 56.163  1.00 67.88  ? 655  ASP A N    1 
ATOM   6589  C  CA   . ASP A  1 463 ? 177.406 102.945 56.240  1.00 69.07  ? 655  ASP A CA   1 
ATOM   6590  C  C    . ASP A  1 463 ? 176.392 102.420 57.250  1.00 69.73  ? 655  ASP A C    1 
ATOM   6591  O  O    . ASP A  1 463 ? 175.870 101.311 57.092  1.00 70.89  ? 655  ASP A O    1 
ATOM   6592  C  CB   . ASP A  1 463 ? 176.769 103.122 54.863  1.00 73.32  ? 655  ASP A CB   1 
ATOM   6593  C  CG   . ASP A  1 463 ? 175.821 104.300 54.805  1.00 77.67  ? 655  ASP A CG   1 
ATOM   6594  O  OD1  . ASP A  1 463 ? 175.420 104.800 55.876  1.00 77.85  ? 655  ASP A OD1  1 
ATOM   6595  O  OD2  . ASP A  1 463 ? 175.479 104.729 53.682  1.00 80.41  ? 655  ASP A OD2  1 
ATOM   6596  H  H    . ASP A  1 463 ? 178.401 101.379 55.592  1.00 81.21  ? 655  ASP A H    1 
ATOM   6597  H  HA   . ASP A  1 463 ? 177.727 103.808 56.545  1.00 82.63  ? 655  ASP A HA   1 
ATOM   6598  H  HB2  . ASP A  1 463 ? 177.469 103.267 54.207  1.00 87.74  ? 655  ASP A HB2  1 
ATOM   6599  H  HB3  . ASP A  1 463 ? 176.267 102.322 54.642  1.00 87.74  ? 655  ASP A HB3  1 
ATOM   6600  N  N    . VAL A  1 464 ? 176.119 103.215 58.288  1.00 69.02  ? 656  VAL A N    1 
ATOM   6601  C  CA   . VAL A  1 464 ? 175.168 102.804 59.318  1.00 65.56  ? 656  VAL A CA   1 
ATOM   6602  C  C    . VAL A  1 464 ? 173.764 102.685 58.740  1.00 68.37  ? 656  VAL A C    1 
ATOM   6603  O  O    . VAL A  1 464 ? 172.939 101.913 59.245  1.00 66.70  ? 656  VAL A O    1 
ATOM   6604  C  CB   . VAL A  1 464 ? 175.210 103.797 60.498  1.00 61.41  ? 656  VAL A CB   1 
ATOM   6605  C  CG1  . VAL A  1 464 ? 174.017 103.600 61.431  1.00 62.61  ? 656  VAL A CG1  1 
ATOM   6606  C  CG2  . VAL A  1 464 ? 176.510 103.650 61.270  1.00 60.53  ? 656  VAL A CG2  1 
ATOM   6607  H  H    . VAL A  1 464 ? 176.469 103.990 58.417  1.00 82.58  ? 656  VAL A H    1 
ATOM   6608  H  HA   . VAL A  1 464 ? 175.426 101.931 59.654  1.00 78.43  ? 656  VAL A HA   1 
ATOM   6609  H  HB   . VAL A  1 464 ? 175.170 104.701 60.149  1.00 73.44  ? 656  VAL A HB   1 
ATOM   6610  H  HG11 . VAL A  1 464 ? 174.077 104.240 62.158  1.00 74.88  ? 656  VAL A HG11 1 
ATOM   6611  H  HG12 . VAL A  1 464 ? 173.198 103.743 60.931  1.00 74.88  ? 656  VAL A HG12 1 
ATOM   6612  H  HG13 . VAL A  1 464 ? 174.037 102.696 61.782  1.00 74.88  ? 656  VAL A HG13 1 
ATOM   6613  H  HG21 . VAL A  1 464 ? 176.513 104.283 62.005  1.00 72.38  ? 656  VAL A HG21 1 
ATOM   6614  H  HG22 . VAL A  1 464 ? 176.573 102.745 61.612  1.00 72.38  ? 656  VAL A HG22 1 
ATOM   6615  H  HG23 . VAL A  1 464 ? 177.253 103.832 60.674  1.00 72.38  ? 656  VAL A HG23 1 
ATOM   6616  N  N    . LEU A  1 465 ? 173.467 103.441 57.683  1.00 69.98  ? 657  LEU A N    1 
ATOM   6617  C  CA   . LEU A  1 465 ? 172.107 103.486 57.160  1.00 69.08  ? 657  LEU A CA   1 
ATOM   6618  C  C    . LEU A  1 465 ? 171.675 102.137 56.597  1.00 70.29  ? 657  LEU A C    1 
ATOM   6619  O  O    . LEU A  1 465 ? 170.515 101.737 56.753  1.00 73.85  ? 657  LEU A O    1 
ATOM   6620  C  CB   . LEU A  1 465 ? 172.005 104.569 56.086  1.00 77.13  ? 657  LEU A CB   1 
ATOM   6621  C  CG   . LEU A  1 465 ? 170.632 104.775 55.445  1.00 82.13  ? 657  LEU A CG   1 
ATOM   6622  C  CD1  . LEU A  1 465 ? 169.588 105.152 56.488  1.00 82.64  ? 657  LEU A CD1  1 
ATOM   6623  C  CD2  . LEU A  1 465 ? 170.718 105.835 54.362  1.00 82.85  ? 657  LEU A CD2  1 
ATOM   6624  H  H    . LEU A  1 465 ? 174.030 103.931 57.256  1.00 83.73  ? 657  LEU A H    1 
ATOM   6625  H  HA   . LEU A  1 465 ? 171.499 103.719 57.880  1.00 82.65  ? 657  LEU A HA   1 
ATOM   6626  H  HB2  . LEU A  1 465 ? 172.266 105.414 56.484  1.00 92.31  ? 657  LEU A HB2  1 
ATOM   6627  H  HB3  . LEU A  1 465 ? 172.624 104.346 55.373  1.00 92.31  ? 657  LEU A HB3  1 
ATOM   6628  H  HG   . LEU A  1 465 ? 170.351 103.945 55.028  1.00 98.31  ? 657  LEU A HG   1 
ATOM   6629  H  HD11 . LEU A  1 465 ? 168.732 105.275 56.047  1.00 98.92  ? 657  LEU A HD11 1 
ATOM   6630  H  HD12 . LEU A  1 465 ? 169.525 104.439 57.142  1.00 98.92  ? 657  LEU A HD12 1 
ATOM   6631  H  HD13 . LEU A  1 465 ? 169.859 105.976 56.921  1.00 98.92  ? 657  LEU A HD13 1 
ATOM   6632  H  HD21 . LEU A  1 465 ? 169.841 105.954 53.966  1.00 99.17  ? 657  LEU A HD21 1 
ATOM   6633  H  HD22 . LEU A  1 465 ? 171.018 106.668 54.760  1.00 99.17  ? 657  LEU A HD22 1 
ATOM   6634  H  HD23 . LEU A  1 465 ? 171.350 105.545 53.686  1.00 99.17  ? 657  LEU A HD23 1 
ATOM   6635  N  N    . ASN A  1 466 ? 172.588 101.427 55.933  1.00 69.25  ? 658  ASN A N    1 
ATOM   6636  C  CA   . ASN A  1 466 ? 172.237 100.198 55.236  1.00 69.99  ? 658  ASN A CA   1 
ATOM   6637  C  C    . ASN A  1 466 ? 173.260 99.082  55.398  1.00 68.05  ? 658  ASN A C    1 
ATOM   6638  O  O    . ASN A  1 466 ? 173.088 98.025  54.783  1.00 66.94  ? 658  ASN A O    1 
ATOM   6639  C  CB   . ASN A  1 466 ? 172.045 100.489 53.742  1.00 74.21  ? 658  ASN A CB   1 
ATOM   6640  C  CG   . ASN A  1 466 ? 173.179 101.304 53.165  1.00 77.20  ? 658  ASN A CG   1 
ATOM   6641  O  OD1  . ASN A  1 466 ? 174.341 101.104 53.515  1.00 78.77  ? 658  ASN A OD1  1 
ATOM   6642  N  ND2  . ASN A  1 466 ? 172.847 102.244 52.290  1.00 82.83  ? 658  ASN A ND2  1 
ATOM   6643  H  H    . ASN A  1 466 ? 173.419 101.639 55.873  1.00 82.85  ? 658  ASN A H    1 
ATOM   6644  H  HA   . ASN A  1 466 ? 171.391 99.875  55.585  1.00 83.74  ? 658  ASN A HA   1 
ATOM   6645  H  HB2  . ASN A  1 466 ? 172.001 99.649  53.259  1.00 88.80  ? 658  ASN A HB2  1 
ATOM   6646  H  HB3  . ASN A  1 466 ? 171.222 100.987 53.619  1.00 88.80  ? 658  ASN A HB3  1 
ATOM   6647  H  HD21 . ASN A  1 466 ? 173.457 102.736 51.934  1.00 99.15  ? 658  ASN A HD21 1 
ATOM   6648  H  HD22 . ASN A  1 466 ? 172.023 102.357 52.072  1.00 99.15  ? 658  ASN A HD22 1 
ATOM   6649  N  N    . GLY A  1 467 ? 174.316 99.280  56.182  1.00 68.11  ? 659  GLY A N    1 
ATOM   6650  C  CA   . GLY A  1 467 ? 175.312 98.250  56.388  1.00 69.06  ? 659  GLY A CA   1 
ATOM   6651  C  C    . GLY A  1 467 ? 176.285 98.058  55.250  1.00 68.35  ? 659  GLY A C    1 
ATOM   6652  O  O    . GLY A  1 467 ? 177.098 97.127  55.304  1.00 63.01  ? 659  GLY A O    1 
ATOM   6653  H  H    . GLY A  1 467 ? 174.474 100.010 56.608  1.00 81.49  ? 659  GLY A H    1 
ATOM   6654  H  HA2  . GLY A  1 467 ? 175.823 98.464  57.184  1.00 82.62  ? 659  GLY A HA2  1 
ATOM   6655  H  HA3  . GLY A  1 467 ? 174.861 97.405  56.541  1.00 82.62  ? 659  GLY A HA3  1 
ATOM   6656  N  N    . ASN A  1 468 ? 176.241 98.906  54.226  1.00 75.91  ? 660  ASN A N    1 
ATOM   6657  C  CA   . ASN A  1 468 ? 177.124 98.739  53.083  1.00 77.71  ? 660  ASN A CA   1 
ATOM   6658  C  C    . ASN A  1 468 ? 178.553 99.118  53.444  1.00 76.49  ? 660  ASN A C    1 
ATOM   6659  O  O    . ASN A  1 468 ? 178.800 100.030 54.239  1.00 78.18  ? 660  ASN A O    1 
ATOM   6660  C  CB   . ASN A  1 468 ? 176.662 99.599  51.907  1.00 78.68  ? 660  ASN A CB   1 
ATOM   6661  C  CG   . ASN A  1 468 ? 175.359 99.123  51.308  1.00 81.50  ? 660  ASN A CG   1 
ATOM   6662  O  OD1  . ASN A  1 468 ? 174.910 98.007  51.568  1.00 83.17  ? 660  ASN A OD1  1 
ATOM   6663  N  ND2  . ASN A  1 468 ? 174.745 99.971  50.491  1.00 82.88  ? 660  ASN A ND2  1 
ATOM   6664  H  H    . ASN A  1 468 ? 175.711 99.581  54.171  1.00 90.84  ? 660  ASN A H    1 
ATOM   6665  H  HA   . ASN A  1 468 ? 177.116 97.810  52.803  1.00 93.01  ? 660  ASN A HA   1 
ATOM   6666  H  HB2  . ASN A  1 468 ? 176.535 100.511 52.214  1.00 94.17  ? 660  ASN A HB2  1 
ATOM   6667  H  HB3  . ASN A  1 468 ? 177.338 99.574  51.213  1.00 94.17  ? 660  ASN A HB3  1 
ATOM   6668  H  HD21 . ASN A  1 468 ? 174.001 99.750  50.123  1.00 99.21  ? 660  ASN A HD21 1 
ATOM   6669  H  HD22 . ASN A  1 468 ? 175.091 100.742 50.333  1.00 99.21  ? 660  ASN A HD22 1 
ATOM   6670  N  N    . CYS A  1 469 ? 179.501 98.404  52.847  1.00 73.63  ? 661  CYS A N    1 
ATOM   6671  C  CA   . CYS A  1 469 ? 180.914 98.748  52.949  1.00 71.30  ? 661  CYS A CA   1 
ATOM   6672  C  C    . CYS A  1 469 ? 181.214 99.791  51.881  1.00 69.79  ? 661  CYS A C    1 
ATOM   6673  O  O    . CYS A  1 469 ? 181.160 99.493  50.684  1.00 73.75  ? 661  CYS A O    1 
ATOM   6674  C  CB   . CYS A  1 469 ? 181.791 97.512  52.779  1.00 74.02  ? 661  CYS A CB   1 
ATOM   6675  S  SG   . CYS A  1 469 ? 183.554 97.842  52.971  1.00 79.84  ? 661  CYS A SG   1 
ATOM   6676  H  H    . CYS A  1 469 ? 179.349 97.706  52.368  1.00 88.11  ? 661  CYS A H    1 
ATOM   6677  H  HA   . CYS A  1 469 ? 181.092 99.137  53.820  1.00 85.31  ? 661  CYS A HA   1 
ATOM   6678  H  HB2  . CYS A  1 469 ? 181.538 96.854  53.445  1.00 88.57  ? 661  CYS A HB2  1 
ATOM   6679  H  HB3  . CYS A  1 469 ? 181.652 97.150  51.890  1.00 88.57  ? 661  CYS A HB3  1 
ATOM   6680  H  HG   . CYS A  1 469 ? 183.894 98.644  52.146  1.00 95.56  ? 661  CYS A HG   1 
ATOM   6681  N  N    . VAL A  1 470 ? 181.514 101.018 52.311  1.00 69.66  ? 662  VAL A N    1 
ATOM   6682  C  CA   . VAL A  1 470 ? 181.709 102.130 51.383  1.00 65.66  ? 662  VAL A CA   1 
ATOM   6683  C  C    . VAL A  1 470 ? 183.177 102.460 51.154  1.00 62.56  ? 662  VAL A C    1 
ATOM   6684  O  O    . VAL A  1 470 ? 183.488 103.205 50.211  1.00 67.41  ? 662  VAL A O    1 
ATOM   6685  C  CB   . VAL A  1 470 ? 180.962 103.394 51.864  1.00 64.56  ? 662  VAL A CB   1 
ATOM   6686  C  CG1  . VAL A  1 470 ? 179.465 103.141 51.891  1.00 64.19  ? 662  VAL A CG1  1 
ATOM   6687  C  CG2  . VAL A  1 470 ? 181.454 103.822 53.243  1.00 65.37  ? 662  VAL A CG2  1 
ATOM   6688  H  H    . VAL A  1 470 ? 181.610 101.232 53.139  1.00 83.34  ? 662  VAL A H    1 
ATOM   6689  H  HA   . VAL A  1 470 ? 181.332 101.879 50.525  1.00 78.55  ? 662  VAL A HA   1 
ATOM   6690  H  HB   . VAL A  1 470 ? 181.134 104.119 51.243  1.00 77.22  ? 662  VAL A HB   1 
ATOM   6691  H  HG11 . VAL A  1 470 ? 179.015 103.945 52.195  1.00 76.78  ? 662  VAL A HG11 1 
ATOM   6692  H  HG12 . VAL A  1 470 ? 179.167 102.913 50.997  1.00 76.78  ? 662  VAL A HG12 1 
ATOM   6693  H  HG13 . VAL A  1 470 ? 179.280 102.409 52.499  1.00 76.78  ? 662  VAL A HG13 1 
ATOM   6694  H  HG21 . VAL A  1 470 ? 180.969 104.616 53.518  1.00 78.20  ? 662  VAL A HG21 1 
ATOM   6695  H  HG22 . VAL A  1 470 ? 181.294 103.102 53.873  1.00 78.20  ? 662  VAL A HG22 1 
ATOM   6696  H  HG23 . VAL A  1 470 ? 182.403 104.015 53.194  1.00 78.20  ? 662  VAL A HG23 1 
ATOM   6697  N  N    . ARG A  1 471 ? 184.085 101.943 51.978  1.00 66.26  ? 663  ARG A N    1 
ATOM   6698  C  CA   . ARG A  1 471 ? 185.511 102.144 51.761  1.00 67.15  ? 663  ARG A CA   1 
ATOM   6699  C  C    . ARG A  1 471 ? 186.269 100.899 52.193  1.00 67.50  ? 663  ARG A C    1 
ATOM   6700  O  O    . ARG A  1 471 ? 185.867 100.201 53.128  1.00 64.02  ? 663  ARG A O    1 
ATOM   6701  C  CB   . ARG A  1 471 ? 186.048 103.357 52.530  1.00 63.08  ? 663  ARG A CB   1 
ATOM   6702  C  CG   . ARG A  1 471 ? 185.476 104.691 52.086  1.00 67.28  ? 663  ARG A CG   1 
ATOM   6703  C  CD   . ARG A  1 471 ? 186.107 105.139 50.778  1.00 70.07  ? 663  ARG A CD   1 
ATOM   6704  N  NE   . ARG A  1 471 ? 185.633 106.457 50.360  1.00 74.90  ? 663  ARG A NE   1 
ATOM   6705  C  CZ   . ARG A  1 471 ? 184.554 106.674 49.612  1.00 72.68  ? 663  ARG A CZ   1 
ATOM   6706  N  NH1  . ARG A  1 471 ? 183.810 105.661 49.184  1.00 70.13  ? 663  ARG A NH1  1 
ATOM   6707  N  NH2  . ARG A  1 471 ? 184.217 107.915 49.291  1.00 71.96  ? 663  ARG A NH2  1 
ATOM   6708  H  H    . ARG A  1 471 ? 183.899 101.470 52.672  1.00 79.27  ? 663  ARG A H    1 
ATOM   6709  H  HA   . ARG A  1 471 ? 185.673 102.287 50.816  1.00 80.33  ? 663  ARG A HA   1 
ATOM   6710  H  HB2  . ARG A  1 471 ? 185.838 103.246 53.470  1.00 75.45  ? 663  ARG A HB2  1 
ATOM   6711  H  HB3  . ARG A  1 471 ? 187.010 103.397 52.413  1.00 75.45  ? 663  ARG A HB3  1 
ATOM   6712  H  HG2  . ARG A  1 471 ? 184.520 104.603 51.951  1.00 80.49  ? 663  ARG A HG2  1 
ATOM   6713  H  HG3  . ARG A  1 471 ? 185.662 105.362 52.761  1.00 80.49  ? 663  ARG A HG3  1 
ATOM   6714  H  HD2  . ARG A  1 471 ? 187.070 105.185 50.888  1.00 83.83  ? 663  ARG A HD2  1 
ATOM   6715  H  HD3  . ARG A  1 471 ? 185.881 104.502 50.082  1.00 83.83  ? 663  ARG A HD3  1 
ATOM   6716  H  HE   . ARG A  1 471 ? 186.085 107.142 50.616  1.00 89.63  ? 663  ARG A HE   1 
ATOM   6717  H  HH11 . ARG A  1 471 ? 184.024 104.854 49.388  1.00 83.91  ? 663  ARG A HH11 1 
ATOM   6718  H  HH12 . ARG A  1 471 ? 183.115 105.813 48.701  1.00 83.91  ? 663  ARG A HH12 1 
ATOM   6719  H  HH21 . ARG A  1 471 ? 184.695 108.576 49.566  1.00 86.10  ? 663  ARG A HH21 1 
ATOM   6720  H  HH22 . ARG A  1 471 ? 183.520 108.060 48.809  1.00 86.10  ? 663  ARG A HH22 1 
ATOM   6721  N  N    . ILE A  1 472 ? 187.369 100.629 51.494  1.00 69.13  ? 664  ILE A N    1 
ATOM   6722  C  CA   . ILE A  1 472 ? 188.315 99.590  51.883  1.00 69.03  ? 664  ILE A CA   1 
ATOM   6723  C  C    . ILE A  1 472 ? 189.712 100.173 51.731  1.00 69.07  ? 664  ILE A C    1 
ATOM   6724  O  O    . ILE A  1 472 ? 190.093 100.600 50.636  1.00 74.59  ? 664  ILE A O    1 
ATOM   6725  C  CB   . ILE A  1 472 ? 188.170 98.309  51.044  1.00 70.19  ? 664  ILE A CB   1 
ATOM   6726  C  CG1  . ILE A  1 472 ? 186.736 97.779  51.141  1.00 71.14  ? 664  ILE A CG1  1 
ATOM   6727  C  CG2  . ILE A  1 472 ? 189.160 97.253  51.528  1.00 74.36  ? 664  ILE A CG2  1 
ATOM   6728  C  CD1  . ILE A  1 472 ? 186.459 96.571  50.271  1.00 71.76  ? 664  ILE A CD1  1 
ATOM   6729  H  H    . ILE A  1 472 ? 187.593 101.045 50.775  1.00 82.71  ? 664  ILE A H    1 
ATOM   6730  H  HA   . ILE A  1 472 ? 188.178 99.362  52.816  1.00 82.58  ? 664  ILE A HA   1 
ATOM   6731  H  HB   . ILE A  1 472 ? 188.364 98.519  50.117  1.00 83.98  ? 664  ILE A HB   1 
ATOM   6732  H  HG12 . ILE A  1 472 ? 186.559 97.527  52.061  1.00 85.12  ? 664  ILE A HG12 1 
ATOM   6733  H  HG13 . ILE A  1 472 ? 186.126 98.483  50.872  1.00 85.12  ? 664  ILE A HG13 1 
ATOM   6734  H  HG21 . ILE A  1 472 ? 189.055 96.453  50.990  1.00 88.99  ? 664  ILE A HG21 1 
ATOM   6735  H  HG22 . ILE A  1 472 ? 190.061 97.600  51.435  1.00 88.99  ? 664  ILE A HG22 1 
ATOM   6736  H  HG23 . ILE A  1 472 ? 188.977 97.052  52.459  1.00 88.99  ? 664  ILE A HG23 1 
ATOM   6737  H  HD11 . ILE A  1 472 ? 185.535 96.301  50.392  1.00 85.86  ? 664  ILE A HD11 1 
ATOM   6738  H  HD12 . ILE A  1 472 ? 186.617 96.807  49.344  1.00 85.86  ? 664  ILE A HD12 1 
ATOM   6739  H  HD13 . ILE A  1 472 ? 187.051 95.850  50.535  1.00 85.86  ? 664  ILE A HD13 1 
ATOM   6740  N  N    . PHE A  1 473 ? 190.473 100.192 52.822  1.00 69.25  ? 665  PHE A N    1 
ATOM   6741  C  CA   . PHE A  1 473 ? 191.789 100.821 52.863  1.00 69.18  ? 665  PHE A CA   1 
ATOM   6742  C  C    . PHE A  1 473 ? 192.829 99.742  53.132  1.00 70.74  ? 665  PHE A C    1 
ATOM   6743  O  O    . PHE A  1 473 ? 192.850 99.150  54.217  1.00 72.81  ? 665  PHE A O    1 
ATOM   6744  C  CB   . PHE A  1 473 ? 191.837 101.906 53.938  1.00 65.46  ? 665  PHE A CB   1 
ATOM   6745  C  CG   . PHE A  1 473 ? 190.935 103.076 53.664  1.00 63.08  ? 665  PHE A CG   1 
ATOM   6746  C  CD1  . PHE A  1 473 ? 190.854 103.629 52.397  1.00 65.33  ? 665  PHE A CD1  1 
ATOM   6747  C  CD2  . PHE A  1 473 ? 190.161 103.619 54.676  1.00 62.83  ? 665  PHE A CD2  1 
ATOM   6748  C  CE1  . PHE A  1 473 ? 190.023 104.705 52.147  1.00 68.48  ? 665  PHE A CE1  1 
ATOM   6749  C  CE2  . PHE A  1 473 ? 189.328 104.694 54.431  1.00 62.89  ? 665  PHE A CE2  1 
ATOM   6750  C  CZ   . PHE A  1 473 ? 189.258 105.237 53.165  1.00 67.22  ? 665  PHE A CZ   1 
ATOM   6751  H  H    . PHE A  1 473 ? 190.242 99.838  53.571  1.00 82.85  ? 665  PHE A H    1 
ATOM   6752  H  HA   . PHE A  1 473 ? 191.982 101.228 52.004  1.00 82.77  ? 665  PHE A HA   1 
ATOM   6753  H  HB2  . PHE A  1 473 ? 191.569 101.518 54.785  1.00 78.30  ? 665  PHE A HB2  1 
ATOM   6754  H  HB3  . PHE A  1 473 ? 192.745 102.241 54.002  1.00 78.30  ? 665  PHE A HB3  1 
ATOM   6755  H  HD1  . PHE A  1 473 ? 191.367 103.275 51.707  1.00 78.15  ? 665  PHE A HD1  1 
ATOM   6756  H  HD2  . PHE A  1 473 ? 190.205 103.257 55.531  1.00 75.15  ? 665  PHE A HD2  1 
ATOM   6757  H  HE1  . PHE A  1 473 ? 189.977 105.069 51.292  1.00 81.93  ? 665  PHE A HE1  1 
ATOM   6758  H  HE2  . PHE A  1 473 ? 188.814 105.050 55.119  1.00 75.22  ? 665  PHE A HE2  1 
ATOM   6759  H  HZ   . PHE A  1 473 ? 188.698 105.960 52.998  1.00 80.41  ? 665  PHE A HZ   1 
ATOM   6760  N  N    . THR A  1 474 ? 193.689 99.494  52.151  1.00 65.64  ? 666  THR A N    1 
ATOM   6761  C  CA   . THR A  1 474 ? 194.716 98.470  52.241  1.00 68.41  ? 666  THR A CA   1 
ATOM   6762  C  C    . THR A  1 474 ? 196.088 99.126  52.264  1.00 66.46  ? 666  THR A C    1 
ATOM   6763  O  O    . THR A  1 474 ? 196.278 100.226 51.738  1.00 69.30  ? 666  THR A O    1 
ATOM   6764  C  CB   . THR A  1 474 ? 194.632 97.492  51.063  1.00 69.77  ? 666  THR A CB   1 
ATOM   6765  O  OG1  . THR A  1 474 ? 194.833 98.201  49.833  1.00 71.38  ? 666  THR A OG1  1 
ATOM   6766  C  CG2  . THR A  1 474 ? 193.272 96.804  51.033  1.00 68.36  ? 666  THR A CG2  1 
ATOM   6767  H  H    . THR A  1 474 ? 193.695 99.919  51.403  1.00 78.52  ? 666  THR A H    1 
ATOM   6768  H  HA   . THR A  1 474 ? 194.601 97.969  53.064  1.00 81.84  ? 666  THR A HA   1 
ATOM   6769  H  HB   . THR A  1 474 ? 195.317 96.813  51.159  1.00 83.48  ? 666  THR A HB   1 
ATOM   6770  H  HG1  . THR A  1 474 ? 195.589 98.567  49.833  1.00 85.40  ? 666  THR A HG1  1 
ATOM   6771  H  HG21 . THR A  1 474 ? 193.230 96.188  50.284  1.00 81.79  ? 666  THR A HG21 1 
ATOM   6772  H  HG22 . THR A  1 474 ? 193.133 96.310  51.856  1.00 81.79  ? 666  THR A HG22 1 
ATOM   6773  H  HG23 . THR A  1 474 ? 192.569 97.465  50.938  1.00 81.79  ? 666  THR A HG23 1 
ATOM   6774  N  N    . GLY A  1 475 ? 197.045 98.443  52.882  1.00 69.71  ? 667  GLY A N    1 
ATOM   6775  C  CA   . GLY A  1 475 ? 198.395 98.961  52.958  1.00 70.39  ? 667  GLY A CA   1 
ATOM   6776  C  C    . GLY A  1 475 ? 199.162 98.449  54.157  1.00 69.54  ? 667  GLY A C    1 
ATOM   6777  O  O    . GLY A  1 475 ? 200.358 98.162  54.054  1.00 71.36  ? 667  GLY A O    1 
ATOM   6778  H  H    . GLY A  1 475 ? 196.934 97.681  53.264  1.00 83.40  ? 667  GLY A H    1 
ATOM   6779  H  HA2  . GLY A  1 475 ? 198.880 98.710  52.157  1.00 84.23  ? 667  GLY A HA2  1 
ATOM   6780  H  HA3  . GLY A  1 475 ? 198.365 99.929  53.006  1.00 84.23  ? 667  GLY A HA3  1 
ATOM   6781  N  N    . HIS A  1 476 ? 198.493 98.330  55.302  1.00 68.64  ? 668  HIS A N    1 
ATOM   6782  C  CA   . HIS A  1 476 ? 199.164 97.831  56.492  1.00 68.02  ? 668  HIS A CA   1 
ATOM   6783  C  C    . HIS A  1 476 ? 199.685 96.422  56.249  1.00 71.62  ? 668  HIS A C    1 
ATOM   6784  O  O    . HIS A  1 476 ? 199.051 95.614  55.565  1.00 71.13  ? 668  HIS A O    1 
ATOM   6785  C  CB   . HIS A  1 476 ? 198.218 97.842  57.692  1.00 66.87  ? 668  HIS A CB   1 
ATOM   6786  C  CG   . HIS A  1 476 ? 198.066 99.188  58.327  1.00 68.31  ? 668  HIS A CG   1 
ATOM   6787  N  ND1  . HIS A  1 476 ? 199.114 99.842  58.937  1.00 69.35  ? 668  HIS A ND1  1 
ATOM   6788  C  CD2  . HIS A  1 476 ? 196.988 99.995  58.462  1.00 66.95  ? 668  HIS A CD2  1 
ATOM   6789  C  CE1  . HIS A  1 476 ? 198.692 101.000 59.411  1.00 69.13  ? 668  HIS A CE1  1 
ATOM   6790  N  NE2  . HIS A  1 476 ? 197.405 101.116 59.138  1.00 65.38  ? 668  HIS A NE2  1 
ATOM   6791  H  H    . HIS A  1 476 ? 197.663 98.528  55.412  1.00 82.12  ? 668  HIS A H    1 
ATOM   6792  H  HA   . HIS A  1 476 ? 199.920 98.404  56.696  1.00 81.38  ? 668  HIS A HA   1 
ATOM   6793  H  HB2  . HIS A  1 476 ? 197.339 97.551  57.400  1.00 80.00  ? 668  HIS A HB2  1 
ATOM   6794  H  HB3  . HIS A  1 476 ? 198.559 97.233  58.365  1.00 80.00  ? 668  HIS A HB3  1 
ATOM   6795  H  HD1  . HIS A  1 476 ? 199.920 99.546  58.994  1.00 82.97  ? 668  HIS A HD1  1 
ATOM   6796  H  HD2  . HIS A  1 476 ? 196.128 99.825  58.151  1.00 80.09  ? 668  HIS A HD2  1 
ATOM   6797  H  HE1  . HIS A  1 476 ? 199.211 101.625 59.864  1.00 82.71  ? 668  HIS A HE1  1 
ATOM   6798  N  N    . LYS A  1 477 ? 200.857 96.135  56.812  1.00 71.74  ? 669  LYS A N    1 
ATOM   6799  C  CA   . LYS A  1 477 ? 201.484 94.827  56.707  1.00 71.22  ? 669  LYS A CA   1 
ATOM   6800  C  C    . LYS A  1 477 ? 201.266 93.979  57.955  1.00 68.72  ? 669  LYS A C    1 
ATOM   6801  O  O    . LYS A  1 477 ? 202.036 93.046  58.207  1.00 70.56  ? 669  LYS A O    1 
ATOM   6802  C  CB   . LYS A  1 477 ? 202.977 94.987  56.423  1.00 74.05  ? 669  LYS A CB   1 
ATOM   6803  C  CG   . LYS A  1 477 ? 203.288 95.852  55.208  1.00 74.97  ? 669  LYS A CG   1 
ATOM   6804  C  CD   . LYS A  1 477 ? 202.638 95.303  53.946  1.00 74.08  ? 669  LYS A CD   1 
ATOM   6805  C  CE   . LYS A  1 477 ? 203.051 96.093  52.718  1.00 78.99  ? 669  LYS A CE   1 
ATOM   6806  N  NZ   . LYS A  1 477 ? 202.600 97.510  52.792  1.00 81.89  ? 669  LYS A NZ   1 
ATOM   6807  H  H    . LYS A  1 477 ? 201.317 96.699  57.271  1.00 85.84  ? 669  LYS A H    1 
ATOM   6808  H  HA   . LYS A  1 477 ? 201.090 94.353  55.957  1.00 85.22  ? 669  LYS A HA   1 
ATOM   6809  H  HB2  . LYS A  1 477 ? 203.399 95.398  57.194  1.00 88.61  ? 669  LYS A HB2  1 
ATOM   6810  H  HB3  . LYS A  1 477 ? 203.361 94.110  56.268  1.00 88.61  ? 669  LYS A HB3  1 
ATOM   6811  H  HG2  . LYS A  1 477 ? 202.950 96.749  55.358  1.00 89.71  ? 669  LYS A HG2  1 
ATOM   6812  H  HG3  . LYS A  1 477 ? 204.248 95.875  55.069  1.00 89.71  ? 669  LYS A HG3  1 
ATOM   6813  H  HD2  . LYS A  1 477 ? 202.911 94.381  53.821  1.00 88.64  ? 669  LYS A HD2  1 
ATOM   6814  H  HD3  . LYS A  1 477 ? 201.673 95.359  54.033  1.00 88.64  ? 669  LYS A HD3  1 
ATOM   6815  H  HE2  . LYS A  1 477 ? 204.018 96.086  52.644  1.00 94.54  ? 669  LYS A HE2  1 
ATOM   6816  H  HE3  . LYS A  1 477 ? 202.652 95.689  51.931  1.00 94.54  ? 669  LYS A HE3  1 
ATOM   6817  H  HZ1  . LYS A  1 477 ? 202.855 97.949  52.061  1.00 98.02  ? 669  LYS A HZ1  1 
ATOM   6818  H  HZ2  . LYS A  1 477 ? 201.713 97.544  52.856  1.00 98.02  ? 669  LYS A HZ2  1 
ATOM   6819  H  HZ3  . LYS A  1 477 ? 202.956 97.905  53.506  1.00 98.02  ? 669  LYS A HZ3  1 
ATOM   6820  N  N    . GLY A  1 478 ? 200.234 94.284  58.735  1.00 66.57  ? 670  GLY A N    1 
ATOM   6821  C  CA   . GLY A  1 478 ? 199.937 93.546  59.938  1.00 62.18  ? 670  GLY A CA   1 
ATOM   6822  C  C    . GLY A  1 478 ? 198.561 93.892  60.469  1.00 61.00  ? 670  GLY A C    1 
ATOM   6823  O  O    . GLY A  1 478 ? 197.916 94.837  60.004  1.00 65.36  ? 670  GLY A O    1 
ATOM   6824  H  H    . GLY A  1 478 ? 199.685 94.927  58.578  1.00 79.63  ? 670  GLY A H    1 
ATOM   6825  H  HA2  . GLY A  1 478 ? 199.968 92.594  59.754  1.00 74.37  ? 670  GLY A HA2  1 
ATOM   6826  H  HA3  . GLY A  1 478 ? 200.595 93.753  60.619  1.00 74.37  ? 670  GLY A HA3  1 
ATOM   6827  N  N    . PRO A  1 479 ? 198.082 93.137  61.456  1.00 60.06  ? 671  PRO A N    1 
ATOM   6828  C  CA   . PRO A  1 479 ? 196.754 93.417  62.012  1.00 64.18  ? 671  PRO A CA   1 
ATOM   6829  C  C    . PRO A  1 479 ? 196.640 94.847  62.519  1.00 64.86  ? 671  PRO A C    1 
ATOM   6830  O  O    . PRO A  1 479 ? 197.580 95.406  63.088  1.00 63.61  ? 671  PRO A O    1 
ATOM   6831  C  CB   . PRO A  1 479 ? 196.632 92.402  63.154  1.00 62.50  ? 671  PRO A CB   1 
ATOM   6832  C  CG   . PRO A  1 479 ? 197.508 91.276  62.730  1.00 60.89  ? 671  PRO A CG   1 
ATOM   6833  C  CD   . PRO A  1 479 ? 198.677 91.928  62.051  1.00 61.83  ? 671  PRO A CD   1 
ATOM   6834  H  HA   . PRO A  1 479 ? 196.064 93.248  61.351  1.00 76.77  ? 671  PRO A HA   1 
ATOM   6835  H  HB2  . PRO A  1 479 ? 196.950 92.797  63.981  1.00 74.75  ? 671  PRO A HB2  1 
ATOM   6836  H  HB3  . PRO A  1 479 ? 195.711 92.111  63.240  1.00 74.75  ? 671  PRO A HB3  1 
ATOM   6837  H  HG2  . PRO A  1 479 ? 197.798 90.776  63.509  1.00 72.82  ? 671  PRO A HG2  1 
ATOM   6838  H  HG3  . PRO A  1 479 ? 197.028 90.702  62.113  1.00 72.82  ? 671  PRO A HG3  1 
ATOM   6839  H  HD2  . PRO A  1 479 ? 199.356 92.169  62.701  1.00 73.95  ? 671  PRO A HD2  1 
ATOM   6840  H  HD3  . PRO A  1 479 ? 199.034 91.349  61.360  1.00 73.95  ? 671  PRO A HD3  1 
ATOM   6841  N  N    . ILE A  1 480 ? 195.462 95.434  62.305  1.00 65.49  ? 672  ILE A N    1 
ATOM   6842  C  CA   . ILE A  1 480 ? 195.187 96.784  62.780  1.00 67.90  ? 672  ILE A CA   1 
ATOM   6843  C  C    . ILE A  1 480 ? 194.973 96.750  64.285  1.00 66.72  ? 672  ILE A C    1 
ATOM   6844  O  O    . ILE A  1 480 ? 194.253 95.888  64.805  1.00 71.76  ? 672  ILE A O    1 
ATOM   6845  C  CB   . ILE A  1 480 ? 193.959 97.366  62.064  1.00 68.84  ? 672  ILE A CB   1 
ATOM   6846  C  CG1  . ILE A  1 480 ? 194.034 97.108  60.555  1.00 67.05  ? 672  ILE A CG1  1 
ATOM   6847  C  CG2  . ILE A  1 480 ? 193.833 98.855  62.350  1.00 69.02  ? 672  ILE A CG2  1 
ATOM   6848  C  CD1  . ILE A  1 480 ? 195.336 97.519  59.915  1.00 71.39  ? 672  ILE A CD1  1 
ATOM   6849  H  H    . ILE A  1 480 ? 194.806 95.069  61.885  1.00 78.33  ? 672  ILE A H    1 
ATOM   6850  H  HA   . ILE A  1 480 ? 195.950 97.354  62.592  1.00 81.24  ? 672  ILE A HA   1 
ATOM   6851  H  HB   . ILE A  1 480 ? 193.169 96.923  62.409  1.00 82.36  ? 672  ILE A HB   1 
ATOM   6852  H  HG12 . ILE A  1 480 ? 193.915 96.159  60.396  1.00 80.21  ? 672  ILE A HG12 1 
ATOM   6853  H  HG13 . ILE A  1 480 ? 193.323 97.604  60.120  1.00 80.21  ? 672  ILE A HG13 1 
ATOM   6854  H  HG21 . ILE A  1 480 ? 193.053 99.199  61.889  1.00 82.58  ? 672  ILE A HG21 1 
ATOM   6855  H  HG22 . ILE A  1 480 ? 193.737 98.985  63.307  1.00 82.58  ? 672  ILE A HG22 1 
ATOM   6856  H  HG23 . ILE A  1 480 ? 194.631 99.305  62.033  1.00 82.58  ? 672  ILE A HG23 1 
ATOM   6857  H  HD11 . ILE A  1 480 ? 195.297 97.322  58.966  1.00 85.42  ? 672  ILE A HD11 1 
ATOM   6858  H  HD12 . ILE A  1 480 ? 195.467 98.470  60.050  1.00 85.42  ? 672  ILE A HD12 1 
ATOM   6859  H  HD13 . ILE A  1 480 ? 196.060 97.023  60.327  1.00 85.42  ? 672  ILE A HD13 1 
ATOM   6860  N  N    . HIS A  1 481 ? 195.597 97.690  64.996  1.00 69.89  ? 673  HIS A N    1 
ATOM   6861  C  CA   . HIS A  1 481 ? 195.419 97.800  66.437  1.00 76.02  ? 673  HIS A CA   1 
ATOM   6862  C  C    . HIS A  1 481 ? 195.037 99.193  66.917  1.00 75.90  ? 673  HIS A C    1 
ATOM   6863  O  O    . HIS A  1 481 ? 194.694 99.340  68.096  1.00 77.27  ? 673  HIS A O    1 
ATOM   6864  C  CB   . HIS A  1 481 ? 196.693 97.357  67.171  1.00 78.32  ? 673  HIS A CB   1 
ATOM   6865  C  CG   . HIS A  1 481 ? 196.845 95.872  67.260  1.00 82.57  ? 673  HIS A CG   1 
ATOM   6866  N  ND1  . HIS A  1 481 ? 197.823 95.179  66.580  1.00 87.31  ? 673  HIS A ND1  1 
ATOM   6867  C  CD2  . HIS A  1 481 ? 196.129 94.943  67.937  1.00 86.62  ? 673  HIS A CD2  1 
ATOM   6868  C  CE1  . HIS A  1 481 ? 197.710 93.889  66.843  1.00 89.03  ? 673  HIS A CE1  1 
ATOM   6869  N  NE2  . HIS A  1 481 ? 196.689 93.719  67.663  1.00 88.87  ? 673  HIS A NE2  1 
ATOM   6870  H  H    . HIS A  1 481 ? 196.130 98.277  64.663  1.00 83.61  ? 673  HIS A H    1 
ATOM   6871  H  HA   . HIS A  1 481 ? 194.707 97.198  66.703  1.00 90.98  ? 673  HIS A HA   1 
ATOM   6872  H  HB2  . HIS A  1 481 ? 197.465 97.707  66.698  1.00 93.74  ? 673  HIS A HB2  1 
ATOM   6873  H  HB3  . HIS A  1 481 ? 196.673 97.709  68.074  1.00 93.74  ? 673  HIS A HB3  1 
ATOM   6874  H  HD2  . HIS A  1 481 ? 195.398 95.105  68.489  1.00 103.69 ? 673  HIS A HD2  1 
ATOM   6875  H  HE1  . HIS A  1 481 ? 198.255 93.215  66.506  1.00 106.59 ? 673  HIS A HE1  1 
ATOM   6876  H  HE2  . HIS A  1 481 ? 196.419 92.965  67.975  1.00 106.40 ? 673  HIS A HE2  1 
ATOM   6877  N  N    . SER A  1 482 ? 195.071 100.209 66.059  1.00 68.53  ? 674  SER A N    1 
ATOM   6878  C  CA   . SER A  1 482 ? 194.660 101.551 66.441  1.00 69.10  ? 674  SER A CA   1 
ATOM   6879  C  C    . SER A  1 482 ? 193.934 102.201 65.274  1.00 68.09  ? 674  SER A C    1 
ATOM   6880  O  O    . SER A  1 482 ? 194.183 101.879 64.109  1.00 69.11  ? 674  SER A O    1 
ATOM   6881  C  CB   . SER A  1 482 ? 195.857 102.408 66.872  1.00 71.38  ? 674  SER A CB   1 
ATOM   6882  O  OG   . SER A  1 482 ? 196.871 102.401 65.883  1.00 77.68  ? 674  SER A OG   1 
ATOM   6883  H  H    . SER A  1 482 ? 195.332 100.143 65.242  1.00 81.99  ? 674  SER A H    1 
ATOM   6884  H  HA   . SER A  1 482 ? 194.043 101.495 67.188  1.00 82.67  ? 674  SER A HA   1 
ATOM   6885  H  HB2  . SER A  1 482 ? 195.558 103.320 67.010  1.00 85.40  ? 674  SER A HB2  1 
ATOM   6886  H  HB3  . SER A  1 482 ? 196.220 102.050 67.697  1.00 85.40  ? 674  SER A HB3  1 
ATOM   6887  H  HG   . SER A  1 482 ? 197.140 101.616 65.753  1.00 92.97  ? 674  SER A HG   1 
ATOM   6888  N  N    . LEU A  1 483 ? 193.024 103.116 65.601  1.00 65.84  ? 675  LEU A N    1 
ATOM   6889  C  CA   . LEU A  1 483 ? 192.101 103.662 64.616  1.00 65.76  ? 675  LEU A CA   1 
ATOM   6890  C  C    . LEU A  1 483 ? 191.470 104.919 65.197  1.00 68.81  ? 675  LEU A C    1 
ATOM   6891  O  O    . LEU A  1 483 ? 190.946 104.880 66.314  1.00 70.65  ? 675  LEU A O    1 
ATOM   6892  C  CB   . LEU A  1 483 ? 191.035 102.615 64.278  1.00 68.62  ? 675  LEU A CB   1 
ATOM   6893  C  CG   . LEU A  1 483 ? 190.319 102.673 62.935  1.00 73.87  ? 675  LEU A CG   1 
ATOM   6894  C  CD1  . LEU A  1 483 ? 190.155 101.256 62.405  1.00 71.97  ? 675  LEU A CD1  1 
ATOM   6895  C  CD2  . LEU A  1 483 ? 188.979 103.350 63.068  1.00 76.40  ? 675  LEU A CD2  1 
ATOM   6896  H  H    . LEU A  1 483 ? 192.923 103.438 66.392  1.00 78.76  ? 675  LEU A H    1 
ATOM   6897  H  HA   . LEU A  1 483 ? 192.582 103.896 63.806  1.00 78.66  ? 675  LEU A HA   1 
ATOM   6898  H  HB2  . LEU A  1 483 ? 191.457 101.743 64.328  1.00 82.09  ? 675  LEU A HB2  1 
ATOM   6899  H  HB3  . LEU A  1 483 ? 190.348 102.669 64.960  1.00 82.09  ? 675  LEU A HB3  1 
ATOM   6900  H  HG   . LEU A  1 483 ? 190.857 103.177 62.304  1.00 88.40  ? 675  LEU A HG   1 
ATOM   6901  H  HD11 . LEU A  1 483 ? 189.699 101.290 61.550  1.00 86.11  ? 675  LEU A HD11 1 
ATOM   6902  H  HD12 . LEU A  1 483 ? 191.032 100.856 62.297  1.00 86.11  ? 675  LEU A HD12 1 
ATOM   6903  H  HD13 . LEU A  1 483 ? 189.632 100.741 63.039  1.00 86.11  ? 675  LEU A HD13 1 
ATOM   6904  H  HD21 . LEU A  1 483 ? 188.549 103.371 62.199  1.00 91.43  ? 675  LEU A HD21 1 
ATOM   6905  H  HD22 . LEU A  1 483 ? 188.434 102.850 63.696  1.00 91.43  ? 675  LEU A HD22 1 
ATOM   6906  H  HD23 . LEU A  1 483 ? 189.113 104.254 63.394  1.00 91.43  ? 675  LEU A HD23 1 
ATOM   6907  N  N    . THR A  1 484 ? 191.516 106.025 64.453  1.00 71.88  ? 676  THR A N    1 
ATOM   6908  C  CA   . THR A  1 484 ? 190.938 107.270 64.946  1.00 70.96  ? 676  THR A CA   1 
ATOM   6909  C  C    . THR A  1 484 ? 190.584 108.176 63.776  1.00 70.64  ? 676  THR A C    1 
ATOM   6910  O  O    . THR A  1 484 ? 191.283 108.202 62.759  1.00 68.70  ? 676  THR A O    1 
ATOM   6911  C  CB   . THR A  1 484 ? 191.893 107.997 65.906  1.00 74.85  ? 676  THR A CB   1 
ATOM   6912  O  OG1  . THR A  1 484 ? 191.167 108.986 66.646  1.00 79.76  ? 676  THR A OG1  1 
ATOM   6913  C  CG2  . THR A  1 484 ? 193.033 108.684 65.148  1.00 77.48  ? 676  THR A CG2  1 
ATOM   6914  H  H    . THR A  1 484 ? 191.870 106.079 63.671  1.00 86.00  ? 676  THR A H    1 
ATOM   6915  H  HA   . THR A  1 484 ? 190.121 107.070 65.430  1.00 84.91  ? 676  THR A HA   1 
ATOM   6916  H  HB   . THR A  1 484 ? 192.279 107.355 66.522  1.00 89.58  ? 676  THR A HB   1 
ATOM   6917  H  HG1  . THR A  1 484 ? 191.684 109.387 67.172  1.00 95.47  ? 676  THR A HG1  1 
ATOM   6918  H  HG21 . THR A  1 484 ? 193.621 109.135 65.773  1.00 92.72  ? 676  THR A HG21 1 
ATOM   6919  H  HG22 . THR A  1 484 ? 193.545 108.025 64.653  1.00 92.72  ? 676  THR A HG22 1 
ATOM   6920  H  HG23 . THR A  1 484 ? 192.673 109.336 64.527  1.00 92.72  ? 676  THR A HG23 1 
ATOM   6921  N  N    . PHE A  1 485 ? 189.492 108.920 63.938  1.00 69.56  ? 677  PHE A N    1 
ATOM   6922  C  CA   . PHE A  1 485 ? 189.070 109.919 62.966  1.00 66.65  ? 677  PHE A CA   1 
ATOM   6923  C  C    . PHE A  1 485 ? 189.622 111.288 63.335  1.00 68.27  ? 677  PHE A C    1 
ATOM   6924  O  O    . PHE A  1 485 ? 189.830 111.602 64.511  1.00 66.87  ? 677  PHE A O    1 
ATOM   6925  C  CB   . PHE A  1 485 ? 187.544 110.012 62.890  1.00 72.90  ? 677  PHE A CB   1 
ATOM   6926  C  CG   . PHE A  1 485 ? 186.888 108.837 62.229  1.00 72.03  ? 677  PHE A CG   1 
ATOM   6927  C  CD1  . PHE A  1 485 ? 186.519 107.728 62.967  1.00 69.76  ? 677  PHE A CD1  1 
ATOM   6928  C  CD2  . PHE A  1 485 ? 186.620 108.853 60.870  1.00 71.34  ? 677  PHE A CD2  1 
ATOM   6929  C  CE1  . PHE A  1 485 ? 185.905 106.650 62.362  1.00 69.36  ? 677  PHE A CE1  1 
ATOM   6930  C  CE2  . PHE A  1 485 ? 186.008 107.778 60.258  1.00 68.25  ? 677  PHE A CE2  1 
ATOM   6931  C  CZ   . PHE A  1 485 ? 185.650 106.675 61.004  1.00 67.68  ? 677  PHE A CZ   1 
ATOM   6932  H  H    . PHE A  1 485 ? 188.970 108.861 64.619  1.00 83.22  ? 677  PHE A H    1 
ATOM   6933  H  HA   . PHE A  1 485 ? 189.407 109.678 62.089  1.00 79.74  ? 677  PHE A HA   1 
ATOM   6934  H  HB2  . PHE A  1 485 ? 187.191 110.079 63.791  1.00 87.24  ? 677  PHE A HB2  1 
ATOM   6935  H  HB3  . PHE A  1 485 ? 187.306 110.806 62.385  1.00 87.24  ? 677  PHE A HB3  1 
ATOM   6936  H  HD1  . PHE A  1 485 ? 186.689 107.706 63.881  1.00 83.46  ? 677  PHE A HD1  1 
ATOM   6937  H  HD2  . PHE A  1 485 ? 186.861 109.595 60.363  1.00 85.35  ? 677  PHE A HD2  1 
ATOM   6938  H  HE1  . PHE A  1 485 ? 185.665 105.906 62.866  1.00 82.99  ? 677  PHE A HE1  1 
ATOM   6939  H  HE2  . PHE A  1 485 ? 185.837 107.798 59.344  1.00 81.65  ? 677  PHE A HE2  1 
ATOM   6940  H  HZ   . PHE A  1 485 ? 185.237 105.949 60.594  1.00 80.96  ? 677  PHE A HZ   1 
ATOM   6941  N  N    . SER A  1 486 ? 189.861 112.105 62.313  1.00 72.01  ? 678  SER A N    1 
ATOM   6942  C  CA   . SER A  1 486 ? 190.199 113.494 62.569  1.00 72.87  ? 678  SER A CA   1 
ATOM   6943  C  C    . SER A  1 486 ? 188.936 114.276 62.930  1.00 74.73  ? 678  SER A C    1 
ATOM   6944  O  O    . SER A  1 486 ? 187.844 113.950 62.459  1.00 75.68  ? 678  SER A O    1 
ATOM   6945  C  CB   . SER A  1 486 ? 190.869 114.118 61.349  1.00 77.98  ? 678  SER A CB   1 
ATOM   6946  O  OG   . SER A  1 486 ? 190.032 114.044 60.208  1.00 77.17  ? 678  SER A OG   1 
ATOM   6947  H  H    . SER A  1 486 ? 189.835 111.884 61.482  1.00 86.16  ? 678  SER A H    1 
ATOM   6948  H  HA   . SER A  1 486 ? 190.816 113.543 63.316  1.00 87.19  ? 678  SER A HA   1 
ATOM   6949  H  HB2  . SER A  1 486 ? 191.060 115.050 61.539  1.00 93.33  ? 678  SER A HB2  1 
ATOM   6950  H  HB3  . SER A  1 486 ? 191.694 113.642 61.166  1.00 93.33  ? 678  SER A HB3  1 
ATOM   6951  H  HG   . SER A  1 486 ? 189.313 114.454 60.352  1.00 92.35  ? 678  SER A HG   1 
ATOM   6952  N  N    . PRO A  1 487 ? 189.054 115.310 63.768  1.00 78.24  ? 679  PRO A N    1 
ATOM   6953  C  CA   . PRO A  1 487 ? 187.843 116.027 64.204  1.00 76.88  ? 679  PRO A CA   1 
ATOM   6954  C  C    . PRO A  1 487 ? 187.035 116.631 63.068  1.00 80.18  ? 679  PRO A C    1 
ATOM   6955  O  O    . PRO A  1 487 ? 185.804 116.713 63.178  1.00 83.58  ? 679  PRO A O    1 
ATOM   6956  C  CB   . PRO A  1 487 ? 188.398 117.112 65.138  1.00 79.82  ? 679  PRO A CB   1 
ATOM   6957  C  CG   . PRO A  1 487 ? 189.712 116.593 65.591  1.00 81.36  ? 679  PRO A CG   1 
ATOM   6958  C  CD   . PRO A  1 487 ? 190.264 115.821 64.435  1.00 81.55  ? 679  PRO A CD   1 
ATOM   6959  H  HA   . PRO A  1 487 ? 187.272 115.433 64.715  1.00 92.01  ? 679  PRO A HA   1 
ATOM   6960  H  HB2  . PRO A  1 487 ? 188.507 117.942 64.648  1.00 95.53  ? 679  PRO A HB2  1 
ATOM   6961  H  HB3  . PRO A  1 487 ? 187.798 117.234 65.891  1.00 95.53  ? 679  PRO A HB3  1 
ATOM   6962  H  HG2  . PRO A  1 487 ? 190.296 117.335 65.815  1.00 97.39  ? 679  PRO A HG2  1 
ATOM   6963  H  HG3  . PRO A  1 487 ? 189.586 116.014 66.359  1.00 97.39  ? 679  PRO A HG3  1 
ATOM   6964  H  HD2  . PRO A  1 487 ? 190.757 116.408 63.840  1.00 97.62  ? 679  PRO A HD2  1 
ATOM   6965  H  HD3  . PRO A  1 487 ? 190.814 115.087 64.749  1.00 97.62  ? 679  PRO A HD3  1 
ATOM   6966  N  N    . ASN A  1 488 ? 187.675 117.064 61.983  1.00 79.14  ? 680  ASN A N    1 
ATOM   6967  C  CA   . ASN A  1 488 ? 186.948 117.672 60.875  1.00 79.19  ? 680  ASN A CA   1 
ATOM   6968  C  C    . ASN A  1 488 ? 186.192 116.652 60.029  1.00 80.71  ? 680  ASN A C    1 
ATOM   6969  O  O    . ASN A  1 488 ? 185.475 117.051 59.104  1.00 80.58  ? 680  ASN A O    1 
ATOM   6970  C  CB   . ASN A  1 488 ? 187.905 118.484 59.994  1.00 82.51  ? 680  ASN A CB   1 
ATOM   6971  C  CG   . ASN A  1 488 ? 189.005 117.640 59.380  1.00 84.49  ? 680  ASN A CG   1 
ATOM   6972  O  OD1  . ASN A  1 488 ? 188.941 116.410 59.382  1.00 83.56  ? 680  ASN A OD1  1 
ATOM   6973  N  ND2  . ASN A  1 488 ? 190.024 118.305 58.845  1.00 85.33  ? 680  ASN A ND2  1 
ATOM   6974  H  H    . ASN A  1 488 ? 188.526 117.016 61.866  1.00 94.72  ? 680  ASN A H    1 
ATOM   6975  H  HA   . ASN A  1 488 ? 186.294 118.288 61.240  1.00 94.77  ? 680  ASN A HA   1 
ATOM   6976  H  HB2  . ASN A  1 488 ? 187.400 118.890 59.272  1.00 98.77  ? 680  ASN A HB2  1 
ATOM   6977  H  HB3  . ASN A  1 488 ? 188.322 119.173 60.534  1.00 98.77  ? 680  ASN A HB3  1 
ATOM   6978  H  HD21 . ASN A  1 488 ? 190.675 117.875 58.483  1.00 102.15 ? 680  ASN A HD21 1 
ATOM   6979  H  HD22 . ASN A  1 488 ? 190.033 119.164 58.863  1.00 102.15 ? 680  ASN A HD22 1 
ATOM   6980  N  N    . GLY A  1 489 ? 186.336 115.358 60.315  1.00 80.29  ? 681  GLY A N    1 
ATOM   6981  C  CA   . GLY A  1 489 ? 185.582 114.328 59.633  1.00 80.21  ? 681  GLY A CA   1 
ATOM   6982  C  C    . GLY A  1 489 ? 186.101 113.938 58.268  1.00 80.74  ? 681  GLY A C    1 
ATOM   6983  O  O    . GLY A  1 489 ? 185.524 113.041 57.641  1.00 78.59  ? 681  GLY A O    1 
ATOM   6984  H  H    . GLY A  1 489 ? 186.876 115.055 60.911  1.00 96.10  ? 681  GLY A H    1 
ATOM   6985  H  HA2  . GLY A  1 489 ? 185.571 113.531 60.186  1.00 96.00  ? 681  GLY A HA2  1 
ATOM   6986  H  HA3  . GLY A  1 489 ? 184.666 114.630 59.527  1.00 96.00  ? 681  GLY A HA3  1 
ATOM   6987  N  N    . ARG A  1 490 ? 187.171 114.571 57.790  1.00 84.16  ? 682  ARG A N    1 
ATOM   6988  C  CA   . ARG A  1 490 ? 187.686 114.312 56.451  1.00 79.80  ? 682  ARG A CA   1 
ATOM   6989  C  C    . ARG A  1 490 ? 188.669 113.152 56.395  1.00 78.43  ? 682  ARG A C    1 
ATOM   6990  O  O    . ARG A  1 490 ? 188.798 112.516 55.341  1.00 77.76  ? 682  ARG A O    1 
ATOM   6991  C  CB   . ARG A  1 490 ? 188.377 115.563 55.906  1.00 82.00  ? 682  ARG A CB   1 
ATOM   6992  C  CG   . ARG A  1 490 ? 187.463 116.757 55.701  1.00 85.98  ? 682  ARG A CG   1 
ATOM   6993  C  CD   . ARG A  1 490 ? 188.283 117.994 55.386  1.00 91.88  ? 682  ARG A CD   1 
ATOM   6994  N  NE   . ARG A  1 490 ? 189.146 117.791 54.225  1.00 95.45  ? 682  ARG A NE   1 
ATOM   6995  C  CZ   . ARG A  1 490 ? 190.261 118.476 53.987  1.00 98.23  ? 682  ARG A CZ   1 
ATOM   6996  N  NH1  . ARG A  1 490 ? 190.668 119.416 54.832  1.00 98.60  ? 682  ARG A NH1  1 
ATOM   6997  N  NH2  . ARG A  1 490 ? 190.981 118.215 52.902  1.00 97.72  ? 682  ARG A NH2  1 
ATOM   6998  H  H    . ARG A  1 490 ? 187.619 115.161 58.227  1.00 100.74 ? 682  ARG A H    1 
ATOM   6999  H  HA   . ARG A  1 490 ? 186.942 114.102 55.865  1.00 95.51  ? 682  ARG A HA   1 
ATOM   7000  H  HB2  . ARG A  1 490 ? 189.071 115.828 56.529  1.00 98.15  ? 682  ARG A HB2  1 
ATOM   7001  H  HB3  . ARG A  1 490 ? 188.774 115.347 55.048  1.00 98.15  ? 682  ARG A HB3  1 
ATOM   7002  H  HG2  . ARG A  1 490 ? 186.866 116.585 54.957  1.00 102.92 ? 682  ARG A HG2  1 
ATOM   7003  H  HG3  . ARG A  1 490 ? 186.957 116.922 56.512  1.00 102.92 ? 682  ARG A HG3  1 
ATOM   7004  H  HD2  . ARG A  1 490 ? 187.685 118.732 55.193  1.00 110.00 ? 682  ARG A HD2  1 
ATOM   7005  H  HD3  . ARG A  1 490 ? 188.844 118.207 56.148  1.00 110.00 ? 682  ARG A HD3  1 
ATOM   7006  H  HE   . ARG A  1 490 ? 188.918 117.186 53.657  1.00 114.29 ? 682  ARG A HE   1 
ATOM   7007  H  HH11 . ARG A  1 490 ? 190.207 119.589 55.537  1.00 118.07 ? 682  ARG A HH11 1 
ATOM   7008  H  HH12 . ARG A  1 490 ? 191.390 119.855 54.673  1.00 118.07 ? 682  ARG A HH12 1 
ATOM   7009  H  HH21 . ARG A  1 490 ? 190.723 117.607 52.352  1.00 117.02 ? 682  ARG A HH21 1 
ATOM   7010  H  HH22 . ARG A  1 490 ? 191.702 118.657 52.748  1.00 117.02 ? 682  ARG A HH22 1 
ATOM   7011  N  N    . PHE A  1 491 ? 189.363 112.855 57.491  1.00 74.58  ? 683  PHE A N    1 
ATOM   7012  C  CA   . PHE A  1 491 ? 190.496 111.945 57.455  1.00 69.60  ? 683  PHE A CA   1 
ATOM   7013  C  C    . PHE A  1 491 ? 190.356 110.850 58.501  1.00 73.30  ? 683  PHE A C    1 
ATOM   7014  O  O    . PHE A  1 491 ? 189.568 110.944 59.446  1.00 72.23  ? 683  PHE A O    1 
ATOM   7015  C  CB   . PHE A  1 491 ? 191.810 112.700 57.672  1.00 69.67  ? 683  PHE A CB   1 
ATOM   7016  C  CG   . PHE A  1 491 ? 192.021 113.814 56.697  1.00 68.79  ? 683  PHE A CG   1 
ATOM   7017  C  CD1  . PHE A  1 491 ? 192.358 113.542 55.383  1.00 70.42  ? 683  PHE A CD1  1 
ATOM   7018  C  CD2  . PHE A  1 491 ? 191.865 115.130 57.087  1.00 66.54  ? 683  PHE A CD2  1 
ATOM   7019  C  CE1  . PHE A  1 491 ? 192.546 114.563 54.478  1.00 72.46  ? 683  PHE A CE1  1 
ATOM   7020  C  CE2  . PHE A  1 491 ? 192.052 116.158 56.188  1.00 74.18  ? 683  PHE A CE2  1 
ATOM   7021  C  CZ   . PHE A  1 491 ? 192.392 115.874 54.879  1.00 75.72  ? 683  PHE A CZ   1 
ATOM   7022  H  H    . PHE A  1 491 ? 189.194 113.172 58.272  1.00 89.25  ? 683  PHE A H    1 
ATOM   7023  H  HA   . PHE A  1 491 ? 190.533 111.522 56.582  1.00 83.28  ? 683  PHE A HA   1 
ATOM   7024  H  HB2  . PHE A  1 491 ? 191.809 113.081 58.564  1.00 83.35  ? 683  PHE A HB2  1 
ATOM   7025  H  HB3  . PHE A  1 491 ? 192.548 112.078 57.579  1.00 83.35  ? 683  PHE A HB3  1 
ATOM   7026  H  HD1  . PHE A  1 491 ? 192.462 112.660 55.109  1.00 84.26  ? 683  PHE A HD1  1 
ATOM   7027  H  HD2  . PHE A  1 491 ? 191.636 115.325 57.967  1.00 79.60  ? 683  PHE A HD2  1 
ATOM   7028  H  HE1  . PHE A  1 491 ? 192.776 114.369 53.598  1.00 86.71  ? 683  PHE A HE1  1 
ATOM   7029  H  HE2  . PHE A  1 491 ? 191.948 117.040 56.461  1.00 88.77  ? 683  PHE A HE2  1 
