data_6FF7
# 
_entry.id   6FF7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.333 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6FF7         
WWPDB D_1200008211 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB 'Human Bact spliceosome state 8 unmasked' EMD-4240 'associated EM volume' 
PDB  'core structure'                          6FF4     unspecified            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6FF7 
_pdbx_database_status.recvd_initial_deposition_date   2018-01-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Haselbach, D.' 1 ? 
'Komarov, I.'   2 ? 
'Agafonov, D.'  3 ? 
'Hartmuth, K.'  4 ? 
'Graf, B.'      5 ? 
'Kastner, B.'   6 ? 
'Luehrmann, R.' 7 ? 
'Stark, H.'     8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            172 
_citation.language                  ? 
_citation.page_first                454 
_citation.page_last                 464.e11 
_citation.title                     'Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2018.01.010 
_citation.pdbx_database_id_PubMed   29361316 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Haselbach, D.'  1  ? 
primary 'Komarov, I.'    2  ? 
primary 'Agafonov, D.E.' 3  ? 
primary 'Hartmuth, K.'   4  ? 
primary 'Graf, B.'       5  ? 
primary 'Dybkov, O.'     6  ? 
primary 'Urlaub, H.'     7  ? 
primary 'Kastner, B.'    8  ? 
primary 'Luhrmann, R.'   9  ? 
primary 'Stark, H.'      10 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6FF7 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.000 
_cell.length_a_esd                 ? 
_cell.length_b                     1.000 
_cell.length_b_esd                 ? 
_cell.length_c                     1.000 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6FF7 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'RNA-binding motif protein, X-linked 2'                              37425.984  1  ?        ? ? ? 
2  polymer     nat 'U2 snRNA'                                                           60186.445  1  ?        ? ? ? 
3  polymer     nat 'BUD13 homolog'                                                      70669.211  1  ?        ? ? ? 
4  polymer     nat 'U5 snRNA'                                                           36908.668  1  ?        ? ? ? 
5  polymer     nat 'U6 snRNA'                                                           34404.438  1  ?        ? ? ? 
6  polymer     nat 'Splicing factor 3A subunit 2'                                       49327.355  1  ?        ? ? ? 
7  polymer     nat 'Splicing factor 3B subunit 2'                                       100377.812 1  ?        ? ? ? 
8  polymer     nat 'Pre-mRNA-processing-splicing factor 8'                              273974.250 1  ?        ? ? ? 
9  polymer     nat '116 kDa U5 small nuclear ribonucleoprotein component'               109560.625 1  ?        ? ? ? 
10 polymer     nat 'SNW domain-containing protein 1'                                    61610.703  1  ?        ? ? ? 
11 polymer     nat 'Pleiotropic regulator 1'                                            57280.758  1  ?        ? ? ? 
12 polymer     nat 'Pre-mRNA-processing factor 17'                                      65612.180  1  ?        ? ? ? 
13 polymer     nat 'Cell division cycle 5-like protein'                                 92406.883  1  ?        ? ? ? 
14 polymer     nat 'Crooked neck-like protein 1'                                        100610.008 1  ?        ? ? ? 
15 polymer     nat 'Pre-mRNA-splicing factor RBM22'                                     46959.555  1  ?        ? ? ? 
16 polymer     nat 'Protein BUD31 homolog'                                              17032.850  1  ?        ? ? ? 
17 polymer     nat 'Spliceosome-associated protein CWC15 homolog'                       26674.447  1  ?        ? ? ? 
18 polymer     nat 'Serine/arginine repetitive matrix protein 2'                        300255.312 1  ?        ? ? ? 
19 polymer     nat 'Peptidyl-prolyl cis-trans isomerase-like 1'                         18257.805  1  5.2.1.8  ? ? ? 
20 polymer     nat 'Serine/arginine repetitive matrix protein 1'                        102600.539 1  ?        ? ? ? 
21 polymer     nat pre-mRNA                                                             118377.562 1  ?        ? ? ? 
22 polymer     nat 'Peptidyl-prolyl cis-trans isomerase CWC27 homolog'                  53941.227  1  5.2.1.8  ? ? ? 
23 polymer     nat 'RING finger protein 113A'                                           38847.199  1  ?        ? ? ? 
24 polymer     nat 'Splicing factor 3B subunit 1'                                       146024.938 1  ?        ? ? ? 
25 polymer     nat 'Splicing factor 3B subunit 3'                                       135718.844 1  ?        ? ? ? 
26 polymer     nat 'Splicing factor 3B subunit 5'                                       10149.369  1  ?        ? ? ? 
27 polymer     nat 'PHD finger-like domain-containing protein 5A'                       12427.524  1  ?        ? ? ? 
28 polymer     nat 'Splicing factor 3B subunit 6'                                       14606.900  2  ?        ? ? ? 
29 polymer     nat 'Smad nuclear-interacting protein 1'                                 45880.738  1  ?        ? ? ? 
30 polymer     nat 'Splicing factor 3A subunit 3'                                       58934.844  1  ?        ? ? ? 
31 polymer     nat 'U5 small nuclear ribonucleoprotein 40 kDa protein'                  39359.492  1  ?        ? ? ? 
32 polymer     nat 'Pre-mRNA-processing factor 19'                                      55245.547  4  2.3.2.27 ? ? ? 
33 polymer     nat 'Pre-mRNA-splicing factor SPF27'                                     26163.420  1  ?        ? ? ? 
34 polymer     nat 'Pre-mRNA-splicing factor SYF1'                                      100148.711 1  ?        ? ? ? 
35 polymer     nat 'Pre-mRNA-splicing factor CWC22 homolog'                             105646.578 1  ?        ? ? ? 
36 polymer     nat 'Intron-binding protein aquarius'                                    171502.453 1  ?        ? ? ? 
37 polymer     nat 
;U2 small nuclear ribonucleoprotein A'
;
28484.592  1  ?        ? ? ? 
38 polymer     nat 
;U2 small nuclear ribonucleoprotein B''
;
25524.367  1  ?        ? ? ? 
39 polymer     nat 'Small nuclear ribonucleoprotein Sm D2'                              13551.928  2  ?        ? ? ? 
40 polymer     nat 'Small nuclear ribonucleoprotein F'                                  9734.171   2  ?        ? ? ? 
41 polymer     nat 'Small nuclear ribonucleoprotein E'                                  10817.601  2  ?        ? ? ? 
42 polymer     nat 'Small nuclear ribonucleoprotein G'                                  8508.084   2  ?        ? ? ? 
43 polymer     nat 'Small nuclear ribonucleoprotein Sm D3'                              13940.308  2  ?        ? ? ? 
44 polymer     nat 
;Small nuclear ribonucleoprotein-associated proteins B and B'
;
24642.131  2  ?        ? ? ? 
45 polymer     nat 'Small nuclear ribonucleoprotein Sm D1'                              13310.653  2  ?        ? ? ? 
46 polymer     nat 'Peptidyl-prolyl cis-trans isomerase E'                              33475.773  1  5.2.1.8  ? ? ? 
47 polymer     nat 'Splicing factor 3A subunit 1'                                       88991.094  1  ?        ? ? ? 
48 polymer     nat 'Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16' 119443.633 1  3.6.4.13 ? ? ? 
49 polymer     nat 'U5 small nuclear ribonucleoprotein 200 kDa helicase'                244823.422 1  3.6.4.13 ? ? ? 
50 polymer     nat 'Pre-mRNA-splicing factor ISY1 homolog'                              33046.254  1  ?        ? ? ? 
51 non-polymer syn 'ZINC ION'                                                           65.409     11 ?        ? ? ? 
52 non-polymer syn 'MAGNESIUM ION'                                                      24.305     5  ?        ? ? ? 
53 non-polymer syn 'INOSITOL HEXAKISPHOSPHATE'                                          660.035    1  ?        ? ? ? 
54 non-polymer syn "GUANOSINE-5'-TRIPHOSPHATE"                                          523.180    1  ?        ? ? ? 
55 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                                           427.201    2  ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
6  'SF3a66,Spliceosome-associated protein 62,SAP 62' 
7  'Pre-mRNA-splicing factor SF3b 145 kDa subunit,SF3b145,Spliceosome-associated protein 145,SAP 145' 
8  '220 kDa U5 snRNP-specific protein,PRP8 homolog,Splicing factor Prp8,p220' 
9  
'Elongation factor Tu GTP-binding domain-containing protein 2,SNU114 homolog,hSNU114,U5 snRNP-specific protein,116 kDa,U5-116 kDa' 
10 'Nuclear protein SkiP,Nuclear receptor coactivator NCoA-62,Ski-interacting protein' 
12 'Cell division cycle 40 homolog,EH-binding protein 3,Ehb3,PRP17 homolog,hPRP17' 
13 'Cdc5-like protein,Pombe cdc5-related protein' 
14 'Crooked neck homolog,hCrn' 
15 'RNA-binding motif protein 22,Zinc finger CCCH domain-containing protein 16' 
16 'Protein EDG-2,Protein G10 homolog' 
18 
;300 kDa nuclear matrix antigen,Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa,Ser/Arg-related nuclear matrix protein of 300 kDa,Splicing coactivator subunit SRm300,Tax-responsive enhancer element-binding protein 803,TaxREB803
;
19 'PPIase,Rotamase PPIL1' 
20 'SR-related nuclear matrix protein of 160 kDa,SRm160,Ser/Arg-related nuclear matrix protein' 
22 'PPIase CWC27,Antigen NY-CO-10,Serologically defined colon cancer antigen 10' 
23 'Zinc finger protein 183' 
24 'Pre-mRNA-splicing factor SF3b 155 kDa subunit,SF3b155,Spliceosome-associated protein 155,SAP 155' 
25 'Pre-mRNA-splicing factor SF3b 130 kDa subunit,SF3b130,STAF130,Spliceosome-associated protein 130,SAP 130' 
26 'SF3b5,Pre-mRNA-splicing factor SF3b 10 kDa subunit' 
27 'PHD finger-like domain protein 5A,Splicing factor 3B-associated 14 kDa protein,SF3b14b' 
28 
;Pre-mRNA branch site protein p14,SF3b 14 kDa subunit,SF3B14a,Spliceosome-associated protein,14-kDa,Splicing factor 3b,subunit 6,14kDa
;
29 'FHA domain-containing protein SNIP1' 
30 'SF3a60,Spliceosome-associated protein 61,SAP 61' 
31 'U5-40K,38 kDa-splicing factor,Prp8-binding protein,hPRP8BP,U5 snRNP-specific 40 kDa protein,WD repeat-containing protein 57' 
32 'Nuclear matrix protein 200,PRP19/PSO4 homolog,hPso4,RING-type E3 ubiquitin transferase PRP19,Senescence evasion factor' 
33 'Breast carcinoma-amplified sequence 2,DNA amplified in mammary carcinoma 1 protein,Spliceosome-associated protein SPF 27' 
34 'Protein HCNP,XPA-binding protein 2' 
35 'Nucampholin homolog,fSAPb' 
36 'Intron-binding protein of 160 kDa,IBP160' 
37 
;U2 snRNP A'
;
38 
;U2 snRNP B''
;
39 'Sm-D2,snRNP core protein D2' 
40 'snRNP-F,Sm protein F,SmF' 
41 'snRNP-E,Sm protein E,SmE' 
42 'snRNP-G,Sm protein G,SmG' 
43 'Sm-D3,snRNP core protein D3' 
44 
;snRNP-B,Sm protein B/B',SmB/B'
;
45 'Sm-D1,Sm-D autoantigen,snRNP core protein D1' 
46 'PPIase E,Cyclophilin E,Cyclophilin-33,Rotamase E' 
47 'SF3a120,Spliceosome-associated protein 114,SAP 114' 
48 'ATP-dependent RNA helicase #3,DEAH-box protein 16' 
49 'Activating signal cointegrator 1 complex subunit 3-like 1,BRR2 homolog,U5 snRNP-specific 200 kDa protein,U5-200KD' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'   no no 
;MNPLTKVKLINELNEREVQLGVADKVSWHSEYKDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFC
FLCYEDQRSTILAVDNFNGIKIKGRTIRVDHVSNYRAPKDSEEIDDVTRQLQEKGCGARTPSPSLSESSEDEKPTKKHKK
DKKEKKKKKKEKEKADREVQAEQPSSSSPRRKTVKEKDDTGPKKHSSKNSERAQKSEPREGQKLPKSRTAYSGGAEDLER
ELKKEKPKHEHKSSSRREAREEKTRIRDRGRSSDAHSSWYNGRSEGRSYRSRSRSRDKSHRHKRARRSRERESSNPSDRW
RH
;
;MNPLTKVKLINELNEREVQLGVADKVSWHSEYKDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFC
FLCYEDQRSTILAVDNFNGIKIKGRTIRVDHVSNYRAPKDSEEIDDVTRQLQEKGCGARTPSPSLSESSEDEKPTKKHKK
DKKEKKKKKKEKEKADREVQAEQPSSSSPRRKTVKEKDDTGPKKHSSKNSERAQKSEPREGQKLPKSRTAYSGGAEDLER
ELKKEKPKHEHKSSSRREAREEKTRIRDRGRSSDAHSSWYNGRSEGRSYRSRSRSRDKSHRHKRARRSRERESSNPSDRW
RH
;
1       ? 
2  polyribonucleotide no no 
;AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGA
GGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUA
UUGCAGUACCUCCAGGAACGGUGCACCC
;
;AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGA
GGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUA
UUGCAGUACCUCCAGGAACGGUGCACCC
;
2       ? 
3  'polypeptide(L)'   no no 
;MAAAPPLSKAEYLKRYLSGADAGVDRGSESGRKRRKKRPKPGGAGGKGMRIVDDDVSWTAISTTKLEKEEEEDDGDLPVV
AEFVDERPEEVKQMEAFRSSAKWKLLGGHNEDLPSNRHFRHDTPDSSPRRVRHGTPDPSPRKDRHDTPDPSPRRARHDTP
DPSPLRGARHDSDTSPPRRIRHDSSDTSPPRRARHDSPDPSPPRRPQHNSSGASPRRVRHDSPDPSPPRRARHGSSDISS
PRRVHNNSPDTSRRTLGSSDTQQLRRARHDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEY
DPDISPPRKKQAKSHFGDKKQLDSKGDCQKATDSDLSSPRHKQSPGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTK
SSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETMAFEAEFQYAETVFRDKSGRKRNLKLERLEQ
RRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNK
KVRPRYSGPAPPPNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM
;
;MAAAPPLSKAEYLKRYLSGADAGVDRGSESGRKRRKKRPKPGGAGGKGMRIVDDDVSWTAISTTKLEKEEEEDDGDLPVV
AEFVDERPEEVKQMEAFRSSAKWKLLGGHNEDLPSNRHFRHDTPDSSPRRVRHGTPDPSPRKDRHDTPDPSPRRARHDTP
DPSPLRGARHDSDTSPPRRIRHDSSDTSPPRRARHDSPDPSPPRRPQHNSSGASPRRVRHDSPDPSPPRRARHGSSDISS
PRRVHNNSPDTSRRTLGSSDTQQLRRARHDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEY
DPDISPPRKKQAKSHFGDKKQLDSKGDCQKATDSDLSSPRHKQSPGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTK
SSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETMAFEAEFQYAETVFRDKSGRKRNLKLERLEQ
RRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNK
KVRPRYSGPAPPPNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM
;
3       ? 
4  polyribonucleotide no no 
;AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCU
UAACCCAAUUUUUUGAGCCUUGCCUUGGCAAGGCUA
;
;AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCU
UAACCCAAUUUUUUGAGCCUUGCCUUGGCAAGGCUA
;
5       ? 
5  polyribonucleotide no no 
;GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACG
CAAAUUCGUGAAGCGUUCCAUAUUUUU
;
;GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACG
CAAAUUCGUGAAGCGUUCCAUAUUUUU
;
6       ? 
6  'polypeptide(L)'   no no 
;MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQT
NLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIE
PPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNG
LPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAP
GVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGM
HPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN
;
;MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQT
NLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIE
PPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNG
LPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAP
GVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGM
HPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN
;
7       ? 
7  'polypeptide(L)'   no no 
;MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAP
PPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQ
EERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMG
APVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSK
KEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVK
KEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDV
TAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPK
MGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYG
PPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSE
EEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMM
GSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQP
QDSRGGSKKYKEFKF
;
;MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAP
PPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQ
EERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMG
APVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSK
KEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVK
KEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDV
TAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPK
MGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYG
PPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSE
EEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMM
GSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQP
QDSRGGSKKYKEFKF
;
8       ? 
8  'polypeptide(L)'   no no 
;MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRK
FRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRH
FKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYR
LANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLY
NNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTAN
GIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATK
FFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDS
HVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFF
MRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCW
KANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPY
ITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSR
IKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGIN
NLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFI
VQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDP
NNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKC
RTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVN
TQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHE
EDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRT
DFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTN
AQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQE
LDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYA
RAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTE
PYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWK
TAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLY
DDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVA
SLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISA
ANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLP
GQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQ
NTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALL
QEGEVYSADREDLYA
;
;MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRK
FRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRH
FKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYR
LANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLY
NNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTAN
GIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATK
FFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDS
HVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFF
MRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCW
KANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPY
ITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSR
IKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGIN
NLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFI
VQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDP
NNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKC
RTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVN
TQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHE
EDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRT
DFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTN
AQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQE
LDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYA
RAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTE
PYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWK
TAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLY
DDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVA
SLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISA
ANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLP
GQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQ
NTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALL
QEGEVYSADREDLYA
;
A       ? 
9  'polypeptide(L)'   no no 
;MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETI
VQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKR
YDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTL
GSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELG
IHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIV
KTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCV
MHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEP
LHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDS
FGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
;
;MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETI
VQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKR
YDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTL
GSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELG
IHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIV
KTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCV
MHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEP
LHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDS
FGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
;
B       ? 
10 'polypeptide(L)'   no no 
;MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKK
KMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVA
AAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKH
EEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPR
TSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE
;
;MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKK
KMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVA
AAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKH
EEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPR
TSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE
;
C       ? 
11 'polypeptide(L)'   no no 
;MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHK
QYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPT
AMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKL
SLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTK
ASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKF
PDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTA
EADKTIKVYREDDTATEETHPVSWKPEIIKRKRF
;
;MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHK
QYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPT
AMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKL
SLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTK
ASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKF
PDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTA
EADKTIKVYREDDTATEETHPVSWKPEIIKRKRF
;
D       ? 
12 'polypeptide(L)'   no no 
;MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQ
YNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAE
KNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTI
LHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYG
ERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKI
VQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQS
MDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHP
HETSKVITCGWDGLIKLWD
;
;MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQ
YNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAE
KNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTI
LHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYG
ERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKI
VQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQS
MDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHP
HETSKVITCGWDGLIKLWD
;
E       ? 
13 'polypeptide(L)'   no no 
;MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPT
QWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLA
NTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFR
KLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIA
RQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQ
VVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGL
LGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLN
VEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEM
EVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKIL
LGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKS
KF
;
;MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPT
QWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLA
NTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFR
KLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIA
RQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQ
VVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGL
LGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLN
VEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEM
EVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKIL
LGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKS
KF
;
L       ? 
14 'polypeptide(L)'   no no 
;MTATVENLTFQKDTLGNAVDKNTSRLELRSYSLAGRHGSTEPLVLAWSSQFRRLTWGCALDALHRSPCVAASQHGVTHLI
RSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQVPLPVPRSCLFSESFVVSVSSQSRFLASVPGTGVQRSTAA
DMAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRT
VISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYME
EMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYE
RAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQY
EEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQA
SLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENC
TSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFEL
SSGKEGSLTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEE
YFDYIFPEDAANQPNLKLLAMAKLWKKQQQEKEDAEHHPDEDVDESES
;
;MTATVENLTFQKDTLGNAVDKNTSRLELRSYSLAGRHGSTEPLVLAWSSQFRRLTWGCALDALHRSPCVAASQHGVTHLI
RSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQVPLPVPRSCLFSESFVVSVSSQSRFLASVPGTGVQRSTAA
DMAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRT
VISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYME
EMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYE
RAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQY
EEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQA
SLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENC
TSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFEL
SSGKEGSLTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEE
YFDYIFPEDAANQPNLKLLAMAKLWKKQQQEKEDAEHHPDEDVDESES
;
O       ? 
15 'polypeptide(L)'   no no 
;MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNV
CQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRN
RPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLG
DTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTD
SGIKLEPVPGLPGALPPPPAAEEEASANYFNLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPI
HYPSQDPQRMGAHAGKHSSP
;
;MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNV
CQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRN
RPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLG
DTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTD
SGIKLEPVPGLPGALPPPPAAEEEASANYFNLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPI
HYPSQDPQRMGAHAGKHSSP
;
P       ? 
16 'polypeptide(L)'   no no 
;MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIK
EGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
;
;MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIK
EGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
;
Q       ? 
17 'polypeptide(L)'   no no 
;MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPT
REHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRM
ENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK
;
;MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPT
REHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRM
ENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK
;
R       ? 
18 'polypeptide(L)'   no no 
;MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRRLEAALVKRPNPDILDHERKRRVELRCLELEEMMEEQ
GYEEQQIQEKVATFRLMLLEKDVNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREA
KQPAPEPPKPYSLVRESSSSRSPTPKQKKKKKKKDRGRRSESSSPRRERKKSSKKKKHRSESESKKRKHRSPTPKSKRKS
KDKKRKRSRSTTPAPKSRRAHRSTSADSASSSDTSRSRSRSAAAKTHTTALAGRSPSPASGRRGEGDAPFSEPGTTSTQR
PSSPETATKQPSSPYEDKDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLATTPLSQEPVNPPSEASPT
RDRSPPKSPEKLPQSSSSESSPPSPQPTKVSRHASSSPESPKPAPAPGSHREISSSPTSKNRSHGRAKRDKSHSHTPSRR
MGRSRSPATAKRGRSRSRTPTKRGHSRSRSPQWRRSRSAQRWGRSRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRG
RSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSP
ARRSGRSRSRTPARRGRSRSRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRGRSRSRSLVRRGRSHSRTPQR
RGRSGSSSERKNKSRTSQRRSRSNSSPEMKKSRISSRRSRSLSSPRSKAKSRLSLRRSLSGSSPCPKQKSQTPPRRSRSG
SSQPKAKSRTPPRRSRSSSSPPPKQKSKTPSRQSHSSSSPHPKVKSGTPPRQGSITSPQANEQSVTPQRRSCFESSPDPE
LKSRTPSRHSCSGSSPPRVKSSTPPRQSPSRSSSPQPKVKAIISPRQRSHSGSSSPSPSRVTSRTTPRRSRSVSPCSNVE
SRLLPRYSHSGSSSPDTKVKPETPPRQSHSGSISPYPKVKAQTPPGPSLSGSKSPCPQEKSKDSLVQSCPGSLSLCAGVK
SSTPPGESYFGVSSLQLKGQSQTSPDHRSDTSSPEVRQSHSESPSLQSKSQTSPKGGRSRSSSPVTELASRSPIRQDRGE
FSASPMLKSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSL
VFKDTLRTPPRERSGAGSSPETKEQNSALPTSSQDEELMEVVEKSEEPAGQILSHLSSELKEMSTSNFESSPEVEERPAV
SLTLDQSQSQASLEAVEVPSMASSWGGPHFSPEHKELSNSPLRENSFGSPLEFRNSGPLGTEMNTGFSSEVKEDLNGPFL
NQLETDPSLDMKEQSTRSSGHSSSELSPDAVEKAGMSSNQSISSPVLDAVPRTPSRERSSSASSPEMKDGLPRTPSRRSR
SGSSPGLRDGSGTPSRHSLSGSSPGMKDIPRTPSRGRSECDSSPEPKALPQTPRPRSRSPSSPELNNKCLTPQRERSGSE
SSVDQKTVARTPLGQRSRSGSSQELDVKPSASPQERSESDSSPDSKAKTRTPLRQRSRSGSSPEVDSKSRLSPRRSRSGS
SPEVKDKPRAAPRAQSGSDSSPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSSPEPKT
KSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRG
RSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRG
RSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSR
RRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSP
VTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSA
SGSSSDRSRSATPPATRNHSGSRTPPVALNSSRMSCFSRPSMSPTPLDRCRSPGMLEPLGSSRTPMSVLQQAGGSMMDGP
GPRIPDHQRTSVPENHAQSRIALALTAISLGTARPPPSMSAAGLAARMSQVPAPVPLMSLRTAPAANLASRIPAASAAAM
NLASARTPAIPTAVNLADSRTPAAAAAMNLASPRTAVAPSAVNLADPRTPTAPAVNLAGARTPAALAALSLTGSGTPPTA
ANYPSSSRTPQAPASANLVGPRSAHATAPVNIAGSRTAAALAPASLTSARMAPALSGANLTSPRVPLSAYERVSGRTSPP
LLDRARSRTPPSAPSQSRMTSERAPSPSSRMGQAPSQSLLPPAQDQPRSPVPSAFSDQSRCLIAQTTPVAGSQSLSSGAV
ATTTSSAGDHNGMLSVPAPGVPHSDVGEPPASTGAQQPSALAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSS
SDSEGSSLPVQPEVALKRVPSPTPAPKEAVREGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
SSSSSSSSPSPAKPGPQALPKPASPKKPPPGERRSRSPRKPIDSLRDSRSLSYSPVERRRPSPQPSPRDQQSSSSERGSR
RGQRGDSRSPSHKRRRETPSPRPMRHRSSRSP
;
;MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRRLEAALVKRPNPDILDHERKRRVELRCLELEEMMEEQ
GYEEQQIQEKVATFRLMLLEKDVNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREA
KQPAPEPPKPYSLVRESSSSRSPTPKQKKKKKKKDRGRRSESSSPRRERKKSSKKKKHRSESESKKRKHRSPTPKSKRKS
KDKKRKRSRSTTPAPKSRRAHRSTSADSASSSDTSRSRSRSAAAKTHTTALAGRSPSPASGRRGEGDAPFSEPGTTSTQR
PSSPETATKQPSSPYEDKDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLATTPLSQEPVNPPSEASPT
RDRSPPKSPEKLPQSSSSESSPPSPQPTKVSRHASSSPESPKPAPAPGSHREISSSPTSKNRSHGRAKRDKSHSHTPSRR
MGRSRSPATAKRGRSRSRTPTKRGHSRSRSPQWRRSRSAQRWGRSRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRG
RSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSP
ARRSGRSRSRTPARRGRSRSRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRGRSRSRSLVRRGRSHSRTPQR
RGRSGSSSERKNKSRTSQRRSRSNSSPEMKKSRISSRRSRSLSSPRSKAKSRLSLRRSLSGSSPCPKQKSQTPPRRSRSG
SSQPKAKSRTPPRRSRSSSSPPPKQKSKTPSRQSHSSSSPHPKVKSGTPPRQGSITSPQANEQSVTPQRRSCFESSPDPE
LKSRTPSRHSCSGSSPPRVKSSTPPRQSPSRSSSPQPKVKAIISPRQRSHSGSSSPSPSRVTSRTTPRRSRSVSPCSNVE
SRLLPRYSHSGSSSPDTKVKPETPPRQSHSGSISPYPKVKAQTPPGPSLSGSKSPCPQEKSKDSLVQSCPGSLSLCAGVK
SSTPPGESYFGVSSLQLKGQSQTSPDHRSDTSSPEVRQSHSESPSLQSKSQTSPKGGRSRSSSPVTELASRSPIRQDRGE
FSASPMLKSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSL
VFKDTLRTPPRERSGAGSSPETKEQNSALPTSSQDEELMEVVEKSEEPAGQILSHLSSELKEMSTSNFESSPEVEERPAV
SLTLDQSQSQASLEAVEVPSMASSWGGPHFSPEHKELSNSPLRENSFGSPLEFRNSGPLGTEMNTGFSSEVKEDLNGPFL
NQLETDPSLDMKEQSTRSSGHSSSELSPDAVEKAGMSSNQSISSPVLDAVPRTPSRERSSSASSPEMKDGLPRTPSRRSR
SGSSPGLRDGSGTPSRHSLSGSSPGMKDIPRTPSRGRSECDSSPEPKALPQTPRPRSRSPSSPELNNKCLTPQRERSGSE
SSVDQKTVARTPLGQRSRSGSSQELDVKPSASPQERSESDSSPDSKAKTRTPLRQRSRSGSSPEVDSKSRLSPRRSRSGS
SPEVKDKPRAAPRAQSGSDSSPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSSPEPKT
KSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRG
RSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRG
RSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSR
RRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSP
VTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSA
SGSSSDRSRSATPPATRNHSGSRTPPVALNSSRMSCFSRPSMSPTPLDRCRSPGMLEPLGSSRTPMSVLQQAGGSMMDGP
GPRIPDHQRTSVPENHAQSRIALALTAISLGTARPPPSMSAAGLAARMSQVPAPVPLMSLRTAPAANLASRIPAASAAAM
NLASARTPAIPTAVNLADSRTPAAAAAMNLASPRTAVAPSAVNLADPRTPTAPAVNLAGARTPAALAALSLTGSGTPPTA
ANYPSSSRTPQAPASANLVGPRSAHATAPVNIAGSRTAAALAPASLTSARMAPALSGANLTSPRVPLSAYERVSGRTSPP
LLDRARSRTPPSAPSQSRMTSERAPSPSSRMGQAPSQSLLPPAQDQPRSPVPSAFSDQSRCLIAQTTPVAGSQSLSSGAV
ATTTSSAGDHNGMLSVPAPGVPHSDVGEPPASTGAQQPSALAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSS
SDSEGSSLPVQPEVALKRVPSPTPAPKEAVREGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
SSSSSSSSPSPAKPGPQALPKPASPKKPPPGERRSRSPRKPIDSLRDSRSLSYSPVERRRPSPQPSPRDQQSSSSERGSR
RGQRGDSRSPSHKRRRETPSPRPMRHRSSRSP
;
S       ? 
19 'polypeptide(L)'   no no 
;MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK
QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKII
KAYPSG
;
;MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK
QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKII
KAYPSG
;
V       ? 
20 'polypeptide(L)'   no no 
;MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNP
DSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKE
SSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPELPEPSVKVKEPSVQEATS
TSDILKVPKPEPIPEPKEPSPEKNSKKEKEKEKTRPRSRSRSKSRSRTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRR
PSPRRRTPPRRMPPPPRHRRSRSPVRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHR
PSPPATPPPKTRHSPTPQQSNRTRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGGKMAAADSVQ
QRRQYRRQNQQSSSDSGSSSSSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSPRGRRRRSPSPPPTRRRRS
PSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPP
PKQRSSPVTKRRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTSSSPPPVRRGASSSPQRRQSPSPSTRP
IRRVSRTPEPKKIKKAASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPPSPVQSQSPSTNWSPAVPVKKAKSPTPSPSPPR
NSDQEGGGKKKKKKKDKKHKKDKKHKKHKKHKKEKAVAAAAAAAVTPAAIAAATTTLAQEEPVAAPEPKKETESEAEDNL
DDLEKHLREKALRSMRKAQVSPQS
;
;MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNP
DSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKE
SSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPELPEPSVKVKEPSVQEATS
TSDILKVPKPEPIPEPKEPSPEKNSKKEKEKEKTRPRSRSRSKSRSRTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRR
PSPRRRTPPRRMPPPPRHRRSRSPVRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHR
PSPPATPPPKTRHSPTPQQSNRTRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGGKMAAADSVQ
QRRQYRRQNQQSSSDSGSSSSSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSPRGRRRRSPSPPPTRRRRS
PSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPP
PKQRSSPVTKRRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTSSSPPPVRRGASSSPQRRQSPSPSTRP
IRRVSRTPEPKKIKKAASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPPSPVQSQSPSTNWSPAVPVKKAKSPTPSPSPPR
NSDQEGGGKKKKKKKDKKHKKDKKHKKHKKHKKEKAVAAAAAAAVTPAAIAAATTTLAQEEPVAAPEPKKETESEAEDNL
DDLEKHLREKALRSMRKAQVSPQS
;
Y       ? 
21 polyribonucleotide no no 
;GAAUACAAGCUCAUCCGAUAUCCGUACACCAUCAGGGUACGAGCUAGCCCAUGGCGUACACCAUCAGGGUACGACUAGUA
GAUCUCGUACACCAUCAGGGUACGGAAUUCUCUAGAGUCGAGGAGGACAUCUCAGCAAAAGAGAAGCUGCUGCGGGCGUC
GGAGGACGAGCGGGACCGGGUGCUGGAGGAGCUGCACAAGGCAGAGGACAGCCUGCUGGCUGCCGACGAGACCGCCGCCA
AGGUAUGUAUCAAGCUUACAAGACAGCUUCUUAUGUAUUUACUGACCUGUGUUUUUUUGCUACUUUUUUUCUUUUCUCCC
CUUCCCCUUUCCCUAUUUUUUUUCUUGCCCUGAUCCGGAAUUUGGAUCC
;
;GAAUACAAGCUCAUCCGAUAUCCGUACACCAUCAGGGUACGAGCUAGCCCAUGGCGUACACCAUCAGGGUACGACUAGUA
GAUCUCGUACACCAUCAGGGUACGGAAUUCUCUAGAGUCGAGGAGGACAUCUCAGCAAAAGAGAAGCUGCUGCGGGCGUC
GGAGGACGAGCGGGACCGGGUGCUGGAGGAGCUGCACAAGGCAGAGGACAGCCUGCUGGCUGCCGACGAGACCGCCGCCA
AGGUAUGUAUCAAGCUUACAAGACAGCUUCUUAUGUAUUUACUGACCUGUGUUUUUUUGCUACUUUUUUUCUUUUCUCCC
CUUCCCCUUUCCCUAUUUUUUUUCUUGCCCUGAUCCGGAAUUUGGAUCC
;
Z       ? 
22 'polypeptide(L)'   no no 
;MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTGTGSGGESIYG
APFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPHK
IKSCEVLFNPFDDIIPREIKRLKKEKPEEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDP
HLSSVPVVESEKGDAPDLVDDGEDESAEHDEYIDGDEKNLMRERIAKKLKKDTSANVKSAGEGEVEKKSVSRSEELRKEA
RQLKRELLAAKQKKVENAAKQAEKRSEEEEAPPDGAVAEYRREKQKYEALRKQQSKKGTSREDQTLALLNQFKSKLTQAI
AETPENDIPETEVEDDEGWMSHVLQFEDKSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR
;
;MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTGTGSGGESIYG
APFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPHK
IKSCEVLFNPFDDIIPREIKRLKKEKPEEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDP
HLSSVPVVESEKGDAPDLVDDGEDESAEHDEYIDGDEKNLMRERIAKKLKKDTSANVKSAGEGEVEKKSVSRSEELRKEA
RQLKRELLAAKQKKVENAAKQAEKRSEEEEAPPDGAVAEYRREKQKYEALRKQQSKKGTSREDQTLALLNQFKSKLTQAI
AETPENDIPETEVEDDEGWMSHVLQFEDKSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR
;
s       ? 
23 'polypeptide(L)'   no no 
;MAEQLSPGKAVDQVCTFLFKKPGRKGAAGRRKRPACDPEPGESGSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAY
GDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQ
KYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGR
YGVYEDENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKH
RATGEGGASDLPEDPDEDAIPIT
;
;MAEQLSPGKAVDQVCTFLFKKPGRKGAAGRRKRPACDPEPGESGSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAY
GDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQ
KYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGR
YGVYEDENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKH
RATGEGGASDLPEDPDEDAIPIT
;
t       ? 
24 'polypeptide(L)'   no no 
;MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQK
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQH
LTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAK
GSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGG
DSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLS
DEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLV
DVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRIL
YKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALG
IPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYG
IESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDG
VEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLG
AADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAV
VMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVG
RIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVA
ETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVY
GFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDAL
IAHYPRIYNDDKNTYIRYELDYIL
;
;MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQK
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQH
LTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAK
GSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGG
DSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLS
DEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLV
DVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRIL
YKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALG
IPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYG
IESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDG
VEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLG
AADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAV
VMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVG
RIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVA
ETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVY
GFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDAL
IAHYPRIYNDDKNTYIRYELDYIL
;
u       ? 
25 'polypeptide(L)'   no no 
;MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVV
GSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEA
HKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPG
GSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDED
MVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDE
LDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVN
ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTG
GELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESL
CIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSW
LSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIII
ETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLV
QLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVL
IGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLD
YDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYT
TLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT
PPEVSKKLEDIRTRYAF
;
;MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVV
GSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEA
HKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPG
GSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDED
MVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDE
LDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVN
ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTG
GELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESL
CIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSW
LSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIII
ETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLV
QLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVL
IGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLD
YDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYT
TLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT
PPEVSKKLEDIRTRYAF
;
v       ? 
26 'polypeptide(L)'   no no 
;MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPA
DKPEEN
;
;MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPA
DKPEEN
;
x       ? 
27 'polypeptide(L)'   no no 
;MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEK
DRDGCPKIVNLGSSKTDLFYERKKYGFKKR
;
;MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEK
DRDGCPKIVNLGSSKTDLFYERKKYGFKKR
;
y       ? 
28 'polypeptide(L)'   no no 
;MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGF
NVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
;
;MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGF
NVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
;
z,N     ? 
29 'polypeptide(L)'   no no 
;MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEPARSGHRGNRARGVSRSPPKK
KNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGREDRQHREPSEQEHRRARNSDRDRHRGHSHQRRTSNERPGSG
QGQGRDRDTQNLQAQEEEREFYNARRREHRQRNDVGGGGSESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFR
GVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVFQYRLVEYTRADGTV
GRRVKPYIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKFGFSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS
;
;MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEPARSGHRGNRARGVSRSPPKK
KNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGREDRQHREPSEQEHRRARNSDRDRHRGHSHQRRTSNERPGSG
QGQGRDRDTQNLQAQEEEREFYNARRREHRQRNDVGGGGSESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFR
GVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVFQYRLVEYTRADGTV
GRRVKPYIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKFGFSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS
;
0       ? 
30 'polypeptide(L)'   no no 
;METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNE
FAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDY
ITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHA
GAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDI
AFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLH
GLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYE
DSSGNVVNKKTYEDLKRQGLL
;
;METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNE
FAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDY
ITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHA
GAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDI
AFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLH
GLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYE
DSSGNVVNKKTYEDLKRQGLL
;
9       ? 
31 'polypeptide(L)'   no no 
;MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGST
LASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPA
RRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTG
LSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRIL
YKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
;
;MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGST
LASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPA
RRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTG
LSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRIL
YKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
;
F       ? 
32 'polypeptide(L)'   no no 
;MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQD
EWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPM
DLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTG
GADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDY
LLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAF
SENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTG
VAFGHHAKFIASTGMDRSLKFYSL
;
;MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQD
EWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPM
DLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTG
GADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDY
LLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAF
SENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTG
VAFGHHAKFIASTGMDRSLKFYSL
;
G,H,I,J ? 
33 'polypeptide(L)'   no no 
;MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIE
LLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHI
QDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
;
;MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIE
LLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHI
QDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
;
K       ? 
34 'polypeptide(L)'   no no 
;MVVMARLSRPERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRA
QVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHP
LPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLDEAAQRLATVVNDERFVSKAGKSNYQLWHELCDLISQNPDKVQSLNV
DAIIRGGLTRFTDQLGKLWCSLADYYIRSGHFEKARDVYEEAIRTVMTVRDFTQVFDSYAQFEESMIAAKMETASELGRE
EEDDVDLELRLARFEQLISRRPLLLNSVLLRQNPHHVHEWHKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVA
FAKFYEDNGQLDDARVILEKATKVNFKQVDDLASVWCQCGELELRHENYDEALRLLRKATALPARRAEYFDGSEPVQNRV
YKSLKVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFKAYERGISLFKWPNVSDIWSTY
LTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAA
EIYGVTHTRGIYQKAIEVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTI
KEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLAAEAERDQPLRAQSKILFVRS
DASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQSVPAAVFGSLKED
;
;MVVMARLSRPERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRA
QVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHP
LPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLDEAAQRLATVVNDERFVSKAGKSNYQLWHELCDLISQNPDKVQSLNV
DAIIRGGLTRFTDQLGKLWCSLADYYIRSGHFEKARDVYEEAIRTVMTVRDFTQVFDSYAQFEESMIAAKMETASELGRE
EEDDVDLELRLARFEQLISRRPLLLNSVLLRQNPHHVHEWHKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVA
FAKFYEDNGQLDDARVILEKATKVNFKQVDDLASVWCQCGELELRHENYDEALRLLRKATALPARRAEYFDGSEPVQNRV
YKSLKVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFKAYERGISLFKWPNVSDIWSTY
LTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAA
EIYGVTHTRGIYQKAIEVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTI
KEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLAAEAERDQPLRAQSKILFVRS
DASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQSVPAAVFGSLKED
;
M       ? 
35 'polypeptide(L)'   no no 
;MKSSVAQIKPSSGHDRRENLNSYQRNSSPEDRYEEQERSPRDRDYFDYSRSDYEHSRRGRSYDSSMESRNRDREKRRERE
RDTDRKRSRKSPSPGRRNPETSVTQSSSAQDEPATKKKKDELDPLLTRTGGAYIPPAKLRMMQEQITDKNSLAYQRMSWE
ALKKSINGLINKVNISNISIIIQELLQENIVRGRGLLSRSVLQAQSASPIFTHVYAALVAIINSKFPQIGELILKRLILN
FRKGYRRNDKQLCLTASKFVAHLINQNVAHEVLCLEMLTLLLERPTDDSVEVAIGFLKECGLKLTQVSPRGINAIFERLR
NILHESEIDKRVQYMIEVMFAVRKDGFKDHPIILEGLDLVEEDDQFTHMLPLEDDYNPEDVLNVFKMDPNFMENEEKYKA
IKKEILDEGDTDSNTDQDAGSSEEDEEEEEEEGEEDEEGQKVTIHDKTEINLVSFRRTIYLAIQSSLDFEECAHKLLKME
FPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKKEYMESFEGIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSL
PWSVLECIKLSEETTTSSSRIFVKIFFQELCEYMGLPKLNARLKDETLQPFFEGLLPRDNPRNTRFAINFFTSIGLGGLT
DELREHLKNTPKVIVAQKPDVEQNKSSPSSSSSASSSSESDSSDSDSDSSDSSSESSSEESDSSSISSHSSASANDVRKK
GHGKTRSKEVDKLIRNQQTNDRKQKERRQEHGHQETRTERERRSEKHRDQNSSGSNWRDPITKYTSDKDVPSERNNYSRV
ANDRDQEMHIDLENKHGDPKKKRGERRNSFSENEKHTHRIKDSENFRRKDRSKSKEMNRKHSGSRSDEDRYQNGAERRWE
KSSRYSEQSRESKKNQDRRREKSPAKQK
;
;MKSSVAQIKPSSGHDRRENLNSYQRNSSPEDRYEEQERSPRDRDYFDYSRSDYEHSRRGRSYDSSMESRNRDREKRRERE
RDTDRKRSRKSPSPGRRNPETSVTQSSSAQDEPATKKKKDELDPLLTRTGGAYIPPAKLRMMQEQITDKNSLAYQRMSWE
ALKKSINGLINKVNISNISIIIQELLQENIVRGRGLLSRSVLQAQSASPIFTHVYAALVAIINSKFPQIGELILKRLILN
FRKGYRRNDKQLCLTASKFVAHLINQNVAHEVLCLEMLTLLLERPTDDSVEVAIGFLKECGLKLTQVSPRGINAIFERLR
NILHESEIDKRVQYMIEVMFAVRKDGFKDHPIILEGLDLVEEDDQFTHMLPLEDDYNPEDVLNVFKMDPNFMENEEKYKA
IKKEILDEGDTDSNTDQDAGSSEEDEEEEEEEGEEDEEGQKVTIHDKTEINLVSFRRTIYLAIQSSLDFEECAHKLLKME
FPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKKEYMESFEGIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSL
PWSVLECIKLSEETTTSSSRIFVKIFFQELCEYMGLPKLNARLKDETLQPFFEGLLPRDNPRNTRFAINFFTSIGLGGLT
DELREHLKNTPKVIVAQKPDVEQNKSSPSSSSSASSSSESDSSDSDSDSSDSSSESSSEESDSSSISSHSSASANDVRKK
GHGKTRSKEVDKLIRNQQTNDRKQKERRQEHGHQETRTERERRSEKHRDQNSSGSNWRDPITKYTSDKDVPSERNNYSRV
ANDRDQEMHIDLENKHGDPKKKRGERRNSFSENEKHTHRIKDSENFRRKDRSKSKEMNRKHSGSRSDEDRYQNGAERRWE
KSSRYSEQSRESKKNQDRRREKSPAKQK
;
T       ? 
36 'polypeptide(L)'   no no 
;MAAPAQPKKIVAPTVSQINAEFVTQLACKYWAPHIKKKSPFDIKVIEDIYEKEIVKSRFAIRKIMLLEFSQYLENYLWMN
YSPEVSSKAYLMSICCMVNEKFRENVPAWEIFKKKPDHFPFFFKHILKAALAETDGEFSLHEQTVLLLFLDHCFNSLEVD
LIRSQVQQLISLPMWMGLQLARLELELKKTPKLRKFWNLIKKNDEKMDPEAREQAYQERRFLSQLIQKFISVLKSVPLSE
PVTMDKVHYCERFIELMIDLEALLPTRRWFNTILDDSHLLVHCYLSNLVRREEDGHLFSQLLDMLKFYTGFEINDQTGNA
LTENEMTTIHYDRITSLQRAAFAHFPELYDFALSNVAEVDTRESLVKFFGPLSSNTLHQVASYLCLLPTLPKNEDTTFDK
EFLLELLVSRHERRISQIQQLNQMPLYPTEKIIWDENIVPTEYYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYE
IRQDIEDSVSRMKPWQSEYGGVVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADVTINLNVRDHIKDEWEGLRKHD
VCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIEDGPEPRPNLRGESRTFRVFLDPNQYQQDMTN
TIQNGAEDVYETFNIIMRRKPKENNFKAVLETIRNLMNTDCVVPDWLHDIILGYGDPSSAHYSKMPNQIATLDFNDTFLS
IEHLKASFPGHNVKVTVEDPALQIPPFRITFPVRSGKGKKRKDADVEDEDTEEAKTLIVEPHVIPNRGPYPYNQPKRNTI
QFTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNIYHNFPEQRTLIVTHSNQALNQLFEKIMALDIDERHLLRLG
HGEEELETEKDFSRYGRVNYVLARRIELLEEVKRLQKSLGVPGDASYTCETAGYFFLYQVMSRWEEYISKVKNKGSTLPD
VTEVSTFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCFRHIKKIFTQLEEFRASELLRSGLDRSKYLLVKEAKIIAMTCT
HAALKRHDLVKLGFKYDNILMEEAAQILEIETFIPLLLQNPQDGFSRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLF
TRFVRVGVPTVDLDAQGRARASLCNLYNWRYKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGVGESEPNPYFYQN
LGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNKVTTVDRFQGQQNDYILLSLVRTRA
VGHLRDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAFSQLTARPLHLHIIPTEPFPTTRKNGERPSHEVQIIKNMPQ
MANFVYNMYMHLIQTTHHYHQTLLQLPPAMVEEGEEVQNQETELETEEEAMTVQADIIPSPTDTSCRQETPAFQTDTTPS
ETGATSTPEAIPALSETTPTVVGAVSAPAEANTPQDATSAPEETK
;
;MAAPAQPKKIVAPTVSQINAEFVTQLACKYWAPHIKKKSPFDIKVIEDIYEKEIVKSRFAIRKIMLLEFSQYLENYLWMN
YSPEVSSKAYLMSICCMVNEKFRENVPAWEIFKKKPDHFPFFFKHILKAALAETDGEFSLHEQTVLLLFLDHCFNSLEVD
LIRSQVQQLISLPMWMGLQLARLELELKKTPKLRKFWNLIKKNDEKMDPEAREQAYQERRFLSQLIQKFISVLKSVPLSE
PVTMDKVHYCERFIELMIDLEALLPTRRWFNTILDDSHLLVHCYLSNLVRREEDGHLFSQLLDMLKFYTGFEINDQTGNA
LTENEMTTIHYDRITSLQRAAFAHFPELYDFALSNVAEVDTRESLVKFFGPLSSNTLHQVASYLCLLPTLPKNEDTTFDK
EFLLELLVSRHERRISQIQQLNQMPLYPTEKIIWDENIVPTEYYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYE
IRQDIEDSVSRMKPWQSEYGGVVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADVTINLNVRDHIKDEWEGLRKHD
VCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIEDGPEPRPNLRGESRTFRVFLDPNQYQQDMTN
TIQNGAEDVYETFNIIMRRKPKENNFKAVLETIRNLMNTDCVVPDWLHDIILGYGDPSSAHYSKMPNQIATLDFNDTFLS
IEHLKASFPGHNVKVTVEDPALQIPPFRITFPVRSGKGKKRKDADVEDEDTEEAKTLIVEPHVIPNRGPYPYNQPKRNTI
QFTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNIYHNFPEQRTLIVTHSNQALNQLFEKIMALDIDERHLLRLG
HGEEELETEKDFSRYGRVNYVLARRIELLEEVKRLQKSLGVPGDASYTCETAGYFFLYQVMSRWEEYISKVKNKGSTLPD
VTEVSTFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCFRHIKKIFTQLEEFRASELLRSGLDRSKYLLVKEAKIIAMTCT
HAALKRHDLVKLGFKYDNILMEEAAQILEIETFIPLLLQNPQDGFSRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLF
TRFVRVGVPTVDLDAQGRARASLCNLYNWRYKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGVGESEPNPYFYQN
LGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNKVTTVDRFQGQQNDYILLSLVRTRA
VGHLRDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAFSQLTARPLHLHIIPTEPFPTTRKNGERPSHEVQIIKNMPQ
MANFVYNMYMHLIQTTHHYHQTLLQLPPAMVEEGEEVQNQETELETEEEAMTVQADIIPSPTDTSCRQETPAFQTDTTPS
ETGATSTPEAIPALSETTPTVVGAVSAPAEANTPQDATSAPEETK
;
U       ? 
37 'polypeptide(L)'   no no 
;MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIG
EGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEK
MFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTD
DGEEEMEEDTVTNGS
;
;MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIG
EGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEK
MFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTD
DGEEEMEEDTVTNGS
;
W       ? 
38 'polypeptide(L)'   no no 
;MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMR
IQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPE
ETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
;
;MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMR
IQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPE
ETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
;
X       ? 
39 'polypeptide(L)'   no no 
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
a,h     ? 
40 'polypeptide(L)'   no no 
;MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEE
DGEMRE
;
;MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEE
DGEMRE
;
b,i     ? 
41 'polypeptide(L)'   no no 
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
c,j     ? 
42 'polypeptide(L)'   no no MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV d,k     ? 
43 'polypeptide(L)'   no no 
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
e,l     ? 
44 'polypeptide(L)'   no no 
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATAS
IAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
;
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATAS
IAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
;
f,m     ? 
45 'polypeptide(L)'   no no 
;MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLL
VDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
;
;MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLL
VDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
;
g,n     ? 
46 'polypeptide(L)'   no no 
;MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVN
LAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLL
RSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG
PNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV
;
;MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVN
LAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLL
RSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG
PNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV
;
o       ? 
47 'polypeptide(L)'   no no 
;MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPK
FNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSIS
AFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVL
DQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGES
EEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKP
LPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVE
ETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPP
SSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMA
PRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEW
KLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK
;
;MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPK
FNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSIS
AFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVL
DQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGES
EEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKP
LPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVE
ETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPP
SSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMA
PRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEW
KLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK
;
p       ? 
48 'polypeptide(L)'   no no 
;MATPAGLERWVQDELHSVLGLSERHVAQFLIGTAQRCTSAEEFVQRLRDTDTLDLSGPARDFALRLWNKVPRKAVVEKPA
RAAEREARALLEKNRSYRLLEDSEESSEETVSRAGSSLQKKRKKRKHLRKKREEEEEEEASEKGKKKTGGSKQQTEKPES
EDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVLERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKRER
EKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEKLEATNRYHMPKETRGQPARAVDLVEEESG
APGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLP
VFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYS
IRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARF
STFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIR
ELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASAN
QRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALG
ALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLV
LLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYR
TVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKKIGKTREEL
G
;
;MATPAGLERWVQDELHSVLGLSERHVAQFLIGTAQRCTSAEEFVQRLRDTDTLDLSGPARDFALRLWNKVPRKAVVEKPA
RAAEREARALLEKNRSYRLLEDSEESSEETVSRAGSSLQKKRKKRKHLRKKREEEEEEEASEKGKKKTGGSKQQTEKPES
EDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVLERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKRER
EKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEKLEATNRYHMPKETRGQPARAVDLVEEESG
APGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLP
VFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYS
IRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARF
STFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIR
ELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASAN
QRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALG
ALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLV
LLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYR
TVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKKIGKTREEL
G
;
q       ? 
49 'polypeptide(L)'   no no 
;MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHD
INKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLL
LGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKV
LRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGG
EALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLA
TYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIE
MTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ
VLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDL
FADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYL
SLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA
ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKL
LERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDK
RMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV
ELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCET
QLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICA
EFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWK
QRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRP
VPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPY
LEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYP
IYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFL
YRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKT
KVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAI
RLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLT
DSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIK
RLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD
;
;MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHD
INKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLL
LGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKV
LRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGG
EALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLA
TYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIE
MTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ
VLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDL
FADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYL
SLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA
ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKL
LERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDK
RMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV
ELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCET
QLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICA
EFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWK
QRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRP
VPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPY
LEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYP
IYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFL
YRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKT
KVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAI
RLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLT
DSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIK
RLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD
;
r       ? 
50 'polypeptide(L)'   no no 
;MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKL
LREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRKTRAELMKAIDFEYY
GYLDEDDGVIVPLEQEYEKKLRAELVEKWKAEREARLARGEKEEEEEEEEEINIYAVTEEESDEEGSQEKGGDDSQQKFI
AHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEEARRLLGY
;
;MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKL
LREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRKTRAELMKAIDFEYY
GYLDEDDGVIVPLEQEYEKKLRAELVEKWKAEREARLARGEKEEEEEEEEEINIYAVTEEESDEEGSQEKGGDDSQQKFI
AHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEEARRLLGY
;