ATOM   7030  H  HZ   . PHE A  1 491 ? 192.520 116.566 54.271  1.00 90.62  ? 683  PHE A HZ   1 
ATOM   7031  N  N    . LEU A  1 492 ? 191.149 109.800 58.302  1.00 73.20  ? 684  LEU A N    1 
ATOM   7032  C  CA   . LEU A  1 492 ? 191.180 108.639 59.177  1.00 69.30  ? 684  LEU A CA   1 
ATOM   7033  C  C    . LEU A  1 492 ? 192.628 108.199 59.317  1.00 71.93  ? 684  LEU A C    1 
ATOM   7034  O  O    . LEU A  1 492 ? 193.339 108.086 58.314  1.00 73.19  ? 684  LEU A O    1 
ATOM   7035  C  CB   . LEU A  1 492 ? 190.325 107.501 58.606  1.00 69.63  ? 684  LEU A CB   1 
ATOM   7036  C  CG   . LEU A  1 492 ? 190.246 106.184 59.381  1.00 69.85  ? 684  LEU A CG   1 
ATOM   7037  C  CD1  . LEU A  1 492 ? 189.481 106.355 60.684  1.00 72.10  ? 684  LEU A CD1  1 
ATOM   7038  C  CD2  . LEU A  1 492 ? 189.605 105.113 58.518  1.00 64.22  ? 684  LEU A CD2  1 
ATOM   7039  H  H    . LEU A  1 492 ? 191.697 109.739 57.642  1.00 87.59  ? 684  LEU A H    1 
ATOM   7040  H  HA   . LEU A  1 492 ? 190.840 108.878 60.053  1.00 82.92  ? 684  LEU A HA   1 
ATOM   7041  H  HB2  . LEU A  1 492 ? 189.416 107.829 58.519  1.00 83.31  ? 684  LEU A HB2  1 
ATOM   7042  H  HB3  . LEU A  1 492 ? 190.668 107.287 57.724  1.00 83.31  ? 684  LEU A HB3  1 
ATOM   7043  H  HG   . LEU A  1 492 ? 191.146 105.893 59.599  1.00 83.57  ? 684  LEU A HG   1 
ATOM   7044  H  HD11 . LEU A  1 492 ? 189.452 105.503 61.147  1.00 86.27  ? 684  LEU A HD11 1 
ATOM   7045  H  HD12 . LEU A  1 492 ? 189.935 107.014 61.233  1.00 86.27  ? 684  LEU A HD12 1 
ATOM   7046  H  HD13 . LEU A  1 492 ? 188.580 106.654 60.484  1.00 86.27  ? 684  LEU A HD13 1 
ATOM   7047  H  HD21 . LEU A  1 492 ? 189.562 104.286 59.022  1.00 76.82  ? 684  LEU A HD21 1 
ATOM   7048  H  HD22 . LEU A  1 492 ? 188.711 105.399 58.273  1.00 76.82  ? 684  LEU A HD22 1 
ATOM   7049  H  HD23 . LEU A  1 492 ? 190.142 104.988 57.720  1.00 76.82  ? 684  LEU A HD23 1 
ATOM   7050  N  N    . ALA A  1 493 ? 193.066 107.969 60.550  1.00 74.67  ? 685  ALA A N    1 
ATOM   7051  C  CA   . ALA A  1 493 ? 194.415 107.501 60.828  1.00 73.60  ? 685  ALA A CA   1 
ATOM   7052  C  C    . ALA A  1 493 ? 194.348 106.108 61.436  1.00 74.54  ? 685  ALA A C    1 
ATOM   7053  O  O    . ALA A  1 493 ? 193.512 105.840 62.305  1.00 75.96  ? 685  ALA A O    1 
ATOM   7054  C  CB   . ALA A  1 493 ? 195.149 108.451 61.778  1.00 74.16  ? 685  ALA A CB   1 
ATOM   7055  H  H    . ALA A  1 493 ? 192.588 108.080 61.256  1.00 89.36  ? 685  ALA A H    1 
ATOM   7056  H  HA   . ALA A  1 493 ? 194.916 107.450 59.999  1.00 88.07  ? 685  ALA A HA   1 
ATOM   7057  H  HB1  . ALA A  1 493 ? 196.042 108.108 61.940  1.00 88.74  ? 685  ALA A HB1  1 
ATOM   7058  H  HB2  . ALA A  1 493 ? 195.200 109.329 61.368  1.00 88.74  ? 685  ALA A HB2  1 
ATOM   7059  H  HB3  . ALA A  1 493 ? 194.658 108.504 62.613  1.00 88.74  ? 685  ALA A HB3  1 
ATOM   7060  N  N    . THR A  1 494 ? 195.228 105.222 60.974  1.00 74.23  ? 686  THR A N    1 
ATOM   7061  C  CA   . THR A  1 494 ? 195.221 103.837 61.417  1.00 75.96  ? 686  THR A CA   1 
ATOM   7062  C  C    . THR A  1 494 ? 196.648 103.371 61.659  1.00 75.37  ? 686  THR A C    1 
ATOM   7063  O  O    . THR A  1 494 ? 197.587 103.818 60.994  1.00 74.90  ? 686  THR A O    1 
ATOM   7064  C  CB   . THR A  1 494 ? 194.529 102.920 60.396  1.00 76.21  ? 686  THR A CB   1 
ATOM   7065  O  OG1  . THR A  1 494 ? 195.211 102.984 59.139  1.00 75.05  ? 686  THR A OG1  1 
ATOM   7066  C  CG2  . THR A  1 494 ? 193.083 103.344 60.198  1.00 79.51  ? 686  THR A CG2  1 
ATOM   7067  H  H    . THR A  1 494 ? 195.842 105.402 60.400  1.00 88.82  ? 686  THR A H    1 
ATOM   7068  H  HA   . THR A  1 494 ? 194.737 103.774 62.255  1.00 90.90  ? 686  THR A HA   1 
ATOM   7069  H  HB   . THR A  1 494 ? 194.539 102.006 60.722  1.00 91.20  ? 686  THR A HB   1 
ATOM   7070  H  HG1  . THR A  1 494 ? 196.008 102.737 59.231  1.00 89.81  ? 686  THR A HG1  1 
ATOM   7071  H  HG21 . THR A  1 494 ? 192.652 102.762 59.553  1.00 95.16  ? 686  THR A HG21 1 
ATOM   7072  H  HG22 . THR A  1 494 ? 192.604 103.292 61.040  1.00 95.16  ? 686  THR A HG22 1 
ATOM   7073  H  HG23 . THR A  1 494 ? 193.048 104.257 59.872  1.00 95.16  ? 686  THR A HG23 1 
ATOM   7074  N  N    . GLY A  1 495 ? 196.794 102.471 62.621  1.00 71.53  ? 687  GLY A N    1 
ATOM   7075  C  CA   . GLY A  1 495 ? 198.092 101.915 62.958  1.00 73.39  ? 687  GLY A CA   1 
ATOM   7076  C  C    . GLY A  1 495 ? 197.986 100.419 63.154  1.00 72.54  ? 687  GLY A C    1 
ATOM   7077  O  O    . GLY A  1 495 ? 196.947 99.897  63.565  1.00 69.85  ? 687  GLY A O    1 
ATOM   7078  H  H    . GLY A  1 495 ? 196.148 102.164 63.098  1.00 85.58  ? 687  GLY A H    1 
ATOM   7079  H  HA2  . GLY A  1 495 ? 198.723 102.095 62.243  1.00 87.82  ? 687  GLY A HA2  1 
ATOM   7080  H  HA3  . GLY A  1 495 ? 198.421 102.317 63.777  1.00 87.82  ? 687  GLY A HA3  1 
ATOM   7081  N  N    . ALA A  1 496 ? 199.082 99.727  62.850  1.00 71.93  ? 688  ALA A N    1 
ATOM   7082  C  CA   . ALA A  1 496 ? 199.101 98.271  62.863  1.00 70.84  ? 688  ALA A CA   1 
ATOM   7083  C  C    . ALA A  1 496 ? 200.415 97.795  63.471  1.00 67.74  ? 688  ALA A C    1 
ATOM   7084  O  O    . ALA A  1 496 ? 201.256 98.594  63.895  1.00 68.33  ? 688  ALA A O    1 
ATOM   7085  C  CB   . ALA A  1 496 ? 198.903 97.712  61.449  1.00 68.67  ? 688  ALA A CB   1 
ATOM   7086  H  H    . ALA A  1 496 ? 199.834 100.083 62.631  1.00 86.07  ? 688  ALA A H    1 
ATOM   7087  H  HA   . ALA A  1 496 ? 198.376 97.949  63.420  1.00 84.76  ? 688  ALA A HA   1 
ATOM   7088  H  HB1  . ALA A  1 496 ? 198.920 96.743  61.488  1.00 82.16  ? 688  ALA A HB1  1 
ATOM   7089  H  HB2  . ALA A  1 496 ? 198.047 98.015  61.108  1.00 82.16  ? 688  ALA A HB2  1 
ATOM   7090  H  HB3  . ALA A  1 496 ? 199.619 98.033  60.879  1.00 82.16  ? 688  ALA A HB3  1 
ATOM   7091  N  N    . THR A  1 497 ? 200.591 96.473  63.507  1.00 71.47  ? 689  THR A N    1 
ATOM   7092  C  CA   . THR A  1 497 ? 201.808 95.879  64.048  1.00 72.23  ? 689  THR A CA   1 
ATOM   7093  C  C    . THR A  1 497 ? 203.039 96.212  63.220  1.00 72.65  ? 689  THR A C    1 
ATOM   7094  O  O    . THR A  1 497 ? 204.158 95.977  63.686  1.00 76.23  ? 689  THR A O    1 
ATOM   7095  C  CB   . THR A  1 497 ? 201.662 94.359  64.138  1.00 74.09  ? 689  THR A CB   1 
ATOM   7096  O  OG1  . THR A  1 497 ? 201.557 93.807  62.820  1.00 75.61  ? 689  THR A OG1  1 
ATOM   7097  C  CG2  . THR A  1 497 ? 200.424 93.978  64.946  1.00 71.72  ? 689  THR A CG2  1 
ATOM   7098  H  H    . THR A  1 497 ? 200.017 95.899  63.222  1.00 85.51  ? 689  THR A H    1 
ATOM   7099  H  HA   . THR A  1 497 ? 201.951 96.219  64.945  1.00 86.43  ? 689  THR A HA   1 
ATOM   7100  H  HB   . THR A  1 497 ? 202.441 93.987  64.581  1.00 88.66  ? 689  THR A HB   1 
ATOM   7101  H  HG1  . THR A  1 497 ? 201.477 92.972  62.863  1.00 90.48  ? 689  THR A HG1  1 
ATOM   7102  H  HG21 . THR A  1 497 ? 200.344 93.013  64.995  1.00 85.82  ? 689  THR A HG21 1 
ATOM   7103  H  HG22 . THR A  1 497 ? 200.492 94.336  65.845  1.00 85.82  ? 689  THR A HG22 1 
ATOM   7104  H  HG23 . THR A  1 497 ? 199.629 94.339  64.522  1.00 85.82  ? 689  THR A HG23 1 
ATOM   7105  N  N    . ASP A  1 498 ? 202.860 96.744  62.012  1.00 69.14  ? 690  ASP A N    1 
ATOM   7106  C  CA   . ASP A  1 498 ? 203.986 97.129  61.172  1.00 67.87  ? 690  ASP A CA   1 
ATOM   7107  C  C    . ASP A  1 498 ? 204.659 98.412  61.642  1.00 70.07  ? 690  ASP A C    1 
ATOM   7108  O  O    . ASP A  1 498 ? 205.695 98.786  61.084  1.00 71.67  ? 690  ASP A O    1 
ATOM   7109  C  CB   . ASP A  1 498 ? 203.519 97.281  59.721  1.00 71.52  ? 690  ASP A CB   1 
ATOM   7110  C  CG   . ASP A  1 498 ? 202.354 98.245  59.578  1.00 74.93  ? 690  ASP A CG   1 
ATOM   7111  O  OD1  . ASP A  1 498 ? 202.015 98.928  60.568  1.00 76.94  ? 690  ASP A OD1  1 
ATOM   7112  O  OD2  . ASP A  1 498 ? 201.767 98.310  58.476  1.00 74.31  ? 690  ASP A OD2  1 
ATOM   7113  H  H    . ASP A  1 498 ? 202.091 96.893  61.656  1.00 82.72  ? 690  ASP A H    1 
ATOM   7114  H  HA   . ASP A  1 498 ? 204.649 96.422  61.197  1.00 81.19  ? 690  ASP A HA   1 
ATOM   7115  H  HB2  . ASP A  1 498 ? 204.254 97.617  59.186  1.00 85.57  ? 690  ASP A HB2  1 
ATOM   7116  H  HB3  . ASP A  1 498 ? 203.234 96.415  59.389  1.00 85.57  ? 690  ASP A HB3  1 
ATOM   7117  N  N    . GLY A  1 499 ? 204.103 99.089  62.644  1.00 77.35  ? 691  GLY A N    1 
ATOM   7118  C  CA   . GLY A  1 499 ? 204.698 100.302 63.163  1.00 78.35  ? 691  GLY A CA   1 
ATOM   7119  C  C    . GLY A  1 499 ? 204.421 101.547 62.355  1.00 78.08  ? 691  GLY A C    1 
ATOM   7120  O  O    . GLY A  1 499 ? 204.972 102.606 62.673  1.00 83.76  ? 691  GLY A O    1 
ATOM   7121  H  H    . GLY A  1 499 ? 203.375 98.859  63.039  1.00 92.57  ? 691  GLY A H    1 
ATOM   7122  H  HA2  . GLY A  1 499 ? 204.369 100.452 64.064  1.00 93.77  ? 691  GLY A HA2  1 
ATOM   7123  H  HA3  . GLY A  1 499 ? 205.659 100.185 63.211  1.00 93.77  ? 691  GLY A HA3  1 
ATOM   7124  N  N    . ARG A  1 500 ? 203.582 101.461 61.330  1.00 74.03  ? 692  ARG A N    1 
ATOM   7125  C  CA   . ARG A  1 500 ? 203.266 102.603 60.488  1.00 73.24  ? 692  ARG A CA   1 
ATOM   7126  C  C    . ARG A  1 500 ? 201.915 103.190 60.868  1.00 73.93  ? 692  ARG A C    1 
ATOM   7127  O  O    . ARG A  1 500 ? 200.998 102.477 61.285  1.00 72.20  ? 692  ARG A O    1 
ATOM   7128  C  CB   . ARG A  1 500 ? 203.238 102.207 59.010  1.00 74.79  ? 692  ARG A CB   1 
ATOM   7129  C  CG   . ARG A  1 500 ? 204.581 101.816 58.420  1.00 77.92  ? 692  ARG A CG   1 
ATOM   7130  C  CD   . ARG A  1 500 ? 204.462 101.591 56.920  1.00 76.28  ? 692  ARG A CD   1 
ATOM   7131  N  NE   . ARG A  1 500 ? 203.459 100.578 56.606  1.00 78.81  ? 692  ARG A NE   1 
ATOM   7132  C  CZ   . ARG A  1 500 ? 202.761 100.523 55.475  1.00 78.63  ? 692  ARG A CZ   1 
ATOM   7133  N  NH1  . ARG A  1 500 ? 202.939 101.427 54.519  1.00 74.35  ? 692  ARG A NH1  1 
ATOM   7134  N  NH2  . ARG A  1 500 ? 201.872 99.555  55.300  1.00 81.47  ? 692  ARG A NH2  1 
ATOM   7135  H  H    . ARG A  1 500 ? 203.176 100.739 61.099  1.00 88.59  ? 692  ARG A H    1 
ATOM   7136  H  HA   . ARG A  1 500 ? 203.942 103.288 60.609  1.00 87.64  ? 692  ARG A HA   1 
ATOM   7137  H  HB2  . ARG A  1 500 ? 202.641 101.449 58.906  1.00 89.50  ? 692  ARG A HB2  1 
ATOM   7138  H  HB3  . ARG A  1 500 ? 202.901 102.958 58.497  1.00 89.50  ? 692  ARG A HB3  1 
ATOM   7139  H  HG2  . ARG A  1 500 ? 205.221 102.528 58.574  1.00 93.26  ? 692  ARG A HG2  1 
ATOM   7140  H  HG3  . ARG A  1 500 ? 204.886 100.991 58.830  1.00 93.26  ? 692  ARG A HG3  1 
ATOM   7141  H  HD2  . ARG A  1 500 ? 204.200 102.421 56.492  1.00 91.29  ? 692  ARG A HD2  1 
ATOM   7142  H  HD3  . ARG A  1 500 ? 205.317 101.290 56.573  1.00 91.29  ? 692  ARG A HD3  1 
ATOM   7143  H  HE   . ARG A  1 500 ? 203.308 99.971  57.197  1.00 94.33  ? 692  ARG A HE   1 
ATOM   7144  H  HH11 . ARG A  1 500 ? 203.513 102.058 54.626  1.00 88.97  ? 692  ARG A HH11 1 
ATOM   7145  H  HH12 . ARG A  1 500 ? 202.481 101.381 53.793  1.00 88.97  ? 692  ARG A HH12 1 
ATOM   7146  H  HH21 . ARG A  1 500 ? 201.751 98.966  55.915  1.00 97.51  ? 692  ARG A HH21 1 
ATOM   7147  H  HH22 . ARG A  1 500 ? 201.418 99.514  54.571  1.00 97.51  ? 692  ARG A HH22 1 
ATOM   7148  N  N    . VAL A  1 501 ? 201.804 104.506 60.719  1.00 76.60  ? 693  VAL A N    1 
ATOM   7149  C  CA   . VAL A  1 501 ? 200.531 105.208 60.805  1.00 77.90  ? 693  VAL A CA   1 
ATOM   7150  C  C    . VAL A  1 501 ? 200.191 105.684 59.402  1.00 78.97  ? 693  VAL A C    1 
ATOM   7151  O  O    . VAL A  1 501 ? 200.941 106.466 58.804  1.00 81.94  ? 693  VAL A O    1 
ATOM   7152  C  CB   . VAL A  1 501 ? 200.577 106.384 61.793  1.00 78.19  ? 693  VAL A CB   1 
ATOM   7153  C  CG1  . VAL A  1 501 ? 199.200 107.029 61.911  1.00 79.39  ? 693  VAL A CG1  1 
ATOM   7154  C  CG2  . VAL A  1 501 ? 201.060 105.915 63.157  1.00 77.63  ? 693  VAL A CG2  1 
ATOM   7155  H  H    . VAL A  1 501 ? 202.471 105.026 60.563  1.00 91.68  ? 693  VAL A H    1 
ATOM   7156  H  HA   . VAL A  1 501 ? 199.841 104.591 61.095  1.00 93.23  ? 693  VAL A HA   1 
ATOM   7157  H  HB   . VAL A  1 501 ? 201.198 107.053 61.465  1.00 93.58  ? 693  VAL A HB   1 
ATOM   7158  H  HG11 . VAL A  1 501 ? 199.250 107.767 62.538  1.00 95.02  ? 693  VAL A HG11 1 
ATOM   7159  H  HG12 . VAL A  1 501 ? 198.928 107.353 61.038  1.00 95.02  ? 693  VAL A HG12 1 
ATOM   7160  H  HG13 . VAL A  1 501 ? 198.567 106.366 62.229  1.00 95.02  ? 693  VAL A HG13 1 
ATOM   7161  H  HG21 . VAL A  1 501 ? 201.080 106.674 63.762  1.00 92.91  ? 693  VAL A HG21 1 
ATOM   7162  H  HG22 . VAL A  1 501 ? 200.449 105.240 63.493  1.00 92.91  ? 693  VAL A HG22 1 
ATOM   7163  H  HG23 . VAL A  1 501 ? 201.950 105.541 63.065  1.00 92.91  ? 693  VAL A HG23 1 
ATOM   7164  N  N    . LEU A  1 502 ? 199.076 105.198 58.873  1.00 79.27  ? 694  LEU A N    1 
ATOM   7165  C  CA   . LEU A  1 502 ? 198.616 105.562 57.543  1.00 79.94  ? 694  LEU A CA   1 
ATOM   7166  C  C    . LEU A  1 502 ? 197.460 106.546 57.659  1.00 77.91  ? 694  LEU A C    1 
ATOM   7167  O  O    . LEU A  1 502 ? 196.579 106.387 58.509  1.00 77.78  ? 694  LEU A O    1 
ATOM   7168  C  CB   . LEU A  1 502 ? 198.186 104.315 56.767  1.00 79.75  ? 694  LEU A CB   1 
ATOM   7169  C  CG   . LEU A  1 502 ? 199.257 103.219 56.689  1.00 77.33  ? 694  LEU A CG   1 
ATOM   7170  C  CD1  . LEU A  1 502 ? 198.745 101.987 55.954  1.00 76.09  ? 694  LEU A CD1  1 
ATOM   7171  C  CD2  . LEU A  1 502 ? 200.523 103.743 56.026  1.00 77.17  ? 694  LEU A CD2  1 
ATOM   7172  H  H    . LEU A  1 502 ? 198.557 104.642 59.276  1.00 94.87  ? 694  LEU A H    1 
ATOM   7173  H  HA   . LEU A  1 502 ? 199.338 105.991 57.058  1.00 95.68  ? 694  LEU A HA   1 
ATOM   7174  H  HB2  . LEU A  1 502 ? 197.406 103.934 57.199  1.00 95.45  ? 694  LEU A HB2  1 
ATOM   7175  H  HB3  . LEU A  1 502 ? 197.963 104.575 55.860  1.00 95.45  ? 694  LEU A HB3  1 
ATOM   7176  H  HG   . LEU A  1 502 ? 199.489 102.947 57.591  1.00 92.55  ? 694  LEU A HG   1 
ATOM   7177  H  HD11 . LEU A  1 502 ? 199.450 101.321 55.927  1.00 91.06  ? 694  LEU A HD11 1 
ATOM   7178  H  HD12 . LEU A  1 502 ? 197.975 101.635 56.427  1.00 91.06  ? 694  LEU A HD12 1 
ATOM   7179  H  HD13 . LEU A  1 502 ? 198.493 102.240 55.052  1.00 91.06  ? 694  LEU A HD13 1 
ATOM   7180  H  HD21 . LEU A  1 502 ? 201.180 103.030 55.991  1.00 92.36  ? 694  LEU A HD21 1 
ATOM   7181  H  HD22 . LEU A  1 502 ? 200.309 104.041 55.128  1.00 92.36  ? 694  LEU A HD22 1 
ATOM   7182  H  HD23 . LEU A  1 502 ? 200.868 104.485 56.547  1.00 92.36  ? 694  LEU A HD23 1 
ATOM   7183  N  N    . LEU A  1 503 ? 197.473 107.566 56.807  1.00 76.85  ? 695  LEU A N    1 
ATOM   7184  C  CA   . LEU A  1 503 ? 196.448 108.600 56.798  1.00 73.64  ? 695  LEU A CA   1 
ATOM   7185  C  C    . LEU A  1 503 ? 195.591 108.433 55.552  1.00 73.02  ? 695  LEU A C    1 
ATOM   7186  O  O    . LEU A  1 503 ? 196.121 108.326 54.441  1.00 72.92  ? 695  LEU A O    1 
ATOM   7187  C  CB   . LEU A  1 503 ? 197.077 109.993 56.831  1.00 76.76  ? 695  LEU A CB   1 
ATOM   7188  C  CG   . LEU A  1 503 ? 198.115 110.221 57.933  1.00 77.48  ? 695  LEU A CG   1 
ATOM   7189  C  CD1  . LEU A  1 503 ? 198.737 111.600 57.799  1.00 78.98  ? 695  LEU A CD1  1 
ATOM   7190  C  CD2  . LEU A  1 503 ? 197.488 110.047 59.310  1.00 74.76  ? 695  LEU A CD2  1 
ATOM   7191  H  H    . LEU A  1 503 ? 198.081 107.682 56.210  1.00 91.97  ? 695  LEU A H    1 
ATOM   7192  H  HA   . LEU A  1 503 ? 195.880 108.499 57.578  1.00 88.12  ? 695  LEU A HA   1 
ATOM   7193  H  HB2  . LEU A  1 503 ? 197.516 110.152 55.981  1.00 91.86  ? 695  LEU A HB2  1 
ATOM   7194  H  HB3  . LEU A  1 503 ? 196.371 110.646 56.958  1.00 91.86  ? 695  LEU A HB3  1 
ATOM   7195  H  HG   . LEU A  1 503 ? 198.822 109.563 57.841  1.00 92.73  ? 695  LEU A HG   1 
ATOM   7196  H  HD11 . LEU A  1 503 ? 199.390 111.722 58.506  1.00 94.52  ? 695  LEU A HD11 1 
ATOM   7197  H  HD12 . LEU A  1 503 ? 199.170 111.668 56.934  1.00 94.52  ? 695  LEU A HD12 1 
ATOM   7198  H  HD13 . LEU A  1 503 ? 198.039 112.270 57.874  1.00 94.52  ? 695  LEU A HD13 1 
ATOM   7199  H  HD21 . LEU A  1 503 ? 198.166 110.197 59.987  1.00 89.46  ? 695  LEU A HD21 1 
ATOM   7200  H  HD22 . LEU A  1 503 ? 196.770 110.691 59.413  1.00 89.46  ? 695  LEU A HD22 1 
ATOM   7201  H  HD23 . LEU A  1 503 ? 197.137 109.146 59.386  1.00 89.46  ? 695  LEU A HD23 1 
ATOM   7202  N  N    . TRP A  1 504 ? 194.274 108.433 55.738  1.00 69.23  ? 696  TRP A N    1 
ATOM   7203  C  CA   . TRP A  1 504 ? 193.333 108.143 54.666  1.00 71.93  ? 696  TRP A CA   1 
ATOM   7204  C  C    . TRP A  1 504 ? 192.397 109.324 54.460  1.00 72.97  ? 696  TRP A C    1 
ATOM   7205  O  O    . TRP A  1 504 ? 191.856 109.871 55.427  1.00 72.30  ? 696  TRP A O    1 
ATOM   7206  C  CB   . TRP A  1 504 ? 192.514 106.888 54.977  1.00 73.29  ? 696  TRP A CB   1 
ATOM   7207  C  CG   . TRP A  1 504 ? 193.335 105.725 55.425  1.00 75.29  ? 696  TRP A CG   1 
ATOM   7208  C  CD1  . TRP A  1 504 ? 193.618 105.368 56.710  1.00 76.69  ? 696  TRP A CD1  1 
ATOM   7209  C  CD2  . TRP A  1 504 ? 193.985 104.763 54.588  1.00 75.20  ? 696  TRP A CD2  1 
ATOM   7210  N  NE1  . TRP A  1 504 ? 194.404 104.240 56.726  1.00 77.91  ? 696  TRP A NE1  1 
ATOM   7211  C  CE2  . TRP A  1 504 ? 194.644 103.849 55.435  1.00 74.08  ? 696  TRP A CE2  1 
ATOM   7212  C  CE3  . TRP A  1 504 ? 194.075 104.585 53.204  1.00 75.57  ? 696  TRP A CE3  1 
ATOM   7213  C  CZ2  . TRP A  1 504 ? 195.380 102.774 54.945  1.00 72.95  ? 696  TRP A CZ2  1 
ATOM   7214  C  CZ3  . TRP A  1 504 ? 194.809 103.516 52.718  1.00 74.64  ? 696  TRP A CZ3  1 
ATOM   7215  C  CH2  . TRP A  1 504 ? 195.450 102.625 53.586  1.00 73.23  ? 696  TRP A CH2  1 
ATOM   7216  H  H    . TRP A  1 504 ? 193.896 108.601 56.492  1.00 82.83  ? 696  TRP A H    1 
ATOM   7217  H  HA   . TRP A  1 504 ? 193.821 107.993 53.842  1.00 86.06  ? 696  TRP A HA   1 
ATOM   7218  H  HB2  . TRP A  1 504 ? 191.882 107.095 55.684  1.00 87.70  ? 696  TRP A HB2  1 
ATOM   7219  H  HB3  . TRP A  1 504 ? 192.035 106.622 54.176  1.00 87.70  ? 696  TRP A HB3  1 
ATOM   7220  H  HD1  . TRP A  1 504 ? 193.321 105.821 57.467  1.00 91.79  ? 696  TRP A HD1  1 
ATOM   7221  H  HE1  . TRP A  1 504 ? 194.697 103.845 57.431  1.00 93.24  ? 696  TRP A HE1  1 
ATOM   7222  H  HE3  . TRP A  1 504 ? 193.650 105.172 52.621  1.00 90.44  ? 696  TRP A HE3  1 
ATOM   7223  H  HZ2  . TRP A  1 504 ? 195.809 102.181 55.519  1.00 87.29  ? 696  TRP A HZ2  1 
ATOM   7224  H  HZ3  . TRP A  1 504 ? 194.875 103.387 51.799  1.00 89.32  ? 696  TRP A HZ3  1 
ATOM   7225  H  HH2  . TRP A  1 504 ? 195.936 101.915 53.232  1.00 87.62  ? 696  TRP A HH2  1 
ATOM   7226  N  N    . ASP A  1 505 ? 192.215 109.710 53.201  1.00 78.15  ? 697  ASP A N    1 
ATOM   7227  C  CA   . ASP A  1 505 ? 191.205 110.687 52.821  1.00 80.16  ? 697  ASP A CA   1 
ATOM   7228  C  C    . ASP A  1 505 ? 189.899 109.945 52.562  1.00 78.93  ? 697  ASP A C    1 
ATOM   7229  O  O    . ASP A  1 505 ? 189.822 109.116 51.648  1.00 80.39  ? 697  ASP A O    1 
ATOM   7230  C  CB   . ASP A  1 505 ? 191.656 111.462 51.583  1.00 82.61  ? 697  ASP A CB   1 
ATOM   7231  C  CG   . ASP A  1 505 ? 190.735 112.617 51.243  1.00 85.13  ? 697  ASP A CG   1 
ATOM   7232  O  OD1  . ASP A  1 505 ? 189.500 112.437 51.290  1.00 88.78  ? 697  ASP A OD1  1 
ATOM   7233  O  OD2  . ASP A  1 505 ? 191.250 113.708 50.923  1.00 87.74  ? 697  ASP A OD2  1 
ATOM   7234  H  H    . ASP A  1 505 ? 192.674 109.413 52.537  1.00 93.53  ? 697  ASP A H    1 
ATOM   7235  H  HA   . ASP A  1 505 ? 191.067 111.315 53.548  1.00 95.95  ? 697  ASP A HA   1 
ATOM   7236  H  HB2  . ASP A  1 505 ? 192.542 111.824 51.743  1.00 98.89  ? 697  ASP A HB2  1 
ATOM   7237  H  HB3  . ASP A  1 505 ? 191.675 110.860 50.823  1.00 98.89  ? 697  ASP A HB3  1 
ATOM   7238  N  N    . ILE A  1 506 ? 188.877 110.232 53.370  1.00 76.70  ? 698  ILE A N    1 
ATOM   7239  C  CA   . ILE A  1 506 ? 187.625 109.487 53.277  1.00 73.42  ? 698  ILE A CA   1 
ATOM   7240  C  C    . ILE A  1 506 ? 186.897 109.827 51.982  1.00 75.30  ? 698  ILE A C    1 
ATOM   7241  O  O    . ILE A  1 506 ? 186.443 108.937 51.255  1.00 78.21  ? 698  ILE A O    1 
ATOM   7242  C  CB   . ILE A  1 506 ? 186.745 109.764 54.510  1.00 74.66  ? 698  ILE A CB   1 
ATOM   7243  C  CG1  . ILE A  1 506 ? 187.407 109.199 55.769  1.00 76.90  ? 698  ILE A CG1  1 
ATOM   7244  C  CG2  . ILE A  1 506 ? 185.357 109.147 54.336  1.00 72.53  ? 698  ILE A CG2  1 
ATOM   7245  C  CD1  . ILE A  1 506 ? 186.813 109.716 57.062  1.00 77.75  ? 698  ILE A CD1  1 
ATOM   7246  H  H    . ILE A  1 506 ? 188.885 110.846 53.972  1.00 91.79  ? 698  ILE A H    1 
ATOM   7247  H  HA   . ILE A  1 506 ? 187.825 108.539 53.264  1.00 87.85  ? 698  ILE A HA   1 
ATOM   7248  H  HB   . ILE A  1 506 ? 186.648 110.724 54.614  1.00 89.34  ? 698  ILE A HB   1 
ATOM   7249  H  HG12 . ILE A  1 506 ? 187.313 108.234 55.765  1.00 92.04  ? 698  ILE A HG12 1 
ATOM   7250  H  HG13 . ILE A  1 506 ? 188.348 109.437 55.760  1.00 92.04  ? 698  ILE A HG13 1 
ATOM   7251  H  HG21 . ILE A  1 506 ? 184.826 109.336 55.125  1.00 86.78  ? 698  ILE A HG21 1 
ATOM   7252  H  HG22 . ILE A  1 506 ? 184.936 109.534 53.553  1.00 86.78  ? 698  ILE A HG22 1 
ATOM   7253  H  HG23 . ILE A  1 506 ? 185.450 108.188 54.222  1.00 86.78  ? 698  ILE A HG23 1 
ATOM   7254  H  HD11 . ILE A  1 506 ? 187.284 109.314 57.808  1.00 93.05  ? 698  ILE A HD11 1 
ATOM   7255  H  HD12 . ILE A  1 506 ? 186.910 110.681 57.090  1.00 93.05  ? 698  ILE A HD12 1 
ATOM   7256  H  HD13 . ILE A  1 506 ? 185.874 109.476 57.095  1.00 93.05  ? 698  ILE A HD13 1 
ATOM   7257  N  N    . GLY A  1 507 ? 186.764 111.120 51.682  1.00 79.55  ? 699  GLY A N    1 
ATOM   7258  C  CA   . GLY A  1 507 ? 186.034 111.521 50.489  1.00 84.55  ? 699  GLY A CA   1 
ATOM   7259  C  C    . GLY A  1 507 ? 186.601 110.907 49.224  1.00 87.98  ? 699  GLY A C    1 
ATOM   7260  O  O    . GLY A  1 507 ? 185.869 110.338 48.409  1.00 87.10  ? 699  GLY A O    1 
ATOM   7261  H  H    . GLY A  1 507 ? 187.082 111.771 52.146  1.00 95.21  ? 699  GLY A H    1 
ATOM   7262  H  HA2  . GLY A  1 507 ? 185.106 111.251 50.572  1.00 101.21 ? 699  GLY A HA2  1 
ATOM   7263  H  HA3  . GLY A  1 507 ? 186.065 112.487 50.401  1.00 101.21 ? 699  GLY A HA3  1 
ATOM   7264  N  N    . HIS A  1 508 ? 187.918 111.010 49.045  1.00 91.82  ? 700  HIS A N    1 
ATOM   7265  C  CA   . HIS A  1 508 ? 188.560 110.484 47.849  1.00 92.05  ? 700  HIS A CA   1 
ATOM   7266  C  C    . HIS A  1 508 ? 188.837 108.992 47.950  1.00 90.50  ? 700  HIS A C    1 
ATOM   7267  O  O    . HIS A  1 508 ? 188.967 108.328 46.916  1.00 94.31  ? 700  HIS A O    1 
ATOM   7268  C  CB   . HIS A  1 508 ? 189.870 111.230 47.588  1.00 96.30  ? 700  HIS A CB   1 
ATOM   7269  C  CG   . HIS A  1 508 ? 189.683 112.681 47.266  1.00 105.69 ? 700  HIS A CG   1 
ATOM   7270  N  ND1  . HIS A  1 508 ? 190.512 113.665 47.761  1.00 108.30 ? 700  HIS A ND1  1 
ATOM   7271  C  CD2  . HIS A  1 508 ? 188.761 113.314 46.504  1.00 107.74 ? 700  HIS A CD2  1 
ATOM   7272  C  CE1  . HIS A  1 508 ? 190.108 114.842 47.317  1.00 109.58 ? 700  HIS A CE1  1 
ATOM   7273  N  NE2  . HIS A  1 508 ? 189.048 114.657 46.552  1.00 108.53 ? 700  HIS A NE2  1 
ATOM   7274  H  H    . HIS A  1 508 ? 188.458 111.381 49.602  1.00 109.93 ? 700  HIS A H    1 
ATOM   7275  H  HA   . HIS A  1 508 ? 187.976 110.628 47.088  1.00 110.22 ? 700  HIS A HA   1 
ATOM   7276  H  HB2  . HIS A  1 508 ? 190.427 111.171 48.379  1.00 115.31 ? 700  HIS A HB2  1 
ATOM   7277  H  HB3  . HIS A  1 508 ? 190.322 110.816 46.836  1.00 115.31 ? 700  HIS A HB3  1 
ATOM   7278  H  HD2  . HIS A  1 508 ? 188.064 112.915 46.036  1.00 129.04 ? 700  HIS A HD2  1 
ATOM   7279  H  HE1  . HIS A  1 508 ? 190.504 115.661 47.509  1.00 131.25 ? 700  HIS A HE1  1 
ATOM   7280  H  HE2  . HIS A  1 508 ? 188.608 115.276 46.148  1.00 129.98 ? 700  HIS A HE2  1 
ATOM   7281  N  N    . GLY A  1 509 ? 188.932 108.455 49.162  1.00 80.39  ? 701  GLY A N    1 
ATOM   7282  C  CA   . GLY A  1 509 ? 189.215 107.043 49.339  1.00 76.39  ? 701  GLY A CA   1 
ATOM   7283  C  C    . GLY A  1 509 ? 190.650 106.685 49.020  1.00 77.65  ? 701  GLY A C    1 
ATOM   7284  O  O    . GLY A  1 509 ? 190.902 105.649 48.391  1.00 76.47  ? 701  GLY A O    1 
ATOM   7285  H  H    . GLY A  1 509 ? 188.836 108.891 49.897  1.00 96.22  ? 701  GLY A H    1 
ATOM   7286  H  HA2  . GLY A  1 509 ? 189.035 106.791 50.258  1.00 91.41  ? 701  GLY A HA2  1 
ATOM   7287  H  HA3  . GLY A  1 509 ? 188.635 106.524 48.760  1.00 91.41  ? 701  GLY A HA3  1 
ATOM   7288  N  N    . LEU A  1 510 ? 191.601 107.513 49.449  1.00 80.58  ? 702  LEU A N    1 
ATOM   7289  C  CA   . LEU A  1 510 ? 193.001 107.348 49.097  1.00 78.28  ? 702  LEU A CA   1 
ATOM   7290  C  C    . LEU A  1 510 ? 193.875 107.432 50.336  1.00 78.91  ? 702  LEU A C    1 
ATOM   7291  O  O    . LEU A  1 510 ? 193.534 108.101 51.316  1.00 80.40  ? 702  LEU A O    1 
ATOM   7292  C  CB   . LEU A  1 510 ? 193.467 108.425 48.114  1.00 81.91  ? 702  LEU A CB   1 
ATOM   7293  C  CG   . LEU A  1 510 ? 192.793 108.462 46.748  1.00 86.54  ? 702  LEU A CG   1 
ATOM   7294  C  CD1  . LEU A  1 510 ? 193.232 109.708 46.000  1.00 87.98  ? 702  LEU A CD1  1 
ATOM   7295  C  CD2  . LEU A  1 510 ? 193.118 107.210 45.963  1.00 88.92  ? 702  LEU A CD2  1 
ATOM   7296  H  H    . LEU A  1 510 ? 191.452 108.192 49.956  1.00 96.44  ? 702  LEU A H    1 
ATOM   7297  H  HA   . LEU A  1 510 ? 193.132 106.478 48.686  1.00 93.69  ? 702  LEU A HA   1 
ATOM   7298  H  HB2  . LEU A  1 510 ? 193.323 109.290 48.527  1.00 98.05  ? 702  LEU A HB2  1 
ATOM   7299  H  HB3  . LEU A  1 510 ? 194.416 108.300 47.959  1.00 98.05  ? 702  LEU A HB3  1 
ATOM   7300  H  HG   . LEU A  1 510 ? 191.831 108.504 46.868  1.00 103.60 ? 702  LEU A HG   1 
ATOM   7301  H  HD11 . LEU A  1 510 ? 192.798 109.725 45.132  1.00 105.33 ? 702  LEU A HD11 1 
ATOM   7302  H  HD12 . LEU A  1 510 ? 192.976 110.491 46.513  1.00 105.33 ? 702  LEU A HD12 1 
ATOM   7303  H  HD13 . LEU A  1 510 ? 194.195 109.686 45.889  1.00 105.33 ? 702  LEU A HD13 1 
ATOM   7304  H  HD21 . LEU A  1 510 ? 192.678 107.257 45.099  1.00 106.45 ? 702  LEU A HD21 1 
ATOM   7305  H  HD22 . LEU A  1 510 ? 194.079 107.154 45.843  1.00 106.45 ? 702  LEU A HD22 1 
ATOM   7306  H  HD23 . LEU A  1 510 ? 192.799 106.438 46.455  1.00 106.45 ? 702  LEU A HD23 1 
ATOM   7307  N  N    . MET A  1 511 ? 195.013 106.747 50.278  1.00 81.02  ? 703  MET A N    1 
ATOM   7308  C  CA   . MET A  1 511 ? 196.086 107.005 51.225  1.00 79.39  ? 703  MET A CA   1 
ATOM   7309  C  C    . MET A  1 511 ? 196.718 108.352 50.904  1.00 76.77  ? 703  MET A C    1 
ATOM   7310  O  O    . MET A  1 511 ? 197.076 108.619 49.753  1.00 79.63  ? 703  MET A O    1 
ATOM   7311  C  CB   . MET A  1 511 ? 197.138 105.900 51.158  1.00 77.00  ? 703  MET A CB   1 
ATOM   7312  C  CG   . MET A  1 511 ? 198.171 105.977 52.270  1.00 79.54  ? 703  MET A CG   1 
ATOM   7313  S  SD   . MET A  1 511 ? 199.605 104.927 51.979  1.00 83.40  ? 703  MET A SD   1 
ATOM   7314  C  CE   . MET A  1 511 ? 198.886 103.306 52.210  1.00 80.33  ? 703  MET A CE   1 
ATOM   7315  H  H    . MET A  1 511 ? 195.187 106.132 49.702  1.00 96.98  ? 703  MET A H    1 
ATOM   7316  H  HA   . MET A  1 511 ? 195.722 107.026 52.124  1.00 95.01  ? 703  MET A HA   1 
ATOM   7317  H  HB2  . MET A  1 511 ? 196.694 105.040 51.223  1.00 92.15  ? 703  MET A HB2  1 
ATOM   7318  H  HB3  . MET A  1 511 ? 197.607 105.966 50.311  1.00 92.15  ? 703  MET A HB3  1 
ATOM   7319  H  HG2  . MET A  1 511 ? 198.482 106.893 52.348  1.00 95.20  ? 703  MET A HG2  1 
ATOM   7320  H  HG3  . MET A  1 511 ? 197.759 105.696 53.102  1.00 95.20  ? 703  MET A HG3  1 
ATOM   7321  H  HE1  . MET A  1 511 ? 199.574 102.635 52.078  1.00 96.15  ? 703  MET A HE1  1 
ATOM   7322  H  HE2  . MET A  1 511 ? 198.532 103.244 53.111  1.00 96.15  ? 703  MET A HE2  1 
ATOM   7323  H  HE3  . MET A  1 511 ? 198.173 103.183 51.564  1.00 96.15  ? 703  MET A HE3  1 
ATOM   7324  N  N    . VAL A  1 512 ? 196.842 109.207 51.918  1.00 78.15  ? 704  VAL A N    1 
ATOM   7325  C  CA   . VAL A  1 512 ? 197.440 110.526 51.754  1.00 82.56  ? 704  VAL A CA   1 
ATOM   7326  C  C    . VAL A  1 512 ? 198.653 110.733 52.643  1.00 81.59  ? 704  VAL A C    1 
ATOM   7327  O  O    . VAL A  1 512 ? 199.282 111.794 52.574  1.00 82.20  ? 704  VAL A O    1 
ATOM   7328  C  CB   . VAL A  1 512 ? 196.408 111.644 52.002  1.00 84.53  ? 704  VAL A CB   1 
ATOM   7329  C  CG1  . VAL A  1 512 ? 195.291 111.560 50.978  1.00 86.53  ? 704  VAL A CG1  1 
ATOM   7330  C  CG2  . VAL A  1 512 ? 195.861 111.564 53.422  1.00 83.35  ? 704  VAL A CG2  1 
ATOM   7331  H  H    . VAL A  1 512 ? 196.584 109.042 52.721  1.00 93.53  ? 704  VAL A H    1 
ATOM   7332  H  HA   . VAL A  1 512 ? 197.739 110.611 50.835  1.00 98.82  ? 704  VAL A HA   1 
ATOM   7333  H  HB   . VAL A  1 512 ? 196.844 112.504 51.898  1.00 101.18 ? 704  VAL A HB   1 
ATOM   7334  H  HG11 . VAL A  1 512 ? 194.652 112.269 51.150  1.00 103.59 ? 704  VAL A HG11 1 
ATOM   7335  H  HG12 . VAL A  1 512 ? 195.668 111.661 50.091  1.00 103.59 ? 704  VAL A HG12 1 
ATOM   7336  H  HG13 . VAL A  1 512 ? 194.856 110.696 51.057  1.00 103.59 ? 704  VAL A HG13 1 
ATOM   7337  H  HG21 . VAL A  1 512 ? 195.215 112.277 53.552  1.00 99.77  ? 704  VAL A HG21 1 
ATOM   7338  H  HG22 . VAL A  1 512 ? 195.433 110.703 53.547  1.00 99.77  ? 704  VAL A HG22 1 
ATOM   7339  H  HG23 . VAL A  1 512 ? 196.594 111.664 54.049  1.00 99.77  ? 704  VAL A HG23 1 
ATOM   7340  N  N    . GLY A  1 513 ? 199.010 109.753 53.465  1.00 77.49  ? 705  GLY A N    1 
ATOM   7341  C  CA   . GLY A  1 513 ? 200.171 109.891 54.316  1.00 75.29  ? 705  GLY A CA   1 
ATOM   7342  C  C    . GLY A  1 513 ? 200.631 108.573 54.894  1.00 73.63  ? 705  GLY A C    1 
ATOM   7343  O  O    . GLY A  1 513 ? 199.822 107.694 55.209  1.00 77.21  ? 705  GLY A O    1 
ATOM   7344  H  H    . GLY A  1 513 ? 198.596 109.003 53.546  1.00 92.74  ? 705  GLY A H    1 
ATOM   7345  H  HA2  . GLY A  1 513 ? 200.901 110.273 53.805  1.00 90.10  ? 705  GLY A HA2  1 
ATOM   7346  H  HA3  . GLY A  1 513 ? 199.963 110.491 55.049  1.00 90.10  ? 705  GLY A HA3  1 
ATOM   7347  N  N    . GLU A  1 514 ? 201.946 108.434 55.036  1.00 75.28  ? 706  GLU A N    1 
ATOM   7348  C  CA   . GLU A  1 514 ? 202.572 107.235 55.585  1.00 80.88  ? 706  GLU A CA   1 
ATOM   7349  C  C    . GLU A  1 514 ? 203.592 107.723 56.608  1.00 82.79  ? 706  GLU A C    1 
ATOM   7350  O  O    . GLU A  1 514 ? 204.677 108.183 56.240  1.00 79.40  ? 706  GLU A O    1 
ATOM   7351  C  CB   . GLU A  1 514 ? 203.217 106.409 54.476  1.00 83.39  ? 706  GLU A CB   1 
ATOM   7352  C  CG   . GLU A  1 514 ? 203.875 105.116 54.918  1.00 84.84  ? 706  GLU A CG   1 
ATOM   7353  C  CD   . GLU A  1 514 ? 204.675 104.476 53.799  1.00 93.57  ? 706  GLU A CD   1 
ATOM   7354  O  OE1  . GLU A  1 514 ? 205.359 105.219 53.059  1.00 97.09  ? 706  GLU A OE1  1 
ATOM   7355  O  OE2  . GLU A  1 514 ? 204.610 103.236 53.649  1.00 94.62  ? 706  GLU A OE2  1 
ATOM   7356  H  H    . GLU A  1 514 ? 202.513 109.041 54.813  1.00 90.09  ? 706  GLU A H    1 
ATOM   7357  H  HA   . GLU A  1 514 ? 201.908 106.692 56.037  1.00 96.81  ? 706  GLU A HA   1 
ATOM   7358  H  HB2  . GLU A  1 514 ? 202.532 106.179 53.828  1.00 99.82  ? 706  GLU A HB2  1 
ATOM   7359  H  HB3  . GLU A  1 514 ? 203.898 106.950 54.047  1.00 99.82  ? 706  GLU A HB3  1 
ATOM   7360  H  HG2  . GLU A  1 514 ? 204.479 105.302 55.654  1.00 101.56 ? 706  GLU A HG2  1 
ATOM   7361  H  HG3  . GLU A  1 514 ? 203.190 104.489 55.197  1.00 101.56 ? 706  GLU A HG3  1 
ATOM   7362  N  N    . LEU A  1 515 ? 203.240 107.631 57.889  1.00 82.53  ? 707  LEU A N    1 
ATOM   7363  C  CA   . LEU A  1 515 ? 204.072 108.156 58.969  1.00 83.63  ? 707  LEU A CA   1 
ATOM   7364  C  C    . LEU A  1 515 ? 204.925 107.015 59.505  1.00 83.38  ? 707  LEU A C    1 
ATOM   7365  O  O    . LEU A  1 515 ? 204.438 106.140 60.226  1.00 79.64  ? 707  LEU A O    1 
ATOM   7366  C  CB   . LEU A  1 515 ? 203.216 108.788 60.060  1.00 83.94  ? 707  LEU A CB   1 
ATOM   7367  C  CG   . LEU A  1 515 ? 202.175 109.793 59.560  1.00 83.95  ? 707  LEU A CG   1 
ATOM   7368  C  CD1  . LEU A  1 515 ? 201.360 110.348 60.716  1.00 83.41  ? 707  LEU A CD1  1 
ATOM   7369  C  CD2  . LEU A  1 515 ? 202.844 110.922 58.788  1.00 84.35  ? 707  LEU A CD2  1 
ATOM   7370  H  H    . LEU A  1 515 ? 202.512 107.264 58.162  1.00 98.78  ? 707  LEU A H    1 
ATOM   7371  H  HA   . LEU A  1 515 ? 204.665 108.838 58.614  1.00 100.11 ? 707  LEU A HA   1 
ATOM   7372  H  HB2  . LEU A  1 515 ? 202.742 108.082 60.527  1.00 100.48 ? 707  LEU A HB2  1 
ATOM   7373  H  HB3  . LEU A  1 515 ? 203.800 109.253 60.679  1.00 100.48 ? 707  LEU A HB3  1 
ATOM   7374  H  HG   . LEU A  1 515 ? 201.565 109.340 58.957  1.00 100.49 ? 707  LEU A HG   1 
ATOM   7375  H  HD11 . LEU A  1 515 ? 200.711 110.980 60.369  1.00 99.84  ? 707  LEU A HD11 1 
ATOM   7376  H  HD12 . LEU A  1 515 ? 200.905 109.616 61.161  1.00 99.84  ? 707  LEU A HD12 1 
ATOM   7377  H  HD13 . LEU A  1 515 ? 201.957 110.793 61.337  1.00 99.84  ? 707  LEU A HD13 1 
ATOM   7378  H  HD21 . LEU A  1 515 ? 202.163 111.543 58.484  1.00 100.98 ? 707  LEU A HD21 1 
ATOM   7379  H  HD22 . LEU A  1 515 ? 203.469 111.377 59.374  1.00 100.98 ? 707  LEU A HD22 1 
ATOM   7380  H  HD23 . LEU A  1 515 ? 203.314 110.548 58.027  1.00 100.98 ? 707  LEU A HD23 1 
ATOM   7381  N  N    . LYS A  1 516 ? 206.202 107.037 59.146  1.00 85.58  ? 708  LYS A N    1 
ATOM   7382  C  CA   . LYS A  1 516 ? 207.159 106.019 59.546  1.00 87.38  ? 708  LYS A CA   1 
ATOM   7383  C  C    . LYS A  1 516 ? 208.022 106.562 60.674  1.00 88.38  ? 708  LYS A C    1 
ATOM   7384  O  O    . LYS A  1 516 ? 208.443 107.722 60.645  1.00 91.56  ? 708  LYS A O    1 
ATOM   7385  C  CB   . LYS A  1 516 ? 208.026 105.605 58.353  1.00 88.94  ? 708  LYS A CB   1 
ATOM   7386  C  CG   . LYS A  1 516 ? 207.219 104.980 57.220  1.00 93.79  ? 708  LYS A CG   1 
ATOM   7387  C  CD   . LYS A  1 516 ? 208.083 104.463 56.070  1.00 97.75  ? 708  LYS A CD   1 
ATOM   7388  C  CE   . LYS A  1 516 ? 208.441 105.560 55.072  1.00 102.84 ? 708  LYS A CE   1 
ATOM   7389  N  NZ   . LYS A  1 516 ? 208.761 104.995 53.726  1.00 105.25 ? 708  LYS A NZ   1 
ATOM   7390  H  H    . LYS A  1 516 ? 206.547 107.652 58.654  1.00 102.45 ? 708  LYS A H    1 
ATOM   7391  H  HA   . LYS A  1 516 ? 206.684 105.237 59.868  1.00 104.61 ? 708  LYS A HA   1 
ATOM   7392  H  HB2  . LYS A  1 516 ? 208.476 106.390 58.003  1.00 106.48 ? 708  LYS A HB2  1 
ATOM   7393  H  HB3  . LYS A  1 516 ? 208.681 104.953 58.650  1.00 106.48 ? 708  LYS A HB3  1 
ATOM   7394  H  HG2  . LYS A  1 516 ? 206.713 104.231 57.572  1.00 112.30 ? 708  LYS A HG2  1 
ATOM   7395  H  HG3  . LYS A  1 516 ? 206.613 105.647 56.861  1.00 112.30 ? 708  LYS A HG3  1 
ATOM   7396  H  HD2  . LYS A  1 516 ? 208.908 104.103 56.431  1.00 117.05 ? 708  LYS A HD2  1 
ATOM   7397  H  HD3  . LYS A  1 516 ? 207.597 103.771 55.595  1.00 117.05 ? 708  LYS A HD3  1 
ATOM   7398  H  HE2  . LYS A  1 516 ? 207.689 106.164 54.976  1.00 123.16 ? 708  LYS A HE2  1 
ATOM   7399  H  HE3  . LYS A  1 516 ? 209.220 106.042 55.392  1.00 123.16 ? 708  LYS A HE3  1 
ATOM   7400  H  HZ1  . LYS A  1 516 ? 208.967 105.651 53.161  1.00 126.05 ? 708  LYS A HZ1  1 
ATOM   7401  H  HZ2  . LYS A  1 516 ? 209.453 104.438 53.787  1.00 126.05 ? 708  LYS A HZ2  1 
ATOM   7402  H  HZ3  . LYS A  1 516 ? 208.058 104.550 53.408  1.00 126.05 ? 708  LYS A HZ3  1 
ATOM   7403  N  N    . GLY A  1 517 ? 208.278 105.720 61.670  1.00 86.32  ? 709  GLY A N    1 
ATOM   7404  C  CA   . GLY A  1 517 ? 209.063 106.132 62.816  1.00 85.96  ? 709  GLY A CA   1 
ATOM   7405  C  C    . GLY A  1 517 ? 209.017 105.125 63.945  1.00 85.04  ? 709  GLY A C    1 
ATOM   7406  O  O    . GLY A  1 517 ? 210.052 104.794 64.530  1.00 87.01  ? 709  GLY A O    1 
ATOM   7407  H  H    . GLY A  1 517 ? 208.005 104.906 61.703  1.00 103.34 ? 709  GLY A H    1 
ATOM   7408  H  HA2  . GLY A  1 517 ? 209.988 106.248 62.547  1.00 102.90 ? 709  GLY A HA2  1 
ATOM   7409  H  HA3  . GLY A  1 517 ? 208.731 106.980 63.147  1.00 102.90 ? 709  GLY A HA3  1 
ATOM   7410  N  N    . HIS A  1 518 ? 207.824 104.626 64.258  1.00 82.32  ? 710  HIS A N    1 
ATOM   7411  C  CA   . HIS A  1 518 ? 207.697 103.608 65.289  1.00 79.41  ? 710  HIS A CA   1 
ATOM   7412  C  C    . HIS A  1 518 ? 208.359 102.314 64.834  1.00 81.28  ? 710  HIS A C    1 
ATOM   7413  O  O    . HIS A  1 518 ? 208.379 101.982 63.645  1.00 80.26  ? 710  HIS A O    1 
ATOM   7414  C  CB   . HIS A  1 518 ? 206.226 103.360 65.623  1.00 77.43  ? 710  HIS A CB   1 
ATOM   7415  C  CG   . HIS A  1 518 ? 205.607 104.438 66.458  1.00 78.42  ? 710  HIS A CG   1 
ATOM   7416  N  ND1  . HIS A  1 518 ? 206.040 104.729 67.734  1.00 79.35  ? 710  HIS A ND1  1 
ATOM   7417  C  CD2  . HIS A  1 518 ? 204.584 105.287 66.205  1.00 76.22  ? 710  HIS A CD2  1 
ATOM   7418  C  CE1  . HIS A  1 518 ? 205.313 105.715 68.229  1.00 78.85  ? 710  HIS A CE1  1 
ATOM   7419  N  NE2  . HIS A  1 518 ? 204.422 106.071 67.322  1.00 75.58  ? 710  HIS A NE2  1 
ATOM   7420  H  H    . HIS A  1 518 ? 207.082 104.858 63.891  1.00 98.54  ? 710  HIS A H    1 
ATOM   7421  H  HA   . HIS A  1 518 ? 208.144 103.912 66.094  1.00 95.04  ? 710  HIS A HA   1 
ATOM   7422  H  HB2  . HIS A  1 518 ? 205.723 103.300 64.796  1.00 92.67  ? 710  HIS A HB2  1 
ATOM   7423  H  HB3  . HIS A  1 518 ? 206.153 102.526 66.114  1.00 92.67  ? 710  HIS A HB3  1 
ATOM   7424  H  HD1  . HIS A  1 518 ? 206.684 104.333 68.143  1.00 94.97  ? 710  HIS A HD1  1 
ATOM   7425  H  HD2  . HIS A  1 518 ? 204.085 105.333 65.422  1.00 91.22  ? 710  HIS A HD2  1 
ATOM   7426  H  HE1  . HIS A  1 518 ? 205.412 106.093 69.073  1.00 94.37  ? 710  HIS A HE1  1 
ATOM   7427  N  N    . THR A  1 519 ? 208.913 101.581 65.799  1.00 82.26  ? 711  THR A N    1 
ATOM   7428  C  CA   . THR A  1 519 ? 209.616 100.336 65.523  1.00 78.99  ? 711  THR A CA   1 
ATOM   7429  C  C    . THR A  1 519 ? 208.841 99.120  66.011  1.00 79.96  ? 711  THR A C    1 
ATOM   7430  O  O    . THR A  1 519 ? 209.369 98.004  65.978  1.00 81.03  ? 711  THR A O    1 
ATOM   7431  C  CB   . THR A  1 519 ? 211.008 100.359 66.160  1.00 74.70  ? 711  THR A CB   1 
ATOM   7432  O  OG1  . THR A  1 519 ? 210.893 100.212 67.580  1.00 75.27  ? 711  THR A OG1  1 
ATOM   7433  C  CG2  . THR A  1 519 ? 211.713 101.674 65.862  1.00 77.10  ? 711  THR A CG2  1 
ATOM   7434  H  H    . THR A  1 519 ? 208.893 101.790 66.633  1.00 98.47  ? 711  THR A H    1 
ATOM   7435  H  HA   . THR A  1 519 ? 209.731 100.249 64.563  1.00 94.54  ? 711  THR A HA   1 
ATOM   7436  H  HB   . THR A  1 519 ? 211.542 99.633  65.801  1.00 89.40  ? 711  THR A HB   1 
ATOM   7437  H  HG1  . THR A  1 519 ? 211.656 100.224 67.933  1.00 90.08  ? 711  THR A HG1  1 
ATOM   7438  H  HG21 . THR A  1 519 ? 212.593 101.679 66.269  1.00 92.27  ? 711  THR A HG21 1 
ATOM   7439  H  HG22 . THR A  1 519 ? 211.810 101.789 64.903  1.00 92.27  ? 711  THR A HG22 1 
ATOM   7440  H  HG23 . THR A  1 519 ? 211.197 102.415 66.217  1.00 92.27  ? 711  THR A HG23 1 
ATOM   7441  N  N    . ASP A  1 520 ? 207.604 99.309  66.462  1.00 80.00  ? 712  ASP A N    1 
ATOM   7442  C  CA   . ASP A  1 520 ? 206.761 98.204  66.896  1.00 81.23  ? 712  ASP A CA   1 
ATOM   7443  C  C    . ASP A  1 520 ? 205.307 98.647  66.772  1.00 81.63  ? 712  ASP A C    1 
ATOM   7444  O  O    . ASP A  1 520 ? 205.012 99.744  66.292  1.00 80.35  ? 712  ASP A O    1 
ATOM   7445  C  CB   . ASP A  1 520 ? 207.114 97.772  68.322  1.00 86.78  ? 712  ASP A CB   1 
ATOM   7446  C  CG   . ASP A  1 520 ? 206.870 96.295  68.561  1.00 88.92  ? 712  ASP A CG   1 
ATOM   7447  O  OD1  . ASP A  1 520 ? 205.817 95.784  68.124  1.00 88.60  ? 712  ASP A OD1  1 
ATOM   7448  O  OD2  . ASP A  1 520 ? 207.737 95.644  69.181  1.00 89.56  ? 712  ASP A OD2  1 
ATOM   7449  H  H    . ASP A  1 520 ? 207.226 100.079 66.526  1.00 95.75  ? 712  ASP A H    1 
ATOM   7450  H  HA   . ASP A  1 520 ? 206.899 97.446  66.307  1.00 97.23  ? 712  ASP A HA   1 
ATOM   7451  H  HB2  . ASP A  1 520 ? 208.054 97.951  68.483  1.00 103.88 ? 712  ASP A HB2  1 
ATOM   7452  H  HB3  . ASP A  1 520 ? 206.568 98.273  68.948  1.00 103.88 ? 712  ASP A HB3  1 
ATOM   7453  N  N    . THR A  1 521 ? 204.399 97.778  67.213  1.00 75.67  ? 713  THR A N    1 
ATOM   7454  C  CA   . THR A  1 521 ? 202.971 97.992  67.012  1.00 71.56  ? 713  THR A CA   1 
ATOM   7455  C  C    . THR A  1 521 ? 202.529 99.362  67.510  1.00 70.59  ? 713  THR A C    1 
ATOM   7456  O  O    . THR A  1 521 ? 202.899 99.790  68.606  1.00 73.34  ? 713  THR A O    1 
ATOM   7457  C  CB   . THR A  1 521 ? 202.177 96.899  67.732  1.00 72.92  ? 713  THR A CB   1 
ATOM   7458  O  OG1  . THR A  1 521 ? 202.642 95.610  67.313  1.00 75.56  ? 713  THR A OG1  1 
ATOM   7459  C  CG2  . THR A  1 521 ? 200.683 97.027  67.436  1.00 71.04  ? 713  THR A CG2  1 
ATOM   7460  H  H    . THR A  1 521 ? 204.588 97.053  67.635  1.00 90.56  ? 713  THR A H    1 
ATOM   7461  H  HA   . THR A  1 521 ? 202.771 97.936  66.064  1.00 85.62  ? 713  THR A HA   1 
ATOM   7462  H  HB   . THR A  1 521 ? 202.306 96.989  68.689  1.00 87.25  ? 713  THR A HB   1 
ATOM   7463  H  HG1  . THR A  1 521 ? 202.209 95.007  67.706  1.00 90.43  ? 713  THR A HG1  1 
ATOM   7464  H  HG21 . THR A  1 521 ? 200.193 96.329  67.898  1.00 85.00  ? 713  THR A HG21 1 
ATOM   7465  H  HG22 . THR A  1 521 ? 200.359 97.891  67.735  1.00 85.00  ? 713  THR A HG22 1 
ATOM   7466  H  HG23 . THR A  1 521 ? 200.526 96.944  66.482  1.00 85.00  ? 713  THR A HG23 1 
ATOM   7467  N  N    . VAL A  1 522 ? 201.734 100.045 66.692  1.00 66.24  ? 714  VAL A N    1 
ATOM   7468  C  CA   . VAL A  1 522 ? 201.061 101.275 67.095  1.00 65.10  ? 714  VAL A CA   1 
ATOM   7469  C  C    . VAL A  1 522 ? 199.739 100.866 67.737  1.00 64.52  ? 714  VAL A C    1 
ATOM   7470  O  O    . VAL A  1 522 ? 198.815 100.430 67.046  1.00 61.75  ? 714  VAL A O    1 
ATOM   7471  C  CB   . VAL A  1 522 ? 200.831 102.211 65.903  1.00 64.82  ? 714  VAL A CB   1 
ATOM   7472  C  CG1  . VAL A  1 522 ? 200.195 103.520 66.366  1.00 63.73  ? 714  VAL A CG1  1 
ATOM   7473  C  CG2  . VAL A  1 522 ? 202.135 102.462 65.144  1.00 66.72  ? 714  VAL A CG2  1 
ATOM   7474  H  H    . VAL A  1 522 ? 201.566 99.811  65.881  1.00 79.24  ? 714  VAL A H    1 
ATOM   7475  H  HA   . VAL A  1 522 ? 201.597 101.739 67.756  1.00 77.87  ? 714  VAL A HA   1 
ATOM   7476  H  HB   . VAL A  1 522 ? 200.212 101.785 65.289  1.00 77.53  ? 714  VAL A HB   1 
ATOM   7477  H  HG11 . VAL A  1 522 ? 200.060 104.095 65.596  1.00 76.23  ? 714  VAL A HG11 1 
ATOM   7478  H  HG12 . VAL A  1 522 ? 199.343 103.325 66.787  1.00 76.23  ? 714  VAL A HG12 1 
ATOM   7479  H  HG13 . VAL A  1 522 ? 200.788 103.952 67.001  1.00 76.23  ? 714  VAL A HG13 1 
ATOM   7480  H  HG21 . VAL A  1 522 ? 201.957 103.056 64.398  1.00 79.81  ? 714  VAL A HG21 1 
ATOM   7481  H  HG22 . VAL A  1 522 ? 202.777 102.869 65.746  1.00 79.81  ? 714  VAL A HG22 1 
ATOM   7482  H  HG23 . VAL A  1 522 ? 202.478 101.615 64.818  1.00 79.81  ? 714  VAL A HG23 1 
ATOM   7483  N  N    . CYS A  1 523 ? 199.642 101.005 69.059  1.00 76.13  ? 715  CYS A N    1 
ATOM   7484  C  CA   . CYS A  1 523 ? 198.476 100.535 69.795  1.00 79.78  ? 715  CYS A CA   1 
ATOM   7485  C  C    . CYS A  1 523 ? 197.562 101.652 70.283  1.00 76.82  ? 715  CYS A C    1 
ATOM   7486  O  O    . CYS A  1 523 ? 196.556 101.360 70.939  1.00 80.81  ? 715  CYS A O    1 
ATOM   7487  C  CB   . CYS A  1 523 ? 198.919 99.677  70.987  1.00 84.47  ? 715  CYS A CB   1 
ATOM   7488  S  SG   . CYS A  1 523 ? 200.394 100.271 71.837  1.00 89.04  ? 715  CYS A SG   1 
ATOM   7489  H  H    . CYS A  1 523 ? 200.244 101.370 69.553  1.00 91.11  ? 715  CYS A H    1 
ATOM   7490  H  HA   . CYS A  1 523 ? 197.952 99.968  69.208  1.00 95.49  ? 715  CYS A HA   1 
ATOM   7491  H  HB2  . CYS A  1 523 ? 198.198 99.650  71.635  1.00 101.12 ? 715  CYS A HB2  1 
ATOM   7492  H  HB3  . CYS A  1 523 ? 199.106 98.779  70.670  1.00 101.12 ? 715  CYS A HB3  1 
ATOM   7493  H  HG   . CYS A  1 523 ? 200.184 101.375 72.258  1.00 106.60 ? 715  CYS A HG   1 
ATOM   7494  N  N    . SER A  1 524 ? 197.867 102.915 69.989  1.00 70.89  ? 716  SER A N    1 
ATOM   7495  C  CA   . SER A  1 524 ? 196.960 104.001 70.335  1.00 71.40  ? 716  SER A CA   1 
ATOM   7496  C  C    . SER A  1 524 ? 197.166 105.173 69.383  1.00 72.28  ? 716  SER A C    1 
ATOM   7497  O  O    . SER A  1 524 ? 198.269 105.396 68.874  1.00 71.84  ? 716  SER A O    1 
ATOM   7498  C  CB   . SER A  1 524 ? 197.152 104.448 71.789  1.00 71.42  ? 716  SER A CB   1 
ATOM   7499  O  OG   . SER A  1 524 ? 198.449 104.974 71.997  1.00 77.86  ? 716  SER A OG   1 
ATOM   7500  H  H    . SER A  1 524 ? 198.588 103.166 69.593  1.00 84.81  ? 716  SER A H    1 
ATOM   7501  H  HA   . SER A  1 524 ? 196.046 103.692 70.235  1.00 85.44  ? 716  SER A HA   1 
ATOM   7502  H  HB2  . SER A  1 524 ? 196.497 105.134 71.996  1.00 85.45  ? 716  SER A HB2  1 
ATOM   7503  H  HB3  . SER A  1 524 ? 197.025 103.683 72.372  1.00 85.45  ? 716  SER A HB3  1 
ATOM   7504  H  HG   . SER A  1 524 ? 199.027 104.391 71.823  1.00 93.18  ? 716  SER A HG   1 
ATOM   7505  N  N    . LEU A  1 525 ? 196.086 105.921 69.156  1.00 70.40  ? 717  LEU A N    1 
ATOM   7506  C  CA   . LEU A  1 525 ? 196.094 107.079 68.272  1.00 71.54  ? 717  LEU A CA   1 
ATOM   7507  C  C    . LEU A  1 525 ? 195.086 108.099 68.780  1.00 70.88  ? 717  LEU A C    1 
ATOM   7508  O  O    . LEU A  1 525 ? 194.039 107.734 69.322  1.00 75.98  ? 717  LEU A O    1 
ATOM   7509  C  CB   . LEU A  1 525 ? 195.739 106.705 66.827  1.00 68.74  ? 717  LEU A CB   1 
ATOM   7510  C  CG   . LEU A  1 525 ? 196.770 105.977 65.963  1.00 67.75  ? 717  LEU A CG   1 
ATOM   7511  C  CD1  . LEU A  1 525 ? 196.108 105.465 64.693  1.00 66.39  ? 717  LEU A CD1  1 
ATOM   7512  C  CD2  . LEU A  1 525 ? 197.934 106.887 65.621  1.00 66.99  ? 717  LEU A CD2  1 
ATOM   7513  H  H    . LEU A  1 525 ? 195.319 105.771 69.514  1.00 84.24  ? 717  LEU A H    1 
ATOM   7514  H  HA   . LEU A  1 525 ? 196.975 107.486 68.278  1.00 85.60  ? 717  LEU A HA   1 
ATOM   7515  H  HB2  . LEU A  1 525 ? 194.953 106.138 66.856  1.00 82.24  ? 717  LEU A HB2  1 
ATOM   7516  H  HB3  . LEU A  1 525 ? 195.516 107.525 66.359  1.00 82.24  ? 717  LEU A HB3  1 
ATOM   7517  H  HG   . LEU A  1 525 ? 197.116 105.215 66.453  1.00 81.05  ? 717  LEU A HG   1 
ATOM   7518  H  HD11 . LEU A  1 525 ? 196.772 105.006 64.154  1.00 79.42  ? 717  LEU A HD11 1 
ATOM   7519  H  HD12 . LEU A  1 525 ? 195.395 104.852 64.934  1.00 79.42  ? 717  LEU A HD12 1 
ATOM   7520  H  HD13 . LEU A  1 525 ? 195.745 106.218 64.200  1.00 79.42  ? 717  LEU A HD13 1 
ATOM   7521  H  HD21 . LEU A  1 525 ? 198.567 106.397 65.074  1.00 80.14  ? 717  LEU A HD21 1 
ATOM   7522  H  HD22 . LEU A  1 525 ? 197.599 107.656 65.132  1.00 80.14  ? 717  LEU A HD22 1 
ATOM   7523  H  HD23 . LEU A  1 525 ? 198.360 107.177 66.442  1.00 80.14  ? 717  LEU A HD23 1 
ATOM   7524  N  N    . ARG A  1 526 ? 195.408 109.381 68.609  1.00 69.97  ? 718  ARG A N    1 
ATOM   7525  C  CA   . ARG A  1 526 ? 194.468 110.437 68.965  1.00 73.09  ? 718  ARG A CA   1 
ATOM   7526  C  C    . ARG A  1 526 ? 194.891 111.742 68.307  1.00 73.85  ? 718  ARG A C    1 
ATOM   7527  O  O    . ARG A  1 526 ? 196.070 112.104 68.350  1.00 76.97  ? 718  ARG A O    1 
ATOM   7528  C  CB   . ARG A  1 526 ? 194.388 110.620 70.486  1.00 79.17  ? 718  ARG A CB   1 
ATOM   7529  C  CG   . ARG A  1 526 ? 193.209 111.471 70.944  1.00 85.07  ? 718  ARG A CG   1 
ATOM   7530  C  CD   . ARG A  1 526 ? 191.903 110.715 70.759  1.00 88.42  ? 718  ARG A CD   1 
ATOM   7531  N  NE   . ARG A  1 526 ? 191.844 109.545 71.630  1.00 94.93  ? 718  ARG A NE   1 
ATOM   7532  C  CZ   . ARG A  1 526 ? 190.991 108.538 71.481  1.00 99.98  ? 718  ARG A CZ   1 
ATOM   7533  N  NH1  . ARG A  1 526 ? 190.116 108.540 70.483  1.00 103.40 ? 718  ARG A NH1  1 
ATOM   7534  N  NH2  . ARG A  1 526 ? 191.020 107.520 72.330  1.00 102.20 ? 718  ARG A NH2  1 
ATOM   7535  H  H    . ARG A  1 526 ? 196.156 109.661 68.291  1.00 83.72  ? 718  ARG A H    1 
ATOM   7536  H  HA   . ARG A  1 526 ? 193.584 110.204 68.640  1.00 87.46  ? 718  ARG A HA   1 
ATOM   7537  H  HB2  . ARG A  1 526 ? 194.303 109.747 70.902  1.00 94.76  ? 718  ARG A HB2  1 
ATOM   7538  H  HB3  . ARG A  1 526 ? 195.202 111.051 70.792  1.00 94.76  ? 718  ARG A HB3  1 
ATOM   7539  H  HG2  . ARG A  1 526 ? 193.310 111.684 71.885  1.00 101.84 ? 718  ARG A HG2  1 
ATOM   7540  H  HG3  . ARG A  1 526 ? 193.172 112.283 70.415  1.00 101.84 ? 718  ARG A HG3  1 
ATOM   7541  H  HD2  . ARG A  1 526 ? 191.160 111.298 70.980  1.00 105.86 ? 718  ARG A HD2  1 
ATOM   7542  H  HD3  . ARG A  1 526 ? 191.833 110.415 69.839  1.00 105.86 ? 718  ARG A HD3  1 
ATOM   7543  H  HE   . ARG A  1 526 ? 192.401 109.505 72.284  1.00 113.67 ? 718  ARG A HE   1 
ATOM   7544  H  HH11 . ARG A  1 526 ? 190.096 109.199 69.931  1.00 123.83 ? 718  ARG A HH11 1 
ATOM   7545  H  HH12 . ARG A  1 526 ? 189.568 107.884 70.391  1.00 123.83 ? 718  ARG A HH12 1 
ATOM   7546  H  HH21 . ARG A  1 526 ? 191.587 107.515 72.976  1.00 122.39 ? 718  ARG A HH21 1 
ATOM   7547  H  HH22 . ARG A  1 526 ? 190.471 106.865 72.235  1.00 122.39 ? 718  ARG A HH22 1 
ATOM   7548  N  N    . PHE A  1 527 ? 193.928 112.440 67.708  1.00 70.45  ? 719  PHE A N    1 
ATOM   7549  C  CA   . PHE A  1 527 ? 194.134 113.792 67.209  1.00 72.31  ? 719  PHE A CA   1 
ATOM   7550  C  C    . PHE A  1 527 ? 193.886 114.800 68.324  1.00 69.42  ? 719  PHE A C    1 
ATOM   7551  O  O    . PHE A  1 527 ? 193.117 114.547 69.255  1.00 68.58  ? 719  PHE A O    1 
ATOM   7552  C  CB   . PHE A  1 527 ? 193.196 114.099 66.040  1.00 73.33  ? 719  PHE A CB   1 
ATOM   7553  C  CG   . PHE A  1 527 ? 193.629 113.506 64.729  1.00 70.32  ? 719  PHE A CG   1 
ATOM   7554  C  CD1  . PHE A  1 527 ? 194.591 114.132 63.956  1.00 69.20  ? 719  PHE A CD1  1 
ATOM   7555  C  CD2  . PHE A  1 527 ? 193.054 112.337 64.257  1.00 66.24  ? 719  PHE A CD2  1 
ATOM   7556  C  CE1  . PHE A  1 527 ? 194.984 113.597 62.745  1.00 67.72  ? 719  PHE A CE1  1 
ATOM   7557  C  CE2  . PHE A  1 527 ? 193.442 111.797 63.045  1.00 64.22  ? 719  PHE A CE2  1 
ATOM   7558  C  CZ   . PHE A  1 527 ? 194.408 112.427 62.289  1.00 62.86  ? 719  PHE A CZ   1 
ATOM   7559  H  H    . PHE A  1 527 ? 193.132 112.143 67.577  1.00 84.29  ? 719  PHE A H    1 
ATOM   7560  H  HA   . PHE A  1 527 ? 195.049 113.889 66.904  1.00 86.53  ? 719  PHE A HA   1 
ATOM   7561  H  HB2  . PHE A  1 527 ? 192.316 113.747 66.246  1.00 87.74  ? 719  PHE A HB2  1 
ATOM   7562  H  HB3  . PHE A  1 527 ? 193.145 115.061 65.926  1.00 87.74  ? 719  PHE A HB3  1 
ATOM   7563  H  HD1  . PHE A  1 527 ? 194.982 114.920 64.258  1.00 82.79  ? 719  PHE A HD1  1 
ATOM   7564  H  HD2  . PHE A  1 527 ? 192.402 111.908 64.764  1.00 79.24  ? 719  PHE A HD2  1 
ATOM   7565  H  HE1  . PHE A  1 527 ? 195.635 114.024 62.237  1.00 81.01  ? 719  PHE A HE1  1 
ATOM   7566  H  HE2  . PHE A  1 527 ? 193.053 111.009 62.740  1.00 76.81  ? 719  PHE A HE2  1 
ATOM   7567  H  HZ   . PHE A  1 527 ? 194.672 112.065 61.474  1.00 75.18  ? 719  PHE A HZ   1 
ATOM   7568  N  N    . SER A  1 528 ? 194.538 115.956 68.221  1.00 68.28  ? 720  SER A N    1 
ATOM   7569  C  CA   . SER A  1 528 ? 194.237 117.036 69.146  1.00 78.64  ? 720  SER A CA   1 
ATOM   7570  C  C    . SER A  1 528 ? 192.839 117.588 68.860  1.00 80.25  ? 720  SER A C    1 
ATOM   7571  O  O    . SER A  1 528 ? 192.197 117.252 67.861  1.00 81.28  ? 720  SER A O    1 
ATOM   7572  C  CB   . SER A  1 528 ? 195.293 118.139 69.058  1.00 86.34  ? 720  SER A CB   1 
ATOM   7573  O  OG   . SER A  1 528 ? 195.370 118.678 67.752  1.00 89.16  ? 720  SER A OG   1 
ATOM   7574  H  H    . SER A  1 528 ? 195.144 116.135 67.638  1.00 81.68  ? 720  SER A H    1 
ATOM   7575  H  HA   . SER A  1 528 ? 194.242 116.688 70.051  1.00 94.12  ? 720  SER A HA   1 
ATOM   7576  H  HB2  . SER A  1 528 ? 195.058 118.848 69.677  1.00 103.36 ? 720  SER A HB2  1 
ATOM   7577  H  HB3  . SER A  1 528 ? 196.156 117.766 69.295  1.00 103.36 ? 720  SER A HB3  1 
ATOM   7578  H  HG   . SER A  1 528 ? 194.629 119.007 67.532  1.00 106.74 ? 720  SER A HG   1 
ATOM   7579  N  N    . ARG A  1 529 ? 192.371 118.459 69.756  1.00 86.06  ? 721  ARG A N    1 
ATOM   7580  C  CA   . ARG A  1 529 ? 190.965 118.849 69.746  1.00 83.99  ? 721  ARG A CA   1 
ATOM   7581  C  C    . ARG A  1 529 ? 190.568 119.564 68.460  1.00 86.27  ? 721  ARG A C    1 
ATOM   7582  O  O    . ARG A  1 529 ? 189.417 119.450 68.024  1.00 85.89  ? 721  ARG A O    1 
ATOM   7583  C  CB   . ARG A  1 529 ? 190.670 119.724 70.960  1.00 85.64  ? 721  ARG A CB   1 
ATOM   7584  C  CG   . ARG A  1 529 ? 190.681 118.954 72.265  1.00 86.99  ? 721  ARG A CG   1 
ATOM   7585  C  CD   . ARG A  1 529 ? 189.344 118.282 72.496  1.00 86.49  ? 721  ARG A CD   1 
ATOM   7586  N  NE   . ARG A  1 529 ? 189.342 117.414 73.668  1.00 81.93  ? 721  ARG A NE   1 
ATOM   7587  C  CZ   . ARG A  1 529 ? 188.244 116.894 74.203  1.00 83.11  ? 721  ARG A CZ   1 
ATOM   7588  N  NH1  . ARG A  1 529 ? 187.054 117.163 73.677  1.00 82.29  ? 721  ARG A NH1  1 
ATOM   7589  N  NH2  . ARG A  1 529 ? 188.330 116.110 75.269  1.00 84.06  ? 721  ARG A NH2  1 
ATOM   7590  H  H    . ARG A  1 529 ? 192.842 118.833 70.371  1.00 103.02 ? 721  ARG A H    1 
ATOM   7591  H  HA   . ARG A  1 529 ? 190.420 118.050 69.819  1.00 100.53 ? 721  ARG A HA   1 
ATOM   7592  H  HB2  . ARG A  1 529 ? 191.343 120.420 71.017  1.00 102.52 ? 721  ARG A HB2  1 
ATOM   7593  H  HB3  . ARG A  1 529 ? 189.791 120.122 70.855  1.00 102.52 ? 721  ARG A HB3  1 
ATOM   7594  H  HG2  . ARG A  1 529 ? 191.368 118.270 72.230  1.00 104.14 ? 721  ARG A HG2  1 
ATOM   7595  H  HG3  . ARG A  1 529 ? 190.849 119.565 73.000  1.00 104.14 ? 721  ARG A HG3  1 
ATOM   7596  H  HD2  . ARG A  1 529 ? 188.666 118.964 72.626  1.00 103.54 ? 721  ARG A HD2  1 
ATOM   7597  H  HD3  . ARG A  1 529 ? 189.125 117.740 71.721  1.00 103.54 ? 721  ARG A HD3  1 
ATOM   7598  H  HE   . ARG A  1 529 ? 190.102 117.161 73.982  1.00 98.07  ? 721  ARG A HE   1 
ATOM   7599  H  HH11 . ARG A  1 529 ? 186.995 117.670 72.986  1.00 98.50  ? 721  ARG A HH11 1 
ATOM   7600  H  HH12 . ARG A  1 529 ? 186.344 116.826 74.026  1.00 98.50  ? 721  ARG A HH12 1 
ATOM   7601  H  HH21 . ARG A  1 529 ? 189.099 115.935 75.613  1.00 100.63 ? 721  ARG A HH21 1 
ATOM   7602  H  HH22 . ARG A  1 529 ? 187.618 115.776 75.616  1.00 100.63 ? 721  ARG A HH22 1 
ATOM   7603  N  N    . ASP A  1 530 ? 191.491 120.298 67.837  1.00 86.76  ? 722  ASP A N    1 
ATOM   7604  C  CA   . ASP A  1 530 ? 191.221 120.962 66.567  1.00 88.67  ? 722  ASP A CA   1 
ATOM   7605  C  C    . ASP A  1 530 ? 191.997 120.327 65.418  1.00 85.95  ? 722  ASP A C    1 
ATOM   7606  O  O    . ASP A  1 530 ? 192.237 120.982 64.398  1.00 88.09  ? 722  ASP A O    1 
ATOM   7607  C  CB   . ASP A  1 530 ? 191.545 122.454 66.662  1.00 97.75  ? 722  ASP A CB   1 
ATOM   7608  C  CG   . ASP A  1 530 ? 190.938 123.108 67.888  1.00 102.69 ? 722  ASP A CG   1 
ATOM   7609  O  OD1  . ASP A  1 530 ? 189.703 123.025 68.059  1.00 101.83 ? 722  ASP A OD1  1 
ATOM   7610  O  OD2  . ASP A  1 530 ? 191.698 123.710 68.678  1.00 104.34 ? 722  ASP A OD2  1 
ATOM   7611  H  H    . ASP A  1 530 ? 192.288 120.427 68.135  1.00 103.86 ? 722  ASP A H    1 
ATOM   7612  H  HA   . ASP A  1 530 ? 190.276 120.877 66.367  1.00 106.15 ? 722  ASP A HA   1 
ATOM   7613  H  HB2  . ASP A  1 530 ? 192.507 122.566 66.707  1.00 117.05 ? 722  ASP A HB2  1 
ATOM   7614  H  HB3  . ASP A  1 530 ? 191.194 122.904 65.877  1.00 117.05 ? 722  ASP A HB3  1 
ATOM   7615  N  N    . GLY A  1 531 ? 192.377 119.059 65.557  1.00 82.62  ? 723  GLY A N    1 
ATOM   7616  C  CA   . GLY A  1 531 ? 193.088 118.363 64.500  1.00 85.29  ? 723  GLY A CA   1 
ATOM   7617  C  C    . GLY A  1 531 ? 194.454 118.927 64.184  1.00 88.97  ? 723  GLY A C    1 
ATOM   7618  O  O    . GLY A  1 531 ? 195.001 118.641 63.116  1.00 89.35  ? 723  GLY A O    1 
ATOM   7619  H  H    . GLY A  1 531 ? 192.233 118.582 66.257  1.00 98.90  ? 723  GLY A H    1 
ATOM   7620  H  HA2  . GLY A  1 531 ? 193.198 117.433 64.753  1.00 102.10 ? 723  GLY A HA2  1 
ATOM   7621  H  HA3  . GLY A  1 531 ? 192.556 118.393 63.689  1.00 102.10 ? 723  GLY A HA3  1 
ATOM   7622  N  N    . GLU A  1 532 ? 195.030 119.721 65.091  1.00 90.82  ? 724  GLU A N    1 
ATOM   7623  C  CA   . GLU A  1 532 ? 196.340 120.310 64.833  1.00 89.94  ? 724  GLU A CA   1 
ATOM   7624  C  C    . GLU A  1 532 ? 197.437 119.253 64.822  1.00 86.96  ? 724  GLU A C    1 
ATOM   7625  O  O    . GLU A  1 532 ? 198.385 119.343 64.032  1.00 88.06  ? 724  GLU A O    1 
ATOM   7626  C  CB   . GLU A  1 532 ? 196.662 121.367 65.890  1.00 94.03  ? 724  GLU A CB   1 
ATOM   7627  C  CG   . GLU A  1 532 ? 195.516 122.301 66.241  1.00 98.88  ? 724  GLU A CG   1 
ATOM   7628  C  CD   . GLU A  1 532 ? 194.931 122.006 67.610  1.00 97.80  ? 724  GLU A CD   1 
ATOM   7629  O  OE1  . GLU A  1 532 ? 194.433 120.879 67.818  1.00 93.94  ? 724  GLU A OE1  1 
ATOM   7630  O  OE2  . GLU A  1 532 ? 194.976 122.902 68.481  1.00 99.77  ? 724  GLU A OE2  1 
ATOM   7631  H  H    . GLU A  1 532 ? 194.687 119.929 65.852  1.00 108.74 ? 724  GLU A H    1 
ATOM   7632  H  HA   . GLU A  1 532 ? 196.329 120.743 63.965  1.00 107.68 ? 724  GLU A HA   1 
ATOM   7633  H  HB2  . GLU A  1 532 ? 196.931 120.916 66.705  1.00 112.59 ? 724  GLU A HB2  1 
ATOM   7634  H  HB3  . GLU A  1 532 ? 197.395 121.914 65.565  1.00 112.59 ? 724  GLU A HB3  1 
ATOM   7635  H  HG2  . GLU A  1 532 ? 195.840 123.215 66.242  1.00 118.41 ? 724  GLU A HG2  1 
ATOM   7636  H  HG3  . GLU A  1 532 ? 194.810 122.198 65.583  1.00 118.41 ? 724  GLU A HG3  1 
ATOM   7637  N  N    . ILE A  1 533 ? 197.325 118.245 65.682  1.00 89.23  ? 725  ILE A N    1 
ATOM   7638  C  CA   . ILE A  1 533 ? 198.412 117.310 65.943  1.00 86.58  ? 725  ILE A CA   1 
ATOM   7639  C  C    . ILE A  1 533 ? 197.834 115.910 66.082  1.00 86.24  ? 725  ILE A C    1 
ATOM   7640  O  O    . ILE A  1 533 ? 196.725 115.733 66.598  1.00 84.47  ? 725  ILE A O    1 
ATOM   7641  C  CB   . ILE A  1 533 ? 199.204 117.719 67.206  1.00 89.99  ? 725  ILE A CB   1 
ATOM   7642  C  CG1  . ILE A  1 533 ? 200.216 118.811 66.844  1.00 95.45  ? 725  ILE A CG1  1 
ATOM   7643  C  CG2  . ILE A  1 533 ? 199.905 116.512 67.847  1.00 90.19  ? 725  ILE A CG2  1 
ATOM   7644  C  CD1  . ILE A  1 533 ? 201.046 119.315 68.008  1.00 103.78 ? 725  ILE A CD1  1 
ATOM   7645  H  H    . ILE A  1 533 ? 196.613 118.079 66.135  1.00 106.83 ? 725  ILE A H    1 
ATOM   7646  H  HA   . ILE A  1 533 ? 199.023 117.312 65.190  1.00 103.64 ? 725  ILE A HA   1 
ATOM   7647  H  HB   . ILE A  1 533 ? 198.580 118.085 67.851  1.00 107.74 ? 725  ILE A HB   1 
ATOM   7648  H  HG12 . ILE A  1 533 ? 200.828 118.458 66.179  1.00 114.29 ? 725  ILE A HG12 1 
ATOM   7649  H  HG13 . ILE A  1 533 ? 199.736 119.569 66.476  1.00 114.29 ? 725  ILE A HG13 1 
ATOM   7650  H  HG21 . ILE A  1 533 ? 200.389 116.809 68.633  1.00 107.97 ? 725  ILE A HG21 1 
ATOM   7651  H  HG22 . ILE A  1 533 ? 199.235 115.856 68.098  1.00 107.97 ? 725  ILE A HG22 1 
ATOM   7652  H  HG23 . ILE A  1 533 ? 200.521 116.127 67.204  1.00 107.97 ? 725  ILE A HG23 1 
ATOM   7653  H  HD11 . ILE A  1 533 ? 201.654 119.999 67.688  1.00 124.28 ? 725  ILE A HD11 1 
ATOM   7654  H  HD12 . ILE A  1 533 ? 200.453 119.687 68.680  1.00 124.28 ? 725  ILE A HD12 1 
ATOM   7655  H  HD13 . ILE A  1 533 ? 201.547 118.574 68.382  1.00 124.28 ? 725  ILE A HD13 1 
ATOM   7656  N  N    . LEU A  1 534 ? 198.587 114.918 65.616  1.00 79.13  ? 726  LEU A N    1 
ATOM   7657  C  CA   . LEU A  1 534 ? 198.243 113.513 65.782  1.00 74.18  ? 726  LEU A CA   1 
ATOM   7658  C  C    . LEU A  1 534 ? 199.251 112.866 66.721  1.00 71.90  ? 726  LEU A C    1 
ATOM   7659  O  O    . LEU A  1 534 ? 200.462 112.966 66.500  1.00 76.30  ? 726  LEU A O    1 
ATOM   7660  C  CB   . LEU A  1 534 ? 198.239 112.783 64.436  1.00 73.41  ? 726  LEU A CB   1 
ATOM   7661  C  CG   . LEU A  1 534 ? 198.018 111.267 64.486  1.00 69.53  ? 726  LEU A CG   1 
ATOM   7662  C  CD1  . LEU A  1 534 ? 196.627 110.936 65.013  1.00 66.73  ? 726  LEU A CD1  1 
ATOM   7663  C  CD2  . LEU A  1 534 ? 198.243 110.643 63.122  1.00 68.41  ? 726  LEU A CD2  1 
ATOM   7664  H  H    . LEU A  1 534 ? 199.323 115.040 65.189  1.00 94.71  ? 726  LEU A H    1 
ATOM   7665  H  HA   . LEU A  1 534 ? 197.360 113.438 66.177  1.00 88.76  ? 726  LEU A HA   1 
ATOM   7666  H  HB2  . LEU A  1 534 ? 197.533 113.159 63.889  1.00 87.84  ? 726  LEU A HB2  1 
ATOM   7667  H  HB3  . LEU A  1 534 ? 199.095 112.936 64.006  1.00 87.84  ? 726  LEU A HB3  1 
ATOM   7668  H  HG   . LEU A  1 534 ? 198.664 110.880 65.098  1.00 83.19  ? 726  LEU A HG   1 
ATOM   7669  H  HD11 . LEU A  1 534 ? 196.519 109.972 65.032  1.00 79.82  ? 726  LEU A HD11 1 
ATOM   7670  H  HD12 . LEU A  1 534 ? 196.534 111.298 65.908  1.00 79.82  ? 726  LEU A HD12 1 
ATOM   7671  H  HD13 . LEU A  1 534 ? 195.965 111.332 64.425  1.00 79.82  ? 726  LEU A HD13 1 
ATOM   7672  H  HD21 . LEU A  1 534 ? 198.097 109.686 63.185  1.00 81.85  ? 726  LEU A HD21 1 
ATOM   7673  H  HD22 . LEU A  1 534 ? 197.619 111.033 62.490  1.00 81.85  ? 726  LEU A HD22 1 
ATOM   7674  H  HD23 . LEU A  1 534 ? 199.154 110.821 62.841  1.00 81.85  ? 726  LEU A HD23 1 
ATOM   7675  N  N    . ALA A  1 535 ? 198.751 112.217 67.769  1.00 74.44  ? 727  ALA A N    1 
ATOM   7676  C  CA   . ALA A  1 535 ? 199.586 111.521 68.737  1.00 75.97  ? 727  ALA A CA   1 
ATOM   7677  C  C    . ALA A  1 535 ? 199.456 110.019 68.532  1.00 73.76  ? 727  ALA A C    1 
ATOM   7678  O  O    . ALA A  1 535 ? 198.358 109.510 68.285  1.00 75.80  ? 727  ALA A O    1 
ATOM   7679  C  CB   . ALA A  1 535 ? 199.194 111.890 70.170  1.00 75.82  ? 727  ALA A CB   1 
ATOM   7680  H  H    . ALA A  1 535 ? 197.911 112.166 67.943  1.00 89.08  ? 727  ALA A H    1 
ATOM   7681  H  HA   . ALA A  1 535 ? 200.513 111.770 68.600  1.00 90.92  ? 727  ALA A HA   1 
ATOM   7682  H  HB1  . ALA A  1 535 ? 199.768 111.409 70.788  1.00 90.73  ? 727  ALA A HB1  1 
ATOM   7683  H  HB2  . ALA A  1 535 ? 199.303 112.846 70.291  1.00 90.73  ? 727  ALA A HB2  1 
ATOM   7684  H  HB3  . ALA A  1 535 ? 198.268 111.641 70.318  1.00 90.73  ? 727  ALA A HB3  1 
ATOM   7685  N  N    . SER A  1 536 ? 200.580 109.312 68.628  1.00 72.26  ? 728  SER A N    1 
ATOM   7686  C  CA   . SER A  1 536 ? 200.610 107.867 68.451  1.00 75.90  ? 728  SER A CA   1 
ATOM   7687  C  C    . SER A  1 536 ? 201.417 107.230 69.573  1.00 78.69  ? 728  SER A C    1 
ATOM   7688  O  O    . SER A  1 536 ? 202.475 107.740 69.955  1.00 75.71  ? 728  SER A O    1 
ATOM   7689  C  CB   . SER A  1 536 ? 201.209 107.485 67.087  1.00 79.55  ? 728  SER A CB   1 
ATOM   7690  O  OG   . SER A  1 536 ? 202.499 108.047 66.912  1.00 78.58  ? 728  SER A OG   1 
ATOM   7691  H  H    . SER A  1 536 ? 201.350 109.655 68.798  1.00 86.47  ? 728  SER A H    1 
ATOM   7692  H  HA   . SER A  1 536 ? 199.705 107.521 68.493  1.00 90.83  ? 728  SER A HA   1 
ATOM   7693  H  HB2  . SER A  1 536 ? 201.278 106.519 67.034  1.00 95.21  ? 728  SER A HB2  1 
ATOM   7694  H  HB3  . SER A  1 536 ? 200.625 107.813 66.385  1.00 95.21  ? 728  SER A HB3  1 
ATOM   7695  H  HG   . SER A  1 536 ? 203.017 107.771 67.512  1.00 94.05  ? 728  SER A HG   1 
ATOM   7696  N  N    . GLY A  1 537 ? 200.903 106.122 70.102  1.00 76.96  ? 729  GLY A N    1 
ATOM   7697  C  CA   . GLY A  1 537 ? 201.598 105.353 71.117  1.00 78.45  ? 729  GLY A CA   1 
ATOM   7698  C  C    . GLY A  1 537 ? 201.875 103.953 70.604  1.00 77.47  ? 729  GLY A C    1 
ATOM   7699  O  O    . GLY A  1 537 ? 201.091 103.394 69.835  1.00 76.87  ? 729  GLY A O    1 
ATOM   7700  H  H    . GLY A  1 537 ? 200.140 105.793 69.882  1.00 92.10  ? 729  GLY A H    1 
ATOM   7701  H  HA2  . GLY A  1 537 ? 202.441 105.780 71.338  1.00 93.90  ? 729  GLY A HA2  1 
ATOM   7702  H  HA3  . GLY A  1 537 ? 201.055 105.294 71.918  1.00 93.90  ? 729  GLY A HA3  1 
ATOM   7703  N  N    . SER A  1 538 ? 202.997 103.382 71.041  1.00 75.72  ? 730  SER A N    1 
ATOM   7704  C  CA   . SER A  1 538 ? 203.510 102.171 70.419  1.00 76.62  ? 730  SER A CA   1 
ATOM   7705  C  C    . SER A  1 538 ? 204.109 101.227 71.453  1.00 75.61  ? 730  SER A C    1 
ATOM   7706  O  O    . SER A  1 538 ? 204.513 101.632 72.547  1.00 72.99  ? 730  SER A O    1 
ATOM   7707  C  CB   . SER A  1 538 ? 204.566 102.507 69.360  1.00 78.51  ? 730  SER A CB   1 
ATOM   7708  O  OG   . SER A  1 538 ? 205.231 101.337 68.919  1.00 81.47  ? 730  SER A OG   1 
ATOM   7709  H  H    . SER A  1 538 ? 203.475 103.678 71.692  1.00 90.61  ? 730  SER A H    1 
ATOM   7710  H  HA   . SER A  1 538 ? 202.780 101.709 69.979  1.00 91.69  ? 730  SER A HA   1 
ATOM   7711  H  HB2  . SER A  1 538 ? 204.129 102.926 68.602  1.00 93.96  ? 730  SER A HB2  1 
ATOM   7712  H  HB3  . SER A  1 538 ? 205.216 103.114 69.745  1.00 93.96  ? 730  SER A HB3  1 
ATOM   7713  H  HG   . SER A  1 538 ? 204.679 100.801 68.583  1.00 97.51  ? 730  SER A HG   1 
ATOM   7714  N  N    . MET A  1 539 ? 204.159 99.945  71.075  1.00 81.65  ? 731  MET A N    1 
ATOM   7715  C  CA   . MET A  1 539 ? 204.832 98.920  71.862  1.00 79.22  ? 731  MET A CA   1 
ATOM   7716  C  C    . MET A  1 539 ? 206.343 99.101  71.887  1.00 79.93  ? 731  MET A C    1 
ATOM   7717  O  O    . MET A  1 539 ? 207.017 98.419  72.667  1.00 79.39  ? 731  MET A O    1 
ATOM   7718  C  CB   . MET A  1 539 ? 204.500 97.532  71.308  1.00 79.48  ? 731  MET A CB   1 
ATOM   7719  C  CG   . MET A  1 539 ? 203.027 97.152  71.410  1.00 79.12  ? 731  MET A CG   1 
ATOM   7720  S  SD   . MET A  1 539 ? 202.425 96.912  73.094  1.00 84.22  ? 731  MET A SD   1 
ATOM   7721  C  CE   . MET A  1 539 ? 203.526 95.640  73.702  1.00 87.16  ? 731  MET A CE   1 
ATOM   7722  H  H    . MET A  1 539 ? 203.802 99.645  70.353  1.00 97.73  ? 731  MET A H    1 
ATOM   7723  H  HA   . MET A  1 539 ? 204.500 98.960  72.773  1.00 94.81  ? 731  MET A HA   1 
ATOM   7724  H  HB2  . MET A  1 539 ? 204.747 97.505  70.370  1.00 95.13  ? 731  MET A HB2  1 
ATOM   7725  H  HB3  . MET A  1 539 ? 205.011 96.870  71.800  1.00 95.13  ? 731  MET A HB3  1 
ATOM   7726  H  HG2  . MET A  1 539 ? 202.497 97.856  71.006  1.00 94.69  ? 731  MET A HG2  1 
ATOM   7727  H  HG3  . MET A  1 539 ? 202.888 96.322  70.927  1.00 94.69  ? 731  MET A HG3  1 
ATOM   7728  H  HE1  . MET A  1 539 ? 203.289 95.429  74.618  1.00 104.34 ? 731  MET A HE1  1 
ATOM   7729  H  HE2  . MET A  1 539 ? 203.434 94.851  73.145  1.00 104.34 ? 731  MET A HE2  1 
ATOM   7730  H  HE3  . MET A  1 539 ? 204.439 95.968  73.664  1.00 104.34 ? 731  MET A HE3  1 
ATOM   7731  N  N    . ASP A  1 540 ? 206.889 99.986  71.052  1.00 74.76  ? 732  ASP A N    1 
ATOM   7732  C  CA   . ASP A  1 540 ? 208.286 100.381 71.184  1.00 79.62  ? 732  ASP A CA   1 
ATOM   7733  C  C    . ASP A  1 540 ? 208.509 101.309 72.371  1.00 80.50  ? 732  ASP A C    1 
ATOM   7734  O  O    . ASP A  1 540 ? 209.634 101.782 72.565  1.00 80.57  ? 732  ASP A O    1 
ATOM   7735  C  CB   . ASP A  1 540 ? 208.773 101.040 69.885  1.00 81.63  ? 732  ASP A CB   1 
ATOM   7736  C  CG   . ASP A  1 540 ? 208.137 102.396 69.630  1.00 83.07  ? 732  ASP A CG   1 
ATOM   7737  O  OD1  . ASP A  1 540 ? 207.401 102.900 70.504  1.00 82.67  ? 732  ASP A OD1  1 
ATOM   7738  O  OD2  . ASP A  1 540 ? 208.374 102.961 68.541  1.00 80.82  ? 732  ASP A OD2  1 
ATOM   7739  H  H    . ASP A  1 540 ? 206.473 100.369 70.404  1.00 89.47  ? 732  ASP A H    1 
ATOM   7740  H  HA   . ASP A  1 540 ? 208.820 99.585  71.329  1.00 95.30  ? 732  ASP A HA   1 
ATOM   7741  H  HB2  . ASP A  1 540 ? 209.734 101.165 69.937  1.00 97.70  ? 732  ASP A HB2  1 
ATOM   7742  H  HB3  . ASP A  1 540 ? 208.554 100.462 69.138  1.00 97.70  ? 732  ASP A HB3  1 
ATOM   7743  N  N    . ASN A  1 541 ? 207.461 101.588 73.149  1.00 80.95  ? 733  ASN A N    1 
ATOM   7744  C  CA   . ASN A  1 541 ? 207.565 102.383 74.369  1.00 80.20  ? 733  ASN A CA   1 
ATOM   7745  C  C    . ASN A  1 541 ? 207.964 103.823 74.054  1.00 83.53  ? 733  ASN A C    1 
ATOM   7746  O  O    . ASN A  1 541 ? 208.829 104.404 74.712  1.00 84.71  ? 733  ASN A O    1 
ATOM   7747  C  CB   . ASN A  1 541 ? 208.536 101.744 75.364  1.00 77.81  ? 733  ASN A CB   1 
ATOM   7748  C  CG   . ASN A  1 541 ? 208.118 100.340 75.757  1.00 78.94  ? 733  ASN A CG   1 
ATOM   7749  O  OD1  . ASN A  1 541 ? 206.939 99.989  75.682  1.00 79.40  ? 733  ASN A OD1  1 
ATOM   7750  N  ND2  . ASN A  1 541 ? 209.080 99.531  76.181  1.00 81.52  ? 733  ASN A ND2  1 
ATOM   7751  H  H    . ASN A  1 541 ? 206.661 101.320 72.985  1.00 96.89  ? 733  ASN A H    1 
ATOM   7752  H  HA   . ASN A  1 541 ? 206.692 102.410 74.792  1.00 96.00  ? 733  ASN A HA   1 
ATOM   7753  H  HB2  . ASN A  1 541 ? 209.417 101.695 74.961  1.00 93.12  ? 733  ASN A HB2  1 
ATOM   7754  H  HB3  . ASN A  1 541 ? 208.568 102.285 76.169  1.00 93.12  ? 733  ASN A HB3  1 
ATOM   7755  H  HD21 . ASN A  1 541 ? 208.891 98.725  76.415  1.00 97.58  ? 733  ASN A HD21 1 
ATOM   7756  H  HD22 . ASN A  1 541 ? 209.892 99.811  76.220  1.00 97.58  ? 733  ASN A HD22 1 
ATOM   7757  N  N    . THR A  1 542 ? 207.329 104.398 73.033  1.00 86.66  ? 734  THR A N    1 
ATOM   7758  C  CA   . THR A  1 542 ? 207.475 105.811 72.723  1.00 90.08  ? 734  THR A CA   1 
ATOM   7759  C  C    . THR A  1 542 ? 206.129 106.369 72.287  1.00 87.58  ? 734  THR A C    1 
ATOM   7760  O  O    . THR A  1 542 ? 205.285 105.647 71.748  1.00 86.74  ? 734  THR A O    1 
ATOM   7761  C  CB   . THR A  1 542 ? 208.513 106.060 71.615  1.00 92.23  ? 734  THR A CB   1 
ATOM   7762  O  OG1  . THR A  1 542 ? 208.026 105.538 70.373  1.00 90.68  ? 734  THR A OG1  1 
ATOM   7763  C  CG2  . THR A  1 542 ? 209.843 105.402 71.954  1.00 94.49  ? 734  THR A CG2  1 
ATOM   7764  H  H    . THR A  1 542 ? 206.800 103.981 72.500  1.00 103.75 ? 734  THR A H    1 
ATOM   7765  H  HA   . THR A  1 542 ? 207.759 106.287 73.519  1.00 107.85 ? 734  THR A HA   1 
ATOM   7766  H  HB   . THR A  1 542 ? 208.660 107.015 71.524  1.00 110.42 ? 734  THR A HB   1 
ATOM   7767  H  HG1  . THR A  1 542 ? 207.891 104.712 70.441  1.00 108.57 ? 734  THR A HG1  1 
ATOM   7768  H  HG21 . THR A  1 542 ? 210.485 105.569 71.247  1.00 113.14 ? 734  THR A HG21 1 
ATOM   7769  H  HG22 . THR A  1 542 ? 210.188 105.764 72.785  1.00 113.14 ? 734  THR A HG22 1 
ATOM   7770  H  HG23 . THR A  1 542 ? 209.723 104.445 72.053  1.00 113.14 ? 734  THR A HG23 1 
ATOM   7771  N  N    . VAL A  1 543 ? 205.935 107.663 72.535  1.00 84.00  ? 735  VAL A N    1 
ATOM   7772  C  CA   . VAL A  1 543 ? 204.827 108.426 71.973  1.00 77.89  ? 735  VAL A CA   1 
ATOM   7773  C  C    . VAL A  1 543 ? 205.405 109.425 70.984  1.00 81.63  ? 735  VAL A C    1 
ATOM   7774  O  O    . VAL A  1 543 ? 206.432 110.057 71.256  1.00 85.15  ? 735  VAL A O    1 
ATOM   7775  C  CB   . VAL A  1 543 ? 204.005 109.142 73.064  1.00 76.88  ? 735  VAL A CB   1 
ATOM   7776  C  CG1  . VAL A  1 543 ? 203.150 110.260 72.460  1.00 78.08  ? 735  VAL A CG1  1 
ATOM   7777  C  CG2  . VAL A  1 543 ? 203.117 108.147 73.794  1.00 74.04  ? 735  VAL A CG2  1 
ATOM   7778  H  H    . VAL A  1 543 ? 206.449 108.132 73.040  1.00 100.56 ? 735  VAL A H    1 
ATOM   7779  H  HA   . VAL A  1 543 ? 204.236 107.826 71.491  1.00 93.23  ? 735  VAL A HA   1 
ATOM   7780  H  HB   . VAL A  1 543 ? 204.610 109.539 73.710  1.00 92.01  ? 735  VAL A HB   1 
ATOM   7781  H  HG11 . VAL A  1 543 ? 202.647 110.690 73.169  1.00 93.45  ? 735  VAL A HG11 1 
ATOM   7782  H  HG12 . VAL A  1 543 ? 203.732 110.905 72.029  1.00 93.45  ? 735  VAL A HG12 1 
ATOM   7783  H  HG13 . VAL A  1 543 ? 202.542 109.876 71.809  1.00 93.45  ? 735  VAL A HG13 1 
ATOM   7784  H  HG21 . VAL A  1 543 ? 202.610 108.617 74.474  1.00 88.60  ? 735  VAL A HG21 1 
ATOM   7785  H  HG22 . VAL A  1 543 ? 202.514 107.736 73.156  1.00 88.60  ? 735  VAL A HG22 1 
ATOM   7786  H  HG23 . VAL A  1 543 ? 203.676 107.469 74.206  1.00 88.60  ? 735  VAL A HG23 1 
ATOM   7787  N  N    . ARG A  1 544 ? 204.751 109.562 69.833  1.00 84.02  ? 736  ARG A N    1 
ATOM   7788  C  CA   . ARG A  1 544 ? 205.211 110.466 68.789  1.00 88.60  ? 736  ARG A CA   1 
ATOM   7789  C  C    . ARG A  1 544 ? 204.096 111.423 68.400  1.00 86.78  ? 736  ARG A C    1 
ATOM   7790  O  O    . ARG A  1 544 ? 202.929 111.032 68.307  1.00 80.67  ? 736  ARG A O    1 
ATOM   7791  C  CB   . ARG A  1 544 ? 205.703 109.684 67.569  1.00 86.23  ? 736  ARG A CB   1 
ATOM   7792  C  CG   . ARG A  1 544 ? 207.000 108.948 67.849  1.00 88.11  ? 736  ARG A CG   1 
ATOM   7793  C  CD   . ARG A  1 544 ? 207.444 108.073 66.697  1.00 88.23  ? 736  ARG A CD   1 
ATOM   7794  N  NE   . ARG A  1 544 ? 208.314 106.997 67.173  1.00 88.25  ? 736  ARG A NE   1 
ATOM   7795  C  CZ   . ARG A  1 544 ? 209.639 106.973 67.051  1.00 92.65  ? 736  ARG A CZ   1 
ATOM   7796  N  NH1  . ARG A  1 544 ? 210.292 107.964 66.453  1.00 92.40  ? 736  ARG A NH1  1 
ATOM   7797  N  NH2  . ARG A  1 544 ? 210.321 105.940 67.529  1.00 95.31  ? 736  ARG A NH2  1 
ATOM   7798  H  H    . ARG A  1 544 ? 204.030 109.138 69.633  1.00 100.58 ? 736  ARG A H    1 
ATOM   7799  H  HA   . ARG A  1 544 ? 205.953 110.990 69.129  1.00 106.07 ? 736  ARG A HA   1 
ATOM   7800  H  HB2  . ARG A  1 544 ? 205.032 109.029 67.319  1.00 103.22 ? 736  ARG A HB2  1 
ATOM   7801  H  HB3  . ARG A  1 544 ? 205.858 110.301 66.837  1.00 103.22 ? 736  ARG A HB3  1 
ATOM   7802  H  HG2  . ARG A  1 544 ? 207.700 109.598 68.019  1.00 105.49 ? 736  ARG A HG2  1 
ATOM   7803  H  HG3  . ARG A  1 544 ? 206.879 108.381 68.627  1.00 105.49 ? 736  ARG A HG3  1 
ATOM   7804  H  HD2  . ARG A  1 544 ? 206.667 107.674 66.275  1.00 105.63 ? 736  ARG A HD2  1 
ATOM   7805  H  HD3  . ARG A  1 544 ? 207.940 108.608 66.057  1.00 105.63 ? 736  ARG A HD3  1 
ATOM   7806  H  HE   . ARG A  1 544 ? 207.940 106.328 67.563  1.00 105.65 ? 736  ARG A HE   1 
ATOM   7807  H  HH11 . ARG A  1 544 ? 209.858 108.638 66.141  1.00 110.63 ? 736  ARG A HH11 1 
ATOM   7808  H  HH12 . ARG A  1 544 ? 211.148 107.933 66.381  1.00 110.63 ? 736  ARG A HH12 1 
ATOM   7809  H  HH21 . ARG A  1 544 ? 209.907 105.293 67.916  1.00 114.13 ? 736  ARG A HH21 1 
ATOM   7810  H  HH22 . ARG A  1 544 ? 211.177 105.916 67.451  1.00 114.13 ? 736  ARG A HH22 1 
ATOM   7811  N  N    . LEU A  1 545 ? 204.470 112.682 68.187  1.00 85.84  ? 737  LEU A N    1 
ATOM   7812  C  CA   . LEU A  1 545 ? 203.544 113.736 67.798  1.00 81.04  ? 737  LEU A CA   1 
ATOM   7813  C  C    . LEU A  1 545 ? 203.814 114.128 66.353  1.00 81.21  ? 737  LEU A C    1 
ATOM   7814  O  O    . LEU A  1 545 ? 204.966 114.373 65.979  1.00 83.45  ? 737  LEU A O    1 
ATOM   7815  C  CB   . LEU A  1 545 ? 203.695 114.948 68.718  1.00 80.10  ? 737  LEU A CB   1 
ATOM   7816  C  CG   . LEU A  1 545 ? 203.579 114.646 70.215  1.00 77.55  ? 737  LEU A CG   1 
ATOM   7817  C  CD1  . LEU A  1 545 ? 203.664 115.928 71.024  1.00 78.69  ? 737  LEU A CD1  1 
ATOM   7818  C  CD2  . LEU A  1 545 ? 202.294 113.889 70.533  1.00 76.06  ? 737  LEU A CD2  1 
ATOM   7819  H  H    . LEU A  1 545 ? 205.281 112.955 68.264  1.00 102.76 ? 737  LEU A H    1 
ATOM   7820  H  HA   . LEU A  1 545 ? 202.633 113.409 67.864  1.00 97.00  ? 737  LEU A HA   1 
ATOM   7821  H  HB2  . LEU A  1 545 ? 204.568 115.343 68.566  1.00 95.87  ? 737  LEU A HB2  1 
ATOM   7822  H  HB3  . LEU A  1 545 ? 203.004 115.592 68.495  1.00 95.87  ? 737  LEU A HB3  1 
ATOM   7823  H  HG   . LEU A  1 545 ? 204.324 114.083 70.476  1.00 92.81  ? 737  LEU A HG   1 
ATOM   7824  H  HD11 . LEU A  1 545 ? 203.588 115.712 71.966  1.00 94.18  ? 737  LEU A HD11 1 
ATOM   7825  H  HD12 . LEU A  1 545 ? 204.517 116.355 70.850  1.00 94.18  ? 737  LEU A HD12 1 
ATOM   7826  H  HD13 . LEU A  1 545 ? 202.939 116.517 70.759  1.00 94.18  ? 737  LEU A HD13 1 
ATOM   7827  H  HD21 . LEU A  1 545 ? 202.257 113.717 71.487  1.00 91.02  ? 737  LEU A HD21 1 
ATOM   7828  H  HD22 . LEU A  1 545 ? 201.534 114.430 70.265  1.00 91.02  ? 737  LEU A HD22 1 
ATOM   7829  H  HD23 . LEU A  1 545 ? 202.292 113.051 70.045  1.00 91.02  ? 737  LEU A HD23 1 
ATOM   7830  N  N    . TRP A  1 546 ? 202.757 114.191 65.548  1.00 84.17  ? 738  TRP A N    1 
ATOM   7831  C  CA   . TRP A  1 546 ? 202.875 114.485 64.129  1.00 84.93  ? 738  TRP A CA   1 
ATOM   7832  C  C    . TRP A  1 546 ? 202.116 115.763 63.790  1.00 83.27  ? 738  TRP A C    1 
ATOM   7833  O  O    . TRP A  1 546 ? 201.096 116.084 64.408  1.00 80.30  ? 738  TRP A O    1 
ATOM   7834  C  CB   . TRP A  1 546 ? 202.339 113.324 63.283  1.00 83.26  ? 738  TRP A CB   1 
ATOM   7835  C  CG   . TRP A  1 546 ? 202.869 111.980 63.693  1.00 78.58  ? 738  TRP A CG   1 
ATOM   7836  C  CD1  . TRP A  1 546 ? 202.348 111.151 64.642  1.00 77.65  ? 738  TRP A CD1  1 
ATOM   7837  C  CD2  . TRP A  1 546 ? 204.018 111.307 63.161  1.00 80.95  ? 738  TRP A CD2  1 
ATOM   7838  N  NE1  . TRP A  1 546 ? 203.101 110.007 64.739  1.00 78.24  ? 738  TRP A NE1  1 
ATOM   7839  C  CE2  . TRP A  1 546 ? 204.132 110.077 63.840  1.00 78.94  ? 738  TRP A CE2  1 
ATOM   7840  C  CE3  . TRP A  1 546 ? 204.961 111.624 62.178  1.00 87.79  ? 738  TRP A CE3  1 
ATOM   7841  C  CZ2  . TRP A  1 546 ? 205.149 109.165 63.569  1.00 81.51  ? 738  TRP A CZ2  1 
ATOM   7842  C  CZ3  . TRP A  1 546 ? 205.971 110.716 61.911  1.00 87.41  ? 738  TRP A CZ3  1 
ATOM   7843  C  CH2  . TRP A  1 546 ? 206.056 109.502 62.603  1.00 85.24  ? 738  TRP A CH2  1 
ATOM   7844  H  H    . TRP A  1 546 ? 201.947 114.064 65.808  1.00 100.75 ? 738  TRP A H    1 
ATOM   7845  H  HA   . TRP A  1 546 ? 203.810 114.618 63.906  1.00 101.66 ? 738  TRP A HA   1 
ATOM   7846  H  HB2  . TRP A  1 546 ? 201.373 113.299 63.363  1.00 99.66  ? 738  TRP A HB2  1 
ATOM   7847  H  HB3  . TRP A  1 546 ? 202.588 113.471 62.357  1.00 99.66  ? 738  TRP A HB3  1 
ATOM   7848  H  HD1  . TRP A  1 546 ? 201.593 111.336 65.153  1.00 92.94  ? 738  TRP A HD1  1 
ATOM   7849  H  HE1  . TRP A  1 546 ? 202.949 109.352 65.276  1.00 93.64  ? 738  TRP A HE1  1 
ATOM   7850  H  HE3  . TRP A  1 546 ? 204.910 112.429 61.714  1.00 105.10 ? 738  TRP A HE3  1 
ATOM   7851  H  HZ2  . TRP A  1 546 ? 205.208 108.358 64.027  1.00 97.56  ? 738  TRP A HZ2  1 
ATOM   7852  H  HZ3  . TRP A  1 546 ? 206.605 110.916 61.259  1.00 104.64 ? 738  TRP A HZ3  1 
ATOM   7853  H  HH2  . TRP A  1 546 ? 206.746 108.912 62.403  1.00 102.03 ? 738  TRP A HH2  1 
ATOM   7854  N  N    . ASP A  1 547 ? 202.626 116.487 62.795  1.00 85.30  ? 739  ASP A N    1 
ATOM   7855  C  CA   . ASP A  1 547 ? 202.015 117.732 62.326  1.00 86.91  ? 739  ASP A CA   1 
ATOM   7856  C  C    . ASP A  1 547 ? 200.873 117.380 61.382  1.00 87.48  ? 739  ASP A C    1 
ATOM   7857  O  O    . ASP A  1 547 ? 201.062 117.207 60.177  1.00 89.59  ? 739  ASP A O    1 
ATOM   7858  C  CB   . ASP A  1 547 ? 203.050 118.613 61.639  1.00 88.38  ? 739  ASP A CB   1 
ATOM   7859  C  CG   . ASP A  1 547 ? 202.524 120.002 61.328  1.00 96.02  ? 739  ASP A CG   1 
ATOM   7860  O  OD1  . ASP A  1 547 ? 201.302 120.223 61.467  1.00 96.10  ? 739  ASP A OD1  1 
ATOM   7861  O  OD2  . ASP A  1 547 ? 203.336 120.872 60.940  1.00 100.09 ? 739  ASP A OD2  1 
ATOM   7862  H  H    . ASP A  1 547 ? 203.341 116.274 62.366  1.00 102.11 ? 739  ASP A H    1 
ATOM   7863  H  HA   . ASP A  1 547 ? 201.651 118.218 63.082  1.00 104.04 ? 739  ASP A HA   1 
ATOM   7864  H  HB2  . ASP A  1 547 ? 203.821 118.707 62.220  1.00 105.80 ? 739  ASP A HB2  1 
ATOM   7865  H  HB3  . ASP A  1 547 ? 203.314 118.198 60.803  1.00 105.80 ? 739  ASP A HB3  1 
ATOM   7866  N  N    . ALA A  1 548 ? 199.663 117.284 61.936  1.00 88.54  ? 740  ALA A N    1 
ATOM   7867  C  CA   . ALA A  1 548 ? 198.515 116.893 61.126  1.00 89.37  ? 740  ALA A CA   1 
ATOM   7868  C  C    . ALA A  1 548 ? 198.135 117.972 60.122  1.00 92.13  ? 740  ALA A C    1 
ATOM   7869  O  O    . ALA A  1 548 ? 197.678 117.654 59.019  1.00 93.45  ? 740  ALA A O    1 
ATOM   7870  C  CB   . ALA A  1 548 ? 197.323 116.568 62.026  1.00 89.46  ? 740  ALA A CB   1 
ATOM   7871  H  H    . ALA A  1 548 ? 199.484 117.438 62.763  1.00 106.00 ? 740  ALA A H    1 
ATOM   7872  H  HA   . ALA A  1 548 ? 198.740 116.091 60.630  1.00 106.99 ? 740  ALA A HA   1 
ATOM   7873  H  HB1  . ALA A  1 548 ? 196.570 116.310 61.471  1.00 107.10 ? 740  ALA A HB1  1 
ATOM   7874  H  HB2  . ALA A  1 548 ? 197.564 115.838 62.617  1.00 107.10 ? 740  ALA A HB2  1 
ATOM   7875  H  HB3  . ALA A  1 548 ? 197.097 117.355 62.546  1.00 107.10 ? 740  ALA A HB3  1 
ATOM   7876  N  N    . ILE A  1 549 ? 198.318 119.246 60.476  1.00 89.11  ? 741  ILE A N    1 
ATOM   7877  C  CA   . ILE A  1 549 ? 198.013 120.327 59.540  1.00 93.40  ? 741  ILE A CA   1 
ATOM   7878  C  C    . ILE A  1 549 ? 198.879 120.200 58.295  1.00 92.75  ? 741  ILE A C    1 
ATOM   7879  O  O    . ILE A  1 549 ? 198.390 120.284 57.162  1.00 93.07  ? 741  ILE A O    1 
ATOM   7880  C  CB   . ILE A  1 549 ? 198.198 121.697 60.219  1.00 94.08  ? 741  ILE A CB   1 
ATOM   7881  C  CG1  . ILE A  1 549 ? 197.304 121.816 61.459  1.00 95.62  ? 741  ILE A CG1  1 
ATOM   7882  C  CG2  . ILE A  1 549 ? 197.902 122.828 59.238  1.00 94.41  ? 741  ILE A CG2  1 
ATOM   7883  C  CD1  . ILE A  1 549 ? 195.811 121.684 61.179  1.00 93.76  ? 741  ILE A CD1  1 
ATOM   7884  H  H    . ILE A  1 549 ? 198.613 119.507 61.241  1.00 106.69 ? 741  ILE A H    1 
ATOM   7885  H  HA   . ILE A  1 549 ? 197.085 120.253 59.267  1.00 111.83 ? 741  ILE A HA   1 
ATOM   7886  H  HB   . ILE A  1 549 ? 199.123 121.774 60.502  1.00 112.65 ? 741  ILE A HB   1 
ATOM   7887  H  HG12 . ILE A  1 549 ? 197.549 121.117 62.085  1.00 114.50 ? 741  ILE A HG12 1 
ATOM   7888  H  HG13 . ILE A  1 549 ? 197.451 122.685 61.864  1.00 114.50 ? 741  ILE A HG13 1 
ATOM   7889  H  HG21 . ILE A  1 549 ? 198.026 123.678 59.689  1.00 113.04 ? 741  ILE A HG21 1 
ATOM   7890  H  HG22 . ILE A  1 549 ? 198.511 122.761 58.486  1.00 113.04 ? 741  ILE A HG22 1 
ATOM   7891  H  HG23 . ILE A  1 549 ? 196.986 122.747 58.930  1.00 113.04 ? 741  ILE A HG23 1 
ATOM   7892  H  HD11 . ILE A  1 549 ? 195.325 121.771 62.014  1.00 112.27 ? 741  ILE A HD11 1 
ATOM   7893  H  HD12 . ILE A  1 549 ? 195.541 122.384 60.565  1.00 112.27 ? 741  ILE A HD12 1 
ATOM   7894  H  HD13 . ILE A  1 549 ? 195.639 120.814 60.786  1.00 112.27 ? 741  ILE A HD13 1 
ATOM   7895  N  N    . LYS A  1 550 ? 200.183 119.997 58.487  1.00 94.83  ? 742  LYS A N    1 
ATOM   7896  C  CA   . LYS A  1 550 ? 201.084 119.867 57.349  1.00 94.66  ? 742  LYS A CA   1 
ATOM   7897  C  C    . LYS A  1 550 ? 200.794 118.602 56.554  1.00 90.88  ? 742  LYS A C    1 
ATOM   7898  O  O    . LYS A  1 550 ? 200.976 118.584 55.332  1.00 91.33  ? 742  LYS A O    1 
ATOM   7899  C  CB   . LYS A  1 550 ? 202.534 119.874 57.831  1.00 98.26  ? 742  LYS A CB   1 
ATOM   7900  C  CG   . LYS A  1 550 ? 203.555 119.927 56.710  1.00 103.72 ? 742  LYS A CG   1 
ATOM   7901  C  CD   . LYS A  1 550 ? 204.964 120.146 57.242  1.00 107.74 ? 742  LYS A CD   1 
ATOM   7902  C  CE   . LYS A  1 550 ? 205.216 121.602 57.613  1.00 112.38 ? 742  LYS A CE   1 
ATOM   7903  N  NZ   . LYS A  1 550 ? 205.085 122.523 56.447  1.00 113.20 ? 742  LYS A NZ   1 
ATOM   7904  H  H    . LYS A  1 550 ? 200.564 119.932 59.256  1.00 113.55 ? 742  LYS A H    1 
ATOM   7905  H  HA   . LYS A  1 550 ? 200.960 120.627 56.759  1.00 113.34 ? 742  LYS A HA   1 
ATOM   7906  H  HB2  . LYS A  1 550 ? 202.673 120.651 58.394  1.00 117.66 ? 742  LYS A HB2  1 
ATOM   7907  H  HB3  . LYS A  1 550 ? 202.698 119.065 58.341  1.00 117.66 ? 742  LYS A HB3  1 
ATOM   7908  H  HG2  . LYS A  1 550 ? 203.541 119.088 56.224  1.00 124.22 ? 742  LYS A HG2  1 
ATOM   7909  H  HG3  . LYS A  1 550 ? 203.338 120.662 56.115  1.00 124.22 ? 742  LYS A HG3  1 
ATOM   7910  H  HD2  . LYS A  1 550 ? 205.092 119.605 58.036  1.00 129.05 ? 742  LYS A HD2  1 
ATOM   7911  H  HD3  . LYS A  1 550 ? 205.605 119.893 56.559  1.00 129.05 ? 742  LYS A HD3  1 
ATOM   7912  H  HE2  . LYS A  1 550 ? 204.570 121.874 58.284  1.00 134.61 ? 742  LYS A HE2  1 