w       ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    ASN n 
1  3    PRO n 
1  4    LEU n 
1  5    THR n 
1  6    LYS n 
1  7    VAL n 
1  8    LYS n 
1  9    LEU n 
1  10   ILE n 
1  11   ASN n 
1  12   GLU n 
1  13   LEU n 
1  14   ASN n 
1  15   GLU n 
1  16   ARG n 
1  17   GLU n 
1  18   VAL n 
1  19   GLN n 
1  20   LEU n 
1  21   GLY n 
1  22   VAL n 
1  23   ALA n 
1  24   ASP n 
1  25   LYS n 
1  26   VAL n 
1  27   SER n 
1  28   TRP n 
1  29   HIS n 
1  30   SER n 
1  31   GLU n 
1  32   TYR n 
1  33   LYS n 
1  34   ASP n 
1  35   SER n 
1  36   ALA n 
1  37   TRP n 
1  38   ILE n 
1  39   PHE n 
1  40   LEU n 
1  41   GLY n 
1  42   GLY n 
1  43   LEU n 
1  44   PRO n 
1  45   TYR n 
1  46   GLU n 
1  47   LEU n 
1  48   THR n 
1  49   GLU n 
1  50   GLY n 
1  51   ASP n 
1  52   ILE n 
1  53   ILE n 
1  54   CYS n 
1  55   VAL n 
1  56   PHE n 
1  57   SER n 
1  58   GLN n 
1  59   TYR n 
1  60   GLY n 
1  61   GLU n 
1  62   ILE n 
1  63   VAL n 
1  64   ASN n 
1  65   ILE n 
1  66   ASN n 
1  67   LEU n 
1  68   VAL n 
1  69   ARG n 
1  70   ASP n 
1  71   LYS n 
1  72   LYS n 
1  73   THR n 
1  74   GLY n 
1  75   LYS n 
1  76   SER n 
1  77   LYS n 
1  78   GLY n 
1  79   PHE n 
1  80   CYS n 
1  81   PHE n 
1  82   LEU n 
1  83   CYS n 
1  84   TYR n 
1  85   GLU n 
1  86   ASP n 
1  87   GLN n 
1  88   ARG n 
1  89   SER n 
1  90   THR n 
1  91   ILE n 
1  92   LEU n 
1  93   ALA n 
1  94   VAL n 
1  95   ASP n 
1  96   ASN n 
1  97   PHE n 
1  98   ASN n 
1  99   GLY n 
1  100  ILE n 
1  101  LYS n 
1  102  ILE n 
1  103  LYS n 
1  104  GLY n 
1  105  ARG n 
1  106  THR n 
1  107  ILE n 
1  108  ARG n 
1  109  VAL n 
1  110  ASP n 
1  111  HIS n 
1  112  VAL n 
1  113  SER n 
1  114  ASN n 
1  115  TYR n 
1  116  ARG n 
1  117  ALA n 
1  118  PRO n 
1  119  LYS n 
1  120  ASP n 
1  121  SER n 
1  122  GLU n 
1  123  GLU n 
1  124  ILE n 
1  125  ASP n 
1  126  ASP n 
1  127  VAL n 
1  128  THR n 
1  129  ARG n 
1  130  GLN n 
1  131  LEU n 
1  132  GLN n 
1  133  GLU n 
1  134  LYS n 
1  135  GLY n 
1  136  CYS n 
1  137  GLY n 
1  138  ALA n 
1  139  ARG n 
1  140  THR n 
1  141  PRO n 
1  142  SER n 
1  143  PRO n 
1  144  SER n 
1  145  LEU n 
1  146  SER n 
1  147  GLU n 
1  148  SER n 
1  149  SER n 
1  150  GLU n 
1  151  ASP n 
1  152  GLU n 
1  153  LYS n 
1  154  PRO n 
1  155  THR n 
1  156  LYS n 
1  157  LYS n 
1  158  HIS n 
1  159  LYS n 
1  160  LYS n 
1  161  ASP n 
1  162  LYS n 
1  163  LYS n 
1  164  GLU n 
1  165  LYS n 
1  166  LYS n 
1  167  LYS n 
1  168  LYS n 
1  169  LYS n 
1  170  LYS n 
1  171  GLU n 
1  172  LYS n 
1  173  GLU n 
1  174  LYS n 
1  175  ALA n 
1  176  ASP n 
1  177  ARG n 
1  178  GLU n 
1  179  VAL n 
1  180  GLN n 
1  181  ALA n 
1  182  GLU n 
1  183  GLN n 
1  184  PRO n 
1  185  SER n 
1  186  SER n 
1  187  SER n 
1  188  SER n 
1  189  PRO n 
1  190  ARG n 
1  191  ARG n 
1  192  LYS n 
1  193  THR n 
1  194  VAL n 
1  195  LYS n 
1  196  GLU n 
1  197  LYS n 
1  198  ASP n 
1  199  ASP n 
1  200  THR n 
1  201  GLY n 
1  202  PRO n 
1  203  LYS n 
1  204  LYS n 
1  205  HIS n 
1  206  SER n 
1  207  SER n 
1  208  LYS n 
1  209  ASN n 
1  210  SER n 
1  211  GLU n 
1  212  ARG n 
1  213  ALA n 
1  214  GLN n 
1  215  LYS n 
1  216  SER n 
1  217  GLU n 
1  218  PRO n 
1  219  ARG n 
1  220  GLU n 
1  221  GLY n 
1  222  GLN n 
1  223  LYS n 
1  224  LEU n 
1  225  PRO n 
1  226  LYS n 
1  227  SER n 
1  228  ARG n 
1  229  THR n 
1  230  ALA n 
1  231  TYR n 
1  232  SER n 
1  233  GLY n 
1  234  GLY n 
1  235  ALA n 
1  236  GLU n 
1  237  ASP n 
1  238  LEU n 
1  239  GLU n 
1  240  ARG n 
1  241  GLU n 
1  242  LEU n 
1  243  LYS n 
1  244  LYS n 
1  245  GLU n 
1  246  LYS n 
1  247  PRO n 
1  248  LYS n 
1  249  HIS n 
1  250  GLU n 
1  251  HIS n 
1  252  LYS n 
1  253  SER n 
1  254  SER n 
1  255  SER n 
1  256  ARG n 
1  257  ARG n 
1  258  GLU n 
1  259  ALA n 
1  260  ARG n 
1  261  GLU n 
1  262  GLU n 
1  263  LYS n 
1  264  THR n 
1  265  ARG n 
1  266  ILE n 
1  267  ARG n 
1  268  ASP n 
1  269  ARG n 
1  270  GLY n 
1  271  ARG n 
1  272  SER n 
1  273  SER n 
1  274  ASP n 
1  275  ALA n 
1  276  HIS n 
1  277  SER n 
1  278  SER n 
1  279  TRP n 
1  280  TYR n 
1  281  ASN n 
1  282  GLY n 
1  283  ARG n 
1  284  SER n 
1  285  GLU n 
1  286  GLY n 
1  287  ARG n 
1  288  SER n 
1  289  TYR n 
1  290  ARG n 
1  291  SER n 
1  292  ARG n 
1  293  SER n 
1  294  ARG n 
1  295  SER n 
1  296  ARG n 
1  297  ASP n 
1  298  LYS n 
1  299  SER n 
1  300  HIS n 
1  301  ARG n 
1  302  HIS n 
1  303  LYS n 
1  304  ARG n 
1  305  ALA n 
1  306  ARG n 
1  307  ARG n 
1  308  SER n 
1  309  ARG n 
1  310  GLU n 
1  311  ARG n 
1  312  GLU n 
1  313  SER n 
1  314  SER n 
1  315  ASN n 
1  316  PRO n 
1  317  SER n 
1  318  ASP n 
1  319  ARG n 
1  320  TRP n 
1  321  ARG n 
1  322  HIS n 
2  1    A   n 
2  2    U   n 
2  3    C   n 
2  4    G   n 
2  5    C   n 
2  6    U   n 
2  7    U   n 
2  8    C   n 
2  9    U   n 
2  10   C   n 
2  11   G   n 
2  12   G   n 
2  13   C   n 
2  14   C   n 
2  15   U   n 
2  16   U   n 
2  17   U   n 
2  18   U   n 
2  19   G   n 
2  20   G   n 
2  21   C   n 
2  22   U   n 
2  23   A   n 
2  24   A   n 
2  25   G   n 
2  26   A   n 
2  27   U   n 
2  28   C   n 
2  29   A   n 
2  30   A   n 
2  31   G   n 
2  32   U   n 
2  33   G   n 
2  34   U   n 
2  35   A   n 
2  36   G   n 
2  37   U   n 
2  38   A   n 
2  39   U   n 
2  40   C   n 
2  41   U   n 
2  42   G   n 
2  43   U   n 
2  44   U   n 
2  45   C   n 
2  46   U   n 
2  47   U   n 
2  48   A   n 
2  49   U   n 
2  50   C   n 
2  51   A   n 
2  52   G   n 
2  53   U   n 
2  54   U   n 
2  55   U   n 
2  56   A   n 
2  57   A   n 
2  58   U   n 
2  59   A   n 
2  60   U   n 
2  61   C   n 
2  62   U   n 
2  63   G   n 
2  64   A   n 
2  65   U   n 
2  66   A   n 
2  67   C   n 
2  68   G   n 
2  69   U   n 
2  70   C   n 
2  71   C   n 
2  72   U   n 
2  73   C   n 
2  74   U   n 
2  75   A   n 
2  76   U   n 
2  77   C   n 
2  78   C   n 
2  79   G   n 
2  80   A   n 
2  81   G   n 
2  82   G   n 
2  83   A   n 
2  84   C   n 
2  85   A   n 
2  86   A   n 
2  87   U   n 
2  88   A   n 
2  89   U   n 
2  90   A   n 
2  91   U   n 
2  92   U   n 
2  93   A   n 
2  94   A   n 
2  95   A   n 
2  96   U   n 
2  97   G   n 
2  98   G   n 
2  99   A   n 
2  100  U   n 
2  101  U   n 
2  102  U   n 
2  103  U   n 
2  104  U   n 
2  105  G   n 
2  106  G   n 
2  107  A   n 
2  108  G   n 
2  109  C   n 
2  110  A   n 
2  111  G   n 
2  112  G   n 
2  113  G   n 
2  114  A   n 
2  115  G   n 
2  116  A   n 
2  117  U   n 
2  118  G   n 
2  119  G   n 
2  120  A   n 
2  121  A   n 
2  122  U   n 
2  123  A   n 
2  124  G   n 
2  125  G   n 
2  126  A   n 
2  127  G   n 
2  128  C   n 
2  129  U   n 
2  130  U   n 
2  131  G   n 
2  132  C   n 
2  133  U   n 
2  134  C   n 
2  135  C   n 
2  136  G   n 
2  137  U   n 
2  138  C   n 
2  139  C   n 
2  140  A   n 
2  141  C   n 
2  142  U   n 
2  143  C   n 
2  144  C   n 
2  145  A   n 
2  146  C   n 
2  147  G   n 
2  148  C   n 
2  149  A   n 
2  150  U   n 
2  151  C   n 
2  152  G   n 
2  153  A   n 
2  154  C   n 
2  155  C   n 
2  156  U   n 
2  157  G   n 
2  158  G   n 
2  159  U   n 
2  160  A   n 
2  161  U   n 
2  162  U   n 
2  163  G   n 
2  164  C   n 
2  165  A   n 
2  166  G   n 
2  167  U   n 
2  168  A   n 
2  169  C   n 
2  170  C   n 
2  171  U   n 
2  172  C   n 
2  173  C   n 
2  174  A   n 
2  175  G   n 
2  176  G   n 
2  177  A   n 
2  178  A   n 
2  179  C   n 
2  180  G   n 
2  181  G   n 
2  182  U   n 
2  183  G   n 
2  184  C   n 
2  185  A   n 
2  186  C   n 
2  187  C   n 
2  188  C   n 
3  1    MET n 
3  2    ALA n 
3  3    ALA n 
3  4    ALA n 
3  5    PRO n 
3  6    PRO n 
3  7    LEU n 
3  8    SER n 
3  9    LYS n 
3  10   ALA n 
3  11   GLU n 
3  12   TYR n 
3  13   LEU n 
3  14   LYS n 
3  15   ARG n 
3  16   TYR n 
3  17   LEU n 
3  18   SER n 
3  19   GLY n 
3  20   ALA n 
3  21   ASP n 
3  22   ALA n 
3  23   GLY n 
3  24   VAL n 
3  25   ASP n 
3  26   ARG n 
3  27   GLY n 
3  28   SER n 
3  29   GLU n 
3  30   SER n 
3  31   GLY n 
3  32   ARG n 
3  33   LYS n 
3  34   ARG n 
3  35   ARG n 
3  36   LYS n 
3  37   LYS n 
3  38   ARG n 
3  39   PRO n 
3  40   LYS n 
3  41   PRO n 
3  42   GLY n 
3  43   GLY n 
3  44   ALA n 
3  45   GLY n 
3  46   GLY n 
3  47   LYS n 
3  48   GLY n 
3  49   MET n 
3  50   ARG n 
3  51   ILE n 
3  52   VAL n 
3  53   ASP n 
3  54   ASP n 
3  55   ASP n 
3  56   VAL n 
3  57   SER n 
3  58   TRP n 
3  59   THR n 
3  60   ALA n 
3  61   ILE n 
3  62   SER n 
3  63   THR n 
3  64   THR n 
3  65   LYS n 
3  66   LEU n 
3  67   GLU n 
3  68   LYS n 
3  69   GLU n 
3  70   GLU n 
3  71   GLU n 
3  72   GLU n 
3  73   ASP n 
3  74   ASP n 
3  75   GLY n 
3  76   ASP n 
3  77   LEU n 
3  78   PRO n 
3  79   VAL n 
3  80   VAL n 
3  81   ALA n 
3  82   GLU n 
3  83   PHE n 
3  84   VAL n 
3  85   ASP n 
3  86   GLU n 
3  87   ARG n 
3  88   PRO n 
3  89   GLU n 
3  90   GLU n 
3  91   VAL n 
3  92   LYS n 
3  93   GLN n 
3  94   MET n 
3  95   GLU n 
3  96   ALA n 
3  97   PHE n 
3  98   ARG n 
3  99   SER n 
3  100  SER n 
3  101  ALA n 
3  102  LYS n 
3  103  TRP n 
3  104  LYS n 
3  105  LEU n 
3  106  LEU n 
3  107  GLY n 
3  108  GLY n 
3  109  HIS n 
3  110  ASN n 
3  111  GLU n 
3  112  ASP n 
3  113  LEU n 
3  114  PRO n 
3  115  SER n 
3  116  ASN n 
3  117  ARG n 
3  118  HIS n 
3  119  PHE n 
3  120  ARG n 
3  121  HIS n 
3  122  ASP n 
3  123  THR n 
3  124  PRO n 
3  125  ASP n 
3  126  SER n 
3  127  SER n 
3  128  PRO n 
3  129  ARG n 
3  130  ARG n 
3  131  VAL n 
3  132  ARG n 
3  133  HIS n 
3  134  GLY n 
3  135  THR n 
3  136  PRO n 
3  137  ASP n 
3  138  PRO n 
3  139  SER n 
3  140  PRO n 
3  141  ARG n 
3  142  LYS n 
3  143  ASP n 
3  144  ARG n 
3  145  HIS n 
3  146  ASP n 
3  147  THR n 
3  148  PRO n 
3  149  ASP n 
3  150  PRO n 
3  151  SER n 
3  152  PRO n 
3  153  ARG n 
3  154  ARG n 
3  155  ALA n 
3  156  ARG n 
3  157  HIS n 
3  158  ASP n 
3  159  THR n 
3  160  PRO n 
3  161  ASP n 
3  162  PRO n 
3  163  SER n 
3  164  PRO n 
3  165  LEU n 
3  166  ARG n 
3  167  GLY n 
3  168  ALA n 
3  169  ARG n 
3  170  HIS n 
3  171  ASP n 
3  172  SER n 
3  173  ASP n 
3  174  THR n 
3  175  SER n 
3  176  PRO n 
3  177  PRO n 
3  178  ARG n 
3  179  ARG n 
3  180  ILE n 
3  181  ARG n 
3  182  HIS n 
3  183  ASP n 
3  184  SER n 
3  185  SER n 
3  186  ASP n 
3  187  THR n 
3  188  SER n 
3  189  PRO n 
3  190  PRO n 
3  191  ARG n 
3  192  ARG n 
3  193  ALA n 
3  194  ARG n 
3  195  HIS n 
3  196  ASP n 
3  197  SER n 
3  198  PRO n 
3  199  ASP n 
3  200  PRO n 
3  201  SER n 
3  202  PRO n 
3  203  PRO n 
3  204  ARG n 
3  205  ARG n 
3  206  PRO n 
3  207  GLN n 
3  208  HIS n 
3  209  ASN n 
3  210  SER n 
3  211  SER n 
3  212  GLY n 
3  213  ALA n 
3  214  SER n 
3  215  PRO n 
3  216  ARG n 
3  217  ARG n 
3  218  VAL n 
3  219  ARG n 
3  220  HIS n 
3  221  ASP n 
3  222  SER n 
3  223  PRO n 
3  224  ASP n 
3  225  PRO n 
3  226  SER n 
3  227  PRO n 
3  228  PRO n 
3  229  ARG n 
3  230  ARG n 
3  231  ALA n 
3  232  ARG n 
3  233  HIS n 
3  234  GLY n 
3  235  SER n 
3  236  SER n 
3  237  ASP n 
3  238  ILE n 
3  239  SER n 
3  240  SER n 
3  241  PRO n 
3  242  ARG n 
3  243  ARG n 
3  244  VAL n 
3  245  HIS n 
3  246  ASN n 
3  247  ASN n 
3  248  SER n 
3  249  PRO n 
3  250  ASP n 
3  251  THR n 
3  252  SER n 
3  253  ARG n 
3  254  ARG n 
3  255  THR n 
3  256  LEU n 
3  257  GLY n 
3  258  SER n 
3  259  SER n 
3  260  ASP n 
3  261  THR n 
3  262  GLN n 
3  263  GLN n 
3  264  LEU n 
3  265  ARG n 
3  266  ARG n 
3  267  ALA n 
3  268  ARG n 
3  269  HIS n 
3  270  ASP n 
3  271  SER n 
3  272  PRO n 
3  273  ASP n 
3  274  LEU n 
3  275  ALA n 
3  276  PRO n 
3  277  ASN n 
3  278  VAL n 
3  279  THR n 
3  280  TYR n 
3  281  SER n 
3  282  LEU n 
3  283  PRO n 
3  284  ARG n 
3  285  THR n 
3  286  LYS n 
3  287  SER n 
3  288  GLY n 
3  289  LYS n 
3  290  ALA n 
3  291  PRO n 
3  292  GLU n 
3  293  ARG n 
3  294  ALA n 
3  295  SER n 
3  296  SER n 
3  297  LYS n 
3  298  THR n 
3  299  SER n 
3  300  PRO n 
3  301  HIS n 
3  302  TRP n 
3  303  LYS n 
3  304  GLU n 
3  305  SER n 
3  306  GLY n 
3  307  ALA n 
3  308  SER n 
3  309  HIS n 
3  310  LEU n 
3  311  SER n 
3  312  PHE n 
3  313  PRO n 
3  314  LYS n 
3  315  ASN n 
3  316  SER n 
3  317  LYS n 
3  318  TYR n 
3  319  GLU n 
3  320  TYR n 
3  321  ASP n 
3  322  PRO n 
3  323  ASP n 
3  324  ILE n 
3  325  SER n 
3  326  PRO n 
3  327  PRO n 
3  328  ARG n 
3  329  LYS n 
3  330  LYS n 
3  331  GLN n 
3  332  ALA n 
3  333  LYS n 
3  334  SER n 
3  335  HIS n 
3  336  PHE n 
3  337  GLY n 
3  338  ASP n 
3  339  LYS n 
3  340  LYS n 
3  341  GLN n 
3  342  LEU n 
3  343  ASP n 
3  344  SER n 
3  345  LYS n 
3  346  GLY n 
3  347  ASP n 
3  348  CYS n 
3  349  GLN n 
3  350  LYS n 
3  351  ALA n 
3  352  THR n 
3  353  ASP n 
3  354  SER n 
3  355  ASP n 
3  356  LEU n 
3  357  SER n 
3  358  SER n 
3  359  PRO n 
3  360  ARG n 
3  361  HIS n 
3  362  LYS n 
3  363  GLN n 
3  364  SER n 
3  365  PRO n 
3  366  GLY n 
3  367  HIS n 
3  368  GLN n 
3  369  ASP n 
3  370  SER n 
3  371  ASP n 
3  372  SER n 
3  373  ASP n 
3  374  LEU n 
3  375  SER n 
3  376  PRO n 
3  377  PRO n 
3  378  ARG n 
3  379  ASN n 
3  380  ARG n 
3  381  PRO n 
3  382  ARG n 
3  383  HIS n 
3  384  ARG n 
3  385  SER n 
3  386  SER n 
3  387  ASP n 
3  388  SER n 
3  389  ASP n 
3  390  LEU n 
3  391  SER n 
3  392  PRO n 
3  393  PRO n 
3  394  ARG n 
3  395  ARG n 
3  396  ARG n 
3  397  GLN n 
3  398  ARG n 
3  399  THR n 
3  400  LYS n 
3  401  SER n 
3  402  SER n 
3  403  ASP n 
3  404  SER n 
3  405  ASP n 
3  406  LEU n 
3  407  SER n 
3  408  PRO n 
3  409  PRO n 
3  410  ARG n 
3  411  ARG n 
3  412  SER n 
3  413  GLN n 
3  414  PRO n 
3  415  PRO n 
3  416  GLY n 
3  417  LYS n 
3  418  LYS n 
3  419  ALA n 
3  420  ALA n 
3  421  HIS n 
3  422  MET n 
3  423  TYR n 
3  424  SER n 
3  425  GLY n 
3  426  ALA n 
3  427  LYS n 
3  428  THR n 
3  429  GLY n 
3  430  LEU n 
3  431  VAL n 
3  432  LEU n 
3  433  THR n 
3  434  ASP n 
3  435  ILE n 
3  436  GLN n 
3  437  ARG n 
3  438  GLU n 
3  439  GLN n 
3  440  GLN n 
3  441  GLU n 
3  442  LEU n 
3  443  LYS n 
3  444  GLU n 
3  445  GLN n 
3  446  ASP n 
3  447  GLN n 
3  448  GLU n 
3  449  THR n 
3  450  MET n 
3  451  ALA n 
3  452  PHE n 
3  453  GLU n 
3  454  ALA n 
3  455  GLU n 
3  456  PHE n 
3  457  GLN n 
3  458  TYR n 
3  459  ALA n 
3  460  GLU n 
3  461  THR n 
3  462  VAL n 
3  463  PHE n 
3  464  ARG n 
3  465  ASP n 
3  466  LYS n 
3  467  SER n 
3  468  GLY n 
3  469  ARG n 
3  470  LYS n 
3  471  ARG n 
3  472  ASN n 
3  473  LEU n 
3  474  LYS n 
3  475  LEU n 
3  476  GLU n 
3  477  ARG n 
3  478  LEU n 
3  479  GLU n 
3  480  GLN n 
3  481  ARG n 
3  482  ARG n 
3  483  LYS n 
3  484  ALA n 
3  485  GLU n 
3  486  LYS n 
3  487  ASP n 
3  488  SER n 
3  489  GLU n 
3  490  ARG n 
3  491  ASP n 
3  492  GLU n 
3  493  LEU n 
3  494  TYR n 
3  495  ALA n 
3  496  GLN n 
3  497  TRP n 
3  498  GLY n 
3  499  LYS n 
3  500  GLY n 
3  501  LEU n 
3  502  ALA n 
3  503  GLN n 
3  504  SER n 
3  505  ARG n 
3  506  GLN n 
3  507  GLN n 
3  508  GLN n 
3  509  GLN n 
3  510  ASN n 
3  511  VAL n 
3  512  GLU n 
3  513  ASP n 
3  514  ALA n 
3  515  MET n 
3  516  LYS n 
3  517  GLU n 
3  518  MET n 
3  519  GLN n 
3  520  LYS n 
3  521  PRO n 
3  522  LEU n 
3  523  ALA n 
3  524  ARG n 
3  525  TYR n 
3  526  ILE n 
3  527  ASP n 
3  528  ASP n 
3  529  GLU n 
3  530  ASP n 
3  531  LEU n 
3  532  ASP n 
3  533  ARG n 
3  534  MET n 
3  535  LEU n 
3  536  ARG n 
3  537  GLU n 
3  538  GLN n 
3  539  GLU n 
3  540  ARG n 
3  541  GLU n 
3  542  GLY n 
3  543  ASP n 
3  544  PRO n 
3  545  MET n 
3  546  ALA n 
3  547  ASN n 
3  548  PHE n 
3  549  ILE n 
3  550  LYS n 
3  551  LYS n 
3  552  ASN n 
3  553  LYS n 
3  554  ALA n 
3  555  LYS n 
3  556  GLU n 
3  557  ASN n 
3  558  LYS n 
3  559  ASN n 
3  560  LYS n 
3  561  LYS n 
3  562  VAL n 
3  563  ARG n 
3  564  PRO n 
3  565  ARG n 
3  566  TYR n 
3  567  SER n 
3  568  GLY n 
3  569  PRO n 
3  570  ALA n 
3  571  PRO n 
3  572  PRO n 
3  573  PRO n 
3  574  ASN n 
3  575  ARG n 
3  576  PHE n 
3  577  ASN n 
3  578  ILE n 
3  579  TRP n 
3  580  PRO n 
3  581  GLY n 
3  582  TYR n 
3  583  ARG n 
3  584  TRP n 
3  585  ASP n 
3  586  GLY n 
3  587  VAL n 
3  588  ASP n 
3  589  ARG n 
3  590  SER n 
3  591  ASN n 
3  592  GLY n 
3  593  PHE n 
3  594  GLU n 
3  595  GLN n 
3  596  LYS n 
3  597  ARG n 
3  598  PHE n 
3  599  ALA n 
3  600  ARG n 
3  601  LEU n 
3  602  ALA n 
3  603  SER n 
3  604  LYS n 
3  605  LYS n 
3  606  ALA n 
3  607  VAL n 
3  608  GLU n 
3  609  GLU n 
3  610  LEU n 
3  611  ALA n 
3  612  TYR n 
3  613  LYS n 
3  614  TRP n 
3  615  SER n 
3  616  VAL n 
3  617  GLU n 
3  618  ASP n 
3  619  MET n 
4  1    A   n 
4  2    U   n 
4  3    A   n 
4  4    C   n 
4  5    U   n 
4  6    C   n 
4  7    U   n 
4  8    G   n 
4  9    G   n 
4  10   U   n 
4  11   U   n 
4  12   U   n 
4  13   C   n 
4  14   U   n 
4  15   C   n 
4  16   U   n 
4  17   U   n 
4  18   C   n 
4  19   A   n 
4  20   G   n 
4  21   A   n 
4  22   U   n 
4  23   C   n 
4  24   G   n 
4  25   C   n 
4  26   A   n 
4  27   U   n 
4  28   A   n 
4  29   A   n 
4  30   A   n 
4  31   U   n 
4  32   C   n 
4  33   U   n 
4  34   U   n 
4  35   U   n 
4  36   C   n 
4  37   G   n 
4  38   C   n 
4  39   C   n 
4  40   U   n 
4  41   U   n 
4  42   U   n 
4  43   U   n 
4  44   A   n 
4  45   C   n 
4  46   U   n 
4  47   A   n 
4  48   A   n 
4  49   A   n 
4  50   G   n 
4  51   A   n 
4  52   U   n 
4  53   U   n 
4  54   U   n 
4  55   C   n 
4  56   C   n 
4  57   G   n 
4  58   U   n 
4  59   G   n 
4  60   G   n 
4  61   A   n 
4  62   G   n 
4  63   A   n 
4  64   G   n 
4  65   G   n 
4  66   A   n 
4  67   A   n 
4  68   C   n 
4  69   A   n 
4  70   A   n 
4  71   C   n 
4  72   U   n 
4  73   C   n 
4  74   U   n 
4  75   G   n 
4  76   A   n 
4  77   G   n 
4  78   U   n 
4  79   C   n 
4  80   U   n 
4  81   U   n 
4  82   A   n 
4  83   A   n 
4  84   C   n 
4  85   C   n 
4  86   C   n 
4  87   A   n 
4  88   A   n 
4  89   U   n 
4  90   U   n 
4  91   U   n 
4  92   U   n 
4  93   U   n 
4  94   U   n 
4  95   G   n 
4  96   A   n 
4  97   G   n 
4  98   C   n 
4  99   C   n 
4  100  U   n 
4  101  U   n 
4  102  G   n 
4  103  C   n 
4  104  C   n 
4  105  U   n 
4  106  U   n 
4  107  G   n 
4  108  G   n 
4  109  C   n 
4  110  A   n 
4  111  A   n 
4  112  G   n 
4  113  G   n 
4  114  C   n 
4  115  U   n 
4  116  A   n 
5  1    G   n 
5  2    U   n 
5  3    G   n 
5  4    C   n 
5  5    U   n 
5  6    C   n 
5  7    G   n 
5  8    C   n 
5  9    U   n 
5  10   U   n 
5  11   C   n 
5  12   G   n 
5  13   G   n 
5  14   C   n 
5  15   A   n 
5  16   G   n 
5  17   C   n 
5  18   A   n 
5  19   C   n 
5  20   A   n 
5  21   U   n 
5  22   A   n 
5  23   U   n 
5  24   A   n 
5  25   C   n 
5  26   U   n 
5  27   A   n 
5  28   A   n 
5  29   A   n 
5  30   A   n 
5  31   U   n 
5  32   U   n 
5  33   G   n 
5  34   G   n 
5  35   A   n 
5  36   A   n 
5  37   C   n 
5  38   G   n 
5  39   A   n 
5  40   U   n 
5  41   A   n 
5  42   C   n 
5  43   A   n 
5  44   G   n 
5  45   A   n 
5  46   G   n 
5  47   A   n 
5  48   A   n 
5  49   G   n 
5  50   A   n 
5  51   U   n 
5  52   U   n 
5  53   A   n 
5  54   G   n 
5  55   C   n 
5  56   A   n 
5  57   U   n 
5  58   G   n 
5  59   G   n 
5  60   C   n 
5  61   C   n 
5  62   C   n 
5  63   C   n 
5  64   U   n 
5  65   G   n 
5  66   C   n 
5  67   G   n 
5  68   C   n 
5  69   A   n 
5  70   A   n 
5  71   G   n 
5  72   G   n 
5  73   A   n 
5  74   U   n 
5  75   G   n 
5  76   A   n 
5  77   C   n 
5  78   A   n 
5  79   C   n 
5  80   G   n 
5  81   C   n 
5  82   A   n 
5  83   A   n 
5  84   A   n 
5  85   U   n 
5  86   U   n 
5  87   C   n 
5  88   G   n 
5  89   U   n 
5  90   G   n 
5  91   A   n 
5  92   A   n 
5  93   G   n 
5  94   C   n 
5  95   G   n 
5  96   U   n 
5  97   U   n 
5  98   C   n 
5  99   C   n 
5  100  A   n 
5  101  U   n 
5  102  A   n 
5  103  U   n 
5  104  U   n 
5  105  U   n 
5  106  U   n 
5  107  U   n 
6  1    MET n 
6  2    ASP n 
6  3    PHE n 
6  4    GLN n 
6  5    HIS n 
6  6    ARG n 
6  7    PRO n 
6  8    GLY n 
6  9    GLY n 
6  10   LYS n 
6  11   THR n 
6  12   GLY n 
6  13   SER n 
6  14   GLY n 
6  15   GLY n 
6  16   VAL n 
6  17   ALA n 
6  18   SER n 
6  19   SER n 
6  20   SER n 
6  21   GLU n 
6  22   SER n 
6  23   ASN n 
6  24   ARG n 
6  25   ASP n 
6  26   ARG n 
6  27   ARG n 
6  28   GLU n 
6  29   ARG n 
6  30   LEU n 
6  31   ARG n 
6  32   GLN n 
6  33   LEU n 
6  34   ALA n 
6  35   LEU n 
6  36   GLU n 
6  37   THR n 
6  38   ILE n 
6  39   ASP n 
6  40   ILE n 
6  41   ASN n 
6  42   LYS n 
6  43   ASP n 
6  44   PRO n 
6  45   TYR n 
6  46   PHE n 
6  47   MET n 
6  48   LYS n 
6  49   ASN n 
6  50   HIS n 
6  51   LEU n 
6  52   GLY n 
6  53   SER n 
6  54   TYR n 
6  55   GLU n 
6  56   CYS n 
6  57   LYS n 
6  58   LEU n 
6  59   CYS n 
6  60   LEU n 
6  61   THR n 
6  62   LEU n 
6  63   HIS n 
6  64   ASN n 
6  65   ASN n 
6  66   GLU n 
6  67   GLY n 
6  68   SER n 
6  69   TYR n 
6  70   LEU n 
6  71   ALA n 
6  72   HIS n 
6  73   THR n 
6  74   GLN n 
6  75   GLY n 
6  76   LYS n 
6  77   LYS n 
6  78   HIS n 
6  79   GLN n 
6  80   THR n 
6  81   ASN n 
6  82   LEU n 
6  83   ALA n 
6  84   ARG n 
6  85   ARG n 
6  86   ALA n 
6  87   ALA n 
6  88   LYS n 
6  89   GLU n 
6  90   ALA n 
6  91   LYS n 
6  92   GLU n 
6  93   ALA n 
6  94   PRO n 
6  95   ALA n 
6  96   GLN n 
6  97   PRO n 
6  98   ALA n 
6  99   PRO n 
6  100  GLU n 
6  101  LYS n 
6  102  VAL n 
6  103  LYS n 
6  104  VAL n 
6  105  GLU n 
6  106  VAL n 
6  107  LYS n 
6  108  LYS n 
6  109  PHE n 
6  110  VAL n 
6  111  LYS n 
6  112  ILE n 
6  113  GLY n 
6  114  ARG n 
6  115  PRO n 
6  116  GLY n 
6  117  TYR n 
6  118  LYS n 
6  119  VAL n 
6  120  THR n 
6  121  LYS n 
6  122  GLN n 
6  123  ARG n 
6  124  ASP n 
6  125  SER n 
6  126  GLU n 
6  127  MET n 
6  128  GLY n 
6  129  GLN n 
6  130  GLN n 
6  131  SER n 
6  132  LEU n 
6  133  LEU n 
6  134  PHE n 
6  135  GLN n 
6  136  ILE n 
6  137  ASP n 
6  138  TYR n 
6  139  PRO n 
6  140  GLU n 
6  141  ILE n 
6  142  ALA n 
6  143  GLU n 
6  144  GLY n 
6  145  ILE n 
6  146  MET n 
6  147  PRO n 
6  148  ARG n 
6  149  HIS n 
6  150  ARG n 
6  151  PHE n 
6  152  MET n 
6  153  SER n 
6  154  ALA n 
6  155  TYR n 
6  156  GLU n 
6  157  GLN n 
6  158  ARG n 
6  159  ILE n 
6  160  GLU n 
6  161  PRO n 
6  162  PRO n 
6  163  ASP n 
6  164  ARG n 
6  165  ARG n 
6  166  TRP n 
6  167  GLN n 
6  168  TYR n 
6  169  LEU n 
6  170  LEU n 
6  171  MET n 
6  172  ALA n 
6  173  ALA n 
6  174  GLU n 
6  175  PRO n 
6  176  TYR n 
6  177  GLU n 
6  178  THR n 
6  179  ILE n 
6  180  ALA n 
6  181  PHE n 
6  182  LYS n 
6  183  VAL n 
6  184  PRO n 
6  185  SER n 
6  186  ARG n 
6  187  GLU n 
6  188  ILE n 
6  189  ASP n 
6  190  LYS n 
6  191  ALA n 
6  192  GLU n 
6  193  GLY n 
6  194  LYS n 
6  195  PHE n 
6  196  TRP n 
6  197  THR n 
6  198  HIS n 
6  199  TRP n 
6  200  ASN n 
6  201  ARG n 
6  202  GLU n 
6  203  THR n 
6  204  LYS n 
6  205  GLN n 
6  206  PHE n 
6  207  PHE n 
6  208  LEU n 
6  209  GLN n 
6  210  PHE n 
6  211  HIS n 
6  212  PHE n 
6  213  LYS n 
6  214  MET n 
6  215  GLU n 
6  216  LYS n 
6  217  PRO n 
6  218  PRO n 
6  219  ALA n 
6  220  PRO n 
6  221  PRO n 
6  222  SER n 
6  223  LEU n 
6  224  PRO n 
6  225  ALA n 
6  226  GLY n 
6  227  PRO n 
6  228  PRO n 
6  229  GLY n 
6  230  VAL n 
6  231  LYS n 
6  232  ARG n 
6  233  PRO n 
6  234  PRO n 
6  235  PRO n 
6  236  PRO n 
6  237  LEU n 
6  238  MET n 
6  239  ASN n 
6  240  GLY n 
6  241  LEU n 
6  242  PRO n 
6  243  PRO n 
6  244  ARG n 
6  245  PRO n 
6  246  PRO n 
6  247  LEU n 
6  248  PRO n 
6  249  GLU n 
6  250  SER n 
6  251  LEU n 
6  252  PRO n 
6  253  PRO n 
6  254  PRO n 
6  255  PRO n 
6  256  PRO n 
6  257  GLY n 
6  258  GLY n 
6  259  LEU n 
6  260  PRO n 
6  261  LEU n 
6  262  PRO n 
6  263  PRO n 
6  264  MET n 
6  265  PRO n 
6  266  PRO n 
6  267  THR n 
6  268  GLY n 
6  269  PRO n 
6  270  ALA n 
6  271  PRO n 
6  272  SER n 
6  273  GLY n 
6  274  PRO n 
6  275  PRO n 
6  276  GLY n 
6  277  PRO n 
6  278  PRO n 
6  279  GLN n 
6  280  LEU n 
6  281  PRO n 
6  282  PRO n 
6  283  PRO n 
6  284  ALA n 
6  285  PRO n 
6  286  GLY n 
6  287  VAL n 
6  288  HIS n 
6  289  PRO n 
6  290  PRO n 
6  291  ALA n 
6  292  PRO n 
6  293  VAL n 
6  294  VAL n 
6  295  HIS n 
6  296  PRO n 
6  297  PRO n 
6  298  ALA n 
6  299  SER n 
6  300  GLY n 
6  301  VAL n 
6  302  HIS n 
6  303  PRO n 
6  304  PRO n 
6  305  ALA n 
6  306  PRO n 
6  307  GLY n 
6  308  VAL n 
6  309  HIS n 
6  310  PRO n 
6  311  PRO n 
6  312  ALA n 
6  313  PRO n 
6  314  GLY n 
6  315  VAL n 
6  316  HIS n 
6  317  PRO n 
6  318  PRO n 
6  319  ALA n 
6  320  PRO n 
6  321  GLY n 
6  322  VAL n 
6  323  HIS n 
6  324  PRO n 
6  325  PRO n 
6  326  THR n 
6  327  SER n 
6  328  GLY n 
6  329  VAL n 
6  330  HIS n 
6  331  PRO n 
6  332  PRO n 
6  333  ALA n 
6  334  PRO n 
6  335  GLY n 
6  336  VAL n 
6  337  HIS n 
6  338  PRO n 
6  339  PRO n 
6  340  ALA n 
6  341  PRO n 
6  342  GLY n 
6  343  VAL n 
6  344  HIS n 
6  345  PRO n 
6  346  PRO n 
6  347  ALA n 
6  348  PRO n 
6  349  GLY n 
6  350  VAL n 
6  351  HIS n 
6  352  PRO n 
6  353  PRO n 
6  354  ALA n 
6  355  PRO n 
6  356  GLY n 
6  357  VAL n 
6  358  HIS n 
6  359  PRO n 
6  360  PRO n 
6  361  ALA n 
6  362  PRO n 
6  363  GLY n 
6  364  VAL n 
6  365  HIS n 
6  366  PRO n 
6  367  PRO n 
6  368  PRO n 
6  369  SER n 
6  370  ALA n 
6  371  GLY n 
6  372  VAL n 
6  373  HIS n 
6  374  PRO n 
6  375  GLN n 
6  376  ALA n 
6  377  PRO n 
6  378  GLY n 
6  379  VAL n 
6  380  HIS n 
6  381  PRO n 
6  382  ALA n 
6  383  ALA n 
6  384  PRO n 
6  385  ALA n 
6  386  VAL n 
6  387  HIS n 
6  388  PRO n 
6  389  GLN n 
6  390  ALA n 
6  391  PRO n 
6  392  GLY n 
6  393  VAL n 
6  394  HIS n 
6  395  PRO n 
6  396  PRO n 
6  397  ALA n 
6  398  PRO n 
6  399  GLY n 
6  400  MET n 
6  401  HIS n 
6  402  PRO n 
6  403  GLN n 
6  404  ALA n 
6  405  PRO n 
6  406  GLY n 
6  407  VAL n 
6  408  HIS n 
6  409  PRO n 
6  410  GLN n 
6  411  PRO n 
6  412  PRO n 
6  413  GLY n 
6  414  VAL n 
6  415  HIS n 
6  416  PRO n 
6  417  SER n 
6  418  ALA n 
6  419  PRO n 
6  420  GLY n 
6  421  VAL n 
6  422  HIS n 
6  423  PRO n 
6  424  GLN n 
6  425  PRO n 
6  426  PRO n 
6  427  GLY n 
6  428  VAL n 
6  429  HIS n 
6  430  PRO n 
6  431  SER n 
6  432  ASN n 
6  433  PRO n 
6  434  GLY n 
6  435  VAL n 
6  436  HIS n 
6  437  PRO n 
6  438  PRO n 
6  439  THR n 
6  440  PRO n 
6  441  MET n 
6  442  PRO n 
6  443  PRO n 
6  444  MET n 
6  445  LEU n 
6  446  ARG n 
6  447  PRO n 
6  448  PRO n 
6  449  LEU n 
6  450  PRO n 
6  451  SER n 
6  452  GLU n 
6  453  GLY n 
6  454  PRO n 
6  455  GLY n 
6  456  ASN n 
6  457  ILE n 
6  458  PRO n 
6  459  PRO n 
6  460  PRO n 
6  461  PRO n 
6  462  PRO n 
6  463  THR n 
6  464  ASN n 
7  1    MET n 
7  2    ALA n 
7  3    THR n 
7  4    GLU n 
7  5    HIS n 
7  6    PRO n 
7  7    GLU n 
7  8    PRO n 
7  9    PRO n 
7  10   LYS n 
7  11   ALA n 
7  12   GLU n 
7  13   LEU n 
7  14   GLN n 
7  15   LEU n 
7  16   PRO n 
7  17   PRO n 
7  18   PRO n 
7  19   PRO n 
7  20   PRO n 
7  21   PRO n 
7  22   GLY n 
7  23   HIS n 
7  24   TYR n 
7  25   GLY n 
7  26   ALA n 
7  27   TRP n 
7  28   ALA n 
7  29   ALA n 
7  30   GLN n 
7  31   GLU n 
7  32   LEU n 
7  33   GLN n 
7  34   ALA n 
7  35   LYS n 
7  36   LEU n 
7  37   ALA n 
7  38   GLU n 
7  39   ILE n 
7  40   GLY n 
7  41   ALA n 
7  42   PRO n 
7  43   ILE n 
7  44   GLN n 
7  45   GLY n 
7  46   ASN n 
7  47   ARG n 
7  48   GLU n 
7  49   GLU n 
7  50   LEU n 
7  51   VAL n 
7  52   GLU n 
7  53   ARG n 
7  54   LEU n 
7  55   GLN n 
7  56   SER n 
7  57   TYR n 
7  58   THR n 
7  59   ARG n 
7  60   GLN n 
7  61   THR n 
7  62   GLY n 
7  63   ILE n 
7  64   VAL n 
7  65   LEU n 
7  66   ASN n 
7  67   ARG n 
7  68   PRO n 
7  69   VAL n 
7  70   LEU n 
7  71   ARG n 
7  72   GLY n 
7  73   GLU n 
7  74   ASP n 
7  75   GLY n 
7  76   ASP n 
7  77   LYS n 
7  78   ALA n 
7  79   ALA n 
7  80   PRO n 
7  81   PRO n 
7  82   PRO n 
7  83   MET n 
7  84   SER n 
7  85   ALA n 
7  86   GLN n 
7  87   LEU n 
7  88   PRO n 
7  89   GLY n 
7  90   ILE n 
7  91   PRO n 
7  92   MET n 
7  93   PRO n 
7  94   PRO n 
7  95   PRO n 
7  96   PRO n 
7  97   LEU n 
7  98   GLY n 
7  99   LEU n 
7  100  PRO n 
7  101  PRO n 
7  102  LEU n 
7  103  GLN n 
7  104  PRO n 
7  105  PRO n 
7  106  PRO n 
7  107  PRO n 
7  108  PRO n 
7  109  PRO n 
7  110  PRO n 
7  111  PRO n 
7  112  PRO n 
7  113  PRO n 
7  114  GLY n 
7  115  LEU n 
7  116  GLY n 
7  117  LEU n 
7  118  GLY n 
7  119  PHE n 
7  120  PRO n 
7  121  MET n 
7  122  ALA n 
7  123  HIS n 
7  124  PRO n 
7  125  PRO n 
7  126  ASN n 
7  127  LEU n 
7  128  GLY n 
7  129  PRO n 
7  130  PRO n 
7  131  PRO n 
7  132  PRO n 
7  133  LEU n 
7  134  ARG n 
7  135  VAL n 
7  136  GLY n 
7  137  GLU n 
7  138  PRO n 
7  139  VAL n 
7  140  ALA n 
7  141  LEU n 
7  142  SER n 
7  143  GLU n 
7  144  GLU n 
7  145  GLU n 
7  146  ARG n 
7  147  LEU n 
7  148  LYS n 
7  149  LEU n 
7  150  ALA n 
7  151  GLN n 
7  152  GLN n 
7  153  GLN n 
7  154  ALA n 
7  155  ALA n 
7  156  LEU n 
7  157  LEU n 
7  158  MET n 
7  159  GLN n 
7  160  GLN n 
7  161  GLU n 
7  162  GLU n 
7  163  ARG n 
7  164  ALA n 
7  165  LYS n 
7  166  GLN n 
7  167  GLN n 
7  168  GLY n 
7  169  ASP n 
7  170  HIS n 
7  171  SER n 
7  172  LEU n 
7  173  LYS n 
7  174  GLU n 
7  175  HIS n 
7  176  GLU n 
7  177  LEU n 
7  178  LEU n 
7  179  GLU n 
7  180  GLN n 
7  181  GLN n 
7  182  LYS n 
7  183  ARG n 
7  184  ALA n 
7  185  ALA n 
7  186  VAL n 
7  187  LEU n 
7  188  LEU n 
7  189  GLU n 
7  190  GLN n 
7  191  GLU n 
7  192  ARG n 
7  193  GLN n 
7  194  GLN n 
7  195  GLU n 
7  196  ILE n 
7  197  ALA n 
7  198  LYS n 
7  199  MET n 
7  200  GLY n 
7  201  THR n 
7  202  PRO n 
7  203  VAL n 
7  204  PRO n 
7  205  ARG n 
7  206  PRO n 
7  207  PRO n 
7  208  GLN n 
7  209  ASP n 
7  210  MET n 
7  211  GLY n 
7  212  GLN n 
7  213  ILE n 
7  214  GLY n 
7  215  VAL n 
7  216  ARG n 
7  217  THR n 
7  218  PRO n 
7  219  LEU n 
7  220  GLY n 
7  221  PRO n 
7  222  ARG n 
7  223  VAL n 
7  224  ALA n 
7  225  ALA n 
7  226  PRO n 
7  227  VAL n 
7  228  GLY n 
7  229  PRO n 
7  230  VAL n 
7  231  GLY n 
7  232  PRO n 
7  233  THR n 
7  234  PRO n 
7  235  THR n 
7  236  VAL n 
7  237  LEU n 
7  238  PRO n 
7  239  MET n 
7  240  GLY n 
7  241  ALA n 
7  242  PRO n 
7  243  VAL n 
7  244  PRO n 
7  245  ARG n 
7  246  PRO n 
7  247  ARG n 
7  248  GLY n 
7  249  PRO n 
7  250  PRO n 
7  251  PRO n 
7  252  PRO n 
7  253  PRO n 
7  254  GLY n 
7  255  ASP n 
7  256  GLU n 
7  257  ASN n 
7  258  ARG n 
7  259  GLU n 
7  260  MET n 
7  261  ASP n 
7  262  ASP n 
7  263  PRO n 
7  264  SER n 
7  265  VAL n 
7  266  GLY n 
7  267  PRO n 
7  268  LYS n 
7  269  ILE n 
7  270  PRO n 
7  271  GLN n 
7  272  ALA n 
7  273  LEU n 
7  274  GLU n 
7  275  LYS n 
7  276  ILE n 
7  277  LEU n 
7  278  GLN n 
7  279  LEU n 
7  280  LYS n 
7  281  GLU n 
7  282  SER n 
7  283  ARG n 
7  284  GLN n 
7  285  GLU n 
7  286  GLU n 
7  287  MET n 
7  288  ASN n 
7  289  SER n 
7  290  GLN n 
7  291  GLN n 
7  292  GLU n 
7  293  GLU n 
7  294  GLU n 
7  295  GLU n 
7  296  MET n 
7  297  GLU n 
7  298  THR n 
7  299  ASP n 
7  300  ALA n 
7  301  ARG n 
7  302  SER n 
7  303  SER n 
7  304  LEU n 
7  305  GLY n 
7  306  GLN n 
7  307  SER n 
7  308  ALA n 
7  309  SER n 
7  310  GLU n 
7  311  THR n 
7  312  GLU n 
7  313  GLU n 
7  314  ASP n 
7  315  THR n 
7  316  VAL n 
7  317  SER n 
7  318  VAL n 
7  319  SER n 
7  320  LYS n 
7  321  LYS n 
7  322  GLU n 
7  323  LYS n 
7  324  ASN n 
7  325  ARG n 
7  326  LYS n 
7  327  ARG n 
7  328  ARG n 
7  329  ASN n 
7  330  ARG n 
7  331  LYS n 
7  332  LYS n 
7  333  LYS n 
7  334  LYS n 
7  335  LYS n 
7  336  PRO n 
7  337  GLN n 
7  338  ARG n 
7  339  VAL n 
7  340  ARG n 
7  341  GLY n 
7  342  VAL n 
7  343  SER n 
7  344  SER n 
7  345  GLU n 
7  346  SER n 
7  347  SER n 
7  348  GLY n 
7  349  ASP n 
7  350  ARG n 
7  351  GLU n 
7  352  LYS n 
7  353  ASP n 
7  354  SER n 
7  355  THR n 
7  356  ARG n 
7  357  SER n 
7  358  ARG n 
7  359  GLY n 
7  360  SER n 
7  361  ASP n 
7  362  SER n 
7  363  PRO n 
7  364  ALA n 
7  365  ALA n 
7  366  ASP n 
7  367  VAL n 
7  368  GLU n 
7  369  ILE n 
7  370  GLU n 
7  371  TYR n 
7  372  VAL n 
7  373  THR n 
7  374  GLU n 
7  375  GLU n 
7  376  PRO n 
7  377  GLU n 
7  378  ILE n 
7  379  TYR n 
7  380  GLU n 
7  381  PRO n 
7  382  ASN n 
7  383  PHE n 
7  384  ILE n 
7  385  PHE n 
7  386  PHE n 
7  387  LYS n 
7  388  ARG n 
7  389  ILE n 
7  390  PHE n 
7  391  GLU n 
7  392  ALA n 
7  393  PHE n 
7  394  LYS n 
7  395  LEU n 
7  396  THR n 
7  397  ASP n 
7  398  ASP n 
7  399  VAL n 
7  400  LYS n 
7  401  LYS n 
7  402  GLU n 
7  403  LYS n 
7  404  GLU n 
7  405  LYS n 
7  406  GLU n 
7  407  PRO n 
7  408  GLU n 
7  409  LYS n 
7  410  LEU n 
7  411  ASP n 
7  412  LYS n 
7  413  LEU n 
7  414  GLU n 
7  415  ASN n 
7  416  SER n 
7  417  ALA n 
7  418  ALA n 
7  419  PRO n 
7  420  LYS n 
7  421  LYS n 
7  422  LYS n 
7  423  GLY n 
7  424  PHE n 
7  425  GLU n 
7  426  GLU n 
7  427  GLU n 
7  428  HIS n 
7  429  LYS n 
7  430  ASP n 
7  431  SER n 
7  432  ASP n 
7  433  ASP n 
7  434  ASP n 
7  435  SER n 
7  436  SER n 
7  437  ASP n 
7  438  ASP n 
7  439  GLU n 
7  440  GLN n 
7  441  GLU n 
7  442  LYS n 
7  443  LYS n 
7  444  PRO n 
7  445  GLU n 
7  446  ALA n 
7  447  PRO n 
7  448  LYS n 
7  449  LEU n 
7  450  SER n 
7  451  LYS n 
7  452  LYS n 
7  453  LYS n 
7  454  LEU n 
7  455  ARG n 
7  456  ARG n 
7  457  MET n 
7  458  ASN n 
7  459  ARG n 
7  460  PHE n 
7  461  THR n 
7  462  VAL n 
7  463  ALA n 
7  464  GLU n 
7  465  LEU n 
7  466  LYS n 
7  467  GLN n 
7  468  LEU n 
7  469  VAL n 
7  470  ALA n 
7  471  ARG n 
7  472  PRO n 
7  473  ASP n 
7  474  VAL n 
7  475  VAL n 
7  476  GLU n 
7  477  MET n 
7  478  HIS n 
7  479  ASP n 
7  480  VAL n 
7  481  THR n 
7  482  ALA n 
7  483  GLN n 
7  484  ASP n 
7  485  PRO n 
7  486  LYS n 
7  487  LEU n 
7  488  LEU n 
7  489  VAL n 
7  490  HIS n 
7  491  LEU n 
7  492  LYS n 
7  493  ALA n 
7  494  THR n 
7  495  ARG n 
7  496  ASN n 
7  497  SER n 
7  498  VAL n 
7  499  PRO n 
7  500  VAL n 
7  501  PRO n 
7  502  ARG n 
7  503  HIS n 
7  504  TRP n 
7  505  CYS n 
7  506  PHE n 
7  507  LYS n 
7  508  ARG n 
7  509  LYS n 
7  510  TYR n 
7  511  LEU n 
7  512  GLN n 
7  513  GLY n 
7  514  LYS n 
7  515  ARG n 
7  516  GLY n 
7  517  ILE n 
7  518  GLU n 
7  519  LYS n 
7  520  PRO n 
7  521  PRO n 
7  522  PHE n 
7  523  GLU n 
7  524  LEU n 
7  525  PRO n 
7  526  ASP n 
7  527  PHE n 
7  528  ILE n 
7  529  LYS n 
7  530  ARG n 
7  531  THR n 
7  532  GLY n 
7  533  ILE n 
7  534  GLN n 
7  535  GLU n 
7  536  MET n 
7  537  ARG n 
7  538  GLU n 
7  539  ALA n 
7  540  LEU n 
7  541  GLN n 
7  542  GLU n 
7  543  LYS n 
7  544  GLU n 
7  545  GLU n 
7  546  GLN n 
7  547  LYS n 
7  548  THR n 
7  549  MET n 
7  550  LYS n 
7  551  SER n 
7  552  LYS n 
7  553  MET n 
7  554  ARG n 
7  555  GLU n 
7  556  LYS n 
7  557  VAL n 
7  558  ARG n 
7  559  PRO n 
7  560  LYS n 
7  561  MET n 
7  562  GLY n 
7  563  LYS n 
7  564  ILE n 
7  565  ASP n 
7  566  ILE n 
7  567  ASP n 
7  568  TYR n 
7  569  GLN n 
7  570  LYS n 
7  571  LEU n 
7  572  HIS n 
7  573  ASP n 
7  574  ALA n 
7  575  PHE n 
7  576  PHE n 
7  577  LYS n 
7  578  TRP n 
7  579  GLN n 
7  580  THR n 
7  581  LYS n 
7  582  PRO n 
7  583  LYS n 
7  584  LEU n 
7  585  THR n 
7  586  ILE n 
7  587  HIS n 
7  588  GLY n 
7  589  ASP n 
7  590  LEU n 
7  591  TYR n 
7  592  TYR n 
7  593  GLU n 
7  594  GLY n 
7  595  LYS n 
7  596  GLU n 
7  597  PHE n 
7  598  GLU n 
7  599  THR n 
7  600  ARG n 
7  601  LEU n 
7  602  LYS n 
7  603  GLU n 
7  604  LYS n 
7  605  LYS n 
7  606  PRO n 
7  607  GLY n 
7  608  ASP n 
7  609  LEU n 
7  610  SER n 
7  611  ASP n 
7  612  GLU n 
7  613  LEU n 
7  614  ARG n 
7  615  ILE n 
7  616  SER n 
7  617  LEU n 
7  618  GLY n 
7  619  MET n 
7  620  PRO n 
7  621  VAL n 
7  622  GLY n 
7  623  PRO n 
7  624  ASN n 
7  625  ALA n 
7  626  HIS n 
7  627  LYS n 
7  628  VAL n 
7  629  PRO n 
7  630  PRO n 
7  631  PRO n 
7  632  TRP n 
7  633  LEU n 
7  634  ILE n 
7  635  ALA n 
7  636  MET n 
7  637  GLN n 
7  638  ARG n 
7  639  TYR n 
7  640  GLY n 
7  641  PRO n 
7  642  PRO n 
7  643  PRO n 
7  644  SER n 
7  645  TYR n 
7  646  PRO n 
7  647  ASN n 
7  648  LEU n 
7  649  LYS n 
7  650  ILE n 
7  651  PRO n 
7  652  GLY n 
7  653  LEU n 
7  654  ASN n 
7  655  SER n 
7  656  PRO n 
7  657  ILE n 
7  658  PRO n 
7  659  GLU n 
7  660  SER n 
7  661  CYS n 
7  662  SER n 
7  663  PHE n 
7  664  GLY n 
7  665  TYR n 
7  666  HIS n 
7  667  ALA n 
7  668  GLY n 
7  669  GLY n 
7  670  TRP n 
7  671  GLY n 
7  672  LYS n 
7  673  PRO n 
7  674  PRO n 
7  675  VAL n 
7  676  ASP n 
7  677  GLU n 
7  678  THR n 
7  679  GLY n 
7  680  LYS n 
7  681  PRO n 
7  682  LEU n 
7  683  TYR n 
7  684  GLY n 
7  685  ASP n 
7  686  VAL n 
7  687  PHE n 
7  688  GLY n 
7  689  THR n 
7  690  ASN n 
7  691  ALA n 
7  692  ALA n 
7  693  GLU n 
7  694  PHE n 
7  695  GLN n 
7  696  THR n 
7  697  LYS n 
7  698  THR n 
7  699  GLU n 
7  700  GLU n 
7  701  GLU n 
7  702  GLU n 
7  703  ILE n 
7  704  ASP n 
7  705  ARG n 
7  706  THR n 
7  707  PRO n 
7  708  TRP n 
7  709  GLY n 
7  710  GLU n 
7  711  LEU n 
7  712  GLU n 
7  713  PRO n 
7  714  SER n 
7  715  ASP n 
7  716  GLU n 
7  717  GLU n 
7  718  SER n 
7  719  SER n 
7  720  GLU n 
7  721  GLU n 
7  722  GLU n 
7  723  GLU n 
7  724  GLU n 
7  725  GLU n 
7  726  GLU n 
7  727  SER n 
7  728  ASP n 
7  729  GLU n 
7  730  ASP n 
7  731  LYS n 
7  732  PRO n 
7  733  ASP n 
7  734  GLU n 
7  735  THR n 
7  736  GLY n 
7  737  PHE n 
7  738  ILE n 
7  739  THR n 
7  740  PRO n 
7  741  ALA n 
7  742  ASP n 
7  743  SER n 
7  744  GLY n 
7  745  LEU n 
7  746  ILE n 
7  747  THR n 
7  748  PRO n 
7  749  GLY n 
7  750  GLY n 
7  751  PHE n 
7  752  SER n 
7  753  SER n 
7  754  VAL n 
7  755  PRO n 
7  756  ALA n 
7  757  GLY n 
7  758  MET n 
7  759  GLU n 
7  760  THR n 
7  761  PRO n 
7  762  GLU n 
7  763  LEU n 
7  764  ILE n 
7  765  GLU n 
7  766  LEU n 
7  767  ARG n 
7  768  LYS n 
7  769  LYS n 
7  770  LYS n 
7  771  ILE n 
7  772  GLU n 
7  773  GLU n 
7  774  ALA n 
7  775  MET n 
7  776  ASP n 
7  777  GLY n 
7  778  SER n 
7  779  GLU n 
7  780  THR n 
7  781  PRO n 
7  782  GLN n 
7  783  LEU n 
7  784  PHE n 
7  785  THR n 
7  786  VAL n 
7  787  LEU n 
7  788  PRO n 
7  789  GLU n 
7  790  LYS n 
7  791  ARG n 
7  792  THR n 
7  793  ALA n 
7  794  THR n 
7  795  VAL n 
7  796  GLY n 
7  797  GLY n 
7  798  ALA n 
7  799  MET n 
7  800  MET n 
7  801  GLY n 
7  802  SER n 
7  803  THR n 
7  804  HIS n 
7  805  ILE n 
7  806  TYR n 
7  807  ASP n 
7  808  MET n 
7  809  SER n 
7  810  THR n 
7  811  VAL n 
7  812  MET n 
7  813  SER n 
7  814  ARG n 
7  815  LYS n 
7  816  GLY n 
7  817  PRO n 
7  818  ALA n 
7  819  PRO n 
7  820  GLU n 
7  821  LEU n 
7  822  GLN n 
7  823  GLY n 
7  824  VAL n 
7  825  GLU n 
7  826  VAL n 
7  827  ALA n 
7  828  LEU n 
7  829  ALA n 
7  830  PRO n 
7  831  GLU n 
7  832  GLU n 
7  833  LEU n 
7  834  GLU n 
7  835  LEU n 
7  836  ASP n 
7  837  PRO n 
7  838  MET n 
7  839  ALA n 
7  840  MET n 
7  841  THR n 
7  842  GLN n 
7  843  LYS n 
7  844  TYR n 
7  845  GLU n 
7  846  GLU n 
7  847  HIS n 
7  848  VAL n 
7  849  ARG n 
7  850  GLU n 
7  851  GLN n 
7  852  GLN n 
7  853  ALA n 
7  854  GLN n 
7  855  VAL n 
7  856  GLU n 
7  857  LYS n 
7  858  GLU n 
7  859  ASP n 
7  860  PHE n 
7  861  SER n 
7  862  ASP n 
7  863  MET n 
7  864  VAL n 
7  865  ALA n 
7  866  GLU n 
7  867  HIS n 
7  868  ALA n 
7  869  ALA n 
7  870  LYS n 
7  871  GLN n 
7  872  LYS n 
7  873  GLN n 
7  874  LYS n 
7  875  LYS n 
7  876  ARG n 
7  877  LYS n 
7  878  ALA n 
7  879  GLN n 
7  880  PRO n 
7  881  GLN n 
7  882  ASP n 
7  883  SER n 
7  884  ARG n 
7  885  GLY n 
7  886  GLY n 
7  887  SER n 
7  888  LYS n 
7  889  LYS n 
7  890  TYR n 
7  891  LYS n 
7  892  GLU n 
7  893  PHE n 
7  894  LYS n 
7  895  PHE n 
8  1    MET n 
8  2    ALA n 
8  3    GLY n 
8  4    VAL n 
8  5    PHE n 
8  6    PRO n 
8  7    TYR n 
8  8    ARG n 
8  9    GLY n 
8  10   PRO n 
8  11   GLY n 
8  12   ASN n 
8  13   PRO n 
8  14   VAL n 
8  15   PRO n 
8  16   GLY n 
8  17   PRO n 
8  18   LEU n 
8  19   ALA n 
8  20   PRO n 
8  21   LEU n 
8  22   PRO n 
8  23   ASP n 
8  24   TYR n 
8  25   MET n 
8  26   SER n 
8  27   GLU n 
8  28   GLU n 
8  29   LYS n 
8  30   LEU n 
8  31   GLN n 
8  32   GLU n 
8  33   LYS n 
8  34   ALA n 
8  35   ARG n 
8  36   LYS n 
8  37   TRP n 
8  38   GLN n 
8  39   GLN n 
8  40   LEU n 
8  41   GLN n 
8  42   ALA n 
8  43   LYS n 
8  44   ARG n 
8  45   TYR n 
8  46   ALA n 
8  47   GLU n 
8  48   LYS n 
8  49   ARG n 
8  50   LYS n 
8  51   PHE n 
8  52   GLY n 
8  53   PHE n 
8  54   VAL n 
8  55   ASP n 
8  56   ALA n 
8  57   GLN n 
8  58   LYS n 
8  59   GLU n 
8  60   ASP n 
8  61   MET n 
8  62   PRO n 
8  63   PRO n 
8  64   GLU n 
8  65   HIS n 
8  66   VAL n 
8  67   ARG n 
8  68   LYS n 
8  69   ILE n 
8  70   ILE n 
8  71   ARG n 
8  72   ASP n 
8  73   HIS n 
8  74   GLY n 
8  75   ASP n 
8  76   MET n 
8  77   THR n 
8  78   ASN n 
8  79   ARG n 
8  80   LYS n 
8  81   PHE n 
8  82   ARG n 
8  83   HIS n 
8  84   ASP n 
8  85   LYS n 
8  86   ARG n 
8  87   VAL n 
8  88   TYR n 
8  89   LEU n 
8  90   GLY n 
8  91   ALA n 
8  92   LEU n 
8  93   LYS n 
8  94   TYR n 
8  95   MET n 
8  96   PRO n 
8  97   HIS n 
8  98   ALA n 
8  99   VAL n 
8  100  LEU n 
8  101  LYS n 
8  102  LEU n 
8  103  LEU n 
8  104  GLU n 
8  105  ASN n 
8  106  MET n 
8  107  PRO n 
8  108  MET n 
8  109  PRO n 
8  110  TRP n 
8  111  GLU n 
8  112  GLN n 
8  113  ILE n 
8  114  ARG n 
8  115  ASP n 
8  116  VAL n 
8  117  PRO n 
8  118  VAL n 
8  119  LEU n 
8  120  TYR n 
8  121  HIS n 
8  122  ILE n 
8  123  THR n 
8  124  GLY n 
8  125  ALA n 
8  126  ILE n 
8  127  SER n 
8  128  PHE n 
8  129  VAL n 
8  130  ASN n 
8  131  GLU n 
8  132  ILE n 
8  133  PRO n 
8  134  TRP n 
8  135  VAL n 
8  136  ILE n 
8  137  GLU n 
8  138  PRO n 
8  139  VAL n 
8  140  TYR n 
8  141  ILE n 
8  142  SER n 
8  143  GLN n 
8  144  TRP n 
8  145  GLY n 
8  146  SER n 
8  147  MET n 
8  148  TRP n 
8  149  ILE n 
8  150  MET n 
8  151  MET n 
8  152  ARG n 
8  153  ARG n 
8  154  GLU n 
8  155  LYS n 
8  156  ARG n 
8  157  ASP n 
8  158  ARG n 
8  159  ARG n 
8  160  HIS n 
8  161  PHE n 
8  162  LYS n 
8  163  ARG n 
8  164  MET n 
8  165  ARG n 
8  166  PHE n 
8  167  PRO n 
8  168  PRO n 
8  169  PHE n 
8  170  ASP n 
8  171  ASP n 
8  172  GLU n 
8  173  GLU n 
8  174  PRO n 
8  175  PRO n 
8  176  LEU n 
8  177  ASP n 
8  178  TYR n 
8  179  ALA n 
8  180  ASP n 
8  181  ASN n 
8  182  ILE n 
8  183  LEU n 
8  184  ASP n 
8  185  VAL n 
8  186  GLU n 
8  187  PRO n 
8  188  LEU n 
8  189  GLU n 
8  190  ALA n 
8  191  ILE n 
8  192  GLN n 
8  193  LEU n 
8  194  GLU n 
8  195  LEU n 
8  196  ASP n 
8  197  PRO n 
8  198  GLU n 
8  199  GLU n 
8  200  ASP n 
8  201  ALA n 
8  202  PRO n 
8  203  VAL n 
8  204  LEU n 
8  205  ASP n 
8  206  TRP n 
8  207  PHE n 
8  208  TYR n 
8  209  ASP n 
8  210  HIS n 
8  211  GLN n 
8  212  PRO n 
8  213  LEU n 
8  214  ARG n 
8  215  ASP n 
8  216  SER n 
8  217  ARG n 
8  218  LYS n 
8  219  TYR n 
8  220  VAL n 
8  221  ASN n 
8  222  GLY n 
8  223  SER n 
8  224  THR n 
8  225  TYR n 
8  226  GLN n 
8  227  ARG n 
8  228  TRP n 
8  229  GLN n 
8  230  PHE n 
8  231  THR n 
8  232  LEU n 
8  233  PRO n 
8  234  MET n 
8  235  MET n 
8  236  SER n 
8  237  THR n 
8  238  LEU n 
8  239  TYR n 
8  240  ARG n 
8  241  LEU n 
8  242  ALA n 
8  243  ASN n 
8  244  GLN n 
8  245  LEU n 
8  246  LEU n 
8  247  THR n 
8  248  ASP n 
8  249  LEU n 
8  250  VAL n 
8  251  ASP n 
8  252  ASP n 
8  253  ASN n 
8  254  TYR n 
8  255  PHE n 
8  256  TYR n 
8  257  LEU n 
8  258  PHE n 
8  259  ASP n 
8  260  LEU n 
8  261  LYS n 
8  262  ALA n 
8  263  PHE n 
8  264  PHE n 
8  265  THR n 
8  266  SER n 
8  267  LYS n 
8  268  ALA n 
8  269  LEU n 
8  270  ASN n 
8  271  MET n 
8  272  ALA n 
8  273  ILE n 
8  274  PRO n 
8  275  GLY n 
8  276  GLY n 
8  277  PRO n 
8  278  LYS n 
8  279  PHE n 
8  280  GLU n 
8  281  PRO n 
8  282  LEU n 
8  283  VAL n 
8  284  ARG n 
8  285  ASP n 
8  286  ILE n 
8  287  ASN n 
8  288  LEU n 
8  289  GLN n 
8  290  ASP n 
8  291  GLU n 
8  292  ASP n 
8  293  TRP n 
8  294  ASN n 
8  295  GLU n 
8  296  PHE n 
8  297  ASN n 
8  298  ASP n 
8  299  ILE n 
8  300  ASN n 
8  301  LYS n 
8  302  ILE n 
8  303  ILE n 
8  304  ILE n 
8  305  ARG n 
8  306  GLN n 
8  307  PRO n 
8  308  ILE n 
8  309  ARG n 
8  310  THR n 
8  311  GLU n 
8  312  TYR n 
8  313  LYS n 
8  314  ILE n 
8  315  ALA n 
8  316  PHE n 
8  317  PRO n 
8  318  TYR n 
8  319  LEU n 
8  320  TYR n 
8  321  ASN n 
8  322  ASN n 
8  323  LEU n 
8  324  PRO n 
8  325  HIS n 
8  326  HIS n 
8  327  VAL n 
8  328  HIS n 
8  329  LEU n 
8  330  THR n 
8  331  TRP n 
8  332  TYR n 
8  333  HIS n 
8  334  THR n 
8  335  PRO n 
8  336  ASN n 
8  337  VAL n 
8  338  VAL n 
8  339  PHE n 
8  340  ILE n 
8  341  LYS n 
8  342  THR n 
8  343  GLU n 
8  344  ASP n 
8  345  PRO n 
8  346  ASP n 
8  347  LEU n 
8  348  PRO n 
8  349  ALA n 
8  350  PHE n 
8  351  TYR n 
8  352  PHE n 
8  353  ASP n 
8  354  PRO n 
8  355  LEU n 
8  356  ILE n 
8  357  ASN n 
8  358  PRO n 
8  359  ILE n 
8  360  SER n 
8  361  HIS n 
8  362  ARG n 
8  363  HIS n 
8  364  SER n 
8  365  VAL n 
8  366  LYS n 
8  367  SER n 
8  368  GLN n 
8  369  GLU n 
8  370  PRO n 
8  371  LEU n 
8  372  PRO n 
8  373  ASP n 
8  374  ASP n 
8  375  ASP n 
8  376  GLU n 
8  377  GLU n 
8  378  PHE n 
8  379  GLU n 
8  380  LEU n 
8  381  PRO n 
8  382  GLU n 
8  383  PHE n 
8  384  VAL n 
8  385  GLU n 
8  386  PRO n 
8  387  PHE n 
8  388  LEU n 
8  389  LYS n 
8  390  ASP n 
8  391  THR n 
8  392  PRO n 
8  393  LEU n 
8  394  TYR n 
8  395  THR n 
8  396  ASP n 
8  397  ASN n 
8  398  THR n 
8  399  ALA n 
8  400  ASN n 
8  401  GLY n 
8  402  ILE n 
8  403  ALA n 
8  404  LEU n 
8  405  LEU n 
8  406  TRP n 
8  407  ALA n 
8  408  PRO n 
8  409  ARG n 
8  410  PRO n 
8  411  PHE n 
8  412  ASN n 
8  413  LEU n 
8  414  ARG n 
8  415  SER n 
8  416  GLY n 
8  417  ARG n 
8  418  THR n 
8  419  ARG n 
8  420  ARG n 
8  421  ALA n 
8  422  LEU n 
8  423  ASP n 
8  424  ILE n 
8  425  PRO n 
8  426  LEU n 
8  427  VAL n 
8  428  LYS n 
8  429  ASN n 
8  430  TRP n 
8  431  TYR n 
8  432  ARG n 
8  433  GLU n 
8  434  HIS n 
8  435  CYS n 
8  436  PRO n 
8  437  ALA n 
8  438  GLY n 
8  439  GLN n 
8  440  PRO n 
8  441  VAL n 
8  442  LYS n 
8  443  VAL n 
8  444  ARG n 
8  445  VAL n 
8  446  SER n 
8  447  TYR n 
8  448  GLN n 
8  449  LYS n 
8  450  LEU n 
8  451  LEU n 
8  452  LYS n 
8  453  TYR n 
8  454  TYR n 
8  455  VAL n 
8  456  LEU n 
8  457  ASN n 
8  458  ALA n 
8  459  LEU n 
8  460  LYS n 
8  461  HIS n 
8  462  ARG n 
8  463  PRO n 
8  464  PRO n 
8  465  LYS n 
8  466  ALA n 
8  467  GLN n 
8  468  LYS n 
8  469  LYS n 
8  470  ARG n 
8  471  TYR n 
8  472  LEU n 
8  473  PHE n 
8  474  ARG n 
8  475  SER n 
8  476  PHE n 
8  477  LYS n 
8  478  ALA n 
8  479  THR n 
8  480  LYS n 
8  481  PHE n 
8  482  PHE n 
8  483  GLN n 
8  484  SER n 
8  485  THR n 
8  486  LYS n 
8  487  LEU n 
8  488  ASP n 
8  489  TRP n 
8  490  VAL n 
8  491  GLU n 
8  492  VAL n 
8  493  GLY n 
8  494  LEU n 
8  495  GLN n 
8  496  VAL n 
8  497  CYS n 
8  498  ARG n 
8  499  GLN n 
8  500  GLY n 
8  501  TYR n 
8  502  ASN n 
8  503  MET n 
8  504  LEU n 
8  505  ASN n 
8  506  LEU n 
8  507  LEU n 
8  508  ILE n 
8  509  HIS n 
8  510  ARG n 
8  511  LYS n 
8  512  ASN n 
8  513  LEU n 
8  514  ASN n 
8  515  TYR n 
8  516  LEU n 
8  517  HIS n 
8  518  LEU n 
8  519  ASP n 
8  520  TYR n 
8  521  ASN n 
8  522  PHE n 
8  523  ASN n 
8  524  LEU n 
8  525  LYS n 
8  526  PRO n 
8  527  VAL n 
8  528  LYS n 
8  529  THR n 
8  530  LEU n 
8  531  THR n 
8  532  THR n 
8  533  LYS n 
8  534  GLU n 
8  535  ARG n 
8  536  LYS n 
8  537  LYS n 
8  538  SER n 
8  539  ARG n 
8  540  PHE n 
8  541  GLY n 
8  542  ASN n 
8  543  ALA n 
8  544  PHE n 
8  545  HIS n 
8  546  LEU n 
8  547  CYS n 
8  548  ARG n 
8  549  GLU n 
8  550  VAL n 
8  551  LEU n 
8  552  ARG n 
8  553  LEU n 
8  554  THR n 
8  555  LYS n 
8  556  LEU n 
8  557  VAL n 
8  558  VAL n 
8  559  ASP n 
8  560  SER n 
8  561  HIS n 
8  562  VAL n 
8  563  GLN n 
8  564  TYR n 
8  565  ARG n 
8  566  LEU n 
8  567  GLY n 
8  568  ASN n 
8  569  VAL n 
8  570  ASP n 
8  571  ALA n 
8  572  PHE n 
8  573  GLN n 
8  574  LEU n 
8  575  ALA n 
8  576  ASP n 
8  577  GLY n 
8  578  LEU n 
8  579  GLN n 
8  580  TYR n 
8  581  ILE n 
8  582  PHE n 
8  583  ALA n 
8  584  HIS n 
8  585  VAL n 
8  586  GLY n 
8  587  GLN n 
8  588  LEU n 
8  589  THR n 
8  590  GLY n 
8  591  MET n 
8  592  TYR n 
8  593  ARG n 
8  594  TYR n 
8  595  LYS n 
8  596  TYR n 
8  597  LYS n 
8  598  LEU n 
8  599  MET n 
8  600  ARG n 
8  601  GLN n 
8  602  ILE n 
8  603  ARG n 
8  604  MET n 
8  605  CYS n 
8  606  LYS n 
8  607  ASP n 
8  608  LEU n 
8  609  LYS n 
8  610  HIS n 
8  611  LEU n 
8  612  ILE n 
8  613  TYR n 
8  614  TYR n 
8  615  ARG n 
8  616  PHE n 
8  617  ASN n 
8  618  THR n 
8  619  GLY n 
8  620  PRO n 
8  621  VAL n 
8  622  GLY n 
8  623  LYS n 
8  624  GLY n 
8  625  PRO n 
8  626  GLY n 
8  627  CYS n 
8  628  GLY n 
8  629  PHE n 
8  630  TRP n 
8  631  ALA n 
8  632  ALA n 
8  633  GLY n 
8  634  TRP n 
8  635  ARG n 
8  636  VAL n 
8  637  TRP n 
8  638  LEU n 
8  639  PHE n 
8  640  PHE n 
8  641  MET n 
8  642  ARG n 
8  643  GLY n 
8  644  ILE n 
8  645  THR n 
8  646  PRO n 
8  647  LEU n 
8  648  LEU n 
8  649  GLU n 
8  650  ARG n 
8  651  TRP n 
8  652  LEU n 
8  653  GLY n 
8  654  ASN n 
8  655  LEU n 
8  656  LEU n 
8  657  ALA n 
8  658  ARG n 
8  659  GLN n 
8  660  PHE n 
8  661  GLU n 
8  662  GLY n 
8  663  ARG n 
8  664  HIS n 
8  665  SER n 
8  666  LYS n 
8  667  GLY n 
8  668  VAL n 
8  669  ALA n 
8  670  LYS n 
8  671  THR n 
8  672  VAL n 
8  673  THR n 
8  674  LYS n 
8  675  GLN n 
8  676  ARG n 
8  677  VAL n 
8  678  GLU n 
8  679  SER n 
8  680  HIS n 
8  681  PHE n 
8  682  ASP n 
8  683  LEU n 
8  684  GLU n 
8  685  LEU n 
8  686  ARG n 
8  687  ALA n 
8  688  ALA n 
8  689  VAL n 
8  690  MET n 
8  691  HIS n 
8  692  ASP n 
8  693  ILE n 
8  694  LEU n 
8  695  ASP n 
8  696  MET n 
8  697  MET n 
8  698  PRO n 
8  699  GLU n 
8  700  GLY n 
8  701  ILE n 
8  702  LYS n 
8  703  GLN n 
8  704  ASN n 
8  705  LYS n 
8  706  ALA n 
8  707  ARG n 
8  708  THR n 
8  709  ILE n 
8  710  LEU n 
8  711  GLN n 
8  712  HIS n 
8  713  LEU n 
8  714  SER n 
8  715  GLU n 
8  716  ALA n 
8  717  TRP n 
8  718  ARG n 
8  719  CYS n 
8  720  TRP n 
8  721  LYS n 
8  722  ALA n 
8  723  ASN n 
8  724  ILE n 
8  725  PRO n 
8  726  TRP n 
8  727  LYS n 
8  728  VAL n 
8  729  PRO n 
8  730  GLY n 
8  731  LEU n 
8  732  PRO n 
8  733  THR n 
8  734  PRO n 
8  735  ILE n 
8  736  GLU n 
8  737  ASN n 
8  738  MET n 
8  739  ILE n 
8  740  LEU n 
8  741  ARG n 
8  742  TYR n 
8  743  VAL n 
8  744  LYS n 
8  745  ALA n 
8  746  LYS n 
8  747  ALA n 
8  748  ASP n 
8  749  TRP n 
8  750  TRP n 
8  751  THR n 
8  752  ASN n 
8  753  THR n 
8  754  ALA n 
8  755  HIS n 
8  756  TYR n 
8  757  ASN n 
8  758  ARG n 
8  759  GLU n 
8  760  ARG n 
8  761  ILE n 
8  762  ARG n 
8  763  ARG n 
8  764  GLY n 
8  765  ALA n 
8  766  THR n 
8  767  VAL n 
8  768  ASP n 
8  769  LYS n 
8  770  THR n 
8  771  VAL n 
8  772  CYS n 
8  773  LYS n 
8  774  LYS n 
8  775  ASN n 
8  776  LEU n 
8  777  GLY n 
8  778  ARG n 
8  779  LEU n 
8  780  THR n 
8  781  ARG n 
8  782  LEU n 
8  783  TYR n 
8  784  LEU n 
8  785  LYS n 
8  786  ALA n 
8  787  GLU n 
8  788  GLN n 
8  789  GLU n 
8  790  ARG n 
8  791  GLN n 
8  792  HIS n 
8  793  ASN n 
8  794  TYR n 
8  795  LEU n 
8  796  LYS n 
8  797  ASP n 
8  798  GLY n 
8  799  PRO n 
8  800  TYR n 
8  801  ILE n 
8  802  THR n 
8  803  ALA n 
8  804  GLU n 
8  805  GLU n 
8  806  ALA n 
8  807  VAL n 
8  808  ALA n 
8  809  VAL n 
8  810  TYR n 
8  811  THR n 
8  812  THR n 
8  813  THR n 
8  814  VAL n 
8  815  HIS n 
8  816  TRP n 
8  817  LEU n 
8  818  GLU n 
8  819  SER n 
8  820  ARG n 
8  821  ARG n 
8  822  PHE n 
8  823  SER n 
8  824  PRO n 
8  825  ILE n 
8  826  PRO n 
8  827  PHE n 
8  828  PRO n 
8  829  PRO n 
8  830  LEU n 
8  831  SER n 
8  832  TYR n 
8  833  LYS n 
8  834  HIS n 
8  835  ASP n 
8  836  THR n 
8  837  LYS n 
8  838  LEU n 
8  839  LEU n 
8  840  ILE n 
8  841  LEU n 
8  842  ALA n 
8  843  LEU n 
8  844  GLU n 
8  845  ARG n 
8  846  LEU n 
8  847  LYS n 
8  848  GLU n 
8  849  ALA n 
8  850  TYR n 
8  851  SER n 
8  852  VAL n 
8  853  LYS n 
8  854  SER n 
8  855  ARG n 
8  856  LEU n 
8  857  ASN n 
8  858  GLN n 
8  859  SER n 
8  860  GLN n 
8  861  ARG n 
8  862  GLU n 
8  863  GLU n 
8  864  LEU n 
8  865  GLY n 
8  866  LEU n 
8  867  ILE n 
8  868  GLU n 
8  869  GLN n 
8  870  ALA n 
8  871  TYR n 
8  872  ASP n 
8  873  ASN n 
8  874  PRO n 
8  875  HIS n 
8  876  GLU n 
8  877  ALA n 
8  878  LEU n 
8  879  SER n 
8  880  ARG n 
8  881  ILE n 
8  882  LYS n 
8  883  ARG n 
8  884  HIS n 
8  885  LEU n 
8  886  LEU n 
8  887  THR n 
8  888  GLN n 
8  889  ARG n 
8  890  ALA n 
8  891  PHE n 
8  892  LYS n 
8  893  GLU n 
8  894  VAL n 
8  895  GLY n 
8  896  ILE n 
8  897  GLU n 
8  898  PHE n 
8  899  MET n 
8  900  ASP n 
8  901  LEU n 
8  902  TYR n 
8  903  SER n 
8  904  HIS n 
8  905  LEU n 
8  906  VAL n 
8  907  PRO n 
8  908  VAL n 
8  909  TYR n 
8  910  ASP n 
8  911  VAL n 
8  912  GLU n 
8  913  PRO n 
8  914  LEU n 
8  915  GLU n 
8  916  LYS n 
8  917  ILE n 
8  918  THR n 
8  919  ASP n 
8  920  ALA n 
8  921  TYR n 
8  922  LEU n 
8  923  ASP n 
8  924  GLN n 
8  925  TYR n 
8  926  LEU n 
8  927  TRP n 
8  928  TYR n 
8  929  GLU n 
8  930  ALA n 
8  931  ASP n 
8  932  LYS n 
8  933  ARG n 
8  934  ARG n 
8  935  LEU n 
8  936  PHE n 
8  937  PRO n 
8  938  PRO n 
8  939  TRP n 
8  940  ILE n 
8  941  LYS n 
8  942  PRO n 
8  943  ALA n 
8  944  ASP n 
8  945  THR n 
8  946  GLU n 
8  947  PRO n 
8  948  PRO n 
8  949  PRO n 
8  950  LEU n 
8  951  LEU n 
8  952  VAL n 
8  953  TYR n 
8  954  LYS n 
8  955  TRP n 
8  956  CYS n 
8  957  GLN n 
8  958  GLY n 
8  959  ILE n 
8  960  ASN n 
8  961  ASN n 
8  962  LEU n 
8  963  GLN n 
8  964  ASP n 
8  965  VAL n 
8  966  TRP n 
8  967  GLU n 
8  968  THR n 
8  969  SER n 
8  970  GLU n 
8  971  GLY n 
8  972  GLU n 
8  973  CYS n 
8  974  ASN n 
8  975  VAL n 
8  976  MET n 
8  977  LEU n 
8  978  GLU n 
8  979  SER n 
8  980  ARG n 
8  981  PHE n 
8  982  GLU n 
8  983  LYS n 
8  984  MET n 
8  985  TYR n 
8  986  GLU n 
8  987  LYS n 
8  988  ILE n 
8  989  ASP n 
8  990  LEU n 
8  991  THR n 
8  992  LEU n 
8  993  LEU n 
8  994  ASN n 
8  995  ARG n 
8  996  LEU n 
8  997  LEU n 
8  998  ARG n 
8  999  LEU n 
8  1000 ILE n 
8  1001 VAL n 
8  1002 ASP n 
8  1003 HIS n 
8  1004 ASN n 
8  1005 ILE n 
8  1006 ALA n 
8  1007 ASP n 
8  1008 TYR n 
8  1009 MET n 
8  1010 THR n 
8  1011 ALA n 
8  1012 LYS n 
8  1013 ASN n 
8  1014 ASN n 
8  1015 VAL n 
8  1016 VAL n 
8  1017 ILE n 
8  1018 ASN n 
8  1019 TYR n 
8  1020 LYS n 
8  1021 ASP n 
8  1022 MET n 
8  1023 ASN n 
8  1024 HIS n 
8  1025 THR n 
8  1026 ASN n 
8  1027 SER n 
8  1028 TYR n 
8  1029 GLY n 
8  1030 ILE n 
8  1031 ILE n 
8  1032 ARG n 
8  1033 GLY n 
8  1034 LEU n 
8  1035 GLN n 
8  1036 PHE n 
8  1037 ALA n 
8  1038 SER n 
8  1039 PHE n 
8  1040 ILE n 
8  1041 VAL n 
8  1042 GLN n 
8  1043 TYR n 
8  1044 TYR n 
8  1045 GLY n 
8  1046 LEU n 
8  1047 VAL n 
8  1048 MET n 
8  1049 ASP n 
8  1050 LEU n 
8  1051 LEU n 
8  1052 VAL n 
8  1053 LEU n 
8  1054 GLY n 
8  1055 LEU n 
8  1056 HIS n 
8  1057 ARG n 
8  1058 ALA n 
8  1059 SER n 
8  1060 GLU n 
8  1061 MET n 
8  1062 ALA n 
8  1063 GLY n 
8  1064 PRO n 
8  1065 PRO n 
8  1066 GLN n 
8  1067 MET n 
8  1068 PRO n 
8  1069 ASN n 
8  1070 ASP n 
8  1071 PHE n 
8  1072 LEU n 
8  1073 SER n 
8  1074 PHE n 
8  1075 GLN n 
8  1076 ASP n 
8  1077 ILE n 
8  1078 ALA n 
8  1079 THR n 
8  1080 GLU n 
8  1081 ALA n 
8  1082 ALA n 
8  1083 HIS n 
8  1084 PRO n 
8  1085 ILE n 
8  1086 ARG n 
8  1087 LEU n 
8  1088 PHE n 
8  1089 CYS n 
8  1090 ARG n 
8  1091 TYR n 
8  1092 ILE n 
8  1093 ASP n 
8  1094 ARG n 
8  1095 ILE n 
8  1096 HIS n 
8  1097 ILE n 
8  1098 PHE n 
8  1099 PHE n 
8  1100 ARG n 
8  1101 PHE n 
8  1102 THR n 
8  1103 ALA n 
8  1104 ASP n 
8  1105 GLU n 
8  1106 ALA n 
8  1107 ARG n 
8  1108 ASP n 
8  1109 LEU n 
8  1110 ILE n 
8  1111 GLN n 
8  1112 ARG n 
8  1113 TYR n 
8  1114 LEU n 
8  1115 THR n 
8  1116 GLU n 
8  1117 HIS n 
8  1118 PRO n 
8  1119 ASP n 
8  1120 PRO n 
8  1121 ASN n 
8  1122 ASN n 
8  1123 GLU n 
8  1124 ASN n 
8  1125 ILE n 
8  1126 VAL n 
8  1127 GLY n 
8  1128 TYR n 
8  1129 ASN n 
8  1130 ASN n 
8  1131 LYS n 
8  1132 LYS n 
8  1133 CYS n 
8  1134 TRP n 
8  1135 PRO n 
8  1136 ARG n 
8  1137 ASP n 
8  1138 ALA n 
8  1139 ARG n 
8  1140 MET n 
8  1141 ARG n 
8  1142 LEU n 
8  1143 MET n 
8  1144 LYS n 
8  1145 HIS n 
8  1146 ASP n 
8  1147 VAL n 
8  1148 ASN n 
8  1149 LEU n 
8  1150 GLY n 
8  1151 ARG n 
8  1152 ALA n 
8  1153 VAL n 
8  1154 PHE n 
8  1155 TRP n 
8  1156 ASP n 
8  1157 ILE n 
8  1158 LYS n 
8  1159 ASN n 
8  1160 ARG n 
8  1161 LEU n 
8  1162 PRO n 
8  1163 ARG n 
8  1164 SER n 
8  1165 VAL n 
8  1166 THR n 
8  1167 THR n 
8  1168 VAL n 
8  1169 GLN n 
8  1170 TRP n 
8  1171 GLU n 
8  1172 ASN n 
8  1173 SER n 
8  1174 PHE n 
8  1175 VAL n 
8  1176 SER n 
8  1177 VAL n 
8  1178 TYR n 
8  1179 SER n 
8  1180 LYS n 
8  1181 ASP n 
8  1182 ASN n 
8  1183 PRO n 
8  1184 ASN n 
8  1185 LEU n 
8  1186 LEU n 
8  1187 PHE n 
8  1188 ASN n 
8  1189 MET n 
8  1190 CYS n 
8  1191 GLY n 
8  1192 PHE n 
8  1193 GLU n 
8  1194 CYS n 
8  1195 ARG n 
8  1196 ILE n 
8  1197 LEU n 
8  1198 PRO n 
8  1199 LYS n 
8  1200 CYS n 
8  1201 ARG n 
8  1202 THR n 
8  1203 SER n 
8  1204 TYR n 
8  1205 GLU n 
8  1206 GLU n 
8  1207 PHE n 
8  1208 THR n 
8  1209 HIS n 
8  1210 LYS n 
8  1211 ASP n 
8  1212 GLY n 
8  1213 VAL n 
8  1214 TRP n 
8  1215 ASN n 
8  1216 LEU n 
8  1217 GLN n 
8  1218 ASN n 
8  1219 GLU n 
8  1220 VAL n 
8  1221 THR n 
8  1222 LYS n 
8  1223 GLU n 
8  1224 ARG n 
8  1225 THR n 
8  1226 ALA n 
8  1227 GLN n 
8  1228 CYS n 
8  1229 PHE n 
8  1230 LEU n 
8  1231 ARG n 
8  1232 VAL n 
8  1233 ASP n 
8  1234 ASP n 
8  1235 GLU n 
8  1236 SER n 
8  1237 MET n 
8  1238 GLN n 
8  1239 ARG n 
8  1240 PHE n 
8  1241 HIS n 
8  1242 ASN n 
8  1243 ARG n 
8  1244 VAL n 
8  1245 ARG n 
8  1246 GLN n 
8  1247 ILE n 
8  1248 LEU n 
8  1249 MET n 
8  1250 ALA n 
8  1251 SER n 
8  1252 GLY n 
8  1253 SER n 
8  1254 THR n 
8  1255 THR n 
8  1256 PHE n 
8  1257 THR n 
8  1258 LYS n 
8  1259 ILE n 
8  1260 VAL n 
8  1261 ASN n 
8  1262 LYS n 
8  1263 TRP n 
8  1264 ASN n 
8  1265 THR n 
8  1266 ALA n 
8  1267 LEU n 
8  1268 ILE n 
8  1269 GLY n 
8  1270 LEU n 
8  1271 MET n 
8  1272 THR n 
8  1273 TYR n 
8  1274 PHE n 
8  1275 ARG n 
8  1276 GLU n 
8  1277 ALA n 
8  1278 VAL n 
8  1279 VAL n 
8  1280 ASN n 
8  1281 THR n 
8  1282 GLN n 
8  1283 GLU n 
8  1284 LEU n 
8  1285 LEU n 
8  1286 ASP n 
8  1287 LEU n 
8  1288 LEU n 
8  1289 VAL n 
8  1290 LYS n 
8  1291 CYS n 
8  1292 GLU n 
8  1293 ASN n 
8  1294 LYS n 
8  1295 ILE n 
8  1296 GLN n 
8  1297 THR n 
8  1298 ARG n 
8  1299 ILE n 
8  1300 LYS n 
8  1301 ILE n 
8  1302 GLY n 
8  1303 LEU n 
8  1304 ASN n 
8  1305 SER n 
8  1306 LYS n 
8  1307 MET n 
8  1308 PRO n 
8  1309 SER n 
8  1310 ARG n 
8  1311 PHE n 
8  1312 PRO n 
8  1313 PRO n 
8  1314 VAL n 
8  1315 VAL n 
8  1316 PHE n 
8  1317 TYR n 
8  1318 THR n 
8  1319 PRO n 
8  1320 LYS n 
8  1321 GLU n 
8  1322 LEU n 
8  1323 GLY n 
8  1324 GLY n 
8  1325 LEU n 
8  1326 GLY n 
8  1327 MET n 
8  1328 LEU n 
8  1329 SER n 
8  1330 MET n 
8  1331 GLY n 
8  1332 HIS n 
8  1333 VAL n 
8  1334 LEU n 
8  1335 ILE n 
8  1336 PRO n 
8  1337 GLN n 
8  1338 SER n 
8  1339 ASP n 
8  1340 LEU n 
8  1341 ARG n 
8  1342 TRP n 
8  1343 SER n 
8  1344 LYS n 
8  1345 GLN n 
8  1346 THR n 
8  1347 ASP n 
8  1348 VAL n 
8  1349 GLY n 
8  1350 ILE n 
8  1351 THR n 
8  1352 HIS n 
8  1353 PHE n 
8  1354 ARG n 
8  1355 SER n 
8  1356 GLY n 
8  1357 MET n 
8  1358 SER n 
8  1359 HIS n 
8  1360 GLU n 
8  1361 GLU n 
8  1362 ASP n 
8  1363 GLN n 
8  1364 LEU n 
8  1365 ILE n 
8  1366 PRO n 
8  1367 ASN n 
8  1368 LEU n 
8  1369 TYR n 
8  1370 ARG n 
8  1371 TYR n 