ATOM   7913  H  HE3  . LYS A  1 550 ? 206.116 121.688 57.964  1.00 134.61 ? 742  LYS A HE3  1 
ATOM   7914  H  HZ1  . LYS A  1 550 ? 205.239 123.361 56.703  1.00 135.60 ? 742  LYS A HZ1  1 
ATOM   7915  H  HZ2  . LYS A  1 550 ? 205.674 122.301 55.817  1.00 135.60 ? 742  LYS A HZ2  1 
ATOM   7916  H  HZ3  . LYS A  1 550 ? 204.264 122.470 56.108  1.00 135.60 ? 742  LYS A HZ3  1 
ATOM   7917  N  N    . ALA A  1 551 ? 200.346 117.540 57.228  1.00 81.21  ? 743  ALA A N    1 
ATOM   7918  C  CA   . ALA A  1 551 ? 200.071 116.283 56.540  1.00 79.52  ? 743  ALA A CA   1 
ATOM   7919  C  C    . ALA A  1 551 ? 198.926 116.431 55.546  1.00 84.97  ? 743  ALA A C    1 
ATOM   7920  O  O    . ALA A  1 551 ? 198.955 115.837 54.461  1.00 87.33  ? 743  ALA A O    1 
ATOM   7921  C  CB   . ALA A  1 551 ? 199.752 115.193 57.561  1.00 75.46  ? 743  ALA A CB   1 
ATOM   7922  H  H    . ALA A  1 551 ? 200.195 117.523 58.074  1.00 97.20  ? 743  ALA A H    1 
ATOM   7923  H  HA   . ALA A  1 551 ? 200.862 116.012 56.048  1.00 95.18  ? 743  ALA A HA   1 
ATOM   7924  H  HB1  . ALA A  1 551 ? 199.572 114.364 57.092  1.00 90.30  ? 743  ALA A HB1  1 
ATOM   7925  H  HB2  . ALA A  1 551 ? 200.514 115.081 58.151  1.00 90.30  ? 743  ALA A HB2  1 
ATOM   7926  H  HB3  . ALA A  1 551 ? 198.973 115.460 58.074  1.00 90.30  ? 743  ALA A HB3  1 
ATOM   7927  N  N    . PHE A  1 552 ? 197.909 117.222 55.895  1.00 89.19  ? 744  PHE A N    1 
ATOM   7928  C  CA   . PHE A  1 552 ? 196.694 117.349 55.098  1.00 89.35  ? 744  PHE A CA   1 
ATOM   7929  C  C    . PHE A  1 552 ? 196.611 118.680 54.356  1.00 94.32  ? 744  PHE A C    1 
ATOM   7930  O  O    . PHE A  1 552 ? 195.533 119.050 53.880  1.00 92.59  ? 744  PHE A O    1 
ATOM   7931  C  CB   . PHE A  1 552 ? 195.463 117.192 55.992  1.00 83.60  ? 744  PHE A CB   1 
ATOM   7932  C  CG   . PHE A  1 552 ? 195.426 115.905 56.767  1.00 81.82  ? 744  PHE A CG   1 
ATOM   7933  C  CD1  . PHE A  1 552 ? 195.592 114.685 56.134  1.00 81.76  ? 744  PHE A CD1  1 
ATOM   7934  C  CD2  . PHE A  1 552 ? 195.211 115.918 58.136  1.00 82.21  ? 744  PHE A CD2  1 
ATOM   7935  C  CE1  . PHE A  1 552 ? 195.550 113.503 56.854  1.00 81.16  ? 744  PHE A CE1  1 
ATOM   7936  C  CE2  . PHE A  1 552 ? 195.168 114.742 58.859  1.00 81.91  ? 744  PHE A CE2  1 
ATOM   7937  C  CZ   . PHE A  1 552 ? 195.337 113.532 58.218  1.00 79.11  ? 744  PHE A CZ   1 
ATOM   7938  H  H    . PHE A  1 552 ? 197.904 117.706 56.606  1.00 106.78 ? 744  PHE A H    1 
ATOM   7939  H  HA   . PHE A  1 552 ? 196.676 116.639 54.438  1.00 106.98 ? 744  PHE A HA   1 
ATOM   7940  H  HB2  . PHE A  1 552 ? 195.446 117.922 56.630  1.00 100.07 ? 744  PHE A HB2  1 
ATOM   7941  H  HB3  . PHE A  1 552 ? 194.668 117.225 55.436  1.00 100.07 ? 744  PHE A HB3  1 
ATOM   7942  H  HD1  . PHE A  1 552 ? 195.735 114.660 55.215  1.00 97.87  ? 744  PHE A HD1  1 
ATOM   7943  H  HD2  . PHE A  1 552 ? 195.095 116.730 58.574  1.00 98.40  ? 744  PHE A HD2  1 
ATOM   7944  H  HE1  . PHE A  1 552 ? 195.665 112.689 56.418  1.00 97.14  ? 744  PHE A HE1  1 
ATOM   7945  H  HE2  . PHE A  1 552 ? 195.025 114.765 59.778  1.00 98.05  ? 744  PHE A HE2  1 
ATOM   7946  H  HZ   . PHE A  1 552 ? 195.310 112.739 58.703  1.00 94.68  ? 744  PHE A HZ   1 
ATOM   7947  N  N    . GLU A  1 553 ? 197.722 119.409 54.247  1.00 113.50 ? 745  GLU A N    1 
ATOM   7948  C  CA   . GLU A  1 553 ? 197.665 120.770 53.718  1.00 121.75 ? 745  GLU A CA   1 
ATOM   7949  C  C    . GLU A  1 553 ? 197.337 120.794 52.227  1.00 125.68 ? 745  GLU A C    1 
ATOM   7950  O  O    . GLU A  1 553 ? 196.482 121.572 51.787  1.00 125.53 ? 745  GLU A O    1 
ATOM   7951  C  CB   . GLU A  1 553 ? 198.983 121.491 53.996  1.00 127.55 ? 745  GLU A CB   1 
ATOM   7952  C  CG   . GLU A  1 553 ? 198.827 122.993 54.167  1.00 135.03 ? 745  GLU A CG   1 
ATOM   7953  C  CD   . GLU A  1 553 ? 200.091 123.663 54.667  1.00 139.43 ? 745  GLU A CD   1 
ATOM   7954  O  OE1  . GLU A  1 553 ? 201.138 122.984 54.738  1.00 139.24 ? 745  GLU A OE1  1 
ATOM   7955  O  OE2  . GLU A  1 553 ? 200.037 124.870 54.985  1.00 141.64 ? 745  GLU A OE2  1 
ATOM   7956  H  H    . GLU A  1 553 ? 198.510 119.143 54.468  1.00 135.95 ? 745  GLU A H    1 
ATOM   7957  H  HA   . GLU A  1 553 ? 196.962 121.253 54.181  1.00 145.85 ? 745  GLU A HA   1 
ATOM   7958  H  HB2  . GLU A  1 553 ? 199.368 121.137 54.813  1.00 152.81 ? 745  GLU A HB2  1 
ATOM   7959  H  HB3  . GLU A  1 553 ? 199.588 121.337 53.253  1.00 152.81 ? 745  GLU A HB3  1 
ATOM   7960  H  HG2  . GLU A  1 553 ? 198.597 123.386 53.310  1.00 161.79 ? 745  GLU A HG2  1 
ATOM   7961  H  HG3  . GLU A  1 553 ? 198.122 123.166 54.811  1.00 161.79 ? 745  GLU A HG3  1 
ATOM   7962  N  N    . ASP A  1 554 ? 198.007 119.963 51.430  1.00 140.80 ? 746  ASP A N    1 
ATOM   7963  C  CA   . ASP A  1 554 ? 197.844 120.010 49.974  1.00 147.12 ? 746  ASP A CA   1 
ATOM   7964  C  C    . ASP A  1 554 ? 196.663 119.185 49.486  1.00 142.68 ? 746  ASP A C    1 
ATOM   7965  O  O    . ASP A  1 554 ? 196.750 118.557 48.426  1.00 144.52 ? 746  ASP A O    1 
ATOM   7966  C  CB   . ASP A  1 554 ? 199.129 119.542 49.298  1.00 153.66 ? 746  ASP A CB   1 
ATOM   7967  C  CG   . ASP A  1 554 ? 199.537 118.143 49.724  1.00 157.14 ? 746  ASP A CG   1 
ATOM   7968  O  OD1  . ASP A  1 554 ? 198.690 117.420 50.292  1.00 155.73 ? 746  ASP A OD1  1 
ATOM   7969  O  OD2  . ASP A  1 554 ? 200.701 117.762 49.476  1.00 159.67 ? 746  ASP A OD2  1 
ATOM   7970  H  H    . ASP A  1 554 ? 198.560 119.365 51.704  1.00 168.71 ? 746  ASP A H    1 
ATOM   7971  H  HA   . ASP A  1 554 ? 197.689 120.930 49.709  1.00 176.29 ? 746  ASP A HA   1 
ATOM   7972  H  HB2  . ASP A  1 554 ? 198.997 119.537 48.337  1.00 184.15 ? 746  ASP A HB2  1 
ATOM   7973  H  HB3  . ASP A  1 554 ? 199.849 120.149 49.532  1.00 184.15 ? 746  ASP A HB3  1 
ATOM   7974  N  N    . LEU A  1 555 ? 195.544 119.177 50.203  1.00 125.52 ? 747  LEU A N    1 
ATOM   7975  C  CA   . LEU A  1 555 ? 194.401 118.360 49.806  1.00 120.98 ? 747  LEU A CA   1 
ATOM   7976  C  C    . LEU A  1 555 ? 193.145 119.204 49.612  1.00 122.59 ? 747  LEU A C    1 
ATOM   7977  O  O    . LEU A  1 555 ? 193.023 120.293 50.171  1.00 125.56 ? 747  LEU A O    1 
ATOM   7978  C  CB   . LEU A  1 555 ? 194.152 117.272 50.852  1.00 115.69 ? 747  LEU A CB   1 
ATOM   7979  C  CG   . LEU A  1 555 ? 195.372 116.410 51.206  1.00 111.02 ? 747  LEU A CG   1 
ATOM   7980  C  CD1  . LEU A  1 555 ? 194.988 115.337 52.210  1.00 107.06 ? 747  LEU A CD1  1 
ATOM   7981  C  CD2  . LEU A  1 555 ? 196.016 115.784 49.972  1.00 111.16 ? 747  LEU A CD2  1 
ATOM   7982  H  H    . LEU A  1 555 ? 195.421 119.634 50.921  1.00 150.38 ? 747  LEU A H    1 
ATOM   7983  H  HA   . LEU A  1 555 ? 194.603 117.925 48.963  1.00 144.93 ? 747  LEU A HA   1 
ATOM   7984  H  HB2  . LEU A  1 555 ? 193.848 117.695 51.670  1.00 138.58 ? 747  LEU A HB2  1 
ATOM   7985  H  HB3  . LEU A  1 555 ? 193.462 116.677 50.519  1.00 138.58 ? 747  LEU A HB3  1 
ATOM   7986  H  HG   . LEU A  1 555 ? 196.037 116.977 51.626  1.00 132.98 ? 747  LEU A HG   1 
ATOM   7987  H  HD11 . LEU A  1 555 ? 195.772 114.805 52.418  1.00 128.23 ? 747  LEU A HD11 1 
ATOM   7988  H  HD12 . LEU A  1 555 ? 194.653 115.763 53.014  1.00 128.23 ? 747  LEU A HD12 1 
ATOM   7989  H  HD13 . LEU A  1 555 ? 194.300 114.774 51.822  1.00 128.23 ? 747  LEU A HD13 1 
ATOM   7990  H  HD21 . LEU A  1 555 ? 196.778 115.252 50.250  1.00 133.15 ? 747  LEU A HD21 1 
ATOM   7991  H  HD22 . LEU A  1 555 ? 195.363 115.221 49.527  1.00 133.15 ? 747  LEU A HD22 1 
ATOM   7992  H  HD23 . LEU A  1 555 ? 196.306 116.491 49.375  1.00 133.15 ? 747  LEU A HD23 1 
ATOM   7993  N  N    . THR A  1 562 ? 194.323 110.873 41.325  1.00 156.04 ? 754  THR A N    1 
ATOM   7994  C  CA   . THR A  1 562 ? 193.216 111.627 40.748  1.00 158.95 ? 754  THR A CA   1 
ATOM   7995  C  C    . THR A  1 562 ? 192.364 110.734 39.852  1.00 159.67 ? 754  THR A C    1 
ATOM   7996  O  O    . THR A  1 562 ? 192.581 110.664 38.642  1.00 159.06 ? 754  THR A O    1 
ATOM   7997  C  CB   . THR A  1 562 ? 193.722 112.841 39.939  1.00 160.67 ? 754  THR A CB   1 
ATOM   7998  O  OG1  . THR A  1 562 ? 192.656 113.370 39.139  1.00 160.05 ? 754  THR A OG1  1 
ATOM   7999  C  CG2  . THR A  1 562 ? 194.899 112.456 39.041  1.00 160.22 ? 754  THR A CG2  1 
ATOM   8000  H  HA   . THR A  1 562 ? 192.652 111.958 41.465  1.00 190.49 ? 754  THR A HA   1 
ATOM   8001  H  HB   . THR A  1 562 ? 194.025 113.527 40.554  1.00 192.56 ? 754  THR A HB   1 
ATOM   8002  H  HG1  . THR A  1 562 ? 192.928 114.030 38.698  1.00 191.81 ? 754  THR A HG1  1 
ATOM   8003  H  HG21 . THR A  1 562 ? 195.202 113.231 38.542  1.00 192.01 ? 754  THR A HG21 1 
ATOM   8004  H  HG22 . THR A  1 562 ? 195.632 112.123 39.582  1.00 192.01 ? 754  THR A HG22 1 
ATOM   8005  H  HG23 . THR A  1 562 ? 194.628 111.765 38.417  1.00 192.01 ? 754  THR A HG23 1 
ATOM   8006  N  N    . ALA A  1 563 ? 191.404 110.040 40.468  1.00 154.47 ? 755  ALA A N    1 
ATOM   8007  C  CA   . ALA A  1 563 ? 190.499 109.122 39.779  1.00 154.82 ? 755  ALA A CA   1 
ATOM   8008  C  C    . ALA A  1 563 ? 191.192 107.810 39.424  1.00 154.62 ? 755  ALA A C    1 
ATOM   8009  O  O    . ALA A  1 563 ? 190.544 106.760 39.378  1.00 151.57 ? 755  ALA A O    1 
ATOM   8010  C  CB   . ALA A  1 563 ? 189.904 109.766 38.521  1.00 157.36 ? 755  ALA A CB   1 
ATOM   8011  H  H    . ALA A  1 563 ? 191.256 110.087 41.314  1.00 185.11 ? 755  ALA A H    1 
ATOM   8012  H  HA   . ALA A  1 563 ? 189.763 108.911 40.375  1.00 185.53 ? 755  ALA A HA   1 
ATOM   8013  H  HB1  . ALA A  1 563 ? 189.311 109.129 38.092  1.00 188.58 ? 755  ALA A HB1  1 
ATOM   8014  H  HB2  . ALA A  1 563 ? 189.410 110.560 38.776  1.00 188.58 ? 755  ALA A HB2  1 
ATOM   8015  H  HB3  . ALA A  1 563 ? 190.626 110.004 37.918  1.00 188.58 ? 755  ALA A HB3  1 
ATOM   8016  N  N    . THR A  1 564 ? 192.505 107.851 39.175  1.00 158.48 ? 756  THR A N    1 
ATOM   8017  C  CA   . THR A  1 564 ? 193.239 106.636 38.837  1.00 153.35 ? 756  THR A CA   1 
ATOM   8018  C  C    . THR A  1 564 ? 193.383 105.688 40.020  1.00 149.32 ? 756  THR A C    1 
ATOM   8019  O  O    . THR A  1 564 ? 193.708 104.512 39.814  1.00 149.29 ? 756  THR A O    1 
ATOM   8020  C  CB   . THR A  1 564 ? 194.625 106.987 38.297  1.00 150.11 ? 756  THR A CB   1 
ATOM   8021  O  OG1  . THR A  1 564 ? 195.310 107.828 39.235  1.00 149.10 ? 756  THR A OG1  1 
ATOM   8022  C  CG2  . THR A  1 564 ? 194.516 107.699 36.961  1.00 151.66 ? 756  THR A CG2  1 
ATOM   8023  H  H    . THR A  1 564 ? 192.986 108.564 39.195  1.00 189.92 ? 756  THR A H    1 
ATOM   8024  H  HA   . THR A  1 564 ? 192.759 106.166 38.137  1.00 183.77 ? 756  THR A HA   1 
ATOM   8025  H  HB   . THR A  1 564 ? 195.134 106.171 38.167  1.00 179.89 ? 756  THR A HB   1 
ATOM   8026  H  HG1  . THR A  1 564 ? 196.073 108.023 38.942  1.00 178.67 ? 756  THR A HG1  1 
ATOM   8027  H  HG21 . THR A  1 564 ? 195.401 107.916 36.628  1.00 181.75 ? 756  THR A HG21 1 
ATOM   8028  H  HG22 . THR A  1 564 ? 194.069 107.128 36.317  1.00 181.75 ? 756  THR A HG22 1 
ATOM   8029  H  HG23 . THR A  1 564 ? 194.007 108.518 37.062  1.00 181.75 ? 756  THR A HG23 1 
ATOM   8030  N  N    . GLY A  1 565 ? 193.165 106.159 41.249  1.00 134.56 ? 757  GLY A N    1 
ATOM   8031  C  CA   . GLY A  1 565 ? 193.238 105.317 42.423  1.00 130.72 ? 757  GLY A CA   1 
ATOM   8032  C  C    . GLY A  1 565 ? 194.361 105.636 43.381  1.00 129.26 ? 757  GLY A C    1 
ATOM   8033  O  O    . GLY A  1 565 ? 194.333 105.152 44.520  1.00 125.66 ? 757  GLY A O    1 
ATOM   8034  H  H    . GLY A  1 565 ? 192.971 106.979 41.423  1.00 161.23 ? 757  GLY A H    1 
ATOM   8035  H  HA2  . GLY A  1 565 ? 192.403 105.387 42.910  1.00 156.61 ? 757  GLY A HA2  1 
ATOM   8036  H  HA3  . GLY A  1 565 ? 193.342 104.395 42.140  1.00 156.61 ? 757  GLY A HA3  1 
ATOM   8037  N  N    . HIS A  1 566 ? 195.354 106.416 42.963  1.00 146.58 ? 758  HIS A N    1 
ATOM   8038  C  CA   . HIS A  1 566 ? 196.558 106.557 43.763  1.00 146.74 ? 758  HIS A CA   1 
ATOM   8039  C  C    . HIS A  1 566 ? 197.187 107.919 43.521  1.00 146.27 ? 758  HIS A C    1 
ATOM   8040  O  O    . HIS A  1 566 ? 196.955 108.566 42.496  1.00 148.32 ? 758  HIS A O    1 
ATOM   8041  C  CB   . HIS A  1 566 ? 197.555 105.446 43.426  1.00 149.30 ? 758  HIS A CB   1 
ATOM   8042  C  CG   . HIS A  1 566 ? 197.865 105.352 41.965  1.00 154.91 ? 758  HIS A CG   1 
ATOM   8043  N  ND1  . HIS A  1 566 ? 198.758 106.193 41.336  1.00 157.12 ? 758  HIS A ND1  1 
ATOM   8044  C  CD2  . HIS A  1 566 ? 197.377 104.534 41.003  1.00 155.08 ? 758  HIS A CD2  1 
ATOM   8045  C  CE1  . HIS A  1 566 ? 198.821 105.884 40.053  1.00 158.92 ? 758  HIS A CE1  1 
ATOM   8046  N  NE2  . HIS A  1 566 ? 197.992 104.882 39.825  1.00 157.97 ? 758  HIS A NE2  1 
ATOM   8047  H  H    . HIS A  1 566 ? 195.353 106.866 42.231  1.00 175.65 ? 758  HIS A H    1 
ATOM   8048  H  HA   . HIS A  1 566 ? 196.330 106.488 44.703  1.00 175.84 ? 758  HIS A HA   1 
ATOM   8049  H  HB2  . HIS A  1 566 ? 198.385 105.616 43.897  1.00 178.91 ? 758  HIS A HB2  1 
ATOM   8050  H  HB3  . HIS A  1 566 ? 197.184 104.595 43.707  1.00 178.91 ? 758  HIS A HB3  1 
ATOM   8051  H  HD2  . HIS A  1 566 ? 196.751 103.857 41.120  1.00 185.84 ? 758  HIS A HD2  1 
ATOM   8052  H  HE1  . HIS A  1 566 ? 199.355 106.304 39.417  1.00 190.46 ? 758  HIS A HE1  1 
ATOM   8053  H  HE2  . HIS A  1 566 ? 197.858 104.508 39.062  1.00 189.31 ? 758  HIS A HE2  1 
ATOM   8054  N  N    . ILE A  1 567 ? 197.974 108.352 44.504  1.00 131.27 ? 759  ILE A N    1 
ATOM   8055  C  CA   . ILE A  1 567 ? 198.754 109.578 44.427  1.00 130.85 ? 759  ILE A CA   1 
ATOM   8056  C  C    . ILE A  1 567 ? 200.184 109.289 44.864  1.00 128.94 ? 759  ILE A C    1 
ATOM   8057  O  O    . ILE A  1 567 ? 200.458 108.313 45.568  1.00 127.55 ? 759  ILE A O    1 
ATOM   8058  C  CB   . ILE A  1 567 ? 198.144 110.714 45.291  1.00 129.25 ? 759  ILE A CB   1 
ATOM   8059  C  CG1  . ILE A  1 567 ? 198.030 110.281 46.758  1.00 126.15 ? 759  ILE A CG1  1 
ATOM   8060  C  CG2  . ILE A  1 567 ? 196.771 111.120 44.751  1.00 126.33 ? 759  ILE A CG2  1 
ATOM   8061  C  CD1  . ILE A  1 567 ? 197.746 111.425 47.714  1.00 124.88 ? 759  ILE A CD1  1 
ATOM   8062  H  H    . ILE A  1 567 ? 198.073 107.934 45.249  1.00 157.28 ? 759  ILE A H    1 
ATOM   8063  H  HA   . ILE A  1 567 ? 198.777 109.881 43.506  1.00 156.77 ? 759  ILE A HA   1 
ATOM   8064  H  HB   . ILE A  1 567 ? 198.731 111.484 45.243  1.00 154.86 ? 759  ILE A HB   1 
ATOM   8065  H  HG12 . ILE A  1 567 ? 197.308 109.640 46.840  1.00 151.13 ? 759  ILE A HG12 1 
ATOM   8066  H  HG13 . ILE A  1 567 ? 198.867 109.870 47.028  1.00 151.13 ? 759  ILE A HG13 1 
ATOM   8067  H  HG21 . ILE A  1 567 ? 196.411 111.829 45.306  1.00 151.34 ? 759  ILE A HG21 1 
ATOM   8068  H  HG22 . ILE A  1 567 ? 196.871 111.432 43.838  1.00 151.34 ? 759  ILE A HG22 1 
ATOM   8069  H  HG23 . ILE A  1 567 ? 196.182 110.349 44.775  1.00 151.34 ? 759  ILE A HG23 1 
ATOM   8070  H  HD11 . ILE A  1 567 ? 197.688 111.074 48.617  1.00 149.61 ? 759  ILE A HD11 1 
ATOM   8071  H  HD12 . ILE A  1 567 ? 198.466 112.072 47.655  1.00 149.61 ? 759  ILE A HD12 1 
ATOM   8072  H  HD13 . ILE A  1 567 ? 196.905 111.841 47.467  1.00 149.61 ? 759  ILE A HD13 1 
ATOM   8073  N  N    . ASN A  1 568 ? 201.100 110.149 44.428  1.00 130.54 ? 760  ASN A N    1 
ATOM   8074  C  CA   . ASN A  1 568 ? 202.494 110.050 44.850  1.00 133.02 ? 760  ASN A CA   1 
ATOM   8075  C  C    . ASN A  1 568 ? 202.622 110.469 46.303  1.00 131.50 ? 760  ASN A C    1 
ATOM   8076  O  O    . ASN A  1 568 ? 202.494 111.651 46.636  1.00 130.96 ? 760  ASN A O    1 
ATOM   8077  C  CB   . ASN A  1 568 ? 203.383 110.905 43.955  1.00 135.98 ? 760  ASN A CB   1 
ATOM   8078  C  CG   . ASN A  1 568 ? 203.636 110.265 42.606  1.00 138.42 ? 760  ASN A CG   1 
ATOM   8079  O  OD1  . ASN A  1 568 ? 203.925 109.066 42.519  1.00 137.33 ? 760  ASN A OD1  1 
ATOM   8080  N  ND2  . ASN A  1 568 ? 203.450 111.032 41.546  1.00 141.19 ? 760  ASN A ND2  1 
ATOM   8081  H  H    . ASN A  1 568 ? 200.940 110.799 43.888  1.00 156.40 ? 760  ASN A H    1 
ATOM   8082  H  HA   . ASN A  1 568 ? 202.785 109.128 44.774  1.00 159.38 ? 760  ASN A HA   1 
ATOM   8083  H  HB2  . ASN A  1 568 ? 202.952 111.761 43.805  1.00 162.92 ? 760  ASN A HB2  1 
ATOM   8084  H  HB3  . ASN A  1 568 ? 204.239 111.035 44.391  1.00 162.92 ? 760  ASN A HB3  1 
ATOM   8085  H  HD21 . ASN A  1 568 ? 203.574 110.712 40.757  1.00 169.18 ? 760  ASN A HD21 1 
ATOM   8086  H  HD22 . ASN A  1 568 ? 203.235 111.858 41.646  1.00 169.18 ? 760  ASN A HD22 1 
ATOM   8087  N  N    . LEU A  1 569 ? 202.873 109.494 47.161  1.00 133.09 ? 761  LEU A N    1 
ATOM   8088  C  CA   . LEU A  1 569 ? 203.041 109.747 48.585  1.00 132.34 ? 761  LEU A CA   1 
ATOM   8089  C  C    . LEU A  1 569 ? 204.425 110.349 48.826  1.00 138.52 ? 761  LEU A C    1 
ATOM   8090  O  O    . LEU A  1 569 ? 205.421 109.828 48.312  1.00 139.71 ? 761  LEU A O    1 
ATOM   8091  C  CB   . LEU A  1 569 ? 202.881 108.467 49.389  1.00 129.59 ? 761  LEU A CB   1 
ATOM   8092  C  CG   . LEU A  1 569 ? 201.871 108.508 50.536  1.00 128.23 ? 761  LEU A CG   1 
ATOM   8093  C  CD1  . LEU A  1 569 ? 200.461 108.721 49.999  1.00 127.31 ? 761  LEU A CD1  1 
ATOM   8094  C  CD2  . LEU A  1 569 ? 201.959 107.226 51.340  1.00 126.55 ? 761  LEU A CD2  1 
ATOM   8095  H  H    . LEU A  1 569 ? 202.951 108.666 46.942  1.00 159.46 ? 761  LEU A H    1 
ATOM   8096  H  HA   . LEU A  1 569 ? 202.372 110.383 48.883  1.00 158.57 ? 761  LEU A HA   1 
ATOM   8097  H  HB2  . LEU A  1 569 ? 202.601 107.762 48.784  1.00 155.26 ? 761  LEU A HB2  1 
ATOM   8098  H  HB3  . LEU A  1 569 ? 203.743 108.239 49.771  1.00 155.26 ? 761  LEU A HB3  1 
ATOM   8099  H  HG   . LEU A  1 569 ? 202.087 109.249 51.124  1.00 153.63 ? 761  LEU A HG   1 
ATOM   8100  H  HD11 . LEU A  1 569 ? 199.840 108.743 50.744  1.00 152.52 ? 761  LEU A HD11 1 
ATOM   8101  H  HD12 . LEU A  1 569 ? 200.430 109.562 49.517  1.00 152.52 ? 761  LEU A HD12 1 
ATOM   8102  H  HD13 . LEU A  1 569 ? 200.237 107.989 49.403  1.00 152.52 ? 761  LEU A HD13 1 
ATOM   8103  H  HD21 . LEU A  1 569 ? 201.315 107.263 52.064  1.00 151.61 ? 761  LEU A HD21 1 
ATOM   8104  H  HD22 . LEU A  1 569 ? 201.761 106.475 50.759  1.00 151.61 ? 761  LEU A HD22 1 
ATOM   8105  H  HD23 . LEU A  1 569 ? 202.856 107.139 51.699  1.00 151.61 ? 761  LEU A HD23 1 
ATOM   8106  N  N    . PRO A  1 570 ? 204.539 111.420 49.608  1.00 143.49 ? 762  PRO A N    1 
ATOM   8107  C  CA   . PRO A  1 570 ? 205.859 112.005 49.859  1.00 144.14 ? 762  PRO A CA   1 
ATOM   8108  C  C    . PRO A  1 570 ? 206.602 111.265 50.959  1.00 140.20 ? 762  PRO A C    1 
ATOM   8109  O  O    . PRO A  1 570 ? 206.003 110.634 51.834  1.00 139.09 ? 762  PRO A O    1 
ATOM   8110  C  CB   . PRO A  1 570 ? 205.524 113.436 50.291  1.00 145.68 ? 762  PRO A CB   1 
ATOM   8111  C  CG   . PRO A  1 570 ? 204.209 113.306 50.976  1.00 144.06 ? 762  PRO A CG   1 
ATOM   8112  C  CD   . PRO A  1 570 ? 203.470 112.175 50.293  1.00 142.03 ? 762  PRO A CD   1 
ATOM   8113  H  HA   . PRO A  1 570 ? 206.392 112.019 49.049  1.00 172.72 ? 762  PRO A HA   1 
ATOM   8114  H  HB2  . PRO A  1 570 ? 206.202 113.764 50.902  1.00 174.57 ? 762  PRO A HB2  1 
ATOM   8115  H  HB3  . PRO A  1 570 ? 205.453 114.008 49.511  1.00 174.57 ? 762  PRO A HB3  1 
ATOM   8116  H  HG2  . PRO A  1 570 ? 204.353 113.099 51.912  1.00 172.62 ? 762  PRO A HG2  1 
ATOM   8117  H  HG3  . PRO A  1 570 ? 203.715 114.136 50.885  1.00 172.62 ? 762  PRO A HG3  1 
ATOM   8118  H  HD2  . PRO A  1 570 ? 203.029 111.615 50.951  1.00 170.18 ? 762  PRO A HD2  1 
ATOM   8119  H  HD3  . PRO A  1 570 ? 202.838 112.527 49.647  1.00 170.18 ? 762  PRO A HD3  1 
ATOM   8120  N  N    . GLU A  1 571 ? 207.929 111.349 50.905  1.00 130.51 ? 763  GLU A N    1 
ATOM   8121  C  CA   . GLU A  1 571 ? 208.766 110.812 51.979  1.00 128.96 ? 763  GLU A CA   1 
ATOM   8122  C  C    . GLU A  1 571 ? 209.014 111.913 53.011  1.00 128.01 ? 763  GLU A C    1 
ATOM   8123  O  O    . GLU A  1 571 ? 210.114 112.447 53.172  1.00 128.08 ? 763  GLU A O    1 
ATOM   8124  C  CB   . GLU A  1 571 ? 210.057 110.225 51.427  1.00 131.72 ? 763  GLU A CB   1 
ATOM   8125  C  CG   . GLU A  1 571 ? 209.794 108.978 50.605  1.00 131.97 ? 763  GLU A CG   1 
ATOM   8126  C  CD   . GLU A  1 571 ? 209.714 107.726 51.459  1.00 133.37 ? 763  GLU A CD   1 
ATOM   8127  O  OE1  . GLU A  1 571 ? 210.242 107.734 52.591  1.00 133.96 ? 763  GLU A OE1  1 
ATOM   8128  O  OE2  . GLU A  1 571 ? 209.099 106.738 51.004  1.00 133.00 ? 763  GLU A OE2  1 
ATOM   8129  H  H    . GLU A  1 571 ? 208.369 111.710 50.261  1.00 156.36 ? 763  GLU A H    1 
ATOM   8130  H  HA   . GLU A  1 571 ? 208.283 110.097 52.422  1.00 154.50 ? 763  GLU A HA   1 
ATOM   8131  H  HB2  . GLU A  1 571 ? 210.488 110.880 50.855  1.00 157.82 ? 763  GLU A HB2  1 
ATOM   8132  H  HB3  . GLU A  1 571 ? 210.641 109.986 52.163  1.00 157.82 ? 763  GLU A HB3  1 
ATOM   8133  H  HG2  . GLU A  1 571 ? 208.949 109.078 50.139  1.00 158.12 ? 763  GLU A HG2  1 
ATOM   8134  H  HG3  . GLU A  1 571 ? 210.515 108.861 49.967  1.00 158.12 ? 763  GLU A HG3  1 
ATOM   8135  N  N    . ASN A  1 572 ? 207.936 112.243 53.720  1.00 140.64 ? 764  ASN A N    1 
ATOM   8136  C  CA   . ASN A  1 572 ? 207.856 113.441 54.538  1.00 143.54 ? 764  ASN A CA   1 
ATOM   8137  C  C    . ASN A  1 572 ? 207.940 113.162 56.032  1.00 138.92 ? 764  ASN A C    1 
ATOM   8138  O  O    . ASN A  1 572 ? 207.978 114.116 56.817  1.00 142.44 ? 764  ASN A O    1 
ATOM   8139  C  CB   . ASN A  1 572 ? 206.537 114.173 54.240  1.00 146.92 ? 764  ASN A CB   1 
ATOM   8140  C  CG   . ASN A  1 572 ? 206.679 115.681 54.272  1.00 153.02 ? 764  ASN A CG   1 
ATOM   8141  O  OD1  . ASN A  1 572 ? 207.786 116.219 54.220  1.00 153.92 ? 764  ASN A OD1  1 
ATOM   8142  N  ND2  . ASN A  1 572 ? 205.548 116.373 54.347  1.00 153.94 ? 764  ASN A ND2  1 
ATOM   8143  H  H    . ASN A  1 572 ? 207.218 111.770 53.740  1.00 168.52 ? 764  ASN A H    1 
ATOM   8144  H  HA   . ASN A  1 572 ? 208.587 114.033 54.303  1.00 172.00 ? 764  ASN A HA   1 
ATOM   8145  H  HB2  . ASN A  1 572 ? 206.229 113.920 53.356  1.00 176.06 ? 764  ASN A HB2  1 
ATOM   8146  H  HB3  . ASN A  1 572 ? 205.879 113.920 54.906  1.00 176.06 ? 764  ASN A HB3  1 
ATOM   8147  H  HD21 . ASN A  1 572 ? 205.571 117.232 54.367  1.00 184.49 ? 764  ASN A HD21 1 
ATOM   8148  H  HD22 . ASN A  1 572 ? 204.794 115.961 54.380  1.00 184.49 ? 764  ASN A HD22 1 
ATOM   8149  N  N    . SER A  1 573 ? 207.964 111.890 56.440  1.00 118.77 ? 765  SER A N    1 
ATOM   8150  C  CA   . SER A  1 573 ? 207.810 111.522 57.845  1.00 111.14 ? 765  SER A CA   1 
ATOM   8151  C  C    . SER A  1 573 ? 208.614 112.414 58.784  1.00 110.76 ? 765  SER A C    1 
ATOM   8152  O  O    . SER A  1 573 ? 208.088 112.908 59.788  1.00 111.48 ? 765  SER A O    1 
ATOM   8153  C  CB   . SER A  1 573 ? 208.217 110.059 58.036  1.00 106.97 ? 765  SER A CB   1 
ATOM   8154  O  OG   . SER A  1 573 ? 207.314 109.192 57.377  1.00 105.16 ? 765  SER A OG   1 
ATOM   8155  H  H    . SER A  1 573 ? 208.069 111.217 55.914  1.00 142.28 ? 765  SER A H    1 
ATOM   8156  H  HA   . SER A  1 573 ? 206.875 111.604 58.088  1.00 133.12 ? 765  SER A HA   1 
ATOM   8157  H  HB2  . SER A  1 573 ? 209.105 109.928 57.669  1.00 128.12 ? 765  SER A HB2  1 
ATOM   8158  H  HB3  . SER A  1 573 ? 208.217 109.853 58.984  1.00 128.12 ? 765  SER A HB3  1 
ATOM   8159  H  HG   . SER A  1 573 ? 207.548 108.393 57.490  1.00 125.95 ? 765  SER A HG   1 
ATOM   8160  N  N    . GLN A  1 574 ? 209.894 112.636 58.480  1.00 105.71 ? 766  GLN A N    1 
ATOM   8161  C  CA   . GLN A  1 574 ? 210.730 113.382 59.413  1.00 109.52 ? 766  GLN A CA   1 
ATOM   8162  C  C    . GLN A  1 574 ? 210.334 114.851 59.470  1.00 110.16 ? 766  GLN A C    1 
ATOM   8163  O  O    . GLN A  1 574 ? 210.532 115.503 60.503  1.00 110.89 ? 766  GLN A O    1 
ATOM   8164  C  CB   . GLN A  1 574 ? 212.208 113.232 59.047  1.00 115.88 ? 766  GLN A CB   1 
ATOM   8165  C  CG   . GLN A  1 574 ? 212.935 112.203 59.906  1.00 120.48 ? 766  GLN A CG   1 
ATOM   8166  C  CD   . GLN A  1 574 ? 212.852 112.523 61.389  1.00 123.96 ? 766  GLN A CD   1 
ATOM   8167  O  OE1  . GLN A  1 574 ? 212.697 113.681 61.777  1.00 125.31 ? 766  GLN A OE1  1 
ATOM   8168  N  NE2  . GLN A  1 574 ? 212.925 111.492 62.224  1.00 123.48 ? 766  GLN A NE2  1 
ATOM   8169  H  H    . GLN A  1 574 ? 210.290 112.374 57.763  1.00 126.60 ? 766  GLN A H    1 
ATOM   8170  H  HA   . GLN A  1 574 ? 210.608 113.012 60.301  1.00 131.17 ? 766  GLN A HA   1 
ATOM   8171  H  HB2  . GLN A  1 574 ? 212.276 112.950 58.121  1.00 138.81 ? 766  GLN A HB2  1 
ATOM   8172  H  HB3  . GLN A  1 574 ? 212.651 114.087 59.166  1.00 138.81 ? 766  GLN A HB3  1 
ATOM   8173  H  HG2  . GLN A  1 574 ? 212.535 111.331 59.763  1.00 144.33 ? 766  GLN A HG2  1 
ATOM   8174  H  HG3  . GLN A  1 574 ? 213.871 112.185 59.654  1.00 144.33 ? 766  GLN A HG3  1 
ATOM   8175  H  HE21 . GLN A  1 574 ? 213.028 110.695 61.916  1.00 147.92 ? 766  GLN A HE21 1 
ATOM   8176  H  HE22 . GLN A  1 574 ? 212.880 111.622 63.073  1.00 147.92 ? 766  GLN A HE22 1 
ATOM   8177  N  N    . GLU A  1 575 ? 209.790 115.396 58.381  1.00 112.39 ? 767  GLU A N    1 
ATOM   8178  C  CA   . GLU A  1 575 ? 209.247 116.749 58.440  1.00 111.53 ? 767  GLU A CA   1 
ATOM   8179  C  C    . GLU A  1 575 ? 207.967 116.794 59.264  1.00 104.18 ? 767  GLU A C    1 
ATOM   8180  O  O    . GLU A  1 575 ? 207.708 117.785 59.956  1.00 104.23 ? 767  GLU A O    1 
ATOM   8181  C  CB   . GLU A  1 575 ? 208.978 117.276 57.031  1.00 116.72 ? 767  GLU A CB   1 
ATOM   8182  C  CG   . GLU A  1 575 ? 208.635 118.760 56.988  1.00 124.73 ? 767  GLU A CG   1 
ATOM   8183  C  CD   . GLU A  1 575 ? 208.479 119.283 55.574  1.00 131.41 ? 767  GLU A CD   1 
ATOM   8184  O  OE1  . GLU A  1 575 ? 209.193 118.791 54.675  1.00 135.06 ? 767  GLU A OE1  1 
ATOM   8185  O  OE2  . GLU A  1 575 ? 207.650 120.192 55.361  1.00 133.30 ? 767  GLU A OE2  1 
ATOM   8186  H  H    . GLU A  1 575 ? 209.724 115.012 57.614  1.00 134.62 ? 767  GLU A H    1 
ATOM   8187  H  HA   . GLU A  1 575 ? 209.897 117.333 58.861  1.00 133.59 ? 767  GLU A HA   1 
ATOM   8188  H  HB2  . GLU A  1 575 ? 209.771 117.139 56.489  1.00 139.81 ? 767  GLU A HB2  1 
ATOM   8189  H  HB3  . GLU A  1 575 ? 208.231 116.788 56.652  1.00 139.81 ? 767  GLU A HB3  1 
ATOM   8190  H  HG2  . GLU A  1 575 ? 207.798 118.905 57.456  1.00 149.43 ? 767  GLU A HG2  1 
ATOM   8191  H  HG3  . GLU A  1 575 ? 209.346 119.262 57.417  1.00 149.43 ? 767  GLU A HG3  1 
ATOM   8192  N  N    . LEU A  1 576 ? 207.161 115.733 59.205  1.00 93.20  ? 768  LEU A N    1 
ATOM   8193  C  CA   . LEU A  1 576 ? 205.916 115.676 59.958  1.00 93.65  ? 768  LEU A CA   1 
ATOM   8194  C  C    . LEU A  1 576 ? 206.129 115.287 61.413  1.00 93.83  ? 768  LEU A C    1 
ATOM   8195  O  O    . LEU A  1 576 ? 205.270 115.586 62.250  1.00 95.79  ? 768  LEU A O    1 
ATOM   8196  C  CB   . LEU A  1 576 ? 204.956 114.679 59.300  1.00 90.30  ? 768  LEU A CB   1 
ATOM   8197  C  CG   . LEU A  1 576 ? 204.569 114.986 57.851  1.00 92.75  ? 768  LEU A CG   1 
ATOM   8198  C  CD1  . LEU A  1 576 ? 203.669 113.898 57.292  1.00 87.46  ? 768  LEU A CD1  1 
ATOM   8199  C  CD2  . LEU A  1 576 ? 203.891 116.345 57.739  1.00 94.32  ? 768  LEU A CD2  1 
ATOM   8200  H  H    . LEU A  1 576 ? 207.316 115.032 58.732  1.00 111.60 ? 768  LEU A H    1 
ATOM   8201  H  HA   . LEU A  1 576 ? 205.497 116.550 59.941  1.00 112.13 ? 768  LEU A HA   1 
ATOM   8202  H  HB2  . LEU A  1 576 ? 205.371 113.802 59.310  1.00 108.11 ? 768  LEU A HB2  1 
ATOM   8203  H  HB3  . LEU A  1 576 ? 204.137 114.655 59.820  1.00 108.11 ? 768  LEU A HB3  1 
ATOM   8204  H  HG   . LEU A  1 576 ? 205.375 115.011 57.311  1.00 111.05 ? 768  LEU A HG   1 
ATOM   8205  H  HD11 . LEU A  1 576 ? 203.440 114.117 56.376  1.00 104.70 ? 768  LEU A HD11 1 
ATOM   8206  H  HD12 . LEU A  1 576 ? 204.142 113.051 57.322  1.00 104.70 ? 768  LEU A HD12 1 
ATOM   8207  H  HD13 . LEU A  1 576 ? 202.864 113.847 57.831  1.00 104.70 ? 768  LEU A HD13 1 
ATOM   8208  H  HD21 . LEU A  1 576 ? 203.660 116.507 56.811  1.00 112.93 ? 768  LEU A HD21 1 
ATOM   8209  H  HD22 . LEU A  1 576 ? 203.089 116.343 58.284  1.00 112.93 ? 768  LEU A HD22 1 
ATOM   8210  H  HD23 . LEU A  1 576 ? 204.502 117.030 58.053  1.00 112.93 ? 768  LEU A HD23 1 
ATOM   8211  N  N    . LEU A  1 577 ? 207.239 114.629 61.732  1.00 91.78  ? 769  LEU A N    1 
ATOM   8212  C  CA   . LEU A  1 577 ? 207.502 114.232 63.108  1.00 86.91  ? 769  LEU A CA   1 
ATOM   8213  C  C    . LEU A  1 577 ? 207.899 115.452 63.929  1.00 85.90  ? 769  LEU A C    1 
ATOM   8214  O  O    . LEU A  1 577 ? 208.927 116.082 63.658  1.00 88.27  ? 769  LEU A O    1 
ATOM   8215  C  CB   . LEU A  1 577 ? 208.598 113.172 63.158  1.00 87.00  ? 769  LEU A CB   1 
ATOM   8216  C  CG   . LEU A  1 577 ? 208.883 112.590 64.545  1.00 88.44  ? 769  LEU A CG   1 
ATOM   8217  C  CD1  . LEU A  1 577 ? 207.616 112.003 65.163  1.00 85.38  ? 769  LEU A CD1  1 
ATOM   8218  C  CD2  . LEU A  1 577 ? 209.977 111.537 64.473  1.00 89.67  ? 769  LEU A CD2  1 
ATOM   8219  H  H    . LEU A  1 577 ? 207.852 114.403 61.174  1.00 109.88 ? 769  LEU A H    1 
ATOM   8220  H  HA   . LEU A  1 577 ? 206.695 113.855 63.493  1.00 104.04 ? 769  LEU A HA   1 
ATOM   8221  H  HB2  . LEU A  1 577 ? 208.342 112.436 62.580  1.00 104.15 ? 769  LEU A HB2  1 
ATOM   8222  H  HB3  . LEU A  1 577 ? 209.423 113.567 62.833  1.00 104.15 ? 769  LEU A HB3  1 
ATOM   8223  H  HG   . LEU A  1 577 ? 209.194 113.302 65.125  1.00 105.89 ? 769  LEU A HG   1 
ATOM   8224  H  HD11 . LEU A  1 577 ? 207.830 111.644 66.039  1.00 102.20 ? 769  LEU A HD11 1 
ATOM   8225  H  HD12 . LEU A  1 577 ? 206.951 112.704 65.246  1.00 102.20 ? 769  LEU A HD12 1 
ATOM   8226  H  HD13 . LEU A  1 577 ? 207.283 111.296 64.588  1.00 102.20 ? 769  LEU A HD13 1 
ATOM   8227  H  HD21 . LEU A  1 577 ? 210.137 111.186 65.363  1.00 107.35 ? 769  LEU A HD21 1 
ATOM   8228  H  HD22 . LEU A  1 577 ? 209.690 110.823 63.882  1.00 107.35 ? 769  LEU A HD22 1 
ATOM   8229  H  HD23 . LEU A  1 577 ? 210.786 111.946 64.128  1.00 107.35 ? 769  LEU A HD23 1 
ATOM   8230  N  N    . LEU A  1 578 ? 207.086 115.785 64.929  1.00 86.17  ? 770  LEU A N    1 
ATOM   8231  C  CA   . LEU A  1 578 ? 207.354 116.941 65.775  1.00 89.10  ? 770  LEU A CA   1 
ATOM   8232  C  C    . LEU A  1 578 ? 208.136 116.586 67.030  1.00 85.01  ? 770  LEU A C    1 
ATOM   8233  O  O    . LEU A  1 578 ? 208.930 117.406 67.505  1.00 89.67  ? 770  LEU A O    1 
ATOM   8234  C  CB   . LEU A  1 578 ? 206.037 117.615 66.173  1.00 92.21  ? 770  LEU A CB   1 
ATOM   8235  C  CG   . LEU A  1 578 ? 205.172 118.138 65.025  1.00 96.02  ? 770  LEU A CG   1 
ATOM   8236  C  CD1  . LEU A  1 578 ? 203.886 118.740 65.564  1.00 96.98  ? 770  LEU A CD1  1 
ATOM   8237  C  CD2  . LEU A  1 578 ? 205.936 119.167 64.200  1.00 96.66  ? 770  LEU A CD2  1 
ATOM   8238  H  H    . LEU A  1 578 ? 206.371 115.356 65.137  1.00 103.15 ? 770  LEU A H    1 
ATOM   8239  H  HA   . LEU A  1 578 ? 207.876 117.584 65.270  1.00 106.67 ? 770  LEU A HA   1 
ATOM   8240  H  HB2  . LEU A  1 578 ? 205.504 116.972 66.667  1.00 110.41 ? 770  LEU A HB2  1 
ATOM   8241  H  HB3  . LEU A  1 578 ? 206.243 118.370 66.747  1.00 110.41 ? 770  LEU A HB3  1 
ATOM   8242  H  HG   . LEU A  1 578 ? 204.937 117.399 64.443  1.00 114.98 ? 770  LEU A HG   1 
ATOM   8243  H  HD11 . LEU A  1 578 ? 203.355 119.065 64.821  1.00 116.13 ? 770  LEU A HD11 1 
ATOM   8244  H  HD12 . LEU A  1 578 ? 203.397 118.056 66.048  1.00 116.13 ? 770  LEU A HD12 1 
ATOM   8245  H  HD13 . LEU A  1 578 ? 204.107 119.474 66.159  1.00 116.13 ? 770  LEU A HD13 1 
ATOM   8246  H  HD21 . LEU A  1 578 ? 205.365 119.481 63.481  1.00 115.74 ? 770  LEU A HD21 1 
ATOM   8247  H  HD22 . LEU A  1 578 ? 206.185 119.909 64.773  1.00 115.74 ? 770  LEU A HD22 1 
ATOM   8248  H  HD23 . LEU A  1 578 ? 206.731 118.750 63.833  1.00 115.74 ? 770  LEU A HD23 1 
ATOM   8249  N  N    . GLY A  1 579 ? 207.929 115.397 67.582  1.00 76.40  ? 771  GLY A N    1 
ATOM   8250  C  CA   . GLY A  1 579 ? 208.631 115.007 68.788  1.00 79.06  ? 771  GLY A CA   1 
ATOM   8251  C  C    . GLY A  1 579 ? 208.420 113.544 69.099  1.00 79.71  ? 771  GLY A C    1 
ATOM   8252  O  O    . GLY A  1 579 ? 207.418 112.940 68.699  1.00 76.14  ? 771  GLY A O    1 
ATOM   8253  H  H    . GLY A  1 579 ? 207.388 114.802 67.277  1.00 91.43  ? 771  GLY A H    1 
ATOM   8254  H  HA2  . GLY A  1 579 ? 209.581 115.168 68.679  1.00 94.62  ? 771  GLY A HA2  1 
ATOM   8255  H  HA3  . GLY A  1 579 ? 208.311 115.533 69.537  1.00 94.62  ? 771  GLY A HA3  1 
ATOM   8256  N  N    . THR A  1 580 ? 209.386 112.983 69.825  1.00 85.48  ? 772  THR A N    1 
ATOM   8257  C  CA   . THR A  1 580 ? 209.334 111.600 70.277  1.00 88.14  ? 772  THR A CA   1 
ATOM   8258  C  C    . THR A  1 580 ? 209.537 111.583 71.784  1.00 88.88  ? 772  THR A C    1 
ATOM   8259  O  O    . THR A  1 580 ? 210.493 112.178 72.291  1.00 92.97  ? 772  THR A O    1 
ATOM   8260  C  CB   . THR A  1 580 ? 210.401 110.736 69.592  1.00 86.90  ? 772  THR A CB   1 
ATOM   8261  O  OG1  . THR A  1 580 ? 210.177 110.724 68.177  1.00 85.38  ? 772  THR A OG1  1 
ATOM   8262  C  CG2  . THR A  1 580 ? 210.361 109.303 70.123  1.00 83.45  ? 772  THR A CG2  1 
ATOM   8263  H  H    . THR A  1 580 ? 210.097 113.397 70.073  1.00 102.33 ? 772  THR A H    1 
ATOM   8264  H  HA   . THR A  1 580 ? 208.462 111.226 70.079  1.00 105.52 ? 772  THR A HA   1 
ATOM   8265  H  HB   . THR A  1 580 ? 211.280 111.106 69.774  1.00 104.04 ? 772  THR A HB   1 
ATOM   8266  H  HG1  . THR A  1 580 ? 210.759 110.253 67.797  1.00 102.21 ? 772  THR A HG1  1 
ATOM   8267  H  HG21 . THR A  1 580 ? 211.039 108.768 69.683  1.00 99.90  ? 772  THR A HG21 1 
ATOM   8268  H  HG22 . THR A  1 580 ? 210.528 109.300 71.079  1.00 99.90  ? 772  THR A HG22 1 
ATOM   8269  H  HG23 . THR A  1 580 ? 209.490 108.911 69.953  1.00 99.90  ? 772  THR A HG23 1 
ATOM   8270  N  N    . TYR A  1 581 ? 208.637 110.909 72.492  1.00 87.52  ? 773  TYR A N    1 
ATOM   8271  C  CA   . TYR A  1 581 ? 208.666 110.840 73.946  1.00 87.96  ? 773  TYR A CA   1 
ATOM   8272  C  C    . TYR A  1 581 ? 208.784 109.385 74.373  1.00 88.92  ? 773  TYR A C    1 
ATOM   8273  O  O    . TYR A  1 581 ? 207.991 108.544 73.939  1.00 88.41  ? 773  TYR A O    1 
ATOM   8274  C  CB   . TYR A  1 581 ? 207.405 111.469 74.545  1.00 88.56  ? 773  TYR A CB   1 
ATOM   8275  C  CG   . TYR A  1 581 ? 207.208 112.917 74.159  1.00 94.74  ? 773  TYR A CG   1 
ATOM   8276  C  CD1  . TYR A  1 581 ? 206.752 113.262 72.893  1.00 94.50  ? 773  TYR A CD1  1 
ATOM   8277  C  CD2  . TYR A  1 581 ? 207.480 113.940 75.058  1.00 99.22  ? 773  TYR A CD2  1 
ATOM   8278  C  CE1  . TYR A  1 581 ? 206.571 114.581 72.533  1.00 97.82  ? 773  TYR A CE1  1 
ATOM   8279  C  CE2  . TYR A  1 581 ? 207.301 115.264 74.707  1.00 100.67 ? 773  TYR A CE2  1 
ATOM   8280  C  CZ   . TYR A  1 581 ? 206.847 115.578 73.443  1.00 100.71 ? 773  TYR A CZ   1 
ATOM   8281  O  OH   . TYR A  1 581 ? 206.667 116.895 73.086  1.00 103.49 ? 773  TYR A OH   1 
ATOM   8282  H  H    . TYR A  1 581 ? 207.984 110.472 72.143  1.00 104.78 ? 773  TYR A H    1 
ATOM   8283  H  HA   . TYR A  1 581 ? 209.439 111.323 74.278  1.00 105.31 ? 773  TYR A HA   1 
ATOM   8284  H  HB2  . TYR A  1 581 ? 206.631 110.971 74.238  1.00 106.02 ? 773  TYR A HB2  1 
ATOM   8285  H  HB3  . TYR A  1 581 ? 207.463 111.424 75.512  1.00 106.02 ? 773  TYR A HB3  1 
ATOM   8286  H  HD1  . TYR A  1 581 ? 206.565 112.591 72.277  1.00 113.15 ? 773  TYR A HD1  1 
ATOM   8287  H  HD2  . TYR A  1 581 ? 207.786 113.730 75.910  1.00 118.81 ? 773  TYR A HD2  1 
ATOM   8288  H  HE1  . TYR A  1 581 ? 206.264 114.796 71.682  1.00 117.14 ? 773  TYR A HE1  1 
ATOM   8289  H  HE2  . TYR A  1 581 ? 207.487 115.939 75.318  1.00 120.55 ? 773  TYR A HE2  1 
ATOM   8290  H  HH   . TYR A  1 581 ? 206.870 117.396 73.728  1.00 123.94 ? 773  TYR A HH   1 
ATOM   8291  N  N    . MET A  1 582 ? 209.764 109.095 75.223  1.00 87.92  ? 774  MET A N    1 
ATOM   8292  C  CA   . MET A  1 582 ? 209.959 107.750 75.750  1.00 89.46  ? 774  MET A CA   1 
ATOM   8293  C  C    . MET A  1 582 ? 209.076 107.528 76.972  1.00 87.18  ? 774  MET A C    1 
ATOM   8294  O  O    . MET A  1 582 ? 209.078 108.339 77.904  1.00 88.39  ? 774  MET A O    1 
ATOM   8295  C  CB   . MET A  1 582 ? 211.427 107.518 76.100  1.00 94.32  ? 774  MET A CB   1 
ATOM   8296  C  CG   . MET A  1 582 ? 212.311 107.333 74.885  1.00 98.19  ? 774  MET A CG   1 
ATOM   8297  S  SD   . MET A  1 582 ? 213.989 106.874 75.335  1.00 110.87 ? 774  MET A SD   1 
ATOM   8298  C  CE   . MET A  1 582 ? 214.640 106.376 73.740  1.00 110.73 ? 774  MET A CE   1 
ATOM   8299  H  H    . MET A  1 582 ? 210.337 109.667 75.513  1.00 105.25 ? 774  MET A H    1 
ATOM   8300  H  HA   . MET A  1 582 ? 209.712 107.108 75.066  1.00 107.10 ? 774  MET A HA   1 
ATOM   8301  H  HB2  . MET A  1 582 ? 211.757 108.284 76.595  1.00 112.93 ? 774  MET A HB2  1 
ATOM   8302  H  HB3  . MET A  1 582 ? 211.497 106.718 76.645  1.00 112.93 ? 774  MET A HB3  1 
ATOM   8303  H  HG2  . MET A  1 582 ? 211.944 106.628 74.329  1.00 117.58 ? 774  MET A HG2  1 
ATOM   8304  H  HG3  . MET A  1 582 ? 212.348 108.165 74.389  1.00 117.58 ? 774  MET A HG3  1 
ATOM   8305  H  HE1  . MET A  1 582 ? 215.563 106.098 73.848  1.00 132.62 ? 774  MET A HE1  1 
ATOM   8306  H  HE2  . MET A  1 582 ? 214.110 105.638 73.399  1.00 132.62 ? 774  MET A HE2  1 
ATOM   8307  H  HE3  . MET A  1 582 ? 214.589 107.128 73.130  1.00 132.62 ? 774  MET A HE3  1 
ATOM   8308  N  N    . THR A  1 583 ? 208.327 106.425 76.960  1.00 82.54  ? 775  THR A N    1 
ATOM   8309  C  CA   . THR A  1 583 ? 207.276 106.194 77.944  1.00 78.74  ? 775  THR A CA   1 
ATOM   8310  C  C    . THR A  1 583 ? 207.673 105.152 78.984  1.00 80.01  ? 775  THR A C    1 
ATOM   8311  O  O    . THR A  1 583 ? 206.985 104.142 79.160  1.00 82.69  ? 775  THR A O    1 
ATOM   8312  C  CB   . THR A  1 583 ? 205.989 105.769 77.236  1.00 80.01  ? 775  THR A CB   1 
ATOM   8313  O  OG1  . THR A  1 583 ? 206.239 104.604 76.440  1.00 81.73  ? 775  THR A OG1  1 
ATOM   8314  C  CG2  . THR A  1 583 ? 205.479 106.894 76.347  1.00 80.55  ? 775  THR A CG2  1 
ATOM   8315  H  H    . THR A  1 583 ? 208.411 105.790 76.386  1.00 98.80  ? 775  THR A H    1 
ATOM   8316  H  HA   . THR A  1 583 ? 207.097 107.026 78.410  1.00 94.24  ? 775  THR A HA   1 
ATOM   8317  H  HB   . THR A  1 583 ? 205.308 105.568 77.897  1.00 95.77  ? 775  THR A HB   1 
ATOM   8318  H  HG1  . THR A  1 583 ? 206.505 103.975 76.928  1.00 97.83  ? 775  THR A HG1  1 
ATOM   8319  H  HG21 . THR A  1 583 ? 204.662 106.619 75.901  1.00 96.41  ? 775  THR A HG21 1 
ATOM   8320  H  HG22 . THR A  1 583 ? 205.295 107.682 76.882  1.00 96.41  ? 775  THR A HG22 1 
ATOM   8321  H  HG23 . THR A  1 583 ? 206.145 107.115 75.678  1.00 96.41  ? 775  THR A HG23 1 
ATOM   8322  N  N    . LYS A  1 584 ? 208.780 105.407 79.682  1.00 83.32  ? 776  LYS A N    1 
ATOM   8323  C  CA   . LYS A  1 584 ? 209.205 104.622 80.844  1.00 85.52  ? 776  LYS A CA   1 
ATOM   8324  C  C    . LYS A  1 584 ? 209.124 103.116 80.599  1.00 82.90  ? 776  LYS A C    1 
ATOM   8325  O  O    . LYS A  1 584 ? 208.757 102.343 81.484  1.00 83.22  ? 776  LYS A O    1 
ATOM   8326  C  CB   . LYS A  1 584 ? 208.378 105.003 82.073  1.00 86.93  ? 776  LYS A CB   1 
ATOM   8327  C  CG   . LYS A  1 584 ? 208.369 106.493 82.395  1.00 89.16  ? 776  LYS A CG   1 
ATOM   8328  C  CD   . LYS A  1 584 ? 209.768 107.039 82.624  1.00 93.66  ? 776  LYS A CD   1 
ATOM   8329  C  CE   . LYS A  1 584 ? 209.721 108.420 83.262  1.00 98.66  ? 776  LYS A CE   1 
ATOM   8330  N  NZ   . LYS A  1 584 ? 211.079 108.973 83.534  1.00 101.67 ? 776  LYS A NZ   1 
ATOM   8331  H  H    . LYS A  1 584 ? 209.318 106.051 79.495  1.00 99.73  ? 776  LYS A H    1 
ATOM   8332  H  HA   . LYS A  1 584 ? 210.131 104.836 81.038  1.00 102.37 ? 776  LYS A HA   1 
ATOM   8333  H  HB2  . LYS A  1 584 ? 207.460 104.729 81.925  1.00 104.07 ? 776  LYS A HB2  1 
ATOM   8334  H  HB3  . LYS A  1 584 ? 208.738 104.538 82.844  1.00 104.07 ? 776  LYS A HB3  1 
ATOM   8335  H  HG2  . LYS A  1 584 ? 207.973 106.976 81.653  1.00 106.75 ? 776  LYS A HG2  1 
ATOM   8336  H  HG3  . LYS A  1 584 ? 207.851 106.640 83.203  1.00 106.75 ? 776  LYS A HG3  1 
ATOM   8337  H  HD2  . LYS A  1 584 ? 210.252 106.444 83.219  1.00 112.15 ? 776  LYS A HD2  1 
ATOM   8338  H  HD3  . LYS A  1 584 ? 210.228 107.111 81.773  1.00 112.15 ? 776  LYS A HD3  1 
ATOM   8339  H  HE2  . LYS A  1 584 ? 209.263 109.030 82.662  1.00 118.14 ? 776  LYS A HE2  1 
ATOM   8340  H  HE3  . LYS A  1 584 ? 209.246 108.363 84.105  1.00 118.14 ? 776  LYS A HE3  1 
ATOM   8341  H  HZ1  . LYS A  1 584 ? 211.010 109.779 83.905  1.00 121.76 ? 776  LYS A HZ1  1 
ATOM   8342  H  HZ2  . LYS A  1 584 ? 211.521 108.435 84.089  1.00 121.76 ? 776  LYS A HZ2  1 
ATOM   8343  H  HZ3  . LYS A  1 584 ? 211.537 109.043 82.774  1.00 121.76 ? 776  LYS A HZ3  1 
ATOM   8344  N  N    . SER A  1 585 ? 209.499 102.685 79.395  1.00 82.78  ? 777  SER A N    1 
ATOM   8345  C  CA   . SER A  1 585 ? 209.635 101.264 79.071  1.00 82.01  ? 777  SER A CA   1 
ATOM   8346  C  C    . SER A  1 585 ? 208.313 100.503 79.145  1.00 82.42  ? 777  SER A C    1 
ATOM   8347  O  O    . SER A  1 585 ? 208.314 99.273  79.284  1.00 80.75  ? 777  SER A O    1 
ATOM   8348  C  CB   . SER A  1 585 ? 210.658 100.588 79.990  1.00 83.64  ? 777  SER A CB   1 
ATOM   8349  O  OG   . SER A  1 585 ? 211.927 101.208 79.893  1.00 90.66  ? 777  SER A OG   1 
ATOM   8350  H  H    . SER A  1 585 ? 209.684 103.207 78.736  1.00 99.08  ? 777  SER A H    1 
ATOM   8351  H  HA   . SER A  1 585 ? 209.964 101.187 78.162  1.00 98.16  ? 777  SER A HA   1 
ATOM   8352  H  HB2  . SER A  1 585 ? 210.347 100.651 80.907  1.00 100.12 ? 777  SER A HB2  1 
ATOM   8353  H  HB3  . SER A  1 585 ? 210.743 99.657  79.734  1.00 100.12 ? 777  SER A HB3  1 
ATOM   8354  H  HG   . SER A  1 585 ? 212.474 100.825 80.403  1.00 108.54 ? 777  SER A HG   1 