8  1372 ILE n 
8  1373 GLN n 
8  1374 PRO n 
8  1375 TRP n 
8  1376 GLU n 
8  1377 SER n 
8  1378 GLU n 
8  1379 PHE n 
8  1380 ILE n 
8  1381 ASP n 
8  1382 SER n 
8  1383 GLN n 
8  1384 ARG n 
8  1385 VAL n 
8  1386 TRP n 
8  1387 ALA n 
8  1388 GLU n 
8  1389 TYR n 
8  1390 ALA n 
8  1391 LEU n 
8  1392 LYS n 
8  1393 ARG n 
8  1394 GLN n 
8  1395 GLU n 
8  1396 ALA n 
8  1397 ILE n 
8  1398 ALA n 
8  1399 GLN n 
8  1400 ASN n 
8  1401 ARG n 
8  1402 ARG n 
8  1403 LEU n 
8  1404 THR n 
8  1405 LEU n 
8  1406 GLU n 
8  1407 ASP n 
8  1408 LEU n 
8  1409 GLU n 
8  1410 ASP n 
8  1411 SER n 
8  1412 TRP n 
8  1413 ASP n 
8  1414 ARG n 
8  1415 GLY n 
8  1416 ILE n 
8  1417 PRO n 
8  1418 ARG n 
8  1419 ILE n 
8  1420 ASN n 
8  1421 THR n 
8  1422 LEU n 
8  1423 PHE n 
8  1424 GLN n 
8  1425 LYS n 
8  1426 ASP n 
8  1427 ARG n 
8  1428 HIS n 
8  1429 THR n 
8  1430 LEU n 
8  1431 ALA n 
8  1432 TYR n 
8  1433 ASP n 
8  1434 LYS n 
8  1435 GLY n 
8  1436 TRP n 
8  1437 ARG n 
8  1438 VAL n 
8  1439 ARG n 
8  1440 THR n 
8  1441 ASP n 
8  1442 PHE n 
8  1443 LYS n 
8  1444 GLN n 
8  1445 TYR n 
8  1446 GLN n 
8  1447 VAL n 
8  1448 LEU n 
8  1449 LYS n 
8  1450 GLN n 
8  1451 ASN n 
8  1452 PRO n 
8  1453 PHE n 
8  1454 TRP n 
8  1455 TRP n 
8  1456 THR n 
8  1457 HIS n 
8  1458 GLN n 
8  1459 ARG n 
8  1460 HIS n 
8  1461 ASP n 
8  1462 GLY n 
8  1463 LYS n 
8  1464 LEU n 
8  1465 TRP n 
8  1466 ASN n 
8  1467 LEU n 
8  1468 ASN n 
8  1469 ASN n 
8  1470 TYR n 
8  1471 ARG n 
8  1472 THR n 
8  1473 ASP n 
8  1474 MET n 
8  1475 ILE n 
8  1476 GLN n 
8  1477 ALA n 
8  1478 LEU n 
8  1479 GLY n 
8  1480 GLY n 
8  1481 VAL n 
8  1482 GLU n 
8  1483 GLY n 
8  1484 ILE n 
8  1485 LEU n 
8  1486 GLU n 
8  1487 HIS n 
8  1488 THR n 
8  1489 LEU n 
8  1490 PHE n 
8  1491 LYS n 
8  1492 GLY n 
8  1493 THR n 
8  1494 TYR n 
8  1495 PHE n 
8  1496 PRO n 
8  1497 THR n 
8  1498 TRP n 
8  1499 GLU n 
8  1500 GLY n 
8  1501 LEU n 
8  1502 PHE n 
8  1503 TRP n 
8  1504 GLU n 
8  1505 LYS n 
8  1506 ALA n 
8  1507 SER n 
8  1508 GLY n 
8  1509 PHE n 
8  1510 GLU n 
8  1511 GLU n 
8  1512 SER n 
8  1513 MET n 
8  1514 LYS n 
8  1515 TRP n 
8  1516 LYS n 
8  1517 LYS n 
8  1518 LEU n 
8  1519 THR n 
8  1520 ASN n 
8  1521 ALA n 
8  1522 GLN n 
8  1523 ARG n 
8  1524 SER n 
8  1525 GLY n 
8  1526 LEU n 
8  1527 ASN n 
8  1528 GLN n 
8  1529 ILE n 
8  1530 PRO n 
8  1531 ASN n 
8  1532 ARG n 
8  1533 ARG n 
8  1534 PHE n 
8  1535 THR n 
8  1536 LEU n 
8  1537 TRP n 
8  1538 TRP n 
8  1539 SER n 
8  1540 PRO n 
8  1541 THR n 
8  1542 ILE n 
8  1543 ASN n 
8  1544 ARG n 
8  1545 ALA n 
8  1546 ASN n 
8  1547 VAL n 
8  1548 TYR n 
8  1549 VAL n 
8  1550 GLY n 
8  1551 PHE n 
8  1552 GLN n 
8  1553 VAL n 
8  1554 GLN n 
8  1555 LEU n 
8  1556 ASP n 
8  1557 LEU n 
8  1558 THR n 
8  1559 GLY n 
8  1560 ILE n 
8  1561 PHE n 
8  1562 MET n 
8  1563 HIS n 
8  1564 GLY n 
8  1565 LYS n 
8  1566 ILE n 
8  1567 PRO n 
8  1568 THR n 
8  1569 LEU n 
8  1570 LYS n 
8  1571 ILE n 
8  1572 SER n 
8  1573 LEU n 
8  1574 ILE n 
8  1575 GLN n 
8  1576 ILE n 
8  1577 PHE n 
8  1578 ARG n 
8  1579 ALA n 
8  1580 HIS n 
8  1581 LEU n 
8  1582 TRP n 
8  1583 GLN n 
8  1584 LYS n 
8  1585 ILE n 
8  1586 HIS n 
8  1587 GLU n 
8  1588 SER n 
8  1589 ILE n 
8  1590 VAL n 
8  1591 MET n 
8  1592 ASP n 
8  1593 LEU n 
8  1594 CYS n 
8  1595 GLN n 
8  1596 VAL n 
8  1597 PHE n 
8  1598 ASP n 
8  1599 GLN n 
8  1600 GLU n 
8  1601 LEU n 
8  1602 ASP n 
8  1603 ALA n 
8  1604 LEU n 
8  1605 GLU n 
8  1606 ILE n 
8  1607 GLU n 
8  1608 THR n 
8  1609 VAL n 
8  1610 GLN n 
8  1611 LYS n 
8  1612 GLU n 
8  1613 THR n 
8  1614 ILE n 
8  1615 HIS n 
8  1616 PRO n 
8  1617 ARG n 
8  1618 LYS n 
8  1619 SER n 
8  1620 TYR n 
8  1621 LYS n 
8  1622 MET n 
8  1623 ASN n 
8  1624 SER n 
8  1625 SER n 
8  1626 CYS n 
8  1627 ALA n 
8  1628 ASP n 
8  1629 ILE n 
8  1630 LEU n 
8  1631 LEU n 
8  1632 PHE n 
8  1633 ALA n 
8  1634 SER n 
8  1635 TYR n 
8  1636 LYS n 
8  1637 TRP n 
8  1638 ASN n 
8  1639 VAL n 
8  1640 SER n 
8  1641 ARG n 
8  1642 PRO n 
8  1643 SER n 
8  1644 LEU n 
8  1645 LEU n 
8  1646 ALA n 
8  1647 ASP n 
8  1648 SER n 
8  1649 LYS n 
8  1650 ASP n 
8  1651 VAL n 
8  1652 MET n 
8  1653 ASP n 
8  1654 SER n 
8  1655 THR n 
8  1656 THR n 
8  1657 THR n 
8  1658 GLN n 
8  1659 LYS n 
8  1660 TYR n 
8  1661 TRP n 
8  1662 ILE n 
8  1663 ASP n 
8  1664 ILE n 
8  1665 GLN n 
8  1666 LEU n 
8  1667 ARG n 
8  1668 TRP n 
8  1669 GLY n 
8  1670 ASP n 
8  1671 TYR n 
8  1672 ASP n 
8  1673 SER n 
8  1674 HIS n 
8  1675 ASP n 
8  1676 ILE n 
8  1677 GLU n 
8  1678 ARG n 
8  1679 TYR n 
8  1680 ALA n 
8  1681 ARG n 
8  1682 ALA n 
8  1683 LYS n 
8  1684 PHE n 
8  1685 LEU n 
8  1686 ASP n 
8  1687 TYR n 
8  1688 THR n 
8  1689 THR n 
8  1690 ASP n 
8  1691 ASN n 
8  1692 MET n 
8  1693 SER n 
8  1694 ILE n 
8  1695 TYR n 
8  1696 PRO n 
8  1697 SER n 
8  1698 PRO n 
8  1699 THR n 
8  1700 GLY n 
8  1701 VAL n 
8  1702 LEU n 
8  1703 ILE n 
8  1704 ALA n 
8  1705 ILE n 
8  1706 ASP n 
8  1707 LEU n 
8  1708 ALA n 
8  1709 TYR n 
8  1710 ASN n 
8  1711 LEU n 
8  1712 HIS n 
8  1713 SER n 
8  1714 ALA n 
8  1715 TYR n 
8  1716 GLY n 
8  1717 ASN n 
8  1718 TRP n 
8  1719 PHE n 
8  1720 PRO n 
8  1721 GLY n 
8  1722 SER n 
8  1723 LYS n 
8  1724 PRO n 
8  1725 LEU n 
8  1726 ILE n 
8  1727 GLN n 
8  1728 GLN n 
8  1729 ALA n 
8  1730 MET n 
8  1731 ALA n 
8  1732 LYS n 
8  1733 ILE n 
8  1734 MET n 
8  1735 LYS n 
8  1736 ALA n 
8  1737 ASN n 
8  1738 PRO n 
8  1739 ALA n 
8  1740 LEU n 
8  1741 TYR n 
8  1742 VAL n 
8  1743 LEU n 
8  1744 ARG n 
8  1745 GLU n 
8  1746 ARG n 
8  1747 ILE n 
8  1748 ARG n 
8  1749 LYS n 
8  1750 GLY n 
8  1751 LEU n 
8  1752 GLN n 
8  1753 LEU n 
8  1754 TYR n 
8  1755 SER n 
8  1756 SER n 
8  1757 GLU n 
8  1758 PRO n 
8  1759 THR n 
8  1760 GLU n 
8  1761 PRO n 
8  1762 TYR n 
8  1763 LEU n 
8  1764 SER n 
8  1765 SER n 
8  1766 GLN n 
8  1767 ASN n 
8  1768 TYR n 
8  1769 GLY n 
8  1770 GLU n 
8  1771 LEU n 
8  1772 PHE n 
8  1773 SER n 
8  1774 ASN n 
8  1775 GLN n 
8  1776 ILE n 
8  1777 ILE n 
8  1778 TRP n 
8  1779 PHE n 
8  1780 VAL n 
8  1781 ASP n 
8  1782 ASP n 
8  1783 THR n 
8  1784 ASN n 
8  1785 VAL n 
8  1786 TYR n 
8  1787 ARG n 
8  1788 VAL n 
8  1789 THR n 
8  1790 ILE n 
8  1791 HIS n 
8  1792 LYS n 
8  1793 THR n 
8  1794 PHE n 
8  1795 GLU n 
8  1796 GLY n 
8  1797 ASN n 
8  1798 LEU n 
8  1799 THR n 
8  1800 THR n 
8  1801 LYS n 
8  1802 PRO n 
8  1803 ILE n 
8  1804 ASN n 
8  1805 GLY n 
8  1806 ALA n 
8  1807 ILE n 
8  1808 PHE n 
8  1809 ILE n 
8  1810 PHE n 
8  1811 ASN n 
8  1812 PRO n 
8  1813 ARG n 
8  1814 THR n 
8  1815 GLY n 
8  1816 GLN n 
8  1817 LEU n 
8  1818 PHE n 
8  1819 LEU n 
8  1820 LYS n 
8  1821 ILE n 
8  1822 ILE n 
8  1823 HIS n 
8  1824 THR n 
8  1825 SER n 
8  1826 VAL n 
8  1827 TRP n 
8  1828 ALA n 
8  1829 GLY n 
8  1830 GLN n 
8  1831 LYS n 
8  1832 ARG n 
8  1833 LEU n 
8  1834 GLY n 
8  1835 GLN n 
8  1836 LEU n 
8  1837 ALA n 
8  1838 LYS n 
8  1839 TRP n 
8  1840 LYS n 
8  1841 THR n 
8  1842 ALA n 
8  1843 GLU n 
8  1844 GLU n 
8  1845 VAL n 
8  1846 ALA n 
8  1847 ALA n 
8  1848 LEU n 
8  1849 ILE n 
8  1850 ARG n 
8  1851 SER n 
8  1852 LEU n 
8  1853 PRO n 
8  1854 VAL n 
8  1855 GLU n 
8  1856 GLU n 
8  1857 GLN n 
8  1858 PRO n 
8  1859 LYS n 
8  1860 GLN n 
8  1861 ILE n 
8  1862 ILE n 
8  1863 VAL n 
8  1864 THR n 
8  1865 ARG n 
8  1866 LYS n 
8  1867 GLY n 
8  1868 MET n 
8  1869 LEU n 
8  1870 ASP n 
8  1871 PRO n 
8  1872 LEU n 
8  1873 GLU n 
8  1874 VAL n 
8  1875 HIS n 
8  1876 LEU n 
8  1877 LEU n 
8  1878 ASP n 
8  1879 PHE n 
8  1880 PRO n 
8  1881 ASN n 
8  1882 ILE n 
8  1883 VAL n 
8  1884 ILE n 
8  1885 LYS n 
8  1886 GLY n 
8  1887 SER n 
8  1888 GLU n 
8  1889 LEU n 
8  1890 GLN n 
8  1891 LEU n 
8  1892 PRO n 
8  1893 PHE n 
8  1894 GLN n 
8  1895 ALA n 
8  1896 CYS n 
8  1897 LEU n 
8  1898 LYS n 
8  1899 VAL n 
8  1900 GLU n 
8  1901 LYS n 
8  1902 PHE n 
8  1903 GLY n 
8  1904 ASP n 
8  1905 LEU n 
8  1906 ILE n 
8  1907 LEU n 
8  1908 LYS n 
8  1909 ALA n 
8  1910 THR n 
8  1911 GLU n 
8  1912 PRO n 
8  1913 GLN n 
8  1914 MET n 
8  1915 VAL n 
8  1916 LEU n 
8  1917 PHE n 
8  1918 ASN n 
8  1919 LEU n 
8  1920 TYR n 
8  1921 ASP n 
8  1922 ASP n 
8  1923 TRP n 
8  1924 LEU n 
8  1925 LYS n 
8  1926 THR n 
8  1927 ILE n 
8  1928 SER n 
8  1929 SER n 
8  1930 TYR n 
8  1931 THR n 
8  1932 ALA n 
8  1933 PHE n 
8  1934 SER n 
8  1935 ARG n 
8  1936 LEU n 
8  1937 ILE n 
8  1938 LEU n 
8  1939 ILE n 
8  1940 LEU n 
8  1941 ARG n 
8  1942 ALA n 
8  1943 LEU n 
8  1944 HIS n 
8  1945 VAL n 
8  1946 ASN n 
8  1947 ASN n 
8  1948 ASP n 
8  1949 ARG n 
8  1950 ALA n 
8  1951 LYS n 
8  1952 VAL n 
8  1953 ILE n 
8  1954 LEU n 
8  1955 LYS n 
8  1956 PRO n 
8  1957 ASP n 
8  1958 LYS n 
8  1959 THR n 
8  1960 THR n 
8  1961 ILE n 
8  1962 THR n 
8  1963 GLU n 
8  1964 PRO n 
8  1965 HIS n 
8  1966 HIS n 
8  1967 ILE n 
8  1968 TRP n 
8  1969 PRO n 
8  1970 THR n 
8  1971 LEU n 
8  1972 THR n 
8  1973 ASP n 
8  1974 GLU n 
8  1975 GLU n 
8  1976 TRP n 
8  1977 ILE n 
8  1978 LYS n 
8  1979 VAL n 
8  1980 GLU n 
8  1981 VAL n 
8  1982 GLN n 
8  1983 LEU n 
8  1984 LYS n 
8  1985 ASP n 
8  1986 LEU n 
8  1987 ILE n 
8  1988 LEU n 
8  1989 ALA n 
8  1990 ASP n 
8  1991 TYR n 
8  1992 GLY n 
8  1993 LYS n 
8  1994 LYS n 
8  1995 ASN n 
8  1996 ASN n 
8  1997 VAL n 
8  1998 ASN n 
8  1999 VAL n 
8  2000 ALA n 
8  2001 SER n 
8  2002 LEU n 
8  2003 THR n 
8  2004 GLN n 
8  2005 SER n 
8  2006 GLU n 
8  2007 ILE n 
8  2008 ARG n 
8  2009 ASP n 
8  2010 ILE n 
8  2011 ILE n 
8  2012 LEU n 
8  2013 GLY n 
8  2014 MET n 
8  2015 GLU n 
8  2016 ILE n 
8  2017 SER n 
8  2018 ALA n 
8  2019 PRO n 
8  2020 SER n 
8  2021 GLN n 
8  2022 GLN n 
8  2023 ARG n 
8  2024 GLN n 
8  2025 GLN n 
8  2026 ILE n 
8  2027 ALA n 
8  2028 GLU n 
8  2029 ILE n 
8  2030 GLU n 
8  2031 LYS n 
8  2032 GLN n 
8  2033 THR n 
8  2034 LYS n 
8  2035 GLU n 
8  2036 GLN n 
8  2037 SER n 
8  2038 GLN n 
8  2039 LEU n 
8  2040 THR n 
8  2041 ALA n 
8  2042 THR n 
8  2043 GLN n 
8  2044 THR n 
8  2045 ARG n 
8  2046 THR n 
8  2047 VAL n 
8  2048 ASN n 
8  2049 LYS n 
8  2050 HIS n 
8  2051 GLY n 
8  2052 ASP n 
8  2053 GLU n 
8  2054 ILE n 
8  2055 ILE n 
8  2056 THR n 
8  2057 SER n 
8  2058 THR n 
8  2059 THR n 
8  2060 SER n 
8  2061 ASN n 
8  2062 TYR n 
8  2063 GLU n 
8  2064 THR n 
8  2065 GLN n 
8  2066 THR n 
8  2067 PHE n 
8  2068 SER n 
8  2069 SER n 
8  2070 LYS n 
8  2071 THR n 
8  2072 GLU n 
8  2073 TRP n 
8  2074 ARG n 
8  2075 VAL n 
8  2076 ARG n 
8  2077 ALA n 
8  2078 ILE n 
8  2079 SER n 
8  2080 ALA n 
8  2081 ALA n 
8  2082 ASN n 
8  2083 LEU n 
8  2084 HIS n 
8  2085 LEU n 
8  2086 ARG n 
8  2087 THR n 
8  2088 ASN n 
8  2089 HIS n 
8  2090 ILE n 
8  2091 TYR n 
8  2092 VAL n 
8  2093 SER n 
8  2094 SER n 
8  2095 ASP n 
8  2096 ASP n 
8  2097 ILE n 
8  2098 LYS n 
8  2099 GLU n 
8  2100 THR n 
8  2101 GLY n 
8  2102 TYR n 
8  2103 THR n 
8  2104 TYR n 
8  2105 ILE n 
8  2106 LEU n 
8  2107 PRO n 
8  2108 LYS n 
8  2109 ASN n 
8  2110 VAL n 
8  2111 LEU n 
8  2112 LYS n 
8  2113 LYS n 
8  2114 PHE n 
8  2115 ILE n 
8  2116 CYS n 
8  2117 ILE n 
8  2118 SER n 
8  2119 ASP n 
8  2120 LEU n 
8  2121 ARG n 
8  2122 ALA n 
8  2123 GLN n 
8  2124 ILE n 
8  2125 ALA n 
8  2126 GLY n 
8  2127 TYR n 
8  2128 LEU n 
8  2129 TYR n 
8  2130 GLY n 
8  2131 VAL n 
8  2132 SER n 
8  2133 PRO n 
8  2134 PRO n 
8  2135 ASP n 
8  2136 ASN n 
8  2137 PRO n 
8  2138 GLN n 
8  2139 VAL n 
8  2140 LYS n 
8  2141 GLU n 
8  2142 ILE n 
8  2143 ARG n 
8  2144 CYS n 
8  2145 ILE n 
8  2146 VAL n 
8  2147 MET n 
8  2148 VAL n 
8  2149 PRO n 
8  2150 GLN n 
8  2151 TRP n 
8  2152 GLY n 
8  2153 THR n 
8  2154 HIS n 
8  2155 GLN n 
8  2156 THR n 
8  2157 VAL n 
8  2158 HIS n 
8  2159 LEU n 
8  2160 PRO n 
8  2161 GLY n 
8  2162 GLN n 
8  2163 LEU n 
8  2164 PRO n 
8  2165 GLN n 
8  2166 HIS n 
8  2167 GLU n 
8  2168 TYR n 
8  2169 LEU n 
8  2170 LYS n 
8  2171 GLU n 
8  2172 MET n 
8  2173 GLU n 
8  2174 PRO n 
8  2175 LEU n 
8  2176 GLY n 
8  2177 TRP n 
8  2178 ILE n 
8  2179 HIS n 
8  2180 THR n 
8  2181 GLN n 
8  2182 PRO n 
8  2183 ASN n 
8  2184 GLU n 
8  2185 SER n 
8  2186 PRO n 
8  2187 GLN n 
8  2188 LEU n 
8  2189 SER n 
8  2190 PRO n 
8  2191 GLN n 
8  2192 ASP n 
8  2193 VAL n 
8  2194 THR n 
8  2195 THR n 
8  2196 HIS n 
8  2197 ALA n 
8  2198 LYS n 
8  2199 ILE n 
8  2200 MET n 
8  2201 ALA n 
8  2202 ASP n 
8  2203 ASN n 
8  2204 PRO n 
8  2205 SER n 
8  2206 TRP n 
8  2207 ASP n 
8  2208 GLY n 
8  2209 GLU n 
8  2210 LYS n 
8  2211 THR n 
8  2212 ILE n 
8  2213 ILE n 
8  2214 ILE n 
8  2215 THR n 
8  2216 CYS n 
8  2217 SER n 
8  2218 PHE n 
8  2219 THR n 
8  2220 PRO n 
8  2221 GLY n 
8  2222 SER n 
8  2223 CYS n 
8  2224 THR n 
8  2225 LEU n 
8  2226 THR n 
8  2227 ALA n 
8  2228 TYR n 
8  2229 LYS n 
8  2230 LEU n 
8  2231 THR n 
8  2232 PRO n 
8  2233 SER n 
8  2234 GLY n 
8  2235 TYR n 
8  2236 GLU n 
8  2237 TRP n 
8  2238 GLY n 
8  2239 ARG n 
8  2240 GLN n 
8  2241 ASN n 
8  2242 THR n 
8  2243 ASP n 
8  2244 LYS n 
8  2245 GLY n 
8  2246 ASN n 
8  2247 ASN n 
8  2248 PRO n 
8  2249 LYS n 
8  2250 GLY n 
8  2251 TYR n 
8  2252 LEU n 
8  2253 PRO n 
8  2254 SER n 
8  2255 HIS n 
8  2256 TYR n 
8  2257 GLU n 
8  2258 ARG n 
8  2259 VAL n 
8  2260 GLN n 
8  2261 MET n 
8  2262 LEU n 
8  2263 LEU n 
8  2264 SER n 
8  2265 ASP n 
8  2266 ARG n 
8  2267 PHE n 
8  2268 LEU n 
8  2269 GLY n 
8  2270 PHE n 
8  2271 PHE n 
8  2272 MET n 
8  2273 VAL n 
8  2274 PRO n 
8  2275 ALA n 
8  2276 GLN n 
8  2277 SER n 
8  2278 SER n 
8  2279 TRP n 
8  2280 ASN n 
8  2281 TYR n 
8  2282 ASN n 
8  2283 PHE n 
8  2284 MET n 
8  2285 GLY n 
8  2286 VAL n 
8  2287 ARG n 
8  2288 HIS n 
8  2289 ASP n 
8  2290 PRO n 
8  2291 ASN n 
8  2292 MET n 
8  2293 LYS n 
8  2294 TYR n 
8  2295 GLU n 
8  2296 LEU n 
8  2297 GLN n 
8  2298 LEU n 
8  2299 ALA n 
8  2300 ASN n 
8  2301 PRO n 
8  2302 LYS n 
8  2303 GLU n 
8  2304 PHE n 
8  2305 TYR n 
8  2306 HIS n 
8  2307 GLU n 
8  2308 VAL n 
8  2309 HIS n 
8  2310 ARG n 
8  2311 PRO n 
8  2312 SER n 
8  2313 HIS n 
8  2314 PHE n 
8  2315 LEU n 
8  2316 ASN n 
8  2317 PHE n 
8  2318 ALA n 
8  2319 LEU n 
8  2320 LEU n 
8  2321 GLN n 
8  2322 GLU n 
8  2323 GLY n 
8  2324 GLU n 
8  2325 VAL n 
8  2326 TYR n 
8  2327 SER n 
8  2328 ALA n 
8  2329 ASP n 
8  2330 ARG n 
8  2331 GLU n 
8  2332 ASP n 
8  2333 LEU n 
8  2334 TYR n 
8  2335 ALA n 
9  1    MET n 
9  2    ASP n 
9  3    THR n 
9  4    ASP n 
9  5    LEU n 
9  6    TYR n 
9  7    ASP n 
9  8    GLU n 
9  9    PHE n 
9  10   GLY n 
9  11   ASN n 
9  12   TYR n 
9  13   ILE n 
9  14   GLY n 
9  15   PRO n 
9  16   GLU n 
9  17   LEU n 
9  18   ASP n 
9  19   SER n 
9  20   ASP n 
9  21   GLU n 
9  22   ASP n 
9  23   ASP n 
9  24   ASP n 
9  25   GLU n 
9  26   LEU n 
9  27   GLY n 
9  28   ARG n 
9  29   GLU n 
9  30   THR n 
9  31   LYS n 
9  32   ASP n 
9  33   LEU n 
9  34   ASP n 
9  35   GLU n 
9  36   MET n 
9  37   ASP n 
9  38   ASP n 
9  39   ASP n 
9  40   ASP n 
9  41   ASP n 
9  42   ASP n 
9  43   ASP n 
9  44   ASP n 
9  45   VAL n 
9  46   GLY n 
9  47   ASP n 
9  48   HIS n 
9  49   ASP n 
9  50   ASP n 
9  51   ASP n 
9  52   HIS n 
9  53   PRO n 
9  54   GLY n 
9  55   MET n 
9  56   GLU n 
9  57   VAL n 
9  58   VAL n 
9  59   LEU n 
9  60   HIS n 
9  61   GLU n 
9  62   ASP n 
9  63   LYS n 
9  64   LYS n 
9  65   TYR n 
9  66   TYR n 
9  67   PRO n 
9  68   THR n 
9  69   ALA n 
9  70   GLU n 
9  71   GLU n 
9  72   VAL n 
9  73   TYR n 
9  74   GLY n 
9  75   PRO n 
9  76   GLU n 
9  77   VAL n 
9  78   GLU n 
9  79   THR n 
9  80   ILE n 
9  81   VAL n 
9  82   GLN n 
9  83   GLU n 
9  84   GLU n 
9  85   ASP n 
9  86   THR n 
9  87   GLN n 
9  88   PRO n 
9  89   LEU n 
9  90   THR n 
9  91   GLU n 
9  92   PRO n 
9  93   ILE n 
9  94   ILE n 
9  95   LYS n 
9  96   PRO n 
9  97   VAL n 
9  98   LYS n 
9  99   THR n 
9  100  LYS n 
9  101  LYS n 
9  102  PHE n 
9  103  THR n 
9  104  LEU n 
9  105  MET n 
9  106  GLU n 
9  107  GLN n 
9  108  THR n 
9  109  LEU n 
9  110  PRO n 
9  111  VAL n 
9  112  THR n 
9  113  VAL n 
9  114  TYR n 
9  115  GLU n 
9  116  MET n 
9  117  ASP n 
9  118  PHE n 
9  119  LEU n 
9  120  ALA n 
9  121  ASP n 
9  122  LEU n 
9  123  MET n 
9  124  ASP n 
9  125  ASN n 
9  126  SER n 
9  127  GLU n 
9  128  LEU n 
9  129  ILE n 
9  130  ARG n 
9  131  ASN n 
9  132  VAL n 
9  133  THR n 
9  134  LEU n 
9  135  CYS n 
9  136  GLY n 
9  137  HIS n 
9  138  LEU n 
9  139  HIS n 
9  140  HIS n 
9  141  GLY n 
9  142  LYS n 
9  143  THR n 
9  144  CYS n 
9  145  PHE n 
9  146  VAL n 
9  147  ASP n 
9  148  CYS n 
9  149  LEU n 
9  150  ILE n 
9  151  GLU n 
9  152  GLN n 
9  153  THR n 
9  154  HIS n 
9  155  PRO n 
9  156  GLU n 
9  157  ILE n 
9  158  ARG n 
9  159  LYS n 
9  160  ARG n 
9  161  TYR n 
9  162  ASP n 
9  163  GLN n 
9  164  ASP n 
9  165  LEU n 
9  166  CYS n 
9  167  TYR n 
9  168  THR n 
9  169  ASP n 
9  170  ILE n 
9  171  LEU n 
9  172  PHE n 
9  173  THR n 
9  174  GLU n 
9  175  GLN n 
9  176  GLU n 
9  177  ARG n 
9  178  GLY n 
9  179  VAL n 
9  180  GLY n 
9  181  ILE n 
9  182  LYS n 
9  183  SER n 
9  184  THR n 
9  185  PRO n 
9  186  VAL n 
9  187  THR n 
9  188  VAL n 
9  189  VAL n 
9  190  LEU n 
9  191  PRO n 
9  192  ASP n 
9  193  THR n 
9  194  LYS n 
9  195  GLY n 
9  196  LYS n 
9  197  SER n 
9  198  TYR n 
9  199  LEU n 
9  200  PHE n 
9  201  ASN n 
9  202  ILE n 
9  203  MET n 
9  204  ASP n 
9  205  THR n 
9  206  PRO n 
9  207  GLY n 
9  208  HIS n 
9  209  VAL n 
9  210  ASN n 
9  211  PHE n 
9  212  SER n 
9  213  ASP n 
9  214  GLU n 
9  215  VAL n 
9  216  THR n 
9  217  ALA n 
9  218  GLY n 
9  219  LEU n 
9  220  ARG n 
9  221  ILE n 
9  222  SER n 
9  223  ASP n 
9  224  GLY n 
9  225  VAL n 
9  226  VAL n 
9  227  LEU n 
9  228  PHE n 
9  229  ILE n 
9  230  ASP n 
9  231  ALA n 
9  232  ALA n 
9  233  GLU n 
9  234  GLY n 
9  235  VAL n 
9  236  MET n 
9  237  LEU n 
9  238  ASN n 
9  239  THR n 
9  240  GLU n 
9  241  ARG n 
9  242  LEU n 
9  243  ILE n 
9  244  LYS n 
9  245  HIS n 
9  246  ALA n 
9  247  VAL n 
9  248  GLN n 
9  249  GLU n 
9  250  ARG n 
9  251  LEU n 
9  252  ALA n 
9  253  VAL n 
9  254  THR n 
9  255  VAL n 
9  256  CYS n 
9  257  ILE n 
9  258  ASN n 
9  259  LYS n 
9  260  ILE n 
9  261  ASP n 
9  262  ARG n 
9  263  LEU n 
9  264  ILE n 
9  265  LEU n 
9  266  GLU n 
9  267  LEU n 
9  268  LYS n 
9  269  LEU n 
9  270  PRO n 
9  271  PRO n 
9  272  THR n 
9  273  ASP n 
9  274  ALA n 
9  275  TYR n 
9  276  TYR n 
9  277  LYS n 
9  278  LEU n 
9  279  ARG n 
9  280  HIS n 
9  281  ILE n 
9  282  VAL n 
9  283  ASP n 
9  284  GLU n 
9  285  VAL n 
9  286  ASN n 
9  287  GLY n 
9  288  LEU n 
9  289  ILE n 
9  290  SER n 
9  291  MET n 
9  292  TYR n 
9  293  SER n 
9  294  THR n 
9  295  ASP n 
9  296  GLU n 
9  297  ASN n 
9  298  LEU n 
9  299  ILE n 
9  300  LEU n 
9  301  SER n 
9  302  PRO n 
9  303  LEU n 
9  304  LEU n 
9  305  GLY n 
9  306  ASN n 
9  307  VAL n 
9  308  CYS n 
9  309  PHE n 
9  310  SER n 
9  311  SER n 
9  312  SER n 
9  313  GLN n 
9  314  TYR n 
9  315  SER n 
9  316  ILE n 
9  317  CYS n 
9  318  PHE n 
9  319  THR n 
9  320  LEU n 
9  321  GLY n 
9  322  SER n 
9  323  PHE n 
9  324  ALA n 
9  325  LYS n 
9  326  ILE n 
9  327  TYR n 
9  328  ALA n 
9  329  ASP n 
9  330  THR n 
9  331  PHE n 
9  332  GLY n 
9  333  ASP n 
9  334  ILE n 
9  335  ASN n 
9  336  TYR n 
9  337  GLN n 
9  338  GLU n 
9  339  PHE n 
9  340  ALA n 
9  341  LYS n 
9  342  ARG n 
9  343  LEU n 
9  344  TRP n 
9  345  GLY n 
9  346  ASP n 
9  347  ILE n 
9  348  TYR n 
9  349  PHE n 
9  350  ASN n 
9  351  PRO n 
9  352  LYS n 
9  353  THR n 
9  354  ARG n 
9  355  LYS n 
9  356  PHE n 
9  357  THR n 
9  358  LYS n 
9  359  LYS n 
9  360  ALA n 
9  361  PRO n 
9  362  THR n 
9  363  SER n 
9  364  SER n 
9  365  SER n 
9  366  GLN n 
9  367  ARG n 
9  368  SER n 
9  369  PHE n 
9  370  VAL n 
9  371  GLU n 
9  372  PHE n 
9  373  ILE n 
9  374  LEU n 
9  375  GLU n 
9  376  PRO n 
9  377  LEU n 
9  378  TYR n 
9  379  LYS n 
9  380  ILE n 
9  381  LEU n 
9  382  ALA n 
9  383  GLN n 
9  384  VAL n 
9  385  VAL n 
9  386  GLY n 
9  387  ASP n 
9  388  VAL n 
9  389  ASP n 
9  390  THR n 
9  391  SER n 
9  392  LEU n 
9  393  PRO n 
9  394  ARG n 
9  395  THR n 
9  396  LEU n 
9  397  ASP n 
9  398  GLU n 
9  399  LEU n 
9  400  GLY n 
9  401  ILE n 
9  402  HIS n 
9  403  LEU n 
9  404  THR n 
9  405  LYS n 
9  406  GLU n 
9  407  GLU n 
9  408  LEU n 
9  409  LYS n 
9  410  LEU n 
9  411  ASN n 
9  412  ILE n 
9  413  ARG n 
9  414  PRO n 
9  415  LEU n 
9  416  LEU n 
9  417  ARG n 
9  418  LEU n 
9  419  VAL n 
9  420  CYS n 
9  421  LYS n 
9  422  LYS n 
9  423  PHE n 
9  424  PHE n 
9  425  GLY n 
9  426  GLU n 
9  427  PHE n 
9  428  THR n 
9  429  GLY n 
9  430  PHE n 
9  431  VAL n 
9  432  ASP n 
9  433  MET n 
9  434  CYS n 
9  435  VAL n 
9  436  GLN n 
9  437  HIS n 
9  438  ILE n 
9  439  PRO n 
9  440  SER n 
9  441  PRO n 
9  442  LYS n 
9  443  VAL n 
9  444  GLY n 
9  445  ALA n 
9  446  LYS n 
9  447  PRO n 
9  448  LYS n 
9  449  ILE n 
9  450  GLU n 
9  451  HIS n 
9  452  THR n 
9  453  TYR n 
9  454  THR n 
9  455  GLY n 
9  456  GLY n 
9  457  VAL n 
9  458  ASP n 
9  459  SER n 
9  460  ASP n 
9  461  LEU n 
9  462  GLY n 
9  463  GLU n 
9  464  ALA n 
9  465  MET n 
9  466  SER n 
9  467  ASP n 
9  468  CYS n 
9  469  ASP n 
9  470  PRO n 
9  471  ASP n 
9  472  GLY n 
9  473  PRO n 
9  474  LEU n 
9  475  MET n 
9  476  CYS n 
9  477  HIS n 
9  478  THR n 
9  479  THR n 
9  480  LYS n 
9  481  MET n 
9  482  TYR n 
9  483  SER n 
9  484  THR n 
9  485  ASP n 
9  486  ASP n 
9  487  GLY n 
9  488  VAL n 
9  489  GLN n 
9  490  PHE n 
9  491  HIS n 
9  492  ALA n 
9  493  PHE n 
9  494  GLY n 
9  495  ARG n 
9  496  VAL n 
9  497  LEU n 
9  498  SER n 
9  499  GLY n 
9  500  THR n 
9  501  ILE n 
9  502  HIS n 
9  503  ALA n 
9  504  GLY n 
9  505  GLN n 
9  506  PRO n 
9  507  VAL n 
9  508  LYS n 
9  509  VAL n 
9  510  LEU n 
9  511  GLY n 
9  512  GLU n 
9  513  ASN n 
9  514  TYR n 
9  515  THR n 
9  516  LEU n 
9  517  GLU n 
9  518  ASP n 
9  519  GLU n 
9  520  GLU n 
9  521  ASP n 
9  522  SER n 
9  523  GLN n 
9  524  ILE n 
9  525  CYS n 
9  526  THR n 
9  527  VAL n 
9  528  GLY n 
9  529  ARG n 
9  530  LEU n 
9  531  TRP n 
9  532  ILE n 
9  533  SER n 
9  534  VAL n 
9  535  ALA n 
9  536  ARG n 
9  537  TYR n 
9  538  HIS n 
9  539  ILE n 
9  540  GLU n 
9  541  VAL n 
9  542  ASN n 
9  543  ARG n 
9  544  VAL n 
9  545  PRO n 
9  546  ALA n 
9  547  GLY n 
9  548  ASN n 
9  549  TRP n 
9  550  VAL n 
9  551  LEU n 
9  552  ILE n 
9  553  GLU n 
9  554  GLY n 
9  555  VAL n 
9  556  ASP n 
9  557  GLN n 
9  558  PRO n 
9  559  ILE n 
9  560  VAL n 
9  561  LYS n 
9  562  THR n 
9  563  ALA n 
9  564  THR n 
9  565  ILE n 
9  566  THR n 
9  567  GLU n 
9  568  PRO n 
9  569  ARG n 
9  570  GLY n 
9  571  ASN n 
9  572  GLU n 
9  573  GLU n 
9  574  ALA n 
9  575  GLN n 
9  576  ILE n 
9  577  PHE n 
9  578  ARG n 
9  579  PRO n 
9  580  LEU n 
9  581  LYS n 
9  582  PHE n 
9  583  ASN n 
9  584  THR n 
9  585  THR n 
9  586  SER n 
9  587  VAL n 
9  588  ILE n 
9  589  LYS n 
9  590  ILE n 
9  591  ALA n 
9  592  VAL n 
9  593  GLU n 
9  594  PRO n 
9  595  VAL n 
9  596  ASN n 
9  597  PRO n 
9  598  SER n 
9  599  GLU n 
9  600  LEU n 
9  601  PRO n 
9  602  LYS n 
9  603  MET n 
9  604  LEU n 
9  605  ASP n 
9  606  GLY n 
9  607  LEU n 
9  608  ARG n 
9  609  LYS n 
9  610  VAL n 
9  611  ASN n 
9  612  LYS n 
9  613  SER n 
9  614  TYR n 
9  615  PRO n 
9  616  SER n 
9  617  LEU n 
9  618  THR n 
9  619  THR n 
9  620  LYS n 
9  621  VAL n 
9  622  GLU n 
9  623  GLU n 
9  624  SER n 
9  625  GLY n 
9  626  GLU n 
9  627  HIS n 
9  628  VAL n 
9  629  ILE n 
9  630  LEU n 
9  631  GLY n 
9  632  THR n 
9  633  GLY n 
9  634  GLU n 
9  635  LEU n 
9  636  TYR n 
9  637  LEU n 
9  638  ASP n 
9  639  CYS n 
9  640  VAL n 
9  641  MET n 
9  642  HIS n 
9  643  ASP n 
9  644  LEU n 
9  645  ARG n 
9  646  LYS n 
9  647  MET n 
9  648  TYR n 
9  649  SER n 
9  650  GLU n 
9  651  ILE n 
9  652  ASP n 
9  653  ILE n 
9  654  LYS n 
9  655  VAL n 
9  656  ALA n 
9  657  ASP n 
9  658  PRO n 
9  659  VAL n 
9  660  VAL n 
9  661  THR n 
9  662  PHE n 
9  663  CYS n 
9  664  GLU n 
9  665  THR n 
9  666  VAL n 
9  667  VAL n 
9  668  GLU n 
9  669  THR n 
9  670  SER n 
9  671  SER n 
9  672  LEU n 
9  673  LYS n 
9  674  CYS n 
9  675  PHE n 
9  676  ALA n 
9  677  GLU n 
9  678  THR n 
9  679  PRO n 
9  680  ASN n 
9  681  LYS n 
9  682  LYS n 
9  683  ASN n 
9  684  LYS n 
9  685  ILE n 
9  686  THR n 
9  687  MET n 
9  688  ILE n 
9  689  ALA n 
9  690  GLU n 
9  691  PRO n 
9  692  LEU n 
9  693  GLU n 
9  694  LYS n 
9  695  GLY n 
9  696  LEU n 
9  697  ALA n 
9  698  GLU n 
9  699  ASP n 
9  700  ILE n 
9  701  GLU n 
9  702  ASN n 
9  703  GLU n 
9  704  VAL n 
9  705  VAL n 
9  706  GLN n 
9  707  ILE n 
9  708  THR n 
9  709  TRP n 
9  710  ASN n 
9  711  ARG n 
9  712  LYS n 
9  713  LYS n 
9  714  LEU n 
9  715  GLY n 
9  716  GLU n 
9  717  PHE n 
9  718  PHE n 
9  719  GLN n 
9  720  THR n 
9  721  LYS n 
9  722  TYR n 
9  723  ASP n 
9  724  TRP n 
9  725  ASP n 
9  726  LEU n 
9  727  LEU n 
9  728  ALA n 
9  729  ALA n 
9  730  ARG n 
9  731  SER n 
9  732  ILE n 
9  733  TRP n 
9  734  ALA n 
9  735  PHE n 
9  736  GLY n 
9  737  PRO n 
9  738  ASP n 
9  739  ALA n 
9  740  THR n 
9  741  GLY n 
9  742  PRO n 
9  743  ASN n 
9  744  ILE n 
9  745  LEU n 
9  746  VAL n 
9  747  ASP n 
9  748  ASP n 
9  749  THR n 
9  750  LEU n 
9  751  PRO n 
9  752  SER n 
9  753  GLU n 
9  754  VAL n 
9  755  ASP n 
9  756  LYS n 
9  757  ALA n 
9  758  LEU n 
9  759  LEU n 
9  760  GLY n 
9  761  SER n 
9  762  VAL n 
9  763  LYS n 
9  764  ASP n 
9  765  SER n 
9  766  ILE n 
9  767  VAL n 
9  768  GLN n 
9  769  GLY n 
9  770  PHE n 
9  771  GLN n 
9  772  TRP n 
9  773  GLY n 
9  774  THR n 
9  775  ARG n 
9  776  GLU n 
9  777  GLY n 
9  778  PRO n 
9  779  LEU n 
9  780  CYS n 
9  781  ASP n 
9  782  GLU n 
9  783  LEU n 
9  784  ILE n 
9  785  ARG n 
9  786  ASN n 
9  787  VAL n 
9  788  LYS n 
9  789  PHE n 
9  790  LYS n 
9  791  ILE n 
9  792  LEU n 
9  793  ASP n 
9  794  ALA n 
9  795  VAL n 
9  796  VAL n 
9  797  ALA n 
9  798  GLN n 
9  799  GLU n 
9  800  PRO n 
9  801  LEU n 
9  802  HIS n 
9  803  ARG n 
9  804  GLY n 
9  805  GLY n 
9  806  GLY n 
9  807  GLN n 
9  808  ILE n 
9  809  ILE n 
9  810  PRO n 
9  811  THR n 
9  812  ALA n 
9  813  ARG n 
9  814  ARG n 
9  815  VAL n 
9  816  VAL n 
9  817  TYR n 
9  818  SER n 
9  819  ALA n 
9  820  PHE n 
9  821  LEU n 
9  822  MET n 
9  823  ALA n 
9  824  THR n 
9  825  PRO n 
9  826  ARG n 
9  827  LEU n 
9  828  MET n 
9  829  GLU n 
9  830  PRO n 
9  831  TYR n 
9  832  TYR n 
9  833  PHE n 
9  834  VAL n 
9  835  GLU n 
9  836  VAL n 
9  837  GLN n 
9  838  ALA n 
9  839  PRO n 
9  840  ALA n 
9  841  ASP n 
9  842  CYS n 
9  843  VAL n 
9  844  SER n 
9  845  ALA n 
9  846  VAL n 
9  847  TYR n 
9  848  THR n 
9  849  VAL n 
9  850  LEU n 
9  851  ALA n 
9  852  ARG n 
9  853  ARG n 
9  854  ARG n 
9  855  GLY n 
9  856  HIS n 
9  857  VAL n 
9  858  THR n 
9  859  GLN n 
9  860  ASP n 
9  861  ALA n 
9  862  PRO n 
9  863  ILE n 
9  864  PRO n 
9  865  GLY n 
9  866  SER n 
9  867  PRO n 
9  868  LEU n 
9  869  TYR n 
9  870  THR n 
9  871  ILE n 
9  872  LYS n 
9  873  ALA n 
9  874  PHE n 
9  875  ILE n 
9  876  PRO n 
9  877  ALA n 
9  878  ILE n 
9  879  ASP n 
9  880  SER n 
9  881  PHE n 
9  882  GLY n 
9  883  PHE n 
9  884  GLU n 
9  885  THR n 
9  886  ASP n 
9  887  LEU n 
9  888  ARG n 
9  889  THR n 
9  890  HIS n 
9  891  THR n 
9  892  GLN n 
9  893  GLY n 
9  894  GLN n 
9  895  ALA n 
9  896  PHE n 
9  897  SER n 
9  898  LEU n 
9  899  SER n 
9  900  VAL n 
9  901  PHE n 
9  902  HIS n 
9  903  HIS n 
9  904  TRP n 
9  905  GLN n 
9  906  ILE n 
9  907  VAL n 
9  908  PRO n 
9  909  GLY n 
9  910  ASP n 
9  911  PRO n 
9  912  LEU n 
9  913  ASP n 
9  914  LYS n 
9  915  SER n 
9  916  ILE n 
9  917  VAL n 
9  918  ILE n 
9  919  ARG n 
9  920  PRO n 
9  921  LEU n 
9  922  GLU n 
9  923  PRO n 
9  924  GLN n 
9  925  PRO n 
9  926  ALA n 
9  927  PRO n 
9  928  HIS n 
9  929  LEU n 
9  930  ALA n 
9  931  ARG n 
9  932  GLU n 
9  933  PHE n 
9  934  MET n 
9  935  ILE n 
9  936  LYS n 
9  937  THR n 
9  938  ARG n 
9  939  ARG n 
9  940  ARG n 
9  941  LYS n 
9  942  GLY n 
9  943  LEU n 
9  944  SER n 
9  945  GLU n 
9  946  ASP n 
9  947  VAL n 
9  948  SER n 
9  949  ILE n 
9  950  SER n 
9  951  LYS n 
9  952  PHE n 
9  953  PHE n 
9  954  ASP n 
9  955  ASP n 
9  956  PRO n 
9  957  MET n 
9  958  LEU n 
9  959  LEU n 
9  960  GLU n 
9  961  LEU n 
9  962  ALA n 
9  963  LYS n 
9  964  GLN n 
9  965  ASP n 
9  966  VAL n 
9  967  VAL n 
9  968  LEU n 
9  969  ASN n 
9  970  TYR n 
9  971  PRO n 
9  972  MET n 
10 1    MET n 
10 2    ALA n 
10 3    LEU n 
10 4    THR n 
10 5    SER n 
10 6    PHE n 
10 7    LEU n 
10 8    PRO n 
10 9    ALA n 
10 10   PRO n 
10 11   THR n 
10 12   GLN n 
10 13   LEU n 
10 14   SER n 
10 15   GLN n 
10 16   ASP n 
10 17   GLN n 
10 18   LEU n 
10 19   GLU n 
10 20   ALA n 
10 21   GLU n 
10 22   GLU n 
10 23   LYS n 
10 24   ALA n 
10 25   ARG n 
10 26   SER n 
10 27   GLN n 
10 28   ARG n 
10 29   SER n 
10 30   ARG n 
10 31   GLN n 
10 32   THR n 
10 33   SER n 
10 34   LEU n 
10 35   VAL n 
10 36   SER n 
10 37   SER n 
10 38   ARG n 
10 39   ARG n 
10 40   GLU n 
10 41   PRO n 
10 42   PRO n 
10 43   PRO n 
10 44   TYR n 
10 45   GLY n 
10 46   TYR n 
10 47   ARG n 
10 48   LYS n 
10 49   GLY n 
10 50   TRP n 
10 51   ILE n 
10 52   PRO n 
10 53   ARG n 
10 54   LEU n 
10 55   LEU n 
10 56   GLU n 
10 57   ASP n 
10 58   PHE n 
10 59   GLY n 
10 60   ASP n 
10 61   GLY n 
10 62   GLY n 
10 63   ALA n 
10 64   PHE n 
10 65   PRO n 
10 66   GLU n 
10 67   ILE n 
10 68   HIS n 
10 69   VAL n 
10 70   ALA n 
10 71   GLN n 
10 72   TYR n 
10 73   PRO n 
10 74   LEU n 
10 75   ASP n 
10 76   MET n 
10 77   GLY n 
10 78   ARG n 
10 79   LYS n 
10 80   LYS n 
10 81   LYS n 
10 82   MET n 
10 83   SER n 
10 84   ASN n 
10 85   ALA n 
10 86   LEU n 
10 87   ALA n 
10 88   ILE n 
10 89   GLN n 
10 90   VAL n 
10 91   ASP n 
10 92   SER n 
10 93   GLU n 
10 94   GLY n 
10 95   LYS n 
10 96   ILE n 
10 97   LYS n 
10 98   TYR n 
10 99   ASP n 
10 100  ALA n 
10 101  ILE n 
10 102  ALA n 
10 103  ARG n 
10 104  GLN n 
10 105  GLY n 
10 106  GLN n 
10 107  SER n 
10 108  LYS n 
10 109  ASP n 
10 110  LYS n 
10 111  VAL n 
10 112  ILE n 
10 113  TYR n 
10 114  SER n 
10 115  LYS n 
10 116  TYR n 
10 117  THR n 
10 118  ASP n 
10 119  LEU n 
10 120  VAL n 
10 121  PRO n 
10 122  LYS n 
10 123  GLU n 
10 124  VAL n 
10 125  MET n 
10 126  ASN n 
10 127  ALA n 
10 128  ASP n 
10 129  ASP n 
10 130  PRO n 
10 131  ASP n 
10 132  LEU n 
10 133  GLN n 
10 134  ARG n 
10 135  PRO n 
10 136  ASP n 
10 137  GLU n 
10 138  GLU n 
10 139  ALA n 
10 140  ILE n 
10 141  LYS n 
10 142  GLU n 
10 143  ILE n 
10 144  THR n 
10 145  GLU n 
10 146  LYS n 
10 147  THR n 
10 148  ARG n 
10 149  VAL n 
10 150  ALA n 
10 151  LEU n 
10 152  GLU n 
10 153  LYS n 
10 154  SER n 
10 155  VAL n 
10 156  SER n 
10 157  GLN n 
10 158  LYS n 
10 159  VAL n 
10 160  ALA n 
10 161  ALA n 
10 162  ALA n 
10 163  MET n 
10 164  PRO n 
10 165  VAL n 
10 166  ARG n 
10 167  ALA n 
10 168  ALA n 
10 169  ASP n 
10 170  LYS n 
10 171  LEU n 
10 172  ALA n 
10 173  PRO n 
10 174  ALA n 
10 175  GLN n 
10 176  TYR n 
10 177  ILE n 
10 178  ARG n 
10 179  TYR n 
10 180  THR n 
10 181  PRO n 
10 182  SER n 
10 183  GLN n 
10 184  GLN n 
10 185  GLY n 
10 186  VAL n 
10 187  ALA n 
10 188  PHE n 
10 189  ASN n 
10 190  SER n 
10 191  GLY n 
10 192  ALA n 
10 193  LYS n 
10 194  GLN n 
10 195  ARG n 
10 196  VAL n 
10 197  ILE n 
10 198  ARG n 
10 199  MET n 
10 200  VAL n 
10 201  GLU n 
10 202  MET n 
10 203  GLN n 
10 204  LYS n 
10 205  ASP n 
10 206  PRO n 
10 207  MET n 
10 208  GLU n 
10 209  PRO n 
10 210  PRO n 
10 211  ARG n 
10 212  PHE n 
10 213  LYS n 
10 214  ILE n 
10 215  ASN n 
10 216  LYS n 
10 217  LYS n 
10 218  ILE n 
10 219  PRO n 
10 220  ARG n 
10 221  GLY n 
10 222  PRO n 
10 223  PRO n 
10 224  SER n 
10 225  PRO n 
10 226  PRO n 
10 227  ALA n 
10 228  PRO n 
10 229  VAL n 
10 230  MET n 
10 231  HIS n 
10 232  SER n 
10 233  PRO n 
10 234  SER n 
10 235  ARG n 
10 236  LYS n 
10 237  MET n 
10 238  THR n 
10 239  VAL n 
10 240  LYS n 
10 241  GLU n 
10 242  GLN n 
10 243  GLN n 
10 244  GLU n 
10 245  TRP n 
10 246  LYS n 
10 247  ILE n 
10 248  PRO n 
10 249  PRO n 
10 250  CYS n 
10 251  ILE n 
10 252  SER n 
10 253  ASN n 
10 254  TRP n 
10 255  LYS n 
10 256  ASN n 
10 257  ALA n 
10 258  LYS n 
10 259  GLY n 
10 260  TYR n 
10 261  THR n 
10 262  ILE n 
10 263  PRO n 
10 264  LEU n 
10 265  ASP n 
10 266  LYS n 
10 267  ARG n 
10 268  LEU n 
10 269  ALA n 
10 270  ALA n 
10 271  ASP n 
10 272  GLY n 
10 273  ARG n 
10 274  GLY n 
10 275  LEU n 
10 276  GLN n 
10 277  THR n 
10 278  VAL n 
10 279  HIS n 
10 280  ILE n 
10 281  ASN n 
10 282  GLU n 
10 283  ASN n 
10 284  PHE n 
10 285  ALA n 
10 286  LYS n 
10 287  LEU n 
10 288  ALA n 
10 289  GLU n 
10 290  ALA n 
10 291  LEU n 
10 292  TYR n 
10 293  ILE n 
10 294  ALA n 
10 295  ASP n 
10 296  ARG n 
10 297  LYS n 
10 298  ALA n 
10 299  ARG n 
10 300  GLU n 
10 301  ALA n 
10 302  VAL n 
10 303  GLU n 
10 304  MET n 
10 305  ARG n 
10 306  ALA n 
10 307  GLN n 
10 308  VAL n 
10 309  GLU n 
10 310  ARG n 
10 311  LYS n 
10 312  MET n 
10 313  ALA n 
10 314  GLN n 
10 315  LYS n 
10 316  GLU n 
10 317  LYS n 
10 318  GLU n 
10 319  LYS n 
10 320  HIS n 
10 321  GLU n 
10 322  GLU n 
10 323  LYS n 
10 324  LEU n 
10 325  ARG n 
10 326  GLU n 
10 327  MET n 
10 328  ALA n 
10 329  GLN n 
10 330  LYS n 
10 331  ALA n 
10 332  ARG n 
10 333  GLU n 
10 334  ARG n 
10 335  ARG n 
10 336  ALA n 
10 337  GLY n 
10 338  ILE n 
10 339  LYS n 
10 340  THR n 
10 341  HIS n 
10 342  VAL n 
10 343  GLU n 
10 344  LYS n 
10 345  GLU n 
10 346  ASP n 
10 347  GLY n 
10 348  GLU n 
10 349  ALA n 
10 350  ARG n 
10 351  GLU n 
10 352  ARG n 
10 353  ASP n 
10 354  GLU n 
10 355  ILE n 
10 356  ARG n 
10 357  HIS n 
10 358  ASP n 
10 359  ARG n 
10 360  ARG n 
10 361  LYS n 
10 362  GLU n 
10 363  ARG n 
10 364  GLN n 
10 365  HIS n 
10 366  ASP n 
10 367  ARG n 
10 368  ASN n 
10 369  LEU n 
10 370  SER n 
10 371  ARG n 
10 372  ALA n 
10 373  ALA n 
10 374  PRO n 
10 375  ASP n 
10 376  LYS n 
10 377  ARG n 
10 378  SER n 
10 379  LYS n 
10 380  LEU n 
10 381  GLN n 
10 382  ARG n 
10 383  ASN n 
10 384  GLU n 
10 385  ASN n 
10 386  ARG n 
10 387  ASP n 
10 388  ILE n 
10 389  SER n 
10 390  GLU n 
10 391  VAL n 
10 392  ILE n 
10 393  ALA n 
10 394  LEU n 
10 395  GLY n 
10 396  VAL n 
10 397  PRO n 
10 398  ASN n 
10 399  PRO n 
10 400  ARG n 
10 401  THR n 
10 402  SER n 
10 403  ASN n 
10 404  GLU n 
10 405  VAL n 
10 406  GLN n 
10 407  TYR n 
10 408  ASP n 
10 409  GLN n 
10 410  ARG n 
10 411  LEU n 
10 412  PHE n 
10 413  ASN n 
10 414  GLN n 
10 415  SER n 
10 416  LYS n 
10 417  GLY n 
10 418  MET n 
10 419  ASP n 
10 420  SER n 
10 421  GLY n 
10 422  PHE n 
10 423  ALA n 
10 424  GLY n 
10 425  GLY n 
10 426  GLU n 
10 427  ASP n 
10 428  GLU n 
10 429  ILE n 
10 430  TYR n 
10 431  ASN n 
10 432  VAL n 
10 433  TYR n 
10 434  ASP n 
10 435  GLN n 
10 436  ALA n 
10 437  TRP n 
10 438  ARG n 
10 439  GLY n 
10 440  GLY n 
10 441  LYS n 
10 442  ASP n 
10 443  MET n 
10 444  ALA n 
10 445  GLN n 
10 446  SER n 
10 447  ILE n 
10 448  TYR n 
10 449  ARG n 
10 450  PRO n 
10 451  SER n 
10 452  LYS n 
10 453  ASN n 
10 454  LEU n 
10 455  ASP n 
10 456  LYS n 
10 457  ASP n 
10 458  MET n 
10 459  TYR n 
10 460  GLY n 
10 461  ASP n 
10 462  ASP n 
10 463  LEU n 
10 464  GLU n 
10 465  ALA n 
10 466  ARG n 
10 467  ILE n 
10 468  LYS n 
10 469  THR n 
10 470  ASN n 
10 471  ARG n 
10 472  PHE n 
10 473  VAL n 
10 474  PRO n 
10 475  ASP n 
10 476  LYS n 
10 477  GLU n 
10 478  PHE n 
10 479  SER n 
10 480  GLY n 
10 481  SER n 
10 482  ASP n 
10 483  ARG n 
10 484  ARG n 
10 485  GLN n 
10 486  ARG n 
10 487  GLY n 
10 488  ARG n 
10 489  GLU n 
10 490  GLY n 
10 491  PRO n 
10 492  VAL n 
10 493  GLN n 
10 494  PHE n 
10 495  GLU n 
10 496  GLU n 
10 497  ASP n 
10 498  PRO n 
10 499  PHE n 
10 500  GLY n 
10 501  LEU n 
10 502  ASP n 
10 503  LYS n 
10 504  PHE n 
10 505  LEU n 
10 506  GLU n 
10 507  GLU n 
10 508  ALA n 
10 509  LYS n 
10 510  GLN n 
10 511  HIS n 
10 512  GLY n 
10 513  GLY n 
10 514  SER n 
10 515  LYS n 
10 516  ARG n 
10 517  PRO n 
10 518  SER n 
10 519  ASP n 
10 520  SER n 
10 521  SER n 
10 522  ARG n 
10 523  PRO n 
10 524  LYS n 
10 525  GLU n 
10 526  HIS n 
10 527  GLU n 
10 528  HIS n 
10 529  GLU n 
10 530  GLY n 
10 531  LYS n 
10 532  LYS n 
10 533  ARG n 
10 534  ARG n 
10 535  LYS n 
10 536  GLU n 
11 1    MET n 
11 2    VAL n 
11 3    GLU n 
11 4    GLU n 
11 5    VAL n 
11 6    GLN n 
11 7    LYS n 
11 8    HIS n 
11 9    SER n 
11 10   VAL n 
11 11   HIS n 
11 12   THR n 
11 13   LEU n 
11 14   VAL n 
11 15   PHE n 
11 16   ARG n 
11 17   SER n 
11 18   LEU n 
11 19   LYS n 
11 20   ARG n 
11 21   THR n 
11 22   HIS n 
11 23   ASP n 
11 24   MET n 
11 25   PHE n 
11 26   VAL n 
11 27   ALA n 
11 28   ASP n 
11 29   ASN n 
11 30   GLY n 
11 31   LYS n 
11 32   PRO n 
11 33   VAL n 
11 34   PRO n 
11 35   LEU n 
11 36   ASP n 
11 37   GLU n 
11 38   GLU n 
11 39   SER n 
11 40   HIS n 
11 41   LYS n 
11 42   ARG n 
11 43   LYS n 
11 44   MET n 
11 45   ALA n 
11 46   ILE n 
11 47   LYS n 
11 48   LEU n 
11 49   ARG n 
11 50   ASN n 
11 51   GLU n 
11 52   TYR n 
11 53   GLY n 
11 54   PRO n 
11 55   VAL n 
11 56   LEU n 
11 57   HIS n 
11 58   MET n 
11 59   PRO n 
11 60   THR n 
11 61   SER n 
11 62   LYS n 
11 63   GLU n 
11 64   ASN n 
11 65   LEU n 
11 66   LYS n 
11 67   GLU n 
11 68   LYS n 
11 69   GLY n 
11 70   PRO n 
11 71   GLN n 
11 72   ASN n 
11 73   ALA n 
11 74   THR n 
11 75   ASP n 
11 76   SER n 
11 77   TYR n 
11 78   VAL n 
11 79   HIS n 
11 80   LYS n 
11 81   GLN n 
11 82   TYR n 
11 83   PRO n 
11 84   ALA n 
11 85   ASN n 
11 86   GLN n 
11 87   GLY n 
11 88   GLN n 
11 89   GLU n 
11 90   VAL n 
11 91   GLU n 
11 92   TYR n 
11 93   PHE n 
11 94   VAL n 
11 95   ALA n 
11 96   GLY n 
11 97   THR n 
11 98   HIS n 
11 99   PRO n 
11 100  TYR n 
11 101  PRO n 
11 102  PRO n 
11 103  GLY n 
11 104  PRO n 
11 105  GLY n 
11 106  VAL n 
11 107  ALA n 
11 108  LEU n 
11 109  THR n 
11 110  ALA n 
11 111  ASP n 
11 112  THR n 
11 113  LYS n 
11 114  ILE n 
11 115  GLN n 
11 116  ARG n 
11 117  MET n 
11 118  PRO n 
11 119  SER n 
11 120  GLU n 
11 121  SER n 
11 122  ALA n 
11 123  ALA n 
11 124  GLN n 
11 125  SER n 
11 126  LEU n 
11 127  ALA n 
11 128  VAL n 
11 129  ALA n 
11 130  LEU n 
11 131  PRO n 
11 132  LEU n 
11 133  GLN n 
11 134  THR n 
11 135  LYS n 
11 136  ALA n 
11 137  ASP n 
11 138  ALA n 
11 139  ASN n 
11 140  ARG n 
11 141  THR n 
11 142  ALA n 
11 143  PRO n 
11 144  SER n 
11 145  GLY n 
11 146  SER n 
11 147  GLU n 
11 148  TYR n 
11 149  ARG n 
11 150  HIS n 
11 151  PRO n 
11 152  GLY n 
11 153  ALA n 
11 154  SER n 
11 155  ASP n 
11 156  ARG n 
11 157  PRO n 
11 158  GLN n 
11 159  PRO n 
11 160  THR n 
11 161  ALA n 
11 162  MET n 
11 163  ASN n 
11 164  SER n 
11 165  ILE n 
11 166  VAL n 
11 167  MET n 
11 168  GLU n 
11 169  THR n 
11 170  GLY n 
11 171  ASN n 
11 172  THR n 
11 173  LYS n 
11 174  ASN n 
11 175  SER n 
11 176  ALA n 
11 177  LEU n 
11 178  MET n 
11 179  ALA n 
11 180  LYS n 
11 181  LYS n 
11 182  ALA n 
11 183  PRO n 
11 184  THR n 
11 185  MET n 
11 186  PRO n 
11 187  LYS n 
11 188  PRO n 
11 189  GLN n 
11 190  TRP n 
11 191  HIS n 
11 192  PRO n 
11 193  PRO n 
11 194  TRP n 
11 195  LYS n 
11 196  LEU n 
11 197  TYR n 
11 198  ARG n 
11 199  VAL n 
11 200  ILE n 
11 201  SER n 
11 202  GLY n 
11 203  HIS n 
11 204  LEU n 
11 205  GLY n 
11 206  TRP n 
11 207  VAL n 
11 208  ARG n 
11 209  CYS n 
11 210  ILE n 
11 211  ALA n 
11 212  VAL n 
11 213  GLU n 
11 214  PRO n 
11 215  GLY n 
11 216  ASN n 
11 217  GLN n 
11 218  TRP n 
11 219  PHE n 
11 220  VAL n 
11 221  THR n 
11 222  GLY n 
11 223  SER n 
11 224  ALA n 
11 225  ASP n 
11 226  ARG n 
11 227  THR n 
11 228  ILE n 
11 229  LYS n 
11 230  ILE n 
11 231  TRP n 
11 232  ASP n 
11 233  LEU n 
11 234  ALA n 
11 235  SER n 
11 236  GLY n 
11 237  LYS n 
11 238  LEU n 
11 239  LYS n 
11 240  LEU n 
11 241  SER n 
11 242  LEU n 
11 243  THR n 
11 244  GLY n 
11 245  HIS n 
11 246  ILE n 
11 247  SER n 
11 248  THR n 
11 249  VAL n 
11 250  ARG n 
11 251  GLY n 
11 252  VAL n 
11 253  ILE n 
11 254  VAL n 
11 255  SER n 
11 256  THR n 
11 257  ARG n 
11 258  SER n 
11 259  PRO n 
11 260  TYR n 
11 261  LEU n 
11 262  PHE n 
11 263  SER n 
11 264  CYS n 
11 265  GLY n 
11 266  GLU n 
11 267  ASP n 
11 268  LYS n 
11 269  GLN n 
11 270  VAL n 
11 271  LYS n 
11 272  CYS n 
11 273  TRP n 
11 274  ASP n 
11 275  LEU n 
11 276  GLU n 
11 277  TYR n 
11 278  ASN n 
11 279  LYS n 
11 280  VAL n 
11 281  ILE n 
11 282  ARG n 
11 283  HIS n 
11 284  TYR n 
11 285  HIS n 
11 286  GLY n 
11 287  HIS n 
11 288  LEU n 
11 289  SER n 
11 290  ALA n 
11 291  VAL n 
11 292  TYR n 
11 293  GLY n 
11 294  LEU n 
11 295  ASP n 
11 296  LEU n 
11 297  HIS n 
11 298  PRO n 
11 299  THR n 
11 300  ILE n 
11 301  ASP n 
11 302  VAL n 
11 303  LEU n 
11 304  VAL n 
11 305  THR n 
11 306  CYS n 
11 307  SER n 
11 308  ARG n 
11 309  ASP n 
11 310  SER n 
11 311  THR n 
11 312  ALA n 
11 313  ARG n 
11 314  ILE n 
11 315  TRP n 
11 316  ASP n 
11 317  VAL n 
11 318  ARG n 
11 319  THR n 
11 320  LYS n 
11 321  ALA n 
11 322  SER n 
11 323  VAL n 
11 324  HIS n 
11 325  THR n 
11 326  LEU n 
11 327  SER n 
11 328  GLY n 
11 329  HIS n 
11 330  THR n 
11 331  ASN n 
11 332  ALA n 
11 333  VAL n 
11 334  ALA n 
11 335  THR n 
11 336  VAL n 
11 337  ARG n 
11 338  CYS n 
11 339  GLN n 
11 340  ALA n 
11 341  ALA n 
11 342  GLU n 
11 343  PRO n 
11 344  GLN n 
11 345  ILE n 
11 346  ILE n 
11 347  THR n 
11 348  GLY n 
11 349  SER n 
11 350  HIS n 
11 351  ASP n 
11 352  THR n 
11 353  THR n 
11 354  ILE n 
11 355  ARG n 
11 356  LEU n 
11 357  TRP n 
11 358  ASP n 
11 359  LEU n 
11 360  VAL n 
11 361  ALA n 
11 362  GLY n 
11 363  LYS n 
11 364  THR n 
11 365  ARG n 
11 366  VAL n 
11 367  THR n 
11 368  LEU n 
11 369  THR n 
11 370  ASN n 
11 371  HIS n 
11 372  LYS n 
11 373  LYS n 
11 374  SER n 
11 375  VAL n 
11 376  ARG n 
11 377  ALA n 
11 378  VAL n 
11 379  VAL n 
11 380  LEU n 
11 381  HIS n 
11 382  PRO n 
11 383  ARG n 
11 384  HIS n 
11 385  TYR n 
11 386  THR n 
11 387  PHE n 
11 388  ALA n 
11 389  SER n 
11 390  GLY n 
11 391  SER n 
11 392  PRO n 
11 393  ASP n 
11 394  ASN n 
11 395  ILE n 
11 396  LYS n 
11 397  GLN n 
11 398  TRP n 
11 399  LYS n 
11 400  PHE n 
11 401  PRO n 
11 402  ASP n 
11 403  GLY n 
11 404  SER n 
11 405  PHE n 
11 406  ILE n 
11 407  GLN n 
11 408  ASN n 
11 409  LEU n 
11 410  SER n 
11 411  GLY n 
11 412  HIS n 
11 413  ASN n 
11 414  ALA n 
11 415  ILE n 
11 416  ILE n 
11 417  ASN n 
11 418  THR n 
11 419  LEU n 
11 420  THR n 
11 421  VAL n 
11 422  ASN n 
11 423  SER n 
11 424  ASP n 
11 425  GLY n 
11 426  VAL n 
11 427  LEU n 
11 428  VAL n 
11 429  SER n 
11 430  GLY n 
11 431  ALA n 
11 432  ASP n 
11 433  ASN n 
11 434  GLY n 
11 435  THR n 
11 436  MET n 
11 437  HIS n 
11 438  LEU n 
11 439  TRP n 
11 440  ASP n 
11 441  TRP n 
11 442  ARG n 
11 443  THR n 
11 444  GLY n 
11 445  TYR n 
11 446  ASN n 
11 447  PHE n 
11 448  GLN n 
11 449  ARG n 
11 450  VAL n 
11 451  HIS n 
11 452  ALA n 
11 453  ALA n 
11 454  VAL n 
11 455  GLN n 
11 456  PRO n 
11 457  GLY n 
11 458  SER n 
11 459  LEU n 
11 460  ASP n 
11 461  SER n 
11 462  GLU n 
11 463  SER n 
11 464  GLY n 
11 465  ILE n 
11 466  PHE n 
11 467  ALA n 
11 468  CYS n 
11 469  ALA n 
11 470  PHE n 
11 471  ASP n 
11 472  GLN n 
11 473  SER n 
11 474  GLU n 
11 475  SER n 
11 476  ARG n 
11 477  LEU n 
11 478  LEU n 
11 479  THR n 
11 480  ALA n 
11 481  GLU n 
11 482  ALA n 
11 483  ASP n 
11 484  LYS n 
11 485  THR n 
11 486  ILE n 
11 487  LYS n 
11 488  VAL n 
11 489  TYR n 
11 490  ARG n 
11 491  GLU n 
11 492  ASP n 
11 493  ASP n 
11 494  THR n 
11 495  ALA n 
11 496  THR n 
11 497  GLU n 
11 498  GLU n 
11 499  THR n 
11 500  HIS n 
11 501  PRO n 
11 502  VAL n 
11 503  SER n 
11 504  TRP n 
11 505  LYS n 
11 506  PRO n 
11 507  GLU n 
11 508  ILE n 
11 509  ILE n 
11 510  LYS n 
11 511  ARG n 
11 512  LYS n 
11 513  ARG n 
11 514  PHE n 
12 1    MET n 
12 2    SER n 
12 3    ALA n 
12 4    ALA n 
12 5    ILE n 
12 6    ALA n 
12 7    ALA n 
12 8    LEU n 
12 9    ALA n 
12 10   ALA n 
12 11   SER n 
12 12   TYR n 
12 13   GLY n 
12 14   SER n 
12 15   GLY n 
12 16   SER n 
12 17   GLY n 
12 18   SER n 
12 19   GLU n 
12 20   SER n 
12 21   ASP n 
12 22   SER n 
12 23   ASP n 
12 24   SER n 
12 25   GLU n 
12 26   SER n 
12 27   SER n 
12 28   ARG n 
12 29   CYS n 
12 30   PRO n 
12 31   LEU n 
12 32   PRO n 
12 33   ALA n 
12 34   ALA n 
12 35   ASP n 
12 36   SER n 
12 37   LEU n 
12 38   MET n 
12 39   HIS n 
12 40   LEU n 
12 41   THR n 
12 42   LYS n 
12 43   SER n 
12 44   PRO n 
12 45   SER n 
12 46   SER n 
12 47   LYS n 
12 48   PRO n 
12 49   SER n 
12 50   LEU n 
12 51   ALA n 
12 52   VAL n 
12 53   ALA n 
12 54   VAL n 
12 55   ASP n 
12 56   SER n 
12 57   ALA n 
12 58   PRO n 
12 59   GLU n 
12 60   VAL n 
12 61   ALA n 
12 62   VAL n 
12 63   LYS n 
12 64   GLU n 
12 65   ASP n 
12 66   LEU n 
12 67   GLU n 
12 68   THR n 
12 69   GLY n 
12 70   VAL n 
12 71   HIS n 
12 72   LEU n 
12 73   ASP n 
12 74   PRO n 
12 75   ALA n 
12 76   VAL n 
12 77   LYS n 
12 78   GLU n 
12 79   VAL n 
12 80   GLN n 
12 81   TYR n 
12 82   ASN n 
12 83   PRO n 
12 84   THR n 
12 85   TYR n 
12 86   GLU n 
12 87   THR n 
12 88   MET n 
12 89   PHE n 
12 90   ALA n 
12 91   PRO n 
12 92   GLU n 
12 93   PHE n 
12 94   GLY n 
12 95   PRO n 
12 96   GLU n 
12 97   ASN n 
12 98   PRO n 
12 99   PHE n 
12 100  ARG n 
12 101  THR n 
12 102  GLN n 
12 103  GLN n 
12 104  MET n 
12 105  ALA n 
12 106  ALA n 
12 107  PRO n 
12 108  ARG n 
12 109  ASN n 
12 110  MET n 
12 111  LEU n 
12 112  SER n 
12 113  GLY n 
12 114  TYR n 
12 115  ALA n 
12 116  GLU n 
12 117  PRO n 
12 118  ALA n 
12 119  HIS n 
12 120  ILE n 
12 121  ASN n 
12 122  ASP n 
12 123  PHE n 
12 124  MET n 
12 125  PHE n 
12 126  GLU n 
12 127  GLN n 
12 128  GLN n 
12 129  ARG n 
12 130  ARG n 
12 131  THR n 
12 132  PHE n 
12 133  ALA n 
12 134  THR n 
12 135  TYR n 
12 136  GLY n 
12 137  TYR n 
12 138  ALA n 
12 139  LEU n 
12 140  ASP n 
12 141  PRO n 
12 142  SER n 
12 143  LEU n 
12 144  ASP n 
12 145  ASN n 
12 146  HIS n 
12 147  GLN n 
12 148  VAL n 
12 149  SER n 
12 150  ALA n 
12 151  LYS n 
12 152  TYR n 
12 153  ILE n 
12 154  GLY n 
12 155  SER n 
12 156  VAL n 
12 157  GLU n 
12 158  GLU n 
12 159  ALA n 
12 160  GLU n 
12 161  LYS n 
12 162  ASN n 
12 163  GLN n 
12 164  GLY n 
12 165  LEU n 
12 166  THR n 
12 167  VAL n 
12 168  PHE n 
12 169  GLU n 
12 170  THR n 
12 171  GLY n 
12 172  GLN n 
12 173  LYS n 
12 174  LYS n 
12 175  THR n 
12 176  GLU n 
12 177  LYS n 
12 178  ARG n 
12 179  LYS n 
12 180  LYS n 
12 181  PHE n 
12 182  LYS n 
12 183  GLU n 
12 184  ASN n 
12 185  ASP n 
12 186  ALA n 
12 187  SER n 
12 188  ASN n 
12 189  ILE n 
12 190  ASP n 
12 191  GLY n 
12 192  PHE n 
12 193  LEU n 
12 194  GLY n 
12 195  PRO n 
12 196  TRP n 
12 197  ALA n 
12 198  LYS n 
12 199  TYR n 
12 200  VAL n 
12 201  ASP n 
12 202  GLU n 
12 203  LYS n 
12 204  ASP n 
12 205  VAL n 
12 206  ALA n 
12 207  LYS n 
12 208  PRO n 
12 209  SER n 
12 210  GLU n 
12 211  GLU n 
12 212  GLU n 
12 213  GLN n 
12 214  LYS n 
12 215  GLU n 
12 216  LEU n 
12 217  ASP n 
12 218  GLU n 
12 219  ILE n 
12 220  THR n 
12 221  ALA n 
12 222  LYS n 
12 223  ARG n 
12 224  GLN n 
12 225  LYS n 
12 226  LYS n 
12 227  GLY n 
12 228  LYS n 
12 229  GLN n 
12 230  GLU n 
12 231  GLU n 
12 232  GLU n 
12 233  LYS n 
12 234  PRO n 
12 235  GLY n 
12 236  GLU n 
12 237  GLU n 
12 238  LYS n 
12 239  THR n 
12 240  ILE n 
12 241  LEU n 
12 242  HIS n 
12 243  VAL n 
12 244  LYS n 
12 245  GLU n 
12 246  MET n 
12 247  TYR n 
12 248  ASP n 
12 249  TYR n 
12 250  GLN n 
12 251  GLY n 
12 252  ARG n 
12 253  SER n 
12 254  TYR n 
12 255  LEU n 
12 256  HIS n 
12 257  ILE n 
12 258  PRO n 
12 259  GLN n 
12 260  ASP n 
12 261  VAL n 
12 262  GLY n 
12 263  VAL n 
12 264  ASN n 
12 265  LEU n 
12 266  ARG n 
12 267  SER n 
12 268  THR n 
12 269  MET n 
12 270  PRO n 
12 271  PRO n 
12 272  GLU n 
12 273  LYS n 
12 274  CYS n 
12 275  TYR n 
12 276  LEU n 
12 277  PRO n 
12 278  LYS n 
12 279  LYS n 
12 280  GLN n 
12 281  ILE n 
12 282  HIS n 
12 283  VAL n 
12 284  TRP n 
12 285  SER n 
12 286  GLY n 
12 287  HIS n 
12 288  THR n 
12 289  LYS n 
12 290  GLY n 
12 291  VAL n 
12 292  SER n 
12 293  ALA n 
12 294  VAL n 
12 295  ARG n 
12 296  LEU n 
12 297  PHE n 
12 298  PRO n 
12 299  LEU n 
12 300  SER n 
12 301  GLY n 
12 302  HIS n 
12 303  LEU n 
12 304  LEU n 
12 305  LEU n 
12 306  SER n 
12 307  CYS n 
12 308  SER n 
12 309  MET n 
12 310  ASP n 
12 311  CYS n 
12 312  LYS n 
12 313  ILE n 
12 314  LYS n 
12 315  LEU n 
12 316  TRP n 
12 317  GLU n 
12 318  VAL n 
12 319  TYR n 
12 320  GLY n 
12 321  GLU n 
12 322  ARG n 
12 323  ARG n 
12 324  CYS n 
12 325  LEU n 
12 326  ARG n 
12 327  THR n 
12 328  PHE n 
12 329  ILE n 
12 330  GLY n 
12 331  HIS n 
12 332  SER n 
12 333  LYS n 
12 334  ALA n 
12 335  VAL n 
12 336  ARG n 
12 337  ASP n 
12 338  ILE n 
12 339  CYS n 
12 340  PHE n 
12 341  ASN n 
12 342  THR n 
12 343  ALA n 
12 344  GLY n 
12 345  THR n 
12 346  GLN n 
12 347  PHE n 
12 348  LEU n 
12 349  SER n 
12 350  ALA n 
12 351  ALA n 
12 352  TYR n 
12 353  ASP n 
12 354  ARG n 
12 355  TYR n 
12 356  LEU n 
12 357  LYS n 
12 358  LEU n 
12 359  TRP n 
12 360  ASP n 
12 361  THR n 
12 362  GLU n 
12 363  THR n 
12 364  GLY n 
12 365  GLN n 
12 366  CYS n 
12 367  ILE n 
12 368  SER n 
12 369  ARG n 
12 370  PHE n 
12 371  THR n 
12 372  ASN n 
12 373  ARG n 
12 374  LYS n 
12 375  VAL n 
12 376  PRO n 
12 377  TYR n 
12 378  CYS n 
12 379  VAL n 
12 380  LYS n 
12 381  PHE n 
12 382  ASN n 
12 383  PRO n 
12 384  ASP n 
12 385  GLU n 
12 386  ASP n 
12 387  LYS n 
12 388  GLN n 
12 389  ASN n 
12 390  LEU n 
12 391  PHE n 
12 392  VAL n 
12 393  ALA n 
12 394  GLY n 
12 395  MET n 
12 396  SER n 
12 397  ASP n 
12 398  LYS n 
12 399  LYS n 
12 400  ILE n 
12 401  VAL n 
12 402  GLN n 
12 403  TRP n 
12 404  ASP n 
12 405  ILE n 
12 406  ARG n 
12 407  SER n 
12 408  GLY n 
12 409  GLU n 
12 410  ILE n 
12 411  VAL n 
12 412  GLN n 
12 413  GLU n 
12 414  TYR n 
12 415  ASP n 
12 416  ARG n 
12 417  HIS n 
12 418  LEU n 
12 419  GLY n 
12 420  ALA n 
12 421  VAL n 
12 422  ASN n 
12 423  THR n 
12 424  ILE n 
12 425  VAL n 
12 426  PHE n 
12 427  VAL n 
12 428  ASP n 
12 429  GLU n 
12 430  ASN n 
12 431  ARG n 
12 432  ARG n 
12 433  PHE n 
12 434  VAL n 
12 435  SER n 
12 436  THR n 
12 437  SER n 
12 438  ASP n 
12 439  ASP n 
12 440  LYS n 
12 441  SER n 
12 442  LEU n 
12 443  ARG n 
12 444  VAL n 
12 445  TRP n 
12 446  GLU n 
12 447  TRP n 
12 448  ASP n 
12 449  ILE n 
12 450  PRO n 
12 451  VAL n 
12 452  ASP n 
12 453  PHE n 
12 454  LYS n 
12 455  TYR n 
12 456  ILE n 
12 457  ALA n 
12 458  GLU n 
12 459  PRO n 
12 460  SER n 
12 461  MET n 
12 462  HIS n 
12 463  SER n 
12 464  MET n 
12 465  PRO n 
12 466  ALA n 
12 467  VAL n 
12 468  THR n 
12 469  LEU n 
12 470  SER n 
12 471  PRO n 
12 472  ASN n 
12 473  GLY n 
12 474  LYS n 
12 475  TRP n 
12 476  LEU n 
12 477  ALA n 
12 478  CYS n 
12 479  GLN n 
12 480  SER n 
12 481  MET n 
12 482  ASP n 
12 483  ASN n 
12 484  GLN n 
12 485  ILE n 
12 486  LEU n 
12 487  ILE n 
12 488  PHE n 
12 489  GLY n 
12 490  ALA n 
12 491  GLN n 
12 492  ASN n 
12 493  ARG n 
12 494  PHE n 
12 495  ARG n 
12 496  LEU n 
12 497  ASN n 
12 498  LYS n 
12 499  LYS n 
12 500  LYS n 
12 501  ILE n 
12 502  PHE n 
12 503  LYS n 
12 504  GLY n 
12 505  HIS n 
12 506  MET n 
12 507  VAL n 
12 508  ALA n 
12 509  GLY n 
12 510  TYR n 
12 511  ALA n 
12 512  CYS n 
12 513  GLN n 
12 514  VAL n 
12 515  ASP n 
12 516  PHE n 
12 517  SER n 
12 518  PRO n 
12 519  ASP n 
12 520  MET n 
12 521  SER n 
12 522  TYR n 
12 523  VAL n 
12 524  ILE n 
12 525  SER n 
12 526  GLY n 
12 527  ASP n 
12 528  GLY n 
12 529  ASN n 
12 530  GLY n 
12 531  LYS n 
12 532  LEU n 
12 533  ASN n 
12 534  ILE n 
12 535  TRP n 
12 536  ASP n 
12 537  TRP n 
12 538  LYS n 
12 539  THR n 
12 540  THR n 
12 541  LYS n 
12 542  LEU n 
12 543  TYR n 
12 544  SER n 
12 545  ARG n 
12 546  PHE n 
12 547  LYS n 
12 548  ALA n 
12 549  HIS n 
12 550  ASP n 
12 551  LYS n 
12 552  VAL n 
12 553  CYS n 
12 554  ILE n 
12 555  GLY n 
12 556  ALA n 
12 557  VAL n 
12 558  TRP n 
12 559  HIS n 
12 560  PRO n 
12 561  HIS n 
12 562  GLU n 
12 563  THR n 
12 564  SER n 
12 565  LYS n 
12 566  VAL n 
12 567  ILE n 
12 568  THR n 
12 569  CYS n 
12 570  GLY n 
12 571  TRP n 
12 572  ASP n 
12 573  GLY n 
12 574  LEU n 
12 575  ILE n 
12 576  LYS n 
12 577  LEU n 
12 578  TRP n 
12 579  ASP n 
13 1    MET n 
13 2    PRO n 
13 3    ARG n 
13 4    ILE n 
13 5    MET n 
13 6    ILE n 
13 7    LYS n 
13 8    GLY n 
13 9    GLY n 
13 10   VAL n 
13 11   TRP n 
13 12   ARG n 
13 13   ASN n 
13 14   THR n 
13 15   GLU n 
13 16   ASP n 
13 17   GLU n 
13 18   ILE n 
13 19   LEU n 
13 20   LYS n 
13 21   ALA n 
13 22   ALA n 
13 23   VAL n 
13 24   MET n 
13 25   LYS n 
13 26   TYR n 
13 27   GLY n 
13 28   LYS n 
13 29   ASN n 
13 30   GLN n 
13 31   TRP n 
13 32   SER n 
13 33   ARG n 
13 34   ILE n 
13 35   ALA n 
13 36   SER n 
13 37   LEU n 
13 38   LEU n 
13 39   HIS n 
13 40   ARG n 
13 41   LYS n 
13 42   SER n 
13 43   ALA n 
13 44   LYS n 
13 45   GLN n 
13 46   CYS n 
13 47   LYS n 
13 48   ALA n 
13 49   ARG n 
13 50   TRP n 
13 51   TYR n 
13 52   GLU n 
13 53   TRP n 
13 54   LEU n 
13 55   ASP n 
13 56   PRO n 
13 57   SER n 
13 58   ILE n 
13 59   LYS n 
13 60   LYS n 
13 61   THR n 
13 62   GLU n 
13 63   TRP n 
13 64   SER n 
13 65   ARG n 
13 66   GLU n 
13 67   GLU n 
13 68   GLU n 
13 69   GLU n 
13 70   LYS n 
13 71   LEU n 
13 72   LEU n 
13 73   HIS n 
13 74   LEU n 
13 75   ALA n 
13 76   LYS n 
13 77   LEU n 
13 78   MET n 
13 79   PRO n 
13 80   THR n 
13 81   GLN n 
13 82   TRP n 
13 83   ARG n 
13 84   THR n 
13 85   ILE n 
13 86   ALA n 
13 87   PRO n 
13 88   ILE n 
13 89   ILE n 
13 90   GLY n 
13 91   ARG n 
13 92   THR n 
13 93   ALA n 
13 94   ALA n 
13 95   GLN n 
13 96   CYS n 
13 97   LEU n 
13 98   GLU n 
13 99   HIS n 
13 100  TYR n 
13 101  GLU n 
13 102  PHE n 
13 103  LEU n 
13 104  LEU n 
13 105  ASP n 
13 106  LYS n 
13 107  ALA n 
13 108  ALA n 
13 109  GLN n 
13 110  ARG n 
13 111  ASP n 
13 112  ASN n 
13 113  GLU n 
13 114  GLU n 
13 115  GLU n 
13 116  THR n 
13 117  THR n 
13 118  ASP n 
13 119  ASP n 
13 120  PRO n 
13 121  ARG n 
13 122  LYS n 
13 123  LEU n 
13 124  LYS n 
13 125  PRO n 
13 126  GLY n 
13 127  GLU n 
13 128  ILE n 
13 129  ASP n 
13 130  PRO n 
13 131  ASN n 
13 132  PRO n 
13 133  GLU n 
13 134  THR n 
13 135  LYS n 
13 136  PRO n 
13 137  ALA n 
13 138  ARG n 
13 139  PRO n 
13 140  ASP n 
13 141  PRO n 
13 142  ILE n 
13 143  ASP n 
13 144  MET n 
13 145  ASP n 
13 146  GLU n 
13 147  ASP n 
13 148  GLU n 
13 149  LEU n 
13 150  GLU n 
13 151  MET n 
13 152  LEU n 
13 153  SER n 
13 154  GLU n 
13 155  ALA n 
13 156  ARG n 
13 157  ALA n 
13 158  ARG n 
13 159  LEU n 
13 160  ALA n 
13 161  ASN n 
13 162  THR n 
13 163  GLN n 
13 164  GLY n 
13 165  LYS n 
13 166  LYS n 
13 167  ALA n 
13 168  LYS n 
13 169  ARG n 
13 170  LYS n 
13 171  ALA n 
13 172  ARG n 
13 173  GLU n 
13 174  LYS n 
13 175  GLN n 
13 176  LEU n 
13 177  GLU n 
13 178  GLU n 
13 179  ALA n 
13 180  ARG n 
13 181  ARG n 
13 182  LEU n 
13 183  ALA n 
13 184  ALA n 
13 185  LEU n 
13 186  GLN n 
13 187  LYS n 
13 188  ARG n 
13 189  ARG n 
13 190  GLU n 
13 191  LEU n 
13 192  ARG n 
13 193  ALA n 
13 194  ALA n 
13 195  GLY n 
13 196  ILE n 
13 197  GLU n 
13 198  ILE n 
13 199  GLN n 
13 200  LYS n 
13 201  LYS n 
13 202  ARG n 
13 203  LYS n 
13 204  ARG n 
13 205  LYS n 
13 206  ARG n 
13 207  GLY n 
13 208  VAL n 
13 209  ASP n 
13 210  TYR n 
13 211  ASN n 
13 212  ALA n 
13 213  GLU n 
13 214  ILE n 
13 215  PRO n 
13 216  PHE n 
13 217  GLU n 
13 218  LYS n 
13 219  LYS n 
13 220  PRO n 
13 221  ALA n 
13 222  LEU n 
13 223  GLY n 
13 224  PHE n 
13 225  TYR n 
13 226  ASP n 
13 227  THR n 
13 228  SER n 
13 229  GLU n 
13 230  GLU n 
13 231  ASN n 
13 232  TYR n 
13 233  GLN n 
13 234  ALA n 
13 235  LEU n 
13 236  ASP n 
13 237  ALA n 
13 238  ASP n 
13 239  PHE n 
13 240  ARG n 
13 241  LYS n 
13 242  LEU n 
13 243  ARG n 
13 244  GLN n 
13 245  GLN n 
13 246  ASP n 
13 247  LEU n 
13 248  ASP n 
13 249  GLY n 
13 250  GLU n 
13 251  LEU n 
13 252  ARG n 
13 253  SER n 
13 254  GLU n 
13 255  LYS n 
13 256  GLU n 
13 257  GLY n 
13 258  ARG n 
13 259  ASP n 
13 260  ARG n 
13 261  LYS n 
13 262  LYS n 
13 263  ASP n 
13 264  LYS n 
13 265  GLN n 
13 266  HIS n 
13 267  LEU n 
13 268  LYS n 
13 269  ARG n 
13 270  LYS n 
13 271  LYS n 
13 272  GLU n 
13 273  SER n 
13 274  ASP n 
13 275  LEU n 
13 276  PRO n 
13 277  SER n 
13 278  ALA n 
13 279  ILE n 
13 280  LEU n 
13 281  GLN n 
13 282  THR n 
13 283  SER n 
13 284  GLY n 
13 285  VAL n 
13 286  SER n 
13 287  GLU n 
13 288  PHE n 
13 289  THR n 
13 290  LYS n 
13 291  LYS n 
13 292  ARG n 
13 293  SER n 
13 294  LYS n 
13 295  LEU n 
13 296  VAL n 
13 297  LEU n 
13 298  PRO n 
13 299  ALA n 
13 300  PRO n 
13 301  GLN n 
13 302  ILE n 
13 303  SER n 
13 304  ASP n 
13 305  ALA n 
13 306  GLU n 
13 307  LEU n 
13 308  GLN n 
13 309  GLU n 
13 310  VAL n 
13 311  VAL n 
13 312  LYS n 
13 313  VAL n 
13 314  GLY n 
13 315  GLN n 
13 316  ALA n 
13 317  SER n 
13 318  GLU n 
13 319  ILE n 
13 320  ALA n 
13 321  ARG n 
13 322  GLN n 
13 323  THR n 
13 324  ALA n 
13 325  GLU n 
13 326  GLU n 
13 327  SER n 
13 328  GLY n 
13 329  ILE n 
13 330  THR n 
13 331  ASN n 
13 332  SER n 
13 333  ALA n 
13 334  SER n 
13 335  SER n 
13 336  THR n 
13 337  LEU n 
13 338  LEU n 
13 339  SER n 
13 340  GLU n 
13 341  TYR n 
13 342  ASN n 
13 343  VAL n 
13 344  THR n 
13 345  ASN n 
13 346  ASN n 
13 347  SER n 
13 348  VAL n 
13 349  ALA n 
13 350  LEU n 
13 351  ARG n 
13 352  THR n 
13 353  PRO n 
13 354  ARG n 
13 355  THR n 
13 356  PRO n 
13 357  ALA n 
13 358  SER n 
13 359  GLN n 
13 360  ASP n 
13 361  ARG n 
13 362  ILE n 
13 363  LEU n 
13 364  GLN n 
13 365  GLU n 
13 366  ALA n 
13 367  GLN n 
13 368  ASN n 
13 369  LEU n 
13 370  MET n 
13 371  ALA n 
13 372  LEU n 
13 373  THR n 
13 374  ASN n 
13 375  VAL n 
13 376  ASP n 
13 377  THR n 
13 378  PRO n 
13 379  LEU n 
13 380  LYS n 
13 381  GLY n 
13 382  GLY n 
13 383  LEU n 
13 384  ASN n 
13 385  THR n 
13 386  PRO n 
13 387  LEU n 
13 388  HIS n 
13 389  GLU n 
13 390  SER n 
13 391  ASP n 
13 392  PHE n 
13 393  SER n 
13 394  GLY n 
13 395  VAL n 
13 396  THR n 
13 397  PRO n 
13 398  GLN n 
13 399  ARG n 
13 400  GLN n 
13 401  VAL n 
13 402  VAL n 
13 403  GLN n 
13 404  THR n 
13 405  PRO n 
13 406  ASN n 
13 407  THR n 
13 408  VAL n 
13 409  LEU n 
13 410  SER n 
13 411  THR n 
13 412  PRO n 
13 413  PHE n 
13 414  ARG n 
13 415  THR n 
13 416  PRO n 
13 417  SER n 
13 418  ASN n 
13 419  GLY n 
13 420  ALA n 
13 421  GLU n 
13 422  GLY n 
13 423  LEU n 
13 424  THR n 
13 425  PRO n 
13 426  ARG n 
13 427  SER n 
13 428  GLY n 
13 429  THR n 
13 430  THR n 
13 431  PRO n 
13 432  LYS n 
13 433  PRO n 
13 434  VAL n 
13 435  ILE n 
13 436  ASN n 
13 437  SER n 
13 438  THR n 
13 439  PRO n 
13 440  GLY n 
13 441  ARG n 
13 442  THR n 
13 443  PRO n 
13 444  LEU n 
13 445  ARG n 
13 446  ASP n 
13 447  LYS n 
13 448  LEU n 
13 449  ASN n 
13 450  ILE n 
13 451  ASN n 
13 452  PRO n 
13 453  GLU n 
13 454  ASP n 
13 455  GLY n 
13 456  MET n 
13 457  ALA n 
13 458  ASP n 
13 459  TYR n 
13 460  SER n 
13 461  ASP n 
13 462  PRO n 
13 463  SER n 
13 464  TYR n 
13 465  VAL n 
13 466  LYS n 
13 467  GLN n 
13 468  MET n 
13 469  GLU n 
13 470  ARG n 
13 471  GLU n 
13 472  SER n 
13 473  ARG n 
13 474  GLU n 
13 475  HIS n 
13 476  LEU n 
13 477  ARG n 
13 478  LEU n 
13 479  GLY n 
13 480  LEU n 
13 481  LEU n 
13 482  GLY n 
13 483  LEU n 
13 484  PRO n 
13 485  ALA n 
13 486  PRO n 
13 487  LYS n 
13 488  ASN n 
13 489  ASP n 
13 490  PHE n 
13 491  GLU n 
13 492  ILE n 
13 493  VAL n 
13 494  LEU n 
13 495  PRO n 
13 496  GLU n 
13 497  ASN n 
13 498  ALA n 
13 499  GLU n 
13 500  LYS n 
13 501  GLU n 
13 502  LEU n 
13 503  GLU n 
13 504  GLU n 
13 505  ARG n 
13 506  GLU n 
13 507  ILE n 
13 508  ASP n 
13 509  ASP n 
13 510  THR n 
13 511  TYR n 
13 512  ILE n 
13 513  GLU n 
13 514  ASP n 
13 515  ALA n 
13 516  ALA n 
13 517  ASP n 
13 518  VAL n 
13 519  ASP n 
13 520  ALA n 
13 521  ARG n 
13 522  LYS n 
13 523  GLN n 
13 524  ALA n 
13 525  ILE n 
13 526  ARG n 
13 527  ASP n 
13 528  ALA n 
13 529  GLU n 
13 530  ARG n 
13 531  VAL n 
13 532  LYS n 
13 533  GLU n 
13 534  MET n 
13 535  LYS n 
13 536  ARG n 
13 537  MET n 
13 538  HIS n 
13 539  LYS n 
13 540  ALA n 
13 541  VAL n 
13 542  GLN n 
13 543  LYS n 
13 544  ASP n 
13 545  LEU n 
13 546  PRO n 
13 547  ARG n 
13 548  PRO n 
13 549  SER n 
13 550  GLU n 
13 551  VAL n 
13 552  ASN n 
13 553  GLU n 
13 554  THR n 
13 555  ILE n 
13 556  LEU n 
13 557  ARG n 
13 558  PRO n 
13 559  LEU n 
13 560  ASN n 
13 561  VAL n 
13 562  GLU n 
13 563  PRO n 
13 564  PRO n 
13 565  LEU n 
13 566  THR n 
13 567  ASP n 
13 568  LEU n 
13 569  GLN n 
13 570  LYS n 
13 571  SER n 
13 572  GLU n 
13 573  GLU n 
13 574  LEU n 
13 575  ILE n 
13 576  LYS n 
13 577  LYS n 
13 578  GLU n 
13 579  MET n 
13 580  ILE n 
13 581  THR n 
13 582  MET n 
13 583  LEU n 
13 584  HIS n 
13 585  TYR n 
13 586  ASP n 
13 587  LEU n 
13 588  LEU n 
13 589  HIS n 
13 590  HIS n 
13 591  PRO n 
13 592  TYR n 
13 593  GLU n 
13 594  PRO n 
13 595  SER n 
13 596  GLY n 
13 597  ASN n 
13 598  LYS n 
13 599  LYS n 
13 600  GLY n 
13 601  LYS n 
13 602  THR n 
13 603  VAL n 
13 604  GLY n 
13 605  PHE n 
13 606  GLY n 
13 607  THR n 
13 608  ASN n 
13 609  ASN n 
13 610  SER n 
13 611  GLU n 
13 612  HIS n 
13 613  ILE n 
13 614  THR n 
13 615  TYR n 
13 616  LEU n 
13 617  GLU n 
13 618  HIS n 
13 619  ASN n 
13 620  PRO n 
13 621  TYR n 
13 622  GLU n 
13 623  LYS n 
13 624  PHE n 
13 625  SER n 
13 626  LYS n 
13 627  GLU n 
13 628  GLU n 
13 629  LEU n 
13 630  LYS n 
13 631  LYS n 
13 632  ALA n 
13 633  GLN n 
13 634  ASP n 
13 635  VAL n 
13 636  LEU n 
13 637  VAL n 
13 638  GLN n 
13 639  GLU n 
13 640  MET n 
13 641  GLU n 
13 642  VAL n 
13 643  VAL n 
13 644  LYS n 
13 645  GLN n 
13 646  GLY n 
13 647  MET n 
13 648  SER n 
13 649  HIS n 
13 650  GLY n 
13 651  GLU n 
13 652  LEU n 
13 653  SER n 
13 654  SER n 
13 655  GLU n 
13 656  ALA n 
13 657  TYR n 
13 658  ASN n 
13 659  GLN n 
13 660  VAL n 
13 661  TRP n 
13 662  GLU n 
13 663  GLU n 
13 664  CYS n 
13 665  TYR n 
13 666  SER n 
13 667  GLN n 
13 668  VAL n 
13 669  LEU n 
13 670  TYR n 
13 671  LEU n 
13 672  PRO n 
13 673  GLY n 
13 674  GLN n 
13 675  SER n 
13 676  ARG n 
13 677  TYR n 
13 678  THR n 
13 679  ARG n 
13 680  ALA n 
13 681  ASN n 
13 682  LEU n 
13 683  ALA n 
13 684  SER n 
13 685  LYS n 
13 686  LYS n 
13 687  ASP n 
13 688  ARG n 
13 689  ILE n 
13 690  GLU n 
13 691  SER n 
13 692  LEU n 
13 693  GLU n 
13 694  LYS n 
13 695  ARG n 
13 696  LEU n 
13 697  GLU n 
13 698  ILE n 
13 699  ASN n 
13 700  ARG n 
13 701  GLY n 
13 702  HIS n 
13 703  MET n 
13 704  THR n 
13 705  THR n 
13 706  GLU n 
13 707  ALA n 
13 708  LYS n 
13 709  ARG n 
13 710  ALA n 
13 711  ALA n 
13 712  LYS n 
13 713  MET n 
13 714  GLU n 
13 715  LYS n 
13 716  LYS n 
13 717  MET n 
13 718  LYS n 
13 719  ILE n 
13 720  LEU n 
13 721  LEU n 
13 722  GLY n 
13 723  GLY n 
13 724  TYR n 
13 725  GLN n 
13 726  SER n 
13 727  ARG n 
13 728  ALA n 
13 729  MET n 
13 730  GLY n 
13 731  LEU n 
13 732  MET n 
13 733  LYS n 
13 734  GLN n 
13 735  LEU n 
13 736  ASN n 
13 737  ASP n 
13 738  LEU n 
13 739  TRP n 
13 740  ASP n 
13 741  GLN n 
13 742  ILE n 
13 743  GLU n 
13 744  GLN n 
13 745  ALA n 
13 746  HIS n 
13 747  LEU n 
13 748  GLU n 
13 749  LEU n 
13 750  ARG n 
13 751  THR n 
13 752  PHE n 
13 753  GLU n 
13 754  GLU n 
13 755  LEU n 
13 756  LYS n 
13 757  LYS n 
13 758  HIS n 
13 759  GLU n 
13 760  ASP n 
13 761  SER n 
13 762  ALA n 
13 763  ILE n 
13 764  PRO n 
13 765  ARG n 
13 766  ARG n 
13 767  LEU n 
13 768  GLU n 
13 769  CYS n 
13 770  LEU n 
13 771  LYS n 
13 772  GLU n 
13 773  ASP n 
13 774  VAL n 
13 775  GLN n 
13 776  ARG n 
13 777  GLN n 
13 778  GLN n 
13 779  GLU n 
13 780  ARG n 
13 781  GLU n 
13 782  LYS n 
13 783  GLU n 
13 784  LEU n 
13 785  GLN n 
13 786  HIS n 
13 787  ARG n 
13 788  TYR n 
13 789  ALA n 
13 790  ASP n 
13 791  LEU n 
13 792  LEU n 
13 793  LEU n 
13 794  GLU n 
13 795  LYS n 
13 796  GLU n 
13 797  THR n 
13 798  LEU n 
13 799  LYS n 
13 800  SER n 
13 801  LYS n 
13 802  PHE n 
14 1    MET n 
14 2    THR n 
14 3    ALA n 
14 4    THR n 
14 5    VAL n 
14 6    GLU n 
14 7    ASN n 
14 8    LEU n 
14 9    THR n 
14 10   PHE n 
14 11   GLN n 
14 12   LYS n 
14 13   ASP n 
14 14   THR n 
14 15   LEU n 
14 16   GLY n 
14 17   ASN n 
14 18   ALA n 
14 19   VAL n 
14 20   ASP n 
14 21   LYS n 
14 22   ASN n 
14 23   THR n 
14 24   SER n 
14 25   ARG n 
14 26   LEU n 
14 27   GLU n 
14 28   LEU n 
14 29   ARG n 
14 30   SER n 
14 31   TYR n 
14 32   SER n 
14 33   LEU n 
14 34   ALA n 
14 35   GLY n 
14 36   ARG n 
14 37   HIS n 
14 38   GLY n 
14 39   SER n 
14 40   THR n 
14 41   GLU n 
14 42   PRO n 
14 43   LEU n 
14 44   VAL n 
14 45   LEU n 
14 46   ALA n 
14 47   TRP n 
14 48   SER n 
14 49   SER n 
14 50   GLN n 
14 51   PHE n 
14 52   ARG n 
14 53   ARG n 
14 54   LEU n 
14 55   THR n 
14 56   TRP n 
14 57   GLY n 
14 58   CYS n 
14 59   ALA n 
14 60   LEU n 
14 61   ASP n 
14 62   ALA n 
14 63   LEU n 
14 64   HIS n 
14 65   ARG n 
14 66   SER n 
14 67   PRO n 
14 68   CYS n 
14 69   VAL n 
14 70   ALA n 
14 71   ALA n 
14 72   SER n 
14 73   GLN n 
14 74   HIS n 
14 75   GLY n 
14 76   VAL n 
14 77   THR n 
14 78   HIS n 
14 79   LEU n 
14 80   ILE n 
14 81   ARG n 
14 82   SER n 
14 83   SER n 
14 84   ARG n 
14 85   THR n 
14 86   PRO n 
14 87   HIS n 
14 88   SER n 
14 89   THR n 
14 90   ARG n 
14 91   CYS n 
14 92   ARG n 
14 93   LYS n 
14 94   GLU n 
14 95   ASP n 
14 96   ALA n 
14 97   GLN n 
14 98   PRO n 
14 99   GLY n 
14 100  HIS n 
14 101  HIS n 
14 102  GLY n 
14 103  ASN n 
14 104  GLY n 
14 105  ALA n 
14 106  ALA n 
14 107  SER n 
14 108  VAL n 
14 109  THR n 
14 110  ALA n 
14 111  GLN n 
14 112  ALA n 
14 113  ARG n 
14 114  GLY n 
14 115  GLN n 
14 116  ARG n 
14 117  SER n 
14 118  VAL n 
14 119  LEU n 
14 120  GLN n 
14 121  VAL n 
14 122  PRO n 
14 123  LEU n 
14 124  PRO n 
14 125  VAL n 
14 126  PRO n 
14 127  ARG n 
14 128  SER n 
14 129  CYS n 
14 130  LEU n 
14 131  PHE n 
14 132  SER n 
14 133  GLU n 
14 134  SER n 
14 135  PHE n 
14 136  VAL n 
14 137  VAL n 
14 138  SER n 
14 139  VAL n 
14 140  SER n 
14 141  SER n 
14 142  GLN n 
14 143  SER n 
14 144  ARG n 
14 145  PHE n 
14 146  LEU n 
14 147  ALA n 
14 148  SER n 
14 149  VAL n 
14 150  PRO n 
14 151  GLY n 
14 152  THR n 
14 153  GLY n 
14 154  VAL n 
14 155  GLN n 
14 156  ARG n 
14 157  SER n 
14 158  THR n 
14 159  ALA n 
14 160  ALA n 
14 161  ASP n 
14 162  MET n 
14 163  ALA n 
14 164  ALA n 
14 165  SER n 
14 166  THR n 
14 167  ALA n 
14 168  ALA n 
14 169  GLY n 
14 170  LYS n 
14 171  GLN n 
14 172  ARG n 
14 173  ILE n 
14 174  PRO n 
14 175  LYS n 
14 176  VAL n 
14 177  ALA n 
14 178  LYS n 
14 179  VAL n 
14 180  LYS n 
14 181  ASN n 
14 182  LYS n 
14 183  ALA n 
14 184  PRO n 
14 185  ALA n 
14 186  GLU n 
14 187  VAL n 
14 188  GLN n 
14 189  ILE n 
14 190  THR n 
14 191  ALA n 
14 192  GLU n 
14 193  GLN n 
14 194  LEU n 
14 195  LEU n 
14 196  ARG n 
14 197  GLU n 
14 198  ALA n 
14 199  LYS n 
14 200  GLU n 
14 201  ARG n 
14 202  GLU n 
14 203  LEU n 
14 204  GLU n 
14 205  LEU n 
14 206  LEU n 
14 207  PRO n 
14 208  PRO n 
14 209  PRO n 
14 210  PRO n 
14 211  GLN n 
14 212  GLN n 
14 213  LYS n 
14 214  ILE n 
14 215  THR n 
14 216  ASP n 
14 217  GLU n 
14 218  GLU n 
14 219  GLU n 
14 220  LEU n 
14 221  ASN n 
14 222  ASP n 
14 223  TYR n 
14 224  LYS n 
14 225  LEU n 
14 226  ARG n 
14 227  LYS n 
14 228  ARG n 
14 229  LYS n 
14 230  THR n 
14 231  PHE n 
14 232  GLU n 
14 233  ASP n 
14 234  ASN n 
14 235  ILE n 
14 236  ARG n 
14 237  LYS n 
14 238  ASN n 
14 239  ARG n 
14 240  THR n 
14 241  VAL n 
14 242  ILE n 
14 243  SER n 
14 244  ASN n 
14 245  TRP n 
14 246  ILE n 
14 247  LYS n 
14 248  TYR n 
14 249  ALA n 
14 250  GLN n 
14 251  TRP n 
14 252  GLU n 
14 253  GLU n 
14 254  SER n 
14 255  LEU n 
14 256  LYS n 
14 257  GLU n 
14 258  ILE n 
14 259  GLN n 
14 260  ARG n 
14 261  ALA n 
14 262  ARG n 
14 263  SER n 
14 264  ILE n 
14 265  TYR n 
14 266  GLU n 
14 267  ARG n 
14 268  ALA n 
14 269  LEU n 
14 270  ASP n 
14 271  VAL n 
14 272  ASP n 
14 273  TYR n 
14 274  ARG n 
14 275  ASN n 
14 276  ILE n 
14 277  THR n 
14 278  LEU n 
14 279  TRP n 
14 280  LEU n 
14 281  LYS n 
14 282  TYR n 
14 283  ALA n 
14 284  GLU n 
14 285  MET n 
14 286  GLU n 
14 287  MET n 
14 288  LYS n 
14 289  ASN n 
14 290  ARG n 
14 291  GLN n 
14 292  VAL n 
14 293  ASN n 
14 294  HIS n 
14 295  ALA n 
14 296  ARG n 
14 297  ASN n 
14 298  ILE n 
14 299  TRP n 
14 300  ASP n 
14 301  ARG n 
14 302  ALA n 
14 303  ILE n 
14 304  THR n 
14 305  THR n 
14 306  LEU n 
14 307  PRO n 
14 308  ARG n 
14 309  VAL n 
14 310  ASN n 
14 311  GLN n 
14 312  PHE n 
14 313  TRP n 
14 314  TYR n 
14 315  LYS n 
14 316  TYR n 
14 317  THR n 
14 318  TYR n 
14 319  MET n 
14 320  GLU n 
14 321  GLU n 
14 322  MET n 
14 323  LEU n 
14 324  GLY n 
14 325  ASN n 
14 326  VAL n 
14 327  ALA n 
14 328  GLY n 
14 329  ALA n 
14 330  ARG n 
14 331  GLN n 
14 332  VAL n 
14 333  PHE n 
14 334  GLU n 
14 335  ARG n 
14 336  TRP n 
14 337  MET n 
14 338  GLU n 
14 339  TRP n 
14 340  GLN n 
14 341  PRO n 
14 342  GLU n 
14 343  GLU n 
14 344  GLN n 
14 345  ALA n 
14 346  TRP n 
14 347  HIS n 
14 348  SER n 
14 349  TYR n 
14 350  ILE n 
14 351  ASN n 
14 352  PHE n 
14 353  GLU n 
14 354  LEU n 
14 355  ARG n 
14 356  TYR n 
14 357  LYS n 
14 358  GLU n 
14 359  VAL n 
14 360  ASP n 
14 361  ARG n 
14 362  ALA n 
14 363  ARG n 
14 364  THR n 
14 365  ILE n 
14 366  TYR n 
14 367  GLU n 
14 368  ARG n 
14 369  PHE n 
14 370  VAL n 
14 371  LEU n 
14 372  VAL n 
14 373  HIS n 
14 374  PRO n 
14 375  ASP n 
14 376  VAL n 
14 377  LYS n 
14 378  ASN n 
14 379  TRP n 
14 380  ILE n 
14 381  LYS n 
14 382  TYR n 
14 383  ALA n 
14 384  ARG n 
14 385  PHE n 
14 386  GLU n 
14 387  GLU n 
14 388  LYS n 
14 389  HIS n 
14 390  ALA n 
14 391  TYR n 
14 392  PHE n 
14 393  ALA n 
14 394  HIS n 
14 395  ALA n 
14 396  ARG n 
14 397  LYS n 
14 398  VAL n 
14 399  TYR n 
14 400  GLU n 
14 401  ARG n 
14 402  ALA n 
14 403  VAL n 
14 404  GLU n 
14 405  PHE n 
14 406  PHE n 
14 407  GLY n 
14 408  ASP n 
14 409  GLU n 
14 410  HIS n 
14 411  MET n 
14 412  ASP n 
14 413  GLU n 
14 414  HIS n 
14 415  LEU n 
14 416  TYR n 
14 417  VAL n 
14 418  ALA n 
14 419  PHE n 
14 420  ALA n 
14 421  LYS n 
14 422  PHE n 
14 423  GLU n 
14 424  GLU n 
14 425  ASN n 
14 426  GLN n 
14 427  LYS n 
14 428  GLU n 
14 429  PHE n 
14 430  GLU n 
14 431  ARG n 
14 432  VAL n 
14 433  ARG n 
14 434  VAL n 
14 435  ILE n 
14 436  TYR n 
14 437  LYS n 
14 438  TYR n 
14 439  ALA n 
14 440  LEU n 
14 441  ASP n 
14 442  ARG n 
14 443  ILE n 
14 444  SER n 
14 445  LYS n 
14 446  GLN n 
14 447  ASP n 
14 448  ALA n 
14 449  GLN n 
14 450  GLU n 
14 451  LEU n 
14 452  PHE n 
14 453  LYS n 
14 454  ASN n 
14 455  TYR n 
14 456  THR n 
14 457  ILE n 
14 458  PHE n 
14 459  GLU n 
14 460  LYS n 
14 461  LYS n 
14 462  PHE n 
14 463  GLY n 
14 464  ASP n 
14 465  ARG n 
14 466  ARG n 
14 467  GLY n 
14 468  ILE n 
14 469  GLU n 
14 470  ASP n 
14 471  ILE n 
14 472  ILE n 
14 473  VAL n 
14 474  SER n 
14 475  LYS n 
14 476  ARG n 
14 477  ARG n 
14 478  PHE n 
14 479  GLN n 
14 480  TYR n 
14 481  GLU n 
14 482  GLU n 
14 483  GLU n 
14 484  VAL n 
14 485  LYS n 
14 486  ALA n 
14 487  ASN n 
14 488  PRO n 
14 489  HIS n 
14 490  ASN n 
14 491  TYR n 
14 492  ASP n 
14 493  ALA n 
14 494  TRP n 
14 495  PHE n 
14 496  ASP n 
14 497  TYR n 
14 498  LEU n 
14 499  ARG n 
14 500  LEU n 
14 501  VAL n 
14 502  GLU n 
14 503  SER n 
14 504  ASP n 
14 505  ALA n 
14 506  GLU n 
14 507  ALA n 
14 508  GLU n 
14 509  ALA n 
14 510  VAL n 
14 511  ARG n 
14 512  GLU n 
14 513  VAL n 
14 514  TYR n 
14 515  GLU n 
14 516  ARG n 
14 517  ALA n 
14 518  ILE n 
14 519  ALA n 
14 520  ASN n 
14 521  VAL n 
14 522  PRO n 
14 523  PRO n 
14 524  ILE n 
14 525  GLN n 
14 526  GLU n 
14 527  LYS n 
14 528  ARG n 
14 529  HIS n 
14 530  TRP n 
14 531  LYS n 
14 532  ARG n 
14 533  TYR n 
14 534  ILE n 
14 535  TYR n 
14 536  LEU n 
14 537  TRP n 
14 538  ILE n 
14 539  ASN n 
14 540  TYR n 
14 541  ALA n 
14 542  LEU n 
14 543  TYR n 
14 544  GLU n 
14 545  GLU n 
14 546  LEU n 
14 547  GLU n 
14 548  ALA n 
14 549  LYS n 
14 550  ASP n 
14 551  PRO n 
14 552  GLU n 
14 553  ARG n 
14 554  THR n 
14 555  ARG n 
14 556  GLN n 
14 557  VAL n 
14 558  TYR n 
14 559  GLN n 
14 560  ALA n 
14 561  SER n 
14 562  LEU n 
14 563  GLU n 
14 564  LEU n 
14 565  ILE n 
14 566  PRO n 
14 567  HIS n 
14 568  LYS n 
14 569  LYS n 
14 570  PHE n 
14 571  THR n 
14 572  PHE n 
14 573  ALA n 
14 574  LYS n 
14 575  MET n 
14 576  TRP n 
14 577  ILE n 
14 578  LEU n 
14 579  TYR n 
14 580  ALA n 
14 581  GLN n 
14 582  PHE n 
14 583  GLU n 
14 584  ILE n 
14 585  ARG n 
14 586  GLN n 
14 587  LYS n 
14 588  ASN n 
14 589  LEU n 
14 590  SER n 
14 591  LEU n 
14 592  ALA n 
14 593  ARG n 
14 594  ARG n 
14 595  ALA n 
14 596  LEU n 
14 597  GLY n 
14 598  THR n 
14 599  SER n 
14 600  ILE n 
14 601  GLY n 
14 602  LYS n 
14 603  CYS n 
14 604  PRO n 
14 605  LYS n 
14 606  ASN n 
14 607  LYS n 
14 608  LEU n 
14 609  PHE n 
14 610  LYS n 
14 611  VAL n 
14 612  TYR n 
14 613  ILE n 
14 614  GLU n 
14 615  LEU n 
14 616  GLU n 
14 617  LEU n 
14 618  GLN n 
14 619  LEU n 
14 620  ARG n 
14 621  GLU n 
14 622  PHE n 
14 623  ASP n 
14 624  ARG n 
14 625  CYS n 
14 626  ARG n 
14 627  LYS n 
14 628  LEU n 
14 629  TYR n 
14 630  GLU n 
14 631  LYS n 
14 632  PHE n 
14 633  LEU n 
14 634  GLU n 
14 635  PHE n 
14 636  GLY n 
14 637  PRO n 
14 638  GLU n 
14 639  ASN n 
14 640  CYS n 
14 641  THR n 
14 642  SER n 
14 643  TRP n 
14 644  ILE n 
14 645  LYS n 
14 646  PHE n 
14 647  ALA n 
14 648  GLU n 
14 649  LEU n 
14 650  GLU n 
14 651  THR n 
14 652  ILE n 
14 653  LEU n 
14 654  GLY n 
14 655  ASP n 
14 656  ILE n 
14 657  ASP n 
14 658  ARG n 
14 659  ALA n 
14 660  ARG n 
14 661  ALA n 
14 662  ILE n 
14 663  TYR n 
14 664  GLU n 
14 665  LEU n 
14 666  ALA n 
14 667  ILE n 
14 668  SER n 
14 669  GLN n 
14 670  PRO n 
14 671  ARG n 
14 672  LEU n 
14 673  ASP n 
14 674  MET n 
14 675  PRO n 
14 676  GLU n 
14 677  VAL n 
14 678  LEU n 
14 679  TRP n 
14 680  LYS n 
14 681  SER n 
14 682  TYR n 
14 683  ILE n 
14 684  ASP n 
14 685  PHE n 
14 686  GLU n 
14 687  ILE n 
14 688  GLU n 
14 689  GLN n 
14 690  GLU n 
14 691  GLU n 
14 692  THR n 
14 693  GLU n 
14 694  ARG n 
14 695  THR n 
14 696  ARG n 
14 697  ASN n 
14 698  LEU n 
14 699  TYR n 
14 700  ARG n 
14 701  ARG n 
14 702  LEU n 
14 703  LEU n 
14 704  GLN n 
14 705  ARG n 
14 706  THR n 
14 707  GLN n 
14 708  HIS n 
14 709  VAL n 
14 710  LYS n 
14 711  VAL n 
14 712  TRP n 
14 713  ILE n 
14 714  SER n 
14 715  PHE n 
14 716  ALA n 
14 717  GLN n 
14 718  PHE n 
14 719  GLU n 
14 720  LEU n 
14 721  SER n 
14 722  SER n 
14 723  GLY n 
14 724  LYS n 
14 725  GLU n 
14 726  GLY n 
14 727  SER n 
14 728  LEU n 
14 729  THR n 
14 730  LYS n 
14 731  CYS n 
14 732  ARG n 
14 733  GLN n 
14 734  ILE n 
14 735  TYR n 
14 736  GLU n 
14 737  GLU n 
14 738  ALA n 
14 739  ASN n 
14 740  LYS n 
14 741  THR n 
14 742  MET n 
14 743  ARG n 
14 744  ASN n 
14 745  CYS n 
14 746  GLU n 
14 747  GLU n 
14 748  LYS n 
14 749  GLU n 
14 750  GLU n 
14 751  ARG n 
14 752  LEU n 
14 753  MET n 
14 754  LEU n 
14 755  LEU n 
14 756  GLU n 
14 757  SER n 
14 758  TRP n 
14 759  ARG n 
14 760  SER n 
14 761  PHE n 
14 762  GLU n 
14 763  GLU n 
14 764  GLU n 
14 765  PHE n 
14 766  GLY n 
14 767  THR n 
14 768  ALA n 
14 769  SER n 
14 770  ASP n 
14 771  LYS n 
14 772  GLU n 
14 773  ARG n 
14 774  VAL n 
14 775  ASP n 
14 776  LYS n 
14 777  LEU n 
14 778  MET n 
14 779  PRO n 
14 780  GLU n 
14 781  LYS n 
14 782  VAL n 
14 783  LYS n 
14 784  LYS n 
14 785  ARG n 
14 786  ARG n 
14 787  LYS n 
14 788  VAL n 
14 789  GLN n 
14 790  THR n 
14 791  ASP n 
14 792  ASP n 
14 793  GLY n 
14 794  SER n 
14 795  ASP n 
14 796  ALA n 
14 797  GLY n 
14 798  TRP n 
14 799  GLU n 
14 800  GLU n 
14 801  TYR n 
14 802  PHE n 
14 803  ASP n 
14 804  TYR n 
14 805  ILE n 
14 806  PHE n 
14 807  PRO n 
14 808  GLU n 
14 809  ASP n 
14 810  ALA n 
14 811  ALA n 
14 812  ASN n 
14 813  GLN n 
14 814  PRO n 
14 815  ASN n 
14 816  LEU n 
14 817  LYS n 
14 818  LEU n 
14 819  LEU n 
14 820  ALA n 
14 821  MET n 
14 822  ALA n 
14 823  LYS n 
14 824  LEU n 
14 825  TRP n 
14 826  LYS n 
14 827  LYS n 
14 828  GLN n 
14 829  GLN n 
14 830  GLN n 
14 831  GLU n 
14 832  LYS n 
14 833  GLU n 
14 834  ASP n 
14 835  ALA n 
14 836  GLU n 
14 837  HIS n 
14 838  HIS n 
14 839  PRO n 
14 840  ASP n 
14 841  GLU n 
14 842  ASP n 
14 843  VAL n 
14 844  ASP n 
14 845  GLU n 
14 846  SER n 
14 847  GLU n 
14 848  SER n 
15 1    MET n 
15 2    ALA n 
15 3    THR n 
15 4    SER n 
15 5    LEU n 
15 6    GLY n 
15 7    SER n 
15 8    ASN n 
15 9    THR n 
15 10   TYR n 
15 11   ASN n 
15 12   ARG n 
15 13   GLN n 
15 14   ASN n 
15 15   TRP n 
15 16   GLU n 
15 17   ASP n 
15 18   ALA n 
15 19   ASP n 
15 20   PHE n 
15 21   PRO n 
15 22   ILE n 
15 23   LEU n 
15 24   CYS n 
15 25   GLN n 
15 26   THR n 
15 27   CYS n 
15 28   LEU n 
15 29   GLY n 
15 30   GLU n 
15 31   ASN n 
15 32   PRO n 
15 33   TYR n 
15 34   ILE n 
15 35   ARG n 
15 36   MET n 
15 37   THR n 
15 38   LYS n 
15 39   GLU n 
15 40   LYS n 
15 41   TYR n 
15 42   GLY n 
15 43   LYS n 
15 44   GLU n 
15 45   CYS n 
15 46   LYS n 
15 47   ILE n 
15 48   CYS n 
15 49   ALA n 
15 50   ARG n 
15 51   PRO n 
15 52   PHE n 
15 53   THR n 
15 54   VAL n 
15 55   PHE n 
15 56   ARG n 
15 57   TRP n 
15 58   CYS n 
15 59   PRO n 
15 60   GLY n 
15 61   VAL n 
15 62   ARG n 
15 63   MET n 
15 64   ARG n 
15 65   PHE n 
15 66   LYS n 
15 67   LYS n 
15 68   THR n 
15 69   GLU n 
15 70   VAL n 
15 71   CYS n 
15 72   GLN n 
15 73   THR n 
15 74   CYS n 
15 75   SER n 
15 76   LYS n 
15 77   LEU n 
15 78   LYS n 
15 79   ASN n 
15 80   VAL n 
15 81   CYS n 
15 82   GLN n 
15 83   THR n 
15 84   CYS n 
15 85   LEU n 
15 86   LEU n 
15 87   ASP n 
15 88   LEU n 
15 89   GLU n 
15 90   TYR n 
15 91   GLY n 
15 92   LEU n 
15 93   PRO n 
15 94   ILE n 
15 95   GLN n 
15 96   VAL n 
15 97   ARG n 
15 98   ASP n 
15 99   ALA n 
15 100  GLY n 
15 101  LEU n 
15 102  SER n 
15 103  PHE n 
15 104  LYS n 
15 105  ASP n 
15 106  ASP n 
15 107  MET n 
15 108  PRO n 
15 109  LYS n 
15 110  SER n 
15 111  ASP n 
15 112  VAL n 
15 113  ASN n 
15 114  LYS n 
15 115  GLU n 
15 116  TYR n 
15 117  TYR n 
15 118  THR n 
15 119  GLN n 
15 120  ASN n 
15 121  MET n 
15 122  GLU n 
15 123  ARG n 
15 124  GLU n 
15 125  ILE n 
15 126  SER n 
15 127  ASN n 
15 128  SER n 
15 129  ASP n 
15 130  GLY n 
15 131  THR n 
15 132  ARG n 
15 133  PRO n 
15 134  VAL n 
15 135  GLY n 
15 136  MET n 
15 137  LEU n 
15 138  GLY n 
15 139  LYS n 
15 140  ALA n 
15 141  THR n 
15 142  SER n 
15 143  THR n 
15 144  SER n 
15 145  ASP n 
15 146  MET n 
15 147  LEU n 
15 148  LEU n 
15 149  LYS n 
15 150  LEU n 
15 151  ALA n 
15 152  ARG n 
15 153  THR n 
15 154  THR n 
15 155  PRO n 
15 156  TYR n 
15 157  TYR n 
15 158  LYS n 
15 159  ARG n 
15 160  ASN n 
15 161  ARG n 
15 162  PRO n 
15 163  HIS n 
15 164  ILE n 
15 165  CYS n 
15 166  SER n 
15 167  PHE n 
15 168  TRP n 
15 169  VAL n 
15 170  LYS n 
15 171  GLY n 
15 172  GLU n 
15 173  CYS n 
15 174  LYS n 
15 175  ARG n 
15 176  GLY n 
15 177  GLU n 
15 178  GLU n 
15 179  CYS n 
15 180  PRO n 
15 181  TYR n 
15 182  ARG n 
15 183  HIS n 
15 184  GLU n 
15 185  LYS n 
15 186  PRO n 
15 187  THR n 
15 188  ASP n 
15 189  PRO n 
15 190  ASP n 
15 191  ASP n 
15 192  PRO n 
15 193  LEU n 
15 194  ALA n 
15 195  ASP n 
15 196  GLN n 
15 197  ASN n 
15 198  ILE n 
15 199  LYS n 
15 200  ASP n 
15 201  ARG n 
15 202  TYR n 
15 203  TYR n 
15 204  GLY n 
15 205  ILE n 
15 206  ASN n 
15 207  ASP n 
15 208  PRO n 
15 209  VAL n 
15 210  ALA n 
15 211  ASP n 
15 212  LYS n 
15 213  LEU n 
15 214  LEU n 
15 215  LYS n 
15 216  ARG n 
15 217  ALA n 
15 218  SER n 
15 219  THR n 
15 220  MET n 
15 221  PRO n 
15 222  ARG n 
15 223  LEU n 
15 224  ASP n 
15 225  PRO n 
15 226  PRO n 
15 227  GLU n 
15 228  ASP n 
15 229  LYS n 
15 230  THR n 
15 231  ILE n 
15 232  THR n 
15 233  THR n 
15 234  LEU n 
15 235  TYR n 
15 236  VAL n 
15 237  GLY n 
15 238  GLY n 
15 239  LEU n 
15 240  GLY n 
15 241  ASP n 
15 242  THR n 
15 243  ILE n 
15 244  THR n 
15 245  GLU n 
15 246  THR n 
15 247  ASP n 
15 248  LEU n 
15 249  ARG n 
15 250  ASN n 
15 251  HIS n 
15 252  PHE n 
15 253  TYR n 
15 254  GLN n 
15 255  PHE n 
15 256  GLY n 
15 257  GLU n 
15 258  ILE n 
15 259  ARG n 
15 260  THR n 
15 261  ILE n 
15 262  THR n 
15 263  VAL n 
15 264  VAL n 
15 265  GLN n 
15 266  ARG n 
15 267  GLN n 
15 268  GLN n 
15 269  CYS n 
15 270  ALA n 
15 271  PHE n 
15 272  ILE n 
15 273  GLN n 
15 274  PHE n 
15 275  ALA n 
15 276  THR n 
15 277  ARG n 
15 278  GLN n 
15 279  ALA n 
15 280  ALA n 
15 281  GLU n 
15 282  VAL n 
15 283  ALA n 
15 284  ALA n 
15 285  GLU n 
15 286  LYS n 
15 287  SER n 
15 288  PHE n 
15 289  ASN n 
15 290  LYS n 
15 291  LEU n 
15 292  ILE n 
15 293  VAL n 
15 294  ASN n 
15 295  GLY n 
15 296  ARG n 
15 297  ARG n 
15 298  LEU n 
15 299  ASN n 
15 300  VAL n 
15 301  LYS n 
15 302  TRP n 
15 303  GLY n 
15 304  ARG n 
15 305  SER n 
15 306  GLN n 
15 307  ALA n 
15 308  ALA n 
15 309  ARG n 
15 310  GLY n 
15 311  LYS n 
15 312  GLU n 
15 313  LYS n 
15 314  GLU n 
15 315  LYS n 
15 316  ASP n 
15 317  GLY n 
15 318  THR n 
15 319  THR n 
15 320  ASP n 
15 321  SER n 
15 322  GLY n 
15 323  ILE n 
15 324  LYS n 
15 325  LEU n 
15 326  GLU n 
15 327  PRO n 
15 328  VAL n 
15 329  PRO n 
15 330  GLY n 
15 331  LEU n 
15 332  PRO n 
15 333  GLY n 
15 334  ALA n 
15 335  LEU n 
15 336  PRO n 
15 337  PRO n 
15 338  PRO n 
15 339  PRO n 
15 340  ALA n 
15 341  ALA n 
15 342  GLU n 
15 343  GLU n 
15 344  GLU n 
15 345  ALA n 
15 346  SER n 
15 347  ALA n 
15 348  ASN n 
15 349  TYR n 
15 350  PHE n 
15 351  ASN n 
15 352  LEU n 
15 353  PRO n 
15 354  PRO n 
15 355  SER n 
15 356  GLY n 
15 357  PRO n 
15 358  PRO n 
15 359  ALA n 
15 360  VAL n 
15 361  VAL n 
15 362  ASN n 
15 363  ILE n 
15 364  ALA n 
15 365  LEU n 
15 366  PRO n 
15 367  PRO n 
15 368  PRO n 
15 369  PRO n 
15 370  GLY n 
15 371  ILE n 
15 372  ALA n 
15 373  PRO n 
15 374  PRO n 
15 375  PRO n 
15 376  PRO n 
15 377  PRO n 
15 378  GLY n 
15 379  PHE n 
15 380  GLY n 
15 381  PRO n 
15 382  HIS n 
15 383  MET n 
15 384  PHE n 
15 385  HIS n 
15 386  PRO n 
15 387  MET n 
15 388  GLY n 
15 389  PRO n 
15 390  PRO n 
15 391  PRO n 
15 392  PRO n 
15 393  PHE n 
15 394  MET n 
15 395  ARG n 
15 396  ALA n 
15 397  PRO n 
15 398  GLY n 
15 399  PRO n 
15 400  ILE n 
15 401  HIS n 
15 402  TYR n 
15 403  PRO n 
15 404  SER n 
15 405  GLN n 
15 406  ASP n 
15 407  PRO n 
15 408  GLN n 
15 409  ARG n 
15 410  MET n 
15 411  GLY n 
15 412  ALA n 
15 413  HIS n 
15 414  ALA n 
15 415  GLY n 
15 416  LYS n 
15 417  HIS n 
15 418  SER n 
15 419  SER n 
15 420  PRO n 
16 1    MET n 
16 2    PRO n 
16 3    LYS n 
16 4    VAL n 
16 5    LYS n 
16 6    ARG n 
16 7    SER n 
16 8    ARG n 
16 9    LYS n 
16 10   ALA n 
16 11   PRO n 
16 12   PRO n 
16 13   ASP n 
16 14   GLY n 
16 15   TRP n 
16 16   GLU n 
16 17   LEU n 
16 18   ILE n 
16 19   GLU n 
16 20   PRO n 
16 21   THR n 
16 22   LEU n 
16 23   ASP n 
16 24   GLU n 
16 25   LEU n 
16 26   ASP n 
16 27   GLN n 
16 28   LYS n 
16 29   MET n 
16 30   ARG n 
16 31   GLU n 
16 32   ALA n 
16 33   GLU n 
16 34   THR n 
16 35   GLU n 
16 36   PRO n 
16 37   HIS n 
16 38   GLU n 
16 39   GLY n 
16 40   LYS n 
16 41   ARG n 
16 42   LYS n 
16 43   VAL n 
16 44   GLU n 
16 45   SER n 
16 46   LEU n 
16 47   TRP n 
16 48   PRO n 
16 49   ILE n 
16 50   PHE n 
16 51   ARG n 
16 52   ILE n 
16 53   HIS n 
16 54   HIS n 
16 55   GLN n 
16 56   LYS n 
16 57   THR n 
16 58   ARG n 
16 59   TYR n 
16 60   ILE n 
16 61   PHE n 
16 62   ASP n 
16 63   LEU n 
16 64   PHE n 
16 65   TYR n 
16 66   LYS n 
16 67   ARG n 
16 68   LYS n 
16 69   ALA n 
16 70   ILE n 
16 71   SER n 
16 72   ARG n 
16 73   GLU n 
16 74   LEU n 
16 75   TYR n 
16 76   GLU n 
16 77   TYR n 
16 78   CYS n 
16 79   ILE n 
16 80   LYS n 
16 81   GLU n 
16 82   GLY n 
16 83   TYR n 
16 84   ALA n 
16 85   ASP n 
16 86   LYS n 
16 87   ASN n 
16 88   LEU n 
16 89   ILE n 
16 90   ALA n 
16 91   LYS n 
16 92   TRP n 
16 93   LYS n 
16 94   LYS n 
16 95   GLN n 
16 96   GLY n 
16 97   TYR n 
16 98   GLU n 
16 99   ASN n 
16 100  LEU n 
16 101  CYS n 
16 102  CYS n 
16 103  LEU n 
16 104  ARG n 
16 105  CYS n 
16 106  ILE n 
16 107  GLN n 
16 108  THR n 
16 109  ARG n 
16 110  ASP n 
16 111  THR n 
16 112  ASN n 
16 113  PHE n 
16 114  GLY n 
16 115  THR n 
16 116  ASN n 
16 117  CYS n 
16 118  ILE n 
16 119  CYS n 
16 120  ARG n 
16 121  VAL n 
16 122  PRO n 
16 123  LYS n 
16 124  SER n 
16 125  LYS n 
16 126  LEU n 
16 127  GLU n 
16 128  VAL n 
16 129  GLY n 
16 130  ARG n 
16 131  ILE n 
16 132  ILE n 
16 133  GLU n 
16 134  CYS n 
16 135  THR n 
16 136  HIS n 
16 137  CYS n 
16 138  GLY n 
16 139  CYS n 
16 140  ARG n 
16 141  GLY n 
16 142  CYS n 
16 143  SER n 
16 144  GLY n 
17 1    MET n 
17 2    THR n 
17 3    THR n 
17 4    ALA n 
17 5    ALA n 
17 6    ARG n 
17 7    PRO n 
17 8    THR n 
17 9    PHE n 
17 10   GLU n 
17 11   PRO n 
17 12   ALA n 
17 13   ARG n 
17 14   GLY n 
17 15   GLY n 
17 16   ARG n 
17 17   GLY n 
17 18   LYS n 
17 19   GLY n 
17 20   GLU n 
17 21   GLY n 
17 22   ASP n 
17 23   LEU n 
17 24   SER n 
17 25   GLN n 
17 26   LEU n 
17 27   SER n 
17 28   LYS n 
17 29   GLN n 
17 30   TYR n 
17 31   SER n 
17 32   SER n 
17 33   ARG n 
17 34   ASP n 
17 35   LEU n 
17 36   PRO n 
17 37   SER n 
17 38   HIS n 
17 39   THR n 
17 40   LYS n 
17 41   ILE n 
17 42   LYS n 
17 43   TYR n 
17 44   ARG n 
17 45   GLN n 
17 46   THR n 
17 47   THR n 
17 48   GLN n 
17 49   ASP n 
17 50   ALA n 
17 51   PRO n 
17 52   GLU n 
17 53   GLU n 
17 54   VAL n 
17 55   ARG n 
17 56   ASN n 
17 57   ARG n 
17 58   ASP n 
17 59   PHE n 
17 60   ARG n 
17 61   ARG n 
17 62   GLU n 
17 63   LEU n 
17 64   GLU n 
17 65   GLU n 
17 66   ARG n 
17 67   GLU n 
17 68   ARG n 
17 69   ALA n 
17 70   ALA n 
17 71   ALA n 
17 72   ARG n 
17 73   GLU n 
17 74   LYS n 
17 75   ASN n 
17 76   ARG n 
17 77   ASP n 
17 78   ARG n 
17 79   PRO n 
17 80   THR n 
17 81   ARG n 
17 82   GLU n 
17 83   HIS n 
17 84   THR n 
17 85   THR n 
17 86   SER n 
17 87   SER n 
17 88   SER n 
17 89   VAL n 
17 90   SER n 
17 91   LYS n 
17 92   LYS n 
17 93   PRO n 
17 94   ARG n 
17 95   LEU n 
17 96   ASP n 
17 97   GLN n 
17 98   ILE n 
17 99   PRO n 
17 100  ALA n 
17 101  ALA n 
17 102  ASN n 
17 103  LEU n 
17 104  ASP n 
17 105  ALA n 
17 106  ASP n 
17 107  ASP n 
17 108  PRO n 
17 109  LEU n 
17 110  THR n 
17 111  ASP n 
17 112  GLU n 
17 113  GLU n 
17 114  ASP n 
17 115  GLU n 
17 116  ASP n 
17 117  PHE n 
17 118  GLU n 
17 119  GLU n 
17 120  GLU n 
17 121  SER n 
17 122  ASP n 
17 123  ASP n 
17 124  ASP n 
17 125  ASP n 
17 126  THR n 
17 127  ALA n 
17 128  ALA n 
17 129  LEU n 
17 130  LEU n 
17 131  ALA n 
17 132  GLU n 
17 133  LEU n 
17 134  GLU n 
17 135  LYS n 
17 136  ILE n 
17 137  LYS n 
17 138  LYS n 
17 139  GLU n 
17 140  ARG n 
17 141  ALA n 
17 142  GLU n 
17 143  GLU n 
17 144  GLN n 
17 145  ALA n 
17 146  ARG n 
17 147  LYS n 
17 148  GLU n 
17 149  GLN n 
17 150  GLU n 
17 151  GLN n 
17 152  LYS n 
17 153  ALA n 
17 154  GLU n 
17 155  GLU n 
17 156  GLU n 
17 157  ARG n 
17 158  ILE n 
17 159  ARG n 
17 160  MET n 
17 161  GLU n 
17 162  ASN n 
17 163  ILE n 
17 164  LEU n 
17 165  SER n 
17 166  GLY n 
17 167  ASN n 
17 168  PRO n 
17 169  LEU n 
17 170  LEU n 
17 171  ASN n 
17 172  LEU n 
17 173  THR n 
17 174  GLY n 
17 175  PRO n 
17 176  SER n 
17 177  GLN n 
17 178  PRO n 
17 179  GLN n 
17 180  ALA n 
17 181  ASN n 
17 182  PHE n 
17 183  LYS n 
17 184  VAL n 
17 185  LYS n 
17 186  ARG n 
17 187  ARG n 
17 188  TRP n 
17 189  ASP n 
17 190  ASP n 
17 191  ASP n 
17 192  VAL n 
17 193  VAL n 
17 194  PHE n 
17 195  LYS n 
17 196  ASN n 
17 197  CYS n 
17 198  ALA n 
17 199  LYS n 
17 200  GLY n 
17 201  VAL n 
17 202  ASP n 
17 203  ASP n 
17 204  GLN n 
17 205  LYS n 
17 206  LYS n 
17 207  ASP n 
17 208  LYS n 
17 209  ARG n 
17 210  PHE n 
17 211  VAL n 
17 212  ASN n 
17 213  ASP n 
17 214  THR n 
17 215  LEU n 
17 216  ARG n 
17 217  SER n 
17 218  GLU n 
17 219  PHE n 
17 220  HIS n 
17 221  LYS n 
17 222  LYS n 
17 223  PHE n 
17 224  MET n 
17 225  GLU n 
17 226  LYS n 
17 227  TYR n 
17 228  ILE n 
17 229  LYS n 
18 1    MET n 
18 2    TYR n 
18 3    ASN n 
18 4    GLY n 
18 5    ILE n 
18 6    GLY n 
18 7    LEU n 
18 8    PRO n 
18 9    THR n 
18 10   PRO n 
18 11   ARG n 
18 12   GLY n 
18 13   SER n 
18 14   GLY n 
18 15   THR n 
18 16   ASN n 
18 17   GLY n 
18 18   TYR n 
18 19   VAL n 
18 20   GLN n 
18 21   ARG n 
18 22   ASN n 
18 23   LEU n 
18 24   SER n 
18 25   LEU n 
18 26   VAL n 
18 27   ARG n 
18 28   GLY n 
18 29   ARG n 
18 30   ARG n 
18 31   GLY n 
18 32   GLU n 
18 33   ARG n 
18 34   PRO n 
18 35   ASP n 
18 36   TYR n 
18 37   LYS n 
18 38   GLY n 
18 39   GLU n 
18 40   GLU n 
18 41   GLU n 
18 42   LEU n 
18 43   ARG n 
18 44   ARG n 
18 45   LEU n 
18 46   GLU n 
18 47   ALA n 
18 48   ALA n 
18 49   LEU n 
18 50   VAL n 
18 51   LYS n 
18 52   ARG n 
18 53   PRO n 
18 54   ASN n 
18 55   PRO n 
18 56   ASP n 
18 57   ILE n 
18 58   LEU n 
18 59   ASP n 
18 60   HIS n 
18 61   GLU n 
18 62   ARG n 
18 63   LYS n 
18 64   ARG n 
18 65   ARG n 
18 66   VAL n 
18 67   GLU n 
18 68   LEU n 
18 69   ARG n 
18 70   CYS n 
18 71   LEU n 
18 72   GLU n 
18 73   LEU n 
18 74   GLU n 
18 75   GLU n 
18 76   MET n 
18 77   MET n 
18 78   GLU n 
18 79   GLU n 
18 80   GLN n 
18 81   GLY n 
18 82   TYR n 
18 83   GLU n 
18 84   GLU n 
18 85   GLN n 
18 86   GLN n 
18 87   ILE n 
18 88   GLN n 
18 89   GLU n 
18 90   LYS n 
18 91   VAL n 
18 92   ALA n 
18 93   THR n 
18 94   PHE n 
18 95   ARG n 
18 96   LEU n 
18 97   MET n 
18 98   LEU n 
18 99   LEU n 
18 100  GLU n 
18 101  LYS n 
18 102  ASP n 
18 103  VAL n 
18 104  ASN n 
18 105  PRO n 
18 106  GLY n 
18 107  GLY n 
18 108  LYS n 
18 109  GLU n 
18 110  GLU n 
18 111  THR n 
18 112  PRO n 
18 113  GLY n 
18 114  GLN n 
18 115  ARG n 
18 116  PRO n 
18 117  ALA n 
18 118  VAL n 
18 119  THR n 
18 120  GLU n 
18 121  THR n 
18 122  HIS n 
18 123  GLN n 
18 124  LEU n 
18 125  ALA n 
18 126  GLU n 
18 127  LEU n 
18 128  ASN n 
18 129  GLU n 
18 130  LYS n 
18 131  LYS n 
18 132  ASN n 
18 133  GLU n 
18 134  ARG n 
18 135  LEU n 
18 136  ARG n 
18 137  ALA n 
18 138  ALA n 
18 139  PHE n 
18 140  GLY n 
18 141  ILE n 
18 142  SER n 
18 143  ASP n 
18 144  SER n 
18 145  TYR n 
18 146  VAL n 
18 147  ASP n 
18 148  GLY n 
18 149  SER n 
18 150  SER n 
18 151  PHE n 
18 152  ASP n 
18 153  PRO n 
18 154  GLN n 
18 155  ARG n 
18 156  ARG n 
18 157  ALA n 
18 158  ARG n 
18 159  GLU n 
18 160  ALA n 
18 161  LYS n 
18 162  GLN n 
18 163  PRO n 
18 164  ALA n 
18 165  PRO n 
18 166  GLU n 
18 167  PRO n 
18 168  PRO n 
18 169  LYS n 
18 170  PRO n 
18 171  TYR n 
18 172  SER n 
18 173  LEU n 
18 174  VAL n 
18 175  ARG n 
18 176  GLU n 
18 177  SER n 
18 178  SER n 
18 179  SER n 
18 180  SER n 
18 181  ARG n 
18 182  SER n 
18 183  PRO n 
18 184  THR n 
18 185  PRO n 
18 186  LYS n 
18 187  GLN n 
18 188  LYS n 
18 189  LYS n 
18 190  LYS n 
18 191  LYS n 
18 192  LYS n 
18 193  LYS n 
18 194  LYS n 
18 195  ASP n 
18 196  ARG n 
18 197  GLY n 
18 198  ARG n 
18 199  ARG n 
18 200  SER n 
18 201  GLU n 
18 202  SER n 
18 203  SER n 
18 204  SER n 
18 205  PRO n 
18 206  ARG n 
18 207  ARG n 
18 208  GLU n 
18 209  ARG n 
18 210  LYS n 
18 211  LYS n 
18 212  SER n 
18 213  SER n 
18 214  LYS n 
18 215  LYS n 
18 216  LYS n 
18 217  LYS n 
18 218  HIS n 
18 219  ARG n 
18 220  SER n 
18 221  GLU n 
18 222  SER n 
18 223  GLU n 
18 224  SER n 
18 225  LYS n 
18 226  LYS n 
18 227  ARG n 
18 228  LYS n 
18 229  HIS n 
18 230  ARG n 
18 231  SER n 
18 232  PRO n 
18 233  THR n 
18 234  PRO n 
18 235  LYS n 
18 236  SER n 
18 237  LYS n 
18 238  ARG n 
18 239  LYS n 
18 240  SER n 
18 241  LYS n 
18 242  ASP n 
18 243  LYS n 
18 244  LYS n 
18 245  ARG n 
18 246  LYS n 
18 247  ARG n 
18 248  SER n 
18 249  ARG n 
18 250  SER n 
18 251  THR n 
18 252  THR n 
18 253  PRO n 
18 254  ALA n 
18 255  PRO n 
18 256  LYS n 
18 257  SER n 
18 258  ARG n 
18 259  ARG n 
18 260  ALA n 
18 261  HIS n 
18 262  ARG n 
18 263  SER n 
18 264  THR n 
18 265  SER n 
18 266  ALA n 
18 267  ASP n 
18 268  SER n 
18 269  ALA n 
18 270  SER n 
18 271  SER n 
18 272  SER n 
18 273  ASP n 
18 274  THR n 
18 275  SER n 
18 276  ARG n 
18 277  SER n 
18 278  ARG n 
18 279  SER n 
18 280  ARG n 
18 281  SER n 
18 282  ALA n 
18 283  ALA n 
18 284  ALA n 
18 285  LYS n 
18 286  THR n 
18 287  HIS n 
18 288  THR n 
18 289  THR n 
18 290  ALA n 
18 291  LEU n 
18 292  ALA n 
18 293  GLY n 
18 294  ARG n 
18 295  SER n 
18 296  PRO n 
18 297  SER n 
18 298  PRO n 
18 299  ALA n 
18 300  SER n 
18 301  GLY n 
18 302  ARG n 
18 303  ARG n 
18 304  GLY n 
18 305  GLU n 
18 306  GLY n 
18 307  ASP n 
18 308  ALA n 
18 309  PRO n 
18 310  PHE n 
18 311  SER n 
18 312  GLU n 
18 313  PRO n 
18 314  GLY n 
18 315  THR n 
18 316  THR n 
18 317  SER n 
18 318  THR n 
18 319  GLN n 
18 320  ARG n 
18 321  PRO n 
18 322  SER n 
18 323  SER n 
18 324  PRO n 
18 325  GLU n 
18 326  THR n 
18 327  ALA n 
18 328  THR n 
18 329  LYS n 
18 330  GLN n 
18 331  PRO n 
18 332  SER n 
18 333  SER n 
18 334  PRO n 
18 335  TYR n 
18 336  GLU n 
18 337  ASP n 
18 338  LYS n 
18 339  ASP n 
18 340  LYS n 
18 341  ASP n 
18 342  LYS n 
18 343  LYS n 
18 344  GLU n 
18 345  LYS n 
18 346  SER n 
18 347  ALA n 
18 348  THR n 
18 349  ARG n 
18 350  PRO n 
18 351  SER n 
18 352  PRO n 
18 353  SER n 
18 354  PRO n 
18 355  GLU n 
18 356  ARG n 
18 357  SER n 
18 358  SER n 
18 359  THR n 
18 360  GLY n 
18 361  PRO n 
18 362  GLU n 
18 363  PRO n 
18 364  PRO n 
18 365  ALA n 
18 366  PRO n 
18 367  THR n 
18 368  PRO n 
18 369  LEU n 
18 370  LEU n 
18 371  ALA n 
18 372  GLU n 
18 373  ARG n 
18 374  HIS n 
18 375  GLY n 
18 376  GLY n 
18 377  SER n 
18 378  PRO n 
18 379  GLN n 
18 380  PRO n 
18 381  LEU n 
18 382  ALA n 
18 383  THR n 
18 384  THR n 
18 385  PRO n 
18 386  LEU n 
18 387  SER n 
18 388  GLN n 
18 389  GLU n 
18 390  PRO n 
18 391  VAL n 
18 392  ASN n 
18 393  PRO n 
18 394  PRO n 
18 395  SER n 
18 396  GLU n 
18 397  ALA n 
18 398  SER n 
18 399  PRO n 
18 400  THR n 
18 401  ARG n 
18 402  ASP n 
18 403  ARG n 
18 404  SER n 
18 405  PRO n 
18 406  PRO n 
18 407  LYS n 
18 408  SER n 
18 409  PRO n 
18 410  GLU n 
18 411  LYS n 
18 412  LEU n 
18 413  PRO n 
18 414  GLN n 
18 415  SER n 
18 416  SER n 
18 417  SER n 
18 418  SER n 
18 419  GLU n 
18 420  SER n 
18 421  SER n 
18 422  PRO n 
18 423  PRO n 
18 424  SER n 
18 425  PRO n 
18 426  GLN n 
18 427  PRO n 
18 428  THR n 
18 429  LYS n 
18 430  VAL n 
18 431  SER n 
18 432  ARG n 
18 433  HIS n 
18 434  ALA n 
18 435  SER n 
18 436  SER n 
18 437  SER n 
18 438  PRO n 
18 439  GLU n 
18 440  SER n 
18 441  PRO n 
18 442  LYS n 
18 443  PRO n 
18 444  ALA n 
18 445  PRO n 
18 446  ALA n 
18 447  PRO n 
18 448  GLY n 
18 449  SER n 
18 450  HIS n 
18 451  ARG n 
18 452  GLU n 
18 453  ILE n 
18 454  SER n 
18 455  SER n 
18 456  SER n 
18 457  PRO n 
18 458  THR n 
18 459  SER n 
18 460  LYS n 
18 461  ASN n 
18 462  ARG n 
18 463  SER n 
18 464  HIS n 
18 465  GLY n 
18 466  ARG n 
18 467  ALA n 
18 468  LYS n 
18 469  ARG n 
18 470  ASP n 
18 471  LYS n 
18 472  SER n 
18 473  HIS n 
18 474  SER n 
18 475  HIS n 
18 476  THR n 
18 477  PRO n 
18 478  SER n 
18 479  ARG n 
18 480  ARG n 
18 481  MET n 
18 482  GLY n 
18 483  ARG n 
18 484  SER n 
18 485  ARG n 
18 486  SER n 
18 487  PRO n 
18 488  ALA n 
18 489  THR n 
18 490  ALA n 
18 491  LYS n 
18 492  ARG n 
18 493  GLY n 
18 494  ARG n 
18 495  SER n 
18 496  ARG n 
18 497  SER n 
18 498  ARG n 
18 499  THR n 
18 500  PRO n 
18 501  THR n 
18 502  LYS n 
18 503  ARG n 
18 504  GLY n 
18 505  HIS n 
18 506  SER n 
18 507  ARG n 
18 508  SER n 
18 509  ARG n 
18 510  SER n 
18 511  PRO n 
18 512  GLN n 
18 513  TRP n 
18 514  ARG n 
18 515  ARG n 
18 516  SER n 
18 517  ARG n 
18 518  SER n 
18 519  ALA n 
18 520  GLN n 
18 521  ARG n 
18 522  TRP n 
18 523  GLY n 
18 524  ARG n 
18 525  SER n 
18 526  ARG n 
18 527  SER n 
18 528  PRO n 
18 529  GLN n 
18 530  ARG n 
18 531  ARG n 
18 532  GLY n 
18 533  ARG n 
18 534  SER n 
18 535  ARG n 
18 536  SER n 
18 537  PRO n 
18 538  GLN n 
18 539  ARG n 
18 540  PRO n 
18 541  GLY n 
18 542  TRP n 
18 543  SER n 
18 544  ARG n 
18 545  SER n 
18 546  ARG n 
18 547  ASN n 
18 548  THR n 
18 549  GLN n 
18 550  ARG n 
18 551  ARG n 
18 552  GLY n 
18 553  ARG n 
18 554  SER n 
18 555  ARG n 
18 556  SER n 
18 557  ALA n 
18 558  ARG n 
18 559  ARG n 
18 560  GLY n 
18 561  ARG n 
18 562  SER n 
18 563  HIS n 
18 564  SER n 
18 565  ARG n 
18 566  SER n 
18 567  PRO n 
18 568  ALA n 
18 569  THR n 
18 570  ARG n 
18 571  GLY n 
18 572  ARG n 
18 573  SER n 
18 574  ARG n 
18 575  SER n 
18 576  ARG n 
18 577  THR n 
18 578  PRO n 
18 579  ALA n 
18 580  ARG n 
18 581  ARG n 
18 582  GLY n 
18 583  ARG n 
18 584  SER n 
18 585  ARG n 
18 586  SER n 
18 587  ARG n 
18 588  THR n 
18 589  PRO n 
18 590  ALA n 
18 591  ARG n 
18 592  ARG n 
18 593  ARG n 
18 594  SER n 
18 595  ARG n 
18 596  SER n 
18 597  ARG n 
18 598  THR n 
18 599  PRO n 
18 600  THR n 
18 601  ARG n 
18 602  ARG n 
18 603  ARG n 
18 604  SER n 
18 605  ARG n 
18 606  SER n 
18 607  ARG n 
18 608  THR n 
18 609  PRO n 
18 610  ALA n 
18 611  ARG n 
18 612  ARG n 
18 613  GLY n 
18 614  ARG n 
18 615  SER n 
18 616  ARG n 
18 617  SER n 
18 618  ARG n 
18 619  THR n 
18 620  PRO n 
18 621  ALA n 
18 622  ARG n 
18 623  ARG n 
18 624  ARG n 
18 625  SER n 
18 626  ARG n 
18 627  THR n 
18 628  ARG n 
18 629  SER n 
18 630  PRO n 
18 631  VAL n 
18 632  ARG n 
18 633  ARG n 
18 634  ARG n 
18 635  SER n 
18 636  ARG n 
18 637  SER n 
18 638  ARG n 
18 639  SER n 
18 640  PRO n 
18 641  ALA n 
18 642  ARG n 
18 643  ARG n 
18 644  SER n 
18 645  GLY n 
18 646  ARG n 
18 647  SER n 
18 648  ARG n 
18 649  SER n 
18 650  ARG n 
18 651  THR n 
18 652  PRO n 
18 653  ALA n 
18 654  ARG n 
18 655  ARG n 
18 656  GLY n 
18 657  ARG n 
18 658  SER n 
18 659  ARG n 
18 660  SER n 
18 661  ARG n 
18 662  THR n 
18 663  PRO n 
18 664  ALA n 
18 665  ARG n 
18 666  ARG n 
18 667  GLY n 
18 668  ARG n 
18 669  SER n 
18 670  ARG n 
18 671  SER n 
18 672  ARG n 
18 673  THR n 
18 674  PRO n 
18 675  ALA n 
18 676  ARG n 
18 677  ARG n 
18 678  SER n 
18 679  GLY n 
18 680  ARG n 
18 681  SER n 
18 682  ARG n 
18 683  SER n 
18 684  ARG n 
18 685  THR n 
18 686  PRO n 
18 687  ALA n 
18 688  ARG n 
18 689  ARG n 
18 690  GLY n 
18 691  ARG n 
18 692  SER n 
18 693  ARG n 
18 694  SER n 
18 695  ARG n 
18 696  THR n 
18 697  PRO n 
18 698  ARG n 
18 699  ARG n 
18 700  GLY n 
18 701  ARG n 
18 702  SER n 
18 703  ARG n 
18 704  SER n 
18 705  ARG n 
18 706  SER n 
18 707  LEU n 
18 708  VAL n 
18 709  ARG n 
18 710  ARG n 
18 711  GLY n 
18 712  ARG n 
18 713  SER n 
18 714  HIS n 
18 715  SER n 
18 716  ARG n 
18 717  THR n 
18 718  PRO n 
18 719  GLN n 
18 720  ARG n 
18 721  ARG n 
18 722  GLY n 
18 723  ARG n 
18 724  SER n 
18 725  GLY n 
18 726  SER n 
18 727  SER n 
18 728  SER n 
18 729  GLU n 
18 730  ARG n 
18 731  LYS n 
18 732  ASN n 
18 733  LYS n 
18 734  SER n 
18 735  ARG n 
18 736  THR n 
18 737  SER n 
18 738  GLN n 
18 739  ARG n 
18 740  ARG n 
18 741  SER n 
18 742  ARG n 
18 743  SER n 
18 744  ASN n 
18 745  SER n 
18 746  SER n 
18 747  PRO n 
18 748  GLU n 
18 749  MET n 
18 750  LYS n 
18 751  LYS n 
18 752  SER n 
18 753  ARG n 
18 754  ILE n 
18 755  SER n 
18 756  SER n 
18 757  ARG n 
18 758  ARG n 
18 759  SER n 
18 760  ARG n 
18 761  SER n 
18 762  LEU n 
18 763  SER n 
18 764  SER n 
18 765  PRO n 
18 766  ARG n 
18 767  SER n 
18 768  LYS n 
18 769  ALA n 
18 770  LYS n 
18 771  SER n 
18 772  ARG n 
18 773  LEU n 
18 774  SER n 
18 775  LEU n 
18 776  ARG n 
18 777  ARG n 
18 778  SER n 
18 779  LEU n 
18 780  SER n 
18 781  GLY n 
18 782  SER n 
18 783  SER n 
18 784  PRO n 
18 785  CYS n 
18 786  PRO n 
18 787  LYS n 
18 788  GLN n 
18 789  LYS n 
18 790  SER n 
18 791  GLN n 
18 792  THR n 
18 793  PRO n 
18 794  PRO n 
18 795  ARG n 
18 796  ARG n 
18 797  SER n 
18 798  ARG n 
18 799  SER n 
18 800  GLY n 
18 801  SER n 
18 802  SER n 
18 803  GLN n 
18 804  PRO n 
18 805  LYS n 
18 806  ALA n 
18 807  LYS n 
18 808  SER n 
18 809  ARG n 
18 810  THR n 
18 811  PRO n 
18 812  PRO n 
18 813  ARG n 
18 814  ARG n 
18 815  SER n 
18 816  ARG n 
18 817  SER n 
18 818  SER n 
18 819  SER n 
18 820  SER n 
18 821  PRO n 
18 822  PRO n 
18 823  PRO n 
18 824  LYS n 
18 825  GLN n 
18 826  LYS n 
18 827  SER n 
18 828  LYS n 
18 829  THR n 
18 830  PRO n 
18 831  SER n 
18 832  ARG n 
18 833  GLN n 
18 834  SER n 
18 835  HIS n 
18 836  SER n 
18 837  SER n 
18 838  SER n 
18 839  SER n 
18 840  PRO n 
18 841  HIS n 
18 842  PRO n 
18 843  LYS n 
18 844  VAL n 
18 845  LYS n 
18 846  SER n 
18 847  GLY n 
18 848  THR n 
18 849  PRO n 
18 850  PRO n 
18 851  ARG n 
18 852  GLN n 
18 853  GLY n 
18 854  SER n 
18 855  ILE n 
18 856  THR n 
18 857  SER n 
18 858  PRO n 
18 859  GLN n 
18 860  ALA n 
18 861  ASN n 
18 862  GLU n 
18 863  GLN n 
18 864  SER n 
18 865  VAL n 
18 866  THR n 
18 867  PRO n 
18 868  GLN n 
18 869  ARG n 
18 870  ARG n 
18 871  SER n 
18 872  CYS n 
18 873  PHE n 
18 874  GLU n 
18 875  SER n 
18 876  SER n 
18 877  PRO n 
18 878  ASP n 
18 879  PRO n 
18 880  GLU n 
18 881  LEU n 
18 882  LYS n 
18 883  SER n 
18 884  ARG n 
18 885  THR n 
18 886  PRO n 
18 887  SER n 
18 888  ARG n 
18 889  HIS n 
18 890  SER n 
18 891  CYS n 
18 892  SER n 
18 893  GLY n 
18 894  SER n 
18 895  SER n 
18 896  PRO n 
18 897  PRO n 
18 898  ARG n 
18 899  VAL n 
18 900  LYS n 
18 901  SER n 
18 902  SER n 
18 903  THR n 
18 904  PRO n 
18 905  PRO n 
18 906  ARG n 
18 907  GLN n 
18 908  SER n 
18 909  PRO n 
18 910  SER n 
18 911  ARG n 
18 912  SER n 
18 913  SER n 
18 914  SER n 
18 915  PRO n 
18 916  GLN n 
18 917  PRO n 
18 918  LYS n 
18 919  VAL n 
18 920  LYS n 
18 921  ALA n 
18 922  ILE n 
18 923  ILE n 
18 924  SER n 
18 925  PRO n 
18 926  ARG n 
18 927  GLN n 
18 928  ARG n 
18 929  SER n 
18 930  HIS n 
18 931  SER n 
18 932  GLY n 
18 933  SER n 
18 934  SER n 
18 935  SER n 
18 936  PRO n 
18 937  SER n 
18 938  PRO n 
18 939  SER n 
18 940  ARG n 
18 941  VAL n 
18 942  THR n 
18 943  SER n 
18 944  ARG n 
18 945  THR n 
18 946  THR n 
18 947  PRO n 
18 948  ARG n 
18 949  ARG n 
18 950  SER n 
18 951  ARG n 
18 952  SER n 
18 953  VAL n 
18 954  SER n 
18 955  PRO n 
18 956  CYS n 
18 957  SER n 
18 958  ASN n 
18 959  VAL n 
18 960  GLU n 
18 961  SER n 
18 962  ARG n 
18 963  LEU n 
18 964  LEU n 
18 965  PRO n 
18 966  ARG n 
18 967  TYR n 
18 968  SER n 
18 969  HIS n 
18 970  SER n 
18 971  GLY n 
18 972  SER n 
18 973  SER n 
18 974  SER n 
18 975  PRO n 
18 976  ASP n 
18 977  THR n 
18 978  LYS n 
18 979  VAL n 
18 980  LYS n 
18 981  PRO n 
18 982  GLU n 
18 983  THR n 
18 984  PRO n 
18 985  PRO n 
18 986  ARG n 
18 987  GLN n 
18 988  SER n 
18 989  HIS n 
18 990  SER n 
18 991  GLY n 
18 992  SER n 
18 993  ILE n 
18 994  SER n 
18 995  PRO n 
18 996  TYR n 
18 997  PRO n 
18 998  LYS n 
18 999  VAL n 
18 1000 LYS n 
18 1001 ALA n 
18 1002 GLN n 
18 1003 THR n 
18 1004 PRO n 
18 1005 PRO n 
18 1006 GLY n 
18 1007 PRO n 
18 1008 SER n 
18 1009 LEU n 
18 1010 SER n 
18 1011 GLY n 
18 1012 SER n 
18 1013 LYS n 
18 1014 SER n 
18 1015 PRO n 
18 1016 CYS n 
18 1017 PRO n 
18 1018 GLN n 
18 1019 GLU n 
18 1020 LYS n 
18 1021 SER n 
18 1022 LYS n 
18 1023 ASP n 
18 1024 SER n 
18 1025 LEU n 
18 1026 VAL n 
18 1027 GLN n 
18 1028 SER n 
18 1029 CYS n 
18 1030 PRO n 
18 1031 GLY n 
18 1032 SER n 
18 1033 LEU n 
18 1034 SER n 
18 1035 LEU n 
18 1036 CYS n 
18 1037 ALA n 
18 1038 GLY n 
18 1039 VAL n 
18 1040 LYS n 
18 1041 SER n 
18 1042 SER n 
18 1043 THR n 
18 1044 PRO n 
18 1045 PRO n 
18 1046 GLY n 
18 1047 GLU n 
18 1048 SER n 
18 1049 TYR n 
18 1050 PHE n 
18 1051 GLY n 
18 1052 VAL n 
18 1053 SER n 
18 1054 SER n 
18 1055 LEU n 
18 1056 GLN n 
18 1057 LEU n 
18 1058 LYS n 
18 1059 GLY n 
18 1060 GLN n 
18 1061 SER n 
18 1062 GLN n 
18 1063 THR n 
18 1064 SER n 
18 1065 PRO n 
18 1066 ASP n 
18 1067 HIS n 
18 1068 ARG n 
18 1069 SER n 
18 1070 ASP n 
18 1071 THR n 
18 1072 SER n 
18 1073 SER n 
18 1074 PRO n 
18 1075 GLU n 
18 1076 VAL n 
18 1077 ARG n 
18 1078 GLN n 
18 1079 SER n 
18 1080 HIS n 
18 1081 SER n 
18 1082 GLU n 
18 1083 SER n 
18 1084 PRO n 
18 1085 SER n 
18 1086 LEU n 
18 1087 GLN n 
18 1088 SER n 
18 1089 LYS n 
18 1090 SER n 
18 1091 GLN n 
18 1092 THR n 
18 1093 SER n 
18 1094 PRO n 
18 1095 LYS n 
18 1096 GLY n 
18 1097 GLY n 
18 1098 ARG n 
18 1099 SER n 
18 1100 ARG n 
18 1101 SER n 
18 1102 SER n 
18 1103 SER n 
18 1104 PRO n 
18 1105 VAL n 
18 1106 THR n 
18 1107 GLU n 
18 1108 LEU n 
18 1109 ALA n 
18 1110 SER n 
18 1111 ARG n 
18 1112 SER n 
18 1113 PRO n 
18 1114 ILE n 
18 1115 ARG n 
18 1116 GLN n 
18 1117 ASP n 
18 1118 ARG n 
18 1119 GLY n 
18 1120 GLU n 
18 1121 PHE n 
18 1122 SER n 
18 1123 ALA n 
18 1124 SER n 
18 1125 PRO n 
18 1126 MET n 
18 1127 LEU n 
18 1128 LYS n 
18 1129 SER n 
18 1130 GLY n 
18 1131 MET n 
18 1132 SER n 
18 1133 PRO n 
18 1134 GLU n 
18 1135 GLN n 
18 1136 SER n 
18 1137 ARG n 
18 1138 PHE n 
18 1139 GLN n 
18 1140 SER n 
18 1141 ASP n 
18 1142 SER n 
18 1143 SER n 
18 1144 SER n 
18 1145 TYR n 
18 1146 PRO n 
18 1147 THR n 
18 1148 VAL n 
18 1149 ASP n 
18 1150 SER n 
18 1151 ASN n 
18 1152 SER n 
18 1153 LEU n 
18 1154 LEU n 
18 1155 GLY n 
18 1156 GLN n 
18 1157 SER n 
18 1158 ARG n 
18 1159 LEU n 
18 1160 GLU n 
18 1161 THR n 
18 1162 ALA n 
18 1163 GLU n 
18 1164 SER n 
18 1165 LYS n 
18 1166 GLU n 
18 1167 LYS n 
18 1168 MET n 
18 1169 ALA n 
18 1170 LEU n 
18 1171 PRO n 
18 1172 PRO n 
18 1173 GLN n 
18 1174 GLU n 
18 1175 ASP n 
18 1176 ALA n 
18 1177 THR n 
18 1178 ALA n 
18 1179 SER n 
18 1180 PRO n 
18 1181 PRO n 
18 1182 ARG n 
18 1183 GLN n 
18 1184 LYS n 
18 1185 ASP n 
18 1186 LYS n 
18 1187 PHE n 
18 1188 SER n 
18 1189 PRO n 
18 1190 PHE n 
18 1191 PRO n 
18 1192 VAL n 
18 1193 GLN n 
18 1194 ASP n 
18 1195 ARG n 
18 1196 PRO n 
18 1197 GLU n 
18 1198 SER n 
18 1199 SER n 
18 1200 LEU n 
18 1201 VAL n 
18 1202 PHE n 
18 1203 LYS n 
18 1204 ASP n 
18 1205 THR n 
18 1206 LEU n 
18 1207 ARG n 
18 1208 THR n 
18 1209 PRO n 
18 1210 PRO n 
18 1211 ARG n 
18 1212 GLU n 
18 1213 ARG n 
18 1214 SER n 
18 1215 GLY n 
18 1216 ALA n 
18 1217 GLY n 
18 1218 SER n 
18 1219 SER n 
18 1220 PRO n 
18 1221 GLU n 
18 1222 THR n 
18 1223 LYS n 
18 1224 GLU n 
18 1225 GLN n 
18 1226 ASN n 
18 1227 SER n 
18 1228 ALA n 
18 1229 LEU n 
18 1230 PRO n 
18 1231 THR n 
18 1232 SER n 
18 1233 SER n 
18 1234 GLN n 
18 1235 ASP n 
18 1236 GLU n 
18 1237 GLU n 
18 1238 LEU n 
18 1239 MET n 
18 1240 GLU n 
18 1241 VAL n 
18 1242 VAL n 
18 1243 GLU n 
18 1244 LYS n 
18 1245 SER n 
18 1246 GLU n 
18 1247 GLU n 
18 1248 PRO n 
18 1249 ALA n 
18 1250 GLY n 
18 1251 GLN n 
18 1252 ILE n 
18 1253 LEU n 
18 1254 SER n 
18 1255 HIS n 
18 1256 LEU n 
18 1257 SER n 
18 1258 SER n 
18 1259 GLU n 
18 1260 LEU n 
18 1261 LYS n 
18 1262 GLU n 
18 1263 MET n 
18 1264 SER n 
18 1265 THR n 
18 1266 SER n 
18 1267 ASN n 
18 1268 PHE n 
18 1269 GLU n 
18 1270 SER n 
18 1271 SER n 
18 1272 PRO n 
18 1273 GLU n 
18 1274 VAL n 
18 1275 GLU n 
18 1276 GLU n 
18 1277 ARG n 
18 1278 PRO n 
18 1279 ALA n 
18 1280 VAL n 
18 1281 SER n 
18 1282 LEU n 
18 1283 THR n 
18 1284 LEU n 
18 1285 ASP n 
18 1286 GLN n 
18 1287 SER n 
18 1288 GLN n 
18 1289 SER n 
18 1290 GLN n 
18 1291 ALA n 
18 1292 SER n 
18 1293 LEU n 
18 1294 GLU n 
18 1295 ALA n 
18 1296 VAL n 
18 1297 GLU n 
18 1298 VAL n 
18 1299 PRO n 
18 1300 SER n 
18 1301 MET n 
18 1302 ALA n 
18 1303 SER n 
18 1304 SER n 
18 1305 TRP n 
18 1306 GLY n 
18 1307 GLY n 
18 1308 PRO n 
18 1309 HIS n 
18 1310 PHE n 
18 1311 SER n 
18 1312 PRO n 
18 1313 GLU n 
18 1314 HIS n 
18 1315 LYS n 
18 1316 GLU n 
18 1317 LEU n 
18 1318 SER n 
18 1319 ASN n 
18 1320 SER n 
18 1321 PRO n 
18 1322 LEU n 
18 1323 ARG n 
18 1324 GLU n 
18 1325 ASN n 
18 1326 SER n 
18 1327 PHE n 
18 1328 GLY n 
18 1329 SER n 
18 1330 PRO n 
18 1331 LEU n 
18 1332 GLU n 
18 1333 PHE n 
18 1334 ARG n 
18 1335 ASN n 
18 1336 SER n 
18 1337 GLY n 
18 1338 PRO n 
18 1339 LEU n 
18 1340 GLY n 
18 1341 THR n 
18 1342 GLU n 
18 1343 MET n 
18 1344 ASN n 
18 1345 THR n 
18 1346 GLY n 
18 1347 PHE n 
18 1348 SER n 
18 1349 SER n 
18 1350 GLU n 
18 1351 VAL n 
18 1352 LYS n 
18 1353 GLU n 
18 1354 ASP n 
18 1355 LEU n 
18 1356 ASN n 
18 1357 GLY n 
18 1358 PRO n 
18 1359 PHE n 
18 1360 LEU n 
18 1361 ASN n 
18 1362 GLN n 
18 1363 LEU n 
18 1364 GLU n 
18 1365 THR n 
18 1366 ASP n 
18 1367 PRO n 
18 1368 SER n 
18 1369 LEU n 
18 1370 ASP n 
18 1371 MET n 
18 1372 LYS n 
18 1373 GLU n 
18 1374 GLN n 
18 1375 SER n 
18 1376 THR n 
18 1377 ARG n 
18 1378 SER n 
18 1379 SER n 
18 1380 GLY n 
18 1381 HIS n 
18 1382 SER n 
18 1383 SER n 
18 1384 SER n 
18 1385 GLU n 
18 1386 LEU n 
18 1387 SER n 
18 1388 PRO n 
18 1389 ASP n 
18 1390 ALA n 
18 1391 VAL n 
18 1392 GLU n 
18 1393 LYS n 
18 1394 ALA n 
18 1395 GLY n 
18 1396 MET n 
18 1397 SER n 
18 1398 SER n 
18 1399 ASN n 
18 1400 GLN n 
18 1401 SER n 
18 1402 ILE n 
18 1403 SER n 
18 1404 SER n 
18 1405 PRO n 
18 1406 VAL n 
18 1407 LEU n 
18 1408 ASP n 
18 1409 ALA n 
18 1410 VAL n 
18 1411 PRO n 
18 1412 ARG n 
18 1413 THR n 
18 1414 PRO n 
18 1415 SER n 
18 1416 ARG n 
18 1417 GLU n 
18 1418 ARG n 
18 1419 SER n 
18 1420 SER n 
18 1421 SER n 
18 1422 ALA n 
18 1423 SER n 
18 1424 SER n 
18 1425 PRO n 
18 1426 GLU n 
18 1427 MET n 
18 1428 LYS n 
18 1429 ASP n 
18 1430 GLY n 
18 1431 LEU n 
18 1432 PRO n 
18 1433 ARG n 
18 1434 THR n 
18 1435 PRO n 
18 1436 SER n 
18 1437 ARG n 
18 1438 ARG n 
18 1439 SER n 
18 1440 ARG n 
18 1441 SER n 
18 1442 GLY n 
18 1443 SER n 
18 1444 SER n 
18 1445 PRO n 
18 1446 GLY n 
18 1447 LEU n 
18 1448 ARG n 
18 1449 ASP n 
18 1450 GLY n 
18 1451 SER n 
18 1452 GLY n 
18 1453 THR n 
18 1454 PRO n 
18 1455 SER n 
18 1456 ARG n 
18 1457 HIS n 
18 1458 SER n 
18 1459 LEU n 
18 1460 SER n 
18 1461 GLY n 
18 1462 SER n 
18 1463 SER n 
18 1464 PRO n 
18 1465 GLY n 
18 1466 MET n 
18 1467 LYS n 
18 1468 ASP n 
18 1469 ILE n 
18 1470 PRO n 
18 1471 ARG n 
18 1472 THR n 
18 1473 PRO n 
18 1474 SER n 
18 1475 ARG n 
18 1476 GLY n 
18 1477 ARG n 
18 1478 SER n 
18 1479 GLU n 
18 1480 CYS n 
18 1481 ASP n 
18 1482 SER n 
18 1483 SER n 
18 1484 PRO n 
18 1485 GLU n 
18 1486 PRO n 
18 1487 LYS n 
18 1488 ALA n 
18 1489 LEU n 
18 1490 PRO n 
18 1491 GLN n 
18 1492 THR n 
18 1493 PRO n 
18 1494 ARG n 
18 1495 PRO n 
18 1496 ARG n 
18 1497 SER n 
18 1498 ARG n 
18 1499 SER n 
18 1500 PRO n 
18 1501 SER n 
18 1502 SER n 
18 1503 PRO n 
18 1504 GLU n 
18 1505 LEU n 
18 1506 ASN n 
18 1507 ASN n 
18 1508 LYS n 
18 1509 CYS n 
18 1510 LEU n 
18 1511 THR n 
18 1512 PRO n 
18 1513 GLN n 
18 1514 ARG n 
18 1515 GLU n 
18 1516 ARG n 
18 1517 SER n 
18 1518 GLY n 
18 1519 SER n 
18 1520 GLU n 
18 1521 SER n 
18 1522 SER n 
18 1523 VAL n 
18 1524 ASP n 
18 1525 GLN n 
18 1526 LYS n 
18 1527 THR n 
18 1528 VAL n 
18 1529 ALA n 
18 1530 ARG n 
18 1531 THR n 
18 1532 PRO n 
18 1533 LEU n 
18 1534 GLY n 
18 1535 GLN n 
18 1536 ARG n 
18 1537 SER n 
18 1538 ARG n 
18 1539 SER n 
18 1540 GLY n 
18 1541 SER n 
18 1542 SER n 
18 1543 GLN n 
18 1544 GLU n 
18 1545 LEU n 
18 1546 ASP n 
18 1547 VAL n 
18 1548 LYS n 
18 1549 PRO n 
18 1550 SER n 
18 1551 ALA n 
18 1552 SER n 
18 1553 PRO n 
18 1554 GLN n 
18 1555 GLU n 
18 1556 ARG n 
18 1557 SER n 
18 1558 GLU n 
18 1559 SER n 
18 1560 ASP n 
18 1561 SER n 
18 1562 SER n 
18 1563 PRO n 
18 1564 ASP n 
18 1565 SER n 
18 1566 LYS n 
18 1567 ALA n 
18 1568 LYS n 
18 1569 THR n 
18 1570 ARG n 
18 1571 THR n 
18 1572 PRO n 
18 1573 LEU n 
18 1574 ARG n 
18 1575 GLN n 
18 1576 ARG n 
18 1577 SER n 
18 1578 ARG n 
18 1579 SER n 
18 1580 GLY n 
18 1581 SER n 
18 1582 SER n 
18 1583 PRO n 
18 1584 GLU n 
18 1585 VAL n 
18 1586 ASP n 
18 1587 SER n 
18 1588 LYS n 
18 1589 SER n 
18 1590 ARG n 
18 1591 LEU n 
18 1592 SER n 
18 1593 PRO n 
18 1594 ARG n 
18 1595 ARG n 
18 1596 SER n 
18 1597 ARG n 
18 1598 SER n 
18 1599 GLY n 
18 1600 SER n 
18 1601 SER n 
18 1602 PRO n 
18 1603 GLU n 
18 1604 VAL n 
18 1605 LYS n 
18 1606 ASP n 
18 1607 LYS n 
18 1608 PRO n 
18 1609 ARG n 
18 1610 ALA n 
18 1611 ALA n 
18 1612 PRO n 
18 1613 ARG n 
18 1614 ALA n 
18 1615 GLN n 
18 1616 SER n 
18 1617 GLY n 
18 1618 SER n 
18 1619 ASP n 
18 1620 SER n 
18 1621 SER n 
18 1622 PRO n 
18 1623 GLU n 
18 1624 PRO n 
18 1625 LYS n 
18 1626 ALA n 
18 1627 PRO n 
18 1628 ALA n 
18 1629 PRO n 
18 1630 ARG n 
18 1631 ALA n 
18 1632 LEU n 
18 1633 PRO n 
18 1634 ARG n 
18 1635 ARG n 
18 1636 SER n 
18 1637 ARG n 
18 1638 SER n 
18 1639 GLY n 
18 1640 SER n 
18 1641 SER n 
18 1642 SER n 
18 1643 LYS n 
18 1644 GLY n 
18 1645 ARG n 
18 1646 GLY n 
18 1647 PRO n 
18 1648 SER n 
18 1649 PRO n 
18 1650 GLU n 
18 1651 GLY n 
18 1652 SER n 
18 1653 SER n 
18 1654 SER n 
18 1655 THR n 
18 1656 GLU n 
18 1657 SER n 
18 1658 SER n 
18 1659 PRO n 
18 1660 GLU n 
18 1661 HIS n 
18 1662 PRO n 
18 1663 PRO n 
18 1664 LYS n 
18 1665 SER n 
18 1666 ARG n 
18 1667 THR n 
18 1668 ALA n 
18 1669 ARG n 
18 1670 ARG n 
18 1671 GLY n 
18 1672 SER n 
18 1673 ARG n 
18 1674 SER n 
18 1675 SER n 
18 1676 PRO n 
18 1677 GLU n 
18 1678 PRO n 
18 1679 LYS n 
18 1680 THR n 
18 1681 LYS n 
18 1682 SER n 
18 1683 ARG n 
18 1684 THR n 
18 1685 PRO n 
18 1686 PRO n 
18 1687 ARG n 
18 1688 ARG n 
18 1689 ARG n 
18 1690 SER n 
18 1691 SER n 
18 1692 ARG n 
18 1693 SER n 
18 1694 SER n 
18 1695 PRO n 
18 1696 GLU n 
18 1697 LEU n 
18 1698 THR n 
18 1699 ARG n 
18 1700 LYS n 
18 1701 ALA n 
18 1702 ARG n 
18 1703 LEU n 
18 1704 SER n 
18 1705 ARG n 
18 1706 ARG n 
18 1707 SER n 
18 1708 ARG n 
18 1709 SER n 
18 1710 ALA n 
18 1711 SER n 
18 1712 SER n 
18 1713 SER n 
18 1714 PRO n 
18 1715 GLU n 
18 1716 THR n 
18 1717 ARG n 
18 1718 SER n 
18 1719 ARG n 
18 1720 THR n 
18 1721 PRO n 
18 1722 PRO n 
18 1723 ARG n 
18 1724 HIS n 
18 1725 ARG n 
18 1726 ARG n 
18 1727 SER n 
18 1728 PRO n 
18 1729 SER n 
18 1730 VAL n 
18 1731 SER n 
18 1732 SER n 
18 1733 PRO n 
18 1734 GLU n 
18 1735 PRO n 
18 1736 ALA n 
18 1737 GLU n 
18 1738 LYS n 
18 1739 SER n 
18 1740 ARG n 
18 1741 SER n 
18 1742 SER n 
18 1743 ARG n 
18 1744 ARG n 
18 1745 ARG n 
18 1746 ARG n 
18 1747 SER n 
18 1748 ALA n 
18 1749 SER n 
18 1750 SER n 
18 1751 PRO n 
18 1752 ARG n 
18 1753 THR n 
18 1754 LYS n 
18 1755 THR n 
18 1756 THR n 
18 1757 SER n 
18 1758 ARG n 
18 1759 ARG n 
18 1760 GLY n 
18 1761 ARG n 
18 1762 SER n 
18 1763 PRO n 
18 1764 SER n 
18 1765 PRO n 
18 1766 LYS n 
18 1767 PRO n 
18 1768 ARG n 
18 1769 GLY n 
18 1770 LEU n 
18 1771 GLN n 
18 1772 ARG n 
18 1773 SER n 
18 1774 ARG n 
18 1775 SER n 
18 1776 ARG n 
18 1777 SER n 
18 1778 ARG n 
18 1779 ARG n 
18 1780 GLU n 
18 1781 LYS n 
18 1782 THR n 
18 1783 ARG n 
18 1784 THR n 
18 1785 THR n 
18 1786 ARG n 
18 1787 ARG n 
18 1788 ARG n 
18 1789 ASP n 
18 1790 ARG n 
18 1791 SER n 
18 1792 GLY n 
18 1793 SER n 
18 1794 SER n 
18 1795 GLN n 
18 1796 SER n 
18 1797 THR n 
18 1798 SER n 
18 1799 ARG n 
18 1800 ARG n 
18 1801 ARG n 
18 1802 GLN n 
18 1803 ARG n 
18 1804 SER n 
18 1805 ARG n 
18 1806 SER n 
18 1807 ARG n 
18 1808 SER n 
18 1809 ARG n 
18 1810 VAL n 
18 1811 THR n 
18 1812 ARG n 
18 1813 ARG n 
18 1814 ARG n 
18 1815 ARG n 
18 1816 GLY n 
18 1817 GLY n 
18 1818 SER n 
18 1819 GLY n 
18 1820 TYR n 
18 1821 HIS n 
18 1822 SER n 
18 1823 ARG n 
18 1824 SER n 
18 1825 PRO n 
18 1826 ALA n 
18 1827 ARG n 
18 1828 GLN n 
18 1829 GLU n 
18 1830 SER n 
18 1831 SER n 
18 1832 ARG n 
18 1833 THR n 
18 1834 SER n 
18 1835 SER n 
18 1836 ARG n 
18 1837 ARG n 
18 1838 ARG n 
18 1839 ARG n 
18 1840 GLY n 
18 1841 ARG n 
18 1842 SER n 
18 1843 ARG n 
18 1844 THR n 
18 1845 PRO n 
18 1846 PRO n 
18 1847 THR n 
18 1848 SER n 
18 1849 ARG n 
18 1850 LYS n 
18 1851 ARG n 
18 1852 SER n 
18 1853 ARG n 
18 1854 SER n 
18 1855 ARG n 
18 1856 THR n 
18 1857 SER n 
18 1858 PRO n 
18 1859 ALA n 
18 1860 PRO n 
18 1861 TRP n 
18 1862 LYS n 
18 1863 ARG n 
18 1864 SER n 
18 1865 ARG n 
18 1866 SER n 
18 1867 ARG n 
18 1868 ALA n 
18 1869 SER n 
18 1870 PRO n 
18 1871 ALA n 
18 1872 THR n 
18 1873 HIS n 
18 1874 ARG n 
18 1875 ARG n 
18 1876 SER n 
18 1877 ARG n 
18 1878 SER n 
18 1879 ARG n 
18 1880 THR n 
18 1881 PRO n 
18 1882 LEU n 
18 1883 ILE n 
18 1884 SER n 
18 1885 ARG n 
18 1886 ARG n 
18 1887 ARG n 
18 1888 SER n 
18 1889 ARG n 
18 1890 SER n 
18 1891 ARG n 
18 1892 THR n 
18 1893 SER n 
18 1894 PRO n 
18 1895 VAL n 
18 1896 SER n 
18 1897 ARG n 
18 1898 ARG n 
18 1899 ARG n 
18 1900 SER n 
18 1901 ARG n 
18 1902 SER n 
18 1903 ARG n 
18 1904 THR n 
18 1905 SER n 
18 1906 VAL n 
18 1907 THR n 
18 1908 ARG n 
18 1909 ARG n 
18 1910 ARG n 
18 1911 SER n 
18 1912 ARG n 
18 1913 SER n 
18 1914 ARG n 
18 1915 ALA n 
18 1916 SER n 
18 1917 PRO n 
18 1918 VAL n 
18 1919 SER n 
18 1920 ARG n 
18 1921 ARG n 
18 1922 ARG n 
18 1923 SER n 
18 1924 ARG n 
18 1925 SER n 
18 1926 ARG n 
18 1927 THR n 
18 1928 PRO n 
18 1929 PRO n 
18 1930 VAL n 
18 1931 THR n 
18 1932 ARG n 
18 1933 ARG n 
18 1934 ARG n 
18 1935 SER n 
18 1936 ARG n 
18 1937 SER n 
18 1938 ARG n 
18 1939 THR n 
18 1940 PRO n 
18 1941 THR n 
18 1942 THR n 
18 1943 ARG n 
18 1944 ARG n 
18 1945 ARG n 
18 1946 SER n 
18 1947 ARG n 
18 1948 SER n 
18 1949 ARG n 
18 1950 THR n 
18 1951 PRO n 
18 1952 PRO n 
18 1953 VAL n 
18 1954 THR n 
18 1955 ARG n 
18 1956 ARG n 
18 1957 ARG n 
18 1958 SER n 
18 1959 ARG n 
18 1960 SER n 
18 1961 ARG n 
18 1962 THR n 
18 1963 PRO n 
18 1964 PRO n 
18 1965 VAL n 
18 1966 THR n 
18 1967 ARG n 
18 1968 ARG n 
18 1969 ARG n 
18 1970 SER n 
18 1971 ARG n 
18 1972 SER n 
18 1973 ARG n 
18 1974 THR n 
18 1975 SER n 
18 1976 PRO n 
18 1977 ILE n 
18 1978 THR n 
18 1979 ARG n 
18 1980 ARG n 
18 1981 ARG n 
18 1982 SER n 
18 1983 ARG n 
18 1984 SER n 
18 1985 ARG n 
18 1986 THR n 
18 1987 SER n 
18 1988 PRO n 
18 1989 VAL n 
18 1990 THR n 
18 1991 ARG n 
18 1992 ARG n 
18 1993 ARG n 
18 1994 SER n 
18 1995 ARG n 
18 1996 SER n 
18 1997 ARG n 
18 1998 THR n 
18 1999 SER n 
18 2000 PRO n 
18 2001 VAL n 
18 2002 THR n 
18 2003 ARG n 
18 2004 ARG n 
18 2005 ARG n 
18 2006 SER n 
18 2007 ARG n 
18 2008 SER n 
18 2009 ARG n 
18 2010 THR n 
18 2011 SER n 
18 2012 PRO n 
18 2013 VAL n 
18 2014 THR n 
18 2015 ARG n 
18 2016 ARG n 
18 2017 ARG n 
18 2018 SER n 
18 2019 ARG n 
18 2020 SER n 
18 2021 ARG n 
18 2022 THR n 
18 2023 PRO n 
18 2024 PRO n 
18 2025 ALA n 
18 2026 ILE n 
18 2027 ARG n 
18 2028 ARG n 
18 2029 ARG n 
18 2030 SER n 
18 2031 ARG n 
18 2032 SER n 
18 2033 ARG n 
18 2034 THR n 
18 2035 PRO n 
18 2036 LEU n 
18 2037 LEU n 
18 2038 PRO n 
18 2039 ARG n 
18 2040 LYS n 
18 2041 ARG n 
18 2042 SER n 
18 2043 ARG n 
18 2044 SER n 
18 2045 ARG n 
18 2046 SER n 
18 2047 PRO n 
18 2048 LEU n 
18 2049 ALA n 
18 2050 ILE n 
18 2051 ARG n 
18 2052 ARG n 
18 2053 ARG n 
18 2054 SER n 
18 2055 ARG n 
18 2056 SER n 
18 2057 ARG n 
18 2058 THR n 
18 2059 PRO n 
18 2060 ARG n 
18 2061 THR n 
18 2062 ALA n 
18 2063 ARG n 
18 2064 GLY n 
18 2065 LYS n 
18 2066 ARG n 
18 2067 SER n 
18 2068 LEU n 
18 2069 THR n 
18 2070 ARG n 
18 2071 SER n 
18 2072 PRO n 
18 2073 PRO n 
18 2074 ALA n 
18 2075 ILE n 
18 2076 ARG n 
18 2077 ARG n 
18 2078 ARG n 
18 2079 SER n 
18 2080 ALA n 
18 2081 SER n 
18 2082 GLY n 
18 2083 SER n 
18 2084 SER n 
18 2085 SER n 
18 2086 ASP n 
18 2087 ARG n 
18 2088 SER n 
18 2089 ARG n 
18 2090 SER n 
18 2091 ALA n 
18 2092 THR n 
18 2093 PRO n 
18 2094 PRO n 
18 2095 ALA n 
18 2096 THR n 
18 2097 ARG n 
18 2098 ASN n 
18 2099 HIS n 
18 2100 SER n 
18 2101 GLY n 
18 2102 SER n 
18 2103 ARG n 
18 2104 THR n 
18 2105 PRO n 
18 2106 PRO n 
18 2107 VAL n 
18 2108 ALA n 
18 2109 LEU n 
18 2110 ASN n 
18 2111 SER n 
18 2112 SER n 
18 2113 ARG n 
18 2114 MET n 
18 2115 SER n 
18 2116 CYS n 
18 2117 PHE n 
18 2118 SER n 
18 2119 ARG n 
18 2120 PRO n 
18 2121 SER n 
18 2122 MET n 
18 2123 SER n 
18 2124 PRO n 
18 2125 THR n 
18 2126 PRO n 
18 2127 LEU n 
18 2128 ASP n 
18 2129 ARG n 
18 2130 CYS n 
18 2131 ARG n 
18 2132 SER n 
18 2133 PRO n 
18 2134 GLY n 
18 2135 MET n 
18 2136 LEU n 
18 2137 GLU n 
18 2138 PRO n 
18 2139 LEU n 
18 2140 GLY n 
18 2141 SER n 
18 2142 SER n 
18 2143 ARG n 
18 2144 THR n 
18 2145 PRO n 
18 2146 MET n 
18 2147 SER n 
18 2148 VAL n 
18 2149 LEU n 
18 2150 GLN n 
18 2151 GLN n 
18 2152 ALA n 
18 2153 GLY n 
18 2154 GLY n 
18 2155 SER n 
18 2156 MET n 
18 2157 MET n 
18 2158 ASP n 
18 2159 GLY n 