ATOM   8355  N  N    . THR A  1 586 ? 207.179 101.193 79.063  1.00 80.81  ? 778  THR A N    1 
ATOM   8356  C  CA   . THR A  1 586 ? 205.889 100.525 79.015  1.00 81.15  ? 778  THR A CA   1 
ATOM   8357  C  C    . THR A  1 586 ? 205.072 101.094 77.865  1.00 81.15  ? 778  THR A C    1 
ATOM   8358  O  O    . THR A  1 586 ? 205.189 102.281 77.545  1.00 81.68  ? 778  THR A O    1 
ATOM   8359  C  CB   . THR A  1 586 ? 205.107 100.686 80.328  1.00 87.03  ? 778  THR A CB   1 
ATOM   8360  O  OG1  . THR A  1 586 ? 204.321 101.882 80.277  1.00 94.46  ? 778  THR A OG1  1 
ATOM   8361  C  CG2  . THR A  1 586 ? 206.047 100.763 81.521  1.00 83.13  ? 778  THR A CG2  1 
ATOM   8362  H  H    . THR A  1 586 ? 207.132 102.052 79.033  1.00 96.72  ? 778  THR A H    1 
ATOM   8363  H  HA   . THR A  1 586 ? 206.024 99.578  78.854  1.00 97.13  ? 778  THR A HA   1 
ATOM   8364  H  HB   . THR A  1 586 ? 204.521 99.922  80.449  1.00 104.19 ? 778  THR A HB   1 
ATOM   8365  H  HG1  . THR A  1 586 ? 203.891 101.974 80.993  1.00 113.10 ? 778  THR A HG1  1 
ATOM   8366  H  HG21 . THR A  1 586 ? 205.536 100.865 82.339  1.00 99.51  ? 778  THR A HG21 1 
ATOM   8367  H  HG22 . THR A  1 586 ? 206.576 99.952  81.578  1.00 99.51  ? 778  THR A HG22 1 
ATOM   8368  H  HG23 . THR A  1 586 ? 206.643 101.523 81.425  1.00 99.51  ? 778  THR A HG23 1 
ATOM   8369  N  N    . PRO A  1 587 ? 204.238 100.275 77.225  1.00 75.03  ? 779  PRO A N    1 
ATOM   8370  C  CA   . PRO A  1 587 ? 203.481 100.760 76.067  1.00 74.64  ? 779  PRO A CA   1 
ATOM   8371  C  C    . PRO A  1 587 ? 202.304 101.630 76.475  1.00 75.40  ? 779  PRO A C    1 
ATOM   8372  O  O    . PRO A  1 587 ? 201.551 101.304 77.396  1.00 76.53  ? 779  PRO A O    1 
ATOM   8373  C  CB   . PRO A  1 587 ? 203.003 99.466  75.400  1.00 73.77  ? 779  PRO A CB   1 
ATOM   8374  C  CG   . PRO A  1 587 ? 202.827 98.529  76.541  1.00 71.08  ? 779  PRO A CG   1 
ATOM   8375  C  CD   . PRO A  1 587 ? 203.935 98.862  77.516  1.00 72.93  ? 779  PRO A CD   1 
ATOM   8376  H  HA   . PRO A  1 587 ? 204.057 101.249 75.459  1.00 89.32  ? 779  PRO A HA   1 
ATOM   8377  H  HB2  . PRO A  1 587 ? 202.162 99.620  74.943  1.00 88.27  ? 779  PRO A HB2  1 
ATOM   8378  H  HB3  . PRO A  1 587 ? 203.680 99.141  74.785  1.00 88.27  ? 779  PRO A HB3  1 
ATOM   8379  H  HG2  . PRO A  1 587 ? 201.958 98.672  76.949  1.00 85.05  ? 779  PRO A HG2  1 
ATOM   8380  H  HG3  . PRO A  1 587 ? 202.911 97.615  76.227  1.00 85.05  ? 779  PRO A HG3  1 
ATOM   8381  H  HD2  . PRO A  1 587 ? 203.621 98.765  78.429  1.00 87.26  ? 779  PRO A HD2  1 
ATOM   8382  H  HD3  . PRO A  1 587 ? 204.712 98.307  77.347  1.00 87.26  ? 779  PRO A HD3  1 
ATOM   8383  N  N    . VAL A  1 588 ? 202.145 102.745 75.768  1.00 79.04  ? 780  VAL A N    1 
ATOM   8384  C  CA   . VAL A  1 588 ? 201.007 103.634 75.966  1.00 78.19  ? 780  VAL A CA   1 
ATOM   8385  C  C    . VAL A  1 588 ? 199.863 103.097 75.116  1.00 73.33  ? 780  VAL A C    1 
ATOM   8386  O  O    . VAL A  1 588 ? 199.936 103.101 73.885  1.00 71.04  ? 780  VAL A O    1 
ATOM   8387  C  CB   . VAL A  1 588 ? 201.348 105.084 75.604  1.00 80.40  ? 780  VAL A CB   1 
ATOM   8388  C  CG1  . VAL A  1 588 ? 200.079 105.923 75.436  1.00 78.13  ? 780  VAL A CG1  1 
ATOM   8389  C  CG2  . VAL A  1 588 ? 202.244 105.690 76.672  1.00 81.44  ? 780  VAL A CG2  1 
ATOM   8390  H  H    . VAL A  1 588 ? 202.691 103.011 75.159  1.00 94.60  ? 780  VAL A H    1 
ATOM   8391  H  HA   . VAL A  1 588 ? 200.735 103.607 76.897  1.00 93.58  ? 780  VAL A HA   1 
ATOM   8392  H  HB   . VAL A  1 588 ? 201.831 105.097 74.763  1.00 96.23  ? 780  VAL A HB   1 
ATOM   8393  H  HG11 . VAL A  1 588 ? 200.329 106.832 75.208  1.00 93.50  ? 780  VAL A HG11 1 
ATOM   8394  H  HG12 . VAL A  1 588 ? 199.539 105.540 74.727  1.00 93.50  ? 780  VAL A HG12 1 
ATOM   8395  H  HG13 . VAL A  1 588 ? 199.583 105.915 76.270  1.00 93.50  ? 780  VAL A HG13 1 
ATOM   8396  H  HG21 . VAL A  1 588 ? 202.450 106.606 76.429  1.00 97.47  ? 780  VAL A HG21 1 
ATOM   8397  H  HG22 . VAL A  1 588 ? 201.778 105.670 77.523  1.00 97.47  ? 780  VAL A HG22 1 
ATOM   8398  H  HG23 . VAL A  1 588 ? 203.061 105.170 76.730  1.00 97.47  ? 780  VAL A HG23 1 
ATOM   8399  N  N    . VAL A  1 589 ? 198.802 102.632 75.779  1.00 70.22  ? 781  VAL A N    1 
ATOM   8400  C  CA   . VAL A  1 589 ? 197.694 101.965 75.107  1.00 68.44  ? 781  VAL A CA   1 
ATOM   8401  C  C    . VAL A  1 589 ? 196.469 102.854 74.969  1.00 67.35  ? 781  VAL A C    1 
ATOM   8402  O  O    . VAL A  1 589 ? 195.453 102.408 74.420  1.00 64.85  ? 781  VAL A O    1 
ATOM   8403  C  CB   . VAL A  1 589 ? 197.324 100.659 75.839  1.00 68.84  ? 781  VAL A CB   1 
ATOM   8404  C  CG1  . VAL A  1 589 ? 198.497 99.692  75.814  1.00 72.10  ? 781  VAL A CG1  1 
ATOM   8405  C  CG2  . VAL A  1 589 ? 196.909 100.951 77.278  1.00 65.08  ? 781  VAL A CG2  1 
ATOM   8406  H  H    . VAL A  1 589 ? 198.702 102.695 76.631  1.00 84.01  ? 781  VAL A H    1 
ATOM   8407  H  HA   . VAL A  1 589 ? 197.980 101.724 74.212  1.00 81.88  ? 781  VAL A HA   1 
ATOM   8408  H  HB   . VAL A  1 589 ? 196.575 100.240 75.387  1.00 82.36  ? 781  VAL A HB   1 
ATOM   8409  H  HG11 . VAL A  1 589 ? 198.246 98.879  76.278  1.00 86.27  ? 781  VAL A HG11 1 
ATOM   8410  H  HG12 . VAL A  1 589 ? 198.721 99.492  74.892  1.00 86.27  ? 781  VAL A HG12 1 
ATOM   8411  H  HG13 . VAL A  1 589 ? 199.256 100.105 76.256  1.00 86.27  ? 781  VAL A HG13 1 
ATOM   8412  H  HG21 . VAL A  1 589 ? 196.682 100.116 77.716  1.00 77.84  ? 781  VAL A HG21 1 
ATOM   8413  H  HG22 . VAL A  1 589 ? 197.649 101.376 77.739  1.00 77.84  ? 781  VAL A HG22 1 
ATOM   8414  H  HG23 . VAL A  1 589 ? 196.140 101.542 77.271  1.00 77.84  ? 781  VAL A HG23 1 
ATOM   8415  N  N    . HIS A  1 590 ? 196.526 104.093 75.452  1.00 73.78  ? 782  HIS A N    1 
ATOM   8416  C  CA   . HIS A  1 590 ? 195.415 105.018 75.282  1.00 68.74  ? 782  HIS A CA   1 
ATOM   8417  C  C    . HIS A  1 590 ? 195.935 106.442 75.393  1.00 66.64  ? 782  HIS A C    1 
ATOM   8418  O  O    . HIS A  1 590 ? 196.724 106.753 76.289  1.00 70.85  ? 782  HIS A O    1 
ATOM   8419  C  CB   . HIS A  1 590 ? 194.314 104.775 76.319  1.00 71.09  ? 782  HIS A CB   1 
ATOM   8420  C  CG   . HIS A  1 590 ? 193.112 105.647 76.137  1.00 74.19  ? 782  HIS A CG   1 
ATOM   8421  N  ND1  . HIS A  1 590 ? 192.936 106.826 76.829  1.00 74.70  ? 782  HIS A ND1  1 
ATOM   8422  C  CD2  . HIS A  1 590 ? 192.029 105.517 75.334  1.00 71.90  ? 782  HIS A CD2  1 
ATOM   8423  C  CE1  . HIS A  1 590 ? 191.794 107.381 76.465  1.00 74.90  ? 782  HIS A CE1  1 
ATOM   8424  N  NE2  . HIS A  1 590 ? 191.224 106.607 75.559  1.00 73.18  ? 782  HIS A NE2  1 
ATOM   8425  H  H    . HIS A  1 590 ? 197.196 104.420 75.880  1.00 88.29  ? 782  HIS A H    1 
ATOM   8426  H  HA   . HIS A  1 590 ? 195.032 104.901 74.398  1.00 82.23  ? 782  HIS A HA   1 
ATOM   8427  H  HB2  . HIS A  1 590 ? 194.023 103.851 76.256  1.00 85.06  ? 782  HIS A HB2  1 
ATOM   8428  H  HB3  . HIS A  1 590 ? 194.674 104.946 77.204  1.00 85.06  ? 782  HIS A HB3  1 
ATOM   8429  H  HD2  . HIS A  1 590 ? 191.860 104.818 74.744  1.00 86.03  ? 782  HIS A HD2  1 
ATOM   8430  H  HE1  . HIS A  1 590 ? 191.450 108.182 76.790  1.00 89.63  ? 782  HIS A HE1  1 
ATOM   8431  H  HE2  . HIS A  1 590 ? 190.472 106.761 75.172  1.00 87.57  ? 782  HIS A HE2  1 
ATOM   8432  N  N    . LEU A  1 591 ? 195.482 107.297 74.482  1.00 67.43  ? 783  LEU A N    1 
ATOM   8433  C  CA   . LEU A  1 591 ? 195.853 108.705 74.458  1.00 69.85  ? 783  LEU A CA   1 
ATOM   8434  C  C    . LEU A  1 591 ? 194.592 109.550 74.531  1.00 72.83  ? 783  LEU A C    1 
ATOM   8435  O  O    . LEU A  1 591 ? 193.622 109.290 73.811  1.00 72.55  ? 783  LEU A O    1 
ATOM   8436  C  CB   . LEU A  1 591 ? 196.650 109.047 73.198  1.00 71.54  ? 783  LEU A CB   1 
ATOM   8437  C  CG   . LEU A  1 591 ? 198.068 108.481 73.166  1.00 72.85  ? 783  LEU A CG   1 
ATOM   8438  C  CD1  . LEU A  1 591 ? 198.569 108.377 71.737  1.00 72.60  ? 783  LEU A CD1  1 
ATOM   8439  C  CD2  . LEU A  1 591 ? 198.996 109.348 74.002  1.00 75.11  ? 783  LEU A CD2  1 
ATOM   8440  H  H    . LEU A  1 591 ? 194.943 107.077 73.849  1.00 80.67  ? 783  LEU A H    1 
ATOM   8441  H  HA   . LEU A  1 591 ? 196.402 108.906 75.232  1.00 83.57  ? 783  LEU A HA   1 
ATOM   8442  H  HB2  . LEU A  1 591 ? 196.176 108.697 72.428  1.00 85.60  ? 783  LEU A HB2  1 
ATOM   8443  H  HB3  . LEU A  1 591 ? 196.718 110.012 73.128  1.00 85.60  ? 783  LEU A HB3  1 
ATOM   8444  H  HG   . LEU A  1 591 ? 198.063 107.590 73.549  1.00 87.17  ? 783  LEU A HG   1 
ATOM   8445  H  HD11 . LEU A  1 591 ? 199.469 108.016 71.743  1.00 86.87  ? 783  LEU A HD11 1 
ATOM   8446  H  HD12 . LEU A  1 591 ? 197.980 107.790 71.238  1.00 86.87  ? 783  LEU A HD12 1 
ATOM   8447  H  HD13 . LEU A  1 591 ? 198.570 109.261 71.338  1.00 86.87  ? 783  LEU A HD13 1 
ATOM   8448  H  HD21 . LEU A  1 591 ? 199.891 108.974 73.970  1.00 89.89  ? 783  LEU A HD21 1 
ATOM   8449  H  HD22 . LEU A  1 591 ? 199.000 110.247 73.638  1.00 89.89  ? 783  LEU A HD22 1 
ATOM   8450  H  HD23 . LEU A  1 591 ? 198.675 109.362 74.917  1.00 89.89  ? 783  LEU A HD23 1 
ATOM   8451  N  N    . HIS A  1 592 ? 194.608 110.549 75.407  1.00 71.37  ? 784  HIS A N    1 
ATOM   8452  C  CA   . HIS A  1 592 ? 193.464 111.421 75.625  1.00 70.51  ? 784  HIS A CA   1 
ATOM   8453  C  C    . HIS A  1 592 ? 193.922 112.870 75.606  1.00 73.62  ? 784  HIS A C    1 
ATOM   8454  O  O    . HIS A  1 592 ? 194.888 113.228 76.287  1.00 75.36  ? 784  HIS A O    1 
ATOM   8455  C  CB   . HIS A  1 592 ? 192.783 111.096 76.958  1.00 72.47  ? 784  HIS A CB   1 
ATOM   8456  C  CG   . HIS A  1 592 ? 191.744 112.091 77.363  1.00 77.51  ? 784  HIS A CG   1 
ATOM   8457  N  ND1  . HIS A  1 592 ? 190.464 112.083 76.853  1.00 78.56  ? 784  HIS A ND1  1 
ATOM   8458  C  CD2  . HIS A  1 592 ? 191.798 113.130 78.230  1.00 78.79  ? 784  HIS A CD2  1 
ATOM   8459  C  CE1  . HIS A  1 592 ? 189.773 113.074 77.388  1.00 77.40  ? 784  HIS A CE1  1 
ATOM   8460  N  NE2  . HIS A  1 592 ? 190.560 113.725 78.226  1.00 76.54  ? 784  HIS A NE2  1 
ATOM   8461  H  H    . HIS A  1 592 ? 195.287 110.745 75.898  1.00 85.39  ? 784  HIS A H    1 
ATOM   8462  H  HA   . HIS A  1 592 ? 192.820 111.293 74.911  1.00 84.36  ? 784  HIS A HA   1 
ATOM   8463  H  HB2  . HIS A  1 592 ? 192.352 110.230 76.886  1.00 86.72  ? 784  HIS A HB2  1 
ATOM   8464  H  HB3  . HIS A  1 592 ? 193.457 111.070 77.655  1.00 86.72  ? 784  HIS A HB3  1 
ATOM   8465  H  HD1  . HIS A  1 592 ? 190.162 111.521 76.276  1.00 94.02  ? 784  HIS A HD1  1 
ATOM   8466  H  HD2  . HIS A  1 592 ? 192.535 113.392 78.733  1.00 94.30  ? 784  HIS A HD2  1 
ATOM   8467  H  HE1  . HIS A  1 592 ? 188.885 113.279 77.206  1.00 92.63  ? 784  HIS A HE1  1 
ATOM   8468  N  N    . PHE A  1 593 ? 193.223 113.697 74.835  1.00 77.59  ? 785  PHE A N    1 
ATOM   8469  C  CA   . PHE A  1 593 ? 193.411 115.142 74.852  1.00 81.01  ? 785  PHE A CA   1 
ATOM   8470  C  C    . PHE A  1 593 ? 192.275 115.750 75.662  1.00 80.16  ? 785  PHE A C    1 
ATOM   8471  O  O    . PHE A  1 593 ? 191.101 115.544 75.337  1.00 79.13  ? 785  PHE A O    1 
ATOM   8472  C  CB   . PHE A  1 593 ? 193.406 115.730 73.438  1.00 80.96  ? 785  PHE A CB   1 
ATOM   8473  C  CG   . PHE A  1 593 ? 194.720 115.627 72.712  1.00 81.14  ? 785  PHE A CG   1 
ATOM   8474  C  CD1  . PHE A  1 593 ? 194.943 114.614 71.793  1.00 79.06  ? 785  PHE A CD1  1 
ATOM   8475  C  CD2  . PHE A  1 593 ? 195.718 116.567 72.920  1.00 83.75  ? 785  PHE A CD2  1 
ATOM   8476  C  CE1  . PHE A  1 593 ? 196.146 114.528 71.110  1.00 80.03  ? 785  PHE A CE1  1 
ATOM   8477  C  CE2  . PHE A  1 593 ? 196.921 116.487 72.238  1.00 84.15  ? 785  PHE A CE2  1 
ATOM   8478  C  CZ   . PHE A  1 593 ? 197.135 115.465 71.335  1.00 83.10  ? 785  PHE A CZ   1 
ATOM   8479  H  H    . PHE A  1 593 ? 192.620 113.438 74.280  1.00 92.86  ? 785  PHE A H    1 
ATOM   8480  H  HA   . PHE A  1 593 ? 194.253 115.360 75.279  1.00 96.97  ? 785  PHE A HA   1 
ATOM   8481  H  HB2  . PHE A  1 593 ? 192.741 115.262 72.910  1.00 96.91  ? 785  PHE A HB2  1 
ATOM   8482  H  HB3  . PHE A  1 593 ? 193.175 116.671 73.495  1.00 96.91  ? 785  PHE A HB3  1 
ATOM   8483  H  HD1  . PHE A  1 593 ? 194.281 113.979 71.638  1.00 94.63  ? 785  PHE A HD1  1 
ATOM   8484  H  HD2  . PHE A  1 593 ? 195.580 117.257 73.527  1.00 100.26 ? 785  PHE A HD2  1 
ATOM   8485  H  HE1  . PHE A  1 593 ? 196.287 113.839 70.502  1.00 95.78  ? 785  PHE A HE1  1 
ATOM   8486  H  HE2  . PHE A  1 593 ? 197.586 117.118 72.392  1.00 100.73 ? 785  PHE A HE2  1 
ATOM   8487  H  HZ   . PHE A  1 593 ? 197.944 115.409 70.879  1.00 99.47  ? 785  PHE A HZ   1 
ATOM   8488  N  N    . THR A  1 594 ? 192.618 116.498 76.706  1.00 80.82  ? 786  THR A N    1 
ATOM   8489  C  CA   . THR A  1 594 ? 191.590 117.223 77.431  1.00 81.87  ? 786  THR A CA   1 
ATOM   8490  C  C    . THR A  1 594 ? 191.082 118.379 76.572  1.00 84.70  ? 786  THR A C    1 
ATOM   8491  O  O    . THR A  1 594 ? 191.676 118.740 75.552  1.00 86.63  ? 786  THR A O    1 
ATOM   8492  C  CB   . THR A  1 594 ? 192.121 117.747 78.767  1.00 81.32  ? 786  THR A CB   1 
ATOM   8493  O  OG1  . THR A  1 594 ? 192.995 118.859 78.538  1.00 83.21  ? 786  THR A OG1  1 
ATOM   8494  C  CG2  . THR A  1 594 ? 192.871 116.657 79.531  1.00 80.06  ? 786  THR A CG2  1 
ATOM   8495  H  H    . THR A  1 594 ? 193.417 116.600 77.005  1.00 96.74  ? 786  THR A H    1 
ATOM   8496  H  HA   . THR A  1 594 ? 190.846 116.628 77.612  1.00 98.00  ? 786  THR A HA   1 
ATOM   8497  H  HB   . THR A  1 594 ? 191.374 118.038 79.313  1.00 97.33  ? 786  THR A HB   1 
ATOM   8498  H  HG1  . THR A  1 594 ? 193.289 119.149 79.270  1.00 99.60  ? 786  THR A HG1  1 
ATOM   8499  H  HG21 . THR A  1 594 ? 193.199 117.009 80.373  1.00 95.82  ? 786  THR A HG21 1 
ATOM   8500  H  HG22 . THR A  1 594 ? 192.277 115.911 79.711  1.00 95.82  ? 786  THR A HG22 1 
ATOM   8501  H  HG23 . THR A  1 594 ? 193.623 116.343 79.006  1.00 95.82  ? 786  THR A HG23 1 
ATOM   8502  N  N    . ARG A  1 595 ? 189.963 118.967 76.994  1.00 86.68  ? 787  ARG A N    1 
ATOM   8503  C  CA   . ARG A  1 595 ? 189.405 120.096 76.260  1.00 91.84  ? 787  ARG A CA   1 
ATOM   8504  C  C    . ARG A  1 595 ? 190.342 121.297 76.237  1.00 94.56  ? 787  ARG A C    1 
ATOM   8505  O  O    . ARG A  1 595 ? 190.052 122.275 75.539  1.00 96.26  ? 787  ARG A O    1 
ATOM   8506  C  CB   . ARG A  1 595 ? 188.055 120.484 76.864  1.00 95.80  ? 787  ARG A CB   1 
ATOM   8507  C  CG   . ARG A  1 595 ? 186.966 119.465 76.583  1.00 96.24  ? 787  ARG A CG   1 
ATOM   8508  C  CD   . ARG A  1 595 ? 185.746 119.680 77.455  1.00 98.00  ? 787  ARG A CD   1 
ATOM   8509  N  NE   . ARG A  1 595 ? 184.689 118.727 77.134  1.00 99.31  ? 787  ARG A NE   1 
ATOM   8510  C  CZ   . ARG A  1 595 ? 183.461 118.769 77.641  1.00 102.04 ? 787  ARG A CZ   1 
ATOM   8511  N  NH1  . ARG A  1 595 ? 183.124 119.723 78.500  1.00 103.48 ? 787  ARG A NH1  1 
ATOM   8512  N  NH2  . ARG A  1 595 ? 182.568 117.854 77.288  1.00 102.63 ? 787  ARG A NH2  1 
ATOM   8513  H  H    . ARG A  1 595 ? 189.515 118.734 77.690  1.00 103.77 ? 787  ARG A H    1 
ATOM   8514  H  HA   . ARG A  1 595 ? 189.251 119.825 75.342  1.00 109.96 ? 787  ARG A HA   1 
ATOM   8515  H  HB2  . ARG A  1 595 ? 188.151 120.562 77.826  1.00 114.71 ? 787  ARG A HB2  1 
ATOM   8516  H  HB3  . ARG A  1 595 ? 187.774 121.333 76.489  1.00 114.71 ? 787  ARG A HB3  1 
ATOM   8517  H  HG2  . ARG A  1 595 ? 186.691 119.540 75.655  1.00 115.24 ? 787  ARG A HG2  1 
ATOM   8518  H  HG3  . ARG A  1 595 ? 187.309 118.575 76.758  1.00 115.24 ? 787  ARG A HG3  1 
ATOM   8519  H  HD2  . ARG A  1 595 ? 185.993 119.561 78.385  1.00 117.36 ? 787  ARG A HD2  1 
ATOM   8520  H  HD3  . ARG A  1 595 ? 185.403 120.576 77.310  1.00 117.36 ? 787  ARG A HD3  1 
ATOM   8521  H  HE   . ARG A  1 595 ? 184.873 118.096 76.580  1.00 118.92 ? 787  ARG A HE   1 
ATOM   8522  H  HH11 . ARG A  1 595 ? 183.700 120.317 78.731  1.00 123.92 ? 787  ARG A HH11 1 
ATOM   8523  H  HH12 . ARG A  1 595 ? 182.328 119.746 78.826  1.00 123.92 ? 787  ARG A HH12 1 
ATOM   8524  H  HH21 . ARG A  1 595 ? 182.784 117.235 76.732  1.00 122.91 ? 787  ARG A HH21 1 
ATOM   8525  H  HH22 . ARG A  1 595 ? 181.773 117.880 77.615  1.00 122.91 ? 787  ARG A HH22 1 
ATOM   8526  N  N    . ARG A  1 596 ? 191.455 121.243 76.970  1.00 102.22 ? 788  ARG A N    1 
ATOM   8527  C  CA   . ARG A  1 596 ? 192.507 122.249 76.914  1.00 104.80 ? 788  ARG A CA   1 
ATOM   8528  C  C    . ARG A  1 596 ? 193.789 121.705 76.289  1.00 103.02 ? 788  ARG A C    1 
ATOM   8529  O  O    . ARG A  1 596 ? 194.861 122.294 76.464  1.00 105.33 ? 788  ARG A O    1 
ATOM   8530  C  CB   . ARG A  1 596 ? 192.783 122.770 78.323  1.00 108.40 ? 788  ARG A CB   1 
ATOM   8531  C  CG   . ARG A  1 596 ? 191.604 123.470 78.978  1.00 113.72 ? 788  ARG A CG   1 
ATOM   8532  C  CD   . ARG A  1 596 ? 192.094 124.495 79.981  1.00 118.87 ? 788  ARG A CD   1 
ATOM   8533  N  NE   . ARG A  1 596 ? 191.071 124.837 80.964  1.00 122.50 ? 788  ARG A NE   1 
ATOM   8534  C  CZ   . ARG A  1 596 ? 191.292 125.584 82.041  1.00 125.78 ? 788  ARG A CZ   1 
ATOM   8535  N  NH1  . ARG A  1 596 ? 192.509 126.057 82.286  1.00 126.71 ? 788  ARG A NH1  1 
ATOM   8536  N  NH2  . ARG A  1 596 ? 190.302 125.857 82.880  1.00 126.26 ? 788  ARG A NH2  1 
ATOM   8537  H  H    . ARG A  1 596 ? 191.625 120.609 77.526  1.00 122.42 ? 788  ARG A H    1 
ATOM   8538  H  HA   . ARG A  1 596 ? 192.203 122.994 76.372  1.00 125.52 ? 788  ARG A HA   1 
ATOM   8539  H  HB2  . ARG A  1 596 ? 193.031 122.022 78.887  1.00 129.83 ? 788  ARG A HB2  1 
ATOM   8540  H  HB3  . ARG A  1 596 ? 193.515 123.405 78.281  1.00 129.83 ? 788  ARG A HB3  1 
ATOM   8541  H  HG2  . ARG A  1 596 ? 191.081 123.928 78.301  1.00 136.22 ? 788  ARG A HG2  1 
ATOM   8542  H  HG3  . ARG A  1 596 ? 191.059 122.818 79.446  1.00 136.22 ? 788  ARG A HG3  1 
ATOM   8543  H  HD2  . ARG A  1 596 ? 192.860 124.135 80.455  1.00 142.40 ? 788  ARG A HD2  1 
ATOM   8544  H  HD3  . ARG A  1 596 ? 192.344 125.306 79.510  1.00 142.40 ? 788  ARG A HD3  1 
ATOM   8545  H  HE   . ARG A  1 596 ? 190.267 124.570 80.818  1.00 146.76 ? 788  ARG A HE   1 
ATOM   8546  H  HH11 . ARG A  1 596 ? 193.154 125.885 81.744  1.00 151.80 ? 788  ARG A HH11 1 
ATOM   8547  H  HH12 . ARG A  1 596 ? 192.650 126.538 82.985  1.00 151.80 ? 788  ARG A HH12 1 
ATOM   8548  H  HH21 . ARG A  1 596 ? 189.513 125.550 82.728  1.00 151.27 ? 788  ARG A HH21 1 
ATOM   8549  H  HH22 . ARG A  1 596 ? 190.450 126.335 83.579  1.00 151.27 ? 788  ARG A HH22 1 
ATOM   8550  N  N    . ASN A  1 597 ? 193.696 120.592 75.558  1.00 90.61  ? 789  ASN A N    1 
ATOM   8551  C  CA   . ASN A  1 597 ? 194.824 120.031 74.810  1.00 89.67  ? 789  ASN A CA   1 
ATOM   8552  C  C    . ASN A  1 597 ? 195.973 119.620 75.733  1.00 89.90  ? 789  ASN A C    1 
ATOM   8553  O  O    . ASN A  1 597 ? 197.150 119.802 75.415  1.00 91.95  ? 789  ASN A O    1 
ATOM   8554  C  CB   . ASN A  1 597 ? 195.302 121.005 73.729  1.00 90.64  ? 789  ASN A CB   1 
ATOM   8555  C  CG   . ASN A  1 597 ? 194.523 120.858 72.434  1.00 87.22  ? 789  ASN A CG   1 
ATOM   8556  O  OD1  . ASN A  1 597 ? 194.028 119.776 72.113  1.00 78.06  ? 789  ASN A OD1  1 
ATOM   8557  N  ND2  . ASN A  1 597 ? 194.411 121.947 71.681  1.00 91.10  ? 789  ASN A ND2  1 
ATOM   8558  H  H    . ASN A  1 597 ? 192.972 120.133 75.478  1.00 108.49 ? 789  ASN A H    1 
ATOM   8559  H  HA   . ASN A  1 597 ? 194.519 119.229 74.359  1.00 107.36 ? 789  ASN A HA   1 
ATOM   8560  H  HB2  . ASN A  1 597 ? 195.188 121.914 74.047  1.00 108.52 ? 789  ASN A HB2  1 
ATOM   8561  H  HB3  . ASN A  1 597 ? 196.238 120.833 73.538  1.00 108.52 ? 789  ASN A HB3  1 
ATOM   8562  H  HD21 . ASN A  1 597 ? 193.979 121.914 70.939  1.00 109.07 ? 789  ASN A HD21 1 
ATOM   8563  H  HD22 . ASN A  1 597 ? 194.770 122.685 71.937  1.00 109.07 ? 789  ASN A HD22 1 
ATOM   8564  N  N    . LEU A  1 598 ? 195.623 119.056 76.886  1.00 92.92  ? 790  LEU A N    1 
ATOM   8565  C  CA   . LEU A  1 598 ? 196.560 118.343 77.742  1.00 90.40  ? 790  LEU A CA   1 
ATOM   8566  C  C    . LEU A  1 598 ? 196.454 116.854 77.437  1.00 86.27  ? 790  LEU A C    1 
ATOM   8567  O  O    . LEU A  1 598 ? 195.350 116.325 77.277  1.00 85.88  ? 790  LEU A O    1 
ATOM   8568  C  CB   . LEU A  1 598 ? 196.254 118.613 79.218  1.00 93.68  ? 790  LEU A CB   1 
ATOM   8569  C  CG   . LEU A  1 598 ? 196.992 117.793 80.278  1.00 95.91  ? 790  LEU A CG   1 
ATOM   8570  C  CD1  . LEU A  1 598 ? 198.459 118.146 80.299  1.00 94.84  ? 790  LEU A CD1  1 
ATOM   8571  C  CD2  . LEU A  1 598 ? 196.371 118.011 81.647  1.00 98.70  ? 790  LEU A CD2  1 
ATOM   8572  H  H    . LEU A  1 598 ? 194.823 119.076 77.200  1.00 111.25 ? 790  LEU A H    1 
ATOM   8573  H  HA   . LEU A  1 598 ? 197.465 118.636 77.553  1.00 108.24 ? 790  LEU A HA   1 
ATOM   8574  H  HB2  . LEU A  1 598 ? 196.454 119.546 79.396  1.00 112.17 ? 790  LEU A HB2  1 
ATOM   8575  H  HB3  . LEU A  1 598 ? 195.306 118.462 79.356  1.00 112.17 ? 790  LEU A HB3  1 
ATOM   8576  H  HG   . LEU A  1 598 ? 196.914 116.851 80.060  1.00 114.85 ? 790  LEU A HG   1 
ATOM   8577  H  HD11 . LEU A  1 598 ? 198.902 117.614 80.978  1.00 113.57 ? 790  LEU A HD11 1 
ATOM   8578  H  HD12 . LEU A  1 598 ? 198.841 117.957 79.428  1.00 113.57 ? 790  LEU A HD12 1 
ATOM   8579  H  HD13 . LEU A  1 598 ? 198.553 119.090 80.504  1.00 113.57 ? 790  LEU A HD13 1 
ATOM   8580  H  HD21 . LEU A  1 598 ? 196.855 117.482 82.301  1.00 118.20 ? 790  LEU A HD21 1 
ATOM   8581  H  HD22 . LEU A  1 598 ? 196.430 118.952 81.874  1.00 118.20 ? 790  LEU A HD22 1 
ATOM   8582  H  HD23 . LEU A  1 598 ? 195.442 117.734 81.619  1.00 118.20 ? 790  LEU A HD23 1 
ATOM   8583  N  N    . VAL A  1 599 ? 197.598 116.176 77.348  1.00 85.65  ? 791  VAL A N    1 
ATOM   8584  C  CA   . VAL A  1 599 ? 197.638 114.774 76.939  1.00 87.77  ? 791  VAL A CA   1 
ATOM   8585  C  C    . VAL A  1 599 ? 197.771 113.890 78.169  1.00 86.83  ? 791  VAL A C    1 
ATOM   8586  O  O    . VAL A  1 599 ? 198.683 114.075 78.985  1.00 88.31  ? 791  VAL A O    1 
ATOM   8587  C  CB   . VAL A  1 599 ? 198.786 114.501 75.952  1.00 87.26  ? 791  VAL A CB   1 
ATOM   8588  C  CG1  . VAL A  1 599 ? 198.909 112.998 75.680  1.00 81.51  ? 791  VAL A CG1  1 
ATOM   8589  C  CG2  . VAL A  1 599 ? 198.556 115.242 74.656  1.00 88.18  ? 791  VAL A CG2  1 
ATOM   8590  H  H    . VAL A  1 599 ? 198.372 116.510 77.522  1.00 102.53 ? 791  VAL A H    1 
ATOM   8591  H  HA   . VAL A  1 599 ? 196.803 114.550 76.498  1.00 105.08 ? 791  VAL A HA   1 
ATOM   8592  H  HB   . VAL A  1 599 ? 199.621 114.810 76.336  1.00 104.46 ? 791  VAL A HB   1 
ATOM   8593  H  HG11 . VAL A  1 599 ? 199.637 112.849 75.056  1.00 97.57  ? 791  VAL A HG11 1 
ATOM   8594  H  HG12 . VAL A  1 599 ? 199.090 112.540 76.516  1.00 97.57  ? 791  VAL A HG12 1 
ATOM   8595  H  HG13 . VAL A  1 599 ? 198.077 112.677 75.299  1.00 97.57  ? 791  VAL A HG13 1 
ATOM   8596  H  HG21 . VAL A  1 599 ? 199.290 115.055 74.051  1.00 105.57 ? 791  VAL A HG21 1 
ATOM   8597  H  HG22 . VAL A  1 599 ? 197.720 114.942 74.265  1.00 105.57 ? 791  VAL A HG22 1 
ATOM   8598  H  HG23 . VAL A  1 599 ? 198.512 116.194 74.840  1.00 105.57 ? 791  VAL A HG23 1 
ATOM   8599  N  N    . LEU A  1 600 ? 196.856 112.934 78.301  1.00 78.43  ? 792  LEU A N    1 
ATOM   8600  C  CA   . LEU A  1 600 ? 196.956 111.858 79.278  1.00 76.38  ? 792  LEU A CA   1 
ATOM   8601  C  C    . LEU A  1 600 ? 197.312 110.579 78.533  1.00 72.14  ? 792  LEU A C    1 
ATOM   8602  O  O    . LEU A  1 600 ? 196.550 110.127 77.672  1.00 73.62  ? 792  LEU A O    1 
ATOM   8603  C  CB   . LEU A  1 600 ? 195.646 111.692 80.049  1.00 76.40  ? 792  LEU A CB   1 
ATOM   8604  C  CG   . LEU A  1 600 ? 195.052 112.972 80.641  1.00 75.33  ? 792  LEU A CG   1 
ATOM   8605  C  CD1  . LEU A  1 600 ? 193.791 112.660 81.424  1.00 72.03  ? 792  LEU A CD1  1 
ATOM   8606  C  CD2  . LEU A  1 600 ? 196.066 113.685 81.524  1.00 83.01  ? 792  LEU A CD2  1 
ATOM   8607  H  H    . LEU A  1 600 ? 196.146 112.887 77.818  1.00 93.87  ? 792  LEU A H    1 
ATOM   8608  H  HA   . LEU A  1 600 ? 197.664 112.056 79.910  1.00 91.41  ? 792  LEU A HA   1 
ATOM   8609  H  HB2  . LEU A  1 600 ? 194.984 111.315 79.449  1.00 91.44  ? 792  LEU A HB2  1 
ATOM   8610  H  HB3  . LEU A  1 600 ? 195.801 111.078 80.785  1.00 91.44  ? 792  LEU A HB3  1 
ATOM   8611  H  HG   . LEU A  1 600 ? 194.812 113.572 79.917  1.00 90.15  ? 792  LEU A HG   1 
ATOM   8612  H  HD11 . LEU A  1 600 ? 193.434 113.485 81.789  1.00 86.19  ? 792  LEU A HD11 1 
ATOM   8613  H  HD12 . LEU A  1 600 ? 193.143 112.252 80.829  1.00 86.19  ? 792  LEU A HD12 1 
ATOM   8614  H  HD13 . LEU A  1 600 ? 194.011 112.048 82.144  1.00 86.19  ? 792  LEU A HD13 1 
ATOM   8615  H  HD21 . LEU A  1 600 ? 195.661 114.490 81.883  1.00 99.36  ? 792  LEU A HD21 1 
ATOM   8616  H  HD22 . LEU A  1 600 ? 196.325 113.094 82.248  1.00 99.36  ? 792  LEU A HD22 1 
ATOM   8617  H  HD23 . LEU A  1 600 ? 196.843 113.915 80.990  1.00 99.36  ? 792  LEU A HD23 1 
ATOM   8618  N  N    . ALA A  1 601 ? 198.470 110.009 78.851  1.00 74.62  ? 793  ALA A N    1 
ATOM   8619  C  CA   . ALA A  1 601 ? 198.984 108.826 78.170  1.00 73.93  ? 793  ALA A CA   1 
ATOM   8620  C  C    . ALA A  1 601 ? 198.932 107.655 79.142  1.00 73.83  ? 793  ALA A C    1 
ATOM   8621  O  O    . ALA A  1 601 ? 199.661 107.637 80.140  1.00 77.86  ? 793  ALA A O    1 
ATOM   8622  C  CB   . ALA A  1 601 ? 200.405 109.064 77.664  1.00 79.18  ? 793  ALA A CB   1 
ATOM   8623  H  H    . ALA A  1 601 ? 198.988 110.297 79.474  1.00 89.29  ? 793  ALA A H    1 
ATOM   8624  H  HA   . ALA A  1 601 ? 198.419 108.619 77.409  1.00 88.47  ? 793  ALA A HA   1 
ATOM   8625  H  HB1  . ALA A  1 601 ? 200.720 108.263 77.217  1.00 94.76  ? 793  ALA A HB1  1 
ATOM   8626  H  HB2  . ALA A  1 601 ? 200.398 109.809 77.042  1.00 94.76  ? 793  ALA A HB2  1 
ATOM   8627  H  HB3  . ALA A  1 601 ? 200.979 109.269 78.419  1.00 94.76  ? 793  ALA A HB3  1 
ATOM   8628  N  N    . ALA A  1 602 ? 198.076 106.678 78.849  1.00 67.40  ? 794  ALA A N    1 
ATOM   8629  C  CA   . ALA A  1 602 ? 197.864 105.539 79.733  1.00 67.40  ? 794  ALA A CA   1 
ATOM   8630  C  C    . ALA A  1 602 ? 198.834 104.421 79.370  1.00 68.22  ? 794  ALA A C    1 
ATOM   8631  O  O    . ALA A  1 602 ? 198.766 103.865 78.268  1.00 65.72  ? 794  ALA A O    1 
ATOM   8632  C  CB   . ALA A  1 602 ? 196.423 105.041 79.635  1.00 63.76  ? 794  ALA A CB   1 
ATOM   8633  H  H    . ALA A  1 602 ? 197.600 106.654 78.133  1.00 80.63  ? 794  ALA A H    1 
ATOM   8634  H  HA   . ALA A  1 602 ? 198.033 105.806 80.650  1.00 80.63  ? 794  ALA A HA   1 
ATOM   8635  H  HB1  . ALA A  1 602 ? 196.310 104.284 80.231  1.00 76.26  ? 794  ALA A HB1  1 
ATOM   8636  H  HB2  . ALA A  1 602 ? 195.823 105.758 79.892  1.00 76.26  ? 794  ALA A HB2  1 
ATOM   8637  H  HB3  . ALA A  1 602 ? 196.244 104.771 78.720  1.00 76.26  ? 794  ALA A HB3  1 
ATOM   8638  N  N    . GLY A  1 603 ? 199.733 104.094 80.295  1.00 72.12  ? 795  GLY A N    1 
ATOM   8639  C  CA   . GLY A  1 603 ? 200.638 102.972 80.113  1.00 74.35  ? 795  GLY A CA   1 
ATOM   8640  C  C    . GLY A  1 603 ? 200.088 101.701 80.743  1.00 73.84  ? 795  GLY A C    1 
ATOM   8641  O  O    . GLY A  1 603 ? 199.439 101.738 81.786  1.00 77.87  ? 795  GLY A O    1 
ATOM   8642  H  H    . GLY A  1 603 ? 199.836 104.512 81.040  1.00 86.30  ? 795  GLY A H    1 
ATOM   8643  H  HA2  . GLY A  1 603 ? 200.776 102.815 79.166  1.00 88.97  ? 795  GLY A HA2  1 
ATOM   8644  H  HA3  . GLY A  1 603 ? 201.495 103.175 80.522  1.00 88.97  ? 795  GLY A HA3  1 
ATOM   8645  N  N    . ALA A  1 604 ? 200.368 100.576 80.094  1.00 69.46  ? 796  ALA A N    1 
ATOM   8646  C  CA   . ALA A  1 604 ? 199.981 99.252  80.573  1.00 66.32  ? 796  ALA A CA   1 
ATOM   8647  C  C    . ALA A  1 604 ? 201.243 98.572  81.092  1.00 66.79  ? 796  ALA A C    1 
ATOM   8648  O  O    . ALA A  1 604 ? 201.995 97.968  80.323  1.00 70.11  ? 796  ALA A O    1 
ATOM   8649  C  CB   . ALA A  1 604 ? 199.323 98.436  79.465  1.00 65.32  ? 796  ALA A CB   1 
ATOM   8650  H  H    . ALA A  1 604 ? 200.795 100.553 79.347  1.00 83.10  ? 796  ALA A H    1 
ATOM   8651  H  HA   . ALA A  1 604 ? 199.353 99.341  81.306  1.00 79.34  ? 796  ALA A HA   1 
ATOM   8652  H  HB1  . ALA A  1 604 ? 199.079 97.565  79.816  1.00 78.13  ? 796  ALA A HB1  1 
ATOM   8653  H  HB2  . ALA A  1 604 ? 198.530 98.903  79.158  1.00 78.13  ? 796  ALA A HB2  1 
ATOM   8654  H  HB3  . ALA A  1 604 ? 199.951 98.334  78.732  1.00 78.13  ? 796  ALA A HB3  1 
ATOM   8655  N  N    . TYR A  1 605 ? 201.472 98.673  82.397  1.00 71.52  ? 797  TYR A N    1 
ATOM   8656  C  CA   . TYR A  1 605 ? 202.694 98.136  82.977  1.00 74.20  ? 797  TYR A CA   1 
ATOM   8657  C  C    . TYR A  1 605 ? 202.710 96.616  82.900  1.00 79.11  ? 797  TYR A C    1 
ATOM   8658  O  O    . TYR A  1 605 ? 201.703 95.949  83.153  1.00 81.22  ? 797  TYR A O    1 
ATOM   8659  C  CB   . TYR A  1 605 ? 202.843 98.581  84.432  1.00 75.95  ? 797  TYR A CB   1 
ATOM   8660  C  CG   . TYR A  1 605 ? 204.041 97.965  85.121  1.00 82.12  ? 797  TYR A CG   1 
ATOM   8661  C  CD1  . TYR A  1 605 ? 205.317 98.472  84.916  1.00 86.48  ? 797  TYR A CD1  1 
ATOM   8662  C  CD2  . TYR A  1 605 ? 203.898 96.877  85.974  1.00 83.87  ? 797  TYR A CD2  1 
ATOM   8663  C  CE1  . TYR A  1 605 ? 206.417 97.914  85.536  1.00 92.67  ? 797  TYR A CE1  1 
ATOM   8664  C  CE2  . TYR A  1 605 ? 204.996 96.312  86.601  1.00 87.40  ? 797  TYR A CE2  1 
ATOM   8665  C  CZ   . TYR A  1 605 ? 206.253 96.836  86.379  1.00 93.68  ? 797  TYR A CZ   1 
ATOM   8666  O  OH   . TYR A  1 605 ? 207.351 96.283  86.999  1.00 96.59  ? 797  TYR A OH   1 
ATOM   8667  H  H    . TYR A  1 605 ? 200.941 99.044  82.963  1.00 85.58  ? 797  TYR A H    1 
ATOM   8668  H  HA   . TYR A  1 605 ? 203.456 98.472  82.479  1.00 88.79  ? 797  TYR A HA   1 
ATOM   8669  H  HB2  . TYR A  1 605 ? 202.947 99.546  84.457  1.00 90.89  ? 797  TYR A HB2  1 
ATOM   8670  H  HB3  . TYR A  1 605 ? 202.049 98.321  84.924  1.00 90.89  ? 797  TYR A HB3  1 
ATOM   8671  H  HD1  . TYR A  1 605 ? 205.433 99.199  84.347  1.00 103.53 ? 797  TYR A HD1  1 
ATOM   8672  H  HD2  . TYR A  1 605 ? 203.052 96.522  86.124  1.00 100.40 ? 797  TYR A HD2  1 
ATOM   8673  H  HE1  . TYR A  1 605 ? 207.266 98.266  85.389  1.00 110.95 ? 797  TYR A HE1  1 
ATOM   8674  H  HE2  . TYR A  1 605 ? 204.886 95.584  87.170  1.00 104.63 ? 797  TYR A HE2  1 
ATOM   8675  H  HH   . TYR A  1 605 ? 207.114 95.637  87.481  1.00 115.66 ? 797  TYR A HH   1 
ATOM   8676  N  N    . SER A  1 606 ? 203.873 96.074  82.543  1.00 98.55  ? 798  SER A N    1 
ATOM   8677  C  CA   . SER A  1 606 ? 204.116 94.649  82.528  1.00 101.84 ? 798  SER A CA   1 
ATOM   8678  C  C    . SER A  1 606 ? 205.558 94.507  83.003  1.00 103.73 ? 798  SER A C    1 
ATOM   8679  O  O    . SER A  1 606 ? 206.452 95.183  82.464  1.00 106.00 ? 798  SER A O    1 
ATOM   8680  C  CB   . SER A  1 606 ? 203.930 94.019  81.145  1.00 104.08 ? 798  SER A CB   1 
ATOM   8681  O  OG   . SER A  1 606 ? 204.116 92.615  81.194  1.00 106.62 ? 798  SER A OG   1 
ATOM   8682  H  H    . SER A  1 606 ? 204.556 96.536  82.298  1.00 118.01 ? 798  SER A H    1 
ATOM   8683  H  HA   . SER A  1 606 ? 203.529 94.205  83.160  1.00 121.96 ? 798  SER A HA   1 
ATOM   8684  H  HB2  . SER A  1 606 ? 203.031 94.207  80.832  1.00 124.65 ? 798  SER A HB2  1 
ATOM   8685  H  HB3  . SER A  1 606 ? 204.579 94.402  80.535  1.00 124.65 ? 798  SER A HB3  1 
ATOM   8686  H  HG   . SER A  1 606 ? 204.011 92.284  80.429  1.00 127.69 ? 798  SER A HG   1 
ATOM   8687  N  N    . PRO A  1 607 ? 205.825 93.661  83.993  1.00 97.15  ? 799  PRO A N    1 
ATOM   8688  C  CA   . PRO A  1 607 ? 207.189 93.551  84.518  1.00 103.18 ? 799  PRO A CA   1 
ATOM   8689  C  C    . PRO A  1 607 ? 208.146 92.938  83.509  1.00 109.11 ? 799  PRO A C    1 
ATOM   8690  O  O    . PRO A  1 607 ? 207.755 92.237  82.572  1.00 104.01 ? 799  PRO A O    1 
ATOM   8691  C  CB   . PRO A  1 607 ? 207.030 92.651  85.748  1.00 99.92  ? 799  PRO A CB   1 
ATOM   8692  C  CG   . PRO A  1 607 ? 205.811 91.854  85.478  1.00 96.82  ? 799  PRO A CG   1 
ATOM   8693  C  CD   . PRO A  1 607 ? 204.899 92.743  84.682  1.00 94.10  ? 799  PRO A CD   1 
ATOM   8694  H  HA   . PRO A  1 607 ? 207.519 94.421  84.793  1.00 123.57 ? 799  PRO A HA   1 
ATOM   8695  H  HB2  . PRO A  1 607 ? 207.805 92.075  85.836  1.00 119.66 ? 799  PRO A HB2  1 
ATOM   8696  H  HB3  . PRO A  1 607 ? 206.915 93.197  86.542  1.00 119.66 ? 799  PRO A HB3  1 
ATOM   8697  H  HG2  . PRO A  1 607 ? 206.047 91.064  84.966  1.00 115.94 ? 799  PRO A HG2  1 
ATOM   8698  H  HG3  . PRO A  1 607 ? 205.394 91.604  86.317  1.00 115.94 ? 799  PRO A HG3  1 
ATOM   8699  H  HD2  . PRO A  1 607 ? 204.398 92.221  84.036  1.00 112.67 ? 799  PRO A HD2  1 
ATOM   8700  H  HD3  . PRO A  1 607 ? 204.310 93.238  85.273  1.00 112.67 ? 799  PRO A HD3  1 
ATOM   8701  N  N    . GLN A  1 608 ? 209.428 93.223  83.718  1.00 139.67 ? 800  GLN A N    1 
ATOM   8702  C  CA   . GLN A  1 608 ? 210.487 92.639  82.910  1.00 146.78 ? 800  GLN A CA   1 
ATOM   8703  C  C    . GLN A  1 608 ? 210.333 92.969  81.430  1.00 147.15 ? 800  GLN A C    1 
ATOM   8704  O  O    . GLN A  1 608 ? 211.266 92.792  80.646  1.00 149.00 ? 800  GLN A O    1 
ATOM   8705  C  CB   . GLN A  1 608 ? 210.430 91.128  83.098  1.00 149.67 ? 800  GLN A CB   1 
ATOM   8706  C  CG   . GLN A  1 608 ? 210.509 90.717  84.558  1.00 153.18 ? 800  GLN A CG   1 
ATOM   8707  C  CD   . GLN A  1 608 ? 209.744 89.440  84.827  1.00 154.70 ? 800  GLN A CD   1 
ATOM   8708  O  OE1  . GLN A  1 608 ? 209.282 88.771  83.903  1.00 153.88 ? 800  GLN A OE1  1 
ATOM   8709  N  NE2  . GLN A  1 608 ? 209.512 89.155  86.101  1.00 155.81 ? 800  GLN A NE2  1 
ATOM   8710  H  H    . GLN A  1 608 ? 209.710 93.758  84.329  1.00 167.35 ? 800  GLN A H    1 
ATOM   8711  H  HA   . GLN A  1 608 ? 211.350 92.961  83.215  1.00 175.88 ? 800  GLN A HA   1 
ATOM   8712  H  HB2  . GLN A  1 608 ? 209.593 90.796  82.737  1.00 179.36 ? 800  GLN A HB2  1 
ATOM   8713  H  HB3  . GLN A  1 608 ? 211.177 90.722  82.631  1.00 179.36 ? 800  GLN A HB3  1 
ATOM   8714  H  HG2  . GLN A  1 608 ? 211.437 90.570  84.798  1.00 183.57 ? 800  GLN A HG2  1 
ATOM   8715  H  HG3  . GLN A  1 608 ? 210.128 91.420  85.107  1.00 183.57 ? 800  GLN A HG3  1 
ATOM   8716  H  HE21 . GLN A  1 608 ? 209.835 89.657  86.720  1.00 186.72 ? 800  GLN A HE21 1 
ATOM   8717  H  HE22 . GLN A  1 608 ? 209.073 88.445  86.310  1.00 186.72 ? 800  GLN A HE22 1 
ATOM   8718  N  N    . GLY B  1 17  ? 142.297 71.252  137.563 1.00 133.18 ? 209  GLY B N    1 
ATOM   8719  C  CA   . GLY B  1 17  ? 140.864 71.478  137.633 1.00 133.65 ? 209  GLY B CA   1 
ATOM   8720  C  C    . GLY B  1 17  ? 140.067 70.476  136.821 1.00 135.91 ? 209  GLY B C    1 
ATOM   8721  O  O    . GLY B  1 17  ? 140.547 69.950  135.816 1.00 139.88 ? 209  GLY B O    1 
ATOM   8722  H  HA2  . GLY B  1 17  ? 140.575 71.422  138.558 1.00 160.13 ? 209  GLY B HA2  1 
ATOM   8723  H  HA3  . GLY B  1 17  ? 140.663 72.368  137.303 1.00 160.13 ? 209  GLY B HA3  1 
ATOM   8724  N  N    . ASP B  1 18  ? 138.842 70.212  137.264 1.00 121.57 ? 210  ASP B N    1 
ATOM   8725  C  CA   . ASP B  1 18  ? 137.999 69.206  136.628 1.00 119.79 ? 210  ASP B CA   1 
ATOM   8726  C  C    . ASP B  1 18  ? 137.413 69.763  135.333 1.00 117.30 ? 210  ASP B C    1 
ATOM   8727  O  O    . ASP B  1 18  ? 136.670 70.750  135.380 1.00 116.54 ? 210  ASP B O    1 
ATOM   8728  C  CB   . ASP B  1 18  ? 136.886 68.784  137.579 1.00 119.71 ? 210  ASP B CB   1 
ATOM   8729  C  CG   . ASP B  1 18  ? 136.034 67.655  137.026 1.00 118.26 ? 210  ASP B CG   1 
ATOM   8730  O  OD1  . ASP B  1 18  ? 136.261 67.238  135.871 1.00 115.97 ? 210  ASP B OD1  1 
ATOM   8731  O  OD2  . ASP B  1 18  ? 135.140 67.178  137.756 1.00 119.12 ? 210  ASP B OD2  1 
ATOM   8732  H  H    . ASP B  1 18  ? 138.473 70.605  137.934 1.00 145.63 ? 210  ASP B H    1 
ATOM   8733  H  HA   . ASP B  1 18  ? 138.533 68.425  136.413 1.00 143.50 ? 210  ASP B HA   1 
ATOM   8734  H  HB2  . ASP B  1 18  ? 137.280 68.481  138.412 1.00 143.40 ? 210  ASP B HB2  1 
ATOM   8735  H  HB3  . ASP B  1 18  ? 136.306 69.544  137.743 1.00 143.40 ? 210  ASP B HB3  1 
ATOM   8736  N  N    . PRO B  1 19  ? 137.706 69.171  134.169 1.00 122.57 ? 211  PRO B N    1 
ATOM   8737  C  CA   . PRO B  1 19  ? 137.204 69.760  132.912 1.00 117.78 ? 211  PRO B CA   1 
ATOM   8738  C  C    . PRO B  1 19  ? 135.689 69.789  132.804 1.00 118.13 ? 211  PRO B C    1 
ATOM   8739  O  O    . PRO B  1 19  ? 135.147 70.690  132.151 1.00 113.17 ? 211  PRO B O    1 
ATOM   8740  C  CB   . PRO B  1 19  ? 137.827 68.868  131.826 1.00 118.28 ? 211  PRO B CB   1 
ATOM   8741  C  CG   . PRO B  1 19  ? 138.308 67.644  132.523 1.00 121.02 ? 211  PRO B CG   1 
ATOM   8742  C  CD   . PRO B  1 19  ? 138.599 68.024  133.931 1.00 121.99 ? 211  PRO B CD   1 
ATOM   8743  H  HA   . PRO B  1 19  ? 137.544 70.663  132.811 1.00 141.09 ? 211  PRO B HA   1 
ATOM   8744  H  HB2  . PRO B  1 19  ? 137.152 68.642  131.167 1.00 141.68 ? 211  PRO B HB2  1 
ATOM   8745  H  HB3  . PRO B  1 19  ? 138.567 69.336  131.409 1.00 141.68 ? 211  PRO B HB3  1 
ATOM   8746  H  HG2  . PRO B  1 19  ? 137.616 66.965  132.494 1.00 144.98 ? 211  PRO B HG2  1 
ATOM   8747  H  HG3  . PRO B  1 19  ? 139.113 67.323  132.088 1.00 144.98 ? 211  PRO B HG3  1 
ATOM   8748  H  HD2  . PRO B  1 19  ? 138.379 67.294  134.530 1.00 146.14 ? 211  PRO B HD2  1 
ATOM   8749  H  HD3  . PRO B  1 19  ? 139.526 68.293  134.024 1.00 146.14 ? 211  PRO B HD3  1 
ATOM   8750  N  N    . THR B  1 20  ? 134.983 68.833  133.412 1.00 115.38 ? 212  THR B N    1 
ATOM   8751  C  CA   . THR B  1 20  ? 133.526 68.866  133.404 1.00 116.06 ? 212  THR B CA   1 
ATOM   8752  C  C    . THR B  1 20  ? 132.972 69.983  134.278 1.00 114.36 ? 212  THR B C    1 
ATOM   8753  O  O    . THR B  1 20  ? 131.781 70.296  134.178 1.00 113.56 ? 212  THR B O    1 
ATOM   8754  C  CB   . THR B  1 20  ? 132.948 67.523  133.860 1.00 119.25 ? 212  THR B CB   1 
ATOM   8755  O  OG1  . THR B  1 20  ? 133.412 67.210  135.177 1.00 122.60 ? 212  THR B OG1  1 
ATOM   8756  C  CG2  . THR B  1 20  ? 133.348 66.412  132.898 1.00 119.02 ? 212  THR B CG2  1 
ATOM   8757  H  H    . THR B  1 20  ? 135.323 68.163  133.831 1.00 138.21 ? 212  THR B H    1 
ATOM   8758  H  HA   . THR B  1 20  ? 133.225 69.024  132.496 1.00 139.02 ? 212  THR B HA   1 
ATOM   8759  H  HB   . THR B  1 20  ? 131.979 67.580  133.869 1.00 142.86 ? 212  THR B HB   1 
ATOM   8760  H  HG1  . THR B  1 20  ? 133.095 66.474  135.426 1.00 146.87 ? 212  THR B HG1  1 
ATOM   8761  H  HG21 . THR B  1 20  ? 132.977 65.566  133.196 1.00 142.57 ? 212  THR B HG21 1 
ATOM   8762  H  HG22 . THR B  1 20  ? 133.015 66.607  132.009 1.00 142.57 ? 212  THR B HG22 1 
ATOM   8763  H  HG23 . THR B  1 20  ? 134.315 66.336  132.863 1.00 142.57 ? 212  THR B HG23 1 
ATOM   8764  N  N    . MET B  1 21  ? 133.805 70.585  135.129 1.00 114.54 ? 213  MET B N    1 
ATOM   8765  C  CA   . MET B  1 21  ? 133.384 71.627  136.053 1.00 115.05 ? 213  MET B CA   1 
ATOM   8766  C  C    . MET B  1 21  ? 133.694 73.027  135.535 1.00 110.45 ? 213  MET B C    1 
ATOM   8767  O  O    . MET B  1 21  ? 133.463 74.005  136.253 1.00 110.75 ? 213  MET B O    1 
ATOM   8768  C  CB   . MET B  1 21  ? 134.085 71.425  137.394 1.00 118.31 ? 213  MET B CB   1 
ATOM   8769  C  CG   . MET B  1 21  ? 133.652 70.180  138.151 1.00 122.60 ? 213  MET B CG   1 
ATOM   8770  S  SD   . MET B  1 21  ? 131.925 70.208  138.658 1.00 128.35 ? 213  MET B SD   1 
ATOM   8771  C  CE   . MET B  1 21  ? 131.972 71.510  139.885 1.00 126.98 ? 213  MET B CE   1 
ATOM   8772  H  H    . MET B  1 21  ? 134.643 70.398  135.187 1.00 137.19 ? 213  MET B H    1 
ATOM   8773  H  HA   . MET B  1 21  ? 132.429 71.549  136.199 1.00 137.82 ? 213  MET B HA   1 
ATOM   8774  H  HB2  . MET B  1 21  ? 135.040 71.357  137.238 1.00 141.73 ? 213  MET B HB2  1 
ATOM   8775  H  HB3  . MET B  1 21  ? 133.900 72.192  137.958 1.00 141.73 ? 213  MET B HB3  1 
ATOM   8776  H  HG2  . MET B  1 21  ? 133.782 69.406  137.582 1.00 146.87 ? 213  MET B HG2  1 
ATOM   8777  H  HG3  . MET B  1 21  ? 134.195 70.096  138.951 1.00 146.87 ? 213  MET B HG3  1 
ATOM   8778  H  HE1  . MET B  1 21  ? 131.081 71.632  140.249 1.00 152.12 ? 213  MET B HE1  1 
ATOM   8779  H  HE2  . MET B  1 21  ? 132.586 71.256  140.591 1.00 152.12 ? 213  MET B HE2  1 
ATOM   8780  H  HE3  . MET B  1 21  ? 132.272 72.330  139.463 1.00 152.12 ? 213  MET B HE3  1 
ATOM   8781  N  N    . TYR B  1 22  ? 134.203 73.149  134.308 1.00 104.73 ? 214  TYR B N    1 
ATOM   8782  C  CA   . TYR B  1 22  ? 134.640 74.454  133.817 1.00 100.78 ? 214  TYR B CA   1 
ATOM   8783  C  C    . TYR B  1 22  ? 133.466 75.406  133.612 1.00 99.75  ? 214  TYR B C    1 
ATOM   8784  O  O    . TYR B  1 22  ? 133.593 76.612  133.854 1.00 97.88  ? 214  TYR B O    1 
ATOM   8785  C  CB   . TYR B  1 22  ? 135.444 74.280  132.531 1.00 101.58 ? 214  TYR B CB   1 
ATOM   8786  C  CG   . TYR B  1 22  ? 136.935 74.223  132.778 1.00 101.36 ? 214  TYR B CG   1 
ATOM   8787  C  CD1  . TYR B  1 22  ? 137.454 73.426  133.789 1.00 104.91 ? 214  TYR B CD1  1 
ATOM   8788  C  CD2  . TYR B  1 22  ? 137.822 74.964  132.008 1.00 97.05  ? 214  TYR B CD2  1 
ATOM   8789  C  CE1  . TYR B  1 22  ? 138.813 73.367  134.030 1.00 103.61 ? 214  TYR B CE1  1 
ATOM   8790  C  CE2  . TYR B  1 22  ? 139.185 74.911  132.241 1.00 98.64  ? 214  TYR B CE2  1 
ATOM   8791  C  CZ   . TYR B  1 22  ? 139.674 74.110  133.252 1.00 101.70 ? 214  TYR B CZ   1 
ATOM   8792  O  OH   . TYR B  1 22  ? 141.029 74.053  133.488 1.00 103.92 ? 214  TYR B OH   1 
ATOM   8793  H  H    . TYR B  1 22  ? 134.304 72.503  133.749 1.00 125.43 ? 214  TYR B H    1 
ATOM   8794  H  HA   . TYR B  1 22  ? 135.228 74.852  134.479 1.00 120.69 ? 214  TYR B HA   1 
ATOM   8795  H  HB2  . TYR B  1 22  ? 135.180 73.451  132.102 1.00 121.64 ? 214  TYR B HB2  1 
ATOM   8796  H  HB3  . TYR B  1 22  ? 135.266 75.030  131.942 1.00 121.64 ? 214  TYR B HB3  1 
ATOM   8797  H  HD1  . TYR B  1 22  ? 136.876 72.924  134.316 1.00 125.65 ? 214  TYR B HD1  1 
ATOM   8798  H  HD2  . TYR B  1 22  ? 137.494 75.505  131.326 1.00 116.21 ? 214  TYR B HD2  1 
ATOM   8799  H  HE1  . TYR B  1 22  ? 139.144 72.827  134.711 1.00 124.09 ? 214  TYR B HE1  1 
ATOM   8800  H  HE2  . TYR B  1 22  ? 139.769 75.412  131.718 1.00 118.12 ? 214  TYR B HE2  1 
ATOM   8801  H  HH   . TYR B  1 22  ? 141.188 73.532  134.128 1.00 124.46 ? 214  TYR B HH   1 
ATOM   8802  N  N    . GLU B  1 23  ? 132.315 74.893  133.172 1.00 101.07 ? 215  GLU B N    1 
ATOM   8803  C  CA   . GLU B  1 23  ? 131.140 75.752  133.046 1.00 101.47 ? 215  GLU B CA   1 
ATOM   8804  C  C    . GLU B  1 23  ? 130.681 76.251  134.410 1.00 105.55 ? 215  GLU B C    1 
ATOM   8805  O  O    . GLU B  1 23  ? 130.216 77.390  134.536 1.00 104.22 ? 215  GLU B O    1 
ATOM   8806  C  CB   . GLU B  1 23  ? 130.006 75.019  132.327 1.00 101.67 ? 215  GLU B CB   1 
ATOM   8807  C  CG   . GLU B  1 23  ? 130.366 74.537  130.929 1.00 100.88 ? 215  GLU B CG   1 
ATOM   8808  C  CD   . GLU B  1 23  ? 129.153 74.086  130.135 1.00 102.31 ? 215  GLU B CD   1 
ATOM   8809  O  OE1  . GLU B  1 23  ? 128.024 74.176  130.665 1.00 103.96 ? 215  GLU B OE1  1 
ATOM   8810  O  OE2  . GLU B  1 23  ? 129.330 73.649  128.977 1.00 99.95  ? 215  GLU B OE2  1 
ATOM   8811  H  H    . GLU B  1 23  ? 132.190 74.072  132.946 1.00 121.04 ? 215  GLU B H    1 
ATOM   8812  H  HA   . GLU B  1 23  ? 131.377 76.526  132.512 1.00 121.51 ? 215  GLU B HA   1 
ATOM   8813  H  HB2  . GLU B  1 23  ? 129.754 74.244  132.852 1.00 121.76 ? 215  GLU B HB2  1 
ATOM   8814  H  HB3  . GLU B  1 23  ? 129.249 75.621  132.247 1.00 121.76 ? 215  GLU B HB3  1 
ATOM   8815  H  HG2  . GLU B  1 23  ? 130.790 75.262  130.444 1.00 120.80 ? 215  GLU B HG2  1 
ATOM   8816  H  HG3  . GLU B  1 23  ? 130.974 73.785  131.001 1.00 120.80 ? 215  GLU B HG3  1 
ATOM   8817  N  N    . GLU B  1 24  ? 130.800 75.414  135.442 1.00 120.79 ? 216  GLU B N    1 
ATOM   8818  C  CA   . GLU B  1 24  ? 130.387 75.835  136.776 1.00 125.95 ? 216  GLU B CA   1 
ATOM   8819  C  C    . GLU B  1 24  ? 131.328 76.896  137.334 1.00 122.37 ? 216  GLU B C    1 
ATOM   8820  O  O    . GLU B  1 24  ? 130.875 77.871  137.944 1.00 125.71 ? 216  GLU B O    1 
ATOM   8821  C  CB   . GLU B  1 24  ? 130.317 74.629  137.714 1.00 133.83 ? 216  GLU B CB   1 
ATOM   8822  C  CG   . GLU B  1 24  ? 129.141 73.689  137.458 1.00 141.47 ? 216  GLU B CG   1 
ATOM   8823  C  CD   . GLU B  1 24  ? 129.316 72.832  136.220 1.00 145.27 ? 216  GLU B CD   1 
ATOM   8824  O  OE1  . GLU B  1 24  ? 130.288 73.056  135.467 1.00 145.74 ? 216  GLU B OE1  1 
ATOM   8825  O  OE2  . GLU B  1 24  ? 128.478 71.931  136.001 1.00 148.41 ? 216  GLU B OE2  1 
ATOM   8826  H  H    . GLU B  1 24  ? 131.111 74.614  135.396 1.00 144.70 ? 216  GLU B H    1 
ATOM   8827  H  HA   . GLU B  1 24  ? 129.499 76.222  136.722 1.00 150.89 ? 216  GLU B HA   1 
ATOM   8828  H  HB2  . GLU B  1 24  ? 131.132 74.113  137.616 1.00 160.35 ? 216  GLU B HB2  1 
ATOM   8829  H  HB3  . GLU B  1 24  ? 130.243 74.951  138.626 1.00 160.35 ? 216  GLU B HB3  1 
ATOM   8830  H  HG2  . GLU B  1 24  ? 129.042 73.096  138.219 1.00 169.51 ? 216  GLU B HG2  1 
ATOM   8831  H  HG3  . GLU B  1 24  ? 128.336 74.218  137.344 1.00 169.51 ? 216  GLU B HG3  1 
ATOM   8832  N  N    . TYR B  1 25  ? 132.639 76.726  137.143 1.00 109.88 ? 217  TYR B N    1 
ATOM   8833  C  CA   . TYR B  1 25  ? 133.583 77.749  137.584 1.00 108.17 ? 217  TYR B CA   1 
ATOM   8834  C  C    . TYR B  1 25  ? 133.267 79.090  136.935 1.00 108.02 ? 217  TYR B C    1 
ATOM   8835  O  O    . TYR B  1 25  ? 133.249 80.132  137.601 1.00 107.97 ? 217  TYR B O    1 
ATOM   8836  C  CB   . TYR B  1 25  ? 135.017 77.345  137.241 1.00 108.41 ? 217  TYR B CB   1 
ATOM   8837  C  CG   . TYR B  1 25  ? 135.464 76.000  137.759 1.00 109.70 ? 217  TYR B CG   1 
ATOM   8838  C  CD1  . TYR B  1 25  ? 134.903 75.438  138.898 1.00 112.79 ? 217  TYR B CD1  1 
ATOM   8839  C  CD2  . TYR B  1 25  ? 136.461 75.292  137.103 1.00 109.56 ? 217  TYR B CD2  1 
ATOM   8840  C  CE1  . TYR B  1 25  ? 135.324 74.205  139.364 1.00 114.94 ? 217  TYR B CE1  1 
ATOM   8841  C  CE2  . TYR B  1 25  ? 136.887 74.066  137.559 1.00 110.67 ? 217  TYR B CE2  1 
ATOM   8842  C  CZ   . TYR B  1 25  ? 136.315 73.523  138.686 1.00 113.65 ? 217  TYR B CZ   1 
ATOM   8843  O  OH   . TYR B  1 25  ? 136.745 72.297  139.138 1.00 117.01 ? 217  TYR B OH   1 
ATOM   8844  H  H    . TYR B  1 25  ? 133.000 76.041  136.768 1.00 131.60 ? 217  TYR B H    1 
ATOM   8845  H  HA   . TYR B  1 25  ? 133.517 77.853  138.546 1.00 129.56 ? 217  TYR B HA   1 
ATOM   8846  H  HB2  . TYR B  1 25  ? 135.107 77.327  136.275 1.00 129.84 ? 217  TYR B HB2  1 
ATOM   8847  H  HB3  . TYR B  1 25  ? 135.619 78.011  137.608 1.00 129.84 ? 217  TYR B HB3  1 
ATOM   8848  H  HD1  . TYR B  1 25  ? 134.234 75.896  139.353 1.00 135.10 ? 217  TYR B HD1  1 
ATOM   8849  H  HD2  . TYR B  1 25  ? 136.849 75.654  136.339 1.00 131.22 ? 217  TYR B HD2  1 
ATOM   8850  H  HE1  . TYR B  1 25  ? 134.940 73.837  140.126 1.00 137.68 ? 217  TYR B HE1  1 
ATOM   8851  H  HE2  . TYR B  1 25  ? 137.555 73.604  137.105 1.00 132.55 ? 217  TYR B HE2  1 
ATOM   8852  H  HH   . TYR B  1 25  ? 136.323 72.082  139.832 1.00 140.16 ? 217  TYR B HH   1 
ATOM   8853  N  N    . TYR B  1 26  ? 133.014 79.078  135.624 1.00 100.61 ? 218  TYR B N    1 
ATOM   8854  C  CA   . TYR B  1 26  ? 132.766 80.317  134.895 1.00 95.34  ? 218  TYR B CA   1 
ATOM   8855  C  C    . TYR B  1 26  ? 131.453 80.955  135.330 1.00 98.30  ? 218  TYR B C    1 
ATOM   8856  O  O    . TYR B  1 26  ? 131.400 82.158  135.614 1.00 99.89  ? 218  TYR B O    1 
ATOM   8857  C  CB   . TYR B  1 26  ? 132.763 80.035  133.392 1.00 89.20  ? 218  TYR B CB   1 
ATOM   8858  C  CG   . TYR B  1 26  ? 132.869 81.269  132.526 1.00 83.58  ? 218  TYR B CG   1 
ATOM   8859  C  CD1  . TYR B  1 26  ? 134.105 81.732  132.094 1.00 82.04  ? 218  TYR B CD1  1 
ATOM   8860  C  CD2  . TYR B  1 26  ? 131.736 81.968  132.135 1.00 84.54  ? 218  TYR B CD2  1 
ATOM   8861  C  CE1  . TYR B  1 26  ? 134.210 82.858  131.300 1.00 78.77  ? 218  TYR B CE1  1 
ATOM   8862  C  CE2  . TYR B  1 26  ? 131.830 83.095  131.341 1.00 82.42  ? 218  TYR B CE2  1 
ATOM   8863  C  CZ   . TYR B  1 26  ? 133.070 83.535  130.926 1.00 79.58  ? 218  TYR B CZ   1 
ATOM   8864  O  OH   . TYR B  1 26  ? 133.168 84.658  130.136 1.00 77.75  ? 218  TYR B OH   1 
ATOM   8865  H  H    . TYR B  1 26  ? 132.982 78.369  135.139 1.00 120.48 ? 218  TYR B H    1 
ATOM   8866  H  HA   . TYR B  1 26  ? 133.481 80.944  135.083 1.00 114.16 ? 218  TYR B HA   1 
ATOM   8867  H  HB2  . TYR B  1 26  ? 133.518 79.462  133.182 1.00 106.79 ? 218  TYR B HB2  1 
ATOM   8868  H  HB3  . TYR B  1 26  ? 131.936 79.584  133.162 1.00 106.79 ? 218  TYR B HB3  1 
ATOM   8869  H  HD1  . TYR B  1 26  ? 134.877 81.277  132.345 1.00 98.21  ? 218  TYR B HD1  1 
ATOM   8870  H  HD2  . TYR B  1 26  ? 130.899 81.673  132.413 1.00 101.20 ? 218  TYR B HD2  1 
ATOM   8871  H  HE1  . TYR B  1 26  ? 135.045 83.156  131.019 1.00 94.27  ? 218  TYR B HE1  1 
ATOM   8872  H  HE2  . TYR B  1 26  ? 131.062 83.554  131.087 1.00 98.66  ? 218  TYR B HE2  1 
ATOM   8873  H  HH   . TYR B  1 26  ? 133.974 84.814  129.958 1.00 93.06  ? 218  TYR B HH   1 
ATOM   8874  N  N    . SER B  1 27  ? 130.378 80.164  135.391 1.00 100.34 ? 219  SER B N    1 
ATOM   8875  C  CA   . SER B  1 27  ? 129.098 80.694  135.850 1.00 99.17  ? 219  SER B CA   1 
ATOM   8876  C  C    . SER B  1 27  ? 129.205 81.261  137.258 1.00 102.42 ? 219  SER B C    1 
ATOM   8877  O  O    . SER B  1 27  ? 128.522 82.238  137.587 1.00 101.64 ? 219  SER B O    1 
ATOM   8878  C  CB   . SER B  1 27  ? 128.023 79.607  135.801 1.00 96.57  ? 219  SER B CB   1 
ATOM   8879  O  OG   . SER B  1 27  ? 127.562 79.398  134.478 1.00 94.87  ? 219  SER B OG   1 
ATOM   8880  H  H    . SER B  1 27  ? 130.365 79.331  135.176 1.00 120.16 ? 219  SER B H    1 
ATOM   8881  H  HA   . SER B  1 27  ? 128.824 81.412  135.258 1.00 118.76 ? 219  SER B HA   1 
ATOM   8882  H  HB2  . SER B  1 27  ? 128.399 78.778  136.137 1.00 115.64 ? 219  SER B HB2  1 
ATOM   8883  H  HB3  . SER B  1 27  ? 127.275 79.879  136.355 1.00 115.64 ? 219  SER B HB3  1 
ATOM   8884  H  HG   . SER B  1 27  ? 128.200 79.160  133.986 1.00 113.59 ? 219  SER B HG   1 
ATOM   8885  N  N    . GLY B  1 28  ? 130.054 80.668  138.100 1.00 111.82 ? 220  GLY B N    1 
ATOM   8886  C  CA   . GLY B  1 28  ? 130.205 81.172  139.455 1.00 116.11 ? 220  GLY B CA   1 
ATOM   8887  C  C    . GLY B  1 28  ? 130.757 82.583  139.484 1.00 114.35 ? 220  GLY B C    1 
ATOM   8888  O  O    . GLY B  1 28  ? 130.249 83.449  140.200 1.00 115.38 ? 220  GLY B O    1 
ATOM   8889  H  H    . GLY B  1 28  ? 130.544 79.987  137.911 1.00 133.94 ? 220  GLY B H    1 
ATOM   8890  H  HA2  . GLY B  1 28  ? 129.342 81.169  139.899 1.00 139.08 ? 220  GLY B HA2  1 
ATOM   8891  H  HA3  . GLY B  1 28  ? 130.808 80.594  139.950 1.00 139.08 ? 220  GLY B HA3  1 
ATOM   8892  N  N    . LEU B  1 29  ? 131.809 82.834  138.702 1.00 104.91 ? 221  LEU B N    1 
ATOM   8893  C  CA   . LEU B  1 29  ? 132.353 84.184  138.611 1.00 100.07 ? 221  LEU B CA   1 
ATOM   8894  C  C    . LEU B  1 29  ? 131.404 85.103  137.854 1.00 96.60  ? 221  LEU B C    1 
ATOM   8895  O  O    . LEU B  1 29  ? 131.274 86.286  138.190 1.00 97.06  ? 221  LEU B O    1 
ATOM   8896  C  CB   . LEU B  1 29  ? 133.725 84.157  137.939 1.00 98.31  ? 221  LEU B CB   1 
ATOM   8897  C  CG   . LEU B  1 29  ? 134.443 85.505  137.850 1.00 98.61  ? 221  LEU B CG   1 
ATOM   8898  C  CD1  . LEU B  1 29  ? 134.932 85.953  139.219 1.00 103.01 ? 221  LEU B CD1  1 
ATOM   8899  C  CD2  . LEU B  1 29  ? 135.600 85.416  136.872 1.00 95.33  ? 221  LEU B CD2  1 
ATOM   8900  H  H    . LEU B  1 29  ? 132.219 82.248  138.223 1.00 125.64 ? 221  LEU B H    1 
ATOM   8901  H  HA   . LEU B  1 29  ? 132.464 84.541  139.506 1.00 119.84 ? 221  LEU B HA   1 
ATOM   8902  H  HB2  . LEU B  1 29  ? 134.298 83.554  138.438 1.00 117.73 ? 221  LEU B HB2  1 
ATOM   8903  H  HB3  . LEU B  1 29  ? 133.616 83.825  137.034 1.00 117.73 ? 221  LEU B HB3  1 
ATOM   8904  H  HG   . LEU B  1 29  ? 133.822 86.173  137.520 1.00 118.09 ? 221  LEU B HG   1 
ATOM   8905  H  HD11 . LEU B  1 29  ? 135.381 86.807  139.130 1.00 123.37 ? 221  LEU B HD11 1 
ATOM   8906  H  HD12 . LEU B  1 29  ? 134.169 86.040  139.813 1.00 123.37 ? 221  LEU B HD12 1 
ATOM   8907  H  HD13 . LEU B  1 29  ? 135.548 85.289  139.567 1.00 123.37 ? 221  LEU B HD13 1 
ATOM   8908  H  HD21 . LEU B  1 29  ? 136.043 86.278  136.828 1.00 114.15 ? 221  LEU B HD21 1 
ATOM   8909  H  HD22 . LEU B  1 29  ? 136.222 84.739  137.181 1.00 114.15 ? 221  LEU B HD22 1 
ATOM   8910  H  HD23 . LEU B  1 29  ? 135.256 85.176  135.998 1.00 114.15 ? 221  LEU B HD23 1 
ATOM   8911  N  N    . LYS B  1 30  ? 130.738 84.578  136.824 1.00 91.06  ? 222  LYS B N    1 
ATOM   8912  C  CA   . LYS B  1 30  ? 129.794 85.385  136.059 1.00 94.19  ? 222  LYS B CA   1 
ATOM   8913  C  C    . LYS B  1 30  ? 128.699 85.937  136.963 1.00 98.38  ? 222  LYS B C    1 
ATOM   8914  O  O    . LYS B  1 30  ? 128.392 87.134  136.929 1.00 98.04  ? 222  LYS B O    1 
ATOM   8915  C  CB   . LYS B  1 30  ? 129.190 84.547  134.932 1.00 96.51  ? 222  LYS B CB   1 
ATOM   8916  C  CG   . LYS B  1 30  ? 128.267 85.316  134.003 1.00 98.64  ? 222  LYS B CG   1 
ATOM   8917  C  CD   . LYS B  1 30  ? 127.705 84.412  132.920 1.00 100.63 ? 222  LYS B CD   1 
ATOM   8918  C  CE   . LYS B  1 30  ? 126.624 85.113  132.114 1.00 103.12 ? 222  LYS B CE   1 
ATOM   8919  N  NZ   . LYS B  1 30  ? 125.778 84.146  131.363 1.00 107.17 ? 222  LYS B NZ   1 
ATOM   8920  H  H    . LYS B  1 30  ? 130.814 83.766  136.553 1.00 109.02 ? 222  LYS B H    1 
ATOM   8921  H  HA   . LYS B  1 30  ? 130.265 86.134  135.661 1.00 112.78 ? 222  LYS B HA   1 
ATOM   8922  H  HB2  . LYS B  1 30  ? 129.911 84.183  134.395 1.00 115.56 ? 222  LYS B HB2  1 
ATOM   8923  H  HB3  . LYS B  1 30  ? 128.677 83.823  135.324 1.00 115.56 ? 222  LYS B HB3  1 
ATOM   8924  H  HG2  . LYS B  1 30  ? 127.525 85.678  134.514 1.00 118.12 ? 222  LYS B HG2  1 
ATOM   8925  H  HG3  . LYS B  1 30  ? 128.763 86.032  133.577 1.00 118.12 ? 222  LYS B HG3  1 
ATOM   8926  H  HD2  . LYS B  1 30  ? 128.419 84.157  132.314 1.00 120.51 ? 222  LYS B HD2  1 
ATOM   8927  H  HD3  . LYS B  1 30  ? 127.316 83.624  133.330 1.00 120.51 ? 222  LYS B HD3  1 
ATOM   8928  H  HE2  . LYS B  1 30  ? 126.051 85.612  132.717 1.00 123.50 ? 222  LYS B HE2  1 
ATOM   8929  H  HE3  . LYS B  1 30  ? 127.040 85.712  131.475 1.00 123.50 ? 222  LYS B HE3  1 
ATOM   8930  H  HZ1  . LYS B  1 30  ? 125.155 84.582  130.901 1.00 128.36 ? 222  LYS B HZ1  1 
ATOM   8931  H  HZ2  . LYS B  1 30  ? 126.281 83.677  130.798 1.00 128.36 ? 222  LYS B HZ2  1 
ATOM   8932  H  HZ3  . LYS B  1 30  ? 125.380 83.586  131.929 1.00 128.36 ? 222  LYS B HZ3  1 
ATOM   8933  N  N    . HIS B  1 31  ? 128.109 85.074  137.791 1.00 106.15 ? 223  HIS B N    1 
ATOM   8934  C  CA   . HIS B  1 31  ? 127.043 85.506  138.688 1.00 106.18 ? 223  HIS B CA   1 
ATOM   8935  C  C    . HIS B  1 31  ? 127.525 86.622  139.608 1.00 106.60 ? 223  HIS B C    1 
ATOM   8936  O  O    . HIS B  1 31  ? 126.846 87.641  139.779 1.00 105.47 ? 223  HIS B O    1 
ATOM   8937  C  CB   . HIS B  1 31  ? 126.546 84.309  139.500 1.00 107.89 ? 223  HIS B CB   1 
ATOM   8938  C  CG   . HIS B  1 31  ? 125.442 84.637  140.454 1.00 115.94 ? 223  HIS B CG   1 
ATOM   8939  N  ND1  . HIS B  1 31  ? 124.120 84.697  140.069 1.00 115.43 ? 223  HIS B ND1  1 
ATOM   8940  C  CD2  . HIS B  1 31  ? 125.461 84.921  141.778 1.00 117.55 ? 223  HIS B CD2  1 
ATOM   8941  C  CE1  . HIS B  1 31  ? 123.372 85.001  141.114 1.00 120.55 ? 223  HIS B CE1  1 
ATOM   8942  N  NE2  . HIS B  1 31  ? 124.162 85.144  142.163 1.00 120.39 ? 223  HIS B NE2  1 
ATOM   8943  H  H    . HIS B  1 31  ? 128.307 84.239  137.850 1.00 127.13 ? 223  HIS B H    1 
ATOM   8944  H  HA   . HIS B  1 31  ? 126.301 85.845  138.163 1.00 127.17 ? 223  HIS B HA   1 
ATOM   8945  H  HB2  . HIS B  1 31  ? 126.217 83.632  138.888 1.00 129.22 ? 223  HIS B HB2  1 
ATOM   8946  H  HB3  . HIS B  1 31  ? 127.287 83.953  140.016 1.00 129.22 ? 223  HIS B HB3  1 
ATOM   8947  H  HD2  . HIS B  1 31  ? 126.213 84.958  142.324 1.00 140.81 ? 223  HIS B HD2  1 
ATOM   8948  H  HE1  . HIS B  1 31  ? 122.448 85.102  141.111 1.00 144.42 ? 223  HIS B HE1  1 
ATOM   8949  H  HE2  . HIS B  1 31  ? 123.904 85.345  142.959 1.00 144.22 ? 223  HIS B HE2  1 
ATOM   8950  N  N    . PHE B  1 32  ? 128.702 86.443  140.211 1.00 104.82 ? 224  PHE B N    1 
ATOM   8951  C  CA   . PHE B  1 32  ? 129.259 87.462  141.095 1.00 106.86 ? 224  PHE B CA   1 
ATOM   8952  C  C    . PHE B  1 32  ? 129.402 88.800  140.380 1.00 106.18 ? 224  PHE B C    1 
ATOM   8953  O  O    . PHE B  1 32  ? 128.993 89.844  140.901 1.00 108.91 ? 224  PHE B O    1 
ATOM   8954  C  CB   . PHE B  1 32  ? 130.611 86.990  141.631 1.00 105.40 ? 224  PHE B CB   1 
ATOM   8955  C  CG   . PHE B  1 32  ? 131.468 88.092  142.178 1.00 105.76 ? 224  PHE B CG   1 
ATOM   8956  C  CD1  . PHE B  1 32  ? 131.183 88.676  143.402 1.00 109.63 ? 224  PHE B CD1  1 
ATOM   8957  C  CD2  . PHE B  1 32  ? 132.569 88.540  141.467 1.00 105.94 ? 224  PHE B CD2  1 
ATOM   8958  C  CE1  . PHE B  1 32  ? 131.981 89.689  143.900 1.00 110.36 ? 224  PHE B CE1  1 
ATOM   8959  C  CE2  . PHE B  1 32  ? 133.367 89.549  141.961 1.00 106.41 ? 224  PHE B CE2  1 
ATOM   8960  C  CZ   . PHE B  1 32  ? 133.074 90.123  143.176 1.00 108.16 ? 224  PHE B CZ   1 
ATOM   8961  H  H    . PHE B  1 32  ? 129.194 85.743  140.123 1.00 125.54 ? 224  PHE B H    1 
ATOM   8962  H  HA   . PHE B  1 32  ? 128.663 87.587  141.850 1.00 127.98 ? 224  PHE B HA   1 
ATOM   8963  H  HB2  . PHE B  1 32  ? 130.458 86.351  142.345 1.00 126.24 ? 224  PHE B HB2  1 
ATOM   8964  H  HB3  . PHE B  1 32  ? 131.101 86.564  140.910 1.00 126.24 ? 224  PHE B HB3  1 
ATOM   8965  H  HD1  . PHE B  1 32  ? 130.447 88.385  143.891 1.00 131.31 ? 224  PHE B HD1  1 
ATOM   8966  H  HD2  . PHE B  1 32  ? 132.773 88.155  140.646 1.00 126.88 ? 224  PHE B HD2  1 
ATOM   8967  H  HE1  . PHE B  1 32  ? 131.782 90.077  144.722 1.00 132.18 ? 224  PHE B HE1  1 
ATOM   8968  H  HE2  . PHE B  1 32  ? 134.103 89.842  141.474 1.00 127.44 ? 224  PHE B HE2  1 
ATOM   8969  H  HZ   . PHE B  1 32  ? 133.612 90.805  143.510 1.00 129.55 ? 224  PHE B HZ   1 
ATOM   8970  N  N    . ILE B  1 33  ? 129.985 88.787  139.180 1.00 101.71 ? 225  ILE B N    1 
ATOM   8971  C  CA   . ILE B  1 33  ? 130.198 90.025  138.435 1.00 97.88  ? 225  ILE B CA   1 
ATOM   8972  C  C    . ILE B  1 33  ? 128.866 90.693  138.114 1.00 97.84  ? 225  ILE B C    1 
ATOM   8973  O  O    . ILE B  1 33  ? 128.682 91.894  138.344 1.00 97.84  ? 225  ILE B O    1 
ATOM   8974  C  CB   . ILE B  1 33  ? 131.020 89.745  137.164 1.00 92.59  ? 225  ILE B CB   1 
ATOM   8975  C  CG1  . ILE B  1 33  ? 132.453 89.379  137.559 1.00 92.67  ? 225  ILE B CG1  1 
ATOM   8976  C  CG2  . ILE B  1 33  ? 130.996 90.949  136.219 1.00 88.51  ? 225  ILE B CG2  1 
ATOM   8977  C  CD1  . ILE B  1 33  ? 133.306 88.874  136.418 1.00 91.28  ? 225  ILE B CD1  1 
ATOM   8978  H  H    . ILE B  1 33  ? 130.264 88.079  138.779 1.00 121.81 ? 225  ILE B H    1 
ATOM   8979  H  HA   . ILE B  1 33  ? 130.709 90.637  138.987 1.00 117.20 ? 225  ILE B HA   1 
ATOM   8980  H  HB   . ILE B  1 33  ? 130.626 88.987  136.705 1.00 110.85 ? 225  ILE B HB   1 
ATOM   8981  H  HG12 . ILE B  1 33  ? 132.886 90.168  137.923 1.00 110.96 ? 225  ILE B HG12 1 
ATOM   8982  H  HG13 . ILE B  1 33  ? 132.421 88.683  138.233 1.00 110.96 ? 225  ILE B HG13 1 
ATOM   8983  H  HG21 . ILE B  1 33  ? 131.521 90.742  135.431 1.00 105.96 ? 225  ILE B HG21 1 
ATOM   8984  H  HG22 . ILE B  1 33  ? 130.078 91.134  135.967 1.00 105.96 ? 225  ILE B HG22 1 
ATOM   8985  H  HG23 . ILE B  1 33  ? 131.374 91.716  136.677 1.00 105.96 ? 225  ILE B HG23 1 
ATOM   8986  H  HD11 . ILE B  1 33  ? 134.192 88.667  136.755 1.00 109.29 ? 225  ILE B HD11 1 
ATOM   8987  H  HD12 . ILE B  1 33  ? 132.897 88.076  136.049 1.00 109.29 ? 225  ILE B HD12 1 
ATOM   8988  H  HD13 . ILE B  1 33  ? 133.362 89.563  135.738 1.00 109.29 ? 225  ILE B HD13 1 
ATOM   8989  N  N    . GLU B  1 34  ? 127.920 89.928  137.569 1.00 102.49 ? 226  GLU B N    1 
ATOM   8990  C  CA   . GLU B  1 34  ? 126.653 90.512  137.147 1.00 106.16 ? 226  GLU B CA   1 
ATOM   8991  C  C    . GLU B  1 34  ? 125.828 91.016  138.324 1.00 109.39 ? 226  GLU B C    1 
ATOM   8992  O  O    . GLU B  1 34  ? 124.916 91.824  138.120 1.00 111.68 ? 226  GLU B O    1 
ATOM   8993  C  CB   . GLU B  1 34  ? 125.853 89.496  136.331 1.00 111.29 ? 226  GLU B CB   1 
ATOM   8994  C  CG   . GLU B  1 34  ? 126.559 89.071  135.053 1.00 113.67 ? 226  GLU B CG   1 
ATOM   8995  C  CD   . GLU B  1 34  ? 125.615 88.471  134.030 1.00 118.19 ? 226  GLU B CD   1 
ATOM   8996  O  OE1  . GLU B  1 34  ? 125.947 88.506  132.825 1.00 116.96 ? 226  GLU B OE1  1 
ATOM   8997  O  OE2  . GLU B  1 34  ? 124.538 87.978  134.427 1.00 121.63 ? 226  GLU B OE2  1 
ATOM   8998  H  H    . GLU B  1 34  ? 127.987 89.081  137.436 1.00 122.74 ? 226  GLU B H    1 
ATOM   8999  H  HA   . GLU B  1 34  ? 126.838 91.270  136.572 1.00 127.14 ? 226  GLU B HA   1 
ATOM   9000  H  HB2  . GLU B  1 34  ? 125.708 88.703  136.871 1.00 133.30 ? 226  GLU B HB2  1 
ATOM   9001  H  HB3  . GLU B  1 34  ? 125.002 89.891  136.086 1.00 133.30 ? 226  GLU B HB3  1 
ATOM   9002  H  HG2  . GLU B  1 34  ? 126.981 89.847  134.653 1.00 136.16 ? 226  GLU B HG2  1 
ATOM   9003  H  HG3  . GLU B  1 34  ? 127.229 88.404  135.270 1.00 136.16 ? 226  GLU B HG3  1 
ATOM   9004  N  N    . CYS B  1 35  ? 126.118 90.559  139.540 1.00 105.75 ? 227  CYS B N    1 
ATOM   9005  C  CA   . CYS B  1 35  ? 125.441 91.050  140.732 1.00 108.60 ? 227  CYS B CA   1 
ATOM   9006  C  C    . CYS B  1 35  ? 126.172 92.210  141.393 1.00 107.72 ? 227  CYS B C    1 
ATOM   9007  O  O    . CYS B  1 35  ? 125.663 92.766  142.370 1.00 113.70 ? 227  CYS B O    1 
ATOM   9008  C  CB   . CYS B  1 35  ? 125.268 89.916  141.746 1.00 112.12 ? 227  CYS B CB   1 
ATOM   9009  S  SG   . CYS B  1 35  ? 124.129 88.622  141.210 1.00 112.18 ? 227  CYS B SG   1 
ATOM   9010  H  H    . CYS B  1 35  ? 126.711 89.957  139.700 1.00 126.65 ? 227  CYS B H    1 
ATOM   9011  H  HA   . CYS B  1 35  ? 124.557 91.361  140.482 1.00 130.07 ? 227  CYS B HA   1 
ATOM   9012  H  HB2  . CYS B  1 35  ? 126.131 89.503  141.903 1.00 134.30 ? 227  CYS B HB2  1 
ATOM   9013  H  HB3  . CYS B  1 35  ? 124.925 90.287  142.574 1.00 134.30 ? 227  CYS B HB3  1 
ATOM   9014  H  HG   . CYS B  1 35  ? 124.541 88.136  140.193 1.00 134.37 ? 227  CYS B HG   1 
ATOM   9015  N  N    . SER B  1 36  ? 127.339 92.596  140.884 1.00 105.15 ? 228  SER B N    1 
ATOM   9016  C  CA   . SER B  1 36  ? 128.064 93.720  141.451 1.00 107.54 ? 228  SER B CA   1 
ATOM   9017  C  C    . SER B  1 36  ? 127.393 95.034  141.057 1.00 104.21 ? 228  SER B C    1 
ATOM   9018  O  O    . SER B  1 36  ? 126.500 95.084  140.206 1.00 102.86 ? 228  SER B O    1 
ATOM   9019  C  CB   . SER B  1 36  ? 129.520 93.714  140.985 1.00 106.16 ? 228  SER B CB   1 
ATOM   9020  O  OG   . SER B  1 36  ? 130.223 92.599  141.505 1.00 109.10 ? 228  SER B OG   1 
ATOM   9021  H  H    . SER B  1 36  ? 127.728 92.224  140.214 1.00 125.93 ? 228  SER B H    1 
ATOM   9022  H  HA   . SER B  1 36  ? 128.054 93.652  142.419 1.00 128.80 ? 228  SER B HA   1 
ATOM   9023  H  HB2  . SER B  1 36  ? 129.540 93.674  140.016 1.00 127.15 ? 228  SER B HB2  1 
ATOM   9024  H  HB3  . SER B  1 36  ? 129.951 94.528  141.290 1.00 127.15 ? 228  SER B HB3  1 
ATOM   9025  H  HG   . SER B  1 36  ? 129.861 91.886  141.248 1.00 130.68 ? 228  SER B HG   1 
ATOM   9026  N  N    . LEU B  1 37  ? 127.833 96.112  141.699 1.00 98.16  ? 229  LEU B N    1 
ATOM   9027  C  CA   . LEU B  1 37  ? 127.362 97.437  141.330 1.00 98.38  ? 229  LEU B CA   1 
ATOM   9028  C  C    . LEU B  1 37  ? 127.729 97.739  139.882 1.00 95.53  ? 229  LEU B C    1 
ATOM   9029  O  O    . LEU B  1 37  ? 128.713 97.222  139.346 1.00 94.06  ? 229  LEU B O    1 
ATOM   9030  C  CB   . LEU B  1 37  ? 127.972 98.490  142.256 1.00 99.79  ? 229  LEU B CB   1 
ATOM   9031  C  CG   . LEU B  1 37  ? 127.466 98.474  143.696 1.00 103.14 ? 229  LEU B CG   1 
ATOM   9032  C  CD1  . LEU B  1 37  ? 128.494 99.075  144.634 1.00 104.49 ? 229  LEU B CD1  1 
ATOM   9033  C  CD2  . LEU B  1 37  ? 126.161 99.241  143.779 1.00 105.13 ? 229  LEU B CD2  1 
ATOM   9034  H  H    . LEU B  1 37  ? 128.399 96.101  142.346 1.00 117.55 ? 229  LEU B H    1 
ATOM   9035  H  HA   . LEU B  1 37  ? 126.397 97.474  141.417 1.00 117.81 ? 229  LEU B HA   1 
ATOM   9036  H  HB2  . LEU B  1 37  ? 128.932 98.355  142.284 1.00 119.49 ? 229  LEU B HB2  1 
ATOM   9037  H  HB3  . LEU B  1 37  ? 127.779 99.368  141.890 1.00 119.49 ? 229  LEU B HB3  1 
ATOM   9038  H  HG   . LEU B  1 37  ? 127.300 97.558  143.969 1.00 123.52 ? 229  LEU B HG   1 
ATOM   9039  H  HD11 . LEU B  1 37  ? 128.146 99.051  145.540 1.00 125.13 ? 229  LEU B HD11 1 
ATOM   9040  H  HD12 . LEU B  1 37  ? 129.311 98.556  144.580 1.00 125.13 ? 229  LEU B HD12 1 
ATOM   9041  H  HD13 . LEU B  1 37  ? 128.665 99.992  144.369 1.00 125.13 ? 229  LEU B HD13 1 
ATOM   9042  H  HD21 . LEU B  1 37  ? 125.845 99.227  144.696 1.00 125.91 ? 229  LEU B HD21 1 
ATOM   9043  H  HD22 . LEU B  1 37  ? 126.315 100.156 143.496 1.00 125.91 ? 229  LEU B HD22 1 
ATOM   9044  H  HD23 . LEU B  1 37  ? 125.510 98.820  143.198 1.00 125.91 ? 229  LEU B HD23 1 
ATOM   9045  N  N    . ASP B  1 38  ? 126.910 98.577  139.242 1.00 95.77  ? 230  ASP B N    1 
ATOM   9046  C  CA   . ASP B  1 38  ? 127.174 98.958  137.858 1.00 93.48  ? 230  ASP B CA   1 
ATOM   9047  C  C    . ASP B  1 38  ? 128.620 99.402  137.676 1.00 92.24  ? 230  ASP B C    1 
ATOM   9048  O  O    . ASP B  1 38  ? 129.278 99.022  136.701 1.00 89.46  ? 230  ASP B O    1 
ATOM   9049  C  CB   . ASP B  1 38  ? 126.213 100.066 137.426 1.00 94.64  ? 230  ASP B CB   1 
ATOM   9050  C  CG   . ASP B  1 38  ? 124.818 99.547  137.119 1.00 95.93  ? 230  ASP B CG   1 
ATOM   9051  O  OD1  . ASP B  1 38  ? 124.619 98.313  137.141 1.00 95.97  ? 230  ASP B OD1  1 
ATOM   9052  O  OD2  . ASP B  1 38  ? 123.919 100.374 136.855 1.00 98.08  ? 230  ASP B OD2  1 
ATOM   9053  H  H    . ASP B  1 38  ? 126.205 98.932  139.582 1.00 114.67 ? 230  ASP B H    1 
ATOM   9054  H  HA   . ASP B  1 38  ? 127.023 98.190  137.285 1.00 111.93 ? 230  ASP B HA   1 
ATOM   9055  H  HB2  . ASP B  1 38  ? 126.139 100.718 138.141 1.00 113.32 ? 230  ASP B HB2  1 
ATOM   9056  H  HB3  . ASP B  1 38  ? 126.558 100.490 136.625 1.00 113.32 ? 230  ASP B HB3  1 
ATOM   9057  N  N    . CYS B  1 39  ? 129.133 100.207 138.610 1.00 97.90  ? 231  CYS B N    1 
ATOM   9058  C  CA   . CYS B  1 39  ? 130.482 100.747 138.465 1.00 93.74  ? 231  CYS B CA   1 
ATOM   9059  C  C    . CYS B  1 39  ? 131.536 99.647  138.533 1.00 92.14  ? 231  CYS B C    1 
ATOM   9060  O  O    . CYS B  1 39  ? 132.525 99.685  137.792 1.00 90.86  ? 231  CYS B O    1 
ATOM   9061  C  CB   . CYS B  1 39  ? 130.735 101.811 139.534 1.00 99.67  ? 231  CYS B CB   1 
ATOM   9062  S  SG   . CYS B  1 39  ? 130.435 101.269 141.233 1.00 103.14 ? 231  CYS B SG   1 
ATOM   9063  H  H    . CYS B  1 39  ? 128.725 100.452 139.327 1.00 117.23 ? 231  CYS B H    1 
ATOM   9064  H  HA   . CYS B  1 39  ? 130.555 101.175 137.598 1.00 112.24 ? 231  CYS B HA   1 
ATOM   9065  H  HB2  . CYS B  1 39  ? 131.661 102.092 139.476 1.00 119.35 ? 231  CYS B HB2  1 
ATOM   9066  H  HB3  . CYS B  1 39  ? 130.153 102.567 139.361 1.00 119.35 ? 231  CYS B HB3  1 
ATOM   9067  H  HG   . CYS B  1 39  ? 130.664 102.179 141.980 1.00 123.52 ? 231  CYS B HG   1 
ATOM   9068  N  N    . HIS B  1 40  ? 131.344 98.653  139.406 1.00 93.45  ? 232  HIS B N    1 
ATOM   9069  C  CA   . HIS B  1 40  ? 132.304 97.556  139.499 1.00 93.48  ? 232  HIS B CA   1 
ATOM   9070  C  C    . HIS B  1 40  ? 132.073 96.525  138.403 1.00 92.50  ? 232  HIS B C    1 
ATOM   9071  O  O    . HIS B  1 40  ? 133.030 95.940  137.882 1.00 90.41  ? 232  HIS B O    1 
ATOM   9072  C  CB   . HIS B  1 40  ? 132.208 96.882  140.867 1.00 96.37  ? 232  HIS B CB   1 
ATOM   9073  C  CG   . HIS B  1 40  ? 132.379 97.820  142.020 1.00 101.48 ? 232  HIS B CG   1 
ATOM   9074  N  ND1  . HIS B  1 40  ? 131.581 97.769  143.142 1.00 102.30 ? 232  HIS B ND1  1 
ATOM   9075  C  CD2  . HIS B  1 40  ? 133.257 98.830  142.227 1.00 100.73 ? 232  HIS B CD2  1 
ATOM   9076  C  CE1  . HIS B  1 40  ? 131.958 98.709  143.990 1.00 104.47 ? 232  HIS B CE1  1 
ATOM   9077  N  NE2  . HIS B  1 40  ? 132.973 99.366  143.459 1.00 103.71 ? 232  HIS B NE2  1 
ATOM   9078  H  H    . HIS B  1 40  ? 130.677 98.593  139.946 1.00 111.89 ? 232  HIS B H    1 
ATOM   9079  H  HA   . HIS B  1 40  ? 133.202 97.910  139.398 1.00 111.92 ? 232  HIS B HA   1 
ATOM   9080  H  HB2  . HIS B  1 40  ? 131.335 96.467  140.950 1.00 115.39 ? 232  HIS B HB2  1 
ATOM   9081  H  HB3  . HIS B  1 40  ? 132.900 96.205  140.931 1.00 115.39 ? 232  HIS B HB3  1 
ATOM   9082  H  HD2  . HIS B  1 40  ? 133.926 99.109  141.644 1.00 120.63 ? 232  HIS B HD2  1 
ATOM   9083  H  HE1  . HIS B  1 40  ? 131.575 98.878  144.820 1.00 125.12 ? 232  HIS B HE1  1 
ATOM   9084  H  HE2  . HIS B  1 40  ? 133.389 100.024 143.826 1.00 124.21 ? 232  HIS B HE2  1 
ATOM   9085  N  N    . ARG B  1 41  ? 130.809 96.286  138.052 1.00 94.25  ? 233  ARG B N    1 
ATOM   9086  C  CA   . ARG B  1 41  ? 130.488 95.348  136.983 1.00 94.34  ? 233  ARG B CA   1 
ATOM   9087  C  C    . ARG B  1 41  ? 131.202 95.720  135.689 1.00 87.93  ? 233  ARG B C    1 
ATOM   9088  O  O    . ARG B  1 41  ? 131.692 94.844  134.967 1.00 83.26  ? 233  ARG B O    1 
ATOM   9089  C  CB   . ARG B  1 41  ? 128.973 95.301  136.794 1.00 102.90 ? 233  ARG B CB   1 
ATOM   9090  C  CG   . ARG B  1 41  ? 128.479 94.269  135.801 1.00 107.63 ? 233  ARG B CG   1 
ATOM   9091  C  CD   . ARG B  1 41  ? 126.962 94.313  135.711 1.00 116.24 ? 233  ARG B CD   1 
ATOM   9092  N  NE   . ARG B  1 41  ? 126.466 93.937  134.387 1.00 120.33 ? 233  ARG B NE   1 
ATOM   9093  C  CZ   . ARG B  1 41  ? 125.862 94.761  133.533 1.00 123.62 ? 233  ARG B CZ   1 
ATOM   9094  N  NH1  . ARG B  1 41  ? 125.655 96.038  133.838 1.00 124.25 ? 233  ARG B NH1  1 
ATOM   9095  N  NH2  . ARG B  1 41  ? 125.452 94.302  132.357 1.00 122.49 ? 233  ARG B NH2  1 
ATOM   9096  H  H    . ARG B  1 41  ? 130.123 96.655  138.418 1.00 112.85 ? 233  ARG B H    1 
ATOM   9097  H  HA   . ARG B  1 41  ? 130.784 94.462  137.243 1.00 112.97 ? 233  ARG B HA   1 
ATOM   9098  H  HB2  . ARG B  1 41  ? 128.561 95.103  137.650 1.00 123.24 ? 233  ARG B HB2  1 
ATOM   9099  H  HB3  . ARG B  1 41  ? 128.674 96.171  136.484 1.00 123.24 ? 233  ARG B HB3  1 
ATOM   9100  H  HG2  . ARG B  1 41  ? 128.845 94.461  134.924 1.00 128.91 ? 233  ARG B HG2  1 
ATOM   9101  H  HG3  . ARG B  1 41  ? 128.745 93.384  136.094 1.00 128.91 ? 233  ARG B HG3  1 
ATOM   9102  H  HD2  . ARG B  1 41  ? 126.589 93.694  136.359 1.00 139.23 ? 233  ARG B HD2  1 
ATOM   9103  H  HD3  . ARG B  1 41  ? 126.659 95.215  135.901 1.00 139.23 ? 233  ARG B HD3  1 
ATOM   9104  H  HE   . ARG B  1 41  ? 126.572 93.120  134.142 1.00 144.15 ? 233  ARG B HE   1 
ATOM   9105  H  HH11 . ARG B  1 41  ? 125.915 96.347  134.598 1.00 148.85 ? 233  ARG B HH11 1 
ATOM   9106  H  HH12 . ARG B  1 41  ? 125.263 96.557  133.275 1.00 148.85 ? 233  ARG B HH12 1 
ATOM   9107  H  HH21 . ARG B  1 41  ? 125.581 93.478  132.149 1.00 146.73 ? 233  ARG B HH21 1 
ATOM   9108  H  HH22 . ARG B  1 41  ? 125.062 94.830  131.802 1.00 146.73 ? 233  ARG B HH22 1 
ATOM   9109  N  N    . ALA B  1 42  ? 131.266 97.016  135.375 1.00 87.45  ? 234  ALA B N    1 
ATOM   9110  C  CA   . ALA B  1 42  ? 131.932 97.451  134.152 1.00 82.85  ? 234  ALA B CA   1 
ATOM   9111  C  C    . ALA B  1 42  ? 133.388 97.007  134.128 1.00 83.58  ? 234  ALA B C    1 
ATOM   9112  O  O    . ALA B  1 42  ? 133.893 96.564  133.090 1.00 86.33  ? 234  ALA B O    1 
ATOM   9113  C  CB   . ALA B  1 42  ? 131.837 98.970  134.017 1.00 83.51  ? 234  ALA B CB   1 
ATOM   9114  H  H    . ALA B  1 42  ? 130.935 97.654  135.849 1.00 104.70 ? 234  ALA B H    1 
ATOM   9115  H  HA   . ALA B  1 42  ? 131.484 97.053  133.389 1.00 99.17  ? 234  ALA B HA   1 
ATOM   9116  H  HB1  . ALA B  1 42  ? 132.284 99.243  133.201 1.00 99.97  ? 234  ALA B HB1  1 
ATOM   9117  H  HB2  . ALA B  1 42  ? 130.902 99.226  133.985 1.00 99.97  ? 234  ALA B HB2  1 
ATOM   9118  H  HB3  . ALA B  1 42  ? 132.267 99.382  134.783 1.00 99.97  ? 234  ALA B HB3  1 
ATOM   9119  N  N    . GLU B  1 43  ? 134.083 97.120  135.262 1.00 88.77  ? 235  GLU B N    1 
ATOM   9120  C  CA   . GLU B  1 43  ? 135.490 96.740  135.313 1.00 87.46  ? 235  GLU B CA   1 
ATOM   9121  C  C    . GLU B  1 43  ? 135.660 95.227  135.368 1.00 86.62  ? 235  GLU B C    1 
ATOM   9122  O  O    . GLU B  1 43  ? 136.478 94.660  134.635 1.00 83.27  ? 235  GLU B O    1 
ATOM   9123  C  CB   . GLU B  1 43  ? 136.171 97.392  136.517 1.00 91.52  ? 235  GLU B CB   1 
ATOM   9124  C  CG   . GLU B  1 43  ? 136.223 98.901  136.446 1.00 93.68  ? 235  GLU B CG   1 
ATOM   9125  C  CD   . GLU B  1 43  ? 137.417 99.469  137.183 1.00 95.99  ? 235  GLU B CD   1 
ATOM   9126  O  OE1  . GLU B  1 43  ? 137.510 99.266  138.411 1.00 100.19 ? 235  GLU B OE1  1 
ATOM   9127  O  OE2  . GLU B  1 43  ? 138.270 100.105 136.528 1.00 96.98  ? 235  GLU B OE2  1 
ATOM   9128  H  H    . GLU B  1 43  ? 133.764 97.412  136.006 1.00 106.27 ? 235  GLU B H    1 
ATOM   9129  H  HA   . GLU B  1 43  ? 135.931 97.060  134.511 1.00 104.71 ? 235  GLU B HA   1 
ATOM   9130  H  HB2  . GLU B  1 43  ? 135.685 97.149  137.320 1.00 109.58 ? 235  GLU B HB2  1 
ATOM   9131  H  HB3  . GLU B  1 43  ? 137.083 97.066  136.574 1.00 109.58 ? 235  GLU B HB3  1 
ATOM   9132  H  HG2  . GLU B  1 43  ? 136.284 99.173  135.517 1.00 112.16 ? 235  GLU B HG2  1 
ATOM   9133  H  HG3  . GLU B  1 43  ? 135.419 99.265  136.849 1.00 112.16 ? 235  GLU B HG3  1 
ATOM   9134  N  N    . LEU B  1 44  ? 134.894 94.554  136.228 1.00 82.72  ? 236  LEU B N    1 
ATOM   9135  C  CA   . LEU B  1 44  ? 135.067 93.117  136.389 1.00 83.23  ? 236  LEU B CA   1 
ATOM   9136  C  C    . LEU B  1 44  ? 134.662 92.346  135.140 1.00 82.30  ? 236  LEU B C    1 
ATOM   9137  O  O    . LEU B  1 44  ? 135.122 91.215  134.953 1.00 82.66  ? 236  LEU B O    1 
ATOM   9138  C  CB   . LEU B  1 44  ? 134.269 92.623  137.595 1.00 85.89  ? 236  LEU B CB   1 
ATOM   9139  C  CG   . LEU B  1 44  ? 134.650 93.237  138.945 1.00 88.03  ? 236  LEU B CG   1 
ATOM   9140  C  CD1  . LEU B  1 44  ? 133.702 92.752  140.027 1.00 90.57  ? 236  LEU B CD1  1 
ATOM   9141  C  CD2  . LEU B  1 44  ? 136.091 92.910  139.314 1.00 87.32  ? 236  LEU B CD2  1 
ATOM   9142  H  H    . LEU B  1 44  ? 134.279 94.901  136.720 1.00 99.02  ? 236  LEU B H    1 
ATOM   9143  H  HA   . LEU B  1 44  ? 136.004 92.934  136.558 1.00 99.63  ? 236  LEU B HA   1 
ATOM   9144  H  HB2  . LEU B  1 44  ? 133.332 92.819  137.443 1.00 102.81 ? 236  LEU B HB2  1 
ATOM   9145  H  HB3  . LEU B  1 44  ? 134.391 91.664  137.669 1.00 102.81 ? 236  LEU B HB3  1 
ATOM   9146  H  HG   . LEU B  1 44  ? 134.568 94.202  138.886 1.00 105.38 ? 236  LEU B HG   1 
ATOM   9147  H  HD11 . LEU B  1 44  ? 133.958 93.150  140.873 1.00 108.43 ? 236  LEU B HD11 1 
ATOM   9148  H  HD12 . LEU B  1 44  ? 132.798 93.017  139.797 1.00 108.43 ? 236  LEU B HD12 1 
ATOM   9149  H  HD13 . LEU B  1 44  ? 133.758 91.785  140.086 1.00 108.43 ? 236  LEU B HD13 1 
ATOM   9150  H  HD21 . LEU B  1 44  ? 136.296 93.313  140.172 1.00 104.53 ? 236  LEU B HD21 1 
ATOM   9151  H  HD22 . LEU B  1 44  ? 136.192 91.947  139.369 1.00 104.53 ? 236  LEU B HD22 1 
ATOM   9152  H  HD23 . LEU B  1 44  ? 136.680 93.266  138.631 1.00 104.53 ? 236  LEU B HD23 1 
ATOM   9153  N  N    . SER B  1 45  ? 133.824 92.928  134.281 1.00 81.98  ? 237  SER B N    1 
ATOM   9154  C  CA   . SER B  1 45  ? 133.464 92.271  133.031 1.00 80.62  ? 237  SER B CA   1 
ATOM   9155  C  C    . SER B  1 45  ? 134.638 92.162  132.068 1.00 77.99  ? 237  SER B C    1 
ATOM   9156  O  O    . SER B  1 45  ? 134.538 91.425  131.082 1.00 77.32  ? 237  SER B O    1 
ATOM   9157  C  CB   . SER B  1 45  ? 132.318 93.019  132.351 1.00 84.11  ? 237  SER B CB   1 
ATOM   9158  O  OG   . SER B  1 45  ? 132.713 94.331  131.989 1.00 89.66  ? 237  SER B OG   1 
ATOM   9159  H  H    . SER B  1 45  ? 133.454 93.696  134.399 1.00 98.13  ? 237  SER B H    1 
ATOM   9160  H  HA   . SER B  1 45  ? 133.157 91.372  133.228 1.00 96.50  ? 237  SER B HA   1 
ATOM   9161  H  HB2  . SER B  1 45  ? 132.057 92.536  131.551 1.00 100.68 ? 237  SER B HB2  1 
ATOM   9162  H  HB3  . SER B  1 45  ? 131.569 93.073  132.965 1.00 100.68 ? 237  SER B HB3  1 
ATOM   9163  H  HG   . SER B  1 45  ? 132.943 94.761  132.673 1.00 107.35 ? 237  SER B HG   1 
ATOM   9164  N  N    . GLN B  1 46  ? 135.741 92.870  132.323 1.00 77.49  ? 238  GLN B N    1 
ATOM   9165  C  CA   . GLN B  1 46  ? 136.942 92.694  131.514 1.00 76.00  ? 238  GLN B CA   1 
ATOM   9166  C  C    . GLN B  1 46  ? 137.524 91.294  131.653 1.00 75.40  ? 238  GLN B C    1 
ATOM   9167  O  O    . GLN B  1 46  ? 138.335 90.885  130.816 1.00 73.87  ? 238  GLN B O    1 
ATOM   9168  C  CB   . GLN B  1 46  ? 137.997 93.735  131.901 1.00 78.49  ? 238  GLN B CB   1 
ATOM   9169  C  CG   . GLN B  1 46  ? 137.589 95.175  131.622 1.00 82.22  ? 238  GLN B CG   1 
ATOM   9170  C  CD   . GLN B  1 46  ? 138.635 96.178  132.072 1.00 84.73  ? 238  GLN B CD   1 
ATOM   9171  O  OE1  . GLN B  1 46  ? 139.437 96.658  131.272 1.00 86.58  ? 238  GLN B OE1  1 
ATOM   9172  N  NE2  . GLN B  1 46  ? 138.618 96.514  133.356 1.00 88.51  ? 238  GLN B NE2  1 
ATOM   9173  H  H    . GLN B  1 46  ? 135.817 93.451  132.952 1.00 92.74  ? 238  GLN B H    1 
ATOM   9174  H  HA   . GLN B  1 46  ? 136.715 92.831  130.581 1.00 90.96  ? 238  GLN B HA   1 
ATOM   9175  H  HB2  . GLN B  1 46  ? 138.175 93.658  132.851 1.00 93.94  ? 238  GLN B HB2  1 
ATOM   9176  H  HB3  . GLN B  1 46  ? 138.808 93.556  131.400 1.00 93.94  ? 238  GLN B HB3  1 
ATOM   9177  H  HG2  . GLN B  1 46  ? 137.457 95.287  130.667 1.00 98.42  ? 238  GLN B HG2  1 
ATOM   9178  H  HG3  . GLN B  1 46  ? 136.765 95.367  132.095 1.00 98.42  ? 238  GLN B HG3  1 
ATOM   9179  H  HE21 . GLN B  1 46  ? 138.040 96.160  133.886 1.00 105.96 ? 238  GLN B HE21 1 
ATOM   9180  H  HE22 . GLN B  1 46  ? 139.189 97.080  133.660 1.00 105.96 ? 238  GLN B HE22 1 
ATOM   9181  N  N    . LEU B  1 47  ? 137.132 90.556  132.693 1.00 76.44  ? 239  LEU B N    1 
ATOM   9182  C  CA   . LEU B  1 47  ? 137.613 89.195  132.890 1.00 76.64  ? 239  LEU B CA   1 
ATOM   9183  C  C    . LEU B  1 47  ? 136.960 88.194  131.946 1.00 75.84  ? 239  LEU B C    1 
ATOM   9184  O  O    . LEU B  1 47  ? 137.527 87.120  131.717 1.00 76.79  ? 239  LEU B O    1 
ATOM   9185  C  CB   . LEU B  1 47  ? 137.360 88.754  134.332 1.00 78.80  ? 239  LEU B CB   1 
ATOM   9186  C  CG   . LEU B  1 47  ? 138.174 89.455  135.418 1.00 80.05  ? 239  LEU B CG   1 
ATOM   9187  C  CD1  . LEU B  1 47  ? 137.507 89.273  136.771 1.00 82.72  ? 239  LEU B CD1  1 
ATOM   9188  C  CD2  . LEU B  1 47  ? 139.594 88.921  135.445 1.00 80.03  ? 239  LEU B CD2  1 
ATOM   9189  H  H    . LEU B  1 47  ? 136.585 90.824  133.299 1.00 91.48  ? 239  LEU B H    1 
ATOM   9190  H  HA   . LEU B  1 47  ? 138.570 89.173  132.733 1.00 91.72  ? 239  LEU B HA   1 
ATOM   9191  H  HB2  . LEU B  1 47  ? 136.423 88.904  134.534 1.00 94.32  ? 239  LEU B HB2  1 
ATOM   9192  H  HB3  . LEU B  1 47  ? 137.553 87.805  134.396 1.00 94.32  ? 239  LEU B HB3  1 
ATOM   9193  H  HG   . LEU B  1 47  ? 138.211 90.404  135.225 1.00 95.81  ? 239  LEU B HG   1 
ATOM   9194  H  HD11 . LEU B  1 47  ? 138.037 89.723  137.447 1.00 99.01  ? 239  LEU B HD11 1 
ATOM   9195  H  HD12 . LEU B  1 47  ? 136.617 89.656  136.738 1.00 99.01  ? 239  LEU B HD12 1 
ATOM   9196  H  HD13 . LEU B  1 47  ? 137.453 88.325  136.971 1.00 99.01  ? 239  LEU B HD13 1 
ATOM   9197  H  HD21 . LEU B  1 47  ? 140.090 89.380  136.140 1.00 95.79  ? 239  LEU B HD21 1 
ATOM   9198  H  HD22 . LEU B  1 47  ? 139.570 87.969  135.629 1.00 95.79  ? 239  LEU B HD22 1 
ATOM   9199  H  HD23 . LEU B  1 47  ? 140.008 89.082  134.582 1.00 95.79  ? 239  LEU B HD23 1 
ATOM   9200  N  N    . PHE B  1 48  ? 135.788 88.518  131.399 1.00 78.30  ? 240  PHE B N    1 
ATOM   9201  C  CA   . PHE B  1 48  ? 135.011 87.525  130.662 1.00 78.36  ? 240  PHE B CA   1 
ATOM   9202  C  C    . PHE B  1 48  ? 135.774 87.005  129.450 1.00 75.94  ? 240  PHE B C    1 
ATOM   9203  O  O    . PHE B  1 48  ? 135.938 85.791  129.282 1.00 76.63  ? 240  PHE B O    1 
ATOM   9204  C  CB   . PHE B  1 48  ? 133.668 88.126  130.238 1.00 78.34  ? 240  PHE B CB   1 
ATOM   9205  C  CG   . PHE B  1 48  ? 132.659 88.210  131.352 1.00 81.04  ? 240  PHE B CG   1 
ATOM   9206  C  CD1  . PHE B  1 48  ? 132.428 87.125  132.181 1.00 80.46  ? 240  PHE B CD1  1 
ATOM   9207  C  CD2  . PHE B  1 48  ? 131.940 89.375  131.567 1.00 81.34  ? 240  PHE B CD2  1 
ATOM   9208  C  CE1  . PHE B  1 48  ? 131.504 87.199  133.204 1.00 84.48  ? 240  PHE B CE1  1 
ATOM   9209  C  CE2  . PHE B  1 48  ? 131.013 89.455  132.589 1.00 82.58  ? 240  PHE B CE2  1 
ATOM   9210  C  CZ   . PHE B  1 48  ? 130.795 88.365  133.408 1.00 84.91  ? 240  PHE B CZ   1 
ATOM   9211  H  H    . PHE B  1 48  ? 135.425 89.296  131.440 1.00 93.71  ? 240  PHE B H    1 
ATOM   9212  H  HA   . PHE B  1 48  ? 134.829 86.772  131.246 1.00 93.78  ? 240  PHE B HA   1 
ATOM   9213  H  HB2  . PHE B  1 48  ? 133.820 89.025  129.907 1.00 93.76  ? 240  PHE B HB2  1 
ATOM   9214  H  HB3  . PHE B  1 48  ? 133.289 87.576  129.535 1.00 93.76  ? 240  PHE B HB3  1 
ATOM   9215  H  HD1  . PHE B  1 48  ? 132.903 86.337  132.049 1.00 96.31  ? 240  PHE B HD1  1 
ATOM   9216  H  HD2  . PHE B  1 48  ? 132.085 90.112  131.019 1.00 97.36  ? 240  PHE B HD2  1 
ATOM   9217  H  HE1  . PHE B  1 48  ? 131.358 86.464  133.754 1.00 101.13 ? 240  PHE B HE1  1 
ATOM   9218  H  HE2  . PHE B  1 48  ? 130.537 90.243  132.725 1.00 98.85  ? 240  PHE B HE2  1 
ATOM   9219  H  HZ   . PHE B  1 48  ? 130.171 88.417  134.096 1.00 101.64 ? 240  PHE B HZ   1 
ATOM   9220  N  N    . TYR B  1 49  ? 136.250 87.908  128.591 1.00 72.51  ? 241  TYR B N    1 
ATOM   9221  C  CA   . TYR B  1 49  ? 136.912 87.472  127.362 1.00 75.33  ? 241  TYR B CA   1 
ATOM   9222  C  C    . TYR B  1 49  ? 138.164 86.653  127.639 1.00 72.94  ? 241  TYR B C    1 
ATOM   9223  O  O    . TYR B  1 49  ? 138.254 85.510  127.158 1.00 71.18  ? 241  TYR B O    1 
ATOM   9224  C  CB   . TYR B  1 49  ? 137.222 88.688  126.485 1.00 81.98  ? 241  TYR B CB   1 
ATOM   9225  C  CG   . TYR B  1 49  ? 138.072 88.357  125.277 1.00 84.45  ? 241  TYR B CG   1 
ATOM   9226  C  CD1  . TYR B  1 49  ? 137.540 87.667  124.195 1.00 85.32  ? 241  TYR B CD1  1 
ATOM   9227  C  CD2  . TYR B  1 49  ? 139.408 88.731  125.222 1.00 85.23  ? 241  TYR B CD2  1 
ATOM   9228  C  CE1  . TYR B  1 49  ? 138.315 87.361  123.090 1.00 85.26  ? 241  TYR B CE1  1 
ATOM   9229  C  CE2  . TYR B  1 49  ? 140.190 88.430  124.123 1.00 86.59  ? 241  TYR B CE2  1 
ATOM   9230  C  CZ   . TYR B  1 49  ? 139.639 87.745  123.060 1.00 88.86  ? 241  TYR B CZ   1 
ATOM   9231  O  OH   . TYR B  1 49  ? 140.420 87.447  121.966 1.00 89.68  ? 241  TYR B OH   1 
ATOM   9232  H  H    . TYR B  1 49  ? 136.205 88.760  128.693 1.00 86.77  ? 241  TYR B H    1 
ATOM   9233  H  HA   . TYR B  1 49  ? 136.298 86.906  126.867 1.00 90.14  ? 241  TYR B HA   1 
ATOM   9234  H  HB2  . TYR B  1 49  ? 136.387 89.067  126.168 1.00 98.13  ? 241  TYR B HB2  1 
ATOM   9235  H  HB3  . TYR B  1 49  ? 137.701 89.343  127.016 1.00 98.13  ? 241  TYR B HB3  1 
ATOM   9236  H  HD1  . TYR B  1 49  ? 136.647 87.406  124.213 1.00 102.14 ? 241  TYR B HD1  1 
ATOM   9237  H  HD2  . TYR B  1 49  ? 139.783 89.193  125.936 1.00 102.03 ? 241  TYR B HD2  1 