18 2160 PRO n 
18 2161 GLY n 
18 2162 PRO n 
18 2163 ARG n 
18 2164 ILE n 
18 2165 PRO n 
18 2166 ASP n 
18 2167 HIS n 
18 2168 GLN n 
18 2169 ARG n 
18 2170 THR n 
18 2171 SER n 
18 2172 VAL n 
18 2173 PRO n 
18 2174 GLU n 
18 2175 ASN n 
18 2176 HIS n 
18 2177 ALA n 
18 2178 GLN n 
18 2179 SER n 
18 2180 ARG n 
18 2181 ILE n 
18 2182 ALA n 
18 2183 LEU n 
18 2184 ALA n 
18 2185 LEU n 
18 2186 THR n 
18 2187 ALA n 
18 2188 ILE n 
18 2189 SER n 
18 2190 LEU n 
18 2191 GLY n 
18 2192 THR n 
18 2193 ALA n 
18 2194 ARG n 
18 2195 PRO n 
18 2196 PRO n 
18 2197 PRO n 
18 2198 SER n 
18 2199 MET n 
18 2200 SER n 
18 2201 ALA n 
18 2202 ALA n 
18 2203 GLY n 
18 2204 LEU n 
18 2205 ALA n 
18 2206 ALA n 
18 2207 ARG n 
18 2208 MET n 
18 2209 SER n 
18 2210 GLN n 
18 2211 VAL n 
18 2212 PRO n 
18 2213 ALA n 
18 2214 PRO n 
18 2215 VAL n 
18 2216 PRO n 
18 2217 LEU n 
18 2218 MET n 
18 2219 SER n 
18 2220 LEU n 
18 2221 ARG n 
18 2222 THR n 
18 2223 ALA n 
18 2224 PRO n 
18 2225 ALA n 
18 2226 ALA n 
18 2227 ASN n 
18 2228 LEU n 
18 2229 ALA n 
18 2230 SER n 
18 2231 ARG n 
18 2232 ILE n 
18 2233 PRO n 
18 2234 ALA n 
18 2235 ALA n 
18 2236 SER n 
18 2237 ALA n 
18 2238 ALA n 
18 2239 ALA n 
18 2240 MET n 
18 2241 ASN n 
18 2242 LEU n 
18 2243 ALA n 
18 2244 SER n 
18 2245 ALA n 
18 2246 ARG n 
18 2247 THR n 
18 2248 PRO n 
18 2249 ALA n 
18 2250 ILE n 
18 2251 PRO n 
18 2252 THR n 
18 2253 ALA n 
18 2254 VAL n 
18 2255 ASN n 
18 2256 LEU n 
18 2257 ALA n 
18 2258 ASP n 
18 2259 SER n 
18 2260 ARG n 
18 2261 THR n 
18 2262 PRO n 
18 2263 ALA n 
18 2264 ALA n 
18 2265 ALA n 
18 2266 ALA n 
18 2267 ALA n 
18 2268 MET n 
18 2269 ASN n 
18 2270 LEU n 
18 2271 ALA n 
18 2272 SER n 
18 2273 PRO n 
18 2274 ARG n 
18 2275 THR n 
18 2276 ALA n 
18 2277 VAL n 
18 2278 ALA n 
18 2279 PRO n 
18 2280 SER n 
18 2281 ALA n 
18 2282 VAL n 
18 2283 ASN n 
18 2284 LEU n 
18 2285 ALA n 
18 2286 ASP n 
18 2287 PRO n 
18 2288 ARG n 
18 2289 THR n 
18 2290 PRO n 
18 2291 THR n 
18 2292 ALA n 
18 2293 PRO n 
18 2294 ALA n 
18 2295 VAL n 
18 2296 ASN n 
18 2297 LEU n 
18 2298 ALA n 
18 2299 GLY n 
18 2300 ALA n 
18 2301 ARG n 
18 2302 THR n 
18 2303 PRO n 
18 2304 ALA n 
18 2305 ALA n 
18 2306 LEU n 
18 2307 ALA n 
18 2308 ALA n 
18 2309 LEU n 
18 2310 SER n 
18 2311 LEU n 
18 2312 THR n 
18 2313 GLY n 
18 2314 SER n 
18 2315 GLY n 
18 2316 THR n 
18 2317 PRO n 
18 2318 PRO n 
18 2319 THR n 
18 2320 ALA n 
18 2321 ALA n 
18 2322 ASN n 
18 2323 TYR n 
18 2324 PRO n 
18 2325 SER n 
18 2326 SER n 
18 2327 SER n 
18 2328 ARG n 
18 2329 THR n 
18 2330 PRO n 
18 2331 GLN n 
18 2332 ALA n 
18 2333 PRO n 
18 2334 ALA n 
18 2335 SER n 
18 2336 ALA n 
18 2337 ASN n 
18 2338 LEU n 
18 2339 VAL n 
18 2340 GLY n 
18 2341 PRO n 
18 2342 ARG n 
18 2343 SER n 
18 2344 ALA n 
18 2345 HIS n 
18 2346 ALA n 
18 2347 THR n 
18 2348 ALA n 
18 2349 PRO n 
18 2350 VAL n 
18 2351 ASN n 
18 2352 ILE n 
18 2353 ALA n 
18 2354 GLY n 
18 2355 SER n 
18 2356 ARG n 
18 2357 THR n 
18 2358 ALA n 
18 2359 ALA n 
18 2360 ALA n 
18 2361 LEU n 
18 2362 ALA n 
18 2363 PRO n 
18 2364 ALA n 
18 2365 SER n 
18 2366 LEU n 
18 2367 THR n 
18 2368 SER n 
18 2369 ALA n 
18 2370 ARG n 
18 2371 MET n 
18 2372 ALA n 
18 2373 PRO n 
18 2374 ALA n 
18 2375 LEU n 
18 2376 SER n 
18 2377 GLY n 
18 2378 ALA n 
18 2379 ASN n 
18 2380 LEU n 
18 2381 THR n 
18 2382 SER n 
18 2383 PRO n 
18 2384 ARG n 
18 2385 VAL n 
18 2386 PRO n 
18 2387 LEU n 
18 2388 SER n 
18 2389 ALA n 
18 2390 TYR n 
18 2391 GLU n 
18 2392 ARG n 
18 2393 VAL n 
18 2394 SER n 
18 2395 GLY n 
18 2396 ARG n 
18 2397 THR n 
18 2398 SER n 
18 2399 PRO n 
18 2400 PRO n 
18 2401 LEU n 
18 2402 LEU n 
18 2403 ASP n 
18 2404 ARG n 
18 2405 ALA n 
18 2406 ARG n 
18 2407 SER n 
18 2408 ARG n 
18 2409 THR n 
18 2410 PRO n 
18 2411 PRO n 
18 2412 SER n 
18 2413 ALA n 
18 2414 PRO n 
18 2415 SER n 
18 2416 GLN n 
18 2417 SER n 
18 2418 ARG n 
18 2419 MET n 
18 2420 THR n 
18 2421 SER n 
18 2422 GLU n 
18 2423 ARG n 
18 2424 ALA n 
18 2425 PRO n 
18 2426 SER n 
18 2427 PRO n 
18 2428 SER n 
18 2429 SER n 
18 2430 ARG n 
18 2431 MET n 
18 2432 GLY n 
18 2433 GLN n 
18 2434 ALA n 
18 2435 PRO n 
18 2436 SER n 
18 2437 GLN n 
18 2438 SER n 
18 2439 LEU n 
18 2440 LEU n 
18 2441 PRO n 
18 2442 PRO n 
18 2443 ALA n 
18 2444 GLN n 
18 2445 ASP n 
18 2446 GLN n 
18 2447 PRO n 
18 2448 ARG n 
18 2449 SER n 
18 2450 PRO n 
18 2451 VAL n 
18 2452 PRO n 
18 2453 SER n 
18 2454 ALA n 
18 2455 PHE n 
18 2456 SER n 
18 2457 ASP n 
18 2458 GLN n 
18 2459 SER n 
18 2460 ARG n 
18 2461 CYS n 
18 2462 LEU n 
18 2463 ILE n 
18 2464 ALA n 
18 2465 GLN n 
18 2466 THR n 
18 2467 THR n 
18 2468 PRO n 
18 2469 VAL n 
18 2470 ALA n 
18 2471 GLY n 
18 2472 SER n 
18 2473 GLN n 
18 2474 SER n 
18 2475 LEU n 
18 2476 SER n 
18 2477 SER n 
18 2478 GLY n 
18 2479 ALA n 
18 2480 VAL n 
18 2481 ALA n 
18 2482 THR n 
18 2483 THR n 
18 2484 THR n 
18 2485 SER n 
18 2486 SER n 
18 2487 ALA n 
18 2488 GLY n 
18 2489 ASP n 
18 2490 HIS n 
18 2491 ASN n 
18 2492 GLY n 
18 2493 MET n 
18 2494 LEU n 
18 2495 SER n 
18 2496 VAL n 
18 2497 PRO n 
18 2498 ALA n 
18 2499 PRO n 
18 2500 GLY n 
18 2501 VAL n 
18 2502 PRO n 
18 2503 HIS n 
18 2504 SER n 
18 2505 ASP n 
18 2506 VAL n 
18 2507 GLY n 
18 2508 GLU n 
18 2509 PRO n 
18 2510 PRO n 
18 2511 ALA n 
18 2512 SER n 
18 2513 THR n 
18 2514 GLY n 
18 2515 ALA n 
18 2516 GLN n 
18 2517 GLN n 
18 2518 PRO n 
18 2519 SER n 
18 2520 ALA n 
18 2521 LEU n 
18 2522 ALA n 
18 2523 ALA n 
18 2524 LEU n 
18 2525 GLN n 
18 2526 PRO n 
18 2527 ALA n 
18 2528 LYS n 
18 2529 GLU n 
18 2530 ARG n 
18 2531 ARG n 
18 2532 SER n 
18 2533 SER n 
18 2534 SER n 
18 2535 SER n 
18 2536 SER n 
18 2537 SER n 
18 2538 SER n 
18 2539 SER n 
18 2540 SER n 
18 2541 SER n 
18 2542 SER n 
18 2543 SER n 
18 2544 SER n 
18 2545 SER n 
18 2546 SER n 
18 2547 SER n 
18 2548 SER n 
18 2549 SER n 
18 2550 SER n 
18 2551 SER n 
18 2552 SER n 
18 2553 SER n 
18 2554 SER n 
18 2555 SER n 
18 2556 SER n 
18 2557 GLY n 
18 2558 SER n 
18 2559 SER n 
18 2560 SER n 
18 2561 SER n 
18 2562 ASP n 
18 2563 SER n 
18 2564 GLU n 
18 2565 GLY n 
18 2566 SER n 
18 2567 SER n 
18 2568 LEU n 
18 2569 PRO n 
18 2570 VAL n 
18 2571 GLN n 
18 2572 PRO n 
18 2573 GLU n 
18 2574 VAL n 
18 2575 ALA n 
18 2576 LEU n 
18 2577 LYS n 
18 2578 ARG n 
18 2579 VAL n 
18 2580 PRO n 
18 2581 SER n 
18 2582 PRO n 
18 2583 THR n 
18 2584 PRO n 
18 2585 ALA n 
18 2586 PRO n 
18 2587 LYS n 
18 2588 GLU n 
18 2589 ALA n 
18 2590 VAL n 
18 2591 ARG n 
18 2592 GLU n 
18 2593 GLY n 
18 2594 ARG n 
18 2595 PRO n 
18 2596 PRO n 
18 2597 GLU n 
18 2598 PRO n 
18 2599 THR n 
18 2600 PRO n 
18 2601 ALA n 
18 2602 LYS n 
18 2603 ARG n 
18 2604 LYS n 
18 2605 ARG n 
18 2606 ARG n 
18 2607 SER n 
18 2608 SER n 
18 2609 SER n 
18 2610 SER n 
18 2611 SER n 
18 2612 SER n 
18 2613 SER n 
18 2614 SER n 
18 2615 SER n 
18 2616 SER n 
18 2617 SER n 
18 2618 SER n 
18 2619 SER n 
18 2620 SER n 
18 2621 SER n 
18 2622 SER n 
18 2623 SER n 
18 2624 SER n 
18 2625 SER n 
18 2626 SER n 
18 2627 SER n 
18 2628 SER n 
18 2629 SER n 
18 2630 SER n 
18 2631 SER n 
18 2632 SER n 
18 2633 SER n 
18 2634 SER n 
18 2635 SER n 
18 2636 SER n 
18 2637 SER n 
18 2638 SER n 
18 2639 SER n 
18 2640 SER n 
18 2641 SER n 
18 2642 SER n 
18 2643 SER n 
18 2644 SER n 
18 2645 SER n 
18 2646 SER n 
18 2647 SER n 
18 2648 SER n 
18 2649 PRO n 
18 2650 SER n 
18 2651 PRO n 
18 2652 ALA n 
18 2653 LYS n 
18 2654 PRO n 
18 2655 GLY n 
18 2656 PRO n 
18 2657 GLN n 
18 2658 ALA n 
18 2659 LEU n 
18 2660 PRO n 
18 2661 LYS n 
18 2662 PRO n 
18 2663 ALA n 
18 2664 SER n 
18 2665 PRO n 
18 2666 LYS n 
18 2667 LYS n 
18 2668 PRO n 
18 2669 PRO n 
18 2670 PRO n 
18 2671 GLY n 
18 2672 GLU n 
18 2673 ARG n 
18 2674 ARG n 
18 2675 SER n 
18 2676 ARG n 
18 2677 SER n 
18 2678 PRO n 
18 2679 ARG n 
18 2680 LYS n 
18 2681 PRO n 
18 2682 ILE n 
18 2683 ASP n 
18 2684 SER n 
18 2685 LEU n 
18 2686 ARG n 
18 2687 ASP n 
18 2688 SER n 
18 2689 ARG n 
18 2690 SER n 
18 2691 LEU n 
18 2692 SER n 
18 2693 TYR n 
18 2694 SER n 
18 2695 PRO n 
18 2696 VAL n 
18 2697 GLU n 
18 2698 ARG n 
18 2699 ARG n 
18 2700 ARG n 
18 2701 PRO n 
18 2702 SER n 
18 2703 PRO n 
18 2704 GLN n 
18 2705 PRO n 
18 2706 SER n 
18 2707 PRO n 
18 2708 ARG n 
18 2709 ASP n 
18 2710 GLN n 
18 2711 GLN n 
18 2712 SER n 
18 2713 SER n 
18 2714 SER n 
18 2715 SER n 
18 2716 GLU n 
18 2717 ARG n 
18 2718 GLY n 
18 2719 SER n 
18 2720 ARG n 
18 2721 ARG n 
18 2722 GLY n 
18 2723 GLN n 
18 2724 ARG n 
18 2725 GLY n 
18 2726 ASP n 
18 2727 SER n 
18 2728 ARG n 
18 2729 SER n 
18 2730 PRO n 
18 2731 SER n 
18 2732 HIS n 
18 2733 LYS n 
18 2734 ARG n 
18 2735 ARG n 
18 2736 ARG n 
18 2737 GLU n 
18 2738 THR n 
18 2739 PRO n 
18 2740 SER n 
18 2741 PRO n 
18 2742 ARG n 
18 2743 PRO n 
18 2744 MET n 
18 2745 ARG n 
18 2746 HIS n 
18 2747 ARG n 
18 2748 SER n 
18 2749 SER n 
18 2750 ARG n 
18 2751 SER n 
18 2752 PRO n 
19 1    MET n 
19 2    ALA n 
19 3    ALA n 
19 4    ILE n 
19 5    PRO n 
19 6    PRO n 
19 7    ASP n 
19 8    SER n 
19 9    TRP n 
19 10   GLN n 
19 11   PRO n 
19 12   PRO n 
19 13   ASN n 
19 14   VAL n 
19 15   TYR n 
19 16   LEU n 
19 17   GLU n 
19 18   THR n 
19 19   SER n 
19 20   MET n 
19 21   GLY n 
19 22   ILE n 
19 23   ILE n 
19 24   VAL n 
19 25   LEU n 
19 26   GLU n 
19 27   LEU n 
19 28   TYR n 
19 29   TRP n 
19 30   LYS n 
19 31   HIS n 
19 32   ALA n 
19 33   PRO n 
19 34   LYS n 
19 35   THR n 
19 36   CYS n 
19 37   LYS n 
19 38   ASN n 
19 39   PHE n 
19 40   ALA n 
19 41   GLU n 
19 42   LEU n 
19 43   ALA n 
19 44   ARG n 
19 45   ARG n 
19 46   GLY n 
19 47   TYR n 
19 48   TYR n 
19 49   ASN n 
19 50   GLY n 
19 51   THR n 
19 52   LYS n 
19 53   PHE n 
19 54   HIS n 
19 55   ARG n 
19 56   ILE n 
19 57   ILE n 
19 58   LYS n 
19 59   ASP n 
19 60   PHE n 
19 61   MET n 
19 62   ILE n 
19 63   GLN n 
19 64   GLY n 
19 65   GLY n 
19 66   ASP n 
19 67   PRO n 
19 68   THR n 
19 69   GLY n 
19 70   THR n 
19 71   GLY n 
19 72   ARG n 
19 73   GLY n 
19 74   GLY n 
19 75   ALA n 
19 76   SER n 
19 77   ILE n 
19 78   TYR n 
19 79   GLY n 
19 80   LYS n 
19 81   GLN n 
19 82   PHE n 
19 83   GLU n 
19 84   ASP n 
19 85   GLU n 
19 86   LEU n 
19 87   HIS n 
19 88   PRO n 
19 89   ASP n 
19 90   LEU n 
19 91   LYS n 
19 92   PHE n 
19 93   THR n 
19 94   GLY n 
19 95   ALA n 
19 96   GLY n 
19 97   ILE n 
19 98   LEU n 
19 99   ALA n 
19 100  MET n 
19 101  ALA n 
19 102  ASN n 
19 103  ALA n 
19 104  GLY n 
19 105  PRO n 
19 106  ASP n 
19 107  THR n 
19 108  ASN n 
19 109  GLY n 
19 110  SER n 
19 111  GLN n 
19 112  PHE n 
19 113  PHE n 
19 114  VAL n 
19 115  THR n 
19 116  LEU n 
19 117  ALA n 
19 118  PRO n 
19 119  THR n 
19 120  GLN n 
19 121  TRP n 
19 122  LEU n 
19 123  ASP n 
19 124  GLY n 
19 125  LYS n 
19 126  HIS n 
19 127  THR n 
19 128  ILE n 
19 129  PHE n 
19 130  GLY n 
19 131  ARG n 
19 132  VAL n 
19 133  CYS n 
19 134  GLN n 
19 135  GLY n 
19 136  ILE n 
19 137  GLY n 
19 138  MET n 
19 139  VAL n 
19 140  ASN n 
19 141  ARG n 
19 142  VAL n 
19 143  GLY n 
19 144  MET n 
19 145  VAL n 
19 146  GLU n 
19 147  THR n 
19 148  ASN n 
19 149  SER n 
19 150  GLN n 
19 151  ASP n 
19 152  ARG n 
19 153  PRO n 
19 154  VAL n 
19 155  ASP n 
19 156  ASP n 
19 157  VAL n 
19 158  LYS n 
19 159  ILE n 
19 160  ILE n 
19 161  LYS n 
19 162  ALA n 
19 163  TYR n 
19 164  PRO n 
19 165  SER n 
19 166  GLY n 
20 1    MET n 
20 2    ASP n 
20 3    ALA n 
20 4    GLY n 
20 5    PHE n 
20 6    PHE n 
20 7    ARG n 
20 8    GLY n 
20 9    THR n 
20 10   SER n 
20 11   ALA n 
20 12   GLU n 
20 13   GLN n 
20 14   ASP n 
20 15   ASN n 
20 16   ARG n 
20 17   PHE n 
20 18   SER n 
20 19   ASN n 
20 20   LYS n 
20 21   GLN n 
20 22   LYS n 
20 23   LYS n 
20 24   LEU n 
20 25   LEU n 
20 26   LYS n 
20 27   GLN n 
20 28   LEU n 
20 29   LYS n 
20 30   PHE n 
20 31   ALA n 
20 32   GLU n 
20 33   CYS n 
20 34   LEU n 
20 35   GLU n 
20 36   LYS n 
20 37   LYS n 
20 38   VAL n 
20 39   ASP n 
20 40   MET n 
20 41   SER n 
20 42   LYS n 
20 43   VAL n 
20 44   ASN n 
20 45   LEU n 
20 46   GLU n 
20 47   VAL n 
20 48   ILE n 
20 49   LYS n 
20 50   PRO n 
20 51   TRP n 
20 52   ILE n 
20 53   THR n 
20 54   LYS n 
20 55   ARG n 
20 56   VAL n 
20 57   THR n 
20 58   GLU n 
20 59   ILE n 
20 60   LEU n 
20 61   GLY n 
20 62   PHE n 
20 63   GLU n 
20 64   ASP n 
20 65   ASP n 
20 66   VAL n 
20 67   VAL n 
20 68   ILE n 
20 69   GLU n 
20 70   PHE n 
20 71   ILE n 
20 72   PHE n 
20 73   ASN n 
20 74   GLN n 
20 75   LEU n 
20 76   GLU n 
20 77   VAL n 
20 78   LYS n 
20 79   ASN n 
20 80   PRO n 
20 81   ASP n 
20 82   SER n 
20 83   LYS n 
20 84   MET n 
20 85   MET n 
20 86   GLN n 
20 87   ILE n 
20 88   ASN n 
20 89   LEU n 
20 90   THR n 
20 91   GLY n 
20 92   PHE n 
20 93   LEU n 
20 94   ASN n 
20 95   GLY n 
20 96   LYS n 
20 97   ASN n 
20 98   ALA n 
20 99   ARG n 
20 100  GLU n 
20 101  PHE n 
20 102  MET n 
20 103  GLY n 
20 104  GLU n 
20 105  LEU n 
20 106  TRP n 
20 107  PRO n 
20 108  LEU n 
20 109  LEU n 
20 110  LEU n 
20 111  SER n 
20 112  ALA n 
20 113  GLN n 
20 114  GLU n 
20 115  ASN n 
20 116  ILE n 
20 117  ALA n 
20 118  GLY n 
20 119  ILE n 
20 120  PRO n 
20 121  SER n 
20 122  ALA n 
20 123  PHE n 
20 124  LEU n 
20 125  GLU n 
20 126  LEU n 
20 127  LYS n 
20 128  LYS n 
20 129  GLU n 
20 130  GLU n 
20 131  ILE n 
20 132  LYS n 
20 133  GLN n 
20 134  ARG n 
20 135  GLN n 
20 136  ILE n 
20 137  GLU n 
20 138  GLN n 
20 139  GLU n 
20 140  LYS n 
20 141  LEU n 
20 142  ALA n 
20 143  SER n 
20 144  MET n 
20 145  LYS n 
20 146  LYS n 
20 147  GLN n 
20 148  ASP n 
20 149  GLU n 
20 150  ASP n 
20 151  LYS n 
20 152  ASP n 
20 153  LYS n 
20 154  ARG n 
20 155  ASP n 
20 156  LYS n 
20 157  GLU n 
20 158  GLU n 
20 159  LYS n 
20 160  GLU n 
20 161  SER n 
20 162  SER n 
20 163  ARG n 
20 164  GLU n 
20 165  LYS n 
20 166  ARG n 
20 167  GLU n 
20 168  ARG n 
20 169  SER n 
20 170  ARG n 
20 171  SER n 
20 172  PRO n 
20 173  ARG n 
20 174  ARG n 
20 175  ARG n 
20 176  LYS n 
20 177  SER n 
20 178  ARG n 
20 179  SER n 
20 180  PRO n 
20 181  SER n 
20 182  PRO n 
20 183  ARG n 
20 184  ARG n 
20 185  ARG n 
20 186  SER n 
20 187  SER n 
20 188  PRO n 
20 189  VAL n 
20 190  ARG n 
20 191  ARG n 
20 192  GLU n 
20 193  ARG n 
20 194  LYS n 
20 195  ARG n 
20 196  SER n 
20 197  HIS n 
20 198  SER n 
20 199  ARG n 
20 200  SER n 
20 201  PRO n 
20 202  ARG n 
20 203  HIS n 
20 204  ARG n 
20 205  THR n 
20 206  LYS n 
20 207  SER n 
20 208  ARG n 
20 209  SER n 
20 210  PRO n 
20 211  SER n 
20 212  PRO n 
20 213  ALA n 
20 214  PRO n 
20 215  GLU n 
20 216  LYS n 
20 217  LYS n 
20 218  GLU n 
20 219  LYS n 
20 220  THR n 
20 221  PRO n 
20 222  GLU n 
20 223  LEU n 
20 224  PRO n 
20 225  GLU n 
20 226  PRO n 
20 227  SER n 
20 228  VAL n 
20 229  LYS n 
20 230  VAL n 
20 231  LYS n 
20 232  GLU n 
20 233  PRO n 
20 234  SER n 
20 235  VAL n 
20 236  GLN n 
20 237  GLU n 
20 238  ALA n 
20 239  THR n 
20 240  SER n 
20 241  THR n 
20 242  SER n 
20 243  ASP n 
20 244  ILE n 
20 245  LEU n 
20 246  LYS n 
20 247  VAL n 
20 248  PRO n 
20 249  LYS n 
20 250  PRO n 
20 251  GLU n 
20 252  PRO n 
20 253  ILE n 
20 254  PRO n 
20 255  GLU n 
20 256  PRO n 
20 257  LYS n 
20 258  GLU n 
20 259  PRO n 
20 260  SER n 
20 261  PRO n 
20 262  GLU n 
20 263  LYS n 
20 264  ASN n 
20 265  SER n 
20 266  LYS n 
20 267  LYS n 
20 268  GLU n 
20 269  LYS n 
20 270  GLU n 
20 271  LYS n 
20 272  GLU n 
20 273  LYS n 
20 274  THR n 
20 275  ARG n 
20 276  PRO n 
20 277  ARG n 
20 278  SER n 
20 279  ARG n 
20 280  SER n 
20 281  ARG n 
20 282  SER n 
20 283  LYS n 
20 284  SER n 
20 285  ARG n 
20 286  SER n 
20 287  ARG n 
20 288  THR n 
20 289  ARG n 
20 290  SER n 
20 291  ARG n 
20 292  SER n 
20 293  PRO n 
20 294  SER n 
20 295  HIS n 
20 296  THR n 
20 297  ARG n 
20 298  PRO n 
20 299  ARG n 
20 300  ARG n 
20 301  ARG n 
20 302  HIS n 
20 303  ARG n 
20 304  SER n 
20 305  ARG n 
20 306  SER n 
20 307  ARG n 
20 308  SER n 
20 309  TYR n 
20 310  SER n 
20 311  PRO n 
20 312  ARG n 
20 313  ARG n 
20 314  ARG n 
20 315  PRO n 
20 316  SER n 
20 317  PRO n 
20 318  ARG n 
20 319  ARG n 
20 320  ARG n 
20 321  PRO n 
20 322  SER n 
20 323  PRO n 
20 324  ARG n 
20 325  ARG n 
20 326  ARG n 
20 327  THR n 
20 328  PRO n 
20 329  PRO n 
20 330  ARG n 
20 331  ARG n 
20 332  MET n 
20 333  PRO n 
20 334  PRO n 
20 335  PRO n 
20 336  PRO n 
20 337  ARG n 
20 338  HIS n 
20 339  ARG n 
20 340  ARG n 
20 341  SER n 
20 342  ARG n 
20 343  SER n 
20 344  PRO n 
20 345  VAL n 
20 346  ARG n 
20 347  ARG n 
20 348  ARG n 
20 349  ARG n 
20 350  ARG n 
20 351  SER n 
20 352  SER n 
20 353  ALA n 
20 354  SER n 
20 355  LEU n 
20 356  SER n 
20 357  GLY n 
20 358  SER n 
20 359  SER n 
20 360  SER n 
20 361  SER n 
20 362  SER n 
20 363  SER n 
20 364  SER n 
20 365  SER n 
20 366  ARG n 
20 367  SER n 
20 368  ARG n 
20 369  SER n 
20 370  PRO n 
20 371  PRO n 
20 372  LYS n 
20 373  LYS n 
20 374  PRO n 
20 375  PRO n 
20 376  LYS n 
20 377  ARG n 
20 378  THR n 
20 379  SER n 
20 380  SER n 
20 381  PRO n 
20 382  PRO n 
20 383  ARG n 
20 384  LYS n 
20 385  THR n 
20 386  ARG n 
20 387  ARG n 
20 388  LEU n 
20 389  SER n 
20 390  PRO n 
20 391  SER n 
20 392  ALA n 
20 393  SER n 
20 394  PRO n 
20 395  PRO n 
20 396  ARG n 
20 397  ARG n 
20 398  ARG n 
20 399  HIS n 
20 400  ARG n 
20 401  PRO n 
20 402  SER n 
20 403  PRO n 
20 404  PRO n 
20 405  ALA n 
20 406  THR n 
20 407  PRO n 
20 408  PRO n 
20 409  PRO n 
20 410  LYS n 
20 411  THR n 
20 412  ARG n 
20 413  HIS n 
20 414  SER n 
20 415  PRO n 
20 416  THR n 
20 417  PRO n 
20 418  GLN n 
20 419  GLN n 
20 420  SER n 
20 421  ASN n 
20 422  ARG n 
20 423  THR n 
20 424  ARG n 
20 425  LYS n 
20 426  SER n 
20 427  ARG n 
20 428  VAL n 
20 429  SER n 
20 430  VAL n 
20 431  SER n 
20 432  PRO n 
20 433  GLY n 
20 434  ARG n 
20 435  THR n 
20 436  SER n 
20 437  GLY n 
20 438  LYS n 
20 439  VAL n 
20 440  THR n 
20 441  LYS n 
20 442  HIS n 
20 443  LYS n 
20 444  GLY n 
20 445  THR n 
20 446  GLU n 
20 447  LYS n 
20 448  ARG n 
20 449  GLU n 
20 450  SER n 
20 451  PRO n 
20 452  SER n 
20 453  PRO n 
20 454  ALA n 
20 455  PRO n 
20 456  LYS n 
20 457  PRO n 
20 458  ARG n 
20 459  LYS n 
20 460  VAL n 
20 461  GLU n 
20 462  LEU n 
20 463  SER n 
20 464  GLU n 
20 465  SER n 
20 466  GLU n 
20 467  GLU n 
20 468  ASP n 
20 469  LYS n 
20 470  GLY n 
20 471  GLY n 
20 472  LYS n 
20 473  MET n 
20 474  ALA n 
20 475  ALA n 
20 476  ALA n 
20 477  ASP n 
20 478  SER n 
20 479  VAL n 
20 480  GLN n 
20 481  GLN n 
20 482  ARG n 
20 483  ARG n 
20 484  GLN n 
20 485  TYR n 
20 486  ARG n 
20 487  ARG n 
20 488  GLN n 
20 489  ASN n 
20 490  GLN n 
20 491  GLN n 
20 492  SER n 
20 493  SER n 
20 494  SER n 
20 495  ASP n 
20 496  SER n 
20 497  GLY n 
20 498  SER n 
20 499  SER n 
20 500  SER n 
20 501  SER n 
20 502  SER n 
20 503  GLU n 
20 504  ASP n 
20 505  GLU n 
20 506  ARG n 
20 507  PRO n 
20 508  LYS n 
20 509  ARG n 
20 510  SER n 
20 511  HIS n 
20 512  VAL n 
20 513  LYS n 
20 514  ASN n 
20 515  GLY n 
20 516  GLU n 
20 517  VAL n 
20 518  GLY n 
20 519  ARG n 
20 520  ARG n 
20 521  ARG n 
20 522  ARG n 
20 523  HIS n 
20 524  SER n 
20 525  PRO n 
20 526  SER n 
20 527  ARG n 
20 528  SER n 
20 529  ALA n 
20 530  SER n 
20 531  PRO n 
20 532  SER n 
20 533  PRO n 
20 534  ARG n 
20 535  LYS n 
20 536  ARG n 
20 537  GLN n 
20 538  LYS n 
20 539  GLU n 
20 540  THR n 
20 541  SER n 
20 542  PRO n 
20 543  ARG n 
20 544  GLY n 
20 545  ARG n 
20 546  ARG n 
20 547  ARG n 
20 548  ARG n 
20 549  SER n 
20 550  PRO n 
20 551  SER n 
20 552  PRO n 
20 553  PRO n 
20 554  PRO n 
20 555  THR n 
20 556  ARG n 
20 557  ARG n 
20 558  ARG n 
20 559  ARG n 
20 560  SER n 
20 561  PRO n 
20 562  SER n 
20 563  PRO n 
20 564  ALA n 
20 565  PRO n 
20 566  PRO n 
20 567  PRO n 
20 568  ARG n 
20 569  ARG n 
20 570  ARG n 
20 571  ARG n 
20 572  THR n 
20 573  PRO n 
20 574  THR n 
20 575  PRO n 
20 576  PRO n 
20 577  PRO n 
20 578  ARG n 
20 579  ARG n 
20 580  ARG n 
20 581  THR n 
20 582  PRO n 
20 583  SER n 
20 584  PRO n 
20 585  PRO n 
20 586  PRO n 
20 587  ARG n 
20 588  ARG n 
20 589  ARG n 
20 590  SER n 
20 591  PRO n 
20 592  SER n 
20 593  PRO n 
20 594  ARG n 
20 595  ARG n 
20 596  TYR n 
20 597  SER n 
20 598  PRO n 
20 599  PRO n 
20 600  ILE n 
20 601  GLN n 
20 602  ARG n 
20 603  ARG n 
20 604  TYR n 
20 605  SER n 
20 606  PRO n 
20 607  SER n 
20 608  PRO n 
20 609  PRO n 
20 610  PRO n 
20 611  LYS n 
20 612  ARG n 
20 613  ARG n 
20 614  THR n 
20 615  ALA n 
20 616  SER n 
20 617  PRO n 
20 618  PRO n 
20 619  PRO n 
20 620  PRO n 
20 621  PRO n 
20 622  LYS n 
20 623  ARG n 
20 624  ARG n 
20 625  ALA n 
20 626  SER n 
20 627  PRO n 
20 628  SER n 
20 629  PRO n 
20 630  PRO n 
20 631  PRO n 
20 632  LYS n 
20 633  ARG n 
20 634  ARG n 
20 635  VAL n 
20 636  SER n 
20 637  HIS n 
20 638  SER n 
20 639  PRO n 
20 640  PRO n 
20 641  PRO n 
20 642  LYS n 
20 643  GLN n 
20 644  ARG n 
20 645  SER n 
20 646  SER n 
20 647  PRO n 
20 648  VAL n 
20 649  THR n 
20 650  LYS n 
20 651  ARG n 
20 652  ARG n 
20 653  SER n 
20 654  PRO n 
20 655  SER n 
20 656  LEU n 
20 657  SER n 
20 658  SER n 
20 659  LYS n 
20 660  HIS n 
20 661  ARG n 
20 662  LYS n 
20 663  GLY n 
20 664  SER n 
20 665  SER n 
20 666  PRO n 
20 667  SER n 
20 668  ARG n 
20 669  SER n 
20 670  THR n 
20 671  ARG n 
20 672  GLU n 
20 673  ALA n 
20 674  ARG n 
20 675  SER n 
20 676  PRO n 
20 677  GLN n 
20 678  PRO n 
20 679  ASN n 
20 680  LYS n 
20 681  ARG n 
20 682  HIS n 
20 683  SER n 
20 684  PRO n 
20 685  SER n 
20 686  PRO n 
20 687  ARG n 
20 688  PRO n 
20 689  ARG n 
20 690  ALA n 
20 691  PRO n 
20 692  GLN n 
20 693  THR n 
20 694  SER n 
20 695  SER n 
20 696  SER n 
20 697  PRO n 
20 698  PRO n 
20 699  PRO n 
20 700  VAL n 
20 701  ARG n 
20 702  ARG n 
20 703  GLY n 
20 704  ALA n 
20 705  SER n 
20 706  SER n 
20 707  SER n 
20 708  PRO n 
20 709  GLN n 
20 710  ARG n 
20 711  ARG n 
20 712  GLN n 
20 713  SER n 
20 714  PRO n 
20 715  SER n 
20 716  PRO n 
20 717  SER n 
20 718  THR n 
20 719  ARG n 
20 720  PRO n 
20 721  ILE n 
20 722  ARG n 
20 723  ARG n 
20 724  VAL n 
20 725  SER n 
20 726  ARG n 
20 727  THR n 
20 728  PRO n 
20 729  GLU n 
20 730  PRO n 
20 731  LYS n 
20 732  LYS n 
20 733  ILE n 
20 734  LYS n 
20 735  LYS n 
20 736  ALA n 
20 737  ALA n 
20 738  SER n 
20 739  PRO n 
20 740  SER n 
20 741  PRO n 
20 742  GLN n 
20 743  SER n 
20 744  VAL n 
20 745  ARG n 
20 746  ARG n 
20 747  VAL n 
20 748  SER n 
20 749  SER n 
20 750  SER n 
20 751  ARG n 
20 752  SER n 
20 753  VAL n 
20 754  SER n 
20 755  GLY n 
20 756  SER n 
20 757  PRO n 
20 758  GLU n 
20 759  PRO n 
20 760  ALA n 
20 761  ALA n 
20 762  LYS n 
20 763  LYS n 
20 764  PRO n 
20 765  PRO n 
20 766  ALA n 
20 767  PRO n 
20 768  PRO n 
20 769  SER n 
20 770  PRO n 
20 771  VAL n 
20 772  GLN n 
20 773  SER n 
20 774  GLN n 
20 775  SER n 
20 776  PRO n 
20 777  SER n 
20 778  THR n 
20 779  ASN n 
20 780  TRP n 
20 781  SER n 
20 782  PRO n 
20 783  ALA n 
20 784  VAL n 
20 785  PRO n 
20 786  VAL n 
20 787  LYS n 
20 788  LYS n 
20 789  ALA n 
20 790  LYS n 
20 791  SER n 
20 792  PRO n 
20 793  THR n 
20 794  PRO n 
20 795  SER n 
20 796  PRO n 
20 797  SER n 
20 798  PRO n 
20 799  PRO n 
20 800  ARG n 
20 801  ASN n 
20 802  SER n 
20 803  ASP n 
20 804  GLN n 
20 805  GLU n 
20 806  GLY n 
20 807  GLY n 
20 808  GLY n 
20 809  LYS n 
20 810  LYS n 
20 811  LYS n 
20 812  LYS n 
20 813  LYS n 
20 814  LYS n 
20 815  LYS n 
20 816  ASP n 
20 817  LYS n 
20 818  LYS n 
20 819  HIS n 
20 820  LYS n 
20 821  LYS n 
20 822  ASP n 
20 823  LYS n 
20 824  LYS n 
20 825  HIS n 
20 826  LYS n 
20 827  LYS n 
20 828  HIS n 
20 829  LYS n 
20 830  LYS n 
20 831  HIS n 
20 832  LYS n 
20 833  LYS n 
20 834  GLU n 
20 835  LYS n 
20 836  ALA n 
20 837  VAL n 
20 838  ALA n 
20 839  ALA n 
20 840  ALA n 
20 841  ALA n 
20 842  ALA n 
20 843  ALA n 
20 844  ALA n 
20 845  VAL n 
20 846  THR n 
20 847  PRO n 
20 848  ALA n 
20 849  ALA n 
20 850  ILE n 
20 851  ALA n 
20 852  ALA n 
20 853  ALA n 
20 854  THR n 
20 855  THR n 
20 856  THR n 
20 857  LEU n 
20 858  ALA n 
20 859  GLN n 
20 860  GLU n 
20 861  GLU n 
20 862  PRO n 
20 863  VAL n 
20 864  ALA n 
20 865  ALA n 
20 866  PRO n 
20 867  GLU n 
20 868  PRO n 
20 869  LYS n 
20 870  LYS n 
20 871  GLU n 
20 872  THR n 
20 873  GLU n 
20 874  SER n 
20 875  GLU n 
20 876  ALA n 
20 877  GLU n 
20 878  ASP n 
20 879  ASN n 
20 880  LEU n 
20 881  ASP n 
20 882  ASP n 
20 883  LEU n 
20 884  GLU n 
20 885  LYS n 
20 886  HIS n 
20 887  LEU n 
20 888  ARG n 
20 889  GLU n 
20 890  LYS n 
20 891  ALA n 
20 892  LEU n 
20 893  ARG n 
20 894  SER n 
20 895  MET n 
20 896  ARG n 
20 897  LYS n 
20 898  ALA n 
20 899  GLN n 
20 900  VAL n 
20 901  SER n 
20 902  PRO n 
20 903  GLN n 
20 904  SER n 
21 1    G   n 
21 2    A   n 
21 3    A   n 
21 4    U   n 
21 5    A   n 
21 6    C   n 
21 7    A   n 
21 8    A   n 
21 9    G   n 
21 10   C   n 
21 11   U   n 
21 12   C   n 
21 13   A   n 
21 14   U   n 
21 15   C   n 
21 16   C   n 
21 17   G   n 
21 18   A   n 
21 19   U   n 
21 20   A   n 
21 21   U   n 
21 22   C   n 
21 23   C   n 
21 24   G   n 
21 25   U   n 
21 26   A   n 
21 27   C   n 
21 28   A   n 
21 29   C   n 
21 30   C   n 
21 31   A   n 
21 32   U   n 
21 33   C   n 
21 34   A   n 
21 35   G   n 
21 36   G   n 
21 37   G   n 
21 38   U   n 
21 39   A   n 
21 40   C   n 
21 41   G   n 
21 42   A   n 
21 43   G   n 
21 44   C   n 
21 45   U   n 
21 46   A   n 
21 47   G   n 
21 48   C   n 
21 49   C   n 
21 50   C   n 
21 51   A   n 
21 52   U   n 
21 53   G   n 
21 54   G   n 
21 55   C   n 
21 56   G   n 
21 57   U   n 
21 58   A   n 
21 59   C   n 
21 60   A   n 
21 61   C   n 
21 62   C   n 
21 63   A   n 
21 64   U   n 
21 65   C   n 
21 66   A   n 
21 67   G   n 
21 68   G   n 
21 69   G   n 
21 70   U   n 
21 71   A   n 
21 72   C   n 
21 73   G   n 
21 74   A   n 
21 75   C   n 
21 76   U   n 
21 77   A   n 
21 78   G   n 
21 79   U   n 
21 80   A   n 
21 81   G   n 
21 82   A   n 
21 83   U   n 
21 84   C   n 
21 85   U   n 
21 86   C   n 
21 87   G   n 
21 88   U   n 
21 89   A   n 
21 90   C   n 
21 91   A   n 
21 92   C   n 
21 93   C   n 
21 94   A   n 
21 95   U   n 
21 96   C   n 
21 97   A   n 
21 98   G   n 
21 99   G   n 
21 100  G   n 
21 101  U   n 
21 102  A   n 
21 103  C   n 
21 104  G   n 
21 105  G   n 
21 106  A   n 
21 107  A   n 
21 108  U   n 
21 109  U   n 
21 110  C   n 
21 111  U   n 
21 112  C   n 
21 113  U   n 
21 114  A   n 
21 115  G   n 
21 116  A   n 
21 117  G   n 
21 118  U   n 
21 119  C   n 
21 120  G   n 
21 121  A   n 
21 122  G   n 
21 123  G   n 
21 124  A   n 
21 125  G   n 
21 126  G   n 
21 127  A   n 
21 128  C   n 
21 129  A   n 
21 130  U   n 
21 131  C   n 
21 132  U   n 
21 133  C   n 
21 134  A   n 
21 135  G   n 
21 136  C   n 
21 137  A   n 
21 138  A   n 
21 139  A   n 
21 140  A   n 
21 141  G   n 
21 142  A   n 
21 143  G   n 
21 144  A   n 
21 145  A   n 
21 146  G   n 
21 147  C   n 
21 148  U   n 
21 149  G   n 
21 150  C   n 
21 151  U   n 
21 152  G   n 
21 153  C   n 
21 154  G   n 
21 155  G   n 
21 156  G   n 
21 157  C   n 
21 158  G   n 
21 159  U   n 
21 160  C   n 
21 161  G   n 
21 162  G   n 
21 163  A   n 
21 164  G   n 
21 165  G   n 
21 166  A   n 
21 167  C   n 
21 168  G   n 
21 169  A   n 
21 170  G   n 
21 171  C   n 
21 172  G   n 
21 173  G   n 
21 174  G   n 
21 175  A   n 
21 176  C   n 
21 177  C   n 
21 178  G   n 
21 179  G   n 
21 180  G   n 
21 181  U   n 
21 182  G   n 
21 183  C   n 
21 184  U   n 
21 185  G   n 
21 186  G   n 
21 187  A   n 
21 188  G   n 
21 189  G   n 
21 190  A   n 
21 191  G   n 
21 192  C   n 
21 193  U   n 
21 194  G   n 
21 195  C   n 
21 196  A   n 
21 197  C   n 
21 198  A   n 
21 199  A   n 
21 200  G   n 
21 201  G   n 
21 202  C   n 
21 203  A   n 
21 204  G   n 
21 205  A   n 
21 206  G   n 
21 207  G   n 
21 208  A   n 
21 209  C   n 
21 210  A   n 
21 211  G   n 
21 212  C   n 
21 213  C   n 
21 214  U   n 
21 215  G   n 
21 216  C   n 
21 217  U   n 
21 218  G   n 
21 219  G   n 
21 220  C   n 
21 221  U   n 
21 222  G   n 
21 223  C   n 
21 224  C   n 
21 225  G   n 
21 226  A   n 
21 227  C   n 
21 228  G   n 
21 229  A   n 
21 230  G   n 
21 231  A   n 
21 232  C   n 
21 233  C   n 
21 234  G   n 
21 235  C   n 
21 236  C   n 
21 237  G   n 
21 238  C   n 
21 239  C   n 
21 240  A   n 
21 241  A   n 
21 242  G   n 
21 243  G   n 
21 244  U   n 
21 245  A   n 
21 246  U   n 
21 247  G   n 
21 248  U   n 
21 249  A   n 
21 250  U   n 
21 251  C   n 
21 252  A   n 
21 253  A   n 
21 254  G   n 
21 255  C   n 
21 256  U   n 
21 257  U   n 
21 258  A   n 
21 259  C   n 
21 260  A   n 
21 261  A   n 
21 262  G   n 
21 263  A   n 
21 264  C   n 
21 265  A   n 
21 266  G   n 
21 267  C   n 
21 268  U   n 
21 269  U   n 
21 270  C   n 
21 271  U   n 
21 272  U   n 
21 273  A   n 
21 274  U   n 
21 275  G   n 
21 276  U   n 
21 277  A   n 
21 278  U   n 
21 279  U   n 
21 280  U   n 
21 281  A   n 
21 282  C   n 
21 283  U   n 
21 284  G   n 
21 285  A   n 
21 286  C   n 
21 287  C   n 
21 288  U   n 
21 289  G   n 
21 290  U   n 
21 291  G   n 
21 292  U   n 
21 293  U   n 
21 294  U   n 
21 295  U   n 
21 296  U   n 
21 297  U   n 
21 298  U   n 
21 299  G   n 
21 300  C   n 
21 301  U   n 
21 302  A   n 
21 303  C   n 
21 304  U   n 
21 305  U   n 
21 306  U   n 
21 307  U   n 
21 308  U   n 
21 309  U   n 
21 310  U   n 
21 311  C   n 
21 312  U   n 
21 313  U   n 
21 314  U   n 
21 315  U   n 
21 316  C   n 
21 317  U   n 
21 318  C   n 
21 319  C   n 
21 320  C   n 
21 321  C   n 
21 322  U   n 
21 323  U   n 
21 324  C   n 
21 325  C   n 
21 326  C   n 
21 327  C   n 
21 328  U   n 
21 329  U   n 
21 330  U   n 
21 331  C   n 
21 332  C   n 
21 333  C   n 
21 334  U   n 
21 335  A   n 
21 336  U   n 
21 337  U   n 
21 338  U   n 
21 339  U   n 
21 340  U   n 
21 341  U   n 
21 342  U   n 
21 343  U   n 
21 344  C   n 
21 345  U   n 
21 346  U   n 
21 347  G   n 
21 348  C   n 
21 349  C   n 
21 350  C   n 
21 351  U   n 
21 352  G   n 
21 353  A   n 
21 354  U   n 
21 355  C   n 
21 356  C   n 
21 357  G   n 
21 358  G   n 
21 359  A   n 
21 360  A   n 
21 361  U   n 
21 362  U   n 
21 363  U   n 
21 364  G   n 
21 365  G   n 
21 366  A   n 
21 367  U   n 
21 368  C   n 
21 369  C   n 
22 1    MET n 
22 2    SER n 
22 3    ASN n 
22 4    ILE n 
22 5    TYR n 
22 6    ILE n 
22 7    GLN n 
22 8    GLU n 
22 9    PRO n 
22 10   PRO n 
22 11   THR n 
22 12   ASN n 
22 13   GLY n 
22 14   LYS n 
22 15   VAL n 
22 16   LEU n 
22 17   LEU n 
22 18   LYS n 
22 19   THR n 
22 20   THR n 
22 21   ALA n 
22 22   GLY n 
22 23   ASP n 
22 24   ILE n 
22 25   ASP n 
22 26   ILE n 
22 27   GLU n 
22 28   LEU n 
22 29   TRP n 
22 30   SER n 
22 31   LYS n 
22 32   GLU n 
22 33   ALA n 
22 34   PRO n 
22 35   LYS n 
22 36   ALA n 
22 37   CYS n 
22 38   ARG n 
22 39   ASN n 
22 40   PHE n 
22 41   ILE n 
22 42   GLN n 
22 43   LEU n 
22 44   CYS n 
22 45   LEU n 
22 46   GLU n 
22 47   ALA n 
22 48   TYR n 
22 49   TYR n 
22 50   ASP n 
22 51   ASN n 
22 52   THR n 
22 53   ILE n 
22 54   PHE n 
22 55   HIS n 
22 56   ARG n 
22 57   VAL n 
22 58   VAL n 
22 59   PRO n 
22 60   GLY n 
22 61   PHE n 
22 62   ILE n 
22 63   VAL n 
22 64   GLN n 
22 65   GLY n 
22 66   GLY n 
22 67   ASP n 
22 68   PRO n 
22 69   THR n 
22 70   GLY n 
22 71   THR n 
22 72   GLY n 
22 73   SER n 
22 74   GLY n 
22 75   GLY n 
22 76   GLU n 
22 77   SER n 
22 78   ILE n 
22 79   TYR n 
22 80   GLY n 
22 81   ALA n 
22 82   PRO n 
22 83   PHE n 
22 84   LYS n 
22 85   ASP n 
22 86   GLU n 
22 87   PHE n 
22 88   HIS n 
22 89   SER n 
22 90   ARG n 
22 91   LEU n 
22 92   ARG n 
22 93   PHE n 
22 94   ASN n 
22 95   ARG n 
22 96   ARG n 
22 97   GLY n 
22 98   LEU n 
22 99   VAL n 
22 100  ALA n 
22 101  MET n 
22 102  ALA n 
22 103  ASN n 
22 104  ALA n 
22 105  GLY n 
22 106  SER n 
22 107  HIS n 
22 108  ASP n 
22 109  ASN n 
22 110  GLY n 
22 111  SER n 
22 112  GLN n 
22 113  PHE n 
22 114  PHE n 
22 115  PHE n 
22 116  THR n 
22 117  LEU n 
22 118  GLY n 
22 119  ARG n 
22 120  ALA n 
22 121  ASP n 
22 122  GLU n 
22 123  LEU n 
22 124  ASN n 
22 125  ASN n 
22 126  LYS n 
22 127  HIS n 
22 128  THR n 
22 129  ILE n 
22 130  PHE n 
22 131  GLY n 
22 132  LYS n 
22 133  VAL n 
22 134  THR n 
22 135  GLY n 
22 136  ASP n 
22 137  THR n 
22 138  VAL n 
22 139  TYR n 
22 140  ASN n 
22 141  MET n 
22 142  LEU n 
22 143  ARG n 
22 144  LEU n 
22 145  SER n 
22 146  GLU n 
22 147  VAL n 
22 148  ASP n 
22 149  ILE n 
22 150  ASP n 
22 151  ASP n 
22 152  ASP n 
22 153  GLU n 
22 154  ARG n 
22 155  PRO n 
22 156  HIS n 
22 157  ASN n 
22 158  PRO n 
22 159  HIS n 
22 160  LYS n 
22 161  ILE n 
22 162  LYS n 
22 163  SER n 
22 164  CYS n 
22 165  GLU n 
22 166  VAL n 
22 167  LEU n 
22 168  PHE n 
22 169  ASN n 
22 170  PRO n 
22 171  PHE n 
22 172  ASP n 
22 173  ASP n 
22 174  ILE n 
22 175  ILE n 
22 176  PRO n 
22 177  ARG n 
22 178  GLU n 
22 179  ILE n 
22 180  LYS n 
22 181  ARG n 
22 182  LEU n 
22 183  LYS n 
22 184  LYS n 
22 185  GLU n 
22 186  LYS n 
22 187  PRO n 
22 188  GLU n 
22 189  GLU n 
22 190  GLU n 
22 191  VAL n 
22 192  LYS n 
22 193  LYS n 
22 194  LEU n 
22 195  LYS n 
22 196  PRO n 
22 197  LYS n 
22 198  GLY n 
22 199  THR n 
22 200  LYS n 
22 201  ASN n 
22 202  PHE n 
22 203  SER n 
22 204  LEU n 
22 205  LEU n 
22 206  SER n 
22 207  PHE n 
22 208  GLY n 
22 209  GLU n 
22 210  GLU n 
22 211  ALA n 
22 212  GLU n 
22 213  GLU n 
22 214  GLU n 
22 215  GLU n 
22 216  GLU n 
22 217  GLU n 
22 218  VAL n 
22 219  ASN n 
22 220  ARG n 
22 221  VAL n 
22 222  SER n 
22 223  GLN n 
22 224  SER n 
22 225  MET n 
22 226  LYS n 
22 227  GLY n 
22 228  LYS n 
22 229  SER n 
22 230  LYS n 
22 231  SER n 
22 232  SER n 
22 233  HIS n 
22 234  ASP n 
22 235  LEU n 
22 236  LEU n 
22 237  LYS n 
22 238  ASP n 
22 239  ASP n 
22 240  PRO n 
22 241  HIS n 
22 242  LEU n 
22 243  SER n 
22 244  SER n 
22 245  VAL n 
22 246  PRO n 
22 247  VAL n 
22 248  VAL n 
22 249  GLU n 
22 250  SER n 
22 251  GLU n 
22 252  LYS n 
22 253  GLY n 
22 254  ASP n 
22 255  ALA n 
22 256  PRO n 
22 257  ASP n 
22 258  LEU n 
22 259  VAL n 
22 260  ASP n 
22 261  ASP n 
22 262  GLY n 
22 263  GLU n 
22 264  ASP n 
22 265  GLU n 
22 266  SER n 
22 267  ALA n 
22 268  GLU n 
22 269  HIS n 
22 270  ASP n 
22 271  GLU n 
22 272  TYR n 
22 273  ILE n 
22 274  ASP n 
22 275  GLY n 
22 276  ASP n 
22 277  GLU n 
22 278  LYS n 
22 279  ASN n 
22 280  LEU n 
22 281  MET n 
22 282  ARG n 
22 283  GLU n 
22 284  ARG n 
22 285  ILE n 
22 286  ALA n 
22 287  LYS n 
22 288  LYS n 
22 289  LEU n 
22 290  LYS n 
22 291  LYS n 
22 292  ASP n 
22 293  THR n 
22 294  SER n 
22 295  ALA n 
22 296  ASN n 
22 297  VAL n 
22 298  LYS n 
22 299  SER n 
22 300  ALA n 
22 301  GLY n 
22 302  GLU n 
22 303  GLY n 
22 304  GLU n 
22 305  VAL n 
22 306  GLU n 
22 307  LYS n 
22 308  LYS n 
22 309  SER n 
22 310  VAL n 
22 311  SER n 
22 312  ARG n 
22 313  SER n 
22 314  GLU n 
22 315  GLU n 
22 316  LEU n 
22 317  ARG n 
22 318  LYS n 
22 319  GLU n 
22 320  ALA n 
22 321  ARG n 
22 322  GLN n 
22 323  LEU n 
22 324  LYS n 
22 325  ARG n 
22 326  GLU n 
22 327  LEU n 
22 328  LEU n 
22 329  ALA n 
22 330  ALA n 
22 331  LYS n 
22 332  GLN n 
22 333  LYS n 
22 334  LYS n 
22 335  VAL n 
22 336  GLU n 
22 337  ASN n 
22 338  ALA n 
22 339  ALA n 
22 340  LYS n 
22 341  GLN n 
22 342  ALA n 
22 343  GLU n 
22 344  LYS n 
22 345  ARG n 
22 346  SER n 
22 347  GLU n 
22 348  GLU n 
22 349  GLU n 
22 350  GLU n 
22 351  ALA n 
22 352  PRO n 
22 353  PRO n 
22 354  ASP n 
22 355  GLY n 
22 356  ALA n 
22 357  VAL n 
22 358  ALA n 
22 359  GLU n 
22 360  TYR n 
22 361  ARG n 
22 362  ARG n 
22 363  GLU n 
22 364  LYS n 
22 365  GLN n 
22 366  LYS n 
22 367  TYR n 
22 368  GLU n 
22 369  ALA n 
22 370  LEU n 
22 371  ARG n 
22 372  LYS n 
22 373  GLN n 
22 374  GLN n 
22 375  SER n 
22 376  LYS n 
22 377  LYS n 
22 378  GLY n 
22 379  THR n 
22 380  SER n 
22 381  ARG n 
22 382  GLU n 
22 383  ASP n 
22 384  GLN n 
22 385  THR n 
22 386  LEU n 
22 387  ALA n 
22 388  LEU n 
22 389  LEU n 
22 390  ASN n 
22 391  GLN n 
22 392  PHE n 
22 393  LYS n 
22 394  SER n 
22 395  LYS n 
22 396  LEU n 
22 397  THR n 
22 398  GLN n 
22 399  ALA n 
22 400  ILE n 
22 401  ALA n 
22 402  GLU n 
22 403  THR n 
22 404  PRO n 
22 405  GLU n 
22 406  ASN n 
22 407  ASP n 
22 408  ILE n 
22 409  PRO n 
22 410  GLU n 
22 411  THR n 
22 412  GLU n 
22 413  VAL n 
22 414  GLU n 
22 415  ASP n 
22 416  ASP n 
22 417  GLU n 
22 418  GLY n 
22 419  TRP n 
22 420  MET n 
22 421  SER n 
22 422  HIS n 
22 423  VAL n 
22 424  LEU n 
22 425  GLN n 
22 426  PHE n 
22 427  GLU n 
22 428  ASP n 
22 429  LYS n 
22 430  SER n 
22 431  ARG n 
22 432  LYS n 
22 433  VAL n 
22 434  LYS n 
22 435  ASP n 
22 436  ALA n 
22 437  SER n 
22 438  MET n 
22 439  GLN n 
22 440  ASP n 
22 441  SER n 
22 442  ASP n 
22 443  THR n 
22 444  PHE n 
22 445  GLU n 
22 446  ILE n 
22 447  TYR n 
22 448  ASP n 
22 449  PRO n 
22 450  ARG n 
22 451  ASN n 
22 452  PRO n 
22 453  VAL n 
22 454  ASN n 
22 455  LYS n 
22 456  ARG n 
22 457  ARG n 
22 458  ARG n 
22 459  GLU n 
22 460  GLU n 
22 461  SER n 
22 462  LYS n 
22 463  LYS n 
22 464  LEU n 
22 465  MET n 
22 466  ARG n 
22 467  GLU n 
22 468  LYS n 
22 469  LYS n 
22 470  GLU n 
22 471  ARG n 
22 472  ARG n 
23 1    MET n 
23 2    ALA n 
23 3    GLU n 
23 4    GLN n 
23 5    LEU n 
23 6    SER n 
23 7    PRO n 
23 8    GLY n 
23 9    LYS n 
23 10   ALA n 
23 11   VAL n 
23 12   ASP n 
23 13   GLN n 
23 14   VAL n 
23 15   CYS n 
23 16   THR n 
23 17   PHE n 
23 18   LEU n 
23 19   PHE n 
23 20   LYS n 
23 21   LYS n 
23 22   PRO n 
23 23   GLY n 
23 24   ARG n 
23 25   LYS n 
23 26   GLY n 
23 27   ALA n 
23 28   ALA n 
23 29   GLY n 
23 30   ARG n 
23 31   ARG n 
23 32   LYS n 
23 33   ARG n 
23 34   PRO n 
23 35   ALA n 
23 36   CYS n 
23 37   ASP n 
23 38   PRO n 
23 39   GLU n 
23 40   PRO n 
23 41   GLY n 
23 42   GLU n 
23 43   SER n 
23 44   GLY n 
23 45   SER n 
23 46   SER n 
23 47   SER n 
23 48   ASP n 
23 49   GLU n 
23 50   GLY n 
23 51   CYS n 
23 52   THR n 
23 53   VAL n 
23 54   VAL n 
23 55   ARG n 
23 56   PRO n 
23 57   GLU n 
23 58   LYS n 
23 59   LYS n 
23 60   ARG n 
23 61   VAL n 
23 62   THR n 
23 63   HIS n 
23 64   ASN n 
23 65   PRO n 
23 66   MET n 
23 67   ILE n 
23 68   GLN n 
23 69   LYS n 
23 70   THR n 
23 71   ARG n 
23 72   ASP n 
23 73   SER n 
23 74   GLY n 
23 75   LYS n 
23 76   GLN n 
23 77   LYS n 
23 78   ALA n 
23 79   ALA n 
23 80   TYR n 
23 81   GLY n 
23 82   ASP n 
23 83   LEU n 
23 84   SER n 
23 85   SER n 
23 86   GLU n 
23 87   GLU n 
23 88   GLU n 
23 89   GLU n 
23 90   GLU n 
23 91   ASN n 
23 92   GLU n 
23 93   PRO n 
23 94   GLU n 
23 95   SER n 
23 96   LEU n 
23 97   GLY n 
23 98   VAL n 
23 99   VAL n 
23 100  TYR n 
23 101  LYS n 
23 102  SER n 
23 103  THR n 
23 104  ARG n 
23 105  SER n 
23 106  ALA n 
23 107  LYS n 
23 108  PRO n 
23 109  VAL n 
23 110  GLY n 
23 111  PRO n 
23 112  GLU n 
23 113  ASP n 
23 114  MET n 
23 115  GLY n 
23 116  ALA n 
23 117  THR n 
23 118  ALA n 
23 119  VAL n 
23 120  TYR n 
23 121  GLU n 
23 122  LEU n 
23 123  ASP n 
23 124  THR n 
23 125  GLU n 
23 126  LYS n 
23 127  GLU n 
23 128  ARG n 
23 129  ASP n 
23 130  ALA n 
23 131  GLN n 
23 132  ALA n 
23 133  ILE n 
23 134  PHE n 
23 135  GLU n 
23 136  ARG n 
23 137  SER n 
23 138  GLN n 
23 139  LYS n 
23 140  ILE n 
23 141  GLN n 
23 142  GLU n 
23 143  GLU n 
23 144  LEU n 
23 145  ARG n 
23 146  GLY n 
23 147  LYS n 
23 148  GLU n 
23 149  ASP n 
23 150  ASP n 
23 151  LYS n 
23 152  ILE n 
23 153  TYR n 
23 154  ARG n 
23 155  GLY n 
23 156  ILE n 
23 157  ASN n 
23 158  ASN n 
23 159  TYR n 
23 160  GLN n 
23 161  LYS n 
23 162  TYR n 
23 163  MET n 
23 164  LYS n 
23 165  PRO n 
23 166  LYS n 
23 167  ASP n 
23 168  THR n 
23 169  SER n 
23 170  MET n 
23 171  GLY n 
23 172  ASN n 
23 173  ALA n 
23 174  SER n 
23 175  SER n 
23 176  GLY n 
23 177  MET n 
23 178  VAL n 
23 179  ARG n 
23 180  LYS n 
23 181  GLY n 
23 182  PRO n 
23 183  ILE n 
23 184  ARG n 
23 185  ALA n 
23 186  PRO n 
23 187  GLU n 
23 188  HIS n 
23 189  LEU n 
23 190  ARG n 
23 191  ALA n 
23 192  THR n 
23 193  VAL n 
23 194  ARG n 
23 195  TRP n 
23 196  ASP n 
23 197  TYR n 
23 198  GLN n 
23 199  PRO n 
23 200  ASP n 
23 201  ILE n 
23 202  CYS n 
23 203  LYS n 
23 204  ASP n 
23 205  TYR n 
23 206  LYS n 
23 207  GLU n 
23 208  THR n 
23 209  GLY n 
23 210  PHE n 
23 211  CYS n 
23 212  GLY n 
23 213  PHE n 
23 214  GLY n 
23 215  ASP n 
23 216  SER n 
23 217  CYS n 
23 218  LYS n 
23 219  PHE n 
23 220  LEU n 
23 221  HIS n 
23 222  ASP n 
23 223  ARG n 
23 224  SER n 
23 225  ASP n 
23 226  TYR n 
23 227  LYS n 
23 228  HIS n 
23 229  GLY n 
23 230  TRP n 
23 231  GLN n 
23 232  ILE n 
23 233  GLU n 
23 234  ARG n 
23 235  GLU n 
23 236  LEU n 
23 237  ASP n 
23 238  GLU n 
23 239  GLY n 
23 240  ARG n 
23 241  TYR n 
23 242  GLY n 
23 243  VAL n 
23 244  TYR n 
23 245  GLU n 
23 246  ASP n 
23 247  GLU n 
23 248  ASN n 
23 249  TYR n 
23 250  GLU n 
23 251  VAL n 
23 252  GLY n 
23 253  SER n 
23 254  ASP n 
23 255  ASP n 
23 256  GLU n 
23 257  GLU n 
23 258  ILE n 
23 259  PRO n 
23 260  PHE n 
23 261  LYS n 
23 262  CYS n 
23 263  PHE n 
23 264  ILE n 
23 265  CYS n 
23 266  ARG n 
23 267  GLN n 
23 268  SER n 
23 269  PHE n 
23 270  GLN n 
23 271  ASN n 
23 272  PRO n 
23 273  VAL n 
23 274  VAL n 
23 275  THR n 
23 276  LYS n 
23 277  CYS n 
23 278  ARG n 
23 279  HIS n 
23 280  TYR n 
23 281  PHE n 
23 282  CYS n 
23 283  GLU n 
23 284  SER n 
23 285  CYS n 
23 286  ALA n 
23 287  LEU n 
23 288  GLN n 
23 289  HIS n 
23 290  PHE n 
23 291  ARG n 
23 292  THR n 
23 293  THR n 
23 294  PRO n 
23 295  ARG n 
23 296  CYS n 
23 297  TYR n 
23 298  VAL n 
23 299  CYS n 
23 300  ASP n 
23 301  GLN n 
23 302  GLN n 
23 303  THR n 
23 304  ASN n 
23 305  GLY n 
23 306  VAL n 
23 307  PHE n 
23 308  ASN n 
23 309  PRO n 
23 310  ALA n 
23 311  LYS n 
23 312  GLU n 
23 313  LEU n 
23 314  ILE n 
23 315  ALA n 
23 316  LYS n 
23 317  LEU n 
23 318  GLU n 
23 319  LYS n 
23 320  HIS n 
23 321  ARG n 
23 322  ALA n 
23 323  THR n 
23 324  GLY n 
23 325  GLU n 
23 326  GLY n 
23 327  GLY n 
23 328  ALA n 
23 329  SER n 
23 330  ASP n 
23 331  LEU n 
23 332  PRO n 
23 333  GLU n 
23 334  ASP n 
23 335  PRO n 
23 336  ASP n 
23 337  GLU n 
23 338  ASP n 
23 339  ALA n 
23 340  ILE n 
23 341  PRO n 
23 342  ILE n 
23 343  THR n 
24 1    MET n 
24 2    ALA n 
24 3    LYS n 
24 4    ILE n 
24 5    ALA n 
24 6    LYS n 
24 7    THR n 
24 8    HIS n 
24 9    GLU n 
24 10   ASP n 
24 11   ILE n 
24 12   GLU n 
24 13   ALA n 
24 14   GLN n 
24 15   ILE n 
24 16   ARG n 
24 17   GLU n 
24 18   ILE n 
24 19   GLN n 
24 20   GLY n 
24 21   LYS n 
24 22   LYS n 
24 23   ALA n 
24 24   ALA n 
24 25   LEU n 
24 26   ASP n 
24 27   GLU n 
24 28   ALA n 
24 29   GLN n 
24 30   GLY n 
24 31   VAL n 
24 32   GLY n 
24 33   LEU n 
24 34   ASP n 
24 35   SER n 
24 36   THR n 
24 37   GLY n 
24 38   TYR n 
24 39   TYR n 
24 40   ASP n 
24 41   GLN n 
24 42   GLU n 
24 43   ILE n 
24 44   TYR n 
24 45   GLY n 
24 46   GLY n 
24 47   SER n 
24 48   ASP n 
24 49   SER n 
24 50   ARG n 
24 51   PHE n 
24 52   ALA n 
24 53   GLY n 
24 54   TYR n 
24 55   VAL n 
24 56   THR n 
24 57   SER n 
24 58   ILE n 
24 59   ALA n 
24 60   ALA n 
24 61   THR n 
24 62   GLU n 
24 63   LEU n 
24 64   GLU n 
24 65   ASP n 
24 66   ASP n 
24 67   ASP n 
24 68   ASP n 
24 69   ASP n 
24 70   TYR n 
24 71   SER n 
24 72   SER n 
24 73   SER n 
24 74   THR n 
24 75   SER n 
24 76   LEU n 
24 77   LEU n 
24 78   GLY n 
24 79   GLN n 
24 80   LYS n 
24 81   LYS n 
24 82   PRO n 
24 83   GLY n 
24 84   TYR n 
24 85   HIS n 
24 86   ALA n 
24 87   PRO n 
24 88   VAL n 
24 89   ALA n 
24 90   LEU n 
24 91   LEU n 
24 92   ASN n 
24 93   ASP n 
24 94   ILE n 
24 95   PRO n 
24 96   GLN n 
24 97   SER n 
24 98   THR n 
24 99   GLU n 
24 100  GLN n 
24 101  TYR n 
24 102  ASP n 
24 103  PRO n 
24 104  PHE n 
24 105  ALA n 
24 106  GLU n 
24 107  HIS n 
24 108  ARG n 
24 109  PRO n 
24 110  PRO n 
24 111  LYS n 
24 112  ILE n 
24 113  ALA n 
24 114  ASP n 
24 115  ARG n 
24 116  GLU n 
24 117  ASP n 
24 118  GLU n 
24 119  TYR n 
24 120  LYS n 
24 121  LYS n 
24 122  HIS n 
24 123  ARG n 
24 124  ARG n 
24 125  THR n 
24 126  MET n 
24 127  ILE n 
24 128  ILE n 
24 129  SER n 
24 130  PRO n 
24 131  GLU n 
24 132  ARG n 
24 133  LEU n 
24 134  ASP n 
24 135  PRO n 
24 136  PHE n 
24 137  ALA n 
24 138  ASP n 
24 139  GLY n 
24 140  GLY n 
24 141  LYS n 
24 142  THR n 
24 143  PRO n 
24 144  ASP n 
24 145  PRO n 
24 146  LYS n 
24 147  MET n 
24 148  ASN n 
24 149  ALA n 
24 150  ARG n 
24 151  THR n 
24 152  TYR n 
24 153  MET n 
24 154  ASP n 
24 155  VAL n 
24 156  MET n 
24 157  ARG n 
24 158  GLU n 
24 159  GLN n 
24 160  HIS n 
24 161  LEU n 
24 162  THR n 
24 163  LYS n 
24 164  GLU n 
24 165  GLU n 
24 166  ARG n 
24 167  GLU n 
24 168  ILE n 
24 169  ARG n 
24 170  GLN n 
24 171  GLN n 
24 172  LEU n 
24 173  ALA n 
24 174  GLU n 
24 175  LYS n 
24 176  ALA n 
24 177  LYS n 
24 178  ALA n 
24 179  GLY n 
24 180  GLU n 
24 181  LEU n 
24 182  LYS n 
24 183  VAL n 
24 184  VAL n 
24 185  ASN n 
24 186  GLY n 
24 187  ALA n 
24 188  ALA n 
24 189  ALA n 
24 190  SER n 
24 191  GLN n 
24 192  PRO n 
24 193  PRO n 
24 194  SER n 
24 195  LYS n 
24 196  ARG n 
24 197  LYS n 
24 198  ARG n 
24 199  ARG n 
24 200  TRP n 
24 201  ASP n 
24 202  GLN n 
24 203  THR n 
24 204  ALA n 
24 205  ASP n 
24 206  GLN n 
24 207  THR n 
24 208  PRO n 
24 209  GLY n 
24 210  ALA n 
24 211  THR n 
24 212  PRO n 
24 213  LYS n 
24 214  LYS n 
24 215  LEU n 
24 216  SER n 
24 217  SER n 
24 218  TRP n 
24 219  ASP n 
24 220  GLN n 
24 221  ALA n 
24 222  GLU n 
24 223  THR n 
24 224  PRO n 
24 225  GLY n 
24 226  HIS n 
24 227  THR n 
24 228  PRO n 
24 229  SER n 
24 230  LEU n 
24 231  ARG n 
24 232  TRP n 
24 233  ASP n 
24 234  GLU n 
24 235  THR n 
24 236  PRO n 
24 237  GLY n 
24 238  ARG n 
24 239  ALA n 
24 240  LYS n 
24 241  GLY n 
24 242  SER n 
24 243  GLU n 
24 244  THR n 
24 245  PRO n 
24 246  GLY n 
24 247  ALA n 
24 248  THR n 
24 249  PRO n 
24 250  GLY n 
24 251  SER n 
24 252  LYS n 
24 253  ILE n 
24 254  TRP n 
24 255  ASP n 
24 256  PRO n 
24 257  THR n 
24 258  PRO n 
24 259  SER n 
24 260  HIS n 
24 261  THR n 
24 262  PRO n 
24 263  ALA n 
24 264  GLY n 
24 265  ALA n 
24 266  ALA n 
24 267  THR n 
24 268  PRO n 
24 269  GLY n 
24 270  ARG n 
24 271  GLY n 
24 272  ASP n 
24 273  THR n 
24 274  PRO n 
24 275  GLY n 
24 276  HIS n 
24 277  ALA n 
24 278  THR n 
24 279  PRO n 
24 280  GLY n 
24 281  HIS n 
24 282  GLY n 
24 283  GLY n 
24 284  ALA n 
24 285  THR n 
24 286  SER n 
24 287  SER n 
24 288  ALA n 
24 289  ARG n 
24 290  LYS n 
24 291  ASN n 
24 292  ARG n 
24 293  TRP n 
24 294  ASP n 
24 295  GLU n 
24 296  THR n 
24 297  PRO n 
24 298  LYS n 
24 299  THR n 
24 300  GLU n 
24 301  ARG n 
24 302  ASP n 
24 303  THR n 
24 304  PRO n 
24 305  GLY n 
24 306  HIS n 
24 307  GLY n 
24 308  SER n 
24 309  GLY n 
24 310  TRP n 
24 311  ALA n 
24 312  GLU n 
24 313  THR n 
24 314  PRO n 
24 315  ARG n 
24 316  THR n 
24 317  ASP n 
24 318  ARG n 
24 319  GLY n 
24 320  GLY n 
24 321  ASP n 
24 322  SER n 
24 323  ILE n 
24 324  GLY n 
24 325  GLU n 
24 326  THR n 
24 327  PRO n 
24 328  THR n 
24 329  PRO n 
24 330  GLY n 
24 331  ALA n 
24 332  SER n 
24 333  LYS n 
24 334  ARG n 
24 335  LYS n 
24 336  SER n 
24 337  ARG n 
24 338  TRP n 
24 339  ASP n 
24 340  GLU n 
24 341  THR n 
24 342  PRO n 
24 343  ALA n 
24 344  SER n 
24 345  GLN n 
24 346  MET n 
24 347  GLY n 
24 348  GLY n 
24 349  SER n 
24 350  THR n 
24 351  PRO n 
24 352  VAL n 
24 353  LEU n 
24 354  THR n 
24 355  PRO n 
24 356  GLY n 
24 357  LYS n 
24 358  THR n 
24 359  PRO n 
24 360  ILE n 
24 361  GLY n 
24 362  THR n 
24 363  PRO n 
24 364  ALA n 
24 365  MET n 
24 366  ASN n 
24 367  MET n 
24 368  ALA n 
24 369  THR n 
24 370  PRO n 
24 371  THR n 
24 372  PRO n 
24 373  GLY n 
24 374  HIS n 
24 375  ILE n 
24 376  MET n 
24 377  SER n 
24 378  MET n 
24 379  THR n 
24 380  PRO n 
24 381  GLU n 
24 382  GLN n 
24 383  LEU n 
24 384  GLN n 
24 385  ALA n 
24 386  TRP n 
24 387  ARG n 
24 388  TRP n 
24 389  GLU n 
24 390  ARG n 
24 391  GLU n 
24 392  ILE n 
24 393  ASP n 
24 394  GLU n 
24 395  ARG n 
24 396  ASN n 
24 397  ARG n 
24 398  PRO n 
24 399  LEU n 
24 400  SER n 
24 401  ASP n 
24 402  GLU n 
24 403  GLU n 
24 404  LEU n 
24 405  ASP n 
24 406  ALA n 
24 407  MET n 
24 408  PHE n 
24 409  PRO n 
24 410  GLU n 
24 411  GLY n 
24 412  TYR n 
24 413  LYS n 
24 414  VAL n 
24 415  LEU n 
24 416  PRO n 
24 417  PRO n 
24 418  PRO n 
24 419  ALA n 
24 420  GLY n 
24 421  TYR n 
24 422  VAL n 
24 423  PRO n 
24 424  ILE n 
24 425  ARG n 
24 426  THR n 
24 427  PRO n 
24 428  ALA n 
24 429  ARG n 
24 430  LYS n 
24 431  LEU n 
24 432  THR n 
24 433  ALA n 
24 434  THR n 
24 435  PRO n 
24 436  THR n 
24 437  PRO n 
24 438  LEU n 
24 439  GLY n 
24 440  GLY n 
24 441  MET n 
24 442  THR n 
24 443  GLY n 
24 444  PHE n 
24 445  HIS n 
24 446  MET n 
24 447  GLN n 
24 448  THR n 
24 449  GLU n 
24 450  ASP n 
24 451  ARG n 
24 452  THR n 
24 453  MET n 
24 454  LYS n 
24 455  SER n 
24 456  VAL n 
24 457  ASN n 
24 458  ASP n 
24 459  GLN n 
24 460  PRO n 
24 461  SER n 
24 462  GLY n 
24 463  ASN n 
24 464  LEU n 
24 465  PRO n 
24 466  PHE n 
24 467  LEU n 
24 468  LYS n 
24 469  PRO n 
24 470  ASP n 
24 471  ASP n 
24 472  ILE n 
24 473  GLN n 
24 474  TYR n 
24 475  PHE n 
24 476  ASP n 
24 477  LYS n 
24 478  LEU n 
24 479  LEU n 
24 480  VAL n 
24 481  ASP n 
24 482  VAL n 
24 483  ASP n 
24 484  GLU n 
24 485  SER n 
24 486  THR n 
24 487  LEU n 
24 488  SER n 
24 489  PRO n 
24 490  GLU n 
24 491  GLU n 
24 492  GLN n 
24 493  LYS n 
24 494  GLU n 
24 495  ARG n 
24 496  LYS n 
24 497  ILE n 
24 498  MET n 
24 499  LYS n 
24 500  LEU n 
24 501  LEU n 
24 502  LEU n 
24 503  LYS n 
24 504  ILE n 
24 505  LYS n 
24 506  ASN n 
24 507  GLY n 
24 508  THR n 
24 509  PRO n 
24 510  PRO n 
24 511  MET n 
24 512  ARG n 
24 513  LYS n 
24 514  ALA n 
24 515  ALA n 
24 516  LEU n 
24 517  ARG n 
24 518  GLN n 
24 519  ILE n 
24 520  THR n 
24 521  ASP n 
24 522  LYS n 
24 523  ALA n 
24 524  ARG n 
24 525  GLU n 
24 526  PHE n 
24 527  GLY n 
24 528  ALA n 
24 529  GLY n 
24 530  PRO n 
24 531  LEU n 
24 532  PHE n 
24 533  ASN n 
24 534  GLN n 
24 535  ILE n 
24 536  LEU n 
24 537  PRO n 
24 538  LEU n 
24 539  LEU n 
24 540  MET n 
24 541  SER n 
24 542  PRO n 
24 543  THR n 
24 544  LEU n 
24 545  GLU n 
24 546  ASP n 
24 547  GLN n 
24 548  GLU n 
24 549  ARG n 
24 550  HIS n 
24 551  LEU n 
24 552  LEU n 
24 553  VAL n 
24 554  LYS n 
24 555  VAL n 
24 556  ILE n 
24 557  ASP n 
24 558  ARG n 
24 559  ILE n 
24 560  LEU n 
24 561  TYR n 
24 562  LYS n 
24 563  LEU n 
24 564  ASP n 
24 565  ASP n 
24 566  LEU n 
24 567  VAL n 
24 568  ARG n 
24 569  PRO n 
24 570  TYR n 
24 571  VAL n 
24 572  HIS n 
24 573  LYS n 
24 574  ILE n 
24 575  LEU n 
24 576  VAL n 
24 577  VAL n 
24 578  ILE n 
24 579  GLU n 
24 580  PRO n 
24 581  LEU n 
24 582  LEU n 
24 583  ILE n 
24 584  ASP n 
24 585  GLU n 
24 586  ASP n 
24 587  TYR n 
24 588  TYR n 
24 589  ALA n 
24 590  ARG n 
24 591  VAL n 
24 592  GLU n 
24 593  GLY n 
24 594  ARG n 
24 595  GLU n 
24 596  ILE n 
24 597  ILE n 
24 598  SER n 
24 599  ASN n 
24 600  LEU n 
24 601  ALA n 
24 602  LYS n 
24 603  ALA n 
24 604  ALA n 
24 605  GLY n 
24 606  LEU n 
24 607  ALA n 
24 608  THR n 
24 609  MET n 
24 610  ILE n 
24 611  SER n 
24 612  THR n 
24 613  MET n 
24 614  ARG n 
24 615  PRO n 
24 616  ASP n 
24 617  ILE n 
24 618  ASP n 
24 619  ASN n 
24 620  MET n 
24 621  ASP n 
24 622  GLU n 
24 623  TYR n 
24 624  VAL n 
24 625  ARG n 
24 626  ASN n 
24 627  THR n 
24 628  THR n 
24 629  ALA n 
24 630  ARG n 
24 631  ALA n 
24 632  PHE n 
24 633  ALA n 
24 634  VAL n 
24 635  VAL n 
24 636  ALA n 
24 637  SER n 
24 638  ALA n 
24 639  LEU n 
24 640  GLY n 
24 641  ILE n 
24 642  PRO n 
24 643  SER n 
24 644  LEU n 
24 645  LEU n 
24 646  PRO n 
24 647  PHE n 
24 648  LEU n 
24 649  LYS n 
24 650  ALA n 
24 651  VAL n 
24 652  CYS n 
24 653  LYS n 
24 654  SER n 
24 655  LYS n 
24 656  LYS n 
24 657  SER n 
24 658  TRP n 
24 659  GLN n 
24 660  ALA n 
24 661  ARG n 
24 662  HIS n 
24 663  THR n 
24 664  GLY n 
24 665  ILE n 
24 666  LYS n 
24 667  ILE n 
24 668  VAL n 
24 669  GLN n 
24 670  GLN n 
24 671  ILE n 
24 672  ALA n 
24 673  ILE n 
24 674  LEU n 
24 675  MET n 
24 676  GLY n 
24 677  CYS n 
24 678  ALA n 
24 679  ILE n 
24 680  LEU n 
24 681  PRO n 
24 682  HIS n 
24 683  LEU n 
24 684  ARG n 
24 685  SER n 
24 686  LEU n 
24 687  VAL n 
24 688  GLU n 
24 689  ILE n 
24 690  ILE n 
24 691  GLU n 
24 692  HIS n 
24 693  GLY n 
24 694  LEU n 
24 695  VAL n 
24 696  ASP n 
24 697  GLU n 
24 698  GLN n 
24 699  GLN n 
24 700  LYS n 
24 701  VAL n 
24 702  ARG n 
24 703  THR n 
24 704  ILE n 
24 705  SER n 
24 706  ALA n 
24 707  LEU n 
24 708  ALA n 
24 709  ILE n 
24 710  ALA n 
24 711  ALA n 
24 712  LEU n 
24 713  ALA n 
24 714  GLU n 
24 715  ALA n 
24 716  ALA n 
24 717  THR n 
24 718  PRO n 
24 719  TYR n 
24 720  GLY n 
24 721  ILE n 
24 722  GLU n 
24 723  SER n 
24 724  PHE n 
24 725  ASP n 
24 726  SER n 
24 727  VAL n 
24 728  LEU n 
24 729  LYS n 
24 730  PRO n 
24 731  LEU n 
24 732  TRP n 
24 733  LYS n 
24 734  GLY n 
24 735  ILE n 
24 736  ARG n 
24 737  GLN n 
24 738  HIS n 
24 739  ARG n 
24 740  GLY n 
24 741  LYS n 
24 742  GLY n 
24 743  LEU n 
24 744  ALA n 
24 745  ALA n 
24 746  PHE n 
24 747  LEU n 
24 748  LYS n 
24 749  ALA n 
24 750  ILE n 
24 751  GLY n 
24 752  TYR n 
24 753  LEU n 
24 754  ILE n 
24 755  PRO n 
24 756  LEU n 
24 757  MET n 
24 758  ASP n 
24 759  ALA n 
24 760  GLU n 
24 761  TYR n 
24 762  ALA n 
24 763  ASN n 
24 764  TYR n 
24 765  TYR n 
24 766  THR n 
24 767  ARG n 
24 768  GLU n 
24 769  VAL n 
24 770  MET n 
24 771  LEU n 
24 772  ILE n 
24 773  LEU n 
24 774  ILE n 
24 775  ARG n 
24 776  GLU n 
24 777  PHE n 
24 778  GLN n 
24 779  SER n 
24 780  PRO n 
24 781  ASP n 
24 782  GLU n 
24 783  GLU n 
24 784  MET n 
24 785  LYS n 
24 786  LYS n 
24 787  ILE n 
24 788  VAL n 
24 789  LEU n 
24 790  LYS n 
24 791  VAL n 
24 792  VAL n 
24 793  LYS n 
24 794  GLN n 
24 795  CYS n 
24 796  CYS n 
24 797  GLY n 
24 798  THR n 
24 799  ASP n 
24 800  GLY n 
24 801  VAL n 
24 802  GLU n 
24 803  ALA n 
24 804  ASN n 
24 805  TYR n 
24 806  ILE n 
24 807  LYS n 
24 808  THR n 
24 809  GLU n 
24 810  ILE n 
24 811  LEU n 
24 812  PRO n 
24 813  PRO n 
24 814  PHE n 
24 815  PHE n 
24 816  LYS n 
24 817  HIS n 
24 818  PHE n 
24 819  TRP n 
24 820  GLN n 
24 821  HIS n 
24 822  ARG n 
24 823  MET n 
24 824  ALA n 
24 825  LEU n 
24 826  ASP n 
24 827  ARG n 
24 828  ARG n 
24 829  ASN n 
24 830  TYR n 
24 831  ARG n 
24 832  GLN n 
24 833  LEU n 
24 834  VAL n 
24 835  ASP n 
24 836  THR n 
24 837  THR n 
24 838  VAL n 
24 839  GLU n 
24 840  LEU n 
24 841  ALA n 
24 842  ASN n 
24 843  LYS n 
24 844  VAL n 
24 845  GLY n 
24 846  ALA n 
24 847  ALA n 
24 848  GLU n 
24 849  ILE n 
24 850  ILE n 
24 851  SER n 
24 852  ARG n 
24 853  ILE n 
24 854  VAL n 
24 855  ASP n 
24 856  ASP n 
24 857  LEU n 
24 858  LYS n 
24 859  ASP n 
24 860  GLU n 
24 861  ALA n 
24 862  GLU n 
24 863  GLN n 
24 864  TYR n 
24 865  ARG n 
24 866  LYS n 
24 867  MET n 
24 868  VAL n 
24 869  MET n 
24 870  GLU n 
24 871  THR n 
24 872  ILE n 
24 873  GLU n 
24 874  LYS n 
24 875  ILE n 
24 876  MET n 
24 877  GLY n 
24 878  ASN n 
24 879  LEU n 
24 880  GLY n 
24 881  ALA n 
24 882  ALA n 
24 883  ASP n 
24 884  ILE n 
24 885  ASP n 
24 886  HIS n 
24 887  LYS n 
24 888  LEU n 
24 889  GLU n 
24 890  GLU n 
24 891  GLN n 
24 892  LEU n 
24 893  ILE n 
24 894  ASP n 
24 895  GLY n 
24 896  ILE n 
24 897  LEU n 
24 898  TYR n 
24 899  ALA n 
24 900  PHE n 
24 901  GLN n 
24 902  GLU n 
24 903  GLN n 
24 904  THR n 
24 905  THR n 
24 906  GLU n 
24 907  ASP n 
24 908  SER n 
24 909  VAL n 
24 910  MET n 
24 911  LEU n 
24 912  ASN n 
24 913  GLY n 
24 914  PHE n 
24 915  GLY n 
24 916  THR n 
24 917  VAL n 
24 918  VAL n 
24 919  ASN n 
24 920  ALA n 
24 921  LEU n 
24 922  GLY n 
24 923  LYS n 
24 924  ARG n 
24 925  VAL n 
24 926  LYS n 
24 927  PRO n 
24 928  TYR n 
24 929  LEU n 
24 930  PRO n 
24 931  GLN n 
24 932  ILE n 
24 933  CYS n 
24 934  GLY n 
24 935  THR n 
24 936  VAL n 
24 937  LEU n 
24 938  TRP n 
24 939  ARG n 
24 940  LEU n 
24 941  ASN n 
24 942  ASN n 
24 943  LYS n 
24 944  SER n 
24 945  ALA n 
24 946  LYS n 
24 947  VAL n 
24 948  ARG n 
24 949  GLN n 
24 950  GLN n 
24 951  ALA n 
24 952  ALA n 
24 953  ASP n 
24 954  LEU n 
24 955  ILE n 
24 956  SER n 
24 957  ARG n 
24 958  THR n 
24 959  ALA n 
24 960  VAL n 
24 961  VAL n 
24 962  MET n 
24 963  LYS n 
24 964  THR n 
24 965  CYS n 
24 966  GLN n 
24 967  GLU n 
24 968  GLU n 
24 969  LYS n 
24 970  LEU n 
24 971  MET n 
24 972  GLY n 
24 973  HIS n 
24 974  LEU n 
24 975  GLY n 
24 976  VAL n 
24 977  VAL n 
24 978  LEU n 
24 979  TYR n 
24 980  GLU n 
24 981  TYR n 
24 982  LEU n 
24 983  GLY n 
24 984  GLU n 
24 985  GLU n 
24 986  TYR n 
24 987  PRO n 
24 988  GLU n 
24 989  VAL n 
24 990  LEU n 
24 991  GLY n 
24 992  SER n 
24 993  ILE n 
24 994  LEU n 
24 995  GLY n 
24 996  ALA n 
24 997  LEU n 
24 998  LYS n 
24 999  ALA n 
24 1000 ILE n 
24 1001 VAL n 
24 1002 ASN n 
24 1003 VAL n 
24 1004 ILE n 
24 1005 GLY n 
24 1006 MET n 
24 1007 HIS n 
24 1008 LYS n 
24 1009 MET n 
24 1010 THR n 
24 1011 PRO n 
24 1012 PRO n 
24 1013 ILE n 
24 1014 LYS n 
24 1015 ASP n 
24 1016 LEU n 
24 1017 LEU n 
24 1018 PRO n 
24 1019 ARG n 
24 1020 LEU n 
24 1021 THR n 
24 1022 PRO n 
24 1023 ILE n 
24 1024 LEU n 
24 1025 LYS n 
24 1026 ASN n 
24 1027 ARG n 
24 1028 HIS n 
24 1029 GLU n 
24 1030 LYS n 
24 1031 VAL n 
24 1032 GLN n 
24 1033 GLU n 
24 1034 ASN n 
24 1035 CYS n 
24 1036 ILE n 
24 1037 ASP n 
24 1038 LEU n 
24 1039 VAL n 
24 1040 GLY n 
24 1041 ARG n 
24 1042 ILE n 
24 1043 ALA n 
24 1044 ASP n 
24 1045 ARG n 
24 1046 GLY n 
24 1047 ALA n 
24 1048 GLU n 
24 1049 TYR n 
24 1050 VAL n 
24 1051 SER n 
24 1052 ALA n 
24 1053 ARG n 
24 1054 GLU n 
24 1055 TRP n 
24 1056 MET n 
24 1057 ARG n 
24 1058 ILE n 
24 1059 CYS n 
24 1060 PHE n 
24 1061 GLU n 
24 1062 LEU n 
24 1063 LEU n 
24 1064 GLU n 
24 1065 LEU n 
24 1066 LEU n 
24 1067 LYS n 
24 1068 ALA n 
24 1069 HIS n 
24 1070 LYS n 
24 1071 LYS n 
24 1072 ALA n 
24 1073 ILE n 
24 1074 ARG n 
24 1075 ARG n 
24 1076 ALA n 
24 1077 THR n 
24 1078 VAL n 
24 1079 ASN n 
24 1080 THR n 
24 1081 PHE n 
24 1082 GLY n 
24 1083 TYR n 
24 1084 ILE n 
24 1085 ALA n 
24 1086 LYS n 
24 1087 ALA n 
24 1088 ILE n 
24 1089 GLY n 
24 1090 PRO n 
24 1091 HIS n 
24 1092 ASP n 
24 1093 VAL n 
24 1094 LEU n 
24 1095 ALA n 
24 1096 THR n 
24 1097 LEU n 
24 1098 LEU n 
24 1099 ASN n 
24 1100 ASN n 
24 1101 LEU n 
24 1102 LYS n 
24 1103 VAL n 
24 1104 GLN n 
24 1105 GLU n 
24 1106 ARG n 
24 1107 GLN n 
24 1108 ASN n 
24 1109 ARG n 
24 1110 VAL n 
24 1111 CYS n 
24 1112 THR n 
24 1113 THR n 
24 1114 VAL n 
24 1115 ALA n 
24 1116 ILE n 
24 1117 ALA n 
24 1118 ILE n 
24 1119 VAL n 
24 1120 ALA n 
24 1121 GLU n 
24 1122 THR n 
24 1123 CYS n 
24 1124 SER n 
24 1125 PRO n 
24 1126 PHE n 
24 1127 THR n 
24 1128 VAL n 
24 1129 LEU n 
24 1130 PRO n 
24 1131 ALA n 
24 1132 LEU n 
24 1133 MET n 
24 1134 ASN n 
24 1135 GLU n 
24 1136 TYR n 
24 1137 ARG n 
24 1138 VAL n 
24 1139 PRO n 
24 1140 GLU n 
24 1141 LEU n 
24 1142 ASN n 
24 1143 VAL n 
24 1144 GLN n 
24 1145 ASN n 
24 1146 GLY n 
24 1147 VAL n 
24 1148 LEU n 
24 1149 LYS n 
24 1150 SER n 
24 1151 LEU n 
24 1152 SER n 
24 1153 PHE n 
24 1154 LEU n 
24 1155 PHE n 
24 1156 GLU n 
24 1157 TYR n 
24 1158 ILE n 
24 1159 GLY n 
24 1160 GLU n 
24 1161 MET n 
24 1162 GLY n 
24 1163 LYS n 
24 1164 ASP n 
24 1165 TYR n 
24 1166 ILE n 
24 1167 TYR n 
24 1168 ALA n 
24 1169 VAL n 
24 1170 THR n 
24 1171 PRO n 
24 1172 LEU n 
24 1173 LEU n 
24 1174 GLU n 
24 1175 ASP n 
24 1176 ALA n 
24 1177 LEU n 
24 1178 MET n 
24 1179 ASP n 
24 1180 ARG n 
24 1181 ASP n 
24 1182 LEU n 
24 1183 VAL n 
24 1184 HIS n 
24 1185 ARG n 
24 1186 GLN n 
24 1187 THR n 
24 1188 ALA n 
24 1189 SER n 
24 1190 ALA n 
24 1191 VAL n 
24 1192 VAL n 
24 1193 GLN n 
24 1194 HIS n 
24 1195 MET n 
24 1196 SER n 
24 1197 LEU n 
24 1198 GLY n 
24 1199 VAL n 
24 1200 TYR n 
24 1201 GLY n 
24 1202 PHE n 
24 1203 GLY n 
24 1204 CYS n 
24 1205 GLU n 
24 1206 ASP n 
24 1207 SER n 
24 1208 LEU n 
24 1209 ASN n 
24 1210 HIS n 
24 1211 LEU n 
24 1212 LEU n 
24 1213 ASN n 
24 1214 TYR n 
24 1215 VAL n 
24 1216 TRP n 
24 1217 PRO n 
24 1218 ASN n 
24 1219 VAL n 
24 1220 PHE n 
24 1221 GLU n 
24 1222 THR n 
24 1223 SER n 
24 1224 PRO n 
24 1225 HIS n 
24 1226 VAL n 
24 1227 ILE n 
24 1228 GLN n 
24 1229 ALA n 
24 1230 VAL n 
24 1231 MET n 
24 1232 GLY n 
24 1233 ALA n 
24 1234 LEU n 
24 1235 GLU n 
24 1236 GLY n 