ATOM   9238  H  HE1  . TYR B  1 49  ? 137.945 86.899  122.373 1.00 102.06 ? 241  TYR B HE1  1 
ATOM   9239  H  HE2  . TYR B  1 49  ? 141.083 88.688  124.100 1.00 103.66 ? 241  TYR B HE2  1 
ATOM   9240  H  HH   . TYR B  1 49  ? 139.966 87.032  121.394 1.00 107.37 ? 241  TYR B HH   1 
ATOM   9241  N  N    . PRO B  1 50  ? 139.149 87.146  128.396 1.00 73.78  ? 242  PRO B N    1 
ATOM   9242  C  CA   . PRO B  1 50  ? 140.375 86.351  128.577 1.00 73.18  ? 242  PRO B CA   1 
ATOM   9243  C  C    . PRO B  1 50  ? 140.136 85.015  129.258 1.00 74.67  ? 242  PRO B C    1 
ATOM   9244  O  O    . PRO B  1 50  ? 140.735 84.009  128.861 1.00 75.10  ? 242  PRO B O    1 
ATOM   9245  C  CB   . PRO B  1 50  ? 141.266 87.273  129.421 1.00 76.26  ? 242  PRO B CB   1 
ATOM   9246  C  CG   . PRO B  1 50  ? 140.324 88.216  130.091 1.00 74.81  ? 242  PRO B CG   1 
ATOM   9247  C  CD   . PRO B  1 50  ? 139.223 88.436  129.104 1.00 73.76  ? 242  PRO B CD   1 
ATOM   9248  H  HA   . PRO B  1 50  ? 140.802 86.197  127.720 1.00 87.56  ? 242  PRO B HA   1 
ATOM   9249  H  HB2  . PRO B  1 50  ? 141.751 86.749  130.078 1.00 91.26  ? 242  PRO B HB2  1 
ATOM   9250  H  HB3  . PRO B  1 50  ? 141.879 87.754  128.844 1.00 91.26  ? 242  PRO B HB3  1 
ATOM   9251  H  HG2  . PRO B  1 50  ? 139.980 87.812  130.903 1.00 89.52  ? 242  PRO B HG2  1 
ATOM   9252  H  HG3  . PRO B  1 50  ? 140.779 89.049  130.287 1.00 89.52  ? 242  PRO B HG3  1 
ATOM   9253  H  HD2  . PRO B  1 50  ? 138.388 88.619  129.563 1.00 88.27  ? 242  PRO B HD2  1 
ATOM   9254  H  HD3  . PRO B  1 50  ? 139.456 89.148  128.489 1.00 88.27  ? 242  PRO B HD3  1 
ATOM   9255  N  N    . LEU B  1 51  ? 139.265 84.969  130.268 1.00 77.47  ? 243  LEU B N    1 
ATOM   9256  C  CA   . LEU B  1 51  ? 138.985 83.701  130.932 1.00 78.58  ? 243  LEU B CA   1 
ATOM   9257  C  C    . LEU B  1 51  ? 138.265 82.737  130.000 1.00 78.39  ? 243  LEU B C    1 
ATOM   9258  O  O    . LEU B  1 51  ? 138.540 81.532  130.012 1.00 75.88  ? 243  LEU B O    1 
ATOM   9259  C  CB   . LEU B  1 51  ? 138.156 83.942  132.194 1.00 80.23  ? 243  LEU B CB   1 
ATOM   9260  C  CG   . LEU B  1 51  ? 138.892 84.602  133.362 1.00 84.76  ? 243  LEU B CG   1 
ATOM   9261  C  CD1  . LEU B  1 51  ? 137.929 84.895  134.503 1.00 85.25  ? 243  LEU B CD1  1 
ATOM   9262  C  CD2  . LEU B  1 51  ? 140.045 83.729  133.847 1.00 86.48  ? 243  LEU B CD2  1 
ATOM   9263  H  H    . LEU B  1 51  ? 138.833 85.644  130.580 1.00 92.72  ? 243  LEU B H    1 
ATOM   9264  H  HA   . LEU B  1 51  ? 139.823 83.292  131.198 1.00 94.05  ? 243  LEU B HA   1 
ATOM   9265  H  HB2  . LEU B  1 51  ? 137.408 84.514  131.963 1.00 96.03  ? 243  LEU B HB2  1 
ATOM   9266  H  HB3  . LEU B  1 51  ? 137.823 83.087  132.508 1.00 96.03  ? 243  LEU B HB3  1 
ATOM   9267  H  HG   . LEU B  1 51  ? 139.264 85.446  133.062 1.00 101.46 ? 243  LEU B HG   1 
ATOM   9268  H  HD11 . LEU B  1 51  ? 138.418 85.312  135.230 1.00 102.06 ? 243  LEU B HD11 1 
ATOM   9269  H  HD12 . LEU B  1 51  ? 137.235 85.494  134.184 1.00 102.06 ? 243  LEU B HD12 1 
ATOM   9270  H  HD13 . LEU B  1 51  ? 137.534 84.062  134.804 1.00 102.06 ? 243  LEU B HD13 1 
ATOM   9271  H  HD21 . LEU B  1 51  ? 140.489 84.174  134.586 1.00 103.52 ? 243  LEU B HD21 1 
ATOM   9272  H  HD22 . LEU B  1 51  ? 139.692 82.874  134.140 1.00 103.52 ? 243  LEU B HD22 1 
ATOM   9273  H  HD23 . LEU B  1 51  ? 140.670 83.596  133.117 1.00 103.52 ? 243  LEU B HD23 1 
ATOM   9274  N  N    . PHE B  1 52  ? 137.344 83.247  129.180 1.00 81.45  ? 244  PHE B N    1 
ATOM   9275  C  CA   . PHE B  1 52  ? 136.636 82.381  128.244 1.00 81.47  ? 244  PHE B CA   1 
ATOM   9276  C  C    . PHE B  1 52  ? 137.602 81.722  127.268 1.00 84.55  ? 244  PHE B C    1 
ATOM   9277  O  O    . PHE B  1 52  ? 137.468 80.532  126.960 1.00 87.55  ? 244  PHE B O    1 
ATOM   9278  C  CB   . PHE B  1 52  ? 135.577 83.177  127.484 1.00 80.39  ? 244  PHE B CB   1 
ATOM   9279  C  CG   . PHE B  1 52  ? 134.926 82.403  126.374 1.00 80.47  ? 244  PHE B CG   1 
ATOM   9280  C  CD1  . PHE B  1 52  ? 133.932 81.480  126.647 1.00 82.47  ? 244  PHE B CD1  1 
ATOM   9281  C  CD2  . PHE B  1 52  ? 135.315 82.593  125.058 1.00 80.60  ? 244  PHE B CD2  1 
ATOM   9282  C  CE1  . PHE B  1 52  ? 133.335 80.763  125.628 1.00 83.52  ? 244  PHE B CE1  1 
ATOM   9283  C  CE2  . PHE B  1 52  ? 134.721 81.879  124.035 1.00 81.05  ? 244  PHE B CE2  1 
ATOM   9284  C  CZ   . PHE B  1 52  ? 133.730 80.962  124.322 1.00 83.06  ? 244  PHE B CZ   1 
ATOM   9285  H  H    . PHE B  1 52  ? 137.116 84.076  129.148 1.00 97.49  ? 244  PHE B H    1 
ATOM   9286  H  HA   . PHE B  1 52  ? 136.186 81.680  128.741 1.00 97.52  ? 244  PHE B HA   1 
ATOM   9287  H  HB2  . PHE B  1 52  ? 134.882 83.447  128.105 1.00 96.22  ? 244  PHE B HB2  1 
ATOM   9288  H  HB3  . PHE B  1 52  ? 135.994 83.962  127.095 1.00 96.22  ? 244  PHE B HB3  1 
ATOM   9289  H  HD1  . PHE B  1 52  ? 133.662 81.341  127.526 1.00 98.72  ? 244  PHE B HD1  1 
ATOM   9290  H  HD2  . PHE B  1 52  ? 135.983 83.209  124.861 1.00 96.48  ? 244  PHE B HD2  1 
ATOM   9291  H  HE1  . PHE B  1 52  ? 132.667 80.146  125.823 1.00 99.98  ? 244  PHE B HE1  1 
ATOM   9292  H  HE2  . PHE B  1 52  ? 134.989 82.015  123.156 1.00 97.01  ? 244  PHE B HE2  1 
ATOM   9293  H  HZ   . PHE B  1 52  ? 133.328 80.481  123.635 1.00 99.43  ? 244  PHE B HZ   1 
ATOM   9294  N  N    . VAL B  1 53  ? 138.580 82.477  126.770 1.00 77.50  ? 245  VAL B N    1 
ATOM   9295  C  CA   . VAL B  1 53  ? 139.494 81.943  125.767 1.00 75.55  ? 245  VAL B CA   1 
ATOM   9296  C  C    . VAL B  1 53  ? 140.508 81.000  126.404 1.00 77.64  ? 245  VAL B C    1 
ATOM   9297  O  O    . VAL B  1 53  ? 140.764 79.906  125.889 1.00 80.01  ? 245  VAL B O    1 
ATOM   9298  C  CB   . VAL B  1 53  ? 140.187 83.093  125.013 1.00 74.03  ? 245  VAL B CB   1 
ATOM   9299  C  CG1  . VAL B  1 53  ? 141.141 82.541  123.961 1.00 73.94  ? 245  VAL B CG1  1 
ATOM   9300  C  CG2  . VAL B  1 53  ? 139.153 84.004  124.368 1.00 73.16  ? 245  VAL B CG2  1 
ATOM   9301  H  H    . VAL B  1 53  ? 138.733 83.293  126.995 1.00 92.75  ? 245  VAL B H    1 
ATOM   9302  H  HA   . VAL B  1 53  ? 138.982 81.432  125.120 1.00 90.41  ? 245  VAL B HA   1 
ATOM   9303  H  HB   . VAL B  1 53  ? 140.704 83.620  125.643 1.00 88.59  ? 245  VAL B HB   1 
ATOM   9304  H  HG11 . VAL B  1 53  ? 141.565 83.282  123.500 1.00 88.48  ? 245  VAL B HG11 1 
ATOM   9305  H  HG12 . VAL B  1 53  ? 141.813 81.996  124.399 1.00 88.48  ? 245  VAL B HG12 1 
ATOM   9306  H  HG13 . VAL B  1 53  ? 140.637 82.003  123.330 1.00 88.48  ? 245  VAL B HG13 1 
ATOM   9307  H  HG21 . VAL B  1 53  ? 139.611 84.719  123.900 1.00 87.54  ? 245  VAL B HG21 1 
ATOM   9308  H  HG22 . VAL B  1 53  ? 138.622 83.485  123.743 1.00 87.54  ? 245  VAL B HG22 1 
ATOM   9309  H  HG23 . VAL B  1 53  ? 138.582 84.373  125.060 1.00 87.54  ? 245  VAL B HG23 1 
ATOM   9310  N  N    . HIS B  1 54  ? 141.102 81.402  127.530 1.00 80.21  ? 246  HIS B N    1 
ATOM   9311  C  CA   . HIS B  1 54  ? 142.080 80.539  128.185 1.00 82.63  ? 246  HIS B CA   1 
ATOM   9312  C  C    . HIS B  1 54  ? 141.442 79.232  128.636 1.00 82.78  ? 246  HIS B C    1 
ATOM   9313  O  O    . HIS B  1 54  ? 142.053 78.163  128.524 1.00 84.75  ? 246  HIS B O    1 
ATOM   9314  C  CB   . HIS B  1 54  ? 142.715 81.261  129.372 1.00 83.80  ? 246  HIS B CB   1 
ATOM   9315  C  CG   . HIS B  1 54  ? 143.878 82.126  128.997 1.00 90.15  ? 246  HIS B CG   1 
ATOM   9316  N  ND1  . HIS B  1 54  ? 143.878 83.493  129.178 1.00 90.53  ? 246  HIS B ND1  1 
ATOM   9317  C  CD2  . HIS B  1 54  ? 145.075 81.821  128.442 1.00 89.01  ? 246  HIS B CD2  1 
ATOM   9318  C  CE1  . HIS B  1 54  ? 145.024 83.992  128.752 1.00 92.90  ? 246  HIS B CE1  1 
ATOM   9319  N  NE2  . HIS B  1 54  ? 145.770 82.999  128.303 1.00 90.28  ? 246  HIS B NE2  1 
ATOM   9320  H  H    . HIS B  1 54  ? 140.958 82.152  127.926 1.00 96.00  ? 246  HIS B H    1 
ATOM   9321  H  HA   . HIS B  1 54  ? 142.784 80.325  127.553 1.00 98.91  ? 246  HIS B HA   1 
ATOM   9322  H  HB2  . HIS B  1 54  ? 142.046 81.827  129.789 1.00 100.31 ? 246  HIS B HB2  1 
ATOM   9323  H  HB3  . HIS B  1 54  ? 143.030 80.601  130.009 1.00 100.31 ? 246  HIS B HB3  1 
ATOM   9324  H  HD2  . HIS B  1 54  ? 145.372 80.973  128.202 1.00 106.57 ? 246  HIS B HD2  1 
ATOM   9325  H  HE1  . HIS B  1 54  ? 145.267 84.890  128.770 1.00 111.23 ? 246  HIS B HE1  1 
ATOM   9326  H  HE2  . HIS B  1 54  ? 146.561 83.076  127.975 1.00 108.09 ? 246  HIS B HE2  1 
ATOM   9327  N  N    . MET B  1 55  ? 140.208 79.296  129.140 1.00 81.59  ? 247  MET B N    1 
ATOM   9328  C  CA   . MET B  1 55  ? 139.535 78.083  129.589 1.00 82.70  ? 247  MET B CA   1 
ATOM   9329  C  C    . MET B  1 55  ? 139.084 77.237  128.407 1.00 80.76  ? 247  MET B C    1 
ATOM   9330  O  O    . MET B  1 55  ? 139.161 76.004  128.455 1.00 82.25  ? 247  MET B O    1 
ATOM   9331  C  CB   . MET B  1 55  ? 138.345 78.445  130.479 1.00 84.21  ? 247  MET B CB   1 
ATOM   9332  C  CG   . MET B  1 55  ? 138.747 79.000  131.833 1.00 86.09  ? 247  MET B CG   1 
ATOM   9333  S  SD   . MET B  1 55  ? 137.348 79.572  132.814 1.00 87.42  ? 247  MET B SD   1 
ATOM   9334  C  CE   . MET B  1 55  ? 136.608 78.013  133.294 1.00 87.81  ? 247  MET B CE   1 
ATOM   9335  H  H    . MET B  1 55  ? 139.748 80.017  129.230 1.00 97.65  ? 247  MET B H    1 
ATOM   9336  H  HA   . MET B  1 55  ? 140.155 77.564  130.124 1.00 98.99  ? 247  MET B HA   1 
ATOM   9337  H  HB2  . MET B  1 55  ? 137.810 79.117  130.028 1.00 100.80 ? 247  MET B HB2  1 
ATOM   9338  H  HB3  . MET B  1 55  ? 137.814 77.647  130.630 1.00 100.80 ? 247  MET B HB3  1 
ATOM   9339  H  HG2  . MET B  1 55  ? 139.199 78.305  132.336 1.00 103.06 ? 247  MET B HG2  1 
ATOM   9340  H  HG3  . MET B  1 55  ? 139.345 79.752  131.699 1.00 103.06 ? 247  MET B HG3  1 
ATOM   9341  H  HE1  . MET B  1 55  ? 135.826 78.191  133.840 1.00 105.13 ? 247  MET B HE1  1 
ATOM   9342  H  HE2  . MET B  1 55  ? 136.352 77.526  132.496 1.00 105.13 ? 247  MET B HE2  1 
ATOM   9343  H  HE3  . MET B  1 55  ? 137.256 77.500  133.802 1.00 105.13 ? 247  MET B HE3  1 
ATOM   9344  N  N    . TYR B  1 56  ? 138.624 77.878  127.332 1.00 76.49  ? 248  TYR B N    1 
ATOM   9345  C  CA   . TYR B  1 56  ? 138.251 77.128  126.139 1.00 78.10  ? 248  TYR B CA   1 
ATOM   9346  C  C    . TYR B  1 56  ? 139.468 76.458  125.514 1.00 83.56  ? 248  TYR B C    1 
ATOM   9347  O  O    . TYR B  1 56  ? 139.422 75.276  125.155 1.00 83.47  ? 248  TYR B O    1 
ATOM   9348  C  CB   . TYR B  1 56  ? 137.569 78.047  125.127 1.00 77.38  ? 248  TYR B CB   1 
ATOM   9349  C  CG   . TYR B  1 56  ? 137.277 77.357  123.817 1.00 74.46  ? 248  TYR B CG   1 
ATOM   9350  C  CD1  . TYR B  1 56  ? 136.243 76.438  123.710 1.00 74.00  ? 248  TYR B CD1  1 
ATOM   9351  C  CD2  . TYR B  1 56  ? 138.042 77.618  122.689 1.00 72.82  ? 248  TYR B CD2  1 
ATOM   9352  C  CE1  . TYR B  1 56  ? 135.976 75.802  122.517 1.00 74.36  ? 248  TYR B CE1  1 
ATOM   9353  C  CE2  . TYR B  1 56  ? 137.783 76.988  121.491 1.00 74.15  ? 248  TYR B CE2  1 
ATOM   9354  C  CZ   . TYR B  1 56  ? 136.750 76.079  121.410 1.00 78.00  ? 248  TYR B CZ   1 
ATOM   9355  O  OH   . TYR B  1 56  ? 136.489 75.448  120.217 1.00 82.74  ? 248  TYR B OH   1 
ATOM   9356  H  H    . TYR B  1 56  ? 138.521 78.729  127.270 1.00 91.54  ? 248  TYR B H    1 
ATOM   9357  H  HA   . TYR B  1 56  ? 137.620 76.434  126.386 1.00 93.47  ? 248  TYR B HA   1 
ATOM   9358  H  HB2  . TYR B  1 56  ? 136.727 78.356  125.497 1.00 92.60  ? 248  TYR B HB2  1 
ATOM   9359  H  HB3  . TYR B  1 56  ? 138.149 78.803  124.945 1.00 92.60  ? 248  TYR B HB3  1 
ATOM   9360  H  HD1  . TYR B  1 56  ? 135.721 76.249  124.456 1.00 88.55  ? 248  TYR B HD1  1 
ATOM   9361  H  HD2  . TYR B  1 56  ? 138.740 78.230  122.743 1.00 87.13  ? 248  TYR B HD2  1 
ATOM   9362  H  HE1  . TYR B  1 56  ? 135.279 75.189  122.459 1.00 88.98  ? 248  TYR B HE1  1 
ATOM   9363  H  HE2  . TYR B  1 56  ? 138.304 77.173  120.743 1.00 88.74  ? 248  TYR B HE2  1 
ATOM   9364  H  HH   . TYR B  1 56  ? 137.031 75.707  119.630 1.00 99.04  ? 248  TYR B HH   1 
ATOM   9365  N  N    . LEU B  1 57  ? 140.569 77.200  125.378 1.00 84.93  ? 249  LEU B N    1 
ATOM   9366  C  CA   . LEU B  1 57  ? 141.771 76.627  124.784 1.00 81.60  ? 249  LEU B CA   1 
ATOM   9367  C  C    . LEU B  1 57  ? 142.365 75.534  125.662 1.00 86.52  ? 249  LEU B C    1 
ATOM   9368  O  O    . LEU B  1 57  ? 143.014 74.618  125.147 1.00 88.33  ? 249  LEU B O    1 
ATOM   9369  C  CB   . LEU B  1 57  ? 142.811 77.719  124.529 1.00 82.16  ? 249  LEU B CB   1 
ATOM   9370  C  CG   . LEU B  1 57  ? 142.508 78.746  123.432 1.00 84.46  ? 249  LEU B CG   1 
ATOM   9371  C  CD1  . LEU B  1 57  ? 143.681 79.703  123.272 1.00 84.25  ? 249  LEU B CD1  1 
ATOM   9372  C  CD2  . LEU B  1 57  ? 142.186 78.077  122.100 1.00 86.67  ? 249  LEU B CD2  1 
ATOM   9373  H  H    . LEU B  1 57  ? 140.644 78.023  125.617 1.00 101.67 ? 249  LEU B H    1 
ATOM   9374  H  HA   . LEU B  1 57  ? 141.540 76.229  123.930 1.00 97.67  ? 249  LEU B HA   1 
ATOM   9375  H  HB2  . LEU B  1 57  ? 142.934 78.214  125.354 1.00 98.35  ? 249  LEU B HB2  1 
ATOM   9376  H  HB3  . LEU B  1 57  ? 143.646 77.287  124.290 1.00 98.35  ? 249  LEU B HB3  1 
ATOM   9377  H  HG   . LEU B  1 57  ? 141.734 79.267  123.696 1.00 101.10 ? 249  LEU B HG   1 
ATOM   9378  H  HD11 . LEU B  1 57  ? 143.472 80.344  122.575 1.00 100.85 ? 249  LEU B HD11 1 
ATOM   9379  H  HD12 . LEU B  1 57  ? 143.829 80.164  124.113 1.00 100.85 ? 249  LEU B HD12 1 
ATOM   9380  H  HD13 . LEU B  1 57  ? 144.471 79.195  123.029 1.00 100.85 ? 249  LEU B HD13 1 
ATOM   9381  H  HD21 . LEU B  1 57  ? 142.002 78.762  121.439 1.00 103.76 ? 249  LEU B HD21 1 
ATOM   9382  H  HD22 . LEU B  1 57  ? 142.948 77.544  121.823 1.00 103.76 ? 249  LEU B HD22 1 
ATOM   9383  H  HD23 . LEU B  1 57  ? 141.408 77.508  122.213 1.00 103.76 ? 249  LEU B HD23 1 
ATOM   9384  N  N    . GLU B  1 58  ? 142.164 75.607  126.981 1.00 88.25  ? 250  GLU B N    1 
ATOM   9385  C  CA   . GLU B  1 58  ? 142.686 74.557  127.849 1.00 93.44  ? 250  GLU B CA   1 
ATOM   9386  C  C    . GLU B  1 58  ? 141.946 73.239  127.634 1.00 91.44  ? 250  GLU B C    1 
ATOM   9387  O  O    . GLU B  1 58  ? 142.574 72.175  127.594 1.00 91.53  ? 250  GLU B O    1 
ATOM   9388  C  CB   . GLU B  1 58  ? 142.614 74.988  129.313 1.00 101.98 ? 250  GLU B CB   1 
ATOM   9389  C  CG   . GLU B  1 58  ? 143.384 74.060  130.246 1.00 110.34 ? 250  GLU B CG   1 
ATOM   9390  C  CD   . GLU B  1 58  ? 143.688 74.687  131.594 1.00 117.49 ? 250  GLU B CD   1 
ATOM   9391  O  OE1  . GLU B  1 58  ? 143.546 75.921  131.727 1.00 119.76 ? 250  GLU B OE1  1 
ATOM   9392  O  OE2  . GLU B  1 58  ? 144.074 73.944  132.520 1.00 122.13 ? 250  GLU B OE2  1 
ATOM   9393  H  H    . GLU B  1 58  ? 141.740 76.237  127.385 1.00 105.65 ? 250  GLU B H    1 
ATOM   9394  H  HA   . GLU B  1 58  ? 143.619 74.409  127.631 1.00 111.88 ? 250  GLU B HA   1 
ATOM   9395  H  HB2  . GLU B  1 58  ? 142.991 75.878  129.398 1.00 122.13 ? 250  GLU B HB2  1 
ATOM   9396  H  HB3  . GLU B  1 58  ? 141.686 74.993  129.595 1.00 122.13 ? 250  GLU B HB3  1 
ATOM   9397  H  HG2  . GLU B  1 58  ? 142.857 73.260  130.400 1.00 132.17 ? 250  GLU B HG2  1 
ATOM   9398  H  HG3  . GLU B  1 58  ? 144.228 73.824  129.829 1.00 132.17 ? 250  GLU B HG3  1 
ATOM   9399  N  N    . LEU B  1 59  ? 140.617 73.280  127.481 1.00 96.19  ? 251  LEU B N    1 
ATOM   9400  C  CA   . LEU B  1 59  ? 139.893 72.049  127.163 1.00 97.32  ? 251  LEU B CA   1 
ATOM   9401  C  C    . LEU B  1 59  ? 140.286 71.515  125.793 1.00 91.57  ? 251  LEU B C    1 
ATOM   9402  O  O    . LEU B  1 59  ? 140.400 70.298  125.606 1.00 93.02  ? 251  LEU B O    1 
ATOM   9403  C  CB   . LEU B  1 59  ? 138.374 72.253  127.226 1.00 99.33  ? 251  LEU B CB   1 
ATOM   9404  C  CG   . LEU B  1 59  ? 137.621 72.402  128.559 1.00 100.77 ? 251  LEU B CG   1 
ATOM   9405  C  CD1  . LEU B  1 59  ? 138.542 72.340  129.771 1.00 102.25 ? 251  LEU B CD1  1 
ATOM   9406  C  CD2  . LEU B  1 59  ? 136.749 73.654  128.594 1.00 100.42 ? 251  LEU B CD2  1 
ATOM   9407  H  H    . LEU B  1 59  ? 140.127 73.983  127.553 1.00 115.18 ? 251  LEU B H    1 
ATOM   9408  H  HA   . LEU B  1 59  ? 140.126 71.375  127.820 1.00 116.53 ? 251  LEU B HA   1 
ATOM   9409  H  HB2  . LEU B  1 59  ? 138.176 73.055  126.717 1.00 118.94 ? 251  LEU B HB2  1 
ATOM   9410  H  HB3  . LEU B  1 59  ? 137.969 71.497  126.774 1.00 118.94 ? 251  LEU B HB3  1 
ATOM   9411  H  HG   . LEU B  1 59  ? 137.017 71.647  128.636 1.00 120.67 ? 251  LEU B HG   1 
ATOM   9412  H  HD11 . LEU B  1 59  ? 138.011 72.439  130.576 1.00 122.46 ? 251  LEU B HD11 1 
ATOM   9413  H  HD12 . LEU B  1 59  ? 138.996 71.483  129.777 1.00 122.46 ? 251  LEU B HD12 1 
ATOM   9414  H  HD13 . LEU B  1 59  ? 139.190 73.059  129.711 1.00 122.46 ? 251  LEU B HD13 1 
ATOM   9415  H  HD21 . LEU B  1 59  ? 136.298 73.701  129.452 1.00 120.26 ? 251  LEU B HD21 1 
ATOM   9416  H  HD22 . LEU B  1 59  ? 137.312 74.435  128.474 1.00 120.26 ? 251  LEU B HD22 1 
ATOM   9417  H  HD23 . LEU B  1 59  ? 136.096 73.604  127.879 1.00 120.26 ? 251  LEU B HD23 1 
ATOM   9418  N  N    . VAL B  1 60  ? 140.507 72.402  124.824 1.00 82.06  ? 252  VAL B N    1 
ATOM   9419  C  CA   . VAL B  1 60  ? 140.904 71.949  123.495 1.00 77.88  ? 252  VAL B CA   1 
ATOM   9420  C  C    . VAL B  1 60  ? 142.284 71.309  123.548 1.00 78.81  ? 252  VAL B C    1 
ATOM   9421  O  O    . VAL B  1 60  ? 142.489 70.197  123.049 1.00 79.52  ? 252  VAL B O    1 
ATOM   9422  C  CB   . VAL B  1 60  ? 140.861 73.116  122.492 1.00 76.58  ? 252  VAL B CB   1 
ATOM   9423  C  CG1  . VAL B  1 60  ? 141.564 72.737  121.184 1.00 76.98  ? 252  VAL B CG1  1 
ATOM   9424  C  CG2  . VAL B  1 60  ? 139.422 73.527  122.222 1.00 76.96  ? 252  VAL B CG2  1 
ATOM   9425  H  H    . VAL B  1 60  ? 140.436 73.255  124.908 1.00 98.23  ? 252  VAL B H    1 
ATOM   9426  H  HA   . VAL B  1 60  ? 140.275 71.275  123.193 1.00 93.20  ? 252  VAL B HA   1 
ATOM   9427  H  HB   . VAL B  1 60  ? 141.325 73.878  122.873 1.00 91.64  ? 252  VAL B HB   1 
ATOM   9428  H  HG11 . VAL B  1 60  ? 141.522 73.489  120.574 1.00 92.12  ? 252  VAL B HG11 1 
ATOM   9429  H  HG12 . VAL B  1 60  ? 142.490 72.517  121.376 1.00 92.12  ? 252  VAL B HG12 1 
ATOM   9430  H  HG13 . VAL B  1 60  ? 141.115 71.969  120.796 1.00 92.12  ? 252  VAL B HG13 1 
ATOM   9431  H  HG21 . VAL B  1 60  ? 139.418 74.262  121.589 1.00 92.10  ? 252  VAL B HG21 1 
ATOM   9432  H  HG22 . VAL B  1 60  ? 138.942 72.769  121.853 1.00 92.10  ? 252  VAL B HG22 1 
ATOM   9433  H  HG23 . VAL B  1 60  ? 139.012 73.805  123.056 1.00 92.10  ? 252  VAL B HG23 1 
ATOM   9434  N  N    . TYR B  1 61  ? 143.248 71.996  124.164 1.00 81.78  ? 253  TYR B N    1 
ATOM   9435  C  CA   . TYR B  1 61  ? 144.618 71.497  124.169 1.00 85.79  ? 253  TYR B CA   1 
ATOM   9436  C  C    . TYR B  1 61  ? 144.720 70.162  124.897 1.00 88.70  ? 253  TYR B C    1 
ATOM   9437  O  O    . TYR B  1 61  ? 145.501 69.288  124.500 1.00 89.12  ? 253  TYR B O    1 
ATOM   9438  C  CB   . TYR B  1 61  ? 145.549 72.528  124.804 1.00 90.23  ? 253  TYR B CB   1 
ATOM   9439  C  CG   . TYR B  1 61  ? 147.012 72.214  124.597 1.00 95.31  ? 253  TYR B CG   1 
ATOM   9440  C  CD1  . TYR B  1 61  ? 147.699 72.723  123.503 1.00 94.38  ? 253  TYR B CD1  1 
ATOM   9441  C  CD2  . TYR B  1 61  ? 147.701 71.397  125.482 1.00 98.56  ? 253  TYR B CD2  1 
ATOM   9442  C  CE1  . TYR B  1 61  ? 149.033 72.436  123.301 1.00 96.86  ? 253  TYR B CE1  1 
ATOM   9443  C  CE2  . TYR B  1 61  ? 149.036 71.104  125.289 1.00 101.90 ? 253  TYR B CE2  1 
ATOM   9444  C  CZ   . TYR B  1 61  ? 149.697 71.625  124.196 1.00 100.92 ? 253  TYR B CZ   1 
ATOM   9445  O  OH   . TYR B  1 61  ? 151.028 71.337  123.998 1.00 103.33 ? 253  TYR B OH   1 
ATOM   9446  H  H    . TYR B  1 61  ? 143.135 72.740  124.579 1.00 97.88  ? 253  TYR B H    1 
ATOM   9447  H  HA   . TYR B  1 61  ? 144.906 71.360  123.253 1.00 102.70 ? 253  TYR B HA   1 
ATOM   9448  H  HB2  . TYR B  1 61  ? 145.372 73.397  124.412 1.00 108.03 ? 253  TYR B HB2  1 
ATOM   9449  H  HB3  . TYR B  1 61  ? 145.383 72.557  125.759 1.00 108.03 ? 253  TYR B HB3  1 
ATOM   9450  H  HD1  . TYR B  1 61  ? 147.252 73.270  122.897 1.00 113.01 ? 253  TYR B HD1  1 
ATOM   9451  H  HD2  . TYR B  1 61  ? 147.257 71.045  126.219 1.00 118.02 ? 253  TYR B HD2  1 
ATOM   9452  H  HE1  . TYR B  1 61  ? 149.481 72.786  122.565 1.00 115.98 ? 253  TYR B HE1  1 
ATOM   9453  H  HE2  . TYR B  1 61  ? 149.487 70.557  125.891 1.00 122.03 ? 253  TYR B HE2  1 
ATOM   9454  H  HH   . TYR B  1 61  ? 151.308 70.836  124.612 1.00 123.74 ? 253  TYR B HH   1 
ATOM   9455  N  N    . ASN B  1 62  ? 143.947 69.985  125.968 1.00 93.26  ? 254  ASN B N    1 
ATOM   9456  C  CA   . ASN B  1 62  ? 143.924 68.733  126.711 1.00 96.30  ? 254  ASN B CA   1 
ATOM   9457  C  C    . ASN B  1 62  ? 142.891 67.748  126.167 1.00 94.88  ? 254  ASN B C    1 
ATOM   9458  O  O    . ASN B  1 62  ? 142.554 66.773  126.849 1.00 97.55  ? 254  ASN B O    1 
ATOM   9459  C  CB   . ASN B  1 62  ? 143.672 69.011  128.195 1.00 99.28  ? 254  ASN B CB   1 
ATOM   9460  C  CG   . ASN B  1 62  ? 144.801 69.795  128.837 1.00 98.00  ? 254  ASN B CG   1 
ATOM   9461  O  OD1  . ASN B  1 62  ? 145.959 69.385  128.787 1.00 99.49  ? 254  ASN B OD1  1 
ATOM   9462  N  ND2  . ASN B  1 62  ? 144.471 70.936  129.431 1.00 96.71  ? 254  ASN B ND2  1 
ATOM   9463  H  H    . ASN B  1 62  ? 143.420 70.586  126.286 1.00 111.66 ? 254  ASN B H    1 
ATOM   9464  H  HA   . ASN B  1 62  ? 144.795 68.313  126.636 1.00 115.31 ? 254  ASN B HA   1 
ATOM   9465  H  HB2  . ASN B  1 62  ? 142.856 69.529  128.286 1.00 118.88 ? 254  ASN B HB2  1 
ATOM   9466  H  HB3  . ASN B  1 62  ? 143.585 68.168  128.666 1.00 118.88 ? 254  ASN B HB3  1 
ATOM   9467  H  HD21 . ASN B  1 62  ? 145.077 71.416  129.808 1.00 115.80 ? 254  ASN B HD21 1 
ATOM   9468  H  HD22 . ASN B  1 62  ? 143.650 71.192  129.444 1.00 115.80 ? 254  ASN B HD22 1 
ATOM   9469  N  N    . GLN B  1 63  ? 142.388 67.984  124.955 1.00 89.79  ? 255  GLN B N    1 
ATOM   9470  C  CA   . GLN B  1 63  ? 141.570 67.012  124.228 1.00 91.48  ? 255  GLN B CA   1 
ATOM   9471  C  C    . GLN B  1 63  ? 140.317 66.618  125.012 1.00 91.52  ? 255  GLN B C    1 
ATOM   9472  O  O    . GLN B  1 63  ? 139.977 65.440  125.137 1.00 95.20  ? 255  GLN B O    1 
ATOM   9473  C  CB   . GLN B  1 63  ? 142.401 65.779  123.869 1.00 96.59  ? 255  GLN B CB   1 
ATOM   9474  C  CG   . GLN B  1 63  ? 143.592 66.098  122.981 1.00 101.30 ? 255  GLN B CG   1 
ATOM   9475  C  CD   . GLN B  1 63  ? 144.489 64.901  122.746 1.00 105.27 ? 255  GLN B CD   1 
ATOM   9476  O  OE1  . GLN B  1 63  ? 144.936 64.249  123.689 1.00 109.53 ? 255  GLN B OE1  1 
ATOM   9477  N  NE2  . GLN B  1 63  ? 144.764 64.609  121.480 1.00 105.36 ? 255  GLN B NE2  1 
ATOM   9478  H  H    . GLN B  1 63  ? 142.509 68.717  124.523 1.00 107.50 ? 255  GLN B H    1 
ATOM   9479  H  HA   . GLN B  1 63  ? 141.277 67.418  123.398 1.00 109.52 ? 255  GLN B HA   1 
ATOM   9480  H  HB2  . GLN B  1 63  ? 142.736 65.377  124.685 1.00 115.66 ? 255  GLN B HB2  1 
ATOM   9481  H  HB3  . GLN B  1 63  ? 141.837 65.147  123.397 1.00 115.66 ? 255  GLN B HB3  1 
ATOM   9482  H  HG2  . GLN B  1 63  ? 143.269 66.404  122.119 1.00 121.32 ? 255  GLN B HG2  1 
ATOM   9483  H  HG3  . GLN B  1 63  ? 144.123 66.792  123.402 1.00 121.32 ? 255  GLN B HG3  1 
ATOM   9484  H  HE21 . GLN B  1 63  ? 144.434 65.088  120.847 1.00 126.19 ? 255  GLN B HE21 1 
ATOM   9485  H  HE22 . GLN B  1 63  ? 145.270 63.939  121.294 1.00 126.19 ? 255  GLN B HE22 1 
ATOM   9486  N  N    . HIS B  1 64  ? 139.629 67.622  125.544 1.00 92.71  ? 256  HIS B N    1 
ATOM   9487  C  CA   . HIS B  1 64  ? 138.274 67.465  126.065 1.00 94.40  ? 256  HIS B CA   1 
ATOM   9488  C  C    . HIS B  1 64  ? 137.306 68.145  125.100 1.00 94.98  ? 256  HIS B C    1 
ATOM   9489  O  O    . HIS B  1 64  ? 136.728 69.195  125.388 1.00 94.40  ? 256  HIS B O    1 
ATOM   9490  C  CB   . HIS B  1 64  ? 138.176 68.043  127.482 1.00 93.77  ? 256  HIS B CB   1 
ATOM   9491  C  CG   . HIS B  1 64  ? 139.177 67.468  128.436 1.00 94.54  ? 256  HIS B CG   1 
ATOM   9492  N  ND1  . HIS B  1 64  ? 139.152 66.149  128.835 1.00 95.42  ? 256  HIS B ND1  1 
ATOM   9493  C  CD2  . HIS B  1 64  ? 140.233 68.033  129.069 1.00 94.19  ? 256  HIS B CD2  1 
ATOM   9494  C  CE1  . HIS B  1 64  ? 140.149 65.926  129.673 1.00 97.49  ? 256  HIS B CE1  1 
ATOM   9495  N  NE2  . HIS B  1 64  ? 140.820 67.053  129.832 1.00 95.40  ? 256  HIS B NE2  1 
ATOM   9496  H  H    . HIS B  1 64  ? 139.932 68.423  125.615 1.00 111.00 ? 256  HIS B H    1 
ATOM   9497  H  HA   . HIS B  1 64  ? 138.053 66.522  126.105 1.00 113.03 ? 256  HIS B HA   1 
ATOM   9498  H  HB2  . HIS B  1 64  ? 138.322 69.001  127.441 1.00 112.28 ? 256  HIS B HB2  1 
ATOM   9499  H  HB3  . HIS B  1 64  ? 137.291 67.859  127.834 1.00 112.28 ? 256  HIS B HB3  1 
ATOM   9500  H  HD2  . HIS B  1 64  ? 140.508 68.919  129.000 1.00 112.78 ? 256  HIS B HD2  1 
ATOM   9501  H  HE1  . HIS B  1 64  ? 140.345 65.114  130.082 1.00 116.74 ? 256  HIS B HE1  1 
ATOM   9502  H  HE2  . HIS B  1 64  ? 141.512 67.156  130.332 1.00 114.24 ? 256  HIS B HE2  1 
ATOM   9503  N  N    . GLU B  1 65  ? 137.134 67.523  123.930 1.00 98.05  ? 257  GLU B N    1 
ATOM   9504  C  CA   . GLU B  1 65  ? 136.455 68.190  122.824 1.00 98.34  ? 257  GLU B CA   1 
ATOM   9505  C  C    . GLU B  1 65  ? 134.991 68.467  123.145 1.00 96.87  ? 257  GLU B C    1 
ATOM   9506  O  O    . GLU B  1 65  ? 134.486 69.560  122.862 1.00 92.79  ? 257  GLU B O    1 
ATOM   9507  C  CB   . GLU B  1 65  ? 136.572 67.344  121.557 1.00 103.91 ? 257  GLU B CB   1 
ATOM   9508  C  CG   . GLU B  1 65  ? 136.327 68.123  120.273 1.00 109.44 ? 257  GLU B CG   1 
ATOM   9509  C  CD   . GLU B  1 65  ? 136.759 67.362  119.034 1.00 114.91 ? 257  GLU B CD   1 
ATOM   9510  O  OE1  . GLU B  1 65  ? 137.393 66.295  119.178 1.00 117.41 ? 257  GLU B OE1  1 
ATOM   9511  O  OE2  . GLU B  1 65  ? 136.463 67.834  117.915 1.00 114.29 ? 257  GLU B OE2  1 
ATOM   9512  H  H    . GLU B  1 65  ? 137.399 66.724  123.756 1.00 117.41 ? 257  GLU B H    1 
ATOM   9513  H  HA   . GLU B  1 65  ? 136.889 69.041  122.656 1.00 117.76 ? 257  GLU B HA   1 
ATOM   9514  H  HB2  . GLU B  1 65  ? 137.467 66.972  121.511 1.00 124.45 ? 257  GLU B HB2  1 
ATOM   9515  H  HB3  . GLU B  1 65  ? 135.920 66.628  121.598 1.00 124.45 ? 257  GLU B HB3  1 
ATOM   9516  H  HG2  . GLU B  1 65  ? 135.379 68.311  120.194 1.00 131.07 ? 257  GLU B HG2  1 
ATOM   9517  H  HG3  . GLU B  1 65  ? 136.829 68.952  120.306 1.00 131.07 ? 257  GLU B HG3  1 
ATOM   9518  N  N    . ASN B  1 66  ? 134.291 67.496  123.733 1.00 102.69 ? 258  ASN B N    1 
ATOM   9519  C  CA   . ASN B  1 66  ? 132.891 67.714  124.084 1.00 103.58 ? 258  ASN B CA   1 
ATOM   9520  C  C    . ASN B  1 66  ? 132.756 68.811  125.131 1.00 101.53 ? 258  ASN B C    1 
ATOM   9521  O  O    . ASN B  1 66  ? 131.859 69.659  125.041 1.00 97.89  ? 258  ASN B O    1 
ATOM   9522  C  CB   . ASN B  1 66  ? 132.263 66.413  124.582 1.00 109.05 ? 258  ASN B CB   1 
ATOM   9523  C  CG   . ASN B  1 66  ? 132.193 65.350  123.505 1.00 113.82 ? 258  ASN B CG   1 
ATOM   9524  O  OD1  . ASN B  1 66  ? 132.527 65.601  122.347 1.00 115.61 ? 258  ASN B OD1  1 
ATOM   9525  N  ND2  . ASN B  1 66  ? 131.752 64.154  123.880 1.00 116.69 ? 258  ASN B ND2  1 
ATOM   9526  H  H    . ASN B  1 66  ? 134.597 66.718  123.935 1.00 122.98 ? 258  ASN B H    1 
ATOM   9527  H  HA   . ASN B  1 66  ? 132.408 67.995  123.291 1.00 124.05 ? 258  ASN B HA   1 
ATOM   9528  H  HB2  . ASN B  1 66  ? 132.796 66.064  125.315 1.00 130.61 ? 258  ASN B HB2  1 
ATOM   9529  H  HB3  . ASN B  1 66  ? 131.359 66.594  124.885 1.00 130.61 ? 258  ASN B HB3  1 
ATOM   9530  H  HD21 . ASN B  1 66  ? 131.694 63.518  123.305 1.00 139.79 ? 258  ASN B HD21 1 
ATOM   9531  H  HD22 . ASN B  1 66  ? 131.527 64.016  124.698 1.00 139.79 ? 258  ASN B HD22 1 
ATOM   9532  N  N    . GLU B  1 67  ? 133.636 68.810  126.133 1.00 102.97 ? 259  GLU B N    1 
ATOM   9533  C  CA   . GLU B  1 67  ? 133.585 69.845  127.160 1.00 101.00 ? 259  GLU B CA   1 
ATOM   9534  C  C    . GLU B  1 67  ? 133.851 71.223  126.567 1.00 97.46  ? 259  GLU B C    1 
ATOM   9535  O  O    . GLU B  1 67  ? 133.206 72.206  126.949 1.00 101.10 ? 259  GLU B O    1 
ATOM   9536  C  CB   . GLU B  1 67  ? 134.597 69.541  128.266 1.00 104.19 ? 259  GLU B CB   1 
ATOM   9537  C  CG   . GLU B  1 67  ? 134.215 68.378  129.179 1.00 109.45 ? 259  GLU B CG   1 
ATOM   9538  C  CD   . GLU B  1 67  ? 134.478 67.017  128.557 1.00 111.69 ? 259  GLU B CD   1 
ATOM   9539  O  OE1  . GLU B  1 67  ? 135.099 66.960  127.475 1.00 110.29 ? 259  GLU B OE1  1 
ATOM   9540  O  OE2  . GLU B  1 67  ? 134.065 66.002  129.158 1.00 114.24 ? 259  GLU B OE2  1 
ATOM   9541  H  H    . GLU B  1 67  ? 134.263 68.231  126.239 1.00 123.32 ? 259  GLU B H    1 
ATOM   9542  H  HA   . GLU B  1 67  ? 132.700 69.854  127.556 1.00 120.95 ? 259  GLU B HA   1 
ATOM   9543  H  HB2  . GLU B  1 67  ? 135.449 69.323  127.855 1.00 124.78 ? 259  GLU B HB2  1 
ATOM   9544  H  HB3  . GLU B  1 67  ? 134.695 70.330  128.821 1.00 124.78 ? 259  GLU B HB3  1 
ATOM   9545  H  HG2  . GLU B  1 67  ? 134.733 68.437  129.997 1.00 131.09 ? 259  GLU B HG2  1 
ATOM   9546  H  HG3  . GLU B  1 67  ? 133.269 68.436  129.382 1.00 131.09 ? 259  GLU B HG3  1 
ATOM   9547  N  N    . ALA B  1 68  ? 134.798 71.317  125.630 1.00 84.26  ? 260  ALA B N    1 
ATOM   9548  C  CA   . ALA B  1 68  ? 135.120 72.606  125.026 1.00 82.00  ? 260  ALA B CA   1 
ATOM   9549  C  C    . ALA B  1 68  ? 133.951 73.144  124.208 1.00 89.32  ? 260  ALA B C    1 
ATOM   9550  O  O    . ALA B  1 68  ? 133.607 74.327  124.308 1.00 90.51  ? 260  ALA B O    1 
ATOM   9551  C  CB   . ALA B  1 68  ? 136.370 72.478  124.156 1.00 79.43  ? 260  ALA B CB   1 
ATOM   9552  H  H    . ALA B  1 68  ? 135.261 70.656  125.332 1.00 100.86 ? 260  ALA B H    1 
ATOM   9553  H  HA   . ALA B  1 68  ? 135.310 73.244  125.731 1.00 98.15  ? 260  ALA B HA   1 
ATOM   9554  H  HB1  . ALA B  1 68  ? 136.570 73.342  123.763 1.00 95.07  ? 260  ALA B HB1  1 
ATOM   9555  H  HB2  . ALA B  1 68  ? 137.112 72.188  124.710 1.00 95.07  ? 260  ALA B HB2  1 
ATOM   9556  H  HB3  . ALA B  1 68  ? 136.204 71.827  123.457 1.00 95.07  ? 260  ALA B HB3  1 
ATOM   9557  N  N    . LYS B  1 69  ? 133.327 72.291  123.391 1.00 108.04 ? 261  LYS B N    1 
ATOM   9558  C  CA   . LYS B  1 69  ? 132.199 72.746  122.583 1.00 112.74 ? 261  LYS B CA   1 
ATOM   9559  C  C    . LYS B  1 69  ? 131.038 73.191  123.463 1.00 110.59 ? 261  LYS B C    1 
ATOM   9560  O  O    . LYS B  1 69  ? 130.417 74.229  123.205 1.00 108.71 ? 261  LYS B O    1 
ATOM   9561  C  CB   . LYS B  1 69  ? 131.750 71.645  121.623 1.00 122.00 ? 261  LYS B CB   1 
ATOM   9562  C  CG   . LYS B  1 69  ? 130.536 72.031  120.786 1.00 129.90 ? 261  LYS B CG   1 
ATOM   9563  C  CD   . LYS B  1 69  ? 130.063 70.891  119.905 1.00 136.99 ? 261  LYS B CD   1 
ATOM   9564  C  CE   . LYS B  1 69  ? 128.806 71.280  119.144 1.00 141.84 ? 261  LYS B CE   1 
ATOM   9565  N  NZ   . LYS B  1 69  ? 128.279 70.174  118.304 1.00 146.02 ? 261  LYS B NZ   1 
ATOM   9566  H  H    . LYS B  1 69  ? 133.533 71.463  123.289 1.00 129.40 ? 261  LYS B H    1 
ATOM   9567  H  HA   . LYS B  1 69  ? 132.480 73.508  122.052 1.00 135.04 ? 261  LYS B HA   1 
ATOM   9568  H  HB2  . LYS B  1 69  ? 132.479 71.442  121.015 1.00 146.15 ? 261  LYS B HB2  1 
ATOM   9569  H  HB3  . LYS B  1 69  ? 131.520 70.856  122.137 1.00 146.15 ? 261  LYS B HB3  1 
ATOM   9570  H  HG2  . LYS B  1 69  ? 129.807 72.278  121.377 1.00 155.64 ? 261  LYS B HG2  1 
ATOM   9571  H  HG3  . LYS B  1 69  ? 130.768 72.779  120.213 1.00 155.64 ? 261  LYS B HG3  1 
ATOM   9572  H  HD2  . LYS B  1 69  ? 130.756 70.673  119.262 1.00 164.14 ? 261  LYS B HD2  1 
ATOM   9573  H  HD3  . LYS B  1 69  ? 129.860 70.120  120.458 1.00 164.14 ? 261  LYS B HD3  1 
ATOM   9574  H  HE2  . LYS B  1 69  ? 128.117 71.530  119.779 1.00 169.96 ? 261  LYS B HE2  1 
ATOM   9575  H  HE3  . LYS B  1 69  ? 129.009 72.029  118.562 1.00 169.96 ? 261  LYS B HE3  1 
ATOM   9576  H  HZ1  . LYS B  1 69  ? 127.545 70.440  117.877 1.00 174.97 ? 261  LYS B HZ1  1 
ATOM   9577  H  HZ2  . LYS B  1 69  ? 128.890 69.928  117.706 1.00 174.97 ? 261  LYS B HZ2  1 
ATOM   9578  H  HZ3  . LYS B  1 69  ? 128.077 69.474  118.816 1.00 174.97 ? 261  LYS B HZ3  1 
ATOM   9579  N  N    . SER B  1 70  ? 130.727 72.418  124.506 1.00 104.50 ? 262  SER B N    1 
ATOM   9580  C  CA   . SER B  1 70  ? 129.661 72.813  125.418 1.00 103.19 ? 262  SER B CA   1 
ATOM   9581  C  C    . SER B  1 70  ? 130.001 74.132  126.095 1.00 99.57  ? 262  SER B C    1 
ATOM   9582  O  O    . SER B  1 70  ? 129.142 75.010  126.239 1.00 99.63  ? 262  SER B O    1 
ATOM   9583  C  CB   . SER B  1 70  ? 129.428 71.718  126.459 1.00 106.57 ? 262  SER B CB   1 
ATOM   9584  O  OG   . SER B  1 70  ? 128.208 71.921  127.153 1.00 109.12 ? 262  SER B OG   1 
ATOM   9585  H  H    . SER B  1 70  ? 131.113 71.675  124.702 1.00 125.15 ? 262  SER B H    1 
ATOM   9586  H  HA   . SER B  1 70  ? 128.840 72.933  124.916 1.00 123.58 ? 262  SER B HA   1 
ATOM   9587  H  HB2  . SER B  1 70  ? 129.396 70.859  126.011 1.00 127.63 ? 262  SER B HB2  1 
ATOM   9588  H  HB3  . SER B  1 70  ? 130.159 71.731  127.098 1.00 127.63 ? 262  SER B HB3  1 
ATOM   9589  H  HG   . SER B  1 70  ? 128.222 72.663  127.547 1.00 130.69 ? 262  SER B HG   1 
ATOM   9590  N  N    . PHE B  1 71  ? 131.257 74.286  126.519 1.00 89.60  ? 263  PHE B N    1 
ATOM   9591  C  CA   . PHE B  1 71  ? 131.695 75.537  127.124 1.00 88.73  ? 263  PHE B CA   1 
ATOM   9592  C  C    . PHE B  1 71  ? 131.541 76.696  126.148 1.00 84.41  ? 263  PHE B C    1 
ATOM   9593  O  O    . PHE B  1 71  ? 131.113 77.791  126.533 1.00 83.39  ? 263  PHE B O    1 
ATOM   9594  C  CB   . PHE B  1 71  ? 133.148 75.398  127.578 1.00 90.59  ? 263  PHE B CB   1 
ATOM   9595  C  CG   . PHE B  1 71  ? 133.689 76.605  128.286 1.00 89.80  ? 263  PHE B CG   1 
ATOM   9596  C  CD1  . PHE B  1 71  ? 133.494 76.772  129.647 1.00 90.55  ? 263  PHE B CD1  1 
ATOM   9597  C  CD2  . PHE B  1 71  ? 134.407 77.565  127.593 1.00 85.49  ? 263  PHE B CD2  1 
ATOM   9598  C  CE1  . PHE B  1 71  ? 133.998 77.879  130.302 1.00 91.19  ? 263  PHE B CE1  1 
ATOM   9599  C  CE2  . PHE B  1 71  ? 134.913 78.673  128.242 1.00 85.43  ? 263  PHE B CE2  1 
ATOM   9600  C  CZ   . PHE B  1 71  ? 134.709 78.831  129.598 1.00 88.66  ? 263  PHE B CZ   1 
ATOM   9601  H  H    . PHE B  1 71  ? 131.868 73.683  126.467 1.00 107.27 ? 263  PHE B H    1 
ATOM   9602  H  HA   . PHE B  1 71  ? 131.150 75.723  127.904 1.00 106.23 ? 263  PHE B HA   1 
ATOM   9603  H  HB2  . PHE B  1 71  ? 133.214 74.645  128.187 1.00 108.46 ? 263  PHE B HB2  1 
ATOM   9604  H  HB3  . PHE B  1 71  ? 133.704 75.239  126.800 1.00 108.46 ? 263  PHE B HB3  1 
ATOM   9605  H  HD1  . PHE B  1 71  ? 133.016 76.133  130.124 1.00 108.41 ? 263  PHE B HD1  1 
ATOM   9606  H  HD2  . PHE B  1 71  ? 134.547 77.464  126.680 1.00 102.34 ? 263  PHE B HD2  1 
ATOM   9607  H  HE1  . PHE B  1 71  ? 133.859 77.983  131.215 1.00 109.18 ? 263  PHE B HE1  1 
ATOM   9608  H  HE2  . PHE B  1 71  ? 135.391 79.313  127.766 1.00 102.26 ? 263  PHE B HE2  1 
ATOM   9609  H  HZ   . PHE B  1 71  ? 135.048 79.577  130.037 1.00 106.14 ? 263  PHE B HZ   1 
ATOM   9610  N  N    . PHE B  1 72  ? 131.881 76.472  124.877 1.00 81.28  ? 264  PHE B N    1 
ATOM   9611  C  CA   . PHE B  1 72  ? 131.769 77.531  123.879 1.00 78.51  ? 264  PHE B CA   1 
ATOM   9612  C  C    . PHE B  1 72  ? 130.315 77.937  123.667 1.00 83.62  ? 264  PHE B C    1 
ATOM   9613  O  O    . PHE B  1 72  ? 129.983 79.127  123.701 1.00 86.00  ? 264  PHE B O    1 
ATOM   9614  C  CB   . PHE B  1 72  ? 132.396 77.075  122.563 1.00 77.56  ? 264  PHE B CB   1 
ATOM   9615  C  CG   . PHE B  1 72  ? 132.628 78.192  121.590 1.00 77.04  ? 264  PHE B CG   1 
ATOM   9616  C  CD1  . PHE B  1 72  ? 131.622 78.604  120.733 1.00 77.52  ? 264  PHE B CD1  1 
ATOM   9617  C  CD2  . PHE B  1 72  ? 133.852 78.836  121.540 1.00 75.65  ? 264  PHE B CD2  1 
ATOM   9618  C  CE1  . PHE B  1 72  ? 131.834 79.636  119.841 1.00 77.00  ? 264  PHE B CE1  1 
ATOM   9619  C  CE2  . PHE B  1 72  ? 134.070 79.867  120.650 1.00 74.80  ? 264  PHE B CE2  1 
ATOM   9620  C  CZ   . PHE B  1 72  ? 133.060 80.268  119.799 1.00 76.50  ? 264  PHE B CZ   1 
ATOM   9621  H  H    . PHE B  1 72  ? 132.175 75.724  124.572 1.00 97.29  ? 264  PHE B H    1 
ATOM   9622  H  HA   . PHE B  1 72  ? 132.256 78.310  124.189 1.00 93.96  ? 264  PHE B HA   1 
ATOM   9623  H  HB2  . PHE B  1 72  ? 133.253 76.661  122.751 1.00 92.83  ? 264  PHE B HB2  1 
ATOM   9624  H  HB3  . PHE B  1 72  ? 131.806 76.431  122.141 1.00 92.83  ? 264  PHE B HB3  1 
ATOM   9625  H  HD1  . PHE B  1 72  ? 130.794 78.181  120.758 1.00 92.78  ? 264  PHE B HD1  1 
ATOM   9626  H  HD2  . PHE B  1 72  ? 134.535 78.569  122.111 1.00 90.53  ? 264  PHE B HD2  1 
ATOM   9627  H  HE1  . PHE B  1 72  ? 131.152 79.904  119.268 1.00 92.16  ? 264  PHE B HE1  1 
ATOM   9628  H  HE2  . PHE B  1 72  ? 134.897 80.291  120.624 1.00 89.51  ? 264  PHE B HE2  1 
ATOM   9629  H  HZ   . PHE B  1 72  ? 133.206 80.963  119.199 1.00 91.55  ? 264  PHE B HZ   1 
ATOM   9630  N  N    . GLU B  1 73  ? 129.432 76.958  123.446 1.00 98.06  ? 265  GLU B N    1 
ATOM   9631  C  CA   . GLU B  1 73  ? 128.021 77.269  123.222 1.00 105.07 ? 265  GLU B CA   1 
ATOM   9632  C  C    . GLU B  1 73  ? 127.455 78.092  124.369 1.00 100.64 ? 265  GLU B C    1 
ATOM   9633  O  O    . GLU B  1 73  ? 126.651 79.006  124.155 1.00 98.37  ? 265  GLU B O    1 
ATOM   9634  C  CB   . GLU B  1 73  ? 127.204 75.989  123.057 1.00 115.77 ? 265  GLU B CB   1 
ATOM   9635  C  CG   . GLU B  1 73  ? 127.204 75.407  121.659 1.00 124.30 ? 265  GLU B CG   1 
ATOM   9636  C  CD   . GLU B  1 73  ? 126.445 74.098  121.587 1.00 133.77 ? 265  GLU B CD   1 
ATOM   9637  O  OE1  . GLU B  1 73  ? 126.931 73.161  120.922 1.00 136.43 ? 265  GLU B OE1  1 
ATOM   9638  O  OE2  . GLU B  1 73  ? 125.365 74.003  122.212 1.00 136.76 ? 265  GLU B OE2  1 
ATOM   9639  H  H    . GLU B  1 73  ? 129.622 76.120  123.421 1.00 117.42 ? 265  GLU B H    1 
ATOM   9640  H  HA   . GLU B  1 73  ? 127.936 77.788  122.407 1.00 125.83 ? 265  GLU B HA   1 
ATOM   9641  H  HB2  . GLU B  1 73  ? 127.563 75.314  123.655 1.00 138.68 ? 265  GLU B HB2  1 
ATOM   9642  H  HB3  . GLU B  1 73  ? 126.283 76.178  123.296 1.00 138.68 ? 265  GLU B HB3  1 
ATOM   9643  H  HG2  . GLU B  1 73  ? 126.781 76.036  121.053 1.00 148.91 ? 265  GLU B HG2  1 
ATOM   9644  H  HG3  . GLU B  1 73  ? 128.119 75.241  121.383 1.00 148.91 ? 265  GLU B HG3  1 
ATOM   9645  N  N    . LYS B  1 74  ? 127.863 77.776  125.596 1.00 99.77  ? 266  LYS B N    1 
ATOM   9646  C  CA   . LYS B  1 74  ? 127.219 78.345  126.770 1.00 101.81 ? 266  LYS B CA   1 
ATOM   9647  C  C    . LYS B  1 74  ? 127.598 79.806  126.977 1.00 99.93  ? 266  LYS B C    1 
ATOM   9648  O  O    . LYS B  1 74  ? 126.793 80.580  127.509 1.00 101.73 ? 266  LYS B O    1 
ATOM   9649  C  CB   . LYS B  1 74  ? 127.611 77.518  127.998 1.00 104.81 ? 266  LYS B CB   1 
ATOM   9650  C  CG   . LYS B  1 74  ? 127.018 77.965  129.328 1.00 109.98 ? 266  LYS B CG   1 
ATOM   9651  C  CD   . LYS B  1 74  ? 125.602 77.448  129.517 1.00 114.26 ? 266  LYS B CD   1 
ATOM   9652  C  CE   . LYS B  1 74  ? 125.063 77.805  130.894 1.00 116.94 ? 266  LYS B CE   1 
ATOM   9653  N  NZ   . LYS B  1 74  ? 125.825 77.139  131.992 1.00 119.20 ? 266  LYS B NZ   1 
ATOM   9654  H  H    . LYS B  1 74  ? 128.509 77.236  125.773 1.00 119.47 ? 266  LYS B H    1 
ATOM   9655  H  HA   . LYS B  1 74  ? 126.256 78.293  126.664 1.00 121.93 ? 266  LYS B HA   1 
ATOM   9656  H  HB2  . LYS B  1 74  ? 127.329 76.602  127.850 1.00 125.52 ? 266  LYS B HB2  1 
ATOM   9657  H  HB3  . LYS B  1 74  ? 128.577 77.547  128.089 1.00 125.52 ? 266  LYS B HB3  1 
ATOM   9658  H  HG2  . LYS B  1 74  ? 127.565 77.624  130.053 1.00 131.73 ? 266  LYS B HG2  1 
ATOM   9659  H  HG3  . LYS B  1 74  ? 126.992 78.935  129.356 1.00 131.73 ? 266  LYS B HG3  1 
ATOM   9660  H  HD2  . LYS B  1 74  ? 125.023 77.847  128.850 1.00 136.86 ? 266  LYS B HD2  1 
ATOM   9661  H  HD3  . LYS B  1 74  ? 125.600 76.481  129.430 1.00 136.86 ? 266  LYS B HD3  1 
ATOM   9662  H  HE2  . LYS B  1 74  ? 125.127 78.764  131.022 1.00 140.08 ? 266  LYS B HE2  1 
ATOM   9663  H  HE3  . LYS B  1 74  ? 124.137 77.522  130.956 1.00 140.08 ? 266  LYS B HE3  1 
ATOM   9664  H  HZ1  . LYS B  1 74  ? 125.484 77.369  132.781 1.00 142.79 ? 266  LYS B HZ1  1 
ATOM   9665  H  HZ2  . LYS B  1 74  ? 125.777 76.255  131.902 1.00 142.79 ? 266  LYS B HZ2  1 
ATOM   9666  H  HZ3  . LYS B  1 74  ? 126.679 77.387  131.962 1.00 142.79 ? 266  LYS B HZ3  1 
ATOM   9667  N  N    . PHE B  1 75  ? 128.800 80.209  126.557 1.00 90.74  ? 267  PHE B N    1 
ATOM   9668  C  CA   . PHE B  1 75  ? 129.332 81.514  126.928 1.00 89.86  ? 267  PHE B CA   1 
ATOM   9669  C  C    . PHE B  1 75  ? 129.794 82.396  125.773 1.00 89.25  ? 267  PHE B C    1 
ATOM   9670  O  O    . PHE B  1 75  ? 130.095 83.570  126.016 1.00 87.65  ? 267  PHE B O    1 
ATOM   9671  C  CB   . PHE B  1 75  ? 130.501 81.322  127.904 1.00 88.86  ? 267  PHE B CB   1 
ATOM   9672  C  CG   . PHE B  1 75  ? 130.099 80.658  129.191 1.00 90.51  ? 267  PHE B CG   1 
ATOM   9673  C  CD1  . PHE B  1 75  ? 129.032 81.141  129.932 1.00 90.56  ? 267  PHE B CD1  1 
ATOM   9674  C  CD2  . PHE B  1 75  ? 130.758 79.526  129.638 1.00 92.08  ? 267  PHE B CD2  1 
ATOM   9675  C  CE1  . PHE B  1 75  ? 128.651 80.527  131.107 1.00 90.69  ? 267  PHE B CE1  1 
ATOM   9676  C  CE2  . PHE B  1 75  ? 130.380 78.905  130.814 1.00 94.17  ? 267  PHE B CE2  1 
ATOM   9677  C  CZ   . PHE B  1 75  ? 129.322 79.404  131.546 1.00 92.75  ? 267  PHE B CZ   1 
ATOM   9678  H  H    . PHE B  1 75  ? 129.323 79.744  126.058 1.00 108.64 ? 267  PHE B H    1 