24 1237 LEU n 
24 1238 ARG n 
24 1239 VAL n 
24 1240 ALA n 
24 1241 ILE n 
24 1242 GLY n 
24 1243 PRO n 
24 1244 CYS n 
24 1245 ARG n 
24 1246 MET n 
24 1247 LEU n 
24 1248 GLN n 
24 1249 TYR n 
24 1250 CYS n 
24 1251 LEU n 
24 1252 GLN n 
24 1253 GLY n 
24 1254 LEU n 
24 1255 PHE n 
24 1256 HIS n 
24 1257 PRO n 
24 1258 ALA n 
24 1259 ARG n 
24 1260 LYS n 
24 1261 VAL n 
24 1262 ARG n 
24 1263 ASP n 
24 1264 VAL n 
24 1265 TYR n 
24 1266 TRP n 
24 1267 LYS n 
24 1268 ILE n 
24 1269 TYR n 
24 1270 ASN n 
24 1271 SER n 
24 1272 ILE n 
24 1273 TYR n 
24 1274 ILE n 
24 1275 GLY n 
24 1276 SER n 
24 1277 GLN n 
24 1278 ASP n 
24 1279 ALA n 
24 1280 LEU n 
24 1281 ILE n 
24 1282 ALA n 
24 1283 HIS n 
24 1284 TYR n 
24 1285 PRO n 
24 1286 ARG n 
24 1287 ILE n 
24 1288 TYR n 
24 1289 ASN n 
24 1290 ASP n 
24 1291 ASP n 
24 1292 LYS n 
24 1293 ASN n 
24 1294 THR n 
24 1295 TYR n 
24 1296 ILE n 
24 1297 ARG n 
24 1298 TYR n 
24 1299 GLU n 
24 1300 LEU n 
24 1301 ASP n 
24 1302 TYR n 
24 1303 ILE n 
24 1304 LEU n 
25 1    MET n 
25 2    PHE n 
25 3    LEU n 
25 4    TYR n 
25 5    ASN n 
25 6    LEU n 
25 7    THR n 
25 8    LEU n 
25 9    GLN n 
25 10   ARG n 
25 11   ALA n 
25 12   THR n 
25 13   GLY n 
25 14   ILE n 
25 15   SER n 
25 16   PHE n 
25 17   ALA n 
25 18   ILE n 
25 19   HIS n 
25 20   GLY n 
25 21   ASN n 
25 22   PHE n 
25 23   SER n 
25 24   GLY n 
25 25   THR n 
25 26   LYS n 
25 27   GLN n 
25 28   GLN n 
25 29   GLU n 
25 30   ILE n 
25 31   VAL n 
25 32   VAL n 
25 33   SER n 
25 34   ARG n 
25 35   GLY n 
25 36   LYS n 
25 37   ILE n 
25 38   LEU n 
25 39   GLU n 
25 40   LEU n 
25 41   LEU n 
25 42   ARG n 
25 43   PRO n 
25 44   ASP n 
25 45   PRO n 
25 46   ASN n 
25 47   THR n 
25 48   GLY n 
25 49   LYS n 
25 50   VAL n 
25 51   HIS n 
25 52   THR n 
25 53   LEU n 
25 54   LEU n 
25 55   THR n 
25 56   VAL n 
25 57   GLU n 
25 58   VAL n 
25 59   PHE n 
25 60   GLY n 
25 61   VAL n 
25 62   ILE n 
25 63   ARG n 
25 64   SER n 
25 65   LEU n 
25 66   MET n 
25 67   ALA n 
25 68   PHE n 
25 69   ARG n 
25 70   LEU n 
25 71   THR n 
25 72   GLY n 
25 73   GLY n 
25 74   THR n 
25 75   LYS n 
25 76   ASP n 
25 77   TYR n 
25 78   ILE n 
25 79   VAL n 
25 80   VAL n 
25 81   GLY n 
25 82   SER n 
25 83   ASP n 
25 84   SER n 
25 85   GLY n 
25 86   ARG n 
25 87   ILE n 
25 88   VAL n 
25 89   ILE n 
25 90   LEU n 
25 91   GLU n 
25 92   TYR n 
25 93   GLN n 
25 94   PRO n 
25 95   SER n 
25 96   LYS n 
25 97   ASN n 
25 98   MET n 
25 99   PHE n 
25 100  GLU n 
25 101  LYS n 
25 102  ILE n 
25 103  HIS n 
25 104  GLN n 
25 105  GLU n 
25 106  THR n 
25 107  PHE n 
25 108  GLY n 
25 109  LYS n 
25 110  SER n 
25 111  GLY n 
25 112  CYS n 
25 113  ARG n 
25 114  ARG n 
25 115  ILE n 
25 116  VAL n 
25 117  PRO n 
25 118  GLY n 
25 119  GLN n 
25 120  PHE n 
25 121  LEU n 
25 122  ALA n 
25 123  VAL n 
25 124  ASP n 
25 125  PRO n 
25 126  LYS n 
25 127  GLY n 
25 128  ARG n 
25 129  ALA n 
25 130  VAL n 
25 131  MET n 
25 132  ILE n 
25 133  SER n 
25 134  ALA n 
25 135  ILE n 
25 136  GLU n 
25 137  LYS n 
25 138  GLN n 
25 139  LYS n 
25 140  LEU n 
25 141  VAL n 
25 142  TYR n 
25 143  ILE n 
25 144  LEU n 
25 145  ASN n 
25 146  ARG n 
25 147  ASP n 
25 148  ALA n 
25 149  ALA n 
25 150  ALA n 
25 151  ARG n 
25 152  LEU n 
25 153  THR n 
25 154  ILE n 
25 155  SER n 
25 156  SER n 
25 157  PRO n 
25 158  LEU n 
25 159  GLU n 
25 160  ALA n 
25 161  HIS n 
25 162  LYS n 
25 163  ALA n 
25 164  ASN n 
25 165  THR n 
25 166  LEU n 
25 167  VAL n 
25 168  TYR n 
25 169  HIS n 
25 170  VAL n 
25 171  VAL n 
25 172  GLY n 
25 173  VAL n 
25 174  ASP n 
25 175  VAL n 
25 176  GLY n 
25 177  PHE n 
25 178  GLU n 
25 179  ASN n 
25 180  PRO n 
25 181  MET n 
25 182  PHE n 
25 183  ALA n 
25 184  CYS n 
25 185  LEU n 
25 186  GLU n 
25 187  MET n 
25 188  ASP n 
25 189  TYR n 
25 190  GLU n 
25 191  GLU n 
25 192  ALA n 
25 193  ASP n 
25 194  ASN n 
25 195  ASP n 
25 196  PRO n 
25 197  THR n 
25 198  GLY n 
25 199  GLU n 
25 200  ALA n 
25 201  ALA n 
25 202  ALA n 
25 203  ASN n 
25 204  THR n 
25 205  GLN n 
25 206  GLN n 
25 207  THR n 
25 208  LEU n 
25 209  THR n 
25 210  PHE n 
25 211  TYR n 
25 212  GLU n 
25 213  LEU n 
25 214  ASP n 
25 215  LEU n 
25 216  GLY n 
25 217  LEU n 
25 218  ASN n 
25 219  HIS n 
25 220  VAL n 
25 221  VAL n 
25 222  ARG n 
25 223  LYS n 
25 224  TYR n 
25 225  SER n 
25 226  GLU n 
25 227  PRO n 
25 228  LEU n 
25 229  GLU n 
25 230  GLU n 
25 231  HIS n 
25 232  GLY n 
25 233  ASN n 
25 234  PHE n 
25 235  LEU n 
25 236  ILE n 
25 237  THR n 
25 238  VAL n 
25 239  PRO n 
25 240  GLY n 
25 241  GLY n 
25 242  SER n 
25 243  ASP n 
25 244  GLY n 
25 245  PRO n 
25 246  SER n 
25 247  GLY n 
25 248  VAL n 
25 249  LEU n 
25 250  ILE n 
25 251  CYS n 
25 252  SER n 
25 253  GLU n 
25 254  ASN n 
25 255  TYR n 
25 256  ILE n 
25 257  THR n 
25 258  TYR n 
25 259  LYS n 
25 260  ASN n 
25 261  PHE n 
25 262  GLY n 
25 263  ASP n 
25 264  GLN n 
25 265  PRO n 
25 266  ASP n 
25 267  ILE n 
25 268  ARG n 
25 269  CYS n 
25 270  PRO n 
25 271  ILE n 
25 272  PRO n 
25 273  ARG n 
25 274  ARG n 
25 275  ARG n 
25 276  ASN n 
25 277  ASP n 
25 278  LEU n 
25 279  ASP n 
25 280  ASP n 
25 281  PRO n 
25 282  GLU n 
25 283  ARG n 
25 284  GLY n 
25 285  MET n 
25 286  ILE n 
25 287  PHE n 
25 288  VAL n 
25 289  CYS n 
25 290  SER n 
25 291  ALA n 
25 292  THR n 
25 293  HIS n 
25 294  LYS n 
25 295  THR n 
25 296  LYS n 
25 297  SER n 
25 298  MET n 
25 299  PHE n 
25 300  PHE n 
25 301  PHE n 
25 302  LEU n 
25 303  ALA n 
25 304  GLN n 
25 305  THR n 
25 306  GLU n 
25 307  GLN n 
25 308  GLY n 
25 309  ASP n 
25 310  ILE n 
25 311  PHE n 
25 312  LYS n 
25 313  ILE n 
25 314  THR n 
25 315  LEU n 
25 316  GLU n 
25 317  THR n 
25 318  ASP n 
25 319  GLU n 
25 320  ASP n 
25 321  MET n 
25 322  VAL n 
25 323  THR n 
25 324  GLU n 
25 325  ILE n 
25 326  ARG n 
25 327  LEU n 
25 328  LYS n 
25 329  TYR n 
25 330  PHE n 
25 331  ASP n 
25 332  THR n 
25 333  VAL n 
25 334  PRO n 
25 335  VAL n 
25 336  ALA n 
25 337  ALA n 
25 338  ALA n 
25 339  MET n 
25 340  CYS n 
25 341  VAL n 
25 342  LEU n 
25 343  LYS n 
25 344  THR n 
25 345  GLY n 
25 346  PHE n 
25 347  LEU n 
25 348  PHE n 
25 349  VAL n 
25 350  ALA n 
25 351  SER n 
25 352  GLU n 
25 353  PHE n 
25 354  GLY n 
25 355  ASN n 
25 356  HIS n 
25 357  TYR n 
25 358  LEU n 
25 359  TYR n 
25 360  GLN n 
25 361  ILE n 
25 362  ALA n 
25 363  HIS n 
25 364  LEU n 
25 365  GLY n 
25 366  ASP n 
25 367  ASP n 
25 368  ASP n 
25 369  GLU n 
25 370  GLU n 
25 371  PRO n 
25 372  GLU n 
25 373  PHE n 
25 374  SER n 
25 375  SER n 
25 376  ALA n 
25 377  MET n 
25 378  PRO n 
25 379  LEU n 
25 380  GLU n 
25 381  GLU n 
25 382  GLY n 
25 383  ASP n 
25 384  THR n 
25 385  PHE n 
25 386  PHE n 
25 387  PHE n 
25 388  GLN n 
25 389  PRO n 
25 390  ARG n 
25 391  PRO n 
25 392  LEU n 
25 393  LYS n 
25 394  ASN n 
25 395  LEU n 
25 396  VAL n 
25 397  LEU n 
25 398  VAL n 
25 399  ASP n 
25 400  GLU n 
25 401  LEU n 
25 402  ASP n 
25 403  SER n 
25 404  LEU n 
25 405  SER n 
25 406  PRO n 
25 407  ILE n 
25 408  LEU n 
25 409  PHE n 
25 410  CYS n 
25 411  GLN n 
25 412  ILE n 
25 413  ALA n 
25 414  ASP n 
25 415  LEU n 
25 416  ALA n 
25 417  ASN n 
25 418  GLU n 
25 419  ASP n 
25 420  THR n 
25 421  PRO n 
25 422  GLN n 
25 423  LEU n 
25 424  TYR n 
25 425  VAL n 
25 426  ALA n 
25 427  CYS n 
25 428  GLY n 
25 429  ARG n 
25 430  GLY n 
25 431  PRO n 
25 432  ARG n 
25 433  SER n 
25 434  SER n 
25 435  LEU n 
25 436  ARG n 
25 437  VAL n 
25 438  LEU n 
25 439  ARG n 
25 440  HIS n 
25 441  GLY n 
25 442  LEU n 
25 443  GLU n 
25 444  VAL n 
25 445  SER n 
25 446  GLU n 
25 447  MET n 
25 448  ALA n 
25 449  VAL n 
25 450  SER n 
25 451  GLU n 
25 452  LEU n 
25 453  PRO n 
25 454  GLY n 
25 455  ASN n 
25 456  PRO n 
25 457  ASN n 
25 458  ALA n 
25 459  VAL n 
25 460  TRP n 
25 461  THR n 
25 462  VAL n 
25 463  ARG n 
25 464  ARG n 
25 465  HIS n 
25 466  ILE n 
25 467  GLU n 
25 468  ASP n 
25 469  GLU n 
25 470  PHE n 
25 471  ASP n 
25 472  ALA n 
25 473  TYR n 
25 474  ILE n 
25 475  ILE n 
25 476  VAL n 
25 477  SER n 
25 478  PHE n 
25 479  VAL n 
25 480  ASN n 
25 481  ALA n 
25 482  THR n 
25 483  LEU n 
25 484  VAL n 
25 485  LEU n 
25 486  SER n 
25 487  ILE n 
25 488  GLY n 
25 489  GLU n 
25 490  THR n 
25 491  VAL n 
25 492  GLU n 
25 493  GLU n 
25 494  VAL n 
25 495  THR n 
25 496  ASP n 
25 497  SER n 
25 498  GLY n 
25 499  PHE n 
25 500  LEU n 
25 501  GLY n 
25 502  THR n 
25 503  THR n 
25 504  PRO n 
25 505  THR n 
25 506  LEU n 
25 507  SER n 
25 508  CYS n 
25 509  SER n 
25 510  LEU n 
25 511  LEU n 
25 512  GLY n 
25 513  ASP n 
25 514  ASP n 
25 515  ALA n 
25 516  LEU n 
25 517  VAL n 
25 518  GLN n 
25 519  VAL n 
25 520  TYR n 
25 521  PRO n 
25 522  ASP n 
25 523  GLY n 
25 524  ILE n 
25 525  ARG n 
25 526  HIS n 
25 527  ILE n 
25 528  ARG n 
25 529  ALA n 
25 530  ASP n 
25 531  LYS n 
25 532  ARG n 
25 533  VAL n 
25 534  ASN n 
25 535  GLU n 
25 536  TRP n 
25 537  LYS n 
25 538  THR n 
25 539  PRO n 
25 540  GLY n 
25 541  LYS n 
25 542  LYS n 
25 543  THR n 
25 544  ILE n 
25 545  VAL n 
25 546  LYS n 
25 547  CYS n 
25 548  ALA n 
25 549  VAL n 
25 550  ASN n 
25 551  GLN n 
25 552  ARG n 
25 553  GLN n 
25 554  VAL n 
25 555  VAL n 
25 556  ILE n 
25 557  ALA n 
25 558  LEU n 
25 559  THR n 
25 560  GLY n 
25 561  GLY n 
25 562  GLU n 
25 563  LEU n 
25 564  VAL n 
25 565  TYR n 
25 566  PHE n 
25 567  GLU n 
25 568  MET n 
25 569  ASP n 
25 570  PRO n 
25 571  SER n 
25 572  GLY n 
25 573  GLN n 
25 574  LEU n 
25 575  ASN n 
25 576  GLU n 
25 577  TYR n 
25 578  THR n 
25 579  GLU n 
25 580  ARG n 
25 581  LYS n 
25 582  GLU n 
25 583  MET n 
25 584  SER n 
25 585  ALA n 
25 586  ASP n 
25 587  VAL n 
25 588  VAL n 
25 589  CYS n 
25 590  MET n 
25 591  SER n 
25 592  LEU n 
25 593  ALA n 
25 594  ASN n 
25 595  VAL n 
25 596  PRO n 
25 597  PRO n 
25 598  GLY n 
25 599  GLU n 
25 600  GLN n 
25 601  ARG n 
25 602  SER n 
25 603  ARG n 
25 604  PHE n 
25 605  LEU n 
25 606  ALA n 
25 607  VAL n 
25 608  GLY n 
25 609  LEU n 
25 610  VAL n 
25 611  ASP n 
25 612  ASN n 
25 613  THR n 
25 614  VAL n 
25 615  ARG n 
25 616  ILE n 
25 617  ILE n 
25 618  SER n 
25 619  LEU n 
25 620  ASP n 
25 621  PRO n 
25 622  SER n 
25 623  ASP n 
25 624  CYS n 
25 625  LEU n 
25 626  GLN n 
25 627  PRO n 
25 628  LEU n 
25 629  SER n 
25 630  MET n 
25 631  GLN n 
25 632  ALA n 
25 633  LEU n 
25 634  PRO n 
25 635  ALA n 
25 636  GLN n 
25 637  PRO n 
25 638  GLU n 
25 639  SER n 
25 640  LEU n 
25 641  CYS n 
25 642  ILE n 
25 643  VAL n 
25 644  GLU n 
25 645  MET n 
25 646  GLY n 
25 647  GLY n 
25 648  THR n 
25 649  GLU n 
25 650  LYS n 
25 651  GLN n 
25 652  ASP n 
25 653  GLU n 
25 654  LEU n 
25 655  GLY n 
25 656  GLU n 
25 657  ARG n 
25 658  GLY n 
25 659  SER n 
25 660  ILE n 
25 661  GLY n 
25 662  PHE n 
25 663  LEU n 
25 664  TYR n 
25 665  LEU n 
25 666  ASN n 
25 667  ILE n 
25 668  GLY n 
25 669  LEU n 
25 670  GLN n 
25 671  ASN n 
25 672  GLY n 
25 673  VAL n 
25 674  LEU n 
25 675  LEU n 
25 676  ARG n 
25 677  THR n 
25 678  VAL n 
25 679  LEU n 
25 680  ASP n 
25 681  PRO n 
25 682  VAL n 
25 683  THR n 
25 684  GLY n 
25 685  ASP n 
25 686  LEU n 
25 687  SER n 
25 688  ASP n 
25 689  THR n 
25 690  ARG n 
25 691  THR n 
25 692  ARG n 
25 693  TYR n 
25 694  LEU n 
25 695  GLY n 
25 696  SER n 
25 697  ARG n 
25 698  PRO n 
25 699  VAL n 
25 700  LYS n 
25 701  LEU n 
25 702  PHE n 
25 703  ARG n 
25 704  VAL n 
25 705  ARG n 
25 706  MET n 
25 707  GLN n 
25 708  GLY n 
25 709  GLN n 
25 710  GLU n 
25 711  ALA n 
25 712  VAL n 
25 713  LEU n 
25 714  ALA n 
25 715  MET n 
25 716  SER n 
25 717  SER n 
25 718  ARG n 
25 719  SER n 
25 720  TRP n 
25 721  LEU n 
25 722  SER n 
25 723  TYR n 
25 724  SER n 
25 725  TYR n 
25 726  GLN n 
25 727  SER n 
25 728  ARG n 
25 729  PHE n 
25 730  HIS n 
25 731  LEU n 
25 732  THR n 
25 733  PRO n 
25 734  LEU n 
25 735  SER n 
25 736  TYR n 
25 737  GLU n 
25 738  THR n 
25 739  LEU n 
25 740  GLU n 
25 741  PHE n 
25 742  ALA n 
25 743  SER n 
25 744  GLY n 
25 745  PHE n 
25 746  ALA n 
25 747  SER n 
25 748  GLU n 
25 749  GLN n 
25 750  CYS n 
25 751  PRO n 
25 752  GLU n 
25 753  GLY n 
25 754  ILE n 
25 755  VAL n 
25 756  ALA n 
25 757  ILE n 
25 758  SER n 
25 759  THR n 
25 760  ASN n 
25 761  THR n 
25 762  LEU n 
25 763  ARG n 
25 764  ILE n 
25 765  LEU n 
25 766  ALA n 
25 767  LEU n 
25 768  GLU n 
25 769  LYS n 
25 770  LEU n 
25 771  GLY n 
25 772  ALA n 
25 773  VAL n 
25 774  PHE n 
25 775  ASN n 
25 776  GLN n 
25 777  VAL n 
25 778  ALA n 
25 779  PHE n 
25 780  PRO n 
25 781  LEU n 
25 782  GLN n 
25 783  TYR n 
25 784  THR n 
25 785  PRO n 
25 786  ARG n 
25 787  LYS n 
25 788  PHE n 
25 789  VAL n 
25 790  ILE n 
25 791  HIS n 
25 792  PRO n 
25 793  GLU n 
25 794  SER n 
25 795  ASN n 
25 796  ASN n 
25 797  LEU n 
25 798  ILE n 
25 799  ILE n 
25 800  ILE n 
25 801  GLU n 
25 802  THR n 
25 803  ASP n 
25 804  HIS n 
25 805  ASN n 
25 806  ALA n 
25 807  TYR n 
25 808  THR n 
25 809  GLU n 
25 810  ALA n 
25 811  THR n 
25 812  LYS n 
25 813  ALA n 
25 814  GLN n 
25 815  ARG n 
25 816  LYS n 
25 817  GLN n 
25 818  GLN n 
25 819  MET n 
25 820  ALA n 
25 821  GLU n 
25 822  GLU n 
25 823  MET n 
25 824  VAL n 
25 825  GLU n 
25 826  ALA n 
25 827  ALA n 
25 828  GLY n 
25 829  GLU n 
25 830  ASP n 
25 831  GLU n 
25 832  ARG n 
25 833  GLU n 
25 834  LEU n 
25 835  ALA n 
25 836  ALA n 
25 837  GLU n 
25 838  MET n 
25 839  ALA n 
25 840  ALA n 
25 841  ALA n 
25 842  PHE n 
25 843  LEU n 
25 844  ASN n 
25 845  GLU n 
25 846  ASN n 
25 847  LEU n 
25 848  PRO n 
25 849  GLU n 
25 850  SER n 
25 851  ILE n 
25 852  PHE n 
25 853  GLY n 
25 854  ALA n 
25 855  PRO n 
25 856  LYS n 
25 857  ALA n 
25 858  GLY n 
25 859  ASN n 
25 860  GLY n 
25 861  GLN n 
25 862  TRP n 
25 863  ALA n 
25 864  SER n 
25 865  VAL n 
25 866  ILE n 
25 867  ARG n 
25 868  VAL n 
25 869  MET n 
25 870  ASN n 
25 871  PRO n 
25 872  ILE n 
25 873  GLN n 
25 874  GLY n 
25 875  ASN n 
25 876  THR n 
25 877  LEU n 
25 878  ASP n 
25 879  LEU n 
25 880  VAL n 
25 881  GLN n 
25 882  LEU n 
25 883  GLU n 
25 884  GLN n 
25 885  ASN n 
25 886  GLU n 
25 887  ALA n 
25 888  ALA n 
25 889  PHE n 
25 890  SER n 
25 891  VAL n 
25 892  ALA n 
25 893  VAL n 
25 894  CYS n 
25 895  ARG n 
25 896  PHE n 
25 897  SER n 
25 898  ASN n 
25 899  THR n 
25 900  GLY n 
25 901  GLU n 
25 902  ASP n 
25 903  TRP n 
25 904  TYR n 
25 905  VAL n 
25 906  LEU n 
25 907  VAL n 
25 908  GLY n 
25 909  VAL n 
25 910  ALA n 
25 911  LYS n 
25 912  ASP n 
25 913  LEU n 
25 914  ILE n 
25 915  LEU n 
25 916  ASN n 
25 917  PRO n 
25 918  ARG n 
25 919  SER n 
25 920  VAL n 
25 921  ALA n 
25 922  GLY n 
25 923  GLY n 
25 924  PHE n 
25 925  VAL n 
25 926  TYR n 
25 927  THR n 
25 928  TYR n 
25 929  LYS n 
25 930  LEU n 
25 931  VAL n 
25 932  ASN n 
25 933  ASN n 
25 934  GLY n 
25 935  GLU n 
25 936  LYS n 
25 937  LEU n 
25 938  GLU n 
25 939  PHE n 
25 940  LEU n 
25 941  HIS n 
25 942  LYS n 
25 943  THR n 
25 944  PRO n 
25 945  VAL n 
25 946  GLU n 
25 947  GLU n 
25 948  VAL n 
25 949  PRO n 
25 950  ALA n 
25 951  ALA n 
25 952  ILE n 
25 953  ALA n 
25 954  PRO n 
25 955  PHE n 
25 956  GLN n 
25 957  GLY n 
25 958  ARG n 
25 959  VAL n 
25 960  LEU n 
25 961  ILE n 
25 962  GLY n 
25 963  VAL n 
25 964  GLY n 
25 965  LYS n 
25 966  LEU n 
25 967  LEU n 
25 968  ARG n 
25 969  VAL n 
25 970  TYR n 
25 971  ASP n 
25 972  LEU n 
25 973  GLY n 
25 974  LYS n 
25 975  LYS n 
25 976  LYS n 
25 977  LEU n 
25 978  LEU n 
25 979  ARG n 
25 980  LYS n 
25 981  CYS n 
25 982  GLU n 
25 983  ASN n 
25 984  LYS n 
25 985  HIS n 
25 986  ILE n 
25 987  ALA n 
25 988  ASN n 
25 989  TYR n 
25 990  ILE n 
25 991  SER n 
25 992  GLY n 
25 993  ILE n 
25 994  GLN n 
25 995  THR n 
25 996  ILE n 
25 997  GLY n 
25 998  HIS n 
25 999  ARG n 
25 1000 VAL n 
25 1001 ILE n 
25 1002 VAL n 
25 1003 SER n 
25 1004 ASP n 
25 1005 VAL n 
25 1006 GLN n 
25 1007 GLU n 
25 1008 SER n 
25 1009 PHE n 
25 1010 ILE n 
25 1011 TRP n 
25 1012 VAL n 
25 1013 ARG n 
25 1014 TYR n 
25 1015 LYS n 
25 1016 ARG n 
25 1017 ASN n 
25 1018 GLU n 
25 1019 ASN n 
25 1020 GLN n 
25 1021 LEU n 
25 1022 ILE n 
25 1023 ILE n 
25 1024 PHE n 
25 1025 ALA n 
25 1026 ASP n 
25 1027 ASP n 
25 1028 THR n 
25 1029 TYR n 
25 1030 PRO n 
25 1031 ARG n 
25 1032 TRP n 
25 1033 VAL n 
25 1034 THR n 
25 1035 THR n 
25 1036 ALA n 
25 1037 SER n 
25 1038 LEU n 
25 1039 LEU n 
25 1040 ASP n 
25 1041 TYR n 
25 1042 ASP n 
25 1043 THR n 
25 1044 VAL n 
25 1045 ALA n 
25 1046 GLY n 
25 1047 ALA n 
25 1048 ASP n 
25 1049 LYS n 
25 1050 PHE n 
25 1051 GLY n 
25 1052 ASN n 
25 1053 ILE n 
25 1054 CYS n 
25 1055 VAL n 
25 1056 VAL n 
25 1057 ARG n 
25 1058 LEU n 
25 1059 PRO n 
25 1060 PRO n 
25 1061 ASN n 
25 1062 THR n 
25 1063 ASN n 
25 1064 ASP n 
25 1065 GLU n 
25 1066 VAL n 
25 1067 ASP n 
25 1068 GLU n 
25 1069 ASP n 
25 1070 PRO n 
25 1071 THR n 
25 1072 GLY n 
25 1073 ASN n 
25 1074 LYS n 
25 1075 ALA n 
25 1076 LEU n 
25 1077 TRP n 
25 1078 ASP n 
25 1079 ARG n 
25 1080 GLY n 
25 1081 LEU n 
25 1082 LEU n 
25 1083 ASN n 
25 1084 GLY n 
25 1085 ALA n 
25 1086 SER n 
25 1087 GLN n 
25 1088 LYS n 
25 1089 ALA n 
25 1090 GLU n 
25 1091 VAL n 
25 1092 ILE n 
25 1093 MET n 
25 1094 ASN n 
25 1095 TYR n 
25 1096 HIS n 
25 1097 VAL n 
25 1098 GLY n 
25 1099 GLU n 
25 1100 THR n 
25 1101 VAL n 
25 1102 LEU n 
25 1103 SER n 
25 1104 LEU n 
25 1105 GLN n 
25 1106 LYS n 
25 1107 THR n 
25 1108 THR n 
25 1109 LEU n 
25 1110 ILE n 
25 1111 PRO n 
25 1112 GLY n 
25 1113 GLY n 
25 1114 SER n 
25 1115 GLU n 
25 1116 SER n 
25 1117 LEU n 
25 1118 VAL n 
25 1119 TYR n 
25 1120 THR n 
25 1121 THR n 
25 1122 LEU n 
25 1123 SER n 
25 1124 GLY n 
25 1125 GLY n 
25 1126 ILE n 
25 1127 GLY n 
25 1128 ILE n 
25 1129 LEU n 
25 1130 VAL n 
25 1131 PRO n 
25 1132 PHE n 
25 1133 THR n 
25 1134 SER n 
25 1135 HIS n 
25 1136 GLU n 
25 1137 ASP n 
25 1138 HIS n 
25 1139 ASP n 
25 1140 PHE n 
25 1141 PHE n 
25 1142 GLN n 
25 1143 HIS n 
25 1144 VAL n 
25 1145 GLU n 
25 1146 MET n 
25 1147 HIS n 
25 1148 LEU n 
25 1149 ARG n 
25 1150 SER n 
25 1151 GLU n 
25 1152 HIS n 
25 1153 PRO n 
25 1154 PRO n 
25 1155 LEU n 
25 1156 CYS n 
25 1157 GLY n 
25 1158 ARG n 
25 1159 ASP n 
25 1160 HIS n 
25 1161 LEU n 
25 1162 SER n 
25 1163 PHE n 
25 1164 ARG n 
25 1165 SER n 
25 1166 TYR n 
25 1167 TYR n 
25 1168 PHE n 
25 1169 PRO n 
25 1170 VAL n 
25 1171 LYS n 
25 1172 ASN n 
25 1173 VAL n 
25 1174 ILE n 
25 1175 ASP n 
25 1176 GLY n 
25 1177 ASP n 
25 1178 LEU n 
25 1179 CYS n 
25 1180 GLU n 
25 1181 GLN n 
25 1182 PHE n 
25 1183 ASN n 
25 1184 SER n 
25 1185 MET n 
25 1186 GLU n 
25 1187 PRO n 
25 1188 ASN n 
25 1189 LYS n 
25 1190 GLN n 
25 1191 LYS n 
25 1192 ASN n 
25 1193 VAL n 
25 1194 SER n 
25 1195 GLU n 
25 1196 GLU n 
25 1197 LEU n 
25 1198 ASP n 
25 1199 ARG n 
25 1200 THR n 
25 1201 PRO n 
25 1202 PRO n 
25 1203 GLU n 
25 1204 VAL n 
25 1205 SER n 
25 1206 LYS n 
25 1207 LYS n 
25 1208 LEU n 
25 1209 GLU n 
25 1210 ASP n 
25 1211 ILE n 
25 1212 ARG n 
25 1213 THR n 
25 1214 ARG n 
25 1215 TYR n 
25 1216 ALA n 
25 1217 PHE n 
26 1    MET n 
26 2    THR n 
26 3    ASP n 
26 4    ARG n 
26 5    TYR n 
26 6    THR n 
26 7    ILE n 
26 8    HIS n 
26 9    SER n 
26 10   GLN n 
26 11   LEU n 
26 12   GLU n 
26 13   HIS n 
26 14   LEU n 
26 15   GLN n 
26 16   SER n 
26 17   LYS n 
26 18   TYR n 
26 19   ILE n 
26 20   GLY n 
26 21   THR n 
26 22   GLY n 
26 23   HIS n 
26 24   ALA n 
26 25   ASP n 
26 26   THR n 
26 27   THR n 
26 28   LYS n 
26 29   TRP n 
26 30   GLU n 
26 31   TRP n 
26 32   LEU n 
26 33   VAL n 
26 34   ASN n 
26 35   GLN n 
26 36   HIS n 
26 37   ARG n 
26 38   ASP n 
26 39   SER n 
26 40   TYR n 
26 41   CYS n 
26 42   SER n 
26 43   TYR n 
26 44   MET n 
26 45   GLY n 
26 46   HIS n 
26 47   PHE n 
26 48   ASP n 
26 49   LEU n 
26 50   LEU n 
26 51   ASN n 
26 52   TYR n 
26 53   PHE n 
26 54   ALA n 
26 55   ILE n 
26 56   ALA n 
26 57   GLU n 
26 58   ASN n 
26 59   GLU n 
26 60   SER n 
26 61   LYS n 
26 62   ALA n 
26 63   ARG n 
26 64   VAL n 
26 65   ARG n 
26 66   PHE n 
26 67   ASN n 
26 68   LEU n 
26 69   MET n 
26 70   GLU n 
26 71   LYS n 
26 72   MET n 
26 73   LEU n 
26 74   GLN n 
26 75   PRO n 
26 76   CYS n 
26 77   GLY n 
26 78   PRO n 
26 79   PRO n 
26 80   ALA n 
26 81   ASP n 
26 82   LYS n 
26 83   PRO n 
26 84   GLU n 
26 85   GLU n 
26 86   ASN n 
27 1    MET n 
27 2    ALA n 
27 3    LYS n 
27 4    HIS n 
27 5    HIS n 
27 6    PRO n 
27 7    ASP n 
27 8    LEU n 
27 9    ILE n 
27 10   PHE n 
27 11   CYS n 
27 12   ARG n 
27 13   LYS n 
27 14   GLN n 
27 15   ALA n 
27 16   GLY n 
27 17   VAL n 
27 18   ALA n 
27 19   ILE n 
27 20   GLY n 
27 21   ARG n 
27 22   LEU n 
27 23   CYS n 
27 24   GLU n 
27 25   LYS n 
27 26   CYS n 
27 27   ASP n 
27 28   GLY n 
27 29   LYS n 
27 30   CYS n 
27 31   VAL n 
27 32   ILE n 
27 33   CYS n 
27 34   ASP n 
27 35   SER n 
27 36   TYR n 
27 37   VAL n 
27 38   ARG n 
27 39   PRO n 
27 40   CYS n 
27 41   THR n 
27 42   LEU n 
27 43   VAL n 
27 44   ARG n 
27 45   ILE n 
27 46   CYS n 
27 47   ASP n 
27 48   GLU n 
27 49   CYS n 
27 50   ASN n 
27 51   TYR n 
27 52   GLY n 
27 53   SER n 
27 54   TYR n 
27 55   GLN n 
27 56   GLY n 
27 57   ARG n 
27 58   CYS n 
27 59   VAL n 
27 60   ILE n 
27 61   CYS n 
27 62   GLY n 
27 63   GLY n 
27 64   PRO n 
27 65   GLY n 
27 66   VAL n 
27 67   SER n 
27 68   ASP n 
27 69   ALA n 
27 70   TYR n 
27 71   TYR n 
27 72   CYS n 
27 73   LYS n 
27 74   GLU n 
27 75   CYS n 
27 76   THR n 
27 77   ILE n 
27 78   GLN n 
27 79   GLU n 
27 80   LYS n 
27 81   ASP n 
27 82   ARG n 
27 83   ASP n 
27 84   GLY n 
27 85   CYS n 
27 86   PRO n 
27 87   LYS n 
27 88   ILE n 
27 89   VAL n 
27 90   ASN n 
27 91   LEU n 
27 92   GLY n 
27 93   SER n 
27 94   SER n 
27 95   LYS n 
27 96   THR n 
27 97   ASP n 
27 98   LEU n 
27 99   PHE n 
27 100  TYR n 
27 101  GLU n 
27 102  ARG n 
27 103  LYS n 
27 104  LYS n 
27 105  TYR n 
27 106  GLY n 
27 107  PHE n 
27 108  LYS n 
27 109  LYS n 
27 110  ARG n 
28 1    MET n 
28 2    ALA n 
28 3    MET n 
28 4    GLN n 
28 5    ALA n 
28 6    ALA n 
28 7    LYS n 
28 8    ARG n 
28 9    ALA n 
28 10   ASN n 
28 11   ILE n 
28 12   ARG n 
28 13   LEU n 
28 14   PRO n 
28 15   PRO n 
28 16   GLU n 
28 17   VAL n 
28 18   ASN n 
28 19   ARG n 
28 20   ILE n 
28 21   LEU n 
28 22   TYR n 
28 23   ILE n 
28 24   ARG n 
28 25   ASN n 
28 26   LEU n 
28 27   PRO n 
28 28   TYR n 
28 29   LYS n 
28 30   ILE n 
28 31   THR n 
28 32   ALA n 
28 33   GLU n 
28 34   GLU n 
28 35   MET n 
28 36   TYR n 
28 37   ASP n 
28 38   ILE n 
28 39   PHE n 
28 40   GLY n 
28 41   LYS n 
28 42   TYR n 
28 43   GLY n 
28 44   PRO n 
28 45   ILE n 
28 46   ARG n 
28 47   GLN n 
28 48   ILE n 
28 49   ARG n 
28 50   VAL n 
28 51   GLY n 
28 52   ASN n 
28 53   THR n 
28 54   PRO n 
28 55   GLU n 
28 56   THR n 
28 57   ARG n 
28 58   GLY n 
28 59   THR n 
28 60   ALA n 
28 61   TYR n 
28 62   VAL n 
28 63   VAL n 
28 64   TYR n 
28 65   GLU n 
28 66   ASP n 
28 67   ILE n 
28 68   PHE n 
28 69   ASP n 
28 70   ALA n 
28 71   LYS n 
28 72   ASN n 
28 73   ALA n 
28 74   CYS n 
28 75   ASP n 
28 76   HIS n 
28 77   LEU n 
28 78   SER n 
28 79   GLY n 
28 80   PHE n 
28 81   ASN n 
28 82   VAL n 
28 83   CYS n 
28 84   ASN n 
28 85   ARG n 
28 86   TYR n 
28 87   LEU n 
28 88   VAL n 
28 89   VAL n 
28 90   LEU n 
28 91   TYR n 
28 92   TYR n 
28 93   ASN n 
28 94   ALA n 
28 95   ASN n 
28 96   ARG n 
28 97   ALA n 
28 98   PHE n 
28 99   GLN n 
28 100  LYS n 
28 101  MET n 
28 102  ASP n 
28 103  THR n 
28 104  LYS n 
28 105  LYS n 
28 106  LYS n 
28 107  GLU n 
28 108  GLU n 
28 109  GLN n 
28 110  LEU n 
28 111  LYS n 
28 112  LEU n 
28 113  LEU n 
28 114  LYS n 
28 115  GLU n 
28 116  LYS n 
28 117  TYR n 
28 118  GLY n 
28 119  ILE n 
28 120  ASN n 
28 121  THR n 
28 122  ASP n 
28 123  PRO n 
28 124  PRO n 
28 125  LYS n 
29 1    MET n 
29 2    LYS n 
29 3    ALA n 
29 4    VAL n 
29 5    LYS n 
29 6    SER n 
29 7    GLU n 
29 8    ARG n 
29 9    GLU n 
29 10   ARG n 
29 11   GLY n 
29 12   SER n 
29 13   ARG n 
29 14   ARG n 
29 15   ARG n 
29 16   HIS n 
29 17   ARG n 
29 18   ASP n 
29 19   GLY n 
29 20   ASP n 
29 21   VAL n 
29 22   VAL n 
29 23   LEU n 
29 24   PRO n 
29 25   ALA n 
29 26   GLY n 
29 27   VAL n 
29 28   VAL n 
29 29   VAL n 
29 30   LYS n 
29 31   GLN n 
29 32   GLU n 
29 33   ARG n 
29 34   LEU n 
29 35   SER n 
29 36   PRO n 
29 37   GLU n 
29 38   VAL n 
29 39   ALA n 
29 40   PRO n 
29 41   PRO n 
29 42   ALA n 
29 43   HIS n 
29 44   ARG n 
29 45   ARG n 
29 46   PRO n 
29 47   ASP n 
29 48   HIS n 
29 49   SER n 
29 50   GLY n 
29 51   GLY n 
29 52   SER n 
29 53   PRO n 
29 54   SER n 
29 55   PRO n 
29 56   PRO n 
29 57   THR n 
29 58   SER n 
29 59   GLU n 
29 60   PRO n 
29 61   ALA n 
29 62   ARG n 
29 63   SER n 
29 64   GLY n 
29 65   HIS n 
29 66   ARG n 
29 67   GLY n 
29 68   ASN n 
29 69   ARG n 
29 70   ALA n 
29 71   ARG n 
29 72   GLY n 
29 73   VAL n 
29 74   SER n 
29 75   ARG n 
29 76   SER n 
29 77   PRO n 
29 78   PRO n 
29 79   LYS n 
29 80   LYS n 
29 81   LYS n 
29 82   ASN n 
29 83   LYS n 
29 84   ALA n 
29 85   SER n 
29 86   GLY n 
29 87   ARG n 
29 88   ARG n 
29 89   SER n 
29 90   LYS n 
29 91   SER n 
29 92   PRO n 
29 93   ARG n 
29 94   SER n 
29 95   LYS n 
29 96   ARG n 
29 97   ASN n 
29 98   ARG n 
29 99   SER n 
29 100  PRO n 
29 101  HIS n 
29 102  HIS n 
29 103  SER n 
29 104  THR n 
29 105  VAL n 
29 106  LYS n 
29 107  VAL n 
29 108  LYS n 
29 109  GLN n 
29 110  GLU n 
29 111  ARG n 
29 112  GLU n 
29 113  ASP n 
29 114  HIS n 
29 115  PRO n 
29 116  ARG n 
29 117  ARG n 
29 118  GLY n 
29 119  ARG n 
29 120  GLU n 
29 121  ASP n 
29 122  ARG n 
29 123  GLN n 
29 124  HIS n 
29 125  ARG n 
29 126  GLU n 
29 127  PRO n 
29 128  SER n 
29 129  GLU n 
29 130  GLN n 
29 131  GLU n 
29 132  HIS n 
29 133  ARG n 
29 134  ARG n 
29 135  ALA n 
29 136  ARG n 
29 137  ASN n 
29 138  SER n 
29 139  ASP n 
29 140  ARG n 
29 141  ASP n 
29 142  ARG n 
29 143  HIS n 
29 144  ARG n 
29 145  GLY n 
29 146  HIS n 
29 147  SER n 
29 148  HIS n 
29 149  GLN n 
29 150  ARG n 
29 151  ARG n 
29 152  THR n 
29 153  SER n 
29 154  ASN n 
29 155  GLU n 
29 156  ARG n 
29 157  PRO n 
29 158  GLY n 
29 159  SER n 
29 160  GLY n 
29 161  GLN n 
29 162  GLY n 
29 163  GLN n 
29 164  GLY n 
29 165  ARG n 
29 166  ASP n 
29 167  ARG n 
29 168  ASP n 
29 169  THR n 
29 170  GLN n 
29 171  ASN n 
29 172  LEU n 
29 173  GLN n 
29 174  ALA n 
29 175  GLN n 
29 176  GLU n 
29 177  GLU n 
29 178  GLU n 
29 179  ARG n 
29 180  GLU n 
29 181  PHE n 
29 182  TYR n 
29 183  ASN n 
29 184  ALA n 
29 185  ARG n 
29 186  ARG n 
29 187  ARG n 
29 188  GLU n 
29 189  HIS n 
29 190  ARG n 
29 191  GLN n 
29 192  ARG n 
29 193  ASN n 
29 194  ASP n 
29 195  VAL n 
29 196  GLY n 
29 197  GLY n 
29 198  GLY n 
29 199  GLY n 
29 200  SER n 
29 201  GLU n 
29 202  SER n 
29 203  GLN n 
29 204  GLU n 
29 205  LEU n 
29 206  VAL n 
29 207  PRO n 
29 208  ARG n 
29 209  PRO n 
29 210  GLY n 
29 211  GLY n 
29 212  ASN n 
29 213  ASN n 
29 214  LYS n 
29 215  GLU n 
29 216  LYS n 
29 217  GLU n 
29 218  VAL n 
29 219  PRO n 
29 220  ALA n 
29 221  LYS n 
29 222  GLU n 
29 223  LYS n 
29 224  PRO n 
29 225  SER n 
29 226  PHE n 
29 227  GLU n 
29 228  LEU n 
29 229  SER n 
29 230  GLY n 
29 231  ALA n 
29 232  LEU n 
29 233  LEU n 
29 234  GLU n 
29 235  ASP n 
29 236  THR n 
29 237  ASN n 
29 238  THR n 
29 239  PHE n 
29 240  ARG n 
29 241  GLY n 
29 242  VAL n 
29 243  VAL n 
29 244  ILE n 
29 245  LYS n 
29 246  TYR n 
29 247  SER n 
29 248  GLU n 
29 249  PRO n 
29 250  PRO n 
29 251  GLU n 
29 252  ALA n 
29 253  ARG n 
29 254  ILE n 
29 255  PRO n 
29 256  LYS n 
29 257  LYS n 
29 258  ARG n 
29 259  TRP n 
29 260  ARG n 
29 261  LEU n 
29 262  TYR n 
29 263  PRO n 
29 264  PHE n 
29 265  LYS n 
29 266  ASN n 
29 267  ASP n 
29 268  GLU n 
29 269  VAL n 
29 270  LEU n 
29 271  PRO n 
29 272  VAL n 
29 273  MET n 
29 274  TYR n 
29 275  ILE n 
29 276  HIS n 
29 277  ARG n 
29 278  GLN n 
29 279  SER n 
29 280  ALA n 
29 281  TYR n 
29 282  LEU n 
29 283  LEU n 
29 284  GLY n 
29 285  ARG n 
29 286  HIS n 
29 287  ARG n 
29 288  ARG n 
29 289  ILE n 
29 290  ALA n 
29 291  ASP n 
29 292  ILE n 
29 293  PRO n 
29 294  ILE n 
29 295  ASP n 
29 296  HIS n 
29 297  PRO n 
29 298  SER n 
29 299  CYS n 
29 300  SER n 
29 301  LYS n 
29 302  GLN n 
29 303  HIS n 
29 304  ALA n 
29 305  VAL n 
29 306  PHE n 
29 307  GLN n 
29 308  TYR n 
29 309  ARG n 
29 310  LEU n 
29 311  VAL n 
29 312  GLU n 
29 313  TYR n 
29 314  THR n 
29 315  ARG n 
29 316  ALA n 
29 317  ASP n 
29 318  GLY n 
29 319  THR n 
29 320  VAL n 
29 321  GLY n 
29 322  ARG n 
29 323  ARG n 
29 324  VAL n 
29 325  LYS n 
29 326  PRO n 
29 327  TYR n 
29 328  ILE n 
29 329  ILE n 
29 330  ASP n 
29 331  LEU n 
29 332  GLY n 
29 333  SER n 
29 334  GLY n 
29 335  ASN n 
29 336  GLY n 
29 337  THR n 
29 338  PHE n 
29 339  LEU n 
29 340  ASN n 
29 341  ASN n 
29 342  LYS n 
29 343  ARG n 
29 344  ILE n 
29 345  GLU n 
29 346  PRO n 
29 347  GLN n 
29 348  ARG n 
29 349  TYR n 
29 350  TYR n 
29 351  GLU n 
29 352  LEU n 
29 353  LYS n 
29 354  GLU n 
29 355  LYS n 
29 356  ASP n 
29 357  VAL n 
29 358  LEU n 
29 359  LYS n 
29 360  PHE n 
29 361  GLY n 
29 362  PHE n 
29 363  SER n 
29 364  SER n 
29 365  ARG n 
29 366  GLU n 
29 367  TYR n 
29 368  VAL n 
29 369  LEU n 
29 370  LEU n 
29 371  HIS n 
29 372  GLU n 
29 373  SER n 
29 374  SER n 
29 375  ASP n 
29 376  THR n 
29 377  SER n 
29 378  GLU n 
29 379  ILE n 
29 380  ASP n 
29 381  ARG n 
29 382  LYS n 
29 383  ASP n 
29 384  ASP n 
29 385  GLU n 
29 386  ASP n 
29 387  GLU n 
29 388  GLU n 
29 389  GLU n 
29 390  GLU n 
29 391  GLU n 
29 392  GLU n 
29 393  VAL n 
29 394  SER n 
29 395  ASP n 
29 396  SER n 
30 1    MET n 
30 2    GLU n 
30 3    THR n 
30 4    ILE n 
30 5    LEU n 
30 6    GLU n 
30 7    GLN n 
30 8    GLN n 
30 9    ARG n 
30 10   ARG n 
30 11   TYR n 
30 12   HIS n 
30 13   GLU n 
30 14   GLU n 
30 15   LYS n 
30 16   GLU n 
30 17   ARG n 
30 18   LEU n 
30 19   MET n 
30 20   ASP n 
30 21   VAL n 
30 22   MET n 
30 23   ALA n 
30 24   LYS n 
30 25   GLU n 
30 26   MET n 
30 27   LEU n 
30 28   THR n 
30 29   LYS n 
30 30   LYS n 
30 31   SER n 
30 32   THR n 
30 33   LEU n 
30 34   ARG n 
30 35   ASP n 
30 36   GLN n 
30 37   ILE n 
30 38   ASN n 
30 39   SER n 
30 40   ASP n 
30 41   HIS n 
30 42   ARG n 
30 43   THR n 
30 44   ARG n 
30 45   ALA n 
30 46   MET n 
30 47   GLN n 
30 48   ASP n 
30 49   ARG n 
30 50   TYR n 
30 51   MET n 
30 52   GLU n 
30 53   VAL n 
30 54   SER n 
30 55   GLY n 
30 56   ASN n 
30 57   LEU n 
30 58   ARG n 
30 59   ASP n 
30 60   LEU n 
30 61   TYR n 
30 62   ASP n 
30 63   ASP n 
30 64   LYS n 
30 65   ASP n 
30 66   GLY n 
30 67   LEU n 
30 68   ARG n 
30 69   LYS n 
30 70   GLU n 
30 71   GLU n 
30 72   LEU n 
30 73   ASN n 
30 74   ALA n 
30 75   ILE n 
30 76   SER n 
30 77   GLY n 
30 78   PRO n 
30 79   ASN n 
30 80   GLU n 
30 81   PHE n 
30 82   ALA n 
30 83   GLU n 
30 84   PHE n 
30 85   TYR n 
30 86   ASN n 
30 87   ARG n 
30 88   LEU n 
30 89   LYS n 
30 90   GLN n 
30 91   ILE n 
30 92   LYS n 
30 93   GLU n 
30 94   PHE n 
30 95   HIS n 
30 96   ARG n 
30 97   LYS n 
30 98   HIS n 
30 99   PRO n 
30 100  ASN n 
30 101  GLU n 
30 102  ILE n 
30 103  CYS n 
30 104  VAL n 
30 105  PRO n 
30 106  MET n 
30 107  SER n 
30 108  VAL n 
30 109  GLU n 
30 110  PHE n 
30 111  GLU n 
30 112  GLU n 
30 113  LEU n 
30 114  LEU n 
30 115  LYS n 
30 116  ALA n 
30 117  ARG n 
30 118  GLU n 
30 119  ASN n 
30 120  PRO n 
30 121  SER n 
30 122  GLU n 
30 123  GLU n 
30 124  ALA n 
30 125  GLN n 
30 126  ASN n 
30 127  LEU n 
30 128  VAL n 
30 129  GLU n 
30 130  PHE n 
30 131  THR n 
30 132  ASP n 
30 133  GLU n 
30 134  GLU n 
30 135  GLY n 
30 136  TYR n 
30 137  GLY n 
30 138  ARG n 
30 139  TYR n 
30 140  LEU n 
30 141  ASP n 
30 142  LEU n 
30 143  HIS n 
30 144  ASP n 
30 145  CYS n 
30 146  TYR n 
30 147  LEU n 
30 148  LYS n 
30 149  TYR n 
30 150  ILE n 
30 151  ASN n 
30 152  LEU n 
30 153  LYS n 
30 154  ALA n 
30 155  SER n 
30 156  GLU n 
30 157  LYS n 
30 158  LEU n 
30 159  ASP n 
30 160  TYR n 
30 161  ILE n 
30 162  THR n 
30 163  TYR n 
30 164  LEU n 
30 165  SER n 
30 166  ILE n 
30 167  PHE n 
30 168  ASP n 
30 169  GLN n 
30 170  LEU n 
30 171  PHE n 
30 172  ASP n 
30 173  ILE n 
30 174  PRO n 
30 175  LYS n 
30 176  GLU n 
30 177  ARG n 
30 178  LYS n 
30 179  ASN n 
30 180  ALA n 
30 181  GLU n 
30 182  TYR n 
30 183  LYS n 
30 184  ARG n 
30 185  TYR n 
30 186  LEU n 
30 187  GLU n 
30 188  MET n 
30 189  LEU n 
30 190  LEU n 
30 191  GLU n 
30 192  TYR n 
30 193  LEU n 
30 194  GLN n 
30 195  ASP n 
30 196  TYR n 
30 197  THR n 
30 198  ASP n 
30 199  ARG n 
30 200  VAL n 
30 201  LYS n 
30 202  PRO n 
30 203  LEU n 
30 204  GLN n 
30 205  ASP n 
30 206  GLN n 
30 207  ASN n 
30 208  GLU n 
30 209  LEU n 
30 210  PHE n 
30 211  GLY n 
30 212  LYS n 
30 213  ILE n 
30 214  GLN n 
30 215  ALA n 
30 216  GLU n 
30 217  PHE n 
30 218  GLU n 
30 219  LYS n 
30 220  LYS n 
30 221  TRP n 
30 222  GLU n 
30 223  ASN n 
30 224  GLY n 
30 225  THR n 
30 226  PHE n 
30 227  PRO n 
30 228  GLY n 
30 229  TRP n 
30 230  PRO n 
30 231  LYS n 
30 232  GLU n 
30 233  THR n 
30 234  SER n 
30 235  SER n 
30 236  ALA n 
30 237  LEU n 
30 238  THR n 
30 239  HIS n 
30 240  ALA n 
30 241  GLY n 
30 242  ALA n 
30 243  HIS n 
30 244  LEU n 
30 245  ASP n 
30 246  LEU n 
30 247  SER n 
30 248  ALA n 
30 249  PHE n 
30 250  SER n 
30 251  SER n 
30 252  TRP n 
30 253  GLU n 
30 254  GLU n 
30 255  LEU n 
30 256  ALA n 
30 257  SER n 
30 258  LEU n 
30 259  GLY n 
30 260  LEU n 
30 261  ASP n 
30 262  ARG n 
30 263  LEU n 
30 264  LYS n 
30 265  SER n 
30 266  ALA n 
30 267  LEU n 
30 268  LEU n 
30 269  ALA n 
30 270  LEU n 
30 271  GLY n 
30 272  LEU n 
30 273  LYS n 
30 274  CYS n 
30 275  GLY n 
30 276  GLY n 
30 277  THR n 
30 278  LEU n 
30 279  GLU n 
30 280  GLU n 
30 281  ARG n 
30 282  ALA n 
30 283  GLN n 
30 284  ARG n 
30 285  LEU n 
30 286  PHE n 
30 287  SER n 
30 288  THR n 
30 289  LYS n 
30 290  GLY n 
30 291  LYS n 
30 292  SER n 
30 293  LEU n 
30 294  GLU n 
30 295  SER n 
30 296  LEU n 
30 297  ASP n 
30 298  THR n 
30 299  SER n 
30 300  LEU n 
30 301  PHE n 
30 302  ALA n 
30 303  LYS n 
30 304  ASN n 
30 305  PRO n 
30 306  LYS n 
30 307  SER n 
30 308  LYS n 
30 309  GLY n 
30 310  THR n 
30 311  LYS n 
30 312  ARG n 
30 313  ASP n 
30 314  THR n 
30 315  GLU n 
30 316  ARG n 
30 317  ASN n 
30 318  LYS n 
30 319  ASP n 
30 320  ILE n 
30 321  ALA n 
30 322  PHE n 
30 323  LEU n 
30 324  GLU n 
30 325  ALA n 
30 326  GLN n 
30 327  ILE n 
30 328  TYR n 
30 329  GLU n 
30 330  TYR n 
30 331  VAL n 
30 332  GLU n 
30 333  ILE n 
30 334  LEU n 
30 335  GLY n 
30 336  GLU n 
30 337  GLN n 
30 338  ARG n 
30 339  HIS n 
30 340  LEU n 
30 341  THR n 
30 342  HIS n 
30 343  GLU n 
30 344  ASN n 
30 345  VAL n 
30 346  GLN n 
30 347  ARG n 
30 348  LYS n 
30 349  GLN n 
30 350  ALA n 
30 351  ARG n 
30 352  THR n 
30 353  GLY n 
30 354  GLU n 
30 355  GLU n 
30 356  ARG n 
30 357  GLU n 
30 358  GLU n 
30 359  GLU n 
30 360  GLU n 
30 361  GLU n 
30 362  GLU n 
30 363  GLN n 
30 364  ILE n 
30 365  SER n 
30 366  GLU n 
30 367  SER n 
30 368  GLU n 
30 369  SER n 
30 370  GLU n 
30 371  ASP n 
30 372  GLU n 
30 373  GLU n 
30 374  ASN n 
30 375  GLU n 
30 376  ILE n 
30 377  ILE n 
30 378  TYR n 
30 379  ASN n 
30 380  PRO n 
30 381  LYS n 
30 382  ASN n 
30 383  LEU n 
30 384  PRO n 
30 385  LEU n 
30 386  GLY n 
30 387  TRP n 
30 388  ASP n 
30 389  GLY n 
30 390  LYS n 
30 391  PRO n 
30 392  ILE n 
30 393  PRO n 
30 394  TYR n 
30 395  TRP n 
30 396  LEU n 
30 397  TYR n 
30 398  LYS n 
30 399  LEU n 
30 400  HIS n 
30 401  GLY n 
30 402  LEU n 
30 403  ASN n 
30 404  ILE n 
30 405  ASN n 
30 406  TYR n 
30 407  ASN n 
30 408  CYS n 
30 409  GLU n 
30 410  ILE n 
30 411  CYS n 
30 412  GLY n 
30 413  ASN n 
30 414  TYR n 
30 415  THR n 
30 416  TYR n 
30 417  ARG n 
30 418  GLY n 
30 419  PRO n 
30 420  LYS n 
30 421  ALA n 
30 422  PHE n 
30 423  GLN n 
30 424  ARG n 
30 425  HIS n 
30 426  PHE n 
30 427  ALA n 
30 428  GLU n 
30 429  TRP n 
30 430  ARG n 
30 431  HIS n 
30 432  ALA n 
30 433  HIS n 
30 434  GLY n 
30 435  MET n 
30 436  ARG n 
30 437  CYS n 
30 438  LEU n 
30 439  GLY n 
30 440  ILE n 
30 441  PRO n 
30 442  ASN n 
30 443  THR n 
30 444  ALA n 
30 445  HIS n 
30 446  PHE n 
30 447  ALA n 
30 448  ASN n 
30 449  VAL n 
30 450  THR n 
30 451  GLN n 
30 452  ILE n 
30 453  GLU n 
30 454  ASP n 
30 455  ALA n 
30 456  VAL n 
30 457  SER n 
30 458  LEU n 
30 459  TRP n 
30 460  ALA n 
30 461  LYS n 
30 462  LEU n 
30 463  LYS n 
30 464  LEU n 
30 465  GLN n 
30 466  LYS n 
30 467  ALA n 
30 468  SER n 
30 469  GLU n 
30 470  ARG n 
30 471  TRP n 
30 472  GLN n 
30 473  PRO n 
30 474  ASP n 
30 475  THR n 
30 476  GLU n 
30 477  GLU n 
30 478  GLU n 
30 479  TYR n 
30 480  GLU n 
30 481  ASP n 
30 482  SER n 
30 483  SER n 
30 484  GLY n 
30 485  ASN n 
30 486  VAL n 
30 487  VAL n 
30 488  ASN n 
30 489  LYS n 
30 490  LYS n 
30 491  THR n 
30 492  TYR n 
30 493  GLU n 
30 494  ASP n 
30 495  LEU n 
30 496  LYS n 
30 497  ARG n 
30 498  GLN n 
30 499  GLY n 
30 500  LEU n 
30 501  LEU n 
31 1    MET n 
31 2    ILE n 
31 3    GLU n 
31 4    GLN n 
31 5    GLN n 
31 6    LYS n 
31 7    ARG n 
31 8    LYS n 
31 9    GLY n 
31 10   PRO n 
31 11   GLU n 
31 12   LEU n 
31 13   PRO n 
31 14   LEU n 
31 15   VAL n 
31 16   PRO n 
31 17   VAL n 
31 18   LYS n 
31 19   ARG n 
31 20   GLN n 
31 21   ARG n 
31 22   HIS n 
31 23   GLU n 
31 24   LEU n 
31 25   LEU n 
31 26   LEU n 
31 27   GLY n 
31 28   ALA n 
31 29   GLY n 
31 30   SER n 
31 31   GLY n 
31 32   PRO n 
31 33   GLY n 
31 34   ALA n 
31 35   GLY n 
31 36   GLN n 
31 37   GLN n 
31 38   GLN n 
31 39   ALA n 
31 40   THR n 
31 41   PRO n 
31 42   GLY n 
31 43   ALA n 
31 44   LEU n 
31 45   LEU n 
31 46   GLN n 
31 47   ALA n 
31 48   GLY n 
31 49   PRO n 
31 50   PRO n 
31 51   ARG n 
31 52   CYS n 
31 53   SER n 
31 54   SER n 
31 55   LEU n 
31 56   GLN n 
31 57   ALA n 
31 58   PRO n 
31 59   ILE n 
31 60   MET n 
31 61   LEU n 
31 62   LEU n 
31 63   SER n 
31 64   GLY n 
31 65   HIS n 
31 66   GLU n 
31 67   GLY n 
31 68   GLU n 
31 69   VAL n 
31 70   TYR n 
31 71   CYS n 
31 72   CYS n 
31 73   LYS n 
31 74   PHE n 
31 75   HIS n 
31 76   PRO n 
31 77   ASN n 
31 78   GLY n 
31 79   SER n 
31 80   THR n 
31 81   LEU n 
31 82   ALA n 
31 83   SER n 
31 84   ALA n 
31 85   GLY n 
31 86   PHE n 
31 87   ASP n 
31 88   ARG n 
31 89   LEU n 
31 90   ILE n 
31 91   LEU n 
31 92   LEU n 
31 93   TRP n 
31 94   ASN n 
31 95   VAL n 
31 96   TYR n 
31 97   GLY n 
31 98   ASP n 
31 99   CYS n 
31 100  ASP n 
31 101  ASN n 
31 102  TYR n 
31 103  ALA n 
31 104  THR n 
31 105  LEU n 
31 106  LYS n 
31 107  GLY n 
31 108  HIS n 
31 109  SER n 
31 110  GLY n 
31 111  ALA n 
31 112  VAL n 
31 113  MET n 
31 114  GLU n 
31 115  LEU n 
31 116  HIS n 
31 117  TYR n 
31 118  ASN n 
31 119  THR n 
31 120  ASP n 
31 121  GLY n 
31 122  SER n 
31 123  MET n 
31 124  LEU n 
31 125  PHE n 
31 126  SER n 
31 127  ALA n 
31 128  SER n 
31 129  THR n 
31 130  ASP n 
31 131  LYS n 
31 132  THR n 
31 133  VAL n 
31 134  ALA n 
31 135  VAL n 
31 136  TRP n 
31 137  ASP n 
31 138  SER n 
31 139  GLU n 
31 140  THR n 
31 141  GLY n 
31 142  GLU n 
31 143  ARG n 
31 144  VAL n 
31 145  LYS n 
31 146  ARG n 
31 147  LEU n 
31 148  LYS n 
31 149  GLY n 
31 150  HIS n 
31 151  THR n 
31 152  SER n 
31 153  PHE n 
31 154  VAL n 
31 155  ASN n 
31 156  SER n 
31 157  CYS n 
31 158  TYR n 
31 159  PRO n 
31 160  ALA n 
31 161  ARG n 
31 162  ARG n 
31 163  GLY n 
31 164  PRO n 
31 165  GLN n 
31 166  LEU n 
31 167  VAL n 
31 168  CYS n 
31 169  THR n 
31 170  GLY n 
31 171  SER n 
31 172  ASP n 
31 173  ASP n 
31 174  GLY n 
31 175  THR n 
31 176  VAL n 
31 177  LYS n 
31 178  LEU n 
31 179  TRP n 
31 180  ASP n 
31 181  ILE n 
31 182  ARG n 
31 183  LYS n 
31 184  LYS n 
31 185  ALA n 
31 186  ALA n 
31 187  ILE n 
31 188  GLN n 
31 189  THR n 
31 190  PHE n 
31 191  GLN n 
31 192  ASN n 
31 193  THR n 
31 194  TYR n 
31 195  GLN n 
31 196  VAL n 
31 197  LEU n 
31 198  ALA n 
31 199  VAL n 
31 200  THR n 
31 201  PHE n 
31 202  ASN n 
31 203  ASP n 
31 204  THR n 
31 205  SER n 
31 206  ASP n 
31 207  GLN n 
31 208  ILE n 
31 209  ILE n 
31 210  SER n 
31 211  GLY n 
31 212  GLY n 
31 213  ILE n 
31 214  ASP n 
31 215  ASN n 
31 216  ASP n 
31 217  ILE n 
31 218  LYS n 
31 219  VAL n 
31 220  TRP n 
31 221  ASP n 
31 222  LEU n 
31 223  ARG n 
31 224  GLN n 
31 225  ASN n 
31 226  LYS n 
31 227  LEU n 
31 228  THR n 
31 229  TYR n 
31 230  THR n 
31 231  MET n 
31 232  ARG n 
31 233  GLY n 
31 234  HIS n 
31 235  ALA n 
31 236  ASP n 
31 237  SER n 
31 238  VAL n 
31 239  THR n 
31 240  GLY n 
31 241  LEU n 
31 242  SER n 
31 243  LEU n 
31 244  SER n 
31 245  SER n 
31 246  GLU n 
31 247  GLY n 
31 248  SER n 
31 249  TYR n 
31 250  LEU n 
31 251  LEU n 
31 252  SER n 
31 253  ASN n 
31 254  ALA n 
31 255  MET n 
31 256  ASP n 
31 257  ASN n 
31 258  THR n 
31 259  VAL n 
31 260  ARG n 
31 261  VAL n 
31 262  TRP n 
31 263  ASP n 
31 264  VAL n 
31 265  ARG n 
31 266  PRO n 
31 267  PHE n 
31 268  ALA n 
31 269  PRO n 
31 270  LYS n 
31 271  GLU n 
31 272  ARG n 
31 273  CYS n 
31 274  VAL n 
31 275  LYS n 
31 276  ILE n 
31 277  PHE n 
31 278  GLN n 
31 279  GLY n 
31 280  ASN n 
31 281  VAL n 
31 282  HIS n 
31 283  ASN n 
31 284  PHE n 
31 285  GLU n 
31 286  LYS n 
31 287  ASN n 
31 288  LEU n 
31 289  LEU n 
31 290  ARG n 
31 291  CYS n 
31 292  SER n 
31 293  TRP n 
31 294  SER n 
31 295  PRO n 
31 296  ASP n 
31 297  GLY n 
31 298  SER n 
31 299  LYS n 
31 300  ILE n 
31 301  ALA n 
31 302  ALA n 
31 303  GLY n 
31 304  SER n 
31 305  ALA n 
31 306  ASP n 
31 307  ARG n 
31 308  PHE n 
31 309  VAL n 
31 310  TYR n 
31 311  VAL n 
31 312  TRP n 
31 313  ASP n 
31 314  THR n 
31 315  THR n 
31 316  SER n 
31 317  ARG n 
31 318  ARG n 
31 319  ILE n 
31 320  LEU n 
31 321  TYR n 
31 322  LYS n 
31 323  LEU n 
31 324  PRO n 
31 325  GLY n 
31 326  HIS n 
31 327  ALA n 
31 328  GLY n 
31 329  SER n 
31 330  ILE n 
31 331  ASN n 
31 332  GLU n 
31 333  VAL n 
31 334  ALA n 
31 335  PHE n 
31 336  HIS n 
31 337  PRO n 
31 338  ASP n 
31 339  GLU n 
31 340  PRO n 
31 341  ILE n 
31 342  ILE n 
31 343  ILE n 
31 344  SER n 
31 345  ALA n 
31 346  SER n 
31 347  SER n 
31 348  ASP n 
31 349  LYS n 
31 350  ARG n 
31 351  LEU n 
31 352  TYR n 
31 353  MET n 
31 354  GLY n 
31 355  GLU n 
31 356  ILE n 
31 357  GLN n 
32 1    MET n 
32 2    SER n 
32 3    LEU n 
32 4    ILE n 
32 5    CYS n 
32 6    SER n 
32 7    ILE n 
32 8    SER n 
32 9    ASN n 
32 10   GLU n 
32 11   VAL n 
32 12   PRO n 
32 13   GLU n 
32 14   HIS n 
32 15   PRO n 
32 16   CYS n 
32 17   VAL n 
32 18   SER n 
32 19   PRO n 
32 20   VAL n 
32 21   SER n 
32 22   ASN n 
32 23   HIS n 
32 24   VAL n 
32 25   TYR n 
32 26   GLU n 
32 27   ARG n 
32 28   ARG n 
32 29   LEU n 
32 30   ILE n 
32 31   GLU n 
32 32   LYS n 
32 33   TYR n 
32 34   ILE n 
32 35   ALA n 
32 36   GLU n 
32 37   ASN n 
32 38   GLY n 
32 39   THR n 
32 40   ASP n 
32 41   PRO n 
32 42   ILE n 
32 43   ASN n 
32 44   ASN n 
32 45   GLN n 
32 46   PRO n 
32 47   LEU n 
32 48   SER n 
32 49   GLU n 
32 50   GLU n 
32 51   GLN n 
32 52   LEU n 
32 53   ILE n 
32 54   ASP n 
32 55   ILE n 
32 56   LYS n 
32 57   VAL n 
32 58   ALA n 
32 59   HIS n 
32 60   PRO n 
32 61   ILE n 
32 62   ARG n 
32 63   PRO n 
32 64   LYS n 
32 65   PRO n 
32 66   PRO n 
32 67   SER n 
32 68   ALA n 
32 69   THR n 
32 70   SER n 
32 71   ILE n 
32 72   PRO n 
32 73   ALA n 
32 74   ILE n 
32 75   LEU n 
32 76   LYS n 
32 77   ALA n 
32 78   LEU n 
32 79   GLN n 
32 80   ASP n 
32 81   GLU n 
32 82   TRP n 
32 83   ASP n 
32 84   ALA n 
32 85   VAL n 
32 86   MET n 
32 87   LEU n 
32 88   HIS n 
32 89   SER n 
32 90   PHE n 
32 91   THR n 
32 92   LEU n 
32 93   ARG n 
32 94   GLN n 
32 95   GLN n 
32 96   LEU n 
32 97   GLN n 
32 98   THR n 
32 99   THR n 
32 100  ARG n 
32 101  GLN n 
32 102  GLU n 
32 103  LEU n 
32 104  SER n 
32 105  HIS n 
32 106  ALA n 
32 107  LEU n 
32 108  TYR n 
32 109  GLN n 
32 110  HIS n 
32 111  ASP n 
32 112  ALA n 
32 113  ALA n 
32 114  CYS n 
32 115  ARG n 
32 116  VAL n 
32 117  ILE n 
32 118  ALA n 
32 119  ARG n 
32 120  LEU n 
32 121  THR n 
32 122  LYS n 
32 123  GLU n 
32 124  VAL n 
32 125  THR n 
32 126  ALA n 
32 127  ALA n 
32 128  ARG n 
32 129  GLU n 
32 130  ALA n 
32 131  LEU n 
32 132  ALA n 
32 133  THR n 
32 134  LEU n 
32 135  LYS n 
32 136  PRO n 
32 137  GLN n 
32 138  ALA n 
32 139  GLY n 
32 140  LEU n 
32 141  ILE n 
32 142  VAL n 
32 143  PRO n 
32 144  GLN n 
32 145  ALA n 
32 146  VAL n 
32 147  PRO n 
32 148  SER n 
32 149  SER n 
32 150  GLN n 
32 151  PRO n 
32 152  SER n 
32 153  VAL n 
32 154  VAL n 
32 155  GLY n 
32 156  ALA n 
32 157  GLY n 
32 158  GLU n 
32 159  PRO n 
32 160  MET n 
32 161  ASP n 
32 162  LEU n 
32 163  GLY n 
32 164  GLU n 
32 165  LEU n 
32 166  VAL n 
32 167  GLY n 
32 168  MET n 
32 169  THR n 
32 170  PRO n 
32 171  GLU n 
32 172  ILE n 
32 173  ILE n 
32 174  GLN n 
32 175  LYS n 
32 176  LEU n 
32 177  GLN n 
32 178  ASP n 
32 179  LYS n 
32 180  ALA n 
32 181  THR n 
32 182  VAL n 
32 183  LEU n 
32 184  THR n 
32 185  THR n 
32 186  GLU n 
32 187  ARG n 
32 188  LYS n 
32 189  LYS n 
32 190  ARG n 
32 191  GLY n 
32 192  LYS n 
32 193  THR n 
32 194  VAL n 
32 195  PRO n 
32 196  GLU n 
32 197  GLU n 
32 198  LEU n 
32 199  VAL n 
32 200  LYS n 
32 201  PRO n 
32 202  GLU n 
32 203  GLU n 
32 204  LEU n 
32 205  SER n 
32 206  LYS n 
32 207  TYR n 
32 208  ARG n 
32 209  GLN n 
32 210  VAL n 
32 211  ALA n 
32 212  SER n 
32 213  HIS n 
32 214  VAL n 
32 215  GLY n 
32 216  LEU n 
32 217  HIS n 
32 218  SER n 
32 219  ALA n 
32 220  SER n 
32 221  ILE n 
32 222  PRO n 
32 223  GLY n 
32 224  ILE n 
32 225  LEU n 
32 226  ALA n 
32 227  LEU n 
32 228  ASP n 
32 229  LEU n 
32 230  CYS n 
32 231  PRO n 
32 232  SER n 
32 233  ASP n 
32 234  THR n 
32 235  ASN n 
32 236  LYS n 
32 237  ILE n 
32 238  LEU n 
32 239  THR n 
32 240  GLY n 
32 241  GLY n 
32 242  ALA n 
32 243  ASP n 
32 244  LYS n 
32 245  ASN n 
32 246  VAL n 
32 247  VAL n 
32 248  VAL n 
32 249  PHE n 
32 250  ASP n 
32 251  LYS n 
32 252  SER n 
32 253  SER n 
32 254  GLU n 
32 255  GLN n 
32 256  ILE n 
32 257  LEU n 
32 258  ALA n 
32 259  THR n 
32 260  LEU n 
32 261  LYS n 
32 262  GLY n 
32 263  HIS n 
32 264  THR n 
32 265  LYS n 
32 266  LYS n 
32 267  VAL n 
32 268  THR n 
32 269  SER n 
32 270  VAL n 
32 271  VAL n 
32 272  PHE n 
32 273  HIS n 
32 274  PRO n 
32 275  SER n 
32 276  GLN n 
32 277  ASP n 
32 278  LEU n 
32 279  VAL n 
32 280  PHE n 
32 281  SER n 
32 282  ALA n 
32 283  SER n 
32 284  PRO n 
32 285  ASP n 
32 286  ALA n 
32 287  THR n 
32 288  ILE n 
32 289  ARG n 
32 290  ILE n 
32 291  TRP n 
32 292  SER n 
32 293  VAL n 
32 294  PRO n 
32 295  ASN n 
32 296  ALA n 
32 297  SER n 
32 298  CYS n 
32 299  VAL n 
32 300  GLN n 
32 301  VAL n 
32 302  VAL n 
32 303  ARG n 
32 304  ALA n 
32 305  HIS n 
32 306  GLU n 
32 307  SER n 
32 308  ALA n 
32 309  VAL n 
32 310  THR n 
32 311  GLY n 
32 312  LEU n 
32 313  SER n 
32 314  LEU n 
32 315  HIS n 
32 316  ALA n 
32 317  THR n 
32 318  GLY n 
32 319  ASP n 
32 320  TYR n 
32 321  LEU n 
32 322  LEU n 
32 323  SER n 
32 324  SER n 
32 325  SER n 
32 326  ASP n 
32 327  ASP n 
32 328  GLN n 
32 329  TYR n 
32 330  TRP n 
32 331  ALA n 
32 332  PHE n 
32 333  SER n 
32 334  ASP n 
32 335  ILE n 
32 336  GLN n 
32 337  THR n 
32 338  GLY n 
32 339  ARG n 
32 340  VAL n 
32 341  LEU n 
32 342  THR n 
32 343  LYS n 
32 344  VAL n 
32 345  THR n 
32 346  ASP n 
32 347  GLU n 
32 348  THR n 
32 349  SER n 
32 350  GLY n 
32 351  CYS n 
32 352  SER n 
32 353  LEU n 
32 354  THR n 
32 355  CYS n 
32 356  ALA n 
32 357  GLN n 
32 358  PHE n 
32 359  HIS n 
32 360  PRO n 
32 361  ASP n 
32 362  GLY n 
32 363  LEU n 
32 364  ILE n 
32 365  PHE n 
32 366  GLY n 
32 367  THR n 
32 368  GLY n 
32 369  THR n 
32 370  MET n 
32 371  ASP n 
32 372  SER n 
32 373  GLN n 
32 374  ILE n 
32 375  LYS n 
32 376  ILE n 
32 377  TRP n 
32 378  ASP n 
32 379  LEU n 
32 380  LYS n 
32 381  GLU n 
32 382  ARG n 
32 383  THR n 
32 384  ASN n 
32 385  VAL n 
32 386  ALA n 
32 387  ASN n 
32 388  PHE n 
32 389  PRO n 
32 390  GLY n 
32 391  HIS n 
32 392  SER n 
32 393  GLY n 
32 394  PRO n 
32 395  ILE n 
32 396  THR n 
32 397  SER n 
32 398  ILE n 
32 399  ALA n 
32 400  PHE n 
32 401  SER n 
32 402  GLU n 
32 403  ASN n 
32 404  GLY n 
32 405  TYR n 
32 406  TYR n 
32 407  LEU n 
32 408  ALA n 
32 409  THR n 
32 410  ALA n 
32 411  ALA n 
32 412  ASP n 
32 413  ASP n 
32 414  SER n 
32 415  SER n 
32 416  VAL n 
32 417  LYS n 
32 418  LEU n 
32 419  TRP n 
32 420  ASP n 
32 421  LEU n 
32 422  ARG n 
32 423  LYS n 
32 424  LEU n 
32 425  LYS n 
32 426  ASN n 
32 427  PHE n 
32 428  LYS n 
32 429  THR n 
32 430  LEU n 
32 431  GLN n 
32 432  LEU n 
32 433  ASP n 
32 434  ASN n 
32 435  ASN n 
32 436  PHE n 
32 437  GLU n 
32 438  VAL n 
32 439  LYS n 
32 440  SER n 
32 441  LEU n 
32 442  ILE n 
32 443  PHE n 
32 444  ASP n 
32 445  GLN n 
32 446  SER n 
32 447  GLY n 
32 448  THR n 
32 449  TYR n 
32 450  LEU n 
32 451  ALA n 
32 452  LEU n 
32 453  GLY n 
32 454  GLY n 
32 455  THR n 
32 456  ASP n 
32 457  VAL n 
32 458  GLN n 
32 459  ILE n 
32 460  TYR n 
32 461  ILE n 
32 462  CYS n 
32 463  LYS n 
32 464  GLN n 
32 465  TRP n 
32 466  THR n 
32 467  GLU n 
32 468  ILE n 
32 469  LEU n 
32 470  HIS n 
32 471  PHE n 
32 472  THR n 
32 473  GLU n 
32 474  HIS n 
32 475  SER n 
32 476  GLY n 
32 477  LEU n 
32 478  THR n 
32 479  THR n 
32 480  GLY n 
32 481  VAL n 
32 482  ALA n 
32 483  PHE n 
32 484  GLY n 
32 485  HIS n 
32 486  HIS n 
32 487  ALA n 
32 488  LYS n 
32 489  PHE n 
32 490  ILE n 
32 491  ALA n 
32 492  SER n 
32 493  THR n 
32 494  GLY n 
32 495  MET n 
32 496  ASP n 
32 497  ARG n 
32 498  SER n 
32 499  LEU n 
32 500  LYS n 
32 501  PHE n 
32 502  TYR n 
32 503  SER n 
32 504  LEU n 
33 1    MET n 
33 2    ALA n 
33 3    GLY n 
33 4    THR n 
33 5    GLY n 
33 6    LEU n 
33 7    VAL n 
33 8    ALA n 
33 9    GLY n 
33 10   GLU n 
33 11   VAL n 
33 12   VAL n 
33 13   VAL n 
33 14   ASP n 
33 15   ALA n 
33 16   LEU n 
33 17   PRO n 
33 18   TYR n 
33 19   PHE n 
33 20   ASP n 
33 21   GLN n 
33 22   GLY n 
33 23   TYR n 
33 24   GLU n 
33 25   ALA n 
33 26   PRO n 
33 27   GLY n 
33 28   VAL n 
33 29   ARG n 
33 30   GLU n 
33 31   ALA n 
33 32   ALA n 
33 33   ALA n 
33 34   ALA n 
33 35   LEU n 
33 36   VAL n 
33 37   GLU n 
33 38   GLU n 
33 39   GLU n 
33 40   THR n 
33 41   ARG n 
33 42   ARG n 
33 43   TYR n 
33 44   ARG n 
33 45   PRO n 
33 46   THR n 
33 47   LYS n 
33 48   ASN n 
33 49   TYR n 
33 50   LEU n 
33 51   SER n 
33 52   TYR n 
33 53   LEU n 
33 54   THR n 
33 55   ALA n 
33 56   PRO n 
33 57   ASP n 
33 58   TYR n 
33 59   SER n 
33 60   ALA n 
33 61   PHE n 
33 62   GLU n 
33 63   THR n 
33 64   ASP n 
33 65   ILE n 
33 66   MET n 
33 67   ARG n 
33 68   ASN n 
33 69   GLU n 
33 70   PHE n 
33 71   GLU n 
33 72   ARG n 
33 73   LEU n 
33 74   ALA n 
33 75   ALA n 
33 76   ARG n 
33 77   GLN n 
33 78   PRO n 
33 79   ILE n 
33 80   GLU n 
33 81   LEU n 
33 82   LEU n 
33 83   SER n 
33 84   MET n 
33 85   LYS n 
33 86   ARG n 
33 87   TYR n 
33 88   GLU n 
33 89   LEU n 
33 90   PRO n 
33 91   ALA n 
33 92   PRO n 
33 93   SER n 
33 94   SER n 
33 95   GLY n 
33 96   GLN n 
33 97   LYS n 
33 98   ASN n 
33 99   ASP n 
33 100  ILE n 
33 101  THR n 
33 102  ALA n 
33 103  TRP n 
33 104  GLN n 
33 105  GLU n 
33 106  CYS n 
33 107  VAL n 
33 108  ASN n 
33 109  ASN n 
33 110  SER n 
33 111  MET n 
33 112  ALA n 
33 113  GLN n 
33 114  LEU n 
33 115  GLU n 
33 116  HIS n 
33 117  GLN n 
33 118  ALA n 
33 119  VAL n 
33 120  ARG n 
33 121  ILE n 
33 122  GLU n 
33 123  ASN n 
33 124  LEU n 
33 125  GLU n 
33 126  LEU n 
33 127  MET n 
33 128  SER n 
33 129  GLN n 
33 130  HIS n 
33 131  GLY n 
33 132  CYS n 
33 133  ASN n 
33 134  ALA n 
33 135  TRP n 
33 136  LYS n 
33 137  VAL n 
33 138  TYR n 
33 139  ASN n 
33 140  GLU n 
33 141  ASN n 
33 142  LEU n 
33 143  VAL n 
33 144  HIS n 
33 145  MET n 
33 146  ILE n 
33 147  GLU n 
33 148  HIS n 
33 149  ALA n 
33 150  GLN n 
33 151  LYS n 
33 152  GLU n 
33 153  LEU n 
33 154  GLN n 
33 155  LYS n 
33 156  LEU n 
33 157  ARG n 
33 158  LYS n 
33 159  HIS n 
33 160  ILE n 
33 161  GLN n 
33 162  ASP n 
33 163  LEU n 
33 164  ASN n 
33 165  TRP n 
33 166  GLN n 
33 167  ARG n 
33 168  LYS n 
33 169  ASN n 
33 170  MET n 
33 171  GLN n 
33 172  LEU n 
33 173  THR n 
33 174  ALA n 
33 175  GLY n 
33 176  SER n 
33 177  LYS n 
33 178  LEU n 
33 179  ARG n 
33 180  GLU n 
33 181  MET n 
33 182  GLU n 
33 183  SER n 
33 184  ASN n 
33 185  TRP n 
33 186  VAL n 
33 187  SER n 
33 188  LEU n 
33 189  VAL n 
33 190  SER n 
33 191  LYS n 
33 192  ASN n 
33 193  TYR n 
33 194  GLU n 
33 195  ILE n 
33 196  GLU n 
33 197  ARG n 
33 198  THR n 
33 199  ILE n 
33 200  VAL n 
33 201  GLN n 
33 202  LEU n 
33 203  GLU n 
33 204  ASN n 
33 205  GLU n 
33 206  ILE n 
33 207  TYR n 
33 208  GLN n 
33 209  ILE n 
33 210  LYS n 
33 211  GLN n 
33 212  GLN n 
33 213  HIS n 
33 214  GLY n 
33 215  GLU n 
33 216  ALA n 
33 217  ASN n 
33 218  LYS n 
33 219  GLU n 
33 220  ASN n 
33 221  ILE n 
33 222  ARG n 
33 223  GLN n 
33 224  ASP n 
33 225  PHE n 
34 1    MET n 
34 2    VAL n 
34 3    VAL n 
34 4    MET n 
34 5    ALA n 
34 6    ARG n 
34 7    LEU n 
34 8    SER n 
34 9    ARG n 
34 10   PRO n 
34 11   GLU n 
34 12   ARG n 
34 13   PRO n 
34 14   ASP n 
34 15   LEU n 
34 16   VAL n 
34 17   PHE n 
34 18   GLU n 
34 19   GLU n 
34 20   GLU n 
34 21   ASP n 
34 22   LEU n 
34 23   PRO n 
34 24   TYR n 
34 25   GLU n 
34 26   GLU n 
34 27   GLU n 
34 28   ILE n 
34 29   MET n 
34 30   ARG n 
34 31   ASN n 
34 32   GLN n 
34 33   PHE n 
34 34   SER n 
34 35   VAL n 
34 36   LYS n 
34 37   CYS n 
34 38   TRP n 
34 39   LEU n 
34 40   ARG n 
34 41   TYR n 
34 42   ILE n 
34 43   GLU n 
34 44   PHE n 
34 45   LYS n 
34 46   GLN n 
34 47   GLY n 
34 48   ALA n 
34 49   PRO n 
34 50   LYS n 
34 51   PRO n 
34 52   ARG n 
34 53   LEU n 
34 54   ASN n 
34 55   GLN n 
34 56   LEU n 
34 57   TYR n 
34 58   GLU n 
34 59   ARG n 
34 60   ALA n 
34 61   LEU n 
34 62   LYS n 
34 63   LEU n 
34 64   LEU n 
34 65   PRO n 
34 66   CYS n 
34 67   SER n 
34 68   TYR n 
34 69   LYS n 
34 70   LEU n 
34 71   TRP n 
34 72   TYR n 
34 73   ARG n 
34 74   TYR n 
34 75   LEU n 
34 76   LYS n 
34 77   ALA n 
34 78   ARG n 
34 79   ARG n 
34 80   ALA n 
34 81   GLN n 
34 82   VAL n 
34 83   LYS n 
34 84   HIS n 
34 85   ARG n 
34 86   CYS n 
34 87   VAL n 
34 88   THR n 
34 89   ASP n 
34 90   PRO n 
34 91   ALA n 
34 92   TYR n 
34 93   GLU n 
34 94   ASP n 
34 95   VAL n 
34 96   ASN n 
34 97   ASN n 
34 98   CYS n 
34 99   HIS n 
34 100  GLU n 
34 101  ARG n 
34 102  ALA n 
34 103  PHE n 
34 104  VAL n 
34 105  PHE n 
34 106  MET n 
34 107  HIS n 
34 108  LYS n 
34 109  MET n 
34 110  PRO n 
34 111  ARG n 
34 112  LEU n 
34 113  TRP n 
34 114  LEU n 
34 115  ASP n 
34 116  TYR n 
34 117  CYS n 
34 118  GLN n 
34 119  PHE n 
34 120  LEU n 
34 121  MET n 
34 122  ASP n 
34 123  GLN n 
34 124  GLY n 
34 125  ARG n 
34 126  VAL n 
34 127  THR n 
34 128  HIS n 
34 129  THR n 
34 130  ARG n 
34 131  ARG n 
34 132  THR n 
34 133  PHE n 
34 134  ASP n 
34 135  ARG n 
34 136  ALA n 
34 137  LEU n 
34 138  ARG n 
34 139  ALA n 
34 140  LEU n 
34 141  PRO n 
34 142  ILE n 
34 143  THR n 
34 144  GLN n 
34 145  HIS n 
34 146  SER n 
34 147  ARG n 
34 148  ILE n 
34 149  TRP n 
34 150  PRO n 
34 151  LEU n 
34 152  TYR n 
34 153  LEU n 
34 154  ARG n 
34 155  PHE n 
34 156  LEU n 
34 157  ARG n 
34 158  SER n 
34 159  HIS n 
34 160  PRO n 
34 161  LEU n 
34 162  PRO n 
34 163  GLU n 
34 164  THR n 
34 165  ALA n 
34 166  VAL n 
34 167  ARG n 
34 168  GLY n 
34 169  TYR n 
34 170  ARG n 
34 171  ARG n 
34 172  PHE n 
34 173  LEU n 
34 174  LYS n 
34 175  LEU n 
34 176  SER n 
34 177  PRO n 
34 178  GLU n 
34 179  SER n 
34 180  ALA n 
34 181  GLU n 
34 182  GLU n 
34 183  TYR n 
34 184  ILE n 
34 185  GLU n 
34 186  TYR n 
34 187  LEU n 
34 188  LYS n 
34 189  SER n 
34 190  SER n 
34 191  ASP n 
34 192  ARG n 
34 193  LEU n 
34 194  ASP n 
34 195  GLU n 
34 196  ALA n 
34 197  ALA n 
34 198  GLN n 
34 199  ARG n 
34 200  LEU n 
34 201  ALA n 
34 202  THR n 
34 203  VAL n 
34 204  VAL n 
34 205  ASN n 
34 206  ASP n 
34 207  GLU n 
34 208  ARG n 
34 209  PHE n 
34 210  VAL n 
34 211  SER n 
34 212  LYS n 
34 213  ALA n 
34 214  GLY n 
34 215  LYS n 
34 216  SER n 
34 217  ASN n 
34 218  TYR n 
34 219  GLN n 
34 220  LEU n 
34 221  TRP n 
34 222  HIS n 
34 223  GLU n 
34 224  LEU n 
34 225  CYS n 
34 226  ASP n 
34 227  LEU n 
34 228  ILE n 
34 229  SER n 
34 230  GLN n 
34 231  ASN n 
34 232  PRO n 
34 233  ASP n 
34 234  LYS n 
34 235  VAL n 
34 236  GLN n 
34 237  SER n 
34 238  LEU n 
34 239  ASN n 
34 240  VAL n 
34 241  ASP n 
34 242  ALA n 
34 243  ILE n 
34 244  ILE n 
34 245  ARG n 
34 246  GLY n 
34 247  GLY n 
34 248  LEU n 
34 249  THR n 
34 250  ARG n 
34 251  PHE n 
34 252  THR n 
34 253  ASP n 
34 254  GLN n 
34 255  LEU n 
34 256  GLY n 
34 257  LYS n 
34 258  LEU n 
34 259  TRP n 
34 260  CYS n 
34 261  SER n 
34 262  LEU n 
34 263  ALA n 
34 264  ASP n 
34 265  TYR n 
34 266  TYR n 
34 267  ILE n 
34 268  ARG n 
34 269  SER n 
34 270  GLY n 
34 271  HIS n 
34 272  PHE n 
34 273  GLU n 
34 274  LYS n 
34 275  ALA n 
34 276  ARG n 
34 277  ASP n 
34 278  VAL n 
34 279  TYR n 
34 280  GLU n 
34 281  GLU n 
34 282  ALA n 
34 283  ILE n 
34 284  ARG n 
34 285  THR n 
34 286  VAL n 
34 287  MET n 
34 288  THR n 
34 289  VAL n 
34 290  ARG n 
34 291  ASP n 
34 292  PHE n 
34 293  THR n 
34 294  GLN n 
34 295  VAL n 
34 296  PHE n 
34 297  ASP n 
34 298  SER n 
34 299  TYR n 
34 300  ALA n 
34 301  GLN n 
34 302  PHE n 
34 303  GLU n 
34 304  GLU n 
34 305  SER n 
34 306  MET n 
34 307  ILE n 
34 308  ALA n 
34 309  ALA n 
34 310  LYS n 
34 311  MET n 
34 312  GLU n 
34 313  THR n 
34 314  ALA n 
34 315  SER n 
34 316  GLU n 
34 317  LEU n 
34 318  GLY n 
34 319  ARG n 
34 320  GLU n 
34 321  GLU n 
34 322  GLU n 
34 323  ASP n 
34 324  ASP n 
34 325  VAL n 
34 326  ASP n 
34 327  LEU n 
34 328  GLU n 
34 329  LEU n 
34 330  ARG n 
34 331  LEU n 
34 332  ALA n 
34 333  ARG n 
34 334  PHE n 
34 335  GLU n 
34 336  GLN n 
34 337  LEU n 
34 338  ILE n 
34 339  SER n 
34 340  ARG n 
34 341  ARG n 
34 342  PRO n 
34 343  LEU n 
34 344  LEU n 
34 345  LEU n 
34 346  ASN n 
34 347  SER n 
34 348  VAL n 
34 349  LEU n 
34 350  LEU n 
34 351  ARG n 
34 352  GLN n 
34 353  ASN n 
34 354  PRO n 
34 355  HIS n 
34 356  HIS n 
34 357  VAL n 
34 358  HIS n 
34 359  GLU n 
34 360  TRP n 
34 361  HIS n 
34 362  LYS n 
34 363  ARG n 
34 364  VAL n 
34 365  ALA n 
34 366  LEU n 
34 367  HIS n 
34 368  GLN n 
34 369  GLY n 
34 370  ARG n 
34 371  PRO n 
34 372  ARG n 
34 373  GLU n 
34 374  ILE n 
34 375  ILE n 
34 376  ASN n 
34 377  THR n 
34 378  TYR n 
34 379  THR n 
34 380  GLU n 
34 381  ALA n 
34 382  VAL n 
34 383  GLN n 
34 384  THR n 
34 385  VAL n 
34 386  ASP n 
34 387  PRO n 
34 388  PHE n 
34 389  LYS n 
34 390  ALA n 
34 391  THR n 
34 392  GLY n 
34 393  LYS n 
34 394  PRO n 
34 395  HIS n 
34 396  THR n 
34 397  LEU n 
34 398  TRP n 
34 399  VAL n 
34 400  ALA n 
34 401  PHE n 
34 402  ALA n 
34 403  LYS n 
34 404  PHE n 
34 405  TYR n 
34 406  GLU n 
34 407  ASP n 
34 408  ASN n 
34 409  GLY n 
34 410  GLN n 
34 411  LEU n 
34 412  ASP n 
34 413  ASP n 
34 414  ALA n 
34 415  ARG n 
34 416  VAL n 
34 417  ILE n 
34 418  LEU n 
34 419  GLU n 
34 420  LYS n 
34 421  ALA n 
34 422  THR n 
34 423  LYS n 
34 424  VAL n 
34 425  ASN n 
34 426  PHE n 
34 427  LYS n 
34 428  GLN n 
34 429  VAL n 
34 430  ASP n 
34 431  ASP n 
34 432  LEU n 
34 433  ALA n 
34 434  SER n 
34 435  VAL n 
34 436  TRP n 
34 437  CYS n 
34 438  GLN n 
34 439  CYS n 
34 440  GLY n 
34 441  GLU n 
34 442  LEU n 
34 443  GLU n 
34 444  LEU n 
34 445  ARG n 
34 446  HIS n 
34 447  GLU n 
34 448  ASN n 
34 449  TYR n 
34 450  ASP n 
34 451  GLU n 
34 452  ALA n 
34 453  LEU n 
34 454  ARG n 
34 455  LEU n 
34 456  LEU n 
34 457  ARG n 
34 458  LYS n 
34 459  ALA n 
34 460  THR n 
34 461  ALA n 
34 462  LEU n 
34 463  PRO n 
34 464  ALA n 
34 465  ARG n 
34 466  ARG n 
34 467  ALA n 
34 468  GLU n 
34 469  TYR n 
34 470  PHE n 
34 471  ASP n 
34 472  GLY n 
34 473  SER n 
34 474  GLU n 
34 475  PRO n 
34 476  VAL n 
34 477  GLN n 
34 478  ASN n 
34 479  ARG n 
34 480  VAL n 
34 481  TYR n 
34 482  LYS n 
34 483  SER n 
34 484  LEU n 
34 485  LYS n 
34 486  VAL n 
34 487  TRP n 
34 488  SER n 
34 489  MET n 
34 490  LEU n 
34 491  ALA n 
34 492  ASP n 
34 493  LEU n 
34 494  GLU n 
34 495  GLU n 
34 496  SER n 
34 497  LEU n 
34 498  GLY n 
34 499  THR n 
34 500  PHE n 
34 501  GLN n 
34 502  SER n 
34 503  THR n 
34 504  LYS n 
34 505  ALA n 
34 506  VAL n 
34 507  TYR n 
34 508  ASP n 
34 509  ARG n 
34 510  ILE n 
34 511  LEU n 
34 512  ASP n 
34 513  LEU n 
34 514  ARG n 
34 515  ILE n 
34 516  ALA n 
34 517  THR n 
34 518  PRO n 
34 519  GLN n 
34 520  ILE n 
34 521  VAL n 
34 522  ILE n 
34 523  ASN n 
34 524  TYR n 
34 525  ALA n 
34 526  MET n 
34 527  PHE n 
34 528  LEU n 
34 529  GLU n 
34 530  GLU n 
34 531  HIS n 
34 532  LYS n 
34 533  TYR n 
34 534  PHE n 
34 535  GLU n 
34 536  GLU n 
34 537  SER n 
34 538  PHE n 
34 539  LYS n 
34 540  ALA n 
34 541  TYR n 
34 542  GLU n 
34 543  ARG n 
34 544  GLY n 
34 545  ILE n 
34 546  SER n 
34 547  LEU n 
34 548  PHE n 
34 549  LYS n 
34 550  TRP n 
34 551  PRO n 
34 552  ASN n 
34 553  VAL n 
34 554  SER n 
34 555  ASP n 
34 556  ILE n 
34 557  TRP n 
34 558  SER n 
34 559  THR n 
34 560  TYR n 
34 561  LEU n 
34 562  THR n 
34 563  LYS n 
34 564  PHE n 
34 565  ILE n 
34 566  ALA n 
34 567  ARG n 
34 568  TYR n 
34 569  GLY n 
34 570  GLY n 
34 571  ARG n 
34 572  LYS n 
34 573  LEU n 
34 574  GLU n 
34 575  ARG n 
34 576  ALA n 
34 577  ARG n 
34 578  ASP n 
34 579  LEU n 
34 580  PHE n 
34 581  GLU n 
34 582  GLN n 
34 583  ALA n 
34 584  LEU n 
34 585  ASP n 
34 586  GLY n 
34 587  CYS n 
34 588  PRO n 
34 589  PRO n 
34 590  LYS n 
34 591  TYR n 
34 592  ALA n 
34 593  LYS n 
34 594  THR n 
34 595  LEU n 
34 596  TYR n 
34 597  LEU n 
34 598  LEU n 
34 599  TYR n 
34 600  ALA n 
34 601  GLN n 
34 602  LEU n 
34 603  GLU n 
34 604  GLU n 
34 605  GLU n 
34 606  TRP n 
34 607  GLY n 
34 608  LEU n 
34 609  ALA n 
34 610  ARG n 
34 611  HIS n 
34 612  ALA n 
34 613  MET n 
34 614  ALA n 
34 615  VAL n 
34 616  TYR n 
34 617  GLU n 
34 618  ARG n 
34 619  ALA n 
34 620  THR n 
34 621  ARG n 
34 622  ALA n 
34 623  VAL n 
34 624  GLU n 
34 625  PRO n 
34 626  ALA n 
34 627  GLN n 
34 628  GLN n 
34 629  TYR n 
34 630  ASP n 
34 631  MET n 
34 632  PHE n 
34 633  ASN n 
34 634  ILE n 
34 635  TYR n 
34 636  ILE n 
34 637  LYS n 
34 638  ARG n 
34 639  ALA n 
34 640  ALA n 
34 641  GLU n 
34 642  ILE n 
34 643  TYR n 
34 644  GLY n 
34 645  VAL n 
34 646  THR n 
34 647  HIS n 
34 648  THR n 
34 649  ARG n 
34 650  GLY n 
34 651  ILE n 
34 652  TYR n 
34 653  GLN n 
34 654  LYS n 
34 655  ALA n 
34 656  ILE n 
34 657  GLU n 
34 658  VAL n 
34 659  LEU n 
34 660  SER n 
34 661  ASP n 
34 662  GLU n 
34 663  HIS n 
34 664  ALA n 
34 665  ARG n 
34 666  GLU n 
34 667  MET n 
34 668  CYS n 
34 669  LEU n 
34 670  ARG n 
34 671  PHE n 
34 672  ALA n 
34 673  ASP n 
34 674  MET n 
34 675  GLU n 
34 676  CYS n 
34 677  LYS n 
34 678  LEU n 
34 679  GLY n 
34 680  GLU n 
34 681  ILE n 
34 682  ASP n 
34 683  ARG n 
34 684  ALA n 
34 685  ARG n 
34 686  ALA n 
34 687  ILE n 
34 688  TYR n 
34 689  SER n 
34 690  PHE n 
34 691  CYS n 
34 692  SER n 
34 693  GLN n 
34 694  ILE n 
34 695  CYS n 
34 696  ASP n 
34 697  PRO n 
34 698  ARG n 
34 699  THR n 
34 700  THR n 
34 701  GLY n 
34 702  ALA n 
34 703  PHE n 
34 704  TRP n 
34 705  GLN n 
34 706  THR n 
34 707  TRP n 
34 708  LYS n 
34 709  ASP n 
34 710  PHE n 
34 711  GLU n 
34 712  VAL n 
34 713  ARG n 
34 714  HIS n 
34 715  GLY n 
34 716  ASN n 
34 717  GLU n 
34 718  ASP n 
34 719  THR n 
34 720  ILE n 
34 721  LYS n 
34 722  GLU n 
34 723  MET n 
34 724  LEU n 
34 725  ARG n 
34 726  ILE n 
34 727  ARG n 
34 728  ARG n 
34 729  SER n 
34 730  VAL n 
34 731  GLN n 
34 732  ALA n 
34 733  THR n 
34 734  TYR n 
34 735  ASN n 
34 736  THR n 
34 737  GLN n 
34 738  VAL n 
34 739  ASN n 
34 740  PHE n 
34 741  MET n 
34 742  ALA n 
34 743  SER n 
34 744  GLN n 
34 745  MET n 
34 746  LEU n 
34 747  LYS n 
34 748  VAL n 
34 749  SER n 
34 750  GLY n 
34 751  SER n 
34 752  ALA n 
34 753  THR n 
34 754  GLY n 
34 755  THR n 
34 756  VAL n 
34 757  SER n 
34 758  ASP n 
34 759  LEU n 
34 760  ALA n 
34 761  PRO n 
34 762  GLY n 
34 763  GLN n 
34 764  SER n 
34 765  GLY n 
34 766  MET n 
34 767  ASP n 
34 768  ASP n 
34 769  MET n 
34 770  LYS n 
34 771  LEU n 
34 772  LEU n 
34 773  GLU n 
34 774  GLN n 
34 775  ARG n 
34 776  ALA n 
34 777  GLU n 
34 778  GLN n 
34 779  LEU n 
34 780  ALA n 
34 781  ALA n 
34 782  GLU n 
34 783  ALA n 
34 784  GLU n 
34 785  ARG n 
34 786  ASP n 
34 787  GLN n 
34 788  PRO n 
34 789  LEU n 
34 790  ARG n 
34 791  ALA n 
34 792  GLN n 
34 793  SER n 
34 794  LYS n 
34 795  ILE n 
34 796  LEU n 
34 797  PHE n 
34 798  VAL n 
34 799  ARG n 
34 800  SER n 
34 801  ASP n 
34 802  ALA n 
34 803  SER n 
34 804  ARG n 
34 805  GLU n 
34 806  GLU n 
34 807  LEU n 
34 808  ALA n 
34 809  GLU n 
34 810  LEU n 
34 811  ALA n 
34 812  GLN n 
34 813  GLN n 
34 814  VAL n 
34 815  ASN n 
34 816  PRO n 
34 817  GLU n 
34 818  GLU n 
34 819  ILE n 
34 820  GLN n 
34 821  LEU n 
34 822  GLY n 
34 823  GLU n 
34 824  ASP n 
34 825  GLU n 
34 826  ASP n 
34 827  GLU n 
34 828  ASP n 
34 829  GLU n 
34 830  MET n 
34 831  ASP n 
34 832  LEU n 
34 833  GLU n 
34 834  PRO n 
34 835  ASN n 
34 836  GLU n 
34 837  VAL n 
34 838  ARG n 
34 839  LEU n 
34 840  GLU n 
34 841  GLN n 
34 842  GLN n 
34 843  SER n 
34 844  VAL n 
34 845  PRO n 
34 846  ALA n 
34 847  ALA n 
34 848  VAL n 
34 849  PHE n 
34 850  GLY n 
34 851  SER n 
34 852  LEU n 
34 853  LYS n 
34 854  GLU n 
34 855  ASP n 
35 1    MET n 
35 2    LYS n 
35 3    SER n 
35 4    SER n 
35 5    VAL n 
35 6    ALA n 
35 7    GLN n 
35 8    ILE n 
35 9    LYS n 
35 10   PRO n 
35 11   SER n 
35 12   SER n 
35 13   GLY n 
35 14   HIS n 
35 15   ASP n 
35 16   ARG n 
35 17   ARG n 
35 18   GLU n 
35 19   ASN n 
35 20   LEU n 
35 21   ASN n 
35 22   SER n 
35 23   TYR n 
35 24   GLN n 
35 25   ARG n 
35 26   ASN n 
35 27   SER n 
35 28   SER n 
35 29   PRO n 
35 30   GLU n 
35 31   ASP n 
35 32   ARG n 
35 33   TYR n 
35 34   GLU n 
35 35   GLU n 
35 36   GLN n 
35 37   GLU n 
35 38   ARG n 
35 39   SER n 
35 40   PRO n 
35 41   ARG n 
35 42   ASP n 
35 43   ARG n 
35 44   ASP n 
35 45   TYR n 
35 46   PHE n 
35 47   ASP n 
35 48   TYR n 
35 49   SER n 
35 50   ARG n 
35 51   SER n 
35 52   ASP n 
35 53   TYR n 
35 54   GLU n 
35 55   HIS n 
35 56   SER n 
35 57   ARG n 
35 58   ARG n 
35 59   GLY n 
35 60   ARG n 
35 61   SER n 
35 62   TYR n 
35 63   ASP n 
35 64   SER n 
35 65   SER n 
35 66   MET n 
35 67   GLU n 
35 68   SER n 
35 69   ARG n 
35 70   ASN n 
35 71   ARG n 
35 72   ASP n 
35 73   ARG n 
35 74   GLU n 
35 75   LYS n 
35 76   ARG n 
35 77   ARG n 
35 78   GLU n 
35 79   ARG n 
35 80   GLU n 
35 81   ARG n 
35 82   ASP n 
35 83   THR n 
35 84   ASP n 
35 85   ARG n 
35 86   LYS n 
35 87   ARG n 
35 88   SER n 
35 89   ARG n 
35 90   LYS n 
35 91   SER n 
35 92   PRO n 
35 93   SER n 
35 94   PRO n 
35 95   GLY n 
35 96   ARG n 
35 97   ARG n 
35 98   ASN n 
35 99   PRO n 
35 100  GLU n 
35 101  THR n 
35 102  SER n 
35 103  VAL n 
35 104  THR n 
35 105  GLN n 
35 106  SER n 
35 107  SER n 
35 108  SER n 
35 109  ALA n 
35 110  GLN n 
35 111  ASP n 
35 112  GLU n 
35 113  PRO n 
35 114  ALA n 
35 115  THR n 
35 116  LYS n 
35 117  LYS n 
35 118  LYS n 
35 119  LYS n 
35 120  ASP n 
35 121  GLU n 
35 122  LEU n 
35 123  ASP n 
35 124  PRO n 
35 125  LEU n 
35 126  LEU n 
35 127  THR n 
35 128  ARG n 
35 129  THR n 
35 130  GLY n 
35 131  GLY n 
35 132  ALA n 
35 133  TYR n 
35 134  ILE n 
35 135  PRO n 
35 136  PRO n 
35 137  ALA n 
35 138  LYS n 
35 139  LEU n 
35 140  ARG n 
35 141  MET n 
35 142  MET n 
35 143  GLN n 
35 144  GLU n 
35 145  GLN n 
35 146  ILE n 
35 147  THR n 
35 148  ASP n 
35 149  LYS n 
35 150  ASN n 
35 151  SER n 
35 152  LEU n 
35 153  ALA n 
35 154  TYR n 
35 155  GLN n 
35 156  ARG n 
35 157  MET n 
35 158  SER n 
35 159  TRP n 
35 160  GLU n 
35 161  ALA n 
35 162  LEU n 
35 163  LYS n 
35 164  LYS n 
35 165  SER n 
35 166  ILE n 
35 167  ASN n 
35 168  GLY n 
35 169  LEU n 
35 170  ILE n 
35 171  ASN n 
35 172  LYS n 
35 173  VAL n 
35 174  ASN n 
35 175  ILE n 
35 176  SER n 
35 177  ASN n 
35 178  ILE n 
35 179  SER n 
35 180  ILE n 
35 181  ILE n 
35 182  ILE n 
35 183  GLN n 
35 184  GLU n 
35 185  LEU n 
35 186  LEU n 
35 187  GLN n 
35 188  GLU n 
35 189  ASN n 
35 190  ILE n 
35 191  VAL n 
35 192  ARG n 
35 193  GLY n 
35 194  ARG n 
35 195  GLY n 
35 196  LEU n 
35 197  LEU n 
35 198  SER n 
35 199  ARG n 
35 200  SER n 
35 201  VAL n 
35 202  LEU n 
35 203  GLN n 
35 204  ALA n 
35 205  GLN n 
35 206  SER n 
35 207  ALA n 
35 208  SER n 
35 209  PRO n 
35 210  ILE n 
35 211  PHE n 
35 212  THR n 
35 213  HIS n 
35 214  VAL n 
35 215  TYR n 
35 216  ALA n 
35 217  ALA n 
35 218  LEU n 
35 219  VAL n 
35 220  ALA n 
35 221  ILE n 
35 222  ILE n 
35 223  ASN n 
35 224  SER n 
35 225  LYS n 
35 226  PHE n 
35 227  PRO n 
35 228  GLN n 
35 229  ILE n 
35 230  GLY n 
35 231  GLU n 
35 232  LEU n 
35 233  ILE n 
35 234  LEU n 
35 235  LYS n 
35 236  ARG n 
35 237  LEU n 
35 238  ILE n 
35 239  LEU n 
35 240  ASN n 
35 241  PHE n 
35 242  ARG n 
35 243  LYS n 
35 244  GLY n 
35 245  TYR n 
35 246  ARG n 
35 247  ARG n 
35 248  ASN n 
35 249  ASP n 
35 250  LYS n 
35 251  GLN n 
35 252  LEU n 
35 253  CYS n 
35 254  LEU n 
35 255  THR n 
35 256  ALA n 
35 257  SER n 
35 258  LYS n 
35 259  PHE n 
35 260  VAL n 
35 261  ALA n 
35 262  HIS n 
35 263  LEU n 
35 264  ILE n 
35 265  ASN n 
35 266  GLN n 
35 267  ASN n 
35 268  VAL n 
35 269  ALA n 
35 270  HIS n 
35 271  GLU n 
35 272  VAL n 
35 273  LEU n 
35 274  CYS n 
35 275  LEU n 
35 276  GLU n 
35 277  MET n 
35 278  LEU n 
35 279  THR n 
35 280  LEU n 
35 281  LEU n 
35 282  LEU n 
35 283  GLU n 
35 284  ARG n 
35 285  PRO n 
35 286  THR n 
35 287  ASP n 
35 288  ASP n 
35 289  SER n 
35 290  VAL n 
35 291  GLU n 
35 292  VAL n 
35 293  ALA n 
35 294  ILE n 
35 295  GLY n 
35 296  PHE n 
35 297  LEU n 
35 298  LYS n 
35 299  GLU n 
35 300  CYS n 
35 301  GLY n 
35 302  LEU n 
35 303  LYS n 
35 304  LEU n 
35 305  THR n 
35 306  GLN n 
35 307  VAL n 
35 308  SER n 
35 309  PRO n 
35 310  ARG n 
35 311  GLY n 
35 312  ILE n 
35 313  ASN n 
35 314  ALA n 
35 315  ILE n 
35 316  PHE n 
35 317  GLU n 
35 318  ARG n 
35 319  LEU n 
35 320  ARG n 
35 321  ASN n 
35 322  ILE n 
35 323  LEU n 
35 324  HIS n 
35 325  GLU n 
35 326  SER n 
35 327  GLU n 
35 328  ILE n 
35 329  ASP n 
35 330  LYS n 
35 331  ARG n 
35 332  VAL n 
35 333  GLN n 
35 334  TYR n 
35 335  MET n 
35 336  ILE n 
35 337  GLU n 
35 338  VAL n 
35 339  MET n 
35 340  PHE n 
35 341  ALA n 
35 342  VAL n 
35 343  ARG n 
35 344  LYS n 
35 345  ASP n 
35 346  GLY n 
35 347  PHE n 
35 348  LYS n 
35 349  ASP n 
35 350  HIS n 
35 351  PRO n 
35 352  ILE n 
35 353  ILE n 
35 354  LEU n 
35 355  GLU n 
35 356  GLY n 
35 357  LEU n 
35 358  ASP n 
35 359  LEU n 
35 360  VAL n 
35 361  GLU n 
35 362  GLU n 
35 363  ASP n 
35 364  ASP n 
35 365  GLN n 
35 366  PHE n 
35 367  THR n 
35 368  HIS n 
35 369  MET n 
35 370  LEU n 
35 371  PRO n 
35 372  LEU n 
35 373  GLU n 
35 374  ASP n 
35 375  ASP n 
35 376  TYR n 
35 377  ASN n 
35 378  PRO n 
35 379  GLU n 
35 380  ASP n 
35 381  VAL n 
35 382  LEU n 
35 383  ASN n 
35 384  VAL n 
35 385  PHE n 
35 386  LYS n 
35 387  MET n 
35 388  ASP n 
35 389  PRO n 
35 390  ASN n 
35 391  PHE n 
35 392  MET n 
35 393  GLU n 
35 394  ASN n 
35 395  GLU n 
35 396  GLU n 
35 397  LYS n 
35 398  TYR n 
35 399  LYS n 
35 400  ALA n 
35 401  ILE n 
35 402  LYS n 
35 403  LYS n 
35 404  GLU n 
35 405  ILE n 
35 406  LEU n 
35 407  ASP n 
35 408  GLU n 
35 409  GLY n 
35 410  ASP n 
35 411  THR n 
35 412  ASP n 
35 413  SER n 
35 414  ASN n 
35 415  THR n 
35 416  ASP n 
35 417  GLN n 
35 418  ASP n 
35 419  ALA n 
35 420  GLY n 
35 421  SER n 
35 422  SER n 
35 423  GLU n 
35 424  GLU n 
35 425  ASP n 
35 426  GLU n 
35 427  GLU n 
35 428  GLU n 
35 429  GLU n 
35 430  GLU n 
35 431  GLU n 
35 432  GLU n 
35 433  GLY n 
35 434  GLU n 
35 435  GLU n 
35 436  ASP n 
35 437  GLU n 
35 438  GLU n 
35 439  GLY n 
35 440  GLN n 
35 441  LYS n 
35 442  VAL n 
35 443  THR n 
35 444  ILE n 
35 445  HIS n 
35 446  ASP n 
35 447  LYS n 
35 448  THR n 
35 449  GLU n 
35 450  ILE n 
35 451  ASN n 
35 452  LEU n 
35 453  VAL n 
35 454  SER n 
35 455  PHE n 
35 456  ARG n 
35 457  ARG n 
35 458  THR n 
35 459  ILE n 
35 460  TYR n 
35 461  LEU n 
35 462  ALA n 
35 463  ILE n 
35 464  GLN n 
35 465  SER n 
35 466  SER n 
35 467  LEU n 
35 468  ASP n 
35 469  PHE n 
35 470  GLU n 
35 471  GLU n 
35 472  CYS n 
35 473  ALA n 
35 474  HIS n 
35 475  LYS n 
35 476  LEU n 
35 477  LEU n 
35 478  LYS n 
35 479  MET n 
35 480  GLU n 
35 481  PHE n 
35 482  PRO n 
35 483  GLU n 
35 484  SER n 
35 485  GLN n 
35 486  THR n 
35 487  LYS n 
35 488  GLU n 
35 489  LEU n 
35 490  CYS n 
35 491  ASN n 
35 492  MET n 
35 493  ILE n 
35 494  LEU n 
35 495  ASP n 
35 496  CYS n 
35 497  CYS n 
35 498  ALA n 
35 499  GLN n 
35 500  GLN n 
35 501  ARG n 
35 502  THR n 
35 503  TYR n 
35 504  GLU n 
35 505  LYS n 
35 506  PHE n 
35 507  PHE n 
35 508  GLY n 
35 509  LEU n 
35 510  LEU n 
35 511  ALA n 
35 512  GLY n 
35 513  ARG n 
35 514  PHE n 
35 515  CYS n 
35 516  MET n 
35 517  LEU n 
35 518  LYS n 
35 519  LYS n 
35 520  GLU n 
35 521  TYR n 
35 522  MET n 
35 523  GLU n 
35 524  SER n 
35 525  PHE n 
35 526  GLU n 
35 527  GLY n 
35 528  ILE n 
35 529  PHE n 
35 530  LYS n 
35 531  GLU n 
35 532  GLN n 
35 533  TYR n 
35 534  ASP n 
35 535  THR n 
35 536  ILE n 
35 537  HIS n 
35 538  ARG n 
35 539  LEU n 
35 540  GLU n 
35 541  THR n 
35 542  ASN n 
35 543  LYS n 
35 544  LEU n 
35 545  ARG n 
35 546  ASN n 
35 547  VAL n 
35 548  ALA n 
35 549  LYS n 
35 550  MET n 
35 551  PHE n 
35 552  ALA n 
35 553  HIS n 
35 554  LEU n 
35 555  LEU n 
35 556  TYR n 
35 557  THR n 
35 558  ASP n 
35 559  SER n 
35 560  LEU n 
35 561  PRO n 
35 562  TRP n 
35 563  SER n 
35 564  VAL n 
35 565  LEU n 
35 566  GLU n 
35 567  CYS n 
35 568  ILE n 
35 569  LYS n 
35 570  LEU n 
35 571  SER n 
35 572  GLU n 
35 573  GLU n 
35 574  THR n 
35 575  THR n 
35 576  THR n 
35 577  SER n 
35 578  SER n 
35 579  SER n 
35 580  ARG n 
35 581  ILE n 
35 582  PHE n 
35 583  VAL n 
35 584  LYS n 
35 585  ILE n 
35 586  PHE n 
35 587  PHE n 
35 588  GLN n 
35 589  GLU n 
35 590  LEU n 
35 591  CYS n 
35 592  GLU n 
35 593  TYR n 
35 594  MET n 
35 595  GLY n 
35 596  LEU n 
35 597  PRO n 
35 598  LYS n 
35 599  LEU n 
35 600  ASN n 
35 601  ALA n 
35 602  ARG n 
35 603  LEU n 
35 604  LYS n 
35 605  ASP n 
35 606  GLU n 
35 607  THR n 
35 608  LEU n 
35 609  GLN n 
35 610  PRO n 
35 611  PHE n 
35 612  PHE n 
35 613  GLU n 
35 614  GLY n 
35 615  LEU n 
35 616  LEU n 
35 617  PRO n 
35 618  ARG n 
35 619  ASP n 
35 620  ASN n 
35 621  PRO n 
35 622  ARG n 
35 623  ASN n 
35 624  THR n 
35 625  ARG n 
35 626  PHE n 
35 627  ALA n 
35 628  ILE n 
35 629  ASN n 
35 630  PHE n 
35 631  PHE n 
35 632  THR n 
35 633  SER n 
35 634  ILE n 
35 635  GLY n 
35 636  LEU n 
35 637  GLY n 
35 638  GLY n 
35 639  LEU n 
35 640  THR n 
35 641  ASP n 
35 642  GLU n 
35 643  LEU n 
35 644  ARG n 
35 645  GLU n 
35 646  HIS n 
35 647  LEU n 
35 648  LYS n 
35 649  ASN n 
35 650  THR n 
35 651  PRO n 
35 652  LYS n 
35 653  VAL n 
35 654  ILE n 
35 655  VAL n 
35 656  ALA n 
35 657  GLN n 
35 658  LYS n 
35 659  PRO n 
35 660  ASP n 
35 661  VAL n 
35 662  GLU n 
35 663  GLN n 
35 664  ASN n 
35 665  LYS n 
35 666  SER n 
35 667  SER n 
35 668  PRO n 
35 669  SER n 
35 670  SER n 
35 671  SER n 
35 672  SER n 
35 673  SER n 
35 674  ALA n 
35 675  SER n 
35 676  SER n 
35 677  SER n 
35 678  SER n 
35 679  GLU n 
35 680  SER n 
35 681  ASP n 
35 682  SER n 
35 683  SER n 
35 684  ASP n 
35 685  SER n 
35 686  ASP n 
35 687  SER n 
35 688  ASP n 
35 689  SER n 
35 690  SER n 
35 691  ASP n 
35 692  SER n 
35 693  SER n 
35 694  SER n 
35 695  GLU n 
35 696  SER n 
35 697  SER n 
35 698  SER n 
35 699  GLU n 
35 700  GLU n 
35 701  SER n 
35 702  ASP n 
35 703  SER n 
35 704  SER n 
35 705  SER n 
35 706  ILE n 
35 707  SER n 
35 708  SER n 
35 709  HIS n 
35 710  SER n 
35 711  SER n 
35 712  ALA n 
35 713  SER n 
35 714  ALA n 
35 715  ASN n 
35 716  ASP n 
35 717  VAL n 
35 718  ARG n 
35 719  LYS n 
35 720  LYS n 
35 721  GLY n 
35 722  HIS n 
35 723  GLY n 
35 724  LYS n 
35 725  THR n 
35 726  ARG n 
35 727  SER n 
35 728  LYS n 
35 729  GLU n 
35 730  VAL n 
35 731  ASP n 
35 732  LYS n 
35 733  LEU n 
35 734  ILE n 
35 735  ARG n 
35 736  ASN n 
35 737  GLN n 
35 738  GLN n 
35 739  THR n 
35 740  ASN n 
35 741  ASP n 
35 742  ARG n 
35 743  LYS n 
35 744  GLN n 
35 745  LYS n 
35 746  GLU n 
35 747  ARG n 
35 748  ARG n 
35 749  GLN n 
35 750  GLU n 
35 751  HIS n 
35 752  GLY n 
35 753  HIS n 
35 754  GLN n 
35 755  GLU n 
35 756  THR n 
35 757  ARG n 
35 758  THR n 
35 759  GLU n 
35 760  ARG n 
35 761  GLU n 
35 762  ARG n 
35 763  ARG n 
35 764  SER n 
35 765  GLU n 
35 766  LYS n 
35 767  HIS n 
35 768  ARG n 
35 769  ASP n 
35 770  GLN n 
35 771  ASN n 
35 772  SER n 
35 773  SER n 
35 774  GLY n 
35 775  SER n 
35 776  ASN n 
35 777  TRP n 
35 778  ARG n 
35 779  ASP n 
35 780  PRO n 
35 781  ILE n 
35 782  THR n 
35 783  LYS n 
35 784  TYR n 
35 785  THR n 
35 786  SER n 
35 787  ASP n 
35 788  LYS n 
35 789  ASP n 
35 790  VAL n 
35 791  PRO n 
35 792  SER n 
35 793  GLU n 
35 794  ARG n 
35 795  ASN n 
35 796  ASN n 
35 797  TYR n 
35 798  SER n 
35 799  ARG n 
35 800  VAL n 
35 801  ALA n 
35 802  ASN n 
35 803  ASP n 
35 804  ARG n 
35 805  ASP n 
35 806  GLN n 
35 807  GLU n 
35 808  MET n 
35 809  HIS n 
35 810  ILE n 
35 811  ASP n 
35 812  LEU n 
35 813  GLU n 
35 814  ASN n 
35 815  LYS n 
35 816  HIS n 
35 817  GLY n 
35 818  ASP n 
35 819  PRO n 
35 820  LYS n 
35 821  LYS n 
35 822  LYS n 
35 823  ARG n 
35 824  GLY n 
35 825  GLU n 
35 826  ARG n 
35 827  ARG n 
35 828  ASN n 
35 829  SER n 
35 830  PHE n 
35 831  SER n 
35 832  GLU n 
35 833  ASN n 
35 834  GLU n 
35 835  LYS n 
35 836  HIS n 
35 837  THR n 
35 838  HIS n 
35 839  ARG n 
35 840  ILE n 
35 841  LYS n 
35 842  ASP n 
35 843  SER n 
35 844  GLU n 
35 845  ASN n 
35 846  PHE n 
35 847  ARG n 
35 848  ARG n 
35 849  LYS n 
35 850  ASP n 
35 851  ARG n 
35 852  SER n 
35 853  LYS n 
35 854  SER n 
35 855  LYS n 
35 856  GLU n 
35 857  MET n 
35 858  ASN n 
35 859  ARG n 
35 860  LYS n 
35 861  HIS n 
35 862  SER n 
35 863  GLY n 
35 864  SER n 
35 865  ARG n 
35 866  SER n 
35 867  ASP n 
35 868  GLU n 
35 869  ASP n 
35 870  ARG n 
35 871  TYR n 
35 872  GLN n 
35 873  ASN n 
35 874  GLY n 
35 875  ALA n 
35 876  GLU n 
35 877  ARG n 
35 878  ARG n 
35 879  TRP n 
35 880  GLU n 
35 881  LYS n 
35 882  SER n 
35 883  SER n 
35 884  ARG n 
35 885  TYR n 
35 886  SER n 
35 887  GLU n 
35 888  GLN n 
35 889  SER n 
35 890  ARG n 
35 891  GLU n 
35 892  SER n 
35 893  LYS n 
35 894  LYS n 
35 895  ASN n 
35 896  GLN n 
35 897  ASP n 
35 898  ARG n 
35 899  ARG n 
35 900  ARG n 
35 901  GLU n 
35 902  LYS n 
35 903  SER n 
35 904  PRO n 
35 905  ALA n 
35 906  LYS n 
35 907  GLN n 
35 908  LYS n 
36 1    MET n 
36 2    ALA n 
36 3    ALA n 
36 4    PRO n 
36 5    ALA n 
36 6    GLN n 
36 7    PRO n 
36 8    LYS n 
36 9    LYS n 
36 10   ILE n 
36 11   VAL n 
36 12   ALA n 
36 13   PRO n 
36 14   THR n 
36 15   VAL n 
36 16   SER n 
36 17   GLN n 
36 18   ILE n 
36 19   ASN n 
36 20   ALA n 
36 21   GLU n 
36 22   PHE n 
36 23   VAL n 
36 24   THR n 
36 25   GLN n 
36 26   LEU n 
36 27   ALA n 
36 28   CYS n 
36 29   LYS n 
36 30   TYR n 
36 31   TRP n 
36 32   ALA n 
36 33   PRO n 
36 34   HIS n 
36 35   ILE n 
36 36   LYS n 
36 37   LYS n 
36 38   LYS n 
36 39   SER n 
36 40   PRO n 
36 41   PHE n 
36 42   ASP n 
36 43   ILE n 
36 44   LYS n 
36 45   VAL n 
36 46   ILE n 
36 47   GLU n 
36 48   ASP n 
36 49   ILE n 
36 50   TYR n 
36 51   GLU n 
36 52   LYS n 
36 53   GLU n 
36 54   ILE n 
36 55   VAL n 
36 56   LYS n 
36 57   SER n 
36 58   ARG n 
36 59   PHE n 
36 60   ALA n 
36 61   ILE n 
36 62   ARG n 
36 63   LYS n 
36 64   ILE n 
36 65   MET n 
36 66   LEU n 
36 67   LEU n 
36 68   GLU n 
36 69   PHE n 
36 70   SER n 
36 71   GLN n 
36 72   TYR n 
36 73   LEU n 
36 74   GLU n 
36 75   ASN n 
36 76   TYR n 
36 77   LEU n 
36 78   TRP n 
36 79   MET n 
36 80   ASN n 
36 81   TYR n 
36 82   SER n 
36 83   PRO n 
36 84   GLU n 
36 85   VAL n 
36 86   SER n 
36 87   SER n 
36 88   LYS n 
36 89   ALA n 
36 90   TYR n 
36 91   LEU n 
36 92   MET n 
36 93   SER n 
36 94   ILE n 
36 95   CYS n 
36 96   CYS n 
36 97   MET n 
36 98   VAL n 
36 99   ASN n 
36 100  GLU n 
36 101  LYS n 
36 102  PHE n 
36 103  ARG n 
36 104  GLU n 
36 105  ASN n 
36 106  VAL n 
36 107  PRO n 
36 108  ALA n 
36 109  TRP n 
36 110  GLU n 
36 111  ILE n 
36 112  PHE n 
36 113  LYS n 
36 114  LYS n 
36 115  LYS n 
36 116  PRO n 
36 117  ASP n 
36 118  HIS n 
36 119  PHE n 
36 120  PRO n 
36 121  PHE n 
36 122  PHE n 
36 123  PHE n 
36 124  LYS n 
36 125  HIS n 
36 126  ILE n 
36 127  LEU n 
36 128  LYS n 
36 129  ALA n 
36 130  ALA n 
36 131  LEU n 
36 132  ALA n 
36 133  GLU n 
36 134  THR n 
36 135  ASP n 
36 136  GLY n 
36 137  GLU n 
36 138  PHE n 
36 139  SER n 
36 140  LEU n 
36 141  HIS n 
36 142  GLU n 
36 143  GLN n 
36 144  THR n 
36 145  VAL n 
36 146  LEU n 
36 147  LEU n 
36 148  LEU n 
36 149  PHE n 
36 150  LEU n 
36 151  ASP n 
36 152  HIS n 
36 153  CYS n 
36 154  PHE n 
36 155  ASN n 
36 156  SER n 
36 157  LEU n 
36 158  GLU n 
36 159  VAL n 
36 160  ASP n 
36 161  LEU n 
36 162  ILE n 
36 163  ARG n 
36 164  SER n 
36 165  GLN n 
36 166  VAL n 
36 167  GLN n 
36 168  GLN n 
36 169  LEU n 
36 170  ILE n 
36 171  SER n 
36 172  LEU n 
36 173  PRO n 
36 174  MET n 
36 175  TRP n 
36 176  MET n 
36 177  GLY n 
36 178  LEU n 
36 179  GLN n 
36 180  LEU n 
36 181  ALA n 
36 182  ARG n 
36 183  LEU n 
36 184  GLU n 
36 185  LEU n 
36 186  GLU n 
36 187  LEU n 
36 188  LYS n 
36 189  LYS n 
36 190  THR n 
36 191  PRO n 
36 192  LYS n 
36 193  LEU n 
36 194  ARG n 
36 195  LYS n 
36 196  PHE n 
36 197  TRP n 
36 198  ASN n 
36 199  LEU n 
36 200  ILE n 
36 201  LYS n 
36 202  LYS n 
36 203  ASN n 
36 204  ASP n 
36 205  GLU n 
36 206  LYS n 
36 207  MET n 
36 208  ASP n 
36 209  PRO n 
36 210  GLU n 
36 211  ALA n 
36 212  ARG n 
36 213  GLU n 
36 214  GLN n 
36 215  ALA n 
36 216  TYR n 
36 217  GLN n 
36 218  GLU n 
36 219  ARG n 
36 220  ARG n 
36 221  PHE n 
36 222  LEU n 
36 223  SER n 
36 224  GLN n 
36 225  LEU n 
36 226  ILE n 
36 227  GLN n 
36 228  LYS n 
36 229  PHE n 
36 230  ILE n 
36 231  SER n 
36 232  VAL n 
36 233  LEU n 
36 234  LYS n 
36 235  SER n 
36 236  VAL n 
36 237  PRO n 
36 238  LEU n 
36 239  SER n 
36 240  GLU n 
36 241  PRO n 
36 242  VAL n 
36 243  THR n 
36 244  MET n 
36 245  ASP n 
36 246  LYS n 
36 247  VAL n 
36 248  HIS n 
36 249  TYR n 
36 250  CYS n 
36 251  GLU n 
36 252  ARG n 
36 253  PHE n 
36 254  ILE n 
36 255  GLU n 
36 256  LEU n 
36 257  MET n 
36 258  ILE n 
36 259  ASP n 
36 260  LEU n 
36 261  GLU n 
36 262  ALA n 
36 263  LEU n 
36 264  LEU n 
36 265  PRO n 
36 266  THR n 
36 267  ARG n 
36 268  ARG n 
36 269  TRP n 
36 270  PHE n 
36 271  ASN n 
36 272  THR n 
36 273  ILE n 
36 274  LEU n 
36 275  ASP n 
36 276  ASP n 
36 277  SER n 
36 278  HIS n 
36 279  LEU n 
36 280  LEU n 
36 281  VAL n 
36 282  HIS n 
36 283  CYS n 
36 284  TYR n 
36 285  LEU n 
36 286  SER n 
36 287  ASN n 
36 288  LEU n 
36 289  VAL n 
36 290  ARG n 
36 291  ARG n 
36 292  GLU n 
36 293  GLU n 
36 294  ASP n 
36 295  GLY n 
36 296  HIS n 
36 297  LEU n 
36 298  PHE n 
36 299  SER n 
36 300  GLN n 
36 301  LEU n 
36 302  LEU n 
36 303  ASP n 
36 304  MET n 
36 305  LEU n 
36 306  LYS n 
36 307  PHE n 
36 308  TYR n 
36 309  THR n 
36 310  GLY n 
36 311  PHE n 
36 312  GLU n 
36 313  ILE n 
36 314  ASN n 
36 315  ASP n 
36 316  GLN n 
36 317  THR n 
36 318  GLY n 
36 319  ASN n 
36 320  ALA n 
36 321  LEU n 
36 322  THR n 
36 323  GLU n 
36 324  ASN n 
36 325  GLU n 
36 326  MET n 
36 327  THR n 
36 328  THR n 
36 329  ILE n 
36 330  HIS n 
36 331  TYR n 
36 332  ASP n 
36 333  ARG n 
36 334  ILE n 
36 335  THR n 
36 336  SER n 
36 337  LEU n 
36 338  GLN n 
36 339  ARG n 
36 340  ALA n 
36 341  ALA n 
36 342  PHE n 
36 343  ALA n 
36 344  HIS n 
36 345  PHE n 
36 346  PRO n 
36 347  GLU n 
36 348  LEU n 
36 349  TYR n 
36 350  ASP n 
36 351  PHE n 
36 352  ALA n 
36 353  LEU n 
36 354  SER n 
36 355  ASN n 
36 356  VAL n 
36 357  ALA n 
36 358  GLU n 
36 359  VAL n 
36 360  ASP n 
36 361  THR n 
36 362  ARG n 
36 363  GLU n 
36 364  SER n 
36 365  LEU n 
36 366  VAL n 
36 367  LYS n 
36 368  PHE n 
36 369  PHE n 
36 370  GLY n 
36 371  PRO n 
36 372  LEU n 
36 373  SER n 
36 374  SER n 
36 375  ASN n 
36 376  THR n 
36 377  LEU n 
36 378  HIS n 
36 379  GLN n 
36 380  VAL n 
36 381  ALA n 
36 382  SER n 
36 383  TYR n 
36 384  LEU n 
36 385  CYS n 
36 386  LEU n 
36 387  LEU n 
36 388  PRO n 
36 389  THR n 
36 390  LEU n 
36 391  PRO n 
36 392  LYS n 
36 393  ASN n 
36 394  GLU n 
36 395  ASP n 
36 396  THR n 
36 397  THR n 
36 398  PHE n 
36 399  ASP n 
36 400  LYS n 
36 401  GLU n 
36 402  PHE n 
36 403  LEU n 
36 404  LEU n 
36 405  GLU n 
36 406  LEU n 
36 407  LEU n 
36 408  VAL n 
36 409  SER n 
36 410  ARG n 
36 411  HIS n 
36 412  GLU n 
36 413  ARG n 
36 414  ARG n 
36 415  ILE n 
36 416  SER n 
36 417  GLN n 
36 418  ILE n 
36 419  GLN n 
36 420  GLN n 
36 421  LEU n 
36 422  ASN n 
36 423  GLN n 
36 424  MET n 
36 425  PRO n 
36 426  LEU n 
36 427  TYR n 
36 428  PRO n 
36 429  THR n 
36 430  GLU n 
36 431  LYS n 
36 432  ILE n 
36 433  ILE n 
36 434  TRP n 
36 435  ASP n 
36 436  GLU n 
36 437  ASN n 
36 438  ILE n 
36 439  VAL n 
36 440  PRO n 
36 441  THR n 
36 442  GLU n 
36 443  TYR n 
36 444  TYR n 
36 445  SER n 
36 446  GLY n 
36 447  GLU n 
36 448  GLY n 
36 449  CYS n 
36 450  LEU n 
36 451  ALA n 
36 452  LEU n 
36 453  PRO n 
36 454  LYS n 
36 455  LEU n 
36 456  ASN n 
36 457  LEU n 
36 458  GLN n 
36 459  PHE n 
36 460  LEU n 
36 461  THR n 
36 462  LEU n 
36 463  HIS n 
36 464  ASP n 
36 465  TYR n 
36 466  LEU n 
36 467  LEU n 
36 468  ARG n 
36 469  ASN n 
36 470  PHE n 
36 471  ASN n 
36 472  LEU n 
36 473  PHE n 
36 474  ARG n 
36 475  LEU n 
36 476  GLU n 
36 477  SER n 
36 478  THR n 
36 479  TYR n 
36 480  GLU n 
36 481  ILE n 
36 482  ARG n 
36 483  GLN n 
36 484  ASP n 
36 485  ILE n 
36 486  GLU n 
36 487  ASP n 
36 488  SER n 
36 489  VAL n 
36 490  SER n 
36 491  ARG n 
36 492  MET n 
36 493  LYS n 
36 494  PRO n 
36 495  TRP n 
36 496  GLN n 
36 497  SER n 
36 498  GLU n 
36 499  TYR n 
36 500  GLY n 
36 501  GLY n 
36 502  VAL n 
36 503  VAL n 
36 504  PHE n 
36 505  GLY n 
36 506  GLY n 
36 507  TRP n 
36 508  ALA n 
36 509  ARG n 
36 510  MET n 
36 511  ALA n 
36 512  GLN n 
36 513  PRO n 
36 514  ILE n 
36 515  VAL n 
36 516  ALA n 
36 517  PHE n 
36 518  THR n 
36 519  VAL n 
36 520  VAL n 
36 521  GLU n 
36 522  VAL n 
36 523  ALA n 
36 524  LYS n 
36 525  PRO n 
36 526  ASN n 
36 527  ILE n 
36 528  GLY n 
36 529  GLU n 
36 530  ASN n 
36 531  TRP n 
36 532  PRO n 
36 533  THR n 
36 534  ARG n 
36 535  VAL n 
36 536  ARG n 
36 537  ALA n 
36 538  ASP n 
36 539  VAL n 
36 540  THR n 
36 541  ILE n 
36 542  ASN n 
36 543  LEU n 
36 544  ASN n 
36 545  VAL n 
36 546  ARG n 
36 547  ASP n 
36 548  HIS n 
36 549  ILE n 
36 550  LYS n 
36 551  ASP n 
36 552  GLU n 
36 553  TRP n 
36 554  GLU n 
36 555  GLY n 
36 556  LEU n 
36 557  ARG n 
36 558  LYS n 
36 559  HIS n 
36 560  ASP n 
36 561  VAL n 
36 562  CYS n 
36 563  PHE n 
36 564  LEU n 
36 565  ILE n 
36 566  THR n 
36 567  VAL n 
36 568  ARG n 
36 569  PRO n 
36 570  THR n 
36 571  LYS n 
36 572  PRO n 
36 573  TYR n 
36 574  GLY n 
36 575  THR n 
36 576  LYS n 
36 577  PHE n 
36 578  ASP n 
36 579  ARG n 
36 580  ARG n 
36 581  ARG n 
36 582  PRO n 
36 583  PHE n 
36 584  ILE n 
36 585  GLU n 
36 586  GLN n 
36 587  VAL n 
36 588  GLY n 
36 589  LEU n 
36 590  VAL n 
36 591  TYR n 
36 592  VAL n 
36 593  ARG n 
36 594  GLY n 
36 595  CYS n 
36 596  GLU n 
36 597  ILE n 
36 598  GLN n 
36 599  GLY n 
36 600  MET n 
36 601  LEU n 
36 602  ASP n 
36 603  ASP n 
36 604  LYS n 
36 605  GLY n 
36 606  ARG n 
36 607  VAL n 
36 608  ILE n 
36 609  GLU n 
36 610  ASP n 
36 611  GLY n 
36 612  PRO n 
36 613  GLU n 
36 614  PRO n 
36 615  ARG n 
36 616  PRO n 
36 617  ASN n 
36 618  LEU n 
36 619  ARG n 
36 620  GLY n 
36 621  GLU n 
36 622  SER n 
36 623  ARG n 
36 624  THR n 
36 625  PHE n 
36 626  ARG n 
36 627  VAL n 
36 628  PHE n 
36 629  LEU n 
36 630  ASP n 
36 631  PRO n 
36 632  ASN n 
36 633  GLN n 
36 634  TYR n 
36 635  GLN n 
36 636  GLN n 
36 637  ASP n 
36 638  MET n 
36 639  THR n 
36 640  ASN n 
36 641  THR n 
36 642  ILE n 
36 643  GLN n 
36 644  ASN n 
36 645  GLY n 
36 646  ALA n 
36 647  GLU n 
36 648  ASP n 
36 649  VAL n 
36 650  TYR n 
36 651  GLU n 
36 652  THR n 
36 653  PHE n 
36 654  ASN n 
36 655  ILE n 
36 656  ILE n 
36 657  MET n 
36 658  ARG n 
36 659  ARG n 
36 660  LYS n 
36 661  PRO n 
36 662  LYS n 
36 663  GLU n 
36 664  ASN n 
36 665  ASN n 
36 666  PHE n 
36 667  LYS n 
36 668  ALA n 
36 669  VAL n 
36 670  LEU n 
36 671  GLU n 
36 672  THR n 
36 673  ILE n 
36 674  ARG n 
36 675  ASN n 
36 676  LEU n 
36 677  MET n 
36 678  ASN n 
36 679  THR n 
36 680  ASP n 
36 681  CYS n 
36 682  VAL n 
36 683  VAL n 
36 684  PRO n 
36 685  ASP n 
36 686  TRP n 
36 687  LEU n 
36 688  HIS n 
36 689  ASP n 
36 690  ILE n 
36 691  ILE n 
36 692  LEU n 
36 693  GLY n 
36 694  TYR n 
36 695  GLY n 
36 696  ASP n 
36 697  PRO n 
36 698  SER n 
36 699  SER n 
36 700  ALA n 
36 701  HIS n 
36 702  TYR n 
36 703  SER n 
36 704  LYS n 
36 705  MET n 
36 706  PRO n 
36 707  ASN n 
36 708  GLN n 
36 709  ILE n 
36 710  ALA n 
36 711  THR n 
36 712  LEU n 
36 713  ASP n 
36 714  PHE n 
36 715  ASN n 
36 716  ASP n 
36 717  THR n 
36 718  PHE n 
36 719  LEU n 
36 720  SER n 
36 721  ILE n 
36 722  GLU n 
36 723  HIS n 
36 724  LEU n 
36 725  LYS n 
36 726  ALA n 
36 727  SER n 
36 728  PHE n 
36 729  PRO n 
36 730  GLY n 
36 731  HIS n 
36 732  ASN n 
36 733  VAL n 
36 734  LYS n 
36 735  VAL n 
36 736  THR n 
36 737  VAL n 
36 738  GLU n 
36 739  ASP n 
36 740  PRO n 
36 741  ALA n 
36 742  LEU n 
36 743  GLN n 
36 744  ILE n 
36 745  PRO n 
36 746  PRO n 
36 747  PHE n 
36 748  ARG n 
36 749  ILE n 
36 750  THR n 
36 751  PHE n 
36 752  PRO n 
36 753  VAL n 
36 754  ARG n 
36 755  SER n 
36 756  GLY n 
36 757  LYS n 
36 758  GLY n 
36 759  LYS n 
36 760  LYS n 
36 761  ARG n 
36 762  LYS n 
36 763  ASP n 
36 764  ALA n 
36 765  ASP n 
36 766  VAL n 
36 767  GLU n 
36 768  ASP n 
36 769  GLU n 
36 770  ASP n 
36 771  THR n 
36 772  GLU n 
36 773  GLU n 
36 774  ALA n 
36 775  LYS n 
36 776  THR n 
36 777  LEU n 
36 778  ILE n 
36 779  VAL n 
36 780  GLU n 
36 781  PRO n 
36 782  HIS n 
36 783  VAL n 
36 784  ILE n 
36 785  PRO n 
36 786  ASN n 
36 787  ARG n 
36 788  GLY n 
36 789  PRO n 
36 790  TYR n 
36 791  PRO n 
36 792  TYR n 
36 793  ASN n 
36 794  GLN n 
36 795  PRO n 
36 796  LYS n 
36 797  ARG n 
36 798  ASN n 
36 799  THR n 
36 800  ILE n 
36 801  GLN n 
36 802  PHE n 
36 803  THR n 
36 804  HIS n 
36 805  THR n 
36 806  GLN n 
36 807  ILE n 
36 808  GLU n 
36 809  ALA n 
36 810  ILE n 
36 811  ARG n 
36 812  ALA n 
36 813  GLY n 
36 814  MET n 
36 815  GLN n 
36 816  PRO n 
36 817  GLY n 
36 818  LEU n 
36 819  THR n 
36 820  MET n 
36 821  VAL n 
36 822  VAL n 
36 823  GLY n 
36 824  PRO n 
36 825  PRO n 
36 826  GLY n 
36 827  THR n 
36 828  GLY n 
36 829  LYS n 
36 830  THR n 
36 831  ASP n 
36 832  VAL n 
36 833  ALA n 
36 834  VAL n 
36 835  GLN n 
36 836  ILE n 
36 837  ILE n 
36 838  SER n 
36 839  ASN n 
36 840  ILE n 
36 841  TYR n 
36 842  HIS n 
36 843  ASN n 
36 844  PHE n 
36 845  PRO n 
36 846  GLU n 
36 847  GLN n 
36 848  ARG n 
36 849  THR n 
36 850  LEU n 
36 851  ILE n 
36 852  VAL n 
36 853  THR n 
36 854  HIS n 
36 855  SER n 
36 856  ASN n 
36 857  GLN n 
36 858  ALA n 
36 859  LEU n 
36 860  ASN n 
36 861  GLN n 
36 862  LEU n 
36 863  PHE n 
36 864  GLU n 
36 865  LYS n 
36 866  ILE n 
36 867  MET n 
36 868  ALA n 
36 869  LEU n 
36 870  ASP n 
36 871  ILE n 
36 872  ASP n 
36 873  GLU n 
36 874  ARG n 
36 875  HIS n 
36 876  LEU n 
36 877  LEU n 
36 878  ARG n 
36 879  LEU n 
36 880  GLY n 
36 881  HIS n 
36 882  GLY n 
36 883  GLU n 
36 884  GLU n 
36 885  GLU n 
36 886  LEU n 
36 887  GLU n 
36 888  THR n 
36 889  GLU n 
36 890  LYS n 
36 891  ASP n 
36 892  PHE n 
36 893  SER n 
36 894  ARG n 
36 895  TYR n 
36 896  GLY n 
36 897  ARG n 
36 898  VAL n 
36 899  ASN n 
36 900  TYR n 
36 901  VAL n 
36 902  LEU n 
36 903  ALA n 
36 904  ARG n 
36 905  ARG n 
36 906  ILE n 
36 907  GLU n 
36 908  LEU n 
36 909  LEU n 
36 910  GLU n 
36 911  GLU n 
36 912  VAL n 
36 913  LYS n 
36 914  ARG n 
36 915  LEU n 
36 916  GLN n 
36 917  LYS n 
36 918  SER n 
36 919  LEU n 
36 920  GLY n 
36 921  VAL n 
36 922  PRO n 
36 923  GLY n 
36 924  ASP n 
36 925  ALA n 
36 926  SER n 
36 927  TYR n 
36 928  THR n 
36 929  CYS n 
36 930  GLU n 
36 931  THR n 
36 932  ALA n 
36 933  GLY n 
36 934  TYR n 
36 935  PHE n 
36 936  PHE n 
36 937  LEU n 
36 938  TYR n 
36 939  GLN n 
36 940  VAL n 
36 941  MET n 
36 942  SER n 
36 943  ARG n 
36 944  TRP n 
36 945  GLU n 
36 946  GLU n 
36 947  TYR n 
36 948  ILE n 
36 949  SER n 
36 950  LYS n 
36 951  VAL n 
36 952  LYS n 
36 953  ASN n 
36 954  LYS n 
36 955  GLY n 
36 956  SER n 
36 957  THR n 
36 958  LEU n 
36 959  PRO n 
36 960  ASP n 
36 961  VAL n 
36 962  THR n 
36 963  GLU n 
36 964  VAL n 
36 965  SER n 
36 966  THR n 
36 967  PHE n 
36 968  PHE n 
36 969  PRO n 
36 970  PHE n 
36 971  HIS n 
36 972  GLU n 
36 973  TYR n 
36 974  PHE n 
36 975  ALA n 
36 976  ASN n 
36 977  ALA n 
36 978  PRO n 
36 979  GLN n 
36 980  PRO n 
36 981  ILE n 
36 982  PHE n 
36 983  LYS n 
36 984  GLY n 
36 985  ARG n 
36 986  SER n 
36 987  TYR n 
36 988  GLU n 
36 989  GLU n 
36 990  ASP n 
36 991  MET n 
36 992  GLU n 
36 993  ILE n 
36 994  ALA n 
36 995  GLU n 
36 996  GLY n 
36 997  CYS n 
36 998  PHE n 
36 999  ARG n 
36 1000 HIS n 
36 1001 ILE n 
36 1002 LYS n 
36 1003 LYS n 
36 1004 ILE n 
36 1005 PHE n 
36 1006 THR n 
36 1007 GLN n 
36 1008 LEU n 
36 1009 GLU n 
36 1010 GLU n 
36 1011 PHE n 
36 1012 ARG n 
36 1013 ALA n 
36 1014 SER n 
36 1015 GLU n 
36 1016 LEU n 
36 1017 LEU n 
36 1018 ARG n 
36 1019 SER n 
36 1020 GLY n 
36 1021 LEU n 
36 1022 ASP n 
36 1023 ARG n 
36 1024 SER n 
36 1025 LYS n 
36 1026 TYR n 
36 1027 LEU n 
36 1028 LEU n 
36 1029 VAL n 
36 1030 LYS n 
36 1031 GLU n 
36 1032 ALA n 
36 1033 LYS n 
36 1034 ILE n 
36 1035 ILE n 
36 1036 ALA n 
36 1037 MET n 
36 1038 THR n 
36 1039 CYS n 
36 1040 THR n 
36 1041 HIS n 
36 1042 ALA n 
36 1043 ALA n 
36 1044 LEU n 
36 1045 LYS n 
36 1046 ARG n 
36 1047 HIS n 
36 1048 ASP n 
36 1049 LEU n 
36 1050 VAL n 
36 1051 LYS n 
36 1052 LEU n 
36 1053 GLY n 
36 1054 PHE n 
36 1055 LYS n 
36 1056 TYR n 
36 1057 ASP n 
36 1058 ASN n 
36 1059 ILE n 
36 1060 LEU n 
36 1061 MET n 
36 1062 GLU n 
36 1063 GLU n 
36 1064 ALA n 
36 1065 ALA n 
36 1066 GLN n 
36 1067 ILE n 
36 1068 LEU n 
36 1069 GLU n 
36 1070 ILE n 
36 1071 GLU n 
36 1072 THR n 
36 1073 PHE n 
36 1074 ILE n 
36 1075 PRO n 
36 1076 LEU n 
36 1077 LEU n 
36 1078 LEU n 
36 1079 GLN n 
36 1080 ASN n 
36 1081 PRO n 
36 1082 GLN n 
36 1083 ASP n 
36 1084 GLY n 
36 1085 PHE n 
36 1086 SER n 
36 1087 ARG n 
36 1088 LEU n 
36 1089 LYS n 
36 1090 ARG n 
36 1091 TRP n 
36 1092 ILE n 
36 1093 MET n 
36 1094 ILE n 
36 1095 GLY n 
36 1096 ASP n 
36 1097 HIS n 
36 1098 HIS n 
36 1099 GLN n 
36 1100 LEU n 
36 1101 PRO n 
36 1102 PRO n 
36 1103 VAL n 
36 1104 ILE n 
36 1105 LYS n 
36 1106 ASN n 
36 1107 MET n 
36 1108 ALA n 
36 1109 PHE n 
36 1110 GLN n 
36 1111 LYS n 
36 1112 TYR n 
36 1113 SER n 
36 1114 ASN n 
36 1115 MET n 
36 1116 GLU n 
36 1117 GLN n 
36 1118 SER n 
36 1119 LEU n 
36 1120 PHE n 
36 1121 THR n 
36 1122 ARG n 
36 1123 PHE n 
36 1124 VAL n 
36 1125 ARG n 
36 1126 VAL n 
36 1127 GLY n 
36 1128 VAL n 
36 1129 PRO n 
36 1130 THR n 
36 1131 VAL n 
36 1132 ASP n 
36 1133 LEU n 
36 1134 ASP n 
36 1135 ALA n 
36 1136 GLN n 
36 1137 GLY n 
36 1138 ARG n 
36 1139 ALA n 
36 1140 ARG n 
36 1141 ALA n 
36 1142 SER n 
36 1143 LEU n 
36 1144 CYS n 
36 1145 ASN n 
36 1146 LEU n 
36 1147 TYR n 
36 1148 ASN n 
36 1149 TRP n 
36 1150 ARG n 
36 1151 TYR n 
36 1152 LYS n 
36 1153 ASN n 
36 1154 LEU n 
36 1155 GLY n 
36 1156 ASN n 
36 1157 LEU n 
36 1158 PRO n 
36 1159 HIS n 
36 1160 VAL n 
36 1161 GLN n 
36 1162 LEU n 
36 1163 LEU n 
36 1164 PRO n 
36 1165 GLU n 
36 1166 PHE n 
36 1167 SER n 
36 1168 THR n 
36 1169 ALA n 
36 1170 ASN n 
36 1171 ALA n 
36 1172 GLY n 
36 1173 LEU n 
36 1174 LEU n 
36 1175 TYR n 
36 1176 ASP n 
36 1177 PHE n 
36 1178 GLN n 
36 1179 LEU n 
36 1180 ILE n 
36 1181 ASN n 
36 1182 VAL n 
36 1183 GLU n 
36 1184 ASP n 
36 1185 PHE n 
36 1186 GLN n 
36 1187 GLY n 
36 1188 VAL n 
36 1189 GLY n 
36 1190 GLU n 
36 1191 SER n 
36 1192 GLU n 
36 1193 PRO n 
36 1194 ASN n 
36 1195 PRO n 
36 1196 TYR n 
36 1197 PHE n 
36 1198 TYR n 
36 1199 GLN n 
36 1200 ASN n 
36 1201 LEU n 
36 1202 GLY n 
36 1203 GLU n 
36 1204 ALA n 
36 1205 GLU n 
36 1206 TYR n 
36 1207 VAL n 
36 1208 VAL n 
36 1209 ALA n 
36 1210 LEU n 
36 1211 PHE n 
36 1212 MET n 
36 1213 TYR n 
36 1214 MET n 
36 1215 CYS n 
36 1216 LEU n 
36 1217 LEU n 
36 1218 GLY n 
36 1219 TYR n 
36 1220 PRO n 
36 1221 ALA n 
36 1222 ASP n 
36 1223 LYS n 
36 1224 ILE n 
36 1225 SER n 
36 1226 ILE n 
36 1227 LEU n 
36 1228 THR n 
36 1229 THR n 
36 1230 TYR n 
36 1231 ASN n 
36 1232 GLY n 
36 1233 GLN n 
36 1234 LYS n 
36 1235 HIS n 
36 1236 LEU n 
36 1237 ILE n 
36 1238 ARG n 
36 1239 ASP n 
36 1240 ILE n 
36 1241 ILE n 
36 1242 ASN n 
36 1243 ARG n 
36 1244 ARG n 
36 1245 CYS n 
36 1246 GLY n 
36 1247 ASN n 
36 1248 ASN n 
36 1249 PRO n 
36 1250 LEU n 
36 1251 ILE n 
36 1252 GLY n 
36 1253 ARG n 
36 1254 PRO n 
36 1255 ASN n 
36 1256 LYS n 
36 1257 VAL n 
36 1258 THR n 
36 1259 THR n 
36 1260 VAL n 
36 1261 ASP n 
36 1262 ARG n 
36 1263 PHE n 
36 1264 GLN n 
36 1265 GLY n 
36 1266 GLN n 
36 1267 GLN n 
36 1268 ASN n 
36 1269 ASP n 
36 1270 TYR n 
36 1271 ILE n 
36 1272 LEU n 
36 1273 LEU n 
36 1274 SER n 
36 1275 LEU n 
36 1276 VAL n 
36 1277 ARG n 
36 1278 THR n 
36 1279 ARG n 
36 1280 ALA n 
36 1281 VAL n 
36 1282 GLY n 
36 1283 HIS n 
36 1284 LEU n 
36 1285 ARG n 
36 1286 ASP n 
36 1287 VAL n 
36 1288 ARG n 
36 1289 ARG n 
36 1290 LEU n 
36 1291 VAL n 
36 1292 VAL n 
36 1293 ALA n 
36 1294 MET n 
36 1295 SER n 
36 1296 ARG n 
36 1297 ALA n 
36 1298 ARG n 
36 1299 LEU n 
36 1300 GLY n 
36 1301 LEU n 
36 1302 TYR n 
36 1303 ILE n 
36 1304 PHE n 
36 1305 ALA n 
36 1306 ARG n 
36 1307 VAL n 
36 1308 SER n 
36 1309 LEU n 
36 1310 PHE n 
36 1311 GLN n 
36 1312 ASN n 
36 1313 CYS n 
36 1314 PHE n 
36 1315 GLU n 
36 1316 LEU n 
36 1317 THR n 
36 1318 PRO n 
36 1319 ALA n 
36 1320 PHE n 
36 1321 SER n 
36 1322 GLN n 
36 1323 LEU n 
36 1324 THR n 
36 1325 ALA n 
36 1326 ARG n 
36 1327 PRO n 
36 1328 LEU n 
36 1329 HIS n 
36 1330 LEU n 
36 1331 HIS n 
36 1332 ILE n 
36 1333 ILE n 
36 1334 PRO n 
36 1335 THR n 
36 1336 GLU n 
36 1337 PRO n 
36 1338 PHE n 
36 1339 PRO n 
36 1340 THR n 
36 1341 THR n 
36 1342 ARG n 
36 1343 LYS n 
36 1344 ASN n 
36 1345 GLY n 
36 1346 GLU n 
36 1347 ARG n 
36 1348 PRO n 
36 1349 SER n 
36 1350 HIS n 
36 1351 GLU n 
36 1352 VAL n 
36 1353 GLN n 
36 1354 ILE n 
36 1355 ILE n 
36 1356 LYS n 
36 1357 ASN n 
36 1358 MET n 
36 1359 PRO n 
36 1360 GLN n 
36 1361 MET n 
36 1362 ALA n 
36 1363 ASN n 
36 1364 PHE n 
36 1365 VAL n 
36 1366 TYR n 
36 1367 ASN n 
36 1368 MET n 
36 1369 TYR n 
36 1370 MET n 
36 1371 HIS n 
36 1372 LEU n 
36 1373 ILE n 
36 1374 GLN n 
36 1375 THR n 
36 1376 THR n 
36 1377 HIS n 
36 1378 HIS n 
36 1379 TYR n 
36 1380 HIS n 
36 1381 GLN n 
36 1382 THR n 
36 1383 LEU n 
36 1384 LEU n 
36 1385 GLN n 
36 1386 LEU n 
36 1387 PRO n 
36 1388 PRO n 
36 1389 ALA n 
36 1390 MET n 
36 1391 VAL n 
36 1392 GLU n 
36 1393 GLU n 
36 1394 GLY n 
36 1395 GLU n 
36 1396 GLU n 
36 1397 VAL n 
36 1398 GLN n 
36 1399 ASN n 
36 1400 GLN n 
36 1401 GLU n 
36 1402 THR n 
36 1403 GLU n 
36 1404 LEU n 
36 1405 GLU n 
36 1406 THR n 
36 1407 GLU n 
36 1408 GLU n 
36 1409 GLU n 
36 1410 ALA n 
36 1411 MET n 
36 1412 THR n 
36 1413 VAL n 
36 1414 GLN n 
36 1415 ALA n 
36 1416 ASP n 
36 1417 ILE n 
36 1418 ILE n 
36 1419 PRO n 
36 1420 SER n 
36 1421 PRO n 
36 1422 THR n 
36 1423 ASP n 
36 1424 THR n 
36 1425 SER n 
36 1426 CYS n 
36 1427 ARG n 
36 1428 GLN n 
36 1429 GLU n 
36 1430 THR n 
36 1431 PRO n 
36 1432 ALA n 
36 1433 PHE n 
36 1434 GLN n 
36 1435 THR n 
36 1436 ASP n 
36 1437 THR n 
36 1438 THR n 
36 1439 PRO n 
36 1440 SER n 
36 1441 GLU n 
36 1442 THR n 
36 1443 GLY n 
36 1444 ALA n 
36 1445 THR n 
36 1446 SER n 
36 1447 THR n 
36 1448 PRO n 
36 1449 GLU n 
36 1450 ALA n 
36 1451 ILE n 
36 1452 PRO n 
36 1453 ALA n 
36 1454 LEU n 
36 1455 SER n 
36 1456 GLU n 
36 1457 THR n 
36 1458 THR n 
36 1459 PRO n 
36 1460 THR n 
36 1461 VAL n 
36 1462 VAL n 
36 1463 GLY n 
36 1464 ALA n 
36 1465 VAL n 
36 1466 SER n 
36 1467 ALA n 
36 1468 PRO n 
36 1469 ALA n 
36 1470 GLU n 
36 1471 ALA n 
36 1472 ASN n 
36 1473 THR n 
36 1474 PRO n 
36 1475 GLN n 
36 1476 ASP n 
36 1477 ALA n 
36 1478 THR n 
36 1479 SER n 
36 1480 ALA n 
36 1481 PRO n 
36 1482 GLU n 
36 1483 GLU n 
36 1484 THR n 
36 1485 LYS n 
37 1    MET n 
37 2    VAL n 
37 3    LYS n 
37 4    LEU n 
37 5    THR n 
37 6    ALA n 
37 7    GLU n 
37 8    LEU n 
37 9    ILE n 
37 10   GLU n 
37 11   GLN n 
37 12   ALA n 
37 13   ALA n 
37 14   GLN n 
37 15   TYR n 
37 16   THR n 
37 17   ASN n 
37 18   ALA n 
37 19   VAL n 
37 20   ARG n 
37 21   ASP n 
37 22   ARG n 
37 23   GLU n 
37 24   LEU n 
37 25   ASP n 
37 26   LEU n 
37 27   ARG n 
37 28   GLY n 
37 29   TYR n 
37 30   LYS n 
37 31   ILE n 
37 32   PRO n 
37 33   VAL n 
37 34   ILE n 
37 35   GLU n 
37 36   ASN n 
37 37   LEU n 
37 38   GLY n 
37 39   ALA n 
37 40   THR n 
37 41   LEU n 
37 42   ASP n 
37 43   GLN n 
37 44   PHE n 
37 45   ASP n 
37 46   ALA n 
37 47   ILE n 
37 48   ASP n 
37 49   PHE n 
37 50   SER n 
37 51   ASP n 
37 52   ASN n 
37 53   GLU n 
37 54   ILE n 
37 55   ARG n 
37 56   LYS n 
37 57   LEU n 
37 58   ASP n 
37 59   GLY n 
37 60   PHE n 
37 61   PRO n 
37 62   LEU n 
37 63   LEU n 
37 64   ARG n 
37 65   ARG n 
37 66   LEU n 
37 67   LYS n 
37 68   THR n 
37 69   LEU n 
37 70   LEU n 
37 71   VAL n 
37 72   ASN n 
37 73   ASN n 
37 74   ASN n 
37 75   ARG n 
37 76   ILE n 
37 77   CYS n 
37 78   ARG n 
37 79   ILE n 
37 80   GLY n 
37 81   GLU n 
37 82   GLY n 
37 83   LEU n 
37 84   ASP n 
37 85   GLN n 
37 86   ALA n 
37 87   LEU n 
37 88   PRO n 
37 89   ASP n 
37 90   LEU n 
37 91   THR n 
37 92   GLU n 
37 93   LEU n 
37 94   ILE n 
37 95   LEU n 
37 96   THR n 
37 97   ASN n 
37 98   ASN n 
37 99   SER n 
37 100  LEU n 
37 101  VAL n 
37 102  GLU n 
37 103  LEU n 
37 104  GLY n 
37 105  ASP n 
37 106  LEU n 
37 107  ASP n 
37 108  PRO n 
37 109  LEU n 
37 110  ALA n 
37 111  SER n 
37 112  LEU n 
37 113  LYS n 
37 114  SER n 
37 115  LEU n 
37 116  THR n 
37 117  TYR n 
37 118  LEU n 
37 119  CYS n 
37 120  ILE n 
37 121  LEU n 
37 122  ARG n 
37 123  ASN n 
37 124  PRO n 
37 125  VAL n 
37 126  THR n 
37 127  ASN n 
37 128  LYS n 
37 129  LYS n 
37 130  HIS n 
37 131  TYR n 
37 132  ARG n 
37 133  LEU n 
37 134  TYR n 
37 135  VAL n 
37 136  ILE n 
37 137  TYR n 
37 138  LYS n 
37 139  VAL n 
37 140  PRO n 
37 141  GLN n 
37 142  VAL n 
37 143  ARG n 
37 144  VAL n 
37 145  LEU n 
37 146  ASP n 
37 147  PHE n 
37 148  GLN n 
37 149  LYS n 
37 150  VAL n 
37 151  LYS n 
37 152  LEU n 
37 153  LYS n 
37 154  GLU n 
37 155  ARG n 
37 156  GLN n 
37 157  GLU n 
37 158  ALA n 
37 159  GLU n 
37 160  LYS n 
37 161  MET n 
37 162  PHE n 
37 163  LYS n 
37 164  GLY n 
37 165  LYS n 
37 166  ARG n 
37 167  GLY n 
37 168  ALA n 
37 169  GLN n 
37 170  LEU n 
37 171  ALA n 
37 172  LYS n 
37 173  ASP n 
37 174  ILE n 
37 175  ALA n 
37 176  ARG n 
37 177  ARG n 
37 178  SER n 
37 179  LYS n 
37 180  THR n 
37 181  PHE n 
37 182  ASN n 
37 183  PRO n 
37 184  GLY n 
37 185  ALA n 
37 186  GLY n 
37 187  LEU n 
37 188  PRO n 
37 189  THR n 
37 190  ASP n 
37 191  LYS n 
37 192  LYS n 
37 193  LYS n 
37 194  GLY n 
37 195  GLY n 
37 196  PRO n 
37 197  SER n 
37 198  PRO n 
37 199  GLY n 
37 200  ASP n 
37 201  VAL n 
37 202  GLU n 
37 203  ALA n 
37 204  ILE n 
37 205  LYS n 
37 206  ASN n 
37 207  ALA n 
37 208  ILE n 
37 209  ALA n 
37 210  ASN n 
37 211  ALA n 
37 212  SER n 
37 213  THR n 
37 214  LEU n 
37 215  ALA n 
37 216  GLU n 
37 217  VAL n 
37 218  GLU n 
37 219  ARG n 
37 220  LEU n 
37 221  LYS n 
37 222  GLY n 
37 223  LEU n 
37 224  LEU n 
37 225  GLN n 
37 226  SER n 
37 227  GLY n 
37 228  GLN n 
37 229  ILE n 
37 230  PRO n 
37 231  GLY n 
37 232  ARG n 
37 233  GLU n 
37 234  ARG n 
37 235  ARG n 
37 236  SER n 
37 237  GLY n 
37 238  PRO n 
37 239  THR n 
37 240  ASP n 
37 241  ASP n 
37 242  GLY n 
37 243  GLU n 
37 244  GLU n 
37 245  GLU n 
37 246  MET n 
37 247  GLU n 
37 248  GLU n 
37 249  ASP n 
37 250  THR n 
37 251  VAL n 
37 252  THR n 
37 253  ASN n 
37 254  GLY n 
37 255  SER n 
38 1    MET n 
38 2    ASP n 
38 3    ILE n 
38 4    ARG n 
38 5    PRO n 
38 6    ASN n 
38 7    HIS n 
38 8    THR n 
38 9    ILE n 
38 10   TYR n 
38 11   ILE n 
38 12   ASN n 
38 13   ASN n 
38 14   MET n 
38 15   ASN n 
38 16   ASP n 
38 17   LYS n 
38 18   ILE n 
38 19   LYS n 
38 20   LYS n 
38 21   GLU n 
38 22   GLU n 
38 23   LEU n 
38 24   LYS n 
38 25   ARG n 
38 26   SER n 
38 27   LEU n 
38 28   TYR n 
38 29   ALA n 
38 30   LEU n 
38 31   PHE n 
38 32   SER n 
38 33   GLN n 
38 34   PHE n 
38 35   GLY n 
38 36   HIS n 
38 37   VAL n 
38 38   VAL n 
38 39   ASP n 
38 40   ILE n 
38 41   VAL n 
38 42   ALA n 
38 43   LEU n 
38 44   LYS n 
38 45   THR n 
38 46   MET n 
38 47   LYS n 
38 48   MET n 
38 49   ARG n 
38 50   GLY n 
38 51   GLN n 
38 52   ALA n 
38 53   PHE n 
38 54   VAL n 
38 55   ILE n 
38 56   PHE n 
38 57   LYS n 
38 58   GLU n 
38 59   LEU n 
38 60   GLY n 
38 61   SER n 
38 62   SER n 
38 63   THR n 
38 64   ASN n 
38 65   ALA n 
38 66   LEU n 
38 67   ARG n 
38 68   GLN n 
38 69   LEU n 
38 70   GLN n 
38 71   GLY n 
38 72   PHE n 
38 73   PRO n 
38 74   PHE n 
38 75   TYR n 
38 76   GLY n 
38 77   LYS n 
38 78   PRO n 
38 79   MET n 
38 80   ARG n 
38 81   ILE n 
38 82   GLN n 
38 83   TYR n 
38 84   ALA n 
38 85   LYS n 
38 86   THR n 
38 87   ASP n 
38 88   SER n 
38 89   ASP n 
38 90   ILE n 
38 91   ILE n 
38 92   SER n 
38 93   LYS n 
38 94   MET n 
38 95   ARG n 
38 96   GLY n 
38 97   THR n 
38 98   PHE n 
38 99   ALA n 
38 100  ASP n 
38 101  LYS n 
38 102  GLU n 
38 103  LYS n 
38 104  LYS n 
38 105  LYS n 
38 106  GLU n 
38 107  LYS n 
38 108  LYS n 
38 109  LYS n 
38 110  ALA n 
38 111  LYS n 
38 112  THR n 
38 113  VAL n 
38 114  GLU n 
38 115  GLN n 
38 116  THR n 
38 117  ALA n 
38 118  THR n 
38 119  THR n 
38 120  THR n 
38 121  ASN n 
38 122  LYS n 
38 123  LYS n 
38 124  PRO n 
38 125  GLY n 
38 126  GLN n 
38 127  GLY n 
38 128  THR n 
38 129  PRO n 
38 130  ASN n 
38 131  SER n 
38 132  ALA n 
38 133  ASN n 
38 134  THR n 
38 135  GLN n 
38 136  GLY n 
38 137  ASN n 
38 138  SER n 
38 139  THR n 
38 140  PRO n 
38 141  ASN n 
38 142  PRO n 
38 143  GLN n 
38 144  VAL n 
38 145  PRO n 
38 146  ASP n 
38 147  TYR n 
38 148  PRO n 
38 149  PRO n 
38 150  ASN n 
38 151  TYR n 
38 152  ILE n 
38 153  LEU n 
38 154  PHE n 
38 155  LEU n 
38 156  ASN n 
38 157  ASN n 
38 158  LEU n 
38 159  PRO n 
38 160  GLU n 
38 161  GLU n 
38 162  THR n 
38 163  ASN n 
38 164  GLU n 
38 165  MET n 
38 166  MET n 
38 167  LEU n 
38 168  SER n 
38 169  MET n 
38 170  LEU n 
38 171  PHE n 
38 172  ASN n 
38 173  GLN n 
38 174  PHE n 
38 175  PRO n 
38 176  GLY n 
38 177  PHE n 
38 178  LYS n 
38 179  GLU n 
38 180  VAL n 
38 181  ARG n 
38 182  LEU n 
38 183  VAL n 
38 184  PRO n 
38 185  GLY n 
38 186  ARG n 
38 187  HIS n 
38 188  ASP n 
38 189  ILE n 
38 190  ALA n 
38 191  PHE n 
38 192  VAL n 
38 193  GLU n 
38 194  PHE n 
38 195  GLU n 
38 196  ASN n 
38 197  ASP n 
38 198  GLY n 
38 199  GLN n 
38 200  ALA n 
38 201  GLY n 
38 202  ALA n 
38 203  ALA n 
38 204  ARG n 
38 205  ASP n 
38 206  ALA n 
38 207  LEU n 
38 208  GLN n 
38 209  GLY n 
38 210  PHE n 
38 211  LYS n 
38 212  ILE n 
38 213  THR n 
38 214  PRO n 
38 215  SER n 
38 216  HIS n 
38 217  ALA n 
38 218  MET n 
38 219  LYS n 
38 220  ILE n 
38 221  THR n 
38 222  TYR n 
38 223  ALA n 
38 224  LYS n 
38 225  LYS n 
39 1    MET n 
39 2    SER n 
39 3    LEU n 
39 4    LEU n 
39 5    ASN n 
39 6    LYS n 
39 7    PRO n 
39 8    LYS n 
39 9    SER n 
39 10   GLU n 
39 11   MET n 
39 12   THR n 
39 13   PRO n 
39 14   GLU n 
39 15   GLU n 
39 16   LEU n 
39 17   GLN n 
39 18   LYS n 
39 19   ARG n 
39 20   GLU n 
39 21   GLU n 
39 22   GLU n 
39 23   GLU n 
39 24   PHE n 
39 25   ASN n 
39 26   THR n 
39 27   GLY n 
39 28   PRO n 
39 29   LEU n 
39 30   SER n 
39 31   VAL n 
39 32   LEU n 
39 33   THR n 
39 34   GLN n 
39 35   SER n 
39 36   VAL n 
39 37   LYS n 
39 38   ASN n 
39 39   ASN n 
39 40   THR n 
39 41   GLN n 
39 42   VAL n 
39 43   LEU n 
39 44   ILE n 
39 45   ASN n 
39 46   CYS n 
39 47   ARG n 
39 48   ASN n 
39 49   ASN n 
39 50   LYS n 
39 51   LYS n 
39 52   LEU n 
39 53   LEU n 
39 54   GLY n 
39 55   ARG n 
39 56   VAL n 
39 57   LYS n 
39 58   ALA n 
39 59   PHE n 
39 60   ASP n 
39 61   ARG n 
39 62   HIS n 
39 63   CYS n 
39 64   ASN n 
39 65   MET n 
39 66   VAL n 
39 67   LEU n 
39 68   GLU n 
39 69   ASN n 
39 70   VAL n 
39 71   LYS n 
39 72   GLU n 
39 73   MET n 
39 74   TRP n 
39 75   THR n 
39 76   GLU n 
39 77   VAL n 
39 78   PRO n 
39 79   LYS n 
39 80   SER n 
39 81   GLY n 
39 82   LYS n 
39 83   GLY n 
39 84   LYS n 
39 85   LYS n 
39 86   LYS n 
39 87   SER n 
39 88   LYS n 
39 89   PRO n 
39 90   VAL n 
39 91   ASN n 
39 92   LYS n 
39 93   ASP n 
39 94   ARG n 
39 95   TYR n 
39 96   ILE n 
39 97   SER n 
39 98   LYS n 
39 99   MET n 
39 100  PHE n 
39 101  LEU n 
39 102  ARG n 
39 103  GLY n 
39 104  ASP n 
39 105  SER n 
39 106  VAL n 
39 107  ILE n 
39 108  VAL n 
39 109  VAL n 
39 110  LEU n 
39 111  ARG n 
39 112  ASN n 
39 113  PRO n 
39 114  LEU n 
39 115  ILE n 
39 116  ALA n 
39 117  GLY n 
39 118  LYS n 
40 1    MET n 
40 2    SER n 
40 3    LEU n 
40 4    PRO n 
40 5    LEU n 
40 6    ASN n 
40 7    PRO n 
40 8    LYS n 
40 9    PRO n 
40 10   PHE n 
40 11   LEU n 
40 12   ASN n 
40 13   GLY n 
40 14   LEU n 
40 15   THR n 
40 16   GLY n 
40 17   LYS n 
40 18   PRO n 
40 19   VAL n 
40 20   MET n 
40 21   VAL n 
40 22   LYS n 
40 23   LEU n 
40 24   LYS n 
40 25   TRP n 
40 26   GLY n 
40 27   MET n 
40 28   GLU n 
40 29   TYR n 
40 30   LYS n 
40 31   GLY n 
40 32   TYR n 
40 33   LEU n 
40 34   VAL n 
40 35   SER n 
40 36   VAL n 
40 37   ASP n 
40 38   GLY n 
40 39   TYR n 
40 40   MET n 
40 41   ASN n 
40 42   MET n 
40 43   GLN n 
40 44   LEU n 
40 45   ALA n 
40 46   ASN n 
40 47   THR n 
40 48   GLU n 
40 49   GLU n 
40 50   TYR n 
40 51   ILE n 
40 52   ASP n 
40 53   GLY n 
40 54   ALA n 
40 55   LEU n 
40 56   SER n 
40 57   GLY n 
40 58   HIS n 
40 59   LEU n 
40 60   GLY n 
40 61   GLU n 
40 62   VAL n 
40 63   LEU n 
40 64   ILE n 
40 65   ARG n 
40 66   CYS n 
40 67   ASN n 
40 68   ASN n 
40 69   VAL n 
40 70   LEU n 
40 71   TYR n 
40 72   ILE n 
40 73   ARG n 
40 74   GLY n 
40 75   VAL n 
40 76   GLU n 
40 77   GLU n 
40 78   GLU n 
40 79   GLU n 
40 80   GLU n 
40 81   ASP n 
40 82   GLY n 
40 83   GLU n 
40 84   MET n 
40 85   ARG n 
40 86   GLU n 
41 1    MET n 
41 2    ALA n 
41 3    TYR n 
41 4    ARG n 
41 5    GLY n 
41 6    GLN n 
41 7    GLY n 
41 8    GLN n 
41 9    LYS n 
41 10   VAL n 
41 11   GLN n 
41 12   LYS n 
41 13   VAL n 
41 14   MET n 
41 15   VAL n 
41 16   GLN n 
41 17   PRO n 
41 18   ILE n 
41 19   ASN n 
41 20   LEU n 
41 21   ILE n 
41 22   PHE n 
41 23   ARG n 
41 24   TYR n 
41 25   LEU n 
41 26   GLN n 
41 27   ASN n 
41 28   ARG n 
41 29   SER n 
41 30   ARG n 
41 31   ILE n 
41 32   GLN n 
41 33   VAL n 
41 34   TRP n 
41 35   LEU n 
41 36   TYR n 
41 37   GLU n 
41 38   GLN n 
41 39   VAL n 
41 40   ASN n 
41 41   MET n 
41 42   ARG n 
41 43   ILE n 
41 44   GLU n 
41 45   GLY n 
41 46   CYS n 
41 47   ILE n 
41 48   ILE n 
41 49   GLY n 
41 50   PHE n 
41 51   ASP n 
41 52   GLU n 
41 53   TYR n 
41 54   MET n 
41 55   ASN n 
41 56   LEU n 
41 57   VAL n 
41 58   LEU n 
41 59   ASP n 
41 60   ASP n 
41 61   ALA n 
41 62   GLU n 
41 63   GLU n 
41 64   ILE n 
41 65   HIS n 
41 66   SER n 
41 67   LYS n 
41 68   THR n 
41 69   LYS n 
41 70   SER n 
41 71   ARG n 
41 72   LYS n 
41 73   GLN n 
41 74   LEU n 
41 75   GLY n 
41 76   ARG n 
41 77   ILE n 
41 78   MET n 
41 79   LEU n 
41 80   LYS n 
41 81   GLY n 
41 82   ASP n 
41 83   ASN n 
41 84   ILE n 
41 85   THR n 
41 86   LEU n 
41 87   LEU n 
41 88   GLN n 
41 89   SER n 
41 90   VAL n 
41 91   SER n 
41 92   ASN n 
42 1    MET n 
42 2    SER n 
42 3    LYS n 
42 4    ALA n 
42 5    HIS n 
42 6    PRO n 
42 7    PRO n 
42 8    GLU n 
42 9    LEU n 
42 10   LYS n 
42 11   LYS n 
42 12   PHE n 
42 13   MET n 
42 14   ASP n 
42 15   LYS n 
42 16   LYS n 
42 17   LEU n 
42 18   SER n 
42 19   LEU n 
42 20   LYS n 
42 21   LEU n 
42 22   ASN n 
42 23   GLY n 
42 24   GLY n 
42 25   ARG n 
42 26   HIS n 
42 27   VAL n 
42 28   GLN n 
42 29   GLY n 
42 30   ILE n 
42 31   LEU n 
42 32   ARG n 
42 33   GLY n 
42 34   PHE n 
42 35   ASP n 
42 36   PRO n 
42 37   PHE n 
42 38   MET n 
42 39   ASN n 
42 40   LEU n 
42 41   VAL n 
42 42   ILE n 
42 43   ASP n 
42 44   GLU n 
42 45   CYS n 
42 46   VAL n 
42 47   GLU n 
42 48   MET n 
42 49   ALA n 
42 50   THR n 
42 51   SER n 
42 52   GLY n 
42 53   GLN n 
42 54   GLN n 
42 55   ASN n 
42 56   ASN n 
42 57   ILE n 
42 58   GLY n 
42 59   MET n 
42 60   VAL n 
42 61   VAL n 
42 62   ILE n 
42 63   ARG n 
42 64   GLY n 
42 65   ASN n 
42 66   SER n 
42 67   ILE n 
42 68   ILE n 
42 69   MET n 
42 70   LEU n 
42 71   GLU n 
42 72   ALA n 
42 73   LEU n 
42 74   GLU n 
42 75   ARG n 
42 76   VAL n 
43 1    MET n 
43 2    SER n 
43 3    ILE n 
43 4    GLY n 
43 5    VAL n 
43 6    PRO n 
43 7    ILE n 
43 8    LYS n 
43 9    VAL n 
43 10   LEU n 
43 11   HIS n 
43 12   GLU n 
43 13   ALA n 
43 14   GLU n 
43 15   GLY n 
43 16   HIS n 
43 17   ILE n 
43 18   VAL n 
43 19   THR n 
43 20   CYS n 
43 21   GLU n 
43 22   THR n 
43 23   ASN n 
43 24   THR n 
43 25   GLY n 
43 26   GLU n 
43 27   VAL n 
43 28   TYR n 
43 29   ARG n 
43 30   GLY n 
43 31   LYS n 
43 32   LEU n 
43 33   ILE n 
43 34   GLU n 
43 35   ALA n 
43 36   GLU n 
43 37   ASP n 
43 38   ASN n 
43 39   MET n 
43 40   ASN n 
43 41   CYS n 
43 42   GLN n 
43 43   MET n 
43 44   SER n 
43 45   ASN n 
43 46   ILE n 
43 47   THR n 
43 48   VAL n 
43 49   THR n 
43 50   TYR n 
43 51   ARG n 
43 52   ASP n 
43 53   GLY n 
43 54   ARG n 
43 55   VAL n 
43 56   ALA n 
43 57   GLN n 
43 58   LEU n 
43 59   GLU n 
43 60   GLN n 
43 61   VAL n 
43 62   TYR n 
43 63   ILE n 
43 64   ARG n 
43 65   GLY n 
43 66   SER n 
43 67   LYS n 
43 68   ILE n 
43 69   ARG n 
43 70   PHE n 
43 71   LEU n 
43 72   ILE n 
43 73   LEU n 
43 74   PRO n 
43 75   ASP n 
43 76   MET n 
43 77   LEU n 
43 78   LYS n 
43 79   ASN n 
43 80   ALA n 
43 81   PRO n 
43 82   MET n 
43 83   LEU n 
43 84   LYS n 
43 85   SER n 
43 86   MET n 
43 87   LYS n 
43 88   ASN n 
43 89   LYS n 
43 90   ASN n 
43 91   GLN n 
43 92   GLY n 
43 93   SER n 
43 94   GLY n 
43 95   ALA n 
43 96   GLY n 
43 97   ARG n 
43 98   GLY n 
43 99   LYS n 
43 100  ALA n 
43 101  ALA n 
43 102  ILE n 
43 103  LEU n 
43 104  LYS n 
43 105  ALA n 
43 106  GLN n 
43 107  VAL n 
43 108  ALA n 
43 109  ALA n 
43 110  ARG n 
43 111  GLY n 
43 112  ARG n 
43 113  GLY n 
43 114  ARG n 
43 115  GLY n 
43 116  MET n 
43 117  GLY n 
43 118  ARG n 
43 119  GLY n 
43 120  ASN n 
43 121  ILE n 
43 122  PHE n 
43 123  GLN n 
43 124  LYS n 
43 125  ARG n 
43 126  ARG n 
44 1    MET n 
44 2    THR n 
44 3    VAL n 
44 4    GLY n 
44 5    LYS n 
44 6    SER n 
44 7    SER n 
44 8    LYS n 
44 9    MET n 
44 10   LEU n 
44 11   GLN n 
44 12   HIS n 
44 13   ILE n 
44 14   ASP n 
44 15   TYR n 
44 16   ARG n 
44 17   MET n 
44 18   ARG n 
44 19   CYS n 
44 20   ILE n 
44 21   LEU n 
44 22   GLN n 
44 23   ASP n 
44 24   GLY n 
44 25   ARG n 
44 26   ILE n 
44 27   PHE n 
44 28   ILE n 
44 29   GLY n 
44 30   THR n 
44 31   PHE n 
44 32   LYS n 
44 33   ALA n 
44 34   PHE n 
44 35   ASP n 
44 36   LYS n 
44 37   HIS n 
44 38   MET n 
44 39   ASN n 
44 40   LEU n 
44 41   ILE n 
44 42   LEU n 
44 43   CYS n 
44 44   ASP n 
44 45   CYS n 
44 46   ASP n 
44 47   GLU n 
44 48   PHE n 
44 49   ARG n 
44 50   LYS n 
44 51   ILE n 
44 52   LYS n 
44 53   PRO n 
44 54   LYS n 
44 55   ASN n 
44 56   SER n 
44 57   LYS n 
44 58   GLN n 
44 59   ALA n 
44 60   GLU n 
44 61   ARG n 
44 62   GLU n 
44 63   GLU n 
44 64   LYS n 
44 65   ARG n 
44 66   VAL n 
44 67   LEU n 
44 68   GLY n 
44 69   LEU n 
44 70   VAL n 
44 71   LEU n 
44 72   LEU n 
44 73   ARG n 
44 74   GLY n 
44 75   GLU n 
44 76   ASN n 
44 77   LEU n 
44 78   VAL n 
44 79   SER n 
44 80   MET n 
44 81   THR n 
44 82   VAL n 
44 83   GLU n 
44 84   GLY n 
44 85   PRO n 
44 86   PRO n 
44 87   PRO n 
44 88   LYS n 
44 89   ASP n 
44 90   THR n 
44 91   GLY n 
44 92   ILE n 
44 93   ALA n 
44 94   ARG n 
44 95   VAL n 
44 96   PRO n 
44 97   LEU n 
44 98   ALA n 
44 99   GLY n 
44 100  ALA n 
44 101  ALA n 
44 102  GLY n 
44 103  GLY n 
44 104  PRO n 
44 105  GLY n 
44 106  ILE n 
44 107  GLY n 
44 108  ARG n 
44 109  ALA n 
44 110  ALA n 
44 111  GLY n 
44 112  ARG n 
44 113  GLY n 
44 114  ILE n 
44 115  PRO n 
44 116  ALA n 
44 117  GLY n 
44 118  VAL n 
44 119  PRO n 
44 120  MET n 
44 121  PRO n 
44 122  GLN n 
44 123  ALA n 
44 124  PRO n 
44 125  ALA n 
44 126  GLY n 
44 127  LEU n 
44 128  ALA n 
44 129  GLY n 
44 130  PRO n 
44 131  VAL n 
44 132  ARG n 
44 133  GLY n 
44 134  VAL n 
44 135  GLY n 
44 136  GLY n 
44 137  PRO n 
44 138  SER n 
44 139  GLN n 
44 140  GLN n 
44 141  VAL n 
44 142  MET n 
44 143  THR n 
44 144  PRO n 
44 145  GLN n 
44 146  GLY n 
44 147  ARG n 
44 148  GLY n 
44 149  THR n 
44 150  VAL n 
44 151  ALA n 
44 152  ALA n 
44 153  ALA n 
44 154  ALA n 
44 155  ALA n 
44 156  ALA n 
44 157  ALA n 
44 158  THR n 
44 159  ALA n 
44 160  SER n 
44 161  ILE n 
44 162  ALA n 
44 163  GLY n 
44 164  ALA n 
44 165  PRO n 
44 166  THR n 
44 167  GLN n 
44 168  TYR n 
44 169  PRO n 
44 170  PRO n 
44 171  GLY n 
44 172  ARG n 
44 173  GLY n 
44 174  GLY n 
44 175  PRO n 
44 176  PRO n 
44 177  PRO n 
44 178  PRO n 
44 179  MET n 
44 180  GLY n 
44 181  ARG n 
44 182  GLY n 
44 183  ALA n 
44 184  PRO n 
44 185  PRO n 
44 186  PRO n 
44 187  GLY n 
44 188  MET n 
44 189  MET n 
44 190  GLY n 
44 191  PRO n 
44 192  PRO n 
44 193  PRO n 
44 194  GLY n 
44 195  MET n 
44 196  ARG n 
44 197  PRO n 
44 198  PRO n 
44 199  MET n 
44 200  GLY n 
44 201  PRO n 
44 202  PRO n 
44 203  MET n 
44 204  GLY n 
44 205  ILE n 
44 206  PRO n 
44 207  PRO n 
44 208  GLY n 
44 209  ARG n 
44 210  GLY n 
44 211  THR n 
44 212  PRO n 
44 213  MET n 
44 214  GLY n 
44 215  MET n 
44 216  PRO n 
44 217  PRO n 
44 218  PRO n 
44 219  GLY n 
44 220  MET n 
44 221  ARG n 
44 222  PRO n 
44 223  PRO n 
44 224  PRO n 
44 225  PRO n 
44 226  GLY n 
44 227  MET n 
44 228  ARG n 
44 229  GLY n 
44 230  PRO n 
44 231  PRO n 
44 232  PRO n 
44 233  PRO n 
44 234  GLY n 
44 235  MET n 
44 236  ARG n 
44 237  PRO n 
44 238  PRO n 
44 239  ARG n 
44 240  PRO n 
45 1    MET n 
45 2    LYS n 
45 3    LEU n 
45 4    VAL n 
45 5    ARG n 
45 6    PHE n 
45 7    LEU n 
45 8    MET n 
45 9    LYS n 
45 10   LEU n 
45 11   SER n 
45 12   HIS n 
45 13   GLU n 
45 14   THR n 
45 15   VAL n 
45 16   THR n 
45 17   ILE n 
45 18   GLU n 
45 19   LEU n 
45 20   LYS n 
45 21   ASN n 
45 22   GLY n 
45 23   THR n 
45 24   GLN n 
45 25   VAL n 
45 26   HIS n 
45 27   GLY n 
45 28   THR n 
45 29   ILE n 
45 30   THR n 
45 31   GLY n 
45 32   VAL n 
45 33   ASP n 
45 34   VAL n 
45 35   SER n 
45 36   MET n 
45 37   ASN n 
45 38   THR n 
45 39   HIS n 
45 40   LEU n 
45 41   LYS n 
45 42   ALA n 
45 43   VAL n 
45 44   LYS n 
45 45   MET n 
45 46   THR n 
45 47   LEU n 
45 48   LYS n 
45 49   ASN n 
45 50   ARG n 
45 51   GLU n 
45 52   PRO n 
45 53   VAL n 
45 54   GLN n 
45 55   LEU n 
45 56   GLU n 
45 57   THR n 
45 58   LEU n 
45 59   SER n 
45 60   ILE n 
45 61   ARG n 
45 62   GLY n 
45 63   ASN n 
45 64   ASN n 
45 65   ILE n 
45 66   ARG n 
45 67   TYR n 
45 68   PHE n 
45 69   ILE n 
45 70   LEU n 
45 71   PRO n 
45 72   ASP n 
45 73   SER n 
45 74   LEU n 
45 75   PRO n 
45 76   LEU n 
45 77   ASP n 
45 78   THR n 
45 79   LEU n 
45 80   LEU n 
45 81   VAL n 
45 82   ASP n 
45 83   VAL n 
45 84   GLU n 
45 85   PRO n 
45 86   LYS n 
45 87   VAL n 
45 88   LYS n 
45 89   SER n 
45 90   LYS n 
45 91   LYS n 
45 92   ARG n 
45 93   GLU n 
45 94   ALA n 
45 95   VAL n 
45 96   ALA n 
45 97   GLY n 
45 98   ARG n 
45 99   GLY n 
45 100  ARG n 
45 101  GLY n 
45 102  ARG n 
45 103  GLY n 
45 104  ARG n 
45 105  GLY n 
45 106  ARG n 
45 107  GLY n 
45 108  ARG n 
45 109  GLY n 
45 110  ARG n 
45 111  GLY n 
45 112  ARG n 