ATOM   9679  H  HA   . PHE B  1 75  ? 128.638 82.000  127.400 1.00 107.59 ? 267  PHE B HA   1 
ATOM   9680  H  HB2  . PHE B  1 75  ? 131.176 80.769  127.481 1.00 106.38 ? 267  PHE B HB2  1 
ATOM   9681  H  HB3  . PHE B  1 75  ? 130.875 82.191  128.121 1.00 106.38 ? 267  PHE B HB3  1 
ATOM   9682  H  HD1  . PHE B  1 75  ? 128.576 81.898  129.640 1.00 108.42 ? 267  PHE B HD1  1 
ATOM   9683  H  HD2  . PHE B  1 75  ? 131.472 79.185  129.148 1.00 110.25 ? 267  PHE B HD2  1 
ATOM   9684  H  HE1  . PHE B  1 75  ? 127.938 80.865  131.600 1.00 108.58 ? 267  PHE B HE1  1 
ATOM   9685  H  HE2  . PHE B  1 75  ? 130.835 78.150  131.109 1.00 112.75 ? 267  PHE B HE2  1 
ATOM   9686  H  HZ   . PHE B  1 75  ? 129.067 78.989  132.338 1.00 111.05 ? 267  PHE B HZ   1 
ATOM   9687  N  N    . HIS B  1 76  ? 129.856 81.894  124.538 1.00 89.22  ? 268  HIS B N    1 
ATOM   9688  C  CA   . HIS B  1 76  ? 130.388 82.712  123.450 1.00 89.16  ? 268  HIS B CA   1 
ATOM   9689  C  C    . HIS B  1 76  ? 129.478 83.891  123.123 1.00 91.19  ? 268  HIS B C    1 
ATOM   9690  O  O    . HIS B  1 76  ? 129.962 84.936  122.673 1.00 91.43  ? 268  HIS B O    1 
ATOM   9691  C  CB   . HIS B  1 76  ? 130.610 81.856  122.204 1.00 90.22  ? 268  HIS B CB   1 
ATOM   9692  C  CG   . HIS B  1 76  ? 129.353 81.549  121.452 1.00 92.91  ? 268  HIS B CG   1 
ATOM   9693  N  ND1  . HIS B  1 76  ? 128.573 80.447  121.727 1.00 95.05  ? 268  HIS B ND1  1 
ATOM   9694  C  CD2  . HIS B  1 76  ? 128.741 82.200  120.436 1.00 92.29  ? 268  HIS B CD2  1 
ATOM   9695  C  CE1  . HIS B  1 76  ? 127.534 80.432  120.912 1.00 94.94  ? 268  HIS B CE1  1 
ATOM   9696  N  NE2  . HIS B  1 76  ? 127.610 81.486  120.122 1.00 93.70  ? 268  HIS B NE2  1 
ATOM   9697  H  H    . HIS B  1 76  ? 129.603 81.104  124.309 1.00 106.82 ? 268  HIS B H    1 
ATOM   9698  H  HA   . HIS B  1 76  ? 131.249 83.069  123.721 1.00 106.74 ? 268  HIS B HA   1 
ATOM   9699  H  HB2  . HIS B  1 76  ? 131.207 82.327  121.602 1.00 108.02 ? 268  HIS B HB2  1 
ATOM   9700  H  HB3  . HIS B  1 76  ? 131.009 81.013  122.470 1.00 108.02 ? 268  HIS B HB3  1 
ATOM   9701  H  HD1  . HIS B  1 76  ? 128.737 79.860  122.334 1.00 113.82 ? 268  HIS B HD1  1 
ATOM   9702  H  HD2  . HIS B  1 76  ? 129.029 82.985  120.029 1.00 110.50 ? 268  HIS B HD2  1 
ATOM   9703  H  HE1  . HIS B  1 76  ? 126.861 79.790  120.900 1.00 113.68 ? 268  HIS B HE1  1 
ATOM   9704  N  N    . GLY B  1 77  ? 128.170 83.753  123.338 1.00 87.63  ? 269  GLY B N    1 
ATOM   9705  C  CA   . GLY B  1 77  ? 127.256 84.854  123.099 1.00 88.22  ? 269  GLY B CA   1 
ATOM   9706  C  C    . GLY B  1 77  ? 127.276 85.938  124.154 1.00 89.46  ? 269  GLY B C    1 
ATOM   9707  O  O    . GLY B  1 77  ? 126.717 87.016  123.928 1.00 86.03  ? 269  GLY B O    1 
ATOM   9708  H  H    . GLY B  1 77  ? 127.794 83.033  123.620 1.00 104.91 ? 269  GLY B H    1 
ATOM   9709  H  HA2  . GLY B  1 77  ? 127.472 85.263  122.246 1.00 105.62 ? 269  GLY B HA2  1 
ATOM   9710  H  HA3  . GLY B  1 77  ? 126.352 84.507  123.044 1.00 105.62 ? 269  GLY B HA3  1 
ATOM   9711  N  N    . ASP B  1 78  ? 127.910 85.679  125.296 1.00 102.00 ? 270  ASP B N    1 
ATOM   9712  C  CA   . ASP B  1 78  ? 128.003 86.649  126.378 1.00 102.15 ? 270  ASP B CA   1 
ATOM   9713  C  C    . ASP B  1 78  ? 129.171 87.615  126.223 1.00 97.20  ? 270  ASP B C    1 
ATOM   9714  O  O    . ASP B  1 78  ? 129.275 88.563  127.009 1.00 96.68  ? 270  ASP B O    1 
ATOM   9715  C  CB   . ASP B  1 78  ? 128.135 85.922  127.720 1.00 107.74 ? 270  ASP B CB   1 
ATOM   9716  C  CG   . ASP B  1 78  ? 126.980 84.980  127.989 1.00 115.51 ? 270  ASP B CG   1 
ATOM   9717  O  OD1  . ASP B  1 78  ? 126.010 84.985  127.201 1.00 118.85 ? 270  ASP B OD1  1 
ATOM   9718  O  OD2  . ASP B  1 78  ? 127.044 84.233  128.989 1.00 117.15 ? 270  ASP B OD2  1 
ATOM   9719  H  H    . ASP B  1 78  ? 128.300 84.932  125.469 1.00 122.15 ? 270  ASP B H    1 
ATOM   9720  H  HA   . ASP B  1 78  ? 127.186 87.171  126.401 1.00 122.33 ? 270  ASP B HA   1 
ATOM   9721  H  HB2  . ASP B  1 78  ? 128.953 85.401  127.719 1.00 129.04 ? 270  ASP B HB2  1 
ATOM   9722  H  HB3  . ASP B  1 78  ? 128.160 86.578  128.434 1.00 129.04 ? 270  ASP B HB3  1 
ATOM   9723  N  N    . GLN B  1 79  ? 130.047 87.403  125.246 1.00 88.98  ? 271  GLN B N    1 
ATOM   9724  C  CA   . GLN B  1 79  ? 131.222 88.246  125.098 1.00 84.30  ? 271  GLN B CA   1 
ATOM   9725  C  C    . GLN B  1 79  ? 130.878 89.545  124.376 1.00 81.54  ? 271  GLN B C    1 
ATOM   9726  O  O    . GLN B  1 79  ? 129.878 89.648  123.660 1.00 81.15  ? 271  GLN B O    1 
ATOM   9727  C  CB   . GLN B  1 79  ? 132.319 87.507  124.332 1.00 82.12  ? 271  GLN B CB   1 
ATOM   9728  C  CG   . GLN B  1 79  ? 132.674 86.160  124.923 1.00 80.45  ? 271  GLN B CG   1 
ATOM   9729  C  CD   . GLN B  1 79  ? 132.974 86.248  126.405 1.00 77.65  ? 271  GLN B CD   1 
ATOM   9730  O  OE1  . GLN B  1 79  ? 133.667 87.161  126.856 1.00 73.98  ? 271  GLN B OE1  1 
ATOM   9731  N  NE2  . GLN B  1 79  ? 132.444 85.304  127.173 1.00 82.56  ? 271  GLN B NE2  1 
ATOM   9732  H  H    . GLN B  1 79  ? 129.983 86.779  124.658 1.00 106.53 ? 271  GLN B H    1 
ATOM   9733  H  HA   . GLN B  1 79  ? 131.566 88.471  125.977 1.00 100.91 ? 271  GLN B HA   1 
ATOM   9734  H  HB2  . GLN B  1 79  ? 132.020 87.362  123.420 1.00 98.30  ? 271  GLN B HB2  1 
ATOM   9735  H  HB3  . GLN B  1 79  ? 133.121 88.052  124.331 1.00 98.30  ? 271  GLN B HB3  1 
ATOM   9736  H  HG2  . GLN B  1 79  ? 131.928 85.553  124.802 1.00 96.29  ? 271  GLN B HG2  1 
ATOM   9737  H  HG3  . GLN B  1 79  ? 133.462 85.814  124.476 1.00 96.29  ? 271  GLN B HG3  1 
ATOM   9738  H  HE21 . GLN B  1 79  ? 131.964 84.684  126.821 1.00 98.82  ? 271  GLN B HE21 1 
ATOM   9739  H  HE22 . GLN B  1 79  ? 132.585 85.311  128.021 1.00 98.82  ? 271  GLN B HE22 1 
ATOM   9740  N  N    . GLU B  1 80  ? 131.744 90.538  124.558 1.00 75.55  ? 272  GLU B N    1 
ATOM   9741  C  CA   . GLU B  1 80  ? 131.544 91.833  123.925 1.00 79.06  ? 272  GLU B CA   1 
ATOM   9742  C  C    . GLU B  1 80  ? 131.478 91.674  122.411 1.00 81.65  ? 272  GLU B C    1 
ATOM   9743  O  O    . GLU B  1 80  ? 132.076 90.765  121.829 1.00 76.85  ? 272  GLU B O    1 
ATOM   9744  C  CB   . GLU B  1 80  ? 132.673 92.794  124.302 1.00 81.68  ? 272  GLU B CB   1 
ATOM   9745  C  CG   . GLU B  1 80  ? 132.736 93.153  125.785 1.00 86.22  ? 272  GLU B CG   1 
ATOM   9746  C  CD   . GLU B  1 80  ? 131.686 94.173  126.194 1.00 88.11  ? 272  GLU B CD   1 
ATOM   9747  O  OE1  . GLU B  1 80  ? 130.975 94.689  125.306 1.00 88.80  ? 272  GLU B OE1  1 
ATOM   9748  O  OE2  . GLU B  1 80  ? 131.574 94.461  127.404 1.00 86.07  ? 272  GLU B OE2  1 
ATOM   9749  H  H    . GLU B  1 80  ? 132.452 90.486  125.043 1.00 90.41  ? 272  GLU B H    1 
ATOM   9750  H  HA   . GLU B  1 80  ? 130.705 92.213  124.229 1.00 94.62  ? 272  GLU B HA   1 
ATOM   9751  H  HB2  . GLU B  1 80  ? 133.520 92.386  124.063 1.00 97.77  ? 272  GLU B HB2  1 
ATOM   9752  H  HB3  . GLU B  1 80  ? 132.557 93.619  123.805 1.00 97.77  ? 272  GLU B HB3  1 
ATOM   9753  H  HG2  . GLU B  1 80  ? 132.594 92.351  126.311 1.00 103.22 ? 272  GLU B HG2  1 
ATOM   9754  H  HG3  . GLU B  1 80  ? 133.609 93.528  125.982 1.00 103.22 ? 272  GLU B HG3  1 
ATOM   9755  N  N    . CYS B  1 81  ? 130.734 92.578  121.772 1.00 91.82  ? 273  CYS B N    1 
ATOM   9756  C  CA   . CYS B  1 81  ? 130.542 92.491  120.330 1.00 96.00  ? 273  CYS B CA   1 
ATOM   9757  C  C    . CYS B  1 81  ? 131.853 92.645  119.570 1.00 89.09  ? 273  CYS B C    1 
ATOM   9758  O  O    . CYS B  1 81  ? 131.993 92.104  118.468 1.00 88.73  ? 273  CYS B O    1 
ATOM   9759  C  CB   . CYS B  1 81  ? 129.538 93.550  119.874 1.00 104.30 ? 273  CYS B CB   1 
ATOM   9760  S  SG   . CYS B  1 81  ? 129.993 95.242  120.323 1.00 112.72 ? 273  CYS B SG   1 
ATOM   9761  H  H    . CYS B  1 81  ? 130.336 93.242  122.147 1.00 109.93 ? 273  CYS B H    1 
ATOM   9762  H  HA   . CYS B  1 81  ? 130.174 91.619  120.115 1.00 114.96 ? 273  CYS B HA   1 
ATOM   9763  H  HB2  . CYS B  1 81  ? 129.462 93.511  118.907 1.00 124.91 ? 273  CYS B HB2  1 
ATOM   9764  H  HB3  . CYS B  1 81  ? 128.678 93.358  120.278 1.00 124.91 ? 273  CYS B HB3  1 
ATOM   9765  H  HG   . CYS B  1 81  ? 129.147 95.993  119.922 1.00 135.02 ? 273  CYS B HG   1 
ATOM   9766  N  N    . TYR B  1 82  ? 132.824 93.368  120.131 1.00 82.99  ? 274  TYR B N    1 
ATOM   9767  C  CA   . TYR B  1 82  ? 134.077 93.591  119.418 1.00 81.10  ? 274  TYR B CA   1 
ATOM   9768  C  C    . TYR B  1 82  ? 135.032 92.406  119.503 1.00 80.73  ? 274  TYR B C    1 
ATOM   9769  O  O    . TYR B  1 82  ? 136.158 92.506  119.005 1.00 81.47  ? 274  TYR B O    1 
ATOM   9770  C  CB   . TYR B  1 82  ? 134.784 94.859  119.920 1.00 81.33  ? 274  TYR B CB   1 
ATOM   9771  C  CG   . TYR B  1 82  ? 134.809 95.064  121.420 1.00 80.22  ? 274  TYR B CG   1 
ATOM   9772  C  CD1  . TYR B  1 82  ? 135.749 94.420  122.214 1.00 79.85  ? 274  TYR B CD1  1 
ATOM   9773  C  CD2  . TYR B  1 82  ? 133.922 95.938  122.036 1.00 78.37  ? 274  TYR B CD2  1 
ATOM   9774  C  CE1  . TYR B  1 82  ? 135.786 94.617  123.582 1.00 80.09  ? 274  TYR B CE1  1 
ATOM   9775  C  CE2  . TYR B  1 82  ? 133.952 96.143  123.404 1.00 80.52  ? 274  TYR B CE2  1 
ATOM   9776  C  CZ   . TYR B  1 82  ? 134.886 95.481  124.171 1.00 82.25  ? 274  TYR B CZ   1 
ATOM   9777  O  OH   . TYR B  1 82  ? 134.920 95.682  125.532 1.00 83.28  ? 274  TYR B OH   1 
ATOM   9778  H  H    . TYR B  1 82  ? 132.782 93.733  120.909 1.00 99.34  ? 274  TYR B H    1 
ATOM   9779  H  HA   . TYR B  1 82  ? 133.871 93.728  118.480 1.00 97.08  ? 274  TYR B HA   1 
ATOM   9780  H  HB2  . TYR B  1 82  ? 135.705 94.833  119.618 1.00 97.34  ? 274  TYR B HB2  1 
ATOM   9781  H  HB3  . TYR B  1 82  ? 134.340 95.629  119.532 1.00 97.34  ? 274  TYR B HB3  1 
ATOM   9782  H  HD1  . TYR B  1 82  ? 136.356 93.836  121.820 1.00 95.57  ? 274  TYR B HD1  1 
ATOM   9783  H  HD2  . TYR B  1 82  ? 133.290 96.385  121.521 1.00 93.80  ? 274  TYR B HD2  1 
ATOM   9784  H  HE1  . TYR B  1 82  ? 136.415 94.172  124.101 1.00 95.86  ? 274  TYR B HE1  1 
ATOM   9785  H  HE2  . TYR B  1 82  ? 133.346 96.725  123.803 1.00 96.38  ? 274  TYR B HE2  1 
ATOM   9786  H  HH   . TYR B  1 82  ? 134.322 96.228  125.757 1.00 99.68  ? 274  TYR B HH   1 
ATOM   9787  N  N    . TYR B  1 83  ? 134.621 91.298  120.119 1.00 79.38  ? 275  TYR B N    1 
ATOM   9788  C  CA   . TYR B  1 83  ? 135.352 90.041  120.047 1.00 77.88  ? 275  TYR B CA   1 
ATOM   9789  C  C    . TYR B  1 83  ? 134.681 89.044  119.114 1.00 80.29  ? 275  TYR B C    1 
ATOM   9790  O  O    . TYR B  1 83  ? 135.079 87.875  119.081 1.00 79.46  ? 275  TYR B O    1 
ATOM   9791  C  CB   . TYR B  1 83  ? 135.498 89.425  121.440 1.00 78.50  ? 275  TYR B CB   1 
ATOM   9792  C  CG   . TYR B  1 83  ? 136.313 90.258  122.400 1.00 78.63  ? 275  TYR B CG   1 
ATOM   9793  C  CD1  . TYR B  1 83  ? 137.628 90.593  122.113 1.00 76.86  ? 275  TYR B CD1  1 
ATOM   9794  C  CD2  . TYR B  1 83  ? 135.769 90.704  123.596 1.00 79.39  ? 275  TYR B CD2  1 
ATOM   9795  C  CE1  . TYR B  1 83  ? 138.379 91.350  122.989 1.00 80.21  ? 275  TYR B CE1  1 
ATOM   9796  C  CE2  . TYR B  1 83  ? 136.513 91.463  124.479 1.00 80.00  ? 275  TYR B CE2  1 
ATOM   9797  C  CZ   . TYR B  1 83  ? 137.817 91.783  124.170 1.00 81.32  ? 275  TYR B CZ   1 
ATOM   9798  O  OH   . TYR B  1 83  ? 138.565 92.539  125.043 1.00 84.12  ? 275  TYR B OH   1 
ATOM   9799  H  H    . TYR B  1 83  ? 133.906 91.253  120.595 1.00 95.01  ? 275  TYR B H    1 
ATOM   9800  H  HA   . TYR B  1 83  ? 136.243 90.216  119.704 1.00 93.21  ? 275  TYR B HA   1 
ATOM   9801  H  HB2  . TYR B  1 83  ? 134.615 89.311  121.824 1.00 93.95  ? 275  TYR B HB2  1 
ATOM   9802  H  HB3  . TYR B  1 83  ? 135.933 88.562  121.355 1.00 93.95  ? 275  TYR B HB3  1 
ATOM   9803  H  HD1  . TYR B  1 83  ? 138.010 90.302  121.317 1.00 91.98  ? 275  TYR B HD1  1 
ATOM   9804  H  HD2  . TYR B  1 83  ? 134.889 90.489  123.807 1.00 95.02  ? 275  TYR B HD2  1 
ATOM   9805  H  HE1  . TYR B  1 83  ? 139.260 91.568  122.783 1.00 96.01  ? 275  TYR B HE1  1 
ATOM   9806  H  HE2  . TYR B  1 83  ? 136.135 91.756  125.277 1.00 95.76  ? 275  TYR B HE2  1 
ATOM   9807  H  HH   . TYR B  1 83  ? 138.106 92.735  125.719 1.00 100.70 ? 275  TYR B HH   1 
ATOM   9808  N  N    . GLN B  1 84  ? 133.672 89.483  118.359 1.00 90.94  ? 276  GLN B N    1 
ATOM   9809  C  CA   . GLN B  1 84  ? 132.940 88.584  117.473 1.00 97.86  ? 276  GLN B CA   1 
ATOM   9810  C  C    . GLN B  1 84  ? 133.889 87.816  116.560 1.00 97.39  ? 276  GLN B C    1 
ATOM   9811  O  O    . GLN B  1 84  ? 133.765 86.597  116.398 1.00 96.20  ? 276  GLN B O    1 
ATOM   9812  C  CB   . GLN B  1 84  ? 131.921 89.388  116.660 1.00 102.17 ? 276  GLN B CB   1 
ATOM   9813  C  CG   . GLN B  1 84  ? 131.412 88.698  115.403 1.00 109.59 ? 276  GLN B CG   1 
ATOM   9814  C  CD   . GLN B  1 84  ? 130.386 89.530  114.662 1.00 115.16 ? 276  GLN B CD   1 
ATOM   9815  O  OE1  . GLN B  1 84  ? 129.201 89.194  114.628 1.00 118.66 ? 276  GLN B OE1  1 
ATOM   9816  N  NE2  . GLN B  1 84  ? 130.839 90.622  114.056 1.00 116.18 ? 276  GLN B NE2  1 
ATOM   9817  H  H    . GLN B  1 84  ? 133.394 90.296  118.344 1.00 108.88 ? 276  GLN B H    1 
ATOM   9818  H  HA   . GLN B  1 84  ? 132.453 87.939  118.010 1.00 117.18 ? 276  GLN B HA   1 
ATOM   9819  H  HB2  . GLN B  1 84  ? 131.153 89.573  117.224 1.00 122.35 ? 276  GLN B HB2  1 
ATOM   9820  H  HB3  . GLN B  1 84  ? 132.333 90.223  116.389 1.00 122.35 ? 276  GLN B HB3  1 
ATOM   9821  H  HG2  . GLN B  1 84  ? 132.159 88.537  114.805 1.00 131.25 ? 276  GLN B HG2  1 
ATOM   9822  H  HG3  . GLN B  1 84  ? 130.997 87.857  115.650 1.00 131.25 ? 276  GLN B HG3  1 
ATOM   9823  H  HE21 . GLN B  1 84  ? 131.674 90.823  114.101 1.00 139.17 ? 276  GLN B HE21 1 
ATOM   9824  H  HE22 . GLN B  1 84  ? 130.298 91.128  113.621 1.00 139.17 ? 276  GLN B HE22 1 
ATOM   9825  N  N    . ASP B  1 85  ? 134.846 88.520  115.949 1.00 95.05  ? 277  ASP B N    1 
ATOM   9826  C  CA   . ASP B  1 85  ? 135.726 87.883  114.973 1.00 95.58  ? 277  ASP B CA   1 
ATOM   9827  C  C    . ASP B  1 85  ? 136.606 86.821  115.622 1.00 91.75  ? 277  ASP B C    1 
ATOM   9828  O  O    . ASP B  1 85  ? 136.799 85.739  115.055 1.00 91.95  ? 277  ASP B O    1 
ATOM   9829  C  CB   . ASP B  1 85  ? 136.589 88.938  114.282 1.00 100.56 ? 277  ASP B CB   1 
ATOM   9830  C  CG   . ASP B  1 85  ? 135.791 89.819  113.340 1.00 107.18 ? 277  ASP B CG   1 
ATOM   9831  O  OD1  . ASP B  1 85  ? 134.596 89.527  113.118 1.00 109.42 ? 277  ASP B OD1  1 
ATOM   9832  O  OD2  . ASP B  1 85  ? 136.360 90.804  112.823 1.00 107.39 ? 277  ASP B OD2  1 
ATOM   9833  H  H    . ASP B  1 85  ? 135.002 89.355  116.080 1.00 113.82 ? 277  ASP B H    1 
ATOM   9834  H  HA   . ASP B  1 85  ? 135.184 87.449  114.296 1.00 114.45 ? 277  ASP B HA   1 
ATOM   9835  H  HB2  . ASP B  1 85  ? 136.993 89.507  114.955 1.00 120.42 ? 277  ASP B HB2  1 
ATOM   9836  H  HB3  . ASP B  1 85  ? 137.279 88.493  113.765 1.00 120.42 ? 277  ASP B HB3  1 
ATOM   9837  N  N    . ASP B  1 86  ? 137.148 87.106  116.809 1.00 88.70  ? 278  ASP B N    1 
ATOM   9838  C  CA   . ASP B  1 86  ? 137.935 86.101  117.518 1.00 82.04  ? 278  ASP B CA   1 
ATOM   9839  C  C    . ASP B  1 86  ? 137.108 84.854  117.797 1.00 76.62  ? 278  ASP B C    1 
ATOM   9840  O  O    . ASP B  1 86  ? 137.619 83.731  117.733 1.00 75.31  ? 278  ASP B O    1 
ATOM   9841  C  CB   . ASP B  1 86  ? 138.482 86.680  118.822 1.00 86.28  ? 278  ASP B CB   1 
ATOM   9842  C  CG   . ASP B  1 86  ? 139.492 87.784  118.592 1.00 90.10  ? 278  ASP B CG   1 
ATOM   9843  O  OD1  . ASP B  1 86  ? 139.932 87.957  117.437 1.00 92.11  ? 278  ASP B OD1  1 
ATOM   9844  O  OD2  . ASP B  1 86  ? 139.850 88.476  119.569 1.00 90.72  ? 278  ASP B OD2  1 
ATOM   9845  H  H    . ASP B  1 86  ? 137.075 87.860  117.217 1.00 106.19 ? 278  ASP B H    1 
ATOM   9846  H  HA   . ASP B  1 86  ? 138.689 85.843  116.965 1.00 98.20  ? 278  ASP B HA   1 
ATOM   9847  H  HB2  . ASP B  1 86  ? 137.747 87.047  119.338 1.00 103.28 ? 278  ASP B HB2  1 
ATOM   9848  H  HB3  . ASP B  1 86  ? 138.919 85.973  119.323 1.00 103.28 ? 278  ASP B HB3  1 
ATOM   9849  N  N    . LEU B  1 87  ? 135.827 85.032  118.116 1.00 77.86  ? 279  LEU B N    1 
ATOM   9850  C  CA   . LEU B  1 87  ? 134.985 83.888  118.442 1.00 83.33  ? 279  LEU B CA   1 
ATOM   9851  C  C    . LEU B  1 87  ? 134.702 83.029  117.217 1.00 85.23  ? 279  LEU B C    1 
ATOM   9852  O  O    . LEU B  1 87  ? 134.601 81.802  117.335 1.00 87.05  ? 279  LEU B O    1 
ATOM   9853  C  CB   . LEU B  1 87  ? 133.681 84.375  119.073 1.00 84.00  ? 279  LEU B CB   1 
ATOM   9854  C  CG   . LEU B  1 87  ? 133.871 85.137  120.387 1.00 83.65  ? 279  LEU B CG   1 
ATOM   9855  C  CD1  . LEU B  1 87  ? 132.579 85.818  120.803 1.00 88.51  ? 279  LEU B CD1  1 
ATOM   9856  C  CD2  . LEU B  1 87  ? 134.377 84.216  121.492 1.00 83.71  ? 279  LEU B CD2  1 
ATOM   9857  H  H    . LEU B  1 87  ? 135.428 85.793  118.150 1.00 93.19  ? 279  LEU B H    1 
ATOM   9858  H  HA   . LEU B  1 87  ? 135.444 83.336  119.094 1.00 99.75  ? 279  LEU B HA   1 
ATOM   9859  H  HB2  . LEU B  1 87  ? 133.235 84.969  118.449 1.00 100.55 ? 279  LEU B HB2  1 
ATOM   9860  H  HB3  . LEU B  1 87  ? 133.117 83.607  119.255 1.00 100.55 ? 279  LEU B HB3  1 
ATOM   9861  H  HG   . LEU B  1 87  ? 134.538 85.828  120.252 1.00 100.13 ? 279  LEU B HG   1 
ATOM   9862  H  HD11 . LEU B  1 87  ? 132.726 86.293  121.636 1.00 105.97 ? 279  LEU B HD11 1 
ATOM   9863  H  HD12 . LEU B  1 87  ? 132.314 86.442  120.109 1.00 105.97 ? 279  LEU B HD12 1 
ATOM   9864  H  HD13 . LEU B  1 87  ? 131.891 85.145  120.922 1.00 105.97 ? 279  LEU B HD13 1 
ATOM   9865  H  HD21 . LEU B  1 87  ? 134.486 84.731  122.306 1.00 100.21 ? 279  LEU B HD21 1 
ATOM   9866  H  HD22 . LEU B  1 87  ? 133.730 83.507  121.632 1.00 100.21 ? 279  LEU B HD22 1 
ATOM   9867  H  HD23 . LEU B  1 87  ? 135.229 83.839  121.222 1.00 100.21 ? 279  LEU B HD23 1 
ATOM   9868  N  N    . ARG B  1 88  ? 134.572 83.642  116.038 1.00 87.93  ? 280  ARG B N    1 
ATOM   9869  C  CA   . ARG B  1 88  ? 134.393 82.859  114.820 1.00 86.92  ? 280  ARG B CA   1 
ATOM   9870  C  C    . ARG B  1 88  ? 135.586 81.941  114.585 1.00 83.73  ? 280  ARG B C    1 
ATOM   9871  O  O    . ARG B  1 88  ? 135.423 80.791  114.161 1.00 83.32  ? 280  ARG B O    1 
ATOM   9872  C  CB   . ARG B  1 88  ? 134.183 83.787  113.622 1.00 89.11  ? 280  ARG B CB   1 
ATOM   9873  C  CG   . ARG B  1 88  ? 132.840 84.506  113.625 1.00 92.24  ? 280  ARG B CG   1 
ATOM   9874  C  CD   . ARG B  1 88  ? 132.664 85.378  112.389 1.00 96.65  ? 280  ARG B CD   1 
ATOM   9875  N  NE   . ARG B  1 88  ? 131.585 86.350  112.549 1.00 100.38 ? 280  ARG B NE   1 
ATOM   9876  C  CZ   . ARG B  1 88  ? 130.290 86.071  112.437 1.00 105.60 ? 280  ARG B CZ   1 
ATOM   9877  N  NH1  . ARG B  1 88  ? 129.885 84.837  112.164 1.00 106.32 ? 280  ARG B NH1  1 
ATOM   9878  N  NH2  . ARG B  1 88  ? 129.392 87.033  112.602 1.00 107.76 ? 280  ARG B NH2  1 
ATOM   9879  H  H    . ARG B  1 88  ? 134.584 84.494  115.920 1.00 105.27 ? 280  ARG B H    1 
ATOM   9880  H  HA   . ARG B  1 88  ? 133.602 82.305  114.913 1.00 104.06 ? 280  ARG B HA   1 
ATOM   9881  H  HB2  . ARG B  1 88  ? 134.880 84.461  113.624 1.00 106.68 ? 280  ARG B HB2  1 
ATOM   9882  H  HB3  . ARG B  1 88  ? 134.236 83.262  112.808 1.00 106.68 ? 280  ARG B HB3  1 
ATOM   9883  H  HG2  . ARG B  1 88  ? 132.126 83.850  113.636 1.00 110.44 ? 280  ARG B HG2  1 
ATOM   9884  H  HG3  . ARG B  1 88  ? 132.785 85.076  114.408 1.00 110.44 ? 280  ARG B HG3  1 
ATOM   9885  H  HD2  . ARG B  1 88  ? 133.487 85.865  112.224 1.00 115.73 ? 280  ARG B HD2  1 
ATOM   9886  H  HD3  . ARG B  1 88  ? 132.452 84.814  111.629 1.00 115.73 ? 280  ARG B HD3  1 
ATOM   9887  H  HE   . ARG B  1 88  ? 131.804 87.163  112.728 1.00 120.20 ? 280  ARG B HE   1 
ATOM   9888  H  HH11 . ARG B  1 88  ? 130.463 84.209  112.056 1.00 127.33 ? 280  ARG B HH11 1 
ATOM   9889  H  HH12 . ARG B  1 88  ? 129.045 84.665  112.094 1.00 127.33 ? 280  ARG B HH12 1 
ATOM   9890  H  HH21 . ARG B  1 88  ? 129.648 87.834  112.779 1.00 129.06 ? 280  ARG B HH21 1 
ATOM   9891  H  HH22 . ARG B  1 88  ? 128.553 86.855  112.531 1.00 129.06 ? 280  ARG B HH22 1 
ATOM   9892  N  N    . VAL B  1 89  ? 136.797 82.434  114.855 1.00 78.13  ? 281  VAL B N    1 
ATOM   9893  C  CA   . VAL B  1 89  ? 137.995 81.619  114.678 1.00 75.49  ? 281  VAL B CA   1 
ATOM   9894  C  C    . VAL B  1 89  ? 138.043 80.501  115.711 1.00 81.20  ? 281  VAL B C    1 
ATOM   9895  O  O    . VAL B  1 89  ? 138.351 79.349  115.382 1.00 81.63  ? 281  VAL B O    1 
ATOM   9896  C  CB   . VAL B  1 89  ? 139.252 82.506  114.744 1.00 71.64  ? 281  VAL B CB   1 
ATOM   9897  C  CG1  . VAL B  1 89  ? 140.517 81.654  114.835 1.00 70.84  ? 281  VAL B CG1  1 
ATOM   9898  C  CG2  . VAL B  1 89  ? 139.312 83.420  113.530 1.00 74.29  ? 281  VAL B CG2  1 
ATOM   9899  H  H    . VAL B  1 89  ? 136.948 83.231  115.140 1.00 93.51  ? 281  VAL B H    1 
ATOM   9900  H  HA   . VAL B  1 89  ? 137.967 81.209  113.799 1.00 90.34  ? 281  VAL B HA   1 
ATOM   9901  H  HB   . VAL B  1 89  ? 139.207 83.062  115.537 1.00 85.72  ? 281  VAL B HB   1 
ATOM   9902  H  HG11 . VAL B  1 89  ? 141.290 82.240  114.874 1.00 84.76  ? 281  VAL B HG11 1 
ATOM   9903  H  HG12 . VAL B  1 89  ? 140.474 81.109  115.636 1.00 84.76  ? 281  VAL B HG12 1 
ATOM   9904  H  HG13 . VAL B  1 89  ? 140.572 81.086  114.050 1.00 84.76  ? 281  VAL B HG13 1 
ATOM   9905  H  HG21 . VAL B  1 89  ? 140.109 83.970  113.588 1.00 88.90  ? 281  VAL B HG21 1 
ATOM   9906  H  HG22 . VAL B  1 89  ? 139.343 82.877  112.727 1.00 88.90  ? 281  VAL B HG22 1 
ATOM   9907  H  HG23 . VAL B  1 89  ? 138.522 83.982  113.519 1.00 88.90  ? 281  VAL B HG23 1 
ATOM   9908  N  N    . LEU B  1 90  ? 137.751 80.818  116.976 1.00 82.29  ? 282  LEU B N    1 
ATOM   9909  C  CA   . LEU B  1 90  ? 137.761 79.788  118.010 1.00 82.74  ? 282  LEU B CA   1 
ATOM   9910  C  C    . LEU B  1 90  ? 136.702 78.731  117.737 1.00 88.03  ? 282  LEU B C    1 
ATOM   9911  O  O    . LEU B  1 90  ? 136.907 77.546  118.026 1.00 90.59  ? 282  LEU B O    1 
ATOM   9912  C  CB   . LEU B  1 90  ? 137.544 80.417  119.386 1.00 82.65  ? 282  LEU B CB   1 
ATOM   9913  C  CG   . LEU B  1 90  ? 138.684 81.277  119.931 1.00 79.50  ? 282  LEU B CG   1 
ATOM   9914  C  CD1  . LEU B  1 90  ? 138.220 82.042  121.160 1.00 78.12  ? 282  LEU B CD1  1 
ATOM   9915  C  CD2  . LEU B  1 90  ? 139.896 80.419  120.257 1.00 80.33  ? 282  LEU B CD2  1 
ATOM   9916  H  H    . LEU B  1 90  ? 137.547 81.606  117.254 1.00 98.49  ? 282  LEU B H    1 
ATOM   9917  H  HA   . LEU B  1 90  ? 138.628 79.352  118.013 1.00 99.04  ? 282  LEU B HA   1 
ATOM   9918  H  HB2  . LEU B  1 90  ? 136.756 80.980  119.341 1.00 98.93  ? 282  LEU B HB2  1 
ATOM   9919  H  HB3  . LEU B  1 90  ? 137.392 79.703  120.025 1.00 98.93  ? 282  LEU B HB3  1 
ATOM   9920  H  HG   . LEU B  1 90  ? 138.945 81.922  119.256 1.00 95.15  ? 282  LEU B HG   1 
ATOM   9921  H  HD11 . LEU B  1 90  ? 138.955 82.582  121.491 1.00 93.50  ? 282  LEU B HD11 1 
ATOM   9922  H  HD12 . LEU B  1 90  ? 137.476 82.613  120.913 1.00 93.50  ? 282  LEU B HD12 1 
ATOM   9923  H  HD13 . LEU B  1 90  ? 137.942 81.409  121.839 1.00 93.50  ? 282  LEU B HD13 1 
ATOM   9924  H  HD21 . LEU B  1 90  ? 140.603 80.989  120.600 1.00 96.15  ? 282  LEU B HD21 1 
ATOM   9925  H  HD22 . LEU B  1 90  ? 139.647 79.762  120.926 1.00 96.15  ? 282  LEU B HD22 1 
ATOM   9926  H  HD23 . LEU B  1 90  ? 140.194 79.973  119.449 1.00 96.15  ? 282  LEU B HD23 1 
ATOM   9927  N  N    . SER B  1 91  ? 135.558 79.143  117.185 1.00 96.09  ? 283  SER B N    1 
ATOM   9928  C  CA   . SER B  1 91  ? 134.504 78.194  116.849 1.00 98.59  ? 283  SER B CA   1 
ATOM   9929  C  C    . SER B  1 91  ? 135.039 77.061  115.985 1.00 99.93  ? 283  SER B C    1 
ATOM   9930  O  O    . SER B  1 91  ? 134.545 75.930  116.063 1.00 101.67 ? 283  SER B O    1 
ATOM   9931  C  CB   . SER B  1 91  ? 133.354 78.912  116.141 1.00 100.14 ? 283  SER B CB   1 
ATOM   9932  O  OG   . SER B  1 91  ? 132.271 78.029  115.906 1.00 103.50 ? 283  SER B OG   1 
ATOM   9933  H  H    . SER B  1 91  ? 135.372 79.961  116.997 1.00 115.06 ? 283  SER B H    1 
ATOM   9934  H  HA   . SER B  1 91  ? 134.156 77.806  117.667 1.00 118.06 ? 283  SER B HA   1 
ATOM   9935  H  HB2  . SER B  1 91  ? 133.049 79.644  116.700 1.00 119.92 ? 283  SER B HB2  1 
ATOM   9936  H  HB3  . SER B  1 91  ? 133.672 79.255  115.291 1.00 119.92 ? 283  SER B HB3  1 
ATOM   9937  H  HG   . SER B  1 91  ? 131.648 78.437  115.518 1.00 123.95 ? 283  SER B HG   1 
ATOM   9938  N  N    . SER B  1 92  ? 136.046 77.343  115.157 1.00 99.38  ? 284  SER B N    1 
ATOM   9939  C  CA   . SER B  1 92  ? 136.595 76.346  114.249 1.00 101.00 ? 284  SER B CA   1 
ATOM   9940  C  C    . SER B  1 92  ? 137.706 75.515  114.879 1.00 101.86 ? 284  SER B C    1 
ATOM   9941  O  O    . SER B  1 92  ? 138.023 74.440  114.359 1.00 105.69 ? 284  SER B O    1 
ATOM   9942  C  CB   . SER B  1 92  ? 137.142 77.037  112.994 1.00 103.43 ? 284  SER B CB   1 
ATOM   9943  O  OG   . SER B  1 92  ? 138.242 77.874  113.318 1.00 102.21 ? 284  SER B OG   1 
ATOM   9944  H  H    . SER B  1 92  ? 136.429 78.111  115.105 1.00 119.01 ? 284  SER B H    1 
ATOM   9945  H  HA   . SER B  1 92  ? 135.886 75.742  113.976 1.00 120.95 ? 284  SER B HA   1 
ATOM   9946  H  HB2  . SER B  1 92  ? 137.435 76.360  112.363 1.00 123.86 ? 284  SER B HB2  1 
ATOM   9947  H  HB3  . SER B  1 92  ? 136.440 77.577  112.599 1.00 123.86 ? 284  SER B HB3  1 
ATOM   9948  H  HG   . SER B  1 92  ? 138.002 78.465  113.865 1.00 122.41 ? 284  SER B HG   1 
ATOM   9949  N  N    . LEU B  1 93  ? 138.299 75.980  115.977 1.00 99.79  ? 285  LEU B N    1 
ATOM   9950  C  CA   . LEU B  1 93  ? 139.363 75.247  116.667 1.00 98.42  ? 285  LEU B CA   1 
ATOM   9951  C  C    . LEU B  1 93  ? 138.770 74.295  117.694 1.00 98.18  ? 285  LEU B C    1 
ATOM   9952  O  O    . LEU B  1 93  ? 138.313 74.715  118.759 1.00 99.18  ? 285  LEU B O    1 
ATOM   9953  C  CB   . LEU B  1 93  ? 140.351 76.192  117.345 1.00 97.00  ? 285  LEU B CB   1 
ATOM   9954  C  CG   . LEU B  1 93  ? 141.521 76.797  116.572 1.00 98.41  ? 285  LEU B CG   1 
ATOM   9955  C  CD1  . LEU B  1 93  ? 142.428 77.528  117.555 1.00 96.88  ? 285  LEU B CD1  1 
ATOM   9956  C  CD2  . LEU B  1 93  ? 142.302 75.730  115.815 1.00 99.43  ? 285  LEU B CD2  1 
ATOM   9957  H  H    . LEU B  1 93  ? 138.100 76.730  116.348 1.00 119.50 ? 285  LEU B H    1 
ATOM   9958  H  HA   . LEU B  1 93  ? 139.853 74.718  116.018 1.00 117.86 ? 285  LEU B HA   1 
ATOM   9959  H  HB2  . LEU B  1 93  ? 139.840 76.940  117.692 1.00 116.15 ? 285  LEU B HB2  1 
ATOM   9960  H  HB3  . LEU B  1 93  ? 140.740 75.712  118.093 1.00 116.15 ? 285  LEU B HB3  1 
ATOM   9961  H  HG   . LEU B  1 93  ? 141.183 77.442  115.931 1.00 117.84 ? 285  LEU B HG   1 
ATOM   9962  H  HD11 . LEU B  1 93  ? 143.173 77.914  117.069 1.00 116.01 ? 285  LEU B HD11 1 
ATOM   9963  H  HD12 . LEU B  1 93  ? 141.919 78.228  117.994 1.00 116.01 ? 285  LEU B HD12 1 
ATOM   9964  H  HD13 . LEU B  1 93  ? 142.755 76.894  118.213 1.00 116.01 ? 285  LEU B HD13 1 
ATOM   9965  H  HD21 . LEU B  1 93  ? 143.033 76.153  115.339 1.00 119.07 ? 285  LEU B HD21 1 
ATOM   9966  H  HD22 . LEU B  1 93  ? 142.649 75.084  116.450 1.00 119.07 ? 285  LEU B HD22 1 
ATOM   9967  H  HD23 . LEU B  1 93  ? 141.707 75.291  115.187 1.00 119.07 ? 285  LEU B HD23 1 
ATOM   9968  N  N    . THR B  1 94  ? 138.777 73.005  117.369 1.00 88.86  ? 286  THR B N    1 
ATOM   9969  C  CA   . THR B  1 94  ? 138.296 71.981  118.281 1.00 85.42  ? 286  THR B CA   1 
ATOM   9970  C  C    . THR B  1 94  ? 139.312 70.875  118.528 1.00 83.41  ? 286  THR B C    1 
ATOM   9971  O  O    . THR B  1 94  ? 139.056 70.013  119.376 1.00 84.19  ? 286  THR B O    1 
ATOM   9972  C  CB   . THR B  1 94  ? 136.994 71.350  117.758 1.00 85.64  ? 286  THR B CB   1 
ATOM   9973  O  OG1  . THR B  1 94  ? 137.287 70.440  116.691 1.00 88.45  ? 286  THR B OG1  1 
ATOM   9974  C  CG2  . THR B  1 94  ? 136.030 72.424  117.264 1.00 86.90  ? 286  THR B CG2  1 
ATOM   9975  H  H    . THR B  1 94  ? 139.059 72.698  116.617 1.00 106.38 ? 286  THR B H    1 
ATOM   9976  H  HA   . THR B  1 94  ? 138.100 72.395  119.135 1.00 102.26 ? 286  THR B HA   1 
ATOM   9977  H  HB   . THR B  1 94  ? 136.563 70.866  118.479 1.00 102.52 ? 286  THR B HB   1 
ATOM   9978  H  HG1  . THR B  1 94  ? 136.577 70.095  116.404 1.00 105.89 ? 286  THR B HG1  1 
ATOM   9979  H  HG21 . THR B  1 94  ? 135.214 72.013  116.937 1.00 104.03 ? 286  THR B HG21 1 
ATOM   9980  H  HG22 . THR B  1 94  ? 135.809 73.030  117.988 1.00 104.03 ? 286  THR B HG22 1 
ATOM   9981  H  HG23 . THR B  1 94  ? 136.438 72.930  116.543 1.00 104.03 ? 286  THR B HG23 1 
ATOM   9982  N  N    . LYS B  1 95  ? 140.447 70.873  117.829 1.00 81.56  ? 287  LYS B N    1 
ATOM   9983  C  CA   . LYS B  1 95  ? 141.449 69.825  117.950 1.00 83.40  ? 287  LYS B CA   1 
ATOM   9984  C  C    . LYS B  1 95  ? 142.755 70.396  118.486 1.00 84.01  ? 287  LYS B C    1 
ATOM   9985  O  O    . LYS B  1 95  ? 143.131 71.530  118.178 1.00 86.42  ? 287  LYS B O    1 
ATOM   9986  C  CB   . LYS B  1 95  ? 141.707 69.154  116.600 1.00 87.45  ? 287  LYS B CB   1 
ATOM   9987  C  CG   . LYS B  1 95  ? 140.450 68.658  115.915 1.00 91.32  ? 287  LYS B CG   1 
ATOM   9988  C  CD   . LYS B  1 95  ? 139.874 67.443  116.613 1.00 95.02  ? 287  LYS B CD   1 
ATOM   9989  C  CE   . LYS B  1 95  ? 138.744 66.837  115.801 1.00 98.16  ? 287  LYS B CE   1 
ATOM   9990  N  NZ   . LYS B  1 95  ? 138.382 65.473  116.266 1.00 100.91 ? 287  LYS B NZ   1 
ATOM   9991  H  H    . LYS B  1 95  ? 140.660 71.485  117.264 1.00 97.63  ? 287  LYS B H    1 
ATOM   9992  H  HA   . LYS B  1 95  ? 141.133 69.150  118.571 1.00 99.83  ? 287  LYS B HA   1 
ATOM   9993  H  HB2  . LYS B  1 95  ? 142.134 69.794  116.009 1.00 104.69 ? 287  LYS B HB2  1 
ATOM   9994  H  HB3  . LYS B  1 95  ? 142.291 68.392  116.736 1.00 104.69 ? 287  LYS B HB3  1 
ATOM   9995  H  HG2  . LYS B  1 95  ? 139.781 69.361  115.927 1.00 109.34 ? 287  LYS B HG2  1 
ATOM   9996  H  HG3  . LYS B  1 95  ? 140.660 68.412  115.000 1.00 109.34 ? 287  LYS B HG3  1 
ATOM   9997  H  HD2  . LYS B  1 95  ? 140.568 66.773  116.718 1.00 113.77 ? 287  LYS B HD2  1 
ATOM   9998  H  HD3  . LYS B  1 95  ? 139.523 67.705  117.479 1.00 113.77 ? 287  LYS B HD3  1 
ATOM   9999  H  HE2  . LYS B  1 95  ? 137.959 67.401  115.881 1.00 117.55 ? 287  LYS B HE2  1 
ATOM   10000 H  HE3  . LYS B  1 95  ? 139.017 66.777  114.872 1.00 117.55 ? 287  LYS B HE3  1 
ATOM   10001 H  HZ1  . LYS B  1 95  ? 137.718 65.149  115.769 1.00 120.84 ? 287  LYS B HZ1  1 
ATOM   10002 H  HZ2  . LYS B  1 95  ? 139.086 64.932  116.197 1.00 120.84 ? 287  LYS B HZ2  1 
ATOM   10003 H  HZ3  . LYS B  1 95  ? 138.121 65.501  117.116 1.00 120.84 ? 287  LYS B HZ3  1 
ATOM   10004 N  N    . LYS B  1 96  ? 143.453 69.588  119.289 1.00 81.53  ? 288  LYS B N    1 
ATOM   10005 C  CA   . LYS B  1 96  ? 144.766 69.988  119.785 1.00 82.82  ? 288  LYS B CA   1 
ATOM   10006 C  C    . LYS B  1 96  ? 145.727 70.252  118.633 1.00 82.74  ? 288  LYS B C    1 
ATOM   10007 O  O    . LYS B  1 96  ? 146.453 71.253  118.632 1.00 82.01  ? 288  LYS B O    1 
ATOM   10008 C  CB   . LYS B  1 96  ? 145.326 68.909  120.712 1.00 86.98  ? 288  LYS B CB   1 
ATOM   10009 C  CG   . LYS B  1 96  ? 146.686 69.241  121.315 1.00 90.74  ? 288  LYS B CG   1 
ATOM   10010 C  CD   . LYS B  1 96  ? 147.293 68.027  121.993 1.00 98.84  ? 288  LYS B CD   1 
ATOM   10011 C  CE   . LYS B  1 96  ? 148.617 68.359  122.660 1.00 104.40 ? 288  LYS B CE   1 
ATOM   10012 N  NZ   . LYS B  1 96  ? 149.207 67.168  123.331 1.00 110.48 ? 288  LYS B NZ   1 
ATOM   10013 H  H    . LYS B  1 96  ? 143.190 68.814  119.556 1.00 97.58  ? 288  LYS B H    1 
ATOM   10014 H  HA   . LYS B  1 96  ? 144.676 70.807  120.296 1.00 99.14  ? 288  LYS B HA   1 
ATOM   10015 H  HB2  . LYS B  1 96  ? 144.704 68.774  121.444 1.00 104.13 ? 288  LYS B HB2  1 
ATOM   10016 H  HB3  . LYS B  1 96  ? 145.420 68.085  120.208 1.00 104.13 ? 288  LYS B HB3  1 
ATOM   10017 H  HG2  . LYS B  1 96  ? 147.287 69.531  120.612 1.00 108.64 ? 288  LYS B HG2  1 
ATOM   10018 H  HG3  . LYS B  1 96  ? 146.581 69.941  121.979 1.00 108.64 ? 288  LYS B HG3  1 
ATOM   10019 H  HD2  . LYS B  1 96  ? 146.683 67.703  122.674 1.00 118.36 ? 288  LYS B HD2  1 
ATOM   10020 H  HD3  . LYS B  1 96  ? 147.452 67.337  121.330 1.00 118.36 ? 288  LYS B HD3  1 
ATOM   10021 H  HE2  . LYS B  1 96  ? 149.244 68.671  121.989 1.00 125.03 ? 288  LYS B HE2  1 
ATOM   10022 H  HE3  . LYS B  1 96  ? 148.475 69.046  123.330 1.00 125.03 ? 288  LYS B HE3  1 
ATOM   10023 H  HZ1  . LYS B  1 96  ? 149.980 67.386  123.714 1.00 132.33 ? 288  LYS B HZ1  1 
ATOM   10024 H  HZ2  . LYS B  1 96  ? 148.650 66.864  123.956 1.00 132.33 ? 288  LYS B HZ2  1 
ATOM   10025 H  HZ3  . LYS B  1 96  ? 149.351 66.523  122.735 1.00 132.33 ? 288  LYS B HZ3  1 
ATOM   10026 N  N    . GLU B  1 97  ? 145.748 69.362  117.639 1.00 86.93  ? 289  GLU B N    1 
ATOM   10027 C  CA   . GLU B  1 97  ? 146.711 69.500  116.551 1.00 88.88  ? 289  GLU B CA   1 
ATOM   10028 C  C    . GLU B  1 97  ? 146.442 70.749  115.719 1.00 87.13  ? 289  GLU B C    1 
ATOM   10029 O  O    . GLU B  1 97  ? 147.378 71.327  115.154 1.00 86.55  ? 289  GLU B O    1 
ATOM   10030 C  CB   . GLU B  1 97  ? 146.696 68.251  115.666 1.00 93.36  ? 289  GLU B CB   1 
ATOM   10031 C  CG   . GLU B  1 97  ? 145.403 68.015  114.880 1.00 102.08 ? 289  GLU B CG   1 
ATOM   10032 C  CD   . GLU B  1 97  ? 144.447 67.061  115.572 1.00 107.16 ? 289  GLU B CD   1 
ATOM   10033 O  OE1  . GLU B  1 97  ? 144.540 66.907  116.811 1.00 106.77 ? 289  GLU B OE1  1 
ATOM   10034 O  OE2  . GLU B  1 97  ? 143.600 66.464  114.870 1.00 107.18 ? 289  GLU B OE2  1 
ATOM   10035 H  H    . GLU B  1 97  ? 145.224 68.682  117.573 1.00 104.07 ? 289  GLU B H    1 
ATOM   10036 H  HA   . GLU B  1 97  ? 147.600 69.583  116.930 1.00 106.40 ? 289  GLU B HA   1 
ATOM   10037 H  HB2  . GLU B  1 97  ? 147.419 68.322  115.022 1.00 111.78 ? 289  GLU B HB2  1 
ATOM   10038 H  HB3  . GLU B  1 97  ? 146.840 67.474  116.229 1.00 111.78 ? 289  GLU B HB3  1 
ATOM   10039 H  HG2  . GLU B  1 97  ? 144.947 68.864  114.764 1.00 122.25 ? 289  GLU B HG2  1 
ATOM   10040 H  HG3  . GLU B  1 97  ? 145.626 67.639  114.014 1.00 122.25 ? 289  GLU B HG3  1 
ATOM   10041 N  N    . HIS B  1 98  ? 145.182 71.182  115.633 1.00 84.39  ? 290  HIS B N    1 
ATOM   10042 C  CA   . HIS B  1 98  ? 144.873 72.413  114.914 1.00 81.06  ? 290  HIS B CA   1 
ATOM   10043 C  C    . HIS B  1 98  ? 145.323 73.634  115.701 1.00 81.46  ? 290  HIS B C    1 
ATOM   10044 O  O    . HIS B  1 98  ? 145.726 74.642  115.109 1.00 81.69  ? 290  HIS B O    1 
ATOM   10045 C  CB   . HIS B  1 98  ? 143.372 72.498  114.634 1.00 78.28  ? 290  HIS B CB   1 
ATOM   10046 C  CG   . HIS B  1 98  ? 142.867 71.439  113.706 1.00 78.85  ? 290  HIS B CG   1 
ATOM   10047 N  ND1  . HIS B  1 98  ? 141.553 71.023  113.700 1.00 76.61  ? 290  HIS B ND1  1 
ATOM   10048 C  CD2  . HIS B  1 98  ? 143.495 70.719  112.746 1.00 79.66  ? 290  HIS B CD2  1 
ATOM   10049 C  CE1  . HIS B  1 98  ? 141.395 70.086  112.783 1.00 79.93  ? 290  HIS B CE1  1 
ATOM   10050 N  NE2  . HIS B  1 98  ? 142.558 69.884  112.189 1.00 79.23  ? 290  HIS B NE2  1 
ATOM   10051 H  H    . HIS B  1 98  ? 144.500 70.787  115.978 1.00 101.02 ? 290  HIS B H    1 
ATOM   10052 H  HA   . HIS B  1 98  ? 145.340 72.412  114.064 1.00 97.02  ? 290  HIS B HA   1 
ATOM   10053 H  HB2  . HIS B  1 98  ? 142.893 72.411  115.473 1.00 93.69  ? 290  HIS B HB2  1 
ATOM   10054 H  HB3  . HIS B  1 98  ? 143.178 73.360  114.233 1.00 93.69  ? 290  HIS B HB3  1 
ATOM   10055 H  HD2  . HIS B  1 98  ? 144.393 70.776  112.512 1.00 95.34  ? 290  HIS B HD2  1 
ATOM   10056 H  HE1  . HIS B  1 98  ? 140.600 69.646  112.586 1.00 95.66  ? 290  HIS B HE1  1 
ATOM   10057 H  HE2  . HIS B  1 98  ? 142.704 69.321  111.556 1.00 94.83  ? 290  HIS B HE2  1 
ATOM   10058 N  N    . MET B  1 99  ? 145.260 73.558  117.031 1.00 81.47  ? 291  MET B N    1 
ATOM   10059 C  CA   . MET B  1 99  ? 145.747 74.644  117.872 1.00 81.94  ? 291  MET B CA   1 
ATOM   10060 C  C    . MET B  1 99  ? 147.260 74.788  117.756 1.00 81.52  ? 291  MET B C    1 
ATOM   10061 O  O    . MET B  1 99  ? 147.785 75.907  117.726 1.00 79.32  ? 291  MET B O    1 
ATOM   10062 C  CB   . MET B  1 99  ? 145.332 74.379  119.318 1.00 84.79  ? 291  MET B CB   1 
ATOM   10063 C  CG   . MET B  1 99  ? 145.536 75.530  120.275 1.00 88.69  ? 291  MET B CG   1 
ATOM   10064 S  SD   . MET B  1 99  ? 144.924 75.085  121.911 1.00 95.68  ? 291  MET B SD   1 
ATOM   10065 C  CE   . MET B  1 99  ? 145.992 76.063  122.961 1.00 95.50  ? 291  MET B CE   1 
ATOM   10066 H  H    . MET B  1 99  ? 144.939 72.889  117.467 1.00 97.52  ? 291  MET B H    1 
ATOM   10067 H  HA   . MET B  1 99  ? 145.330 75.472  117.589 1.00 98.08  ? 291  MET B HA   1 
ATOM   10068 H  HB2  . MET B  1 99  ? 144.388 74.155  119.330 1.00 101.50 ? 291  MET B HB2  1 
ATOM   10069 H  HB3  . MET B  1 99  ? 145.847 73.628  119.653 1.00 101.50 ? 291  MET B HB3  1 
ATOM   10070 H  HG2  . MET B  1 99  ? 146.482 75.732  120.344 1.00 106.18 ? 291  MET B HG2  1 
ATOM   10071 H  HG3  . MET B  1 99  ? 145.044 76.305  119.962 1.00 106.18 ? 291  MET B HG3  1 
ATOM   10072 H  HE1  . MET B  1 99  ? 145.753 75.905  123.888 1.00 114.36 ? 291  MET B HE1  1 
ATOM   10073 H  HE2  . MET B  1 99  ? 146.912 75.801  122.807 1.00 114.36 ? 291  MET B HE2  1 
ATOM   10074 H  HE3  . MET B  1 99  ? 145.874 77.001  122.745 1.00 114.36 ? 291  MET B HE3  1 
ATOM   10075 N  N    . LYS B  1 100 ? 147.974 73.662  117.687 1.00 82.37  ? 292  LYS B N    1 
ATOM   10076 C  CA   . LYS B  1 100 ? 149.426 73.691  117.561 1.00 84.09  ? 292  LYS B CA   1 
ATOM   10077 C  C    . LYS B  1 100 ? 149.882 74.318  116.250 1.00 82.04  ? 292  LYS B C    1 
ATOM   10078 O  O    . LYS B  1 100 ? 151.037 74.749  116.154 1.00 82.69  ? 292  LYS B O    1 
ATOM   10079 C  CB   . LYS B  1 100 ? 149.979 72.271  117.685 1.00 86.69  ? 292  LYS B CB   1 
ATOM   10080 C  CG   . LYS B  1 100 ? 149.888 71.703  119.093 1.00 91.10  ? 292  LYS B CG   1 
ATOM   10081 C  CD   . LYS B  1 100 ? 150.121 70.201  119.110 1.00 97.68  ? 292  LYS B CD   1 
ATOM   10082 C  CE   . LYS B  1 100 ? 151.585 69.860  119.333 1.00 102.51 ? 292  LYS B CE   1 
ATOM   10083 N  NZ   . LYS B  1 100 ? 151.962 69.953  120.771 1.00 107.02 ? 292  LYS B NZ   1 
ATOM   10084 H  H    . LYS B  1 100 ? 147.638 72.871  117.712 1.00 98.59  ? 292  LYS B H    1 
ATOM   10085 H  HA   . LYS B  1 100 ? 149.793 74.218  118.287 1.00 100.66 ? 292  LYS B HA   1 
ATOM   10086 H  HB2  . LYS B  1 100 ? 149.478 71.687  117.095 1.00 103.78 ? 292  LYS B HB2  1 
ATOM   10087 H  HB3  . LYS B  1 100 ? 150.914 72.276  117.426 1.00 103.78 ? 292  LYS B HB3  1 
ATOM   10088 H  HG2  . LYS B  1 100 ? 150.563 72.121  119.651 1.00 109.07 ? 292  LYS B HG2  1 
ATOM   10089 H  HG3  . LYS B  1 100 ? 149.003 71.877  119.450 1.00 109.07 ? 292  LYS B HG3  1 
ATOM   10090 H  HD2  . LYS B  1 100 ? 149.605 69.806  119.830 1.00 116.96 ? 292  LYS B HD2  1 
ATOM   10091 H  HD3  . LYS B  1 100 ? 149.849 69.826  118.258 1.00 116.96 ? 292  LYS B HD3  1 
ATOM   10092 H  HE2  . LYS B  1 100 ? 151.751 68.952  119.035 1.00 122.76 ? 292  LYS B HE2  1 
ATOM   10093 H  HE3  . LYS B  1 100 ? 152.138 70.482  118.834 1.00 122.76 ? 292  LYS B HE3  1 
ATOM   10094 H  HZ1  . LYS B  1 100 ? 152.822 69.749  120.874 1.00 128.18 ? 292  LYS B HZ1  1 
ATOM   10095 H  HZ2  . LYS B  1 100 ? 151.823 70.780  121.068 1.00 128.18 ? 292  LYS B HZ2  1 
ATOM   10096 H  HZ3  . LYS B  1 100 ? 151.470 69.387  121.251 1.00 128.18 ? 292  LYS B HZ3  1 
ATOM   10097 N  N    . GLY B  1 101 ? 149.018 74.364  115.240 1.00 75.19  ? 293  GLY B N    1 
ATOM   10098 C  CA   . GLY B  1 101 ? 149.349 74.983  113.976 1.00 74.04  ? 293  GLY B CA   1 
ATOM   10099 C  C    . GLY B  1 101 ? 149.019 76.454  113.882 1.00 75.81  ? 293  GLY B C    1 
ATOM   10100 O  O    . GLY B  1 101 ? 149.269 77.070  112.841 1.00 76.75  ? 293  GLY B O    1 
ATOM   10101 H  H    . GLY B  1 101 ? 148.223 74.037  115.270 1.00 89.99  ? 293  GLY B H    1 
ATOM   10102 H  HA2  . GLY B  1 101 ? 150.300 74.879  113.815 1.00 88.60  ? 293  GLY B HA2  1 
ATOM   10103 H  HA3  . GLY B  1 101 ? 148.873 74.524  113.267 1.00 88.60  ? 293  GLY B HA3  1 
ATOM   10104 N  N    . ASN B  1 102 ? 148.462 77.039  114.940 1.00 81.23  ? 294  ASN B N    1 
ATOM   10105 C  CA   . ASN B  1 102 ? 148.103 78.455  114.978 1.00 79.58  ? 294  ASN B CA   1 
ATOM   10106 C  C    . ASN B  1 102 ? 148.993 79.127  116.020 1.00 77.78  ? 294  ASN B C    1 
ATOM   10107 O  O    . ASN B  1 102 ? 148.732 79.038  117.223 1.00 77.64  ? 294  ASN B O    1 
ATOM   10108 C  CB   . ASN B  1 102 ? 146.620 78.624  115.298 1.00 82.51  ? 294  ASN B CB   1 
ATOM   10109 C  CG   . ASN B  1 102 ? 146.171 80.071  115.255 1.00 83.96  ? 294  ASN B CG   1 
ATOM   10110 O  OD1  . ASN B  1 102 ? 146.904 80.976  115.655 1.00 85.90  ? 294  ASN B OD1  1 
ATOM   10111 N  ND2  . ASN B  1 102 ? 144.960 80.298  114.760 1.00 84.26  ? 294  ASN B ND2  1 
ATOM   10112 H  H    . ASN B  1 102 ? 148.277 76.623  115.669 1.00 97.23  ? 294  ASN B H    1 
ATOM   10113 H  HA   . ASN B  1 102 ? 148.280 78.859  114.114 1.00 95.25  ? 294  ASN B HA   1 
ATOM   10114 H  HB2  . ASN B  1 102 ? 146.098 78.129  114.647 1.00 98.76  ? 294  ASN B HB2  1 
ATOM   10115 H  HB3  . ASN B  1 102 ? 146.448 78.282  116.189 1.00 98.76  ? 294  ASN B HB3  1 
ATOM   10116 H  HD21 . ASN B  1 102 ? 144.658 81.101  114.713 1.00 100.87 ? 294  ASN B HD21 1 
ATOM   10117 H  HD22 . ASN B  1 102 ? 144.476 79.640  114.489 1.00 100.87 ? 294  ASN B HD22 1 
ATOM   10118 N  N    . GLU B  1 103 ? 150.038 79.812  115.549 1.00 76.11  ? 295  GLU B N    1 
ATOM   10119 C  CA   . GLU B  1 103 ? 151.014 80.403  116.460 1.00 78.29  ? 295  GLU B CA   1 
ATOM   10120 C  C    . GLU B  1 103 ? 150.427 81.552  117.269 1.00 76.64  ?