45 113  GLY n 
45 114  ARG n 
45 115  GLY n 
45 116  GLY n 
45 117  PRO n 
45 118  ARG n 
45 119  ARG n 
46 1    MET n 
46 2    ALA n 
46 3    THR n 
46 4    THR n 
46 5    LYS n 
46 6    ARG n 
46 7    VAL n 
46 8    LEU n 
46 9    TYR n 
46 10   VAL n 
46 11   GLY n 
46 12   GLY n 
46 13   LEU n 
46 14   ALA n 
46 15   GLU n 
46 16   GLU n 
46 17   VAL n 
46 18   ASP n 
46 19   ASP n 
46 20   LYS n 
46 21   VAL n 
46 22   LEU n 
46 23   HIS n 
46 24   ALA n 
46 25   ALA n 
46 26   PHE n 
46 27   ILE n 
46 28   PRO n 
46 29   PHE n 
46 30   GLY n 
46 31   ASP n 
46 32   ILE n 
46 33   THR n 
46 34   ASP n 
46 35   ILE n 
46 36   GLN n 
46 37   ILE n 
46 38   PRO n 
46 39   LEU n 
46 40   ASP n 
46 41   TYR n 
46 42   GLU n 
46 43   THR n 
46 44   GLU n 
46 45   LYS n 
46 46   HIS n 
46 47   ARG n 
46 48   GLY n 
46 49   PHE n 
46 50   ALA n 
46 51   PHE n 
46 52   VAL n 
46 53   GLU n 
46 54   PHE n 
46 55   GLU n 
46 56   LEU n 
46 57   ALA n 
46 58   GLU n 
46 59   ASP n 
46 60   ALA n 
46 61   ALA n 
46 62   ALA n 
46 63   ALA n 
46 64   ILE n 
46 65   ASP n 
46 66   ASN n 
46 67   MET n 
46 68   ASN n 
46 69   GLU n 
46 70   SER n 
46 71   GLU n 
46 72   LEU n 
46 73   PHE n 
46 74   GLY n 
46 75   ARG n 
46 76   THR n 
46 77   ILE n 
46 78   ARG n 
46 79   VAL n 
46 80   ASN n 
46 81   LEU n 
46 82   ALA n 
46 83   LYS n 
46 84   PRO n 
46 85   MET n 
46 86   ARG n 
46 87   ILE n 
46 88   LYS n 
46 89   GLU n 
46 90   GLY n 
46 91   SER n 
46 92   SER n 
46 93   ARG n 
46 94   PRO n 
46 95   VAL n 
46 96   TRP n 
46 97   SER n 
46 98   ASP n 
46 99   ASP n 
46 100  ASP n 
46 101  TRP n 
46 102  LEU n 
46 103  LYS n 
46 104  LYS n 
46 105  PHE n 
46 106  SER n 
46 107  GLY n 
46 108  LYS n 
46 109  THR n 
46 110  LEU n 
46 111  GLU n 
46 112  GLU n 
46 113  ASN n 
46 114  LYS n 
46 115  GLU n 
46 116  GLU n 
46 117  GLU n 
46 118  GLY n 
46 119  SER n 
46 120  GLU n 
46 121  PRO n 
46 122  PRO n 
46 123  LYS n 
46 124  ALA n 
46 125  GLU n 
46 126  THR n 
46 127  GLN n 
46 128  GLU n 
46 129  GLY n 
46 130  GLU n 
46 131  PRO n 
46 132  ILE n 
46 133  ALA n 
46 134  LYS n 
46 135  LYS n 
46 136  ALA n 
46 137  ARG n 
46 138  SER n 
46 139  ASN n 
46 140  PRO n 
46 141  GLN n 
46 142  VAL n 
46 143  TYR n 
46 144  MET n 
46 145  ASP n 
46 146  ILE n 
46 147  LYS n 
46 148  ILE n 
46 149  GLY n 
46 150  ASN n 
46 151  LYS n 
46 152  PRO n 
46 153  ALA n 
46 154  GLY n 
46 155  ARG n 
46 156  ILE n 
46 157  GLN n 
46 158  MET n 
46 159  LEU n 
46 160  LEU n 
46 161  ARG n 
46 162  SER n 
46 163  ASP n 
46 164  VAL n 
46 165  VAL n 
46 166  PRO n 
46 167  MET n 
46 168  THR n 
46 169  ALA n 
46 170  GLU n 
46 171  ASN n 
46 172  PHE n 
46 173  ARG n 
46 174  CYS n 
46 175  LEU n 
46 176  CYS n 
46 177  THR n 
46 178  HIS n 
46 179  GLU n 
46 180  LYS n 
46 181  GLY n 
46 182  PHE n 
46 183  GLY n 
46 184  PHE n 
46 185  LYS n 
46 186  GLY n 
46 187  SER n 
46 188  SER n 
46 189  PHE n 
46 190  HIS n 
46 191  ARG n 
46 192  ILE n 
46 193  ILE n 
46 194  PRO n 
46 195  GLN n 
46 196  PHE n 
46 197  MET n 
46 198  CYS n 
46 199  GLN n 
46 200  GLY n 
46 201  GLY n 
46 202  ASP n 
46 203  PHE n 
46 204  THR n 
46 205  ASN n 
46 206  HIS n 
46 207  ASN n 
46 208  GLY n 
46 209  THR n 
46 210  GLY n 
46 211  GLY n 
46 212  LYS n 
46 213  SER n 
46 214  ILE n 
46 215  TYR n 
46 216  GLY n 
46 217  LYS n 
46 218  LYS n 
46 219  PHE n 
46 220  ASP n 
46 221  ASP n 
46 222  GLU n 
46 223  ASN n 
46 224  PHE n 
46 225  ILE n 
46 226  LEU n 
46 227  LYS n 
46 228  HIS n 
46 229  THR n 
46 230  GLY n 
46 231  PRO n 
46 232  GLY n 
46 233  LEU n 
46 234  LEU n 
46 235  SER n 
46 236  MET n 
46 237  ALA n 
46 238  ASN n 
46 239  SER n 
46 240  GLY n 
46 241  PRO n 
46 242  ASN n 
46 243  THR n 
46 244  ASN n 
46 245  GLY n 
46 246  SER n 
46 247  GLN n 
46 248  PHE n 
46 249  PHE n 
46 250  LEU n 
46 251  THR n 
46 252  CYS n 
46 253  ASP n 
46 254  LYS n 
46 255  THR n 
46 256  ASP n 
46 257  TRP n 
46 258  LEU n 
46 259  ASP n 
46 260  GLY n 
46 261  LYS n 
46 262  HIS n 
46 263  VAL n 
46 264  VAL n 
46 265  PHE n 
46 266  GLY n 
46 267  GLU n 
46 268  VAL n 
46 269  THR n 
46 270  GLU n 
46 271  GLY n 
46 272  LEU n 
46 273  ASP n 
46 274  VAL n 
46 275  LEU n 
46 276  ARG n 
46 277  GLN n 
46 278  ILE n 
46 279  GLU n 
46 280  ALA n 
46 281  GLN n 
46 282  GLY n 
46 283  SER n 
46 284  LYS n 
46 285  ASP n 
46 286  GLY n 
46 287  LYS n 
46 288  PRO n 
46 289  LYS n 
46 290  GLN n 
46 291  LYS n 
46 292  VAL n 
46 293  ILE n 
46 294  ILE n 
46 295  ALA n 
46 296  ASP n 
46 297  CYS n 
46 298  GLY n 
46 299  GLU n 
46 300  TYR n 
46 301  VAL n 
47 1    MET n 
47 2    PRO n 
47 3    ALA n 
47 4    GLY n 
47 5    PRO n 
47 6    VAL n 
47 7    GLN n 
47 8    ALA n 
47 9    VAL n 
47 10   PRO n 
47 11   PRO n 
47 12   PRO n 
47 13   PRO n 
47 14   PRO n 
47 15   VAL n 
47 16   PRO n 
47 17   THR n 
47 18   GLU n 
47 19   PRO n 
47 20   LYS n 
47 21   GLN n 
47 22   PRO n 
47 23   THR n 
47 24   GLU n 
47 25   GLU n 
47 26   GLU n 
47 27   ALA n 
47 28   SER n 
47 29   SER n 
47 30   LYS n 
47 31   GLU n 
47 32   ASP n 
47 33   SER n 
47 34   ALA n 
47 35   PRO n 
47 36   SER n 
47 37   LYS n 
47 38   PRO n 
47 39   VAL n 
47 40   VAL n 
47 41   GLY n 
47 42   ILE n 
47 43   ILE n 
47 44   TYR n 
47 45   PRO n 
47 46   PRO n 
47 47   PRO n 
47 48   GLU n 
47 49   VAL n 
47 50   ARG n 
47 51   ASN n 
47 52   ILE n 
47 53   VAL n 
47 54   ASP n 
47 55   LYS n 
47 56   THR n 
47 57   ALA n 
47 58   SER n 
47 59   PHE n 
47 60   VAL n 
47 61   ALA n 
47 62   ARG n 
47 63   ASN n 
47 64   GLY n 
47 65   PRO n 
47 66   GLU n 
47 67   PHE n 
47 68   GLU n 
47 69   ALA n 
47 70   ARG n 
47 71   ILE n 
47 72   ARG n 
47 73   GLN n 
47 74   ASN n 
47 75   GLU n 
47 76   ILE n 
47 77   ASN n 
47 78   ASN n 
47 79   PRO n 
47 80   LYS n 
47 81   PHE n 
47 82   ASN n 
47 83   PHE n 
47 84   LEU n 
47 85   ASN n 
47 86   PRO n 
47 87   ASN n 
47 88   ASP n 
47 89   PRO n 
47 90   TYR n 
47 91   HIS n 
47 92   ALA n 
47 93   TYR n 
47 94   TYR n 
47 95   ARG n 
47 96   HIS n 
47 97   LYS n 
47 98   VAL n 
47 99   SER n 
47 100  GLU n 
47 101  PHE n 
47 102  LYS n 
47 103  GLU n 
47 104  GLY n 
47 105  LYS n 
47 106  ALA n 
47 107  GLN n 
47 108  GLU n 
47 109  PRO n 
47 110  SER n 
47 111  ALA n 
47 112  ALA n 
47 113  ILE n 
47 114  PRO n 
47 115  LYS n 
47 116  VAL n 
47 117  MET n 
47 118  GLN n 
47 119  GLN n 
47 120  GLN n 
47 121  GLN n 
47 122  GLN n 
47 123  THR n 
47 124  THR n 
47 125  GLN n 
47 126  GLN n 
47 127  GLN n 
47 128  LEU n 
47 129  PRO n 
47 130  GLN n 
47 131  LYS n 
47 132  VAL n 
47 133  GLN n 
47 134  ALA n 
47 135  GLN n 
47 136  VAL n 
47 137  ILE n 
47 138  GLN n 
47 139  GLU n 
47 140  THR n 
47 141  ILE n 
47 142  VAL n 
47 143  PRO n 
47 144  LYS n 
47 145  GLU n 
47 146  PRO n 
47 147  PRO n 
47 148  PRO n 
47 149  GLU n 
47 150  PHE n 
47 151  GLU n 
47 152  PHE n 
47 153  ILE n 
47 154  ALA n 
47 155  ASP n 
47 156  PRO n 
47 157  PRO n 
47 158  SER n 
47 159  ILE n 
47 160  SER n 
47 161  ALA n 
47 162  PHE n 
47 163  ASP n 
47 164  LEU n 
47 165  ASP n 
47 166  VAL n 
47 167  VAL n 
47 168  LYS n 
47 169  LEU n 
47 170  THR n 
47 171  ALA n 
47 172  GLN n 
47 173  PHE n 
47 174  VAL n 
47 175  ALA n 
47 176  ARG n 
47 177  ASN n 
47 178  GLY n 
47 179  ARG n 
47 180  GLN n 
47 181  PHE n 
47 182  LEU n 
47 183  THR n 
47 184  GLN n 
47 185  LEU n 
47 186  MET n 
47 187  GLN n 
47 188  LYS n 
47 189  GLU n 
47 190  GLN n 
47 191  ARG n 
47 192  ASN n 
47 193  TYR n 
47 194  GLN n 
47 195  PHE n 
47 196  ASP n 
47 197  PHE n 
47 198  LEU n 
47 199  ARG n 
47 200  PRO n 
47 201  GLN n 
47 202  HIS n 
47 203  SER n 
47 204  LEU n 
47 205  PHE n 
47 206  ASN n 
47 207  TYR n 
47 208  PHE n 
47 209  THR n 
47 210  LYS n 
47 211  LEU n 
47 212  VAL n 
47 213  GLU n 
47 214  GLN n 
47 215  TYR n 
47 216  THR n 
47 217  LYS n 
47 218  ILE n 
47 219  LEU n 
47 220  ILE n 
47 221  PRO n 
47 222  PRO n 
47 223  LYS n 
47 224  GLY n 
47 225  LEU n 
47 226  PHE n 
47 227  SER n 
47 228  LYS n 
47 229  LEU n 
47 230  LYS n 
47 231  LYS n 
47 232  GLU n 
47 233  ALA n 
47 234  GLU n 
47 235  ASN n 
47 236  PRO n 
47 237  ARG n 
47 238  GLU n 
47 239  VAL n 
47 240  LEU n 
47 241  ASP n 
47 242  GLN n 
47 243  VAL n 
47 244  CYS n 
47 245  TYR n 
47 246  ARG n 
47 247  VAL n 
47 248  GLU n 
47 249  TRP n 
47 250  ALA n 
47 251  LYS n 
47 252  PHE n 
47 253  GLN n 
47 254  GLU n 
47 255  ARG n 
47 256  GLU n 
47 257  ARG n 
47 258  LYS n 
47 259  LYS n 
47 260  GLU n 
47 261  GLU n 
47 262  GLU n 
47 263  GLU n 
47 264  LYS n 
47 265  GLU n 
47 266  LYS n 
47 267  GLU n 
47 268  ARG n 
47 269  VAL n 
47 270  ALA n 
47 271  TYR n 
47 272  ALA n 
47 273  GLN n 
47 274  ILE n 
47 275  ASP n 
47 276  TRP n 
47 277  HIS n 
47 278  ASP n 
47 279  PHE n 
47 280  VAL n 
47 281  VAL n 
47 282  VAL n 
47 283  GLU n 
47 284  THR n 
47 285  VAL n 
47 286  ASP n 
47 287  PHE n 
47 288  GLN n 
47 289  PRO n 
47 290  ASN n 
47 291  GLU n 
47 292  GLN n 
47 293  GLY n 
47 294  ASN n 
47 295  PHE n 
47 296  PRO n 
47 297  PRO n 
47 298  PRO n 
47 299  THR n 
47 300  THR n 
47 301  PRO n 
47 302  GLU n 
47 303  GLU n 
47 304  LEU n 
47 305  GLY n 
47 306  ALA n 
47 307  ARG n 
47 308  ILE n 
47 309  LEU n 
47 310  ILE n 
47 311  GLN n 
47 312  GLU n 
47 313  ARG n 
47 314  TYR n 
47 315  GLU n 
47 316  LYS n 
47 317  PHE n 
47 318  GLY n 
47 319  GLU n 
47 320  SER n 
47 321  GLU n 
47 322  GLU n 
47 323  VAL n 
47 324  GLU n 
47 325  MET n 
47 326  GLU n 
47 327  VAL n 
47 328  GLU n 
47 329  SER n 
47 330  ASP n 
47 331  GLU n 
47 332  GLU n 
47 333  ASP n 
47 334  ASP n 
47 335  LYS n 
47 336  GLN n 
47 337  GLU n 
47 338  LYS n 
47 339  ALA n 
47 340  GLU n 
47 341  GLU n 
47 342  PRO n 
47 343  PRO n 
47 344  SER n 
47 345  GLN n 
47 346  LEU n 
47 347  ASP n 
47 348  GLN n 
47 349  ASP n 
47 350  THR n 
47 351  GLN n 
47 352  VAL n 
47 353  GLN n 
47 354  ASP n 
47 355  MET n 
47 356  ASP n 
47 357  GLU n 
47 358  GLY n 
47 359  SER n 
47 360  ASP n 
47 361  ASP n 
47 362  GLU n 
47 363  GLU n 
47 364  GLU n 
47 365  GLY n 
47 366  GLN n 
47 367  LYS n 
47 368  VAL n 
47 369  PRO n 
47 370  PRO n 
47 371  PRO n 
47 372  PRO n 
47 373  GLU n 
47 374  THR n 
47 375  PRO n 
47 376  MET n 
47 377  PRO n 
47 378  PRO n 
47 379  PRO n 
47 380  LEU n 
47 381  PRO n 
47 382  PRO n 
47 383  THR n 
47 384  PRO n 
47 385  ASP n 
47 386  GLN n 
47 387  VAL n 
47 388  ILE n 
47 389  VAL n 
47 390  ARG n 
47 391  LYS n 
47 392  ASP n 
47 393  TYR n 
47 394  ASP n 
47 395  PRO n 
47 396  LYS n 
47 397  ALA n 
47 398  SER n 
47 399  LYS n 
47 400  PRO n 
47 401  LEU n 
47 402  PRO n 
47 403  PRO n 
47 404  ALA n 
47 405  PRO n 
47 406  ALA n 
47 407  PRO n 
47 408  ASP n 
47 409  GLU n 
47 410  TYR n 
47 411  LEU n 
47 412  VAL n 
47 413  SER n 
47 414  PRO n 
47 415  ILE n 
47 416  THR n 
47 417  GLY n 
47 418  GLU n 
47 419  LYS n 
47 420  ILE n 
47 421  PRO n 
47 422  ALA n 
47 423  SER n 
47 424  LYS n 
47 425  MET n 
47 426  GLN n 
47 427  GLU n 
47 428  HIS n 
47 429  MET n 
47 430  ARG n 
47 431  ILE n 
47 432  GLY n 
47 433  LEU n 
47 434  LEU n 
47 435  ASP n 
47 436  PRO n 
47 437  ARG n 
47 438  TRP n 
47 439  LEU n 
47 440  GLU n 
47 441  GLN n 
47 442  ARG n 
47 443  ASP n 
47 444  ARG n 
47 445  SER n 
47 446  ILE n 
47 447  ARG n 
47 448  GLU n 
47 449  LYS n 
47 450  GLN n 
47 451  SER n 
47 452  ASP n 
47 453  ASP n 
47 454  GLU n 
47 455  VAL n 
47 456  TYR n 
47 457  ALA n 
47 458  PRO n 
47 459  GLY n 
47 460  LEU n 
47 461  ASP n 
47 462  ILE n 
47 463  GLU n 
47 464  SER n 
47 465  SER n 
47 466  LEU n 
47 467  LYS n 
47 468  GLN n 
47 469  LEU n 
47 470  ALA n 
47 471  GLU n 
47 472  ARG n 
47 473  ARG n 
47 474  THR n 
47 475  ASP n 
47 476  ILE n 
47 477  PHE n 
47 478  GLY n 
47 479  VAL n 
47 480  GLU n 
47 481  GLU n 
47 482  THR n 
47 483  ALA n 
47 484  ILE n 
47 485  GLY n 
47 486  LYS n 
47 487  LYS n 
47 488  ILE n 
47 489  GLY n 
47 490  GLU n 
47 491  GLU n 
47 492  GLU n 
47 493  ILE n 
47 494  GLN n 
47 495  LYS n 
47 496  PRO n 
47 497  GLU n 
47 498  GLU n 
47 499  LYS n 
47 500  VAL n 
47 501  THR n 
47 502  TRP n 
47 503  ASP n 
47 504  GLY n 
47 505  HIS n 
47 506  SER n 
47 507  GLY n 
47 508  SER n 
47 509  MET n 
47 510  ALA n 
47 511  ARG n 
47 512  THR n 
47 513  GLN n 
47 514  GLN n 
47 515  ALA n 
47 516  ALA n 
47 517  GLN n 
47 518  ALA n 
47 519  ASN n 
47 520  ILE n 
47 521  THR n 
47 522  LEU n 
47 523  GLN n 
47 524  GLU n 
47 525  GLN n 
47 526  ILE n 
47 527  GLU n 
47 528  ALA n 
47 529  ILE n 
47 530  HIS n 
47 531  LYS n 
47 532  ALA n 
47 533  LYS n 
47 534  GLY n 
47 535  LEU n 
47 536  VAL n 
47 537  PRO n 
47 538  GLU n 
47 539  ASP n 
47 540  ASP n 
47 541  THR n 
47 542  LYS n 
47 543  GLU n 
47 544  LYS n 
47 545  ILE n 
47 546  GLY n 
47 547  PRO n 
47 548  SER n 
47 549  LYS n 
47 550  PRO n 
47 551  ASN n 
47 552  GLU n 
47 553  ILE n 
47 554  PRO n 
47 555  GLN n 
47 556  GLN n 
47 557  PRO n 
47 558  PRO n 
47 559  PRO n 
47 560  PRO n 
47 561  SER n 
47 562  SER n 
47 563  ALA n 
47 564  THR n 
47 565  ASN n 
47 566  ILE n 
47 567  PRO n 
47 568  SER n 
47 569  SER n 
47 570  ALA n 
47 571  PRO n 
47 572  PRO n 
47 573  ILE n 
47 574  THR n 
47 575  SER n 
47 576  VAL n 
47 577  PRO n 
47 578  ARG n 
47 579  PRO n 
47 580  PRO n 
47 581  THR n 
47 582  MET n 
47 583  PRO n 
47 584  PRO n 
47 585  PRO n 
47 586  VAL n 
47 587  ARG n 
47 588  THR n 
47 589  THR n 
47 590  VAL n 
47 591  VAL n 
47 592  SER n 
47 593  ALA n 
47 594  VAL n 
47 595  PRO n 
47 596  VAL n 
47 597  MET n 
47 598  PRO n 
47 599  ARG n 
47 600  PRO n 
47 601  PRO n 
47 602  MET n 
47 603  ALA n 
47 604  SER n 
47 605  VAL n 
47 606  VAL n 
47 607  ARG n 
47 608  LEU n 
47 609  PRO n 
47 610  PRO n 
47 611  GLY n 
47 612  SER n 
47 613  VAL n 
47 614  ILE n 
47 615  ALA n 
47 616  PRO n 
47 617  MET n 
47 618  PRO n 
47 619  PRO n 
47 620  ILE n 
47 621  ILE n 
47 622  HIS n 
47 623  ALA n 
47 624  PRO n 
47 625  ARG n 
47 626  ILE n 
47 627  ASN n 
47 628  VAL n 
47 629  VAL n 
47 630  PRO n 
47 631  MET n 
47 632  PRO n 
47 633  PRO n 
47 634  SER n 
47 635  ALA n 
47 636  PRO n 
47 637  PRO n 
47 638  ILE n 
47 639  MET n 
47 640  ALA n 
47 641  PRO n 
47 642  ARG n 
47 643  PRO n 
47 644  PRO n 
47 645  PRO n 
47 646  MET n 
47 647  ILE n 
47 648  VAL n 
47 649  PRO n 
47 650  THR n 
47 651  ALA n 
47 652  PHE n 
47 653  VAL n 
47 654  PRO n 
47 655  ALA n 
47 656  PRO n 
47 657  PRO n 
47 658  VAL n 
47 659  ALA n 
47 660  PRO n 
47 661  VAL n 
47 662  PRO n 
47 663  ALA n 
47 664  PRO n 
47 665  ALA n 
47 666  PRO n 
47 667  MET n 
47 668  PRO n 
47 669  PRO n 
47 670  VAL n 
47 671  HIS n 
47 672  PRO n 
47 673  PRO n 
47 674  PRO n 
47 675  PRO n 
47 676  MET n 
47 677  GLU n 
47 678  ASP n 
47 679  GLU n 
47 680  PRO n 
47 681  THR n 
47 682  SER n 
47 683  LYS n 
47 684  LYS n 
47 685  LEU n 
47 686  LYS n 
47 687  THR n 
47 688  GLU n 
47 689  ASP n 
47 690  SER n 
47 691  LEU n 
47 692  MET n 
47 693  PRO n 
47 694  GLU n 
47 695  GLU n 
47 696  GLU n 
47 697  PHE n 
47 698  LEU n 
47 699  ARG n 
47 700  ARG n 
47 701  ASN n 
47 702  LYS n 
47 703  GLY n 
47 704  PRO n 
47 705  VAL n 
47 706  SER n 
47 707  ILE n 
47 708  LYS n 
47 709  VAL n 
47 710  GLN n 
47 711  VAL n 
47 712  PRO n 
47 713  ASN n 
47 714  MET n 
47 715  GLN n 
47 716  ASP n 
47 717  LYS n 
47 718  THR n 
47 719  GLU n 
47 720  TRP n 
47 721  LYS n 
47 722  LEU n 
47 723  ASN n 
47 724  GLY n 
47 725  GLN n 
47 726  VAL n 
47 727  LEU n 
47 728  VAL n 
47 729  PHE n 
47 730  THR n 
47 731  LEU n 
47 732  PRO n 
47 733  LEU n 
47 734  THR n 
47 735  ASP n 
47 736  GLN n 
47 737  VAL n 
47 738  SER n 
47 739  VAL n 
47 740  ILE n 
47 741  LYS n 
47 742  VAL n 
47 743  LYS n 
47 744  ILE n 
47 745  HIS n 
47 746  GLU n 
47 747  ALA n 
47 748  THR n 
47 749  GLY n 
47 750  MET n 
47 751  PRO n 
47 752  ALA n 
47 753  GLY n 
47 754  LYS n 
47 755  GLN n 
47 756  LYS n 
47 757  LEU n 
47 758  GLN n 
47 759  TYR n 
47 760  GLU n 
47 761  GLY n 
47 762  ILE n 
47 763  PHE n 
47 764  ILE n 
47 765  LYS n 
47 766  ASP n 
47 767  SER n 
47 768  ASN n 
47 769  SER n 
47 770  LEU n 
47 771  ALA n 
47 772  TYR n 
47 773  TYR n 
47 774  ASN n 
47 775  MET n 
47 776  ALA n 
47 777  ASN n 
47 778  GLY n 
47 779  ALA n 
47 780  VAL n 
47 781  ILE n 
47 782  HIS n 
47 783  LEU n 
47 784  ALA n 
47 785  LEU n 
47 786  LYS n 
47 787  GLU n 
47 788  ARG n 
47 789  GLY n 
47 790  GLY n 
47 791  ARG n 
47 792  LYS n 
47 793  LYS n 
48 1    MET n 
48 2    ALA n 
48 3    THR n 
48 4    PRO n 
48 5    ALA n 
48 6    GLY n 
48 7    LEU n 
48 8    GLU n 
48 9    ARG n 
48 10   TRP n 
48 11   VAL n 
48 12   GLN n 
48 13   ASP n 
48 14   GLU n 
48 15   LEU n 
48 16   HIS n 
48 17   SER n 
48 18   VAL n 
48 19   LEU n 
48 20   GLY n 
48 21   LEU n 
48 22   SER n 
48 23   GLU n 
48 24   ARG n 
48 25   HIS n 
48 26   VAL n 
48 27   ALA n 
48 28   GLN n 
48 29   PHE n 
48 30   LEU n 
48 31   ILE n 
48 32   GLY n 
48 33   THR n 
48 34   ALA n 
48 35   GLN n 
48 36   ARG n 
48 37   CYS n 
48 38   THR n 
48 39   SER n 
48 40   ALA n 
48 41   GLU n 
48 42   GLU n 
48 43   PHE n 
48 44   VAL n 
48 45   GLN n 
48 46   ARG n 
48 47   LEU n 
48 48   ARG n 
48 49   ASP n 
48 50   THR n 
48 51   ASP n 
48 52   THR n 
48 53   LEU n 
48 54   ASP n 
48 55   LEU n 
48 56   SER n 
48 57   GLY n 
48 58   PRO n 
48 59   ALA n 
48 60   ARG n 
48 61   ASP n 
48 62   PHE n 
48 63   ALA n 
48 64   LEU n 
48 65   ARG n 
48 66   LEU n 
48 67   TRP n 
48 68   ASN n 
48 69   LYS n 
48 70   VAL n 
48 71   PRO n 
48 72   ARG n 
48 73   LYS n 
48 74   ALA n 
48 75   VAL n 
48 76   VAL n 
48 77   GLU n 
48 78   LYS n 
48 79   PRO n 
48 80   ALA n 
48 81   ARG n 
48 82   ALA n 
48 83   ALA n 
48 84   GLU n 
48 85   ARG n 
48 86   GLU n 
48 87   ALA n 
48 88   ARG n 
48 89   ALA n 
48 90   LEU n 
48 91   LEU n 
48 92   GLU n 
48 93   LYS n 
48 94   ASN n 
48 95   ARG n 
48 96   SER n 
48 97   TYR n 
48 98   ARG n 
48 99   LEU n 
48 100  LEU n 
48 101  GLU n 
48 102  ASP n 
48 103  SER n 
48 104  GLU n 
48 105  GLU n 
48 106  SER n 
48 107  SER n 
48 108  GLU n 
48 109  GLU n 
48 110  THR n 
48 111  VAL n 
48 112  SER n 
48 113  ARG n 
48 114  ALA n 
48 115  GLY n 
48 116  SER n 
48 117  SER n 
48 118  LEU n 
48 119  GLN n 
48 120  LYS n 
48 121  LYS n 
48 122  ARG n 
48 123  LYS n 
48 124  LYS n 
48 125  ARG n 
48 126  LYS n 
48 127  HIS n 
48 128  LEU n 
48 129  ARG n 
48 130  LYS n 
48 131  LYS n 
48 132  ARG n 
48 133  GLU n 
48 134  GLU n 
48 135  GLU n 
48 136  GLU n 
48 137  GLU n 
48 138  GLU n 
48 139  GLU n 
48 140  ALA n 
48 141  SER n 
48 142  GLU n 
48 143  LYS n 
48 144  GLY n 
48 145  LYS n 
48 146  LYS n 
48 147  LYS n 
48 148  THR n 
48 149  GLY n 
48 150  GLY n 
48 151  SER n 
48 152  LYS n 
48 153  GLN n 
48 154  GLN n 
48 155  THR n 
48 156  GLU n 
48 157  LYS n 
48 158  PRO n 
48 159  GLU n 
48 160  SER n 
48 161  GLU n 
48 162  ASP n 
48 163  GLU n 
48 164  TRP n 
48 165  GLU n 
48 166  ARG n 
48 167  THR n 
48 168  GLU n 
48 169  ARG n 
48 170  GLU n 
48 171  ARG n 
48 172  LEU n 
48 173  GLN n 
48 174  ASP n 
48 175  LEU n 
48 176  GLU n 
48 177  GLU n 
48 178  ARG n 
48 179  ASP n 
48 180  ALA n 
48 181  PHE n 
48 182  ALA n 
48 183  GLU n 
48 184  ARG n 
48 185  VAL n 
48 186  ARG n 
48 187  GLN n 
48 188  ARG n 
48 189  ASP n 
48 190  LYS n 
48 191  ASP n 
48 192  ARG n 
48 193  THR n 
48 194  ARG n 
48 195  ASN n 
48 196  VAL n 
48 197  LEU n 
48 198  GLU n 
48 199  ARG n 
48 200  SER n 
48 201  ASP n 
48 202  LYS n 
48 203  LYS n 
48 204  ALA n 
48 205  TYR n 
48 206  GLU n 
48 207  GLU n 
48 208  ALA n 
48 209  GLN n 
48 210  LYS n 
48 211  ARG n 
48 212  LEU n 
48 213  LYS n 
48 214  MET n 
48 215  ALA n 
48 216  GLU n 
48 217  GLU n 
48 218  ASP n 
48 219  ARG n 
48 220  LYS n 
48 221  ALA n 
48 222  MET n 
48 223  VAL n 
48 224  PRO n 
48 225  GLU n 
48 226  LEU n 
48 227  ARG n 
48 228  LYS n 
48 229  LYS n 
48 230  SER n 
48 231  ARG n 
48 232  ARG n 
48 233  GLU n 
48 234  TYR n 
48 235  LEU n 
48 236  ALA n 
48 237  LYS n 
48 238  ARG n 
48 239  GLU n 
48 240  ARG n 
48 241  GLU n 
48 242  LYS n 
48 243  LEU n 
48 244  GLU n 
48 245  ASP n 
48 246  LEU n 
48 247  GLU n 
48 248  ALA n 
48 249  GLU n 
48 250  LEU n 
48 251  ALA n 
48 252  ASP n 
48 253  GLU n 
48 254  GLU n 
48 255  PHE n 
48 256  LEU n 
48 257  PHE n 
48 258  GLY n 
48 259  ASP n 
48 260  VAL n 
48 261  GLU n 
48 262  LEU n 
48 263  SER n 
48 264  ARG n 
48 265  HIS n 
48 266  GLU n 
48 267  ARG n 
48 268  GLN n 
48 269  GLU n 
48 270  LEU n 
48 271  LYS n 
48 272  TYR n 
48 273  LYS n 
48 274  ARG n 
48 275  ARG n 
48 276  VAL n 
48 277  ARG n 
48 278  ASP n 
48 279  LEU n 
48 280  ALA n 
48 281  ARG n 
48 282  GLU n 
48 283  TYR n 
48 284  ARG n 
48 285  ALA n 
48 286  ALA n 
48 287  GLY n 
48 288  GLU n 
48 289  GLN n 
48 290  GLU n 
48 291  LYS n 
48 292  LEU n 
48 293  GLU n 
48 294  ALA n 
48 295  THR n 
48 296  ASN n 
48 297  ARG n 
48 298  TYR n 
48 299  HIS n 
48 300  MET n 
48 301  PRO n 
48 302  LYS n 
48 303  GLU n 
48 304  THR n 
48 305  ARG n 
48 306  GLY n 
48 307  GLN n 
48 308  PRO n 
48 309  ALA n 
48 310  ARG n 
48 311  ALA n 
48 312  VAL n 
48 313  ASP n 
48 314  LEU n 
48 315  VAL n 
48 316  GLU n 
48 317  GLU n 
48 318  GLU n 
48 319  SER n 
48 320  GLY n 
48 321  ALA n 
48 322  PRO n 
48 323  GLY n 
48 324  GLU n 
48 325  GLU n 
48 326  GLN n 
48 327  ARG n 
48 328  ARG n 
48 329  TRP n 
48 330  GLU n 
48 331  GLU n 
48 332  ALA n 
48 333  ARG n 
48 334  LEU n 
48 335  GLY n 
48 336  ALA n 
48 337  ALA n 
48 338  SER n 
48 339  LEU n 
48 340  LYS n 
48 341  PHE n 
48 342  GLY n 
48 343  ALA n 
48 344  ARG n 
48 345  ASP n 
48 346  ALA n 
48 347  ALA n 
48 348  SER n 
48 349  GLN n 
48 350  GLU n 
48 351  PRO n 
48 352  LYS n 
48 353  TYR n 
48 354  GLN n 
48 355  LEU n 
48 356  VAL n 
48 357  LEU n 
48 358  GLU n 
48 359  GLU n 
48 360  GLU n 
48 361  GLU n 
48 362  THR n 
48 363  ILE n 
48 364  GLU n 
48 365  PHE n 
48 366  VAL n 
48 367  ARG n 
48 368  ALA n 
48 369  THR n 
48 370  GLN n 
48 371  LEU n 
48 372  GLN n 
48 373  GLY n 
48 374  ASP n 
48 375  GLU n 
48 376  GLU n 
48 377  PRO n 
48 378  SER n 
48 379  ALA n 
48 380  PRO n 
48 381  PRO n 
48 382  THR n 
48 383  SER n 
48 384  THR n 
48 385  GLN n 
48 386  ALA n 
48 387  GLN n 
48 388  GLN n 
48 389  LYS n 
48 390  GLU n 
48 391  SER n 
48 392  ILE n 
48 393  GLN n 
48 394  ALA n 
48 395  VAL n 
48 396  ARG n 
48 397  ARG n 
48 398  SER n 
48 399  LEU n 
48 400  PRO n 
48 401  VAL n 
48 402  PHE n 
48 403  PRO n 
48 404  PHE n 
48 405  ARG n 
48 406  GLU n 
48 407  GLU n 
48 408  LEU n 
48 409  LEU n 
48 410  ALA n 
48 411  ALA n 
48 412  ILE n 
48 413  ALA n 
48 414  ASN n 
48 415  HIS n 
48 416  GLN n 
48 417  VAL n 
48 418  LEU n 
48 419  ILE n 
48 420  ILE n 
48 421  GLU n 
48 422  GLY n 
48 423  GLU n 
48 424  THR n 
48 425  GLY n 
48 426  SER n 
48 427  GLY n 
48 428  LYS n 
48 429  THR n 
48 430  THR n 
48 431  GLN n 
48 432  ILE n 
48 433  PRO n 
48 434  GLN n 
48 435  TYR n 
48 436  LEU n 
48 437  PHE n 
48 438  GLU n 
48 439  GLU n 
48 440  GLY n 
48 441  TYR n 
48 442  THR n 
48 443  ASN n 
48 444  LYS n 
48 445  GLY n 
48 446  MET n 
48 447  LYS n 
48 448  ILE n 
48 449  ALA n 
48 450  CYS n 
48 451  THR n 
48 452  GLN n 
48 453  PRO n 
48 454  ARG n 
48 455  ARG n 
48 456  VAL n 
48 457  ALA n 
48 458  ALA n 
48 459  MET n 
48 460  SER n 
48 461  VAL n 
48 462  ALA n 
48 463  ALA n 
48 464  ARG n 
48 465  VAL n 
48 466  ALA n 
48 467  ARG n 
48 468  GLU n 
48 469  MET n 
48 470  GLY n 
48 471  VAL n 
48 472  LYS n 
48 473  LEU n 
48 474  GLY n 
48 475  ASN n 
48 476  GLU n 
48 477  VAL n 
48 478  GLY n 
48 479  TYR n 
48 480  SER n 
48 481  ILE n 
48 482  ARG n 
48 483  PHE n 
48 484  GLU n 
48 485  ASP n 
48 486  CYS n 
48 487  THR n 
48 488  SER n 
48 489  GLU n 
48 490  ARG n 
48 491  THR n 
48 492  VAL n 
48 493  LEU n 
48 494  ARG n 
48 495  TYR n 
48 496  MET n 
48 497  THR n 
48 498  ASP n 
48 499  GLY n 
48 500  MET n 
48 501  LEU n 
48 502  LEU n 
48 503  ARG n 
48 504  GLU n 
48 505  PHE n 
48 506  LEU n 
48 507  SER n 
48 508  GLU n 
48 509  PRO n 
48 510  ASP n 
48 511  LEU n 
48 512  ALA n 
48 513  SER n 
48 514  TYR n 
48 515  SER n 
48 516  VAL n 
48 517  VAL n 
48 518  MET n 
48 519  VAL n 
48 520  ASP n 
48 521  GLU n 
48 522  ALA n 
48 523  HIS n 
48 524  GLU n 
48 525  ARG n 
48 526  THR n 
48 527  LEU n 
48 528  HIS n 
48 529  THR n 
48 530  ASP n 
48 531  ILE n 
48 532  LEU n 
48 533  PHE n 
48 534  GLY n 
48 535  LEU n 
48 536  ILE n 
48 537  LYS n 
48 538  ASP n 
48 539  VAL n 
48 540  ALA n 
48 541  ARG n 
48 542  PHE n 
48 543  ARG n 
48 544  PRO n 
48 545  GLU n 
48 546  LEU n 
48 547  LYS n 
48 548  VAL n 
48 549  LEU n 
48 550  VAL n 
48 551  ALA n 
48 552  SER n 
48 553  ALA n 
48 554  THR n 
48 555  MET n 
48 556  ASP n 
48 557  THR n 
48 558  ALA n 
48 559  ARG n 
48 560  PHE n 
48 561  SER n 
48 562  THR n 
48 563  PHE n 
48 564  PHE n 
48 565  ASP n 
48 566  ASP n 
48 567  ALA n 
48 568  PRO n 
48 569  VAL n 
48 570  PHE n 
48 571  ARG n 
48 572  ILE n 
48 573  PRO n 
48 574  GLY n 
48 575  ARG n 
48 576  ARG n 
48 577  PHE n 
48 578  PRO n 
48 579  VAL n 
48 580  ASP n 
48 581  ILE n 
48 582  PHE n 
48 583  TYR n 
48 584  THR n 
48 585  LYS n 
48 586  ALA n 
48 587  PRO n 
48 588  GLU n 
48 589  ALA n 
48 590  ASP n 
48 591  TYR n 
48 592  LEU n 
48 593  GLU n 
48 594  ALA n 
48 595  CYS n 
48 596  VAL n 
48 597  VAL n 
48 598  SER n 
48 599  VAL n 
48 600  LEU n 
48 601  GLN n 
48 602  ILE n 
48 603  HIS n 
48 604  VAL n 
48 605  THR n 
48 606  GLN n 
48 607  PRO n 
48 608  PRO n 
48 609  GLY n 
48 610  ASP n 
48 611  ILE n 
48 612  LEU n 
48 613  VAL n 
48 614  PHE n 
48 615  LEU n 
48 616  THR n 
48 617  GLY n 
48 618  GLN n 
48 619  GLU n 
48 620  GLU n 
48 621  ILE n 
48 622  GLU n 
48 623  ALA n 
48 624  ALA n 
48 625  CYS n 
48 626  GLU n 
48 627  MET n 
48 628  LEU n 
48 629  GLN n 
48 630  ASP n 
48 631  ARG n 
48 632  CYS n 
48 633  ARG n 
48 634  ARG n 
48 635  LEU n 
48 636  GLY n 
48 637  SER n 
48 638  LYS n 
48 639  ILE n 
48 640  ARG n 
48 641  GLU n 
48 642  LEU n 
48 643  LEU n 
48 644  VAL n 
48 645  LEU n 
48 646  PRO n 
48 647  ILE n 
48 648  TYR n 
48 649  ALA n 
48 650  ASN n 
48 651  LEU n 
48 652  PRO n 
48 653  SER n 
48 654  ASP n 
48 655  MET n 
48 656  GLN n 
48 657  ALA n 
48 658  ARG n 
48 659  ILE n 
48 660  PHE n 
48 661  GLN n 
48 662  PRO n 
48 663  THR n 
48 664  PRO n 
48 665  PRO n 
48 666  GLY n 
48 667  ALA n 
48 668  ARG n 
48 669  LYS n 
48 670  VAL n 
48 671  VAL n 
48 672  VAL n 
48 673  ALA n 
48 674  THR n 
48 675  ASN n 
48 676  ILE n 
48 677  ALA n 
48 678  GLU n 
48 679  THR n 
48 680  SER n 
48 681  LEU n 
48 682  THR n 
48 683  ILE n 
48 684  GLU n 
48 685  GLY n 
48 686  ILE n 
48 687  ILE n 
48 688  TYR n 
48 689  VAL n 
48 690  LEU n 
48 691  ASP n 
48 692  PRO n 
48 693  GLY n 
48 694  PHE n 
48 695  CYS n 
48 696  LYS n 
48 697  GLN n 
48 698  LYS n 
48 699  SER n 
48 700  TYR n 
48 701  ASN n 
48 702  PRO n 
48 703  ARG n 
48 704  THR n 
48 705  GLY n 
48 706  MET n 
48 707  GLU n 
48 708  SER n 
48 709  LEU n 
48 710  THR n 
48 711  VAL n 
48 712  THR n 
48 713  PRO n 
48 714  CYS n 
48 715  SER n 
48 716  LYS n 
48 717  ALA n 
48 718  SER n 
48 719  ALA n 
48 720  ASN n 
48 721  GLN n 
48 722  ARG n 
48 723  ALA n 
48 724  GLY n 
48 725  ARG n 
48 726  ALA n 
48 727  GLY n 
48 728  ARG n 
48 729  VAL n 
48 730  ALA n 
48 731  ALA n 
48 732  GLY n 
48 733  LYS n 
48 734  CYS n 
48 735  PHE n 
48 736  ARG n 
48 737  LEU n 
48 738  TYR n 
48 739  THR n 
48 740  ALA n 
48 741  TRP n 
48 742  ALA n 
48 743  TYR n 
48 744  GLN n 
48 745  HIS n 
48 746  GLU n 
48 747  LEU n 
48 748  GLU n 
48 749  GLU n 
48 750  THR n 
48 751  THR n 
48 752  VAL n 
48 753  PRO n 
48 754  GLU n 
48 755  ILE n 
48 756  GLN n 
48 757  ARG n 
48 758  THR n 
48 759  SER n 
48 760  LEU n 
48 761  GLY n 
48 762  ASN n 
48 763  VAL n 
48 764  VAL n 
48 765  LEU n 
48 766  LEU n 
48 767  LEU n 
48 768  LYS n 
48 769  SER n 
48 770  LEU n 
48 771  GLY n 
48 772  ILE n 
48 773  HIS n 
48 774  ASP n 
48 775  LEU n 
48 776  MET n 
48 777  HIS n 
48 778  PHE n 
48 779  ASP n 
48 780  PHE n 
48 781  LEU n 
48 782  ASP n 
48 783  PRO n 
48 784  PRO n 
48 785  PRO n 
48 786  TYR n 
48 787  GLU n 
48 788  THR n 
48 789  LEU n 
48 790  LEU n 
48 791  LEU n 
48 792  ALA n 
48 793  LEU n 
48 794  GLU n 
48 795  GLN n 
48 796  LEU n 
48 797  TYR n 
48 798  ALA n 
48 799  LEU n 
48 800  GLY n 
48 801  ALA n 
48 802  LEU n 
48 803  ASN n 
48 804  HIS n 
48 805  LEU n 
48 806  GLY n 
48 807  GLU n 
48 808  LEU n 
48 809  THR n 
48 810  THR n 
48 811  SER n 
48 812  GLY n 
48 813  ARG n 
48 814  LYS n 
48 815  MET n 
48 816  ALA n 
48 817  GLU n 
48 818  LEU n 
48 819  PRO n 
48 820  VAL n 
48 821  ASP n 
48 822  PRO n 
48 823  MET n 
48 824  LEU n 
48 825  SER n 
48 826  LYS n 
48 827  MET n 
48 828  ILE n 
48 829  LEU n 
48 830  ALA n 
48 831  SER n 
48 832  GLU n 
48 833  LYS n 
48 834  TYR n 
48 835  SER n 
48 836  CYS n 
48 837  SER n 
48 838  GLU n 
48 839  GLU n 
48 840  ILE n 
48 841  LEU n 
48 842  THR n 
48 843  VAL n 
48 844  ALA n 
48 845  ALA n 
48 846  MET n 
48 847  LEU n 
48 848  SER n 
48 849  VAL n 
48 850  ASN n 
48 851  ASN n 
48 852  SER n 
48 853  ILE n 
48 854  PHE n 
48 855  TYR n 
48 856  ARG n 
48 857  PRO n 
48 858  LYS n 
48 859  ASP n 
48 860  LYS n 
48 861  VAL n 
48 862  VAL n 
48 863  HIS n 
48 864  ALA n 
48 865  ASP n 
48 866  ASN n 
48 867  ALA n 
48 868  ARG n 
48 869  VAL n 
48 870  ASN n 
48 871  PHE n 
48 872  PHE n 
48 873  LEU n 
48 874  PRO n 
48 875  GLY n 
48 876  GLY n 
48 877  ASP n 
48 878  HIS n 
48 879  LEU n 
48 880  VAL n 
48 881  LEU n 
48 882  LEU n 
48 883  ASN n 
48 884  VAL n 
48 885  TYR n 
48 886  THR n 
48 887  GLN n 
48 888  TRP n 
48 889  ALA n 
48 890  GLU n 
48 891  SER n 
48 892  GLY n 
48 893  TYR n 
48 894  SER n 
48 895  SER n 
48 896  GLN n 
48 897  TRP n 
48 898  CYS n 
48 899  TYR n 
48 900  GLU n 
48 901  ASN n 
48 902  PHE n 
48 903  VAL n 
48 904  GLN n 
48 905  PHE n 
48 906  ARG n 
48 907  SER n 
48 908  MET n 
48 909  ARG n 
48 910  ARG n 
48 911  ALA n 
48 912  ARG n 
48 913  ASP n 
48 914  VAL n 
48 915  ARG n 
48 916  GLU n 
48 917  GLN n 
48 918  LEU n 
48 919  GLU n 
48 920  GLY n 
48 921  LEU n 
48 922  LEU n 
48 923  GLU n 
48 924  ARG n 
48 925  VAL n 
48 926  GLU n 
48 927  VAL n 
48 928  GLY n 
48 929  LEU n 
48 930  SER n 
48 931  SER n 
48 932  CYS n 
48 933  GLN n 
48 934  GLY n 
48 935  ASP n 
48 936  TYR n 
48 937  ILE n 
48 938  ARG n 
48 939  VAL n 
48 940  ARG n 
48 941  LYS n 
48 942  ALA n 
48 943  ILE n 
48 944  THR n 
48 945  ALA n 
48 946  GLY n 
48 947  TYR n 
48 948  PHE n 
48 949  TYR n 
48 950  HIS n 
48 951  THR n 
48 952  ALA n 
48 953  ARG n 
48 954  LEU n 
48 955  THR n 
48 956  ARG n 
48 957  SER n 
48 958  GLY n 
48 959  TYR n 
48 960  ARG n 
48 961  THR n 
48 962  VAL n 
48 963  LYS n 
48 964  GLN n 
48 965  GLN n 
48 966  GLN n 
48 967  THR n 
48 968  VAL n 
48 969  PHE n 
48 970  ILE n 
48 971  HIS n 
48 972  PRO n 
48 973  ASN n 
48 974  SER n 
48 975  SER n 
48 976  LEU n 
48 977  PHE n 
48 978  GLU n 
48 979  GLN n 
48 980  GLN n 
48 981  PRO n 
48 982  ARG n 
48 983  TRP n 
48 984  LEU n 
48 985  LEU n 
48 986  TYR n 
48 987  HIS n 
48 988  GLU n 
48 989  LEU n 
48 990  VAL n 
48 991  LEU n 
48 992  THR n 
48 993  THR n 
48 994  LYS n 
48 995  GLU n 
48 996  PHE n 
48 997  MET n 
48 998  ARG n 
48 999  GLN n 
48 1000 VAL n 
48 1001 LEU n 
48 1002 GLU n 
48 1003 ILE n 
48 1004 GLU n 
48 1005 SER n 
48 1006 SER n 
48 1007 TRP n 
48 1008 LEU n 
48 1009 LEU n 
48 1010 GLU n 
48 1011 VAL n 
48 1012 ALA n 
48 1013 PRO n 
48 1014 HIS n 
48 1015 TYR n 
48 1016 TYR n 
48 1017 LYS n 
48 1018 ALA n 
48 1019 LYS n 
48 1020 GLU n 
48 1021 LEU n 
48 1022 GLU n 
48 1023 ASP n 
48 1024 PRO n 
48 1025 HIS n 
48 1026 ALA n 
48 1027 LYS n 
48 1028 LYS n 
48 1029 MET n 
48 1030 PRO n 
48 1031 LYS n 
48 1032 LYS n 
48 1033 ILE n 
48 1034 GLY n 
48 1035 LYS n 
48 1036 THR n 
48 1037 ARG n 
48 1038 GLU n 
48 1039 GLU n 
48 1040 LEU n 
48 1041 GLY n 
49 1    MET n 
49 2    ALA n 
49 3    ASP n 
49 4    VAL n 
49 5    THR n 
49 6    ALA n 
49 7    ARG n 
49 8    SER n 
49 9    LEU n 
49 10   GLN n 
49 11   TYR n 
49 12   GLU n 
49 13   TYR n 
49 14   LYS n 
49 15   ALA n 
49 16   ASN n 
49 17   SER n 
49 18   ASN n 
49 19   LEU n 
49 20   VAL n 
49 21   LEU n 
49 22   GLN n 
49 23   ALA n 
49 24   ASP n 
49 25   ARG n 
49 26   SER n 
49 27   LEU n 
49 28   ILE n 
49 29   ASP n 
49 30   ARG n 
49 31   THR n 
49 32   ARG n 
49 33   ARG n 
49 34   ASP n 
49 35   GLU n 
49 36   PRO n 
49 37   THR n 
49 38   GLY n 
49 39   GLU n 
49 40   VAL n 
49 41   LEU n 
49 42   SER n 
49 43   LEU n 
49 44   VAL n 
49 45   GLY n 
49 46   LYS n 
49 47   LEU n 
49 48   GLU n 
49 49   GLY n 
49 50   THR n 
49 51   ARG n 
49 52   MET n 
49 53   GLY n 
49 54   ASP n 
49 55   LYS n 
49 56   ALA n 
49 57   GLN n 
49 58   ARG n 
49 59   THR n 
49 60   LYS n 
49 61   PRO n 
49 62   GLN n 
49 63   MET n 
49 64   GLN n 
49 65   GLU n 
49 66   GLU n 
49 67   ARG n 
49 68   ARG n 
49 69   ALA n 
49 70   LYS n 
49 71   ARG n 
49 72   ARG n 
49 73   LYS n 
49 74   ARG n 
49 75   ASP n 
49 76   GLU n 
49 77   ASP n 
49 78   ARG n 
49 79   HIS n 
49 80   ASP n 
49 81   ILE n 
49 82   ASN n 
49 83   LYS n 
49 84   MET n 
49 85   LYS n 
49 86   GLY n 
49 87   TYR n 
49 88   THR n 
49 89   LEU n 
49 90   LEU n 
49 91   SER n 
49 92   GLU n 
49 93   GLY n 
49 94   ILE n 
49 95   ASP n 
49 96   GLU n 
49 97   MET n 
49 98   VAL n 
49 99   GLY n 
49 100  ILE n 
49 101  ILE n 
49 102  TYR n 
49 103  LYS n 
49 104  PRO n 
49 105  LYS n 
49 106  THR n 
49 107  LYS n 
49 108  GLU n 
49 109  THR n 
49 110  ARG n 
49 111  GLU n 
49 112  THR n 
49 113  TYR n 
49 114  GLU n 
49 115  VAL n 
49 116  LEU n 
49 117  LEU n 
49 118  SER n 
49 119  PHE n 
49 120  ILE n 
49 121  GLN n 
49 122  ALA n 
49 123  ALA n 
49 124  LEU n 
49 125  GLY n 
49 126  ASP n 
49 127  GLN n 
49 128  PRO n 
49 129  ARG n 
49 130  ASP n 
49 131  ILE n 
49 132  LEU n 
49 133  CYS n 
49 134  GLY n 
49 135  ALA n 
49 136  ALA n 
49 137  ASP n 
49 138  GLU n 
49 139  VAL n 
49 140  LEU n 
49 141  ALA n 
49 142  VAL n 
49 143  LEU n 
49 144  LYS n 
49 145  ASN n 
49 146  GLU n 
49 147  LYS n 
49 148  LEU n 
49 149  ARG n 
49 150  ASP n 
49 151  LYS n 
49 152  GLU n 
49 153  ARG n 
49 154  ARG n 
49 155  LYS n 
49 156  GLU n 
49 157  ILE n 
49 158  ASP n 
49 159  LEU n 
49 160  LEU n 
49 161  LEU n 
49 162  GLY n 
49 163  GLN n 
49 164  THR n 
49 165  ASP n 
49 166  ASP n 
49 167  THR n 
49 168  ARG n 
49 169  TYR n 
49 170  HIS n 
49 171  VAL n 
49 172  LEU n 
49 173  VAL n 
49 174  ASN n 
49 175  LEU n 
49 176  GLY n 
49 177  LYS n 
49 178  LYS n 
49 179  ILE n 
49 180  THR n 
49 181  ASP n 
49 182  TYR n 
49 183  GLY n 
49 184  GLY n 
49 185  ASP n 
49 186  LYS n 
49 187  GLU n 
49 188  ILE n 
49 189  GLN n 
49 190  ASN n 
49 191  MET n 
49 192  ASP n 
49 193  ASP n 
49 194  ASN n 
49 195  ILE n 
49 196  ASP n 
49 197  GLU n 
49 198  THR n 
49 199  TYR n 
49 200  GLY n 
49 201  VAL n 
49 202  ASN n 
49 203  VAL n 
49 204  GLN n 
49 205  PHE n 
49 206  GLU n 
49 207  SER n 
49 208  ASP n 
49 209  GLU n 
49 210  GLU n 
49 211  GLU n 
49 212  GLY n 
49 213  ASP n 
49 214  GLU n 
49 215  ASP n 
49 216  VAL n 
49 217  TYR n 
49 218  GLY n 
49 219  GLU n 
49 220  VAL n 
49 221  ARG n 
49 222  GLU n 
49 223  GLU n 
49 224  ALA n 
49 225  SER n 
49 226  ASP n 
49 227  ASP n 
49 228  ASP n 
49 229  MET n 
49 230  GLU n 
49 231  GLY n 
49 232  ASP n 
49 233  GLU n 
49 234  ALA n 
49 235  VAL n 
49 236  VAL n 
49 237  ARG n 
49 238  CYS n 
49 239  THR n 
49 240  LEU n 
49 241  SER n 
49 242  ALA n 
49 243  ASN n 
49 244  LEU n 
49 245  VAL n 
49 246  ALA n 
49 247  SER n 
49 248  GLY n 
49 249  GLU n 
49 250  LEU n 
49 251  MET n 
49 252  SER n 
49 253  SER n 
49 254  LYS n 
49 255  LYS n 
49 256  LYS n 
49 257  ASP n 
49 258  LEU n 
49 259  HIS n 
49 260  PRO n 
49 261  ARG n 
49 262  ASP n 
49 263  ILE n 
49 264  ASP n 
49 265  ALA n 
49 266  PHE n 
49 267  TRP n 
49 268  LEU n 
49 269  GLN n 
49 270  ARG n 
49 271  GLN n 
49 272  LEU n 
49 273  SER n 
49 274  ARG n 
49 275  PHE n 
49 276  TYR n 
49 277  ASP n 
49 278  ASP n 
49 279  ALA n 
49 280  ILE n 
49 281  VAL n 
49 282  SER n 
49 283  GLN n 
49 284  LYS n 
49 285  LYS n 
49 286  ALA n 
49 287  ASP n 
49 288  GLU n 
49 289  VAL n 
49 290  LEU n 
49 291  GLU n 
49 292  ILE n 
49 293  LEU n 
49 294  LYS n 
49 295  THR n 
49 296  ALA n 
49 297  SER n 
49 298  ASP n 
49 299  ASP n 
49 300  ARG n 
49 301  GLU n 
49 302  CYS n 
49 303  GLU n 
49 304  ASN n 
49 305  GLN n 
49 306  LEU n 
49 307  VAL n 
49 308  LEU n 
49 309  LEU n 
49 310  LEU n 
49 311  GLY n 
49 312  PHE n 
49 313  ASN n 
49 314  THR n 
49 315  PHE n 
49 316  ASP n 
49 317  PHE n 
49 318  ILE n 
49 319  LYS n 
49 320  VAL n 
49 321  LEU n 
49 322  ARG n 
49 323  GLN n 
49 324  HIS n 
49 325  ARG n 
49 326  MET n 
49 327  MET n 
49 328  ILE n 
49 329  LEU n 
49 330  TYR n 
49 331  CYS n 
49 332  THR n 
49 333  LEU n 
49 334  LEU n 
49 335  ALA n 
49 336  SER n 
49 337  ALA n 
49 338  GLN n 
49 339  SER n 
49 340  GLU n 
49 341  ALA n 
49 342  GLU n 
49 343  LYS n 
49 344  GLU n 
49 345  ARG n 
49 346  ILE n 
49 347  MET n 
49 348  GLY n 
49 349  LYS n 
49 350  MET n 
49 351  GLU n 
49 352  ALA n 
49 353  ASP n 
49 354  PRO n 
49 355  GLU n 
49 356  LEU n 
49 357  SER n 
49 358  LYS n 
49 359  PHE n 
49 360  LEU n 
49 361  TYR n 
49 362  GLN n 
49 363  LEU n 
49 364  HIS n 
49 365  GLU n 
49 366  THR n 
49 367  GLU n 
49 368  LYS n 
49 369  GLU n 
49 370  ASP n 
49 371  LEU n 
49 372  ILE n 
49 373  ARG n 
49 374  GLU n 
49 375  GLU n 
49 376  ARG n 
49 377  SER n 
49 378  ARG n 
49 379  ARG n 
49 380  GLU n 
49 381  ARG n 
49 382  VAL n 
49 383  ARG n 
49 384  GLN n 
49 385  SER n 
49 386  ARG n 
49 387  MET n 
49 388  ASP n 
49 389  THR n 
49 390  ASP n 
49 391  LEU n 
49 392  GLU n 
49 393  THR n 
49 394  MET n 
49 395  ASP n 
49 396  LEU n 
49 397  ASP n 
49 398  GLN n 
49 399  GLY n 
49 400  GLY n 
49 401  GLU n 
49 402  ALA n 
49 403  LEU n 
49 404  ALA n 
49 405  PRO n 
49 406  ARG n 
49 407  GLN n 
49 408  VAL n 
49 409  LEU n 
49 410  ASP n 
49 411  LEU n 
49 412  GLU n 
49 413  ASP n 
49 414  LEU n 
49 415  VAL n 
49 416  PHE n 
49 417  THR n 
49 418  GLN n 
49 419  GLY n 
49 420  SER n 
49 421  HIS n 
49 422  PHE n 
49 423  MET n 
49 424  ALA n 
49 425  ASN n 
49 426  LYS n 
49 427  ARG n 
49 428  CYS n 
49 429  GLN n 
49 430  LEU n 
49 431  PRO n 
49 432  ASP n 
49 433  GLY n 
49 434  SER n 
49 435  PHE n 
49 436  ARG n 
49 437  ARG n 
49 438  GLN n 
49 439  ARG n 
49 440  LYS n 
49 441  GLY n 
49 442  TYR n 
49 443  GLU n 
49 444  GLU n 
49 445  VAL n 
49 446  HIS n 
49 447  VAL n 
49 448  PRO n 
49 449  ALA n 
49 450  LEU n 
49 451  LYS n 
49 452  PRO n 
49 453  LYS n 
49 454  PRO n 
49 455  PHE n 
49 456  GLY n 
49 457  SER n 
49 458  GLU n 
49 459  GLU n 
49 460  GLN n 
49 461  LEU n 
49 462  LEU n 
49 463  PRO n 
49 464  VAL n 
49 465  GLU n 
49 466  LYS n 
49 467  LEU n 
49 468  PRO n 
49 469  LYS n 
49 470  TYR n 
49 471  ALA n 
49 472  GLN n 
49 473  ALA n 
49 474  GLY n 
49 475  PHE n 
49 476  GLU n 
49 477  GLY n 
49 478  PHE n 
49 479  LYS n 
49 480  THR n 
49 481  LEU n 
49 482  ASN n 
49 483  ARG n 
49 484  ILE n 
49 485  GLN n 
49 486  SER n 
49 487  LYS n 
49 488  LEU n 
49 489  TYR n 
49 490  ARG n 
49 491  ALA n 
49 492  ALA n 
49 493  LEU n 
49 494  GLU n 
49 495  THR n 
49 496  ASP n 
49 497  GLU n 
49 498  ASN n 
49 499  LEU n 
49 500  LEU n 
49 501  LEU n 
49 502  CYS n 
49 503  ALA n 
49 504  PRO n 
49 505  THR n 
49 506  GLY n 
49 507  ALA n 
49 508  GLY n 
49 509  LYS n 
49 510  THR n 
49 511  ASN n 
49 512  VAL n 
49 513  ALA n 
49 514  LEU n 
49 515  MET n 
49 516  CYS n 
49 517  MET n 
49 518  LEU n 
49 519  ARG n 
49 520  GLU n 
49 521  ILE n 
49 522  GLY n 
49 523  LYS n 
49 524  HIS n 
49 525  ILE n 
49 526  ASN n 
49 527  MET n 
49 528  ASP n 
49 529  GLY n 
49 530  THR n 
49 531  ILE n 
49 532  ASN n 
49 533  VAL n 
49 534  ASP n 
49 535  ASP n 
49 536  PHE n 
49 537  LYS n 
49 538  ILE n 
49 539  ILE n 
49 540  TYR n 
49 541  ILE n 
49 542  ALA n 
49 543  PRO n 
49 544  MET n 
49 545  ARG n 
49 546  SER n 
49 547  LEU n 
49 548  VAL n 
49 549  GLN n 
49 550  GLU n 
49 551  MET n 
49 552  VAL n 
49 553  GLY n 
49 554  SER n 
49 555  PHE n 
49 556  GLY n 
49 557  LYS n 
49 558  ARG n 
49 559  LEU n 
49 560  ALA n 
49 561  THR n 
49 562  TYR n 
49 563  GLY n 
49 564  ILE n 
49 565  THR n 
49 566  VAL n 
49 567  ALA n 
49 568  GLU n 
49 569  LEU n 
49 570  THR n 
49 571  GLY n 
49 572  ASP n 
49 573  HIS n 
49 574  GLN n 
49 575  LEU n 
49 576  CYS n 
49 577  LYS n 
49 578  GLU n 
49 579  GLU n 
49 580  ILE n 
49 581  SER n 
49 582  ALA n 
49 583  THR n 
49 584  GLN n 
49 585  ILE n 
49 586  ILE n 
49 587  VAL n 
49 588  CYS n 
49 589  THR n 
49 590  PRO n 
49 591  GLU n 
49 592  LYS n 
49 593  TRP n 
49 594  ASP n 
49 595  ILE n 
49 596  ILE n 
49 597  THR n 
49 598  ARG n 
49 599  LYS n 
49 600  GLY n 
49 601  GLY n 
49 602  GLU n 
49 603  ARG n 
49 604  THR n 
49 605  TYR n 
49 606  THR n 
49 607  GLN n 
49 608  LEU n 
49 609  VAL n 
49 610  ARG n 
49 611  LEU n 
49 612  ILE n 
49 613  ILE n 
49 614  LEU n 
49 615  ASP n 
49 616  GLU n 
49 617  ILE n 
49 618  HIS n 
49 619  LEU n 
49 620  LEU n 
49 621  HIS n 
49 622  ASP n 
49 623  ASP n 
49 624  ARG n 
49 625  GLY n 
49 626  PRO n 
49 627  VAL n 
49 628  LEU n 
49 629  GLU n 
49 630  ALA n 
49 631  LEU n 
49 632  VAL n 
49 633  ALA n 
49 634  ARG n 
49 635  ALA n 
49 636  ILE n 
49 637  ARG n 
49 638  ASN n 
49 639  ILE n 
49 640  GLU n 
49 641  MET n 
49 642  THR n 
49 643  GLN n 
49 644  GLU n 
49 645  ASP n 
49 646  VAL n 
49 647  ARG n 
49 648  LEU n 
49 649  ILE n 
49 650  GLY n 
49 651  LEU n 
49 652  SER n 
49 653  ALA n 
49 654  THR n 
49 655  LEU n 
49 656  PRO n 
49 657  ASN n 
49 658  TYR n 
49 659  GLU n 
49 660  ASP n 
49 661  VAL n 
49 662  ALA n 
49 663  THR n 
49 664  PHE n 
49 665  LEU n 
49 666  ARG n 
49 667  VAL n 
49 668  ASP n 
49 669  PRO n 
49 670  ALA n 
49 671  LYS n 
49 672  GLY n 
49 673  LEU n 
49 674  PHE n 
49 675  TYR n 
49 676  PHE n 
49 677  ASP n 
49 678  ASN n 
49 679  SER n 
49 680  PHE n 
49 681  ARG n 
49 682  PRO n 
49 683  VAL n 
49 684  PRO n 
49 685  LEU n 
49 686  GLU n 
49 687  GLN n 
49 688  THR n 
49 689  TYR n 
49 690  VAL n 
49 691  GLY n 
49 692  ILE n 
49 693  THR n 
49 694  GLU n 
49 695  LYS n 
49 696  LYS n 
49 697  ALA n 
49 698  ILE n 
49 699  LYS n 
49 700  ARG n 
49 701  PHE n 
49 702  GLN n 
49 703  ILE n 
49 704  MET n 
49 705  ASN n 
49 706  GLU n 
49 707  ILE n 
49 708  VAL n 
49 709  TYR n 
49 710  GLU n 
49 711  LYS n 
49 712  ILE n 
49 713  MET n 
49 714  GLU n 
49 715  HIS n 
49 716  ALA n 
49 717  GLY n 
49 718  LYS n 
49 719  ASN n 
49 720  GLN n 
49 721  VAL n 
49 722  LEU n 
49 723  VAL n 
49 724  PHE n 
49 725  VAL n 
49 726  HIS n 
49 727  SER n 
49 728  ARG n 
49 729  LYS n 
49 730  GLU n 
49 731  THR n 
49 732  GLY n 
49 733  LYS n 
49 734  THR n 
49 735  ALA n 
49 736  ARG n 
49 737  ALA n 
49 738  ILE n 
49 739  ARG n 
49 740  ASP n 
49 741  MET n 
49 742  CYS n 
49 743  LEU n 
49 744  GLU n 
49 745  LYS n 
49 746  ASP n 
49 747  THR n 
49 748  LEU n 
49 749  GLY n 
49 750  LEU n 
49 751  PHE n 
49 752  LEU n 
49 753  ARG n 
49 754  GLU n 
49 755  GLY n 
49 756  SER n 
49 757  ALA n 
49 758  SER n 
49 759  THR n 
49 760  GLU n 
49 761  VAL n 
49 762  LEU n 
49 763  ARG n 
49 764  THR n 
49 765  GLU n 
49 766  ALA n 
49 767  GLU n 
49 768  GLN n 
49 769  CYS n 
49 770  LYS n 
49 771  ASN n 
49 772  LEU n 
49 773  GLU n 
49 774  LEU n 
49 775  LYS n 
49 776  ASP n 
49 777  LEU n 
49 778  LEU n 
49 779  PRO n 
49 780  TYR n 
49 781  GLY n 
49 782  PHE n 
49 783  ALA n 
49 784  ILE n 
49 785  HIS n 
49 786  HIS n 
49 787  ALA n 
49 788  GLY n 
49 789  MET n 
49 790  THR n 
49 791  ARG n 
49 792  VAL n 
49 793  ASP n 
49 794  ARG n 
49 795  THR n 
49 796  LEU n 
49 797  VAL n 
49 798  GLU n 
49 799  ASP n 
49 800  LEU n 
49 801  PHE n 
49 802  ALA n 
49 803  ASP n 
49 804  LYS n 
49 805  HIS n 
49 806  ILE n 
49 807  GLN n 
49 808  VAL n 
49 809  LEU n 
49 810  VAL n 
49 811  SER n 
49 812  THR n 
49 813  ALA n 
49 814  THR n 
49 815  LEU n 
49 816  ALA n 
49 817  TRP n 
49 818  GLY n 
49 819  VAL n 
49 820  ASN n 
49 821  LEU n 
49 822  PRO n 
49 823  ALA n 
49 824  HIS n 
49 825  THR n 
49 826  VAL n 
49 827  ILE n 
49 828  ILE n 
49 829  LYS n 
49 830  GLY n 
49 831  THR n 
49 832  GLN n 
49 833  VAL n 
49 834  TYR n 
49 835  SER n 
49 836  PRO n 
49 837  GLU n 
49 838  LYS n 
49 839  GLY n 
49 840  ARG n 
49 841  TRP n 
49 842  THR n 
49 843  GLU n 
49 844  LEU n 
49 845  GLY n 
49 846  ALA n 
49 847  LEU n 
49 848  ASP n 
49 849  ILE n 
49 850  LEU n 
49 851  GLN n 
49 852  MET n 
49 853  LEU n 
49 854  GLY n 
49 855  ARG n 
49 856  ALA n 
49 857  GLY n 
49 858  ARG n 
49 859  PRO n 
49 860  GLN n 
49 861  TYR n 
49 862  ASP n 
49 863  THR n 
49 864  LYS n 
49 865  GLY n 
49 866  GLU n 
49 867  GLY n 
49 868  ILE n 
49 869  LEU n 
49 870  ILE n 
49 871  THR n 
49 872  SER n 
49 873  HIS n 
49 874  GLY n 
49 875  GLU n 
49 876  LEU n 
49 877  GLN n 
49 878  TYR n 
49 879  TYR n 
49 880  LEU n 
49 881  SER n 
49 882  LEU n 
49 883  LEU n 
49 884  ASN n 
49 885  GLN n 
49 886  GLN n 
49 887  LEU n 
49 888  PRO n 
49 889  ILE n 
49 890  GLU n 
49 891  SER n 
49 892  GLN n 
49 893  MET n 
49 894  VAL n 
49 895  SER n 
49 896  LYS n 
49 897  LEU n 
49 898  PRO n 
49 899  ASP n 
49 900  MET n 
49 901  LEU n 
49 902  ASN n 
49 903  ALA n 
49 904  GLU n 
49 905  ILE n 
49 906  VAL n 
49 907  LEU n 
49 908  GLY n 
49 909  ASN n 
49 910  VAL n 
49 911  GLN n 
49 912  ASN n 
49 913  ALA n 
49 914  LYS n 
49 915  ASP n 
49 916  ALA n 
49 917  VAL n 
49 918  ASN n 
49 919  TRP n 
49 920  LEU n 
49 921  GLY n 
49 922  TYR n 
49 923  ALA n 
49 924  TYR n 
49 925  LEU n 
49 926  TYR n 
49 927  ILE n 
49 928  ARG n 
49 929  MET n 
49 930  LEU n 
49 931  ARG n 
49 932  SER n 
49 933  PRO n 
49 934  THR n 
49 935  LEU n 
49 936  TYR n 
49 937  GLY n 
49 938  ILE n 
49 939  SER n 
49 940  HIS n 
49 941  ASP n 
49 942  ASP n 
49 943  LEU n 
49 944  LYS n 
49 945  GLY n 
49 946  ASP n 
49 947  PRO n 
49 948  LEU n 
49 949  LEU n 
49 950  ASP n 
49 951  GLN n 
49 952  ARG n 
49 953  ARG n 
49 954  LEU n 
49 955  ASP n 
49 956  LEU n 
49 957  VAL n 
49 958  HIS n 
49 959  THR n 
49 960  ALA n 
49 961  ALA n 
49 962  LEU n 
49 963  MET n 
49 964  LEU n 
49 965  ASP n 
49 966  LYS n 
49 967  ASN n 
49 968  ASN n 
49 969  LEU n 
49 970  VAL n 
49 971  LYS n 
49 972  TYR n 
49 973  ASP n 
49 974  LYS n 
49 975  LYS n 
49 976  THR n 
49 977  GLY n 
49 978  ASN n 
49 979  PHE n 
49 980  GLN n 
49 981  VAL n 
49 982  THR n 
49 983  GLU n 
49 984  LEU n 
49 985  GLY n 
49 986  ARG n 
49 987  ILE n 
49 988  ALA n 
49 989  SER n 
49 990  HIS n 
49 991  TYR n 
49 992  TYR n 
49 993  ILE n 
49 994  THR n 
49 995  ASN n 
49 996  ASP n 
49 997  THR n 
49 998  VAL n 
49 999  GLN n 
49 1000 THR n 
49 1001 TYR n 
49 1002 ASN n 
49 1003 GLN n 
49 1004 LEU n 
49 1005 LEU n 
49 1006 LYS n 
49 1007 PRO n 
49 1008 THR n 
49 1009 LEU n 
49 1010 SER n 
49 1011 GLU n 
49 1012 ILE n 
49 1013 GLU n 
49 1014 LEU n 
49 1015 PHE n 
49 1016 ARG n 
49 1017 VAL n 
49 1018 PHE n 
49 1019 SER n 
49 1020 LEU n 
49 1021 SER n 
49 1022 SER n 
49 1023 GLU n 
49 1024 PHE n 
49 1025 LYS n 
49 1026 ASN n 
49 1027 ILE n 
49 1028 THR n 
49 1029 VAL n 
49 1030 ARG n 
49 1031 GLU n 
49 1032 GLU n 
49 1033 GLU n 
49 1034 LYS n 
49 1035 LEU n 
49 1036 GLU n 
49 1037 LEU n 
49 1038 GLN n 
49 1039 LYS n 
49 1040 LEU n 
49 1041 LEU n 
49 1042 GLU n 
49 1043 ARG n 
49 1044 VAL n 
49 1045 PRO n 
49 1046 ILE n 
49 1047 PRO n 
49 1048 VAL n 
49 1049 LYS n 
49 1050 GLU n 
49 1051 SER n 
49 1052 ILE n 
49 1053 GLU n 
49 1054 GLU n 
49 1055 PRO n 
49 1056 SER n 
49 1057 ALA n 
49 1058 LYS n 
49 1059 ILE n 
49 1060 ASN n 
49 1061 VAL n 
49 1062 LEU n 
49 1063 LEU n 
49 1064 GLN n 
49 1065 ALA n 
49 1066 PHE n 
49 1067 ILE n 
49 1068 SER n 
49 1069 GLN n 
49 1070 LEU n 
49 1071 LYS n 
49 1072 LEU n 
49 1073 GLU n 
49 1074 GLY n 
49 1075 PHE n 
49 1076 ALA n 
49 1077 LEU n 
49 1078 MET n 
49 1079 ALA n 
49 1080 ASP n 
49 1081 MET n 
49 1082 VAL n 
49 1083 TYR n 
49 1084 VAL n 
49 1085 THR n 
49 1086 GLN n 
49 1087 SER n 
49 1088 ALA n 
49 1089 GLY n 
49 1090 ARG n 
49 1091 LEU n 
49 1092 MET n 
49 1093 ARG n 
49 1094 ALA n 
49 1095 ILE n 
49 1096 PHE n 
49 1097 GLU n 
49 1098 ILE n 
49 1099 VAL n 
49 1100 LEU n 
49 1101 ASN n 
49 1102 ARG n 
49 1103 GLY n 
49 1104 TRP n 
49 1105 ALA n 
49 1106 GLN n 
49 1107 LEU n 
49 1108 THR n 
49 1109 ASP n 
49 1110 LYS n 
49 1111 THR n 
49 1112 LEU n 
49 1113 ASN n 
49 1114 LEU n 
49 1115 CYS n 
49 1116 LYS n 
49 1117 MET n 
49 1118 ILE n 
49 1119 ASP n 
49 1120 LYS n 
49 1121 ARG n 
49 1122 MET n 
49 1123 TRP n 
49 1124 GLN n 
49 1125 SER n 
49 1126 MET n 
49 1127 CYS n 
49 1128 PRO n 
49 1129 LEU n 
49 1130 ARG n 
49 1131 GLN n 
49 1132 PHE n 
49 1133 ARG n 
49 1134 LYS n 
49 1135 LEU n 
49 1136 PRO n 
49 1137 GLU n 
49 1138 GLU n 
49 1139 VAL n 
49 1140 VAL n 
49 1141 LYS n 
49 1142 LYS n 
49 1143 ILE n 
49 1144 GLU n 
49 1145 LYS n 
49 1146 LYS n 
49 1147 ASN n 
49 1148 PHE n 
49 1149 PRO n 
49 1150 PHE n 
49 1151 GLU n 
49 1152 ARG n 
49 1153 LEU n 
49 1154 TYR n 
49 1155 ASP n 
49 1156 LEU n 
49 1157 ASN n 
49 1158 HIS n 
49 1159 ASN n 
49 1160 GLU n 
49 1161 ILE n 
49 1162 GLY n 
49 1163 GLU n 
49 1164 LEU n 
49 1165 ILE n 
49 1166 ARG n 
49 1167 MET n 
49 1168 PRO n 
49 1169 LYS n 
49 1170 MET n 
49 1171 GLY n 
49 1172 LYS n 
49 1173 THR n 
49 1174 ILE n 
49 1175 HIS n 
49 1176 LYS n 
49 1177 TYR n 
49 1178 VAL n 
49 1179 HIS n 
49 1180 LEU n 
49 1181 PHE n 
49 1182 PRO n 
49 1183 LYS n 
49 1184 LEU n 
49 1185 GLU n 
49 1186 LEU n 
49 1187 SER n 
49 1188 VAL n 
49 1189 HIS n 
49 1190 LEU n 
49 1191 GLN n 
49 1192 PRO n 
49 1193 ILE n 
49 1194 THR n 
49 1195 ARG n 
49 1196 SER n 
49 1197 THR n 
49 1198 LEU n 
49 1199 LYS n 
49 1200 VAL n 
49 1201 GLU n 
49 1202 LEU n 
49 1203 THR n 
49 1204 ILE n 
49 1205 THR n 
49 1206 PRO n 
49 1207 ASP n 
49 1208 PHE n 
49 1209 GLN n 
49 1210 TRP n 
49 1211 ASP n 
49 1212 GLU n 
49 1213 LYS n 
49 1214 VAL n 
49 1215 HIS n 
49 1216 GLY n 
49 1217 SER n 
49 1218 SER n 
49 1219 GLU n 
49 1220 ALA n 
49 1221 PHE n 
49 1222 TRP n 
49 1223 ILE n 
49 1224 LEU n 
49 1225 VAL n 
49 1226 GLU n 
49 1227 ASP n 
49 1228 VAL n 
49 1229 ASP n 
49 1230 SER n 
49 1231 GLU n 
49 1232 VAL n 
49 1233 ILE n 
49 1234 LEU n 
49 1235 HIS n 
49 1236 HIS n 
49 1237 GLU n 
49 1238 TYR n 
49 1239 PHE n 
49 1240 LEU n 
49 1241 LEU n 
49 1242 LYS n 
49 1243 ALA n 
49 1244 LYS n 
49 1245 TYR n 
49 1246 ALA n 
49 1247 GLN n 
49 1248 ASP n 
49 1249 GLU n 
49 1250 HIS n 
49 1251 LEU n 
49 1252 ILE n 
49 1253 THR n 
49 1254 PHE n 
49 1255 PHE n 
49 1256 VAL n 
49 1257 PRO n 
49 1258 VAL n 
49 1259 PHE n 
49 1260 GLU n 
49 1261 PRO n 
49 1262 LEU n 
49 1263 PRO n 
49 1264 PRO n 
49 1265 GLN n 
49 1266 TYR n 
49 1267 PHE n 
49 1268 ILE n 
49 1269 ARG n 
49 1270 VAL n 
49 1271 VAL n 
49 1272 SER n 
49 1273 ASP n 
49 1274 ARG n 
49 1275 TRP n 
49 1276 LEU n 
49 1277 SER n 
49 1278 CYS n 
49 1279 GLU n 
49 1280 THR n 
49 1281 GLN n 
49 1282 LEU n 
49 1283 PRO n 
49 1284 VAL n 
49 1285 SER n 
49 1286 PHE n 
49 1287 ARG n 
49 1288 HIS n 
49 1289 LEU n 
49 1290 ILE n 
49 1291 LEU n 
49 1292 PRO n 
49 1293 GLU n 
49 1294 LYS n 
49 1295 TYR n 
49 1296 PRO n 
49 1297 PRO n 
49 1298 PRO n 
49 1299 THR n 
49 1300 GLU n 
49 1301 LEU n 
49 1302 LEU n 
49 1303 ASP n 
49 1304 LEU n 
49 1305 GLN n 
49 1306 PRO n 
49 1307 LEU n 
49 1308 PRO n 
49 1309 VAL n 
49 1310 SER n 
49 1311 ALA n 
49 1312 LEU n 
49 1313 ARG n 
49 1314 ASN n 
49 1315 SER n 
49 1316 ALA n 
49 1317 PHE n 
49 1318 GLU n 
49 1319 SER n 
49 1320 LEU n 
49 1321 TYR n 
49 1322 GLN n 
49 1323 ASP n 
49 1324 LYS n 
49 1325 PHE n 
49 1326 PRO n 
49 1327 PHE n 
49 1328 PHE n 
49 1329 ASN n 
49 1330 PRO n 
49 1331 ILE n 
49 1332 GLN n 
49 1333 THR n 
49 1334 GLN n 
49 1335 VAL n 
49 1336 PHE n 
49 1337 ASN n 
49 1338 THR n 
49 1339 VAL n 
49 1340 TYR n 
49 1341 ASN n 
49 1342 SER n 
49 1343 ASP n 
49 1344 ASP n 
49 1345 ASN n 
49 1346 VAL n 
49 1347 PHE n 
49 1348 VAL n 
49 1349 GLY n 
49 1350 ALA n 
49 1351 PRO n 
49 1352 THR n 
49 1353 GLY n 
49 1354 SER n 
49 1355 GLY n 
49 1356 LYS n 
49 1357 THR n 
49 1358 ILE n 
49 1359 CYS n 
49 1360 ALA n 
49 1361 GLU n 
49 1362 PHE n 
49 1363 ALA n 
49 1364 ILE n 
49 1365 LEU n 
49 1366 ARG n 
49 1367 MET n 
49 1368 LEU n 
49 1369 LEU n 
49 1370 GLN n 
49 1371 SER n 
49 1372 SER n 
49 1373 GLU n 
49 1374 GLY n 
49 1375 ARG n 
49 1376 CYS n 
49 1377 VAL n 
49 1378 TYR n 
49 1379 ILE n 
49 1380 THR n 
49 1381 PRO n 
49 1382 MET n 
49 1383 GLU n 
49 1384 ALA n 
49 1385 LEU n 
49 1386 ALA n 
49 1387 GLU n 
49 1388 GLN n 
49 1389 VAL n 
49 1390 TYR n 
49 1391 MET n 
49 1392 ASP n 
49 1393 TRP n 
49 1394 TYR n 
49 1395 GLU n 
49 1396 LYS n 
49 1397 PHE n 
49 1398 GLN n 
49 1399 ASP n 
49 1400 ARG n 
49 1401 LEU n 
49 1402 ASN n 
49 1403 LYS n 
49 1404 LYS n 
49 1405 VAL n 
49 1406 VAL n 
49 1407 LEU n 
49 1408 LEU n 
49 1409 THR n 
49 1410 GLY n 
49 1411 GLU n 
49 1412 THR n 
49 1413 SER n 
49 1414 THR n 
49 1415 ASP n 
49 1416 LEU n 
49 1417 LYS n 
49 1418 LEU n 
49 1419 LEU n 
49 1420 GLY n 
49 1421 LYS n 
49 1422 GLY n 
49 1423 ASN n 
49 1424 ILE n 
49 1425 ILE n 
49 1426 ILE n 
49 1427 SER n 
49 1428 THR n 
49 1429 PRO n 
49 1430 GLU n 
49 1431 LYS n 
49 1432 TRP n 
49 1433 ASP n 
49 1434 ILE n 
49 1435 LEU n 
49 1436 SER n 
49 1437 ARG n 
49 1438 ARG n 
49 1439 TRP n 
49 1440 LYS n 
49 1441 GLN n 
49 1442 ARG n 
49 1443 LYS n 
49 1444 ASN n 
49 1445 VAL n 
49 1446 GLN n 
49 1447 ASN n 
49 1448 ILE n 
49 1449 ASN n 
49 1450 LEU n 
49 1451 PHE n 
49 1452 VAL n 
49 1453 VAL n 
49 1454 ASP n 
49 1455 GLU n 
49 1456 VAL n 
49 1457 HIS n 
49 1458 LEU n 
49 1459 ILE n 
49 1460 GLY n 
49 1461 GLY n 
49 1462 GLU n 
49 1463 ASN n 
49 1464 GLY n 
49 1465 PRO n 
49 1466 VAL n 
49 1467 LEU n 
49 1468 GLU n 
49 1469 VAL n 
49 1470 ILE n 
49 1471 CYS n 
49 1472 SER n 
49 1473 ARG n 
49 1474 MET n 
49 1475 ARG n 
49 1476 TYR n 
49 1477 ILE n 
49 1478 SER n 
49 1479 SER n 
49 1480 GLN n 
49 1481 ILE n 
49 1482 GLU n 
49 1483 ARG n 
49 1484 PRO n 
49 1485 ILE n 
49 1486 ARG n 
49 1487 ILE n 
49 1488 VAL n 
49 1489 ALA n 
49 1490 LEU n 
49 1491 SER n 
49 1492 SER n 
49 1493 SER n 
49 1494 LEU n 
49 1495 SER n 
49 1496 ASN n 
49 1497 ALA n 
49 1498 LYS n 
49 1499 ASP n 
49 1500 VAL n 
49 1501 ALA n 
49 1502 HIS n 
49 1503 TRP n 
49 1504 LEU n 
49 1505 GLY n 
49 1506 CYS n 
49 1507 SER n 
49 1508 ALA n 
49 1509 THR n 
49 1510 SER n 
49 1511 THR n 
49 1512 PHE n 
49 1513 ASN n 
49 1514 PHE n 
49 1515 HIS n 
49 1516 PRO n 
49 1517 ASN n 
49 1518 VAL n 
49 1519 ARG n 
49 1520 PRO n 
49 1521 VAL n 
49 1522 PRO n 
49 1523 LEU n 
49 1524 GLU n 
49 1525 LEU n 
49 1526 HIS n 
49 1527 ILE n 
49 1528 GLN n 
49 1529 GLY n 
49 1530 PHE n 
49 1531 ASN n 
49 1532 ILE n 
49 1533 SER n 
49 1534 HIS n 
49 1535 THR n 
49 1536 GLN n 
49 1537 THR n 
49 1538 ARG n 
49 1539 LEU n 
49 1540 LEU n 
49 1541 SER n 
49 1542 MET n 
49 1543 ALA n 
49 1544 LYS n 
49 1545 PRO n 
49 1546 VAL n 
49 1547 TYR n 
49 1548 HIS n 
49 1549 ALA n 
49 1550 ILE n 
49 1551 THR n 
49 1552 LYS n 
49 1553 HIS n 
49 1554 SER n 
49 1555 PRO n 
49 1556 LYS n 
49 1557 LYS n 
49 1558 PRO n 
49 1559 VAL n 
49 1560 ILE n 
49 1561 VAL n 
49 1562 PHE n 
49 1563 VAL n 
49 1564 PRO n 
49 1565 SER n 
49 1566 ARG n 
49 1567 LYS n 
49 1568 GLN n 
49 1569 THR n 
49 1570 ARG n 
49 1571 LEU n 
49 1572 THR n 
49 1573 ALA n 
49 1574 ILE n 
49 1575 ASP n 
49 1576 ILE n 
49 1577 LEU n 
49 1578 THR n 
49 1579 THR n 
49 1580 CYS n 
49 1581 ALA n 
49 1582 ALA n 
49 1583 ASP n 
49 1584 ILE n 
49 1585 GLN n 
49 1586 ARG n 
49 1587 GLN n 
49 1588 ARG n 
49 1589 PHE n 
49 1590 LEU n 
49 1591 HIS n 
49 1592 CYS n 
49 1593 THR n 
49 1594 GLU n 
49 1595 LYS n 
49 1596 ASP n 
49 1597 LEU n 
49 1598 ILE n 
49 1599 PRO n 
49 1600 TYR n 
49 1601 LEU n 
49 1602 GLU n 
49 1603 LYS n 
49 1604 LEU n 
49 1605 SER n 
49 1606 ASP n 
49 1607 SER n 
49 1608 THR n 
49 1609 LEU n 
49 1610 LYS n 
49 1611 GLU n 
49 1612 THR n 
49 1613 LEU n 
49 1614 LEU n 
49 1615 ASN n 
49 1616 GLY n 
49 1617 VAL n 
49 1618 GLY n 
49 1619 TYR n 
49 1620 LEU n 
49 1621 HIS n 
49 1622 GLU n 
49 1623 GLY n 
49 1624 LEU n 
49 1625 SER n 
49 1626 PRO n 
49 1627 MET n 
49 1628 GLU n 
49 1629 ARG n 
49 1630 ARG n 
49 1631 LEU n 
49 1632 VAL n 
49 1633 GLU n 
49 1634 GLN n 
49 1635 LEU n 
49 1636 PHE n 
49 1637 SER n 
49 1638 SER n 
49 1639 GLY n 
49 1640 ALA n 
49 1641 ILE n 
49 1642 GLN n 
49 1643 VAL n 
49 1644 VAL n 
49 1645 VAL n 
49 1646 ALA n 
49 1647 SER n 
49 1648 ARG n 
49 1649 SER n 
49 1650 LEU n 
49 1651 CYS n 
49 1652 TRP n 
49 1653 GLY n 
49 1654 MET n 
49 1655 ASN n 
49 1656 VAL n 
49 1657 ALA n 
49 1658 ALA n 
49 1659 HIS n 
49 1660 LEU n 
49 1661 VAL n 
49 1662 ILE n 
49 1663 ILE n 
49 1664 MET n 
49 1665 ASP n 
49 1666 THR n 
49 1667 GLN n 
49 1668 TYR n 
49 1669 TYR n 
49 1670 ASN n 
49 1671 GLY n 
49 1672 LYS n 
49 1673 ILE n 
49 1674 HIS n 
49 1675 ALA n 
49 1676 TYR n 
49 1677 VAL n 
49 1678 ASP n 
49 1679 TYR n 
49 1680 PRO n 
49 1681 ILE n 
49 1682 TYR n 
49 1683 ASP n 
49 1684 VAL n 
49 1685 LEU n 
49 1686 GLN n 
49 1687 MET n 
49 1688 VAL n 
49 1689 GLY n 
49 1690 HIS n 
49 1691 ALA n 
49 1692 ASN n 
49 1693 ARG n 
49 1694 PRO n 
49 1695 LEU n 
49 1696 GLN n 
49 1697 ASP n 
49 1698 ASP n 
49 1699 GLU n 
49 1700 GLY n 
49 1701 ARG n 
49 1702 CYS n 
49 1703 VAL n 
49 1704 ILE n 
49 1705 MET n 
49 1706 CYS n 
49 1707 GLN n 
49 1708 GLY n 
49 1709 SER n 
49 1710 LYS n 
49 1711 LYS n 
49 1712 ASP n 
49 1713 PHE n 
49 1714 PHE n 
49 1715 LYS n 
49 1716 LYS n 
49 1717 PHE n 
49 1718 LEU n 
49 1719 TYR n 
49 1720 GLU n 
49 1721 PRO n 
49 1722 LEU n 
49 1723 PRO n 
49 1724 VAL n 
49 1725 GLU n 
49 1726 SER n 
49 1727 HIS n 
49 1728 LEU n 
49 1729 ASP n 
49 1730 HIS n 
49 1731 CYS n 
49 1732 MET n 
49 1733 HIS n 
49 1734 ASP n 
49 1735 HIS n 
49 1736 PHE n 
49 1737 ASN n 
49 1738 ALA n 
49 1739 GLU n 
49 1740 ILE n 
49 1741 VAL n 
49 1742 THR n 
49 1743 LYS n 
49 1744 THR n 
49 1745 ILE n 
49 1746 GLU n 
49 1747 ASN n 
49 1748 LYS n 
49 1749 GLN n 
49 1750 ASP n 
49 1751 ALA n 
49 1752 VAL n 
49 1753 ASP n 
49 1754 TYR n 
49 1755 LEU n 
49 1756 THR n 
49 1757 TRP n 
49 1758 THR n 
49 1759 PHE n 
49 1760 LEU n 
49 1761 TYR n 
49 1762 ARG n 
49 1763 ARG n 
49 1764 MET n 
49 1765 THR n 
49 1766 GLN n 
49 1767 ASN n 
49 1768 PRO n 
49 1769 ASN n 
49 1770 TYR n 
49 1771 TYR n 
49 1772 ASN n 
49 1773 LEU n 
49 1774 GLN n 
49 1775 GLY n 
49 1776 ILE n 
49 1777 SER n 
49 1778 HIS n 
49 1779 ARG n 
49 1780 HIS n 
49 1781 LEU n 
49 1782 SER n 
49 1783 ASP n 
49 1784 HIS n 
49 1785 LEU n 
49 1786 SER n 
49 1787 GLU n 
49 1788 LEU n 
49 1789 VAL n 
49 1790 GLU n 
49 1791 GLN n 
49 1792 THR n 
49 1793 LEU n 
49 1794 SER n 
49 1795 ASP n 
49 1796 LEU n 
49 1797 GLU n 
49 1798 GLN n 
49 1799 SER n 
49 1800 LYS n 
49 1801 CYS n 
49 1802 ILE n 
49 1803 SER n 
49 1804 ILE n 
49 1805 GLU n 
49 1806 ASP n 
49 1807 GLU n 
49 1808 MET n 
49 1809 ASP n 
49 1810 VAL n 
49 1811 ALA n 
49 1812 PRO n 
49 1813 LEU n 
49 1814 ASN n 
49 1815 LEU n 
49 1816 GLY n 
49 1817 MET n 
49 1818 ILE n 
49 1819 ALA n 
49 1820 ALA n 
49 1821 TYR n 
49 1822 TYR n 
49 1823 TYR n 
49 1824 ILE n 
49 1825 ASN n 
49 1826 TYR n 
49 1827 THR n 
49 1828 THR n 
49 1829 ILE n 
49 1830 GLU n 
49 1831 LEU n 
49 1832 PHE n 
49 1833 SER n 
49 1834 MET n 
49 1835 SER n 
49 1836 LEU n 
49 1837 ASN n 
49 1838 ALA n 
49 1839 LYS n 
49 1840 THR n 
49 1841 LYS n 
49 1842 VAL n 
49 1843 ARG n 
49 1844 GLY n 
49 1845 LEU n 
49 1846 ILE n 
49 1847 GLU n 
49 1848 ILE n 
49 1849 ILE n 
49 1850 SER n 
49 1851 ASN n 
49 1852 ALA n 
49 1853 ALA n 
49 1854 GLU n 
49 1855 TYR n 
49 1856 GLU n 
49 1857 ASN n 
49 1858 ILE n 
49 1859 PRO n 
49 1860 ILE n 
49 1861 ARG n 
49 1862 HIS n 
49 1863 HIS n 
49 1864 GLU n 
49 1865 ASP n 
49 1866 ASN n 
49 1867 LEU n 
49 1868 LEU n 
49 1869 ARG n 
49 1870 GLN n 
49 1871 LEU n 
49 1872 ALA n 
49 1873 GLN n 
49 1874 LYS n 
49 1875 VAL n 
49 1876 PRO n 
49 1877 HIS n 
49 1878 LYS n 
49 1879 LEU n 
49 1880 ASN n 
49 1881 ASN n 
49 1882 PRO n 
49 1883 LYS n 
49 1884 PHE n 
49 1885 ASN n 
49 1886 ASP n 
49 1887 PRO n 
49 1888 HIS n 
49 1889 VAL n 
49 1890 LYS n 
49 1891 THR n 
49 1892 ASN n 
49 1893 LEU n 
49 1894 LEU n 
49 1895 LEU n 
49 1896 GLN n 
49 1897 ALA n 
49 1898 HIS n 
49 1899 LEU n 
49 1900 SER n 
49 1901 ARG n 
49 1902 MET n 
49 1903 GLN n 
49 1904 LEU n 
49 1905 SER n 
49 1906 ALA n 
49 1907 GLU n 
49 1908 LEU n 
49 1909 GLN n 
49 1910 SER n 
49 1911 ASP n 
49 1912 THR n 
49 1913 GLU n 
49 1914 GLU n 
49 1915 ILE n 
49 1916 LEU n 
49 1917 SER n 
49 1918 LYS n 
49 1919 ALA n 
49 1920 ILE n 
49 1921 ARG n 
49 1922 LEU n 
49 1923 ILE n 
49 1924 GLN n 
49 1925 ALA n 
49 1926 CYS n 
49 1927 VAL n 
49 1928 ASP n 
49 1929 VAL n 
49 1930 LEU n 
49 1931 SER n 
49 1932 SER n 
49 1933 ASN n 
49 1934 GLY n 
49 1935 TRP n 
49 1936 LEU n 
49 1937 SER n 
49 1938 PRO n 
49 1939 ALA n 
49 1940 LEU n 
49 1941 ALA n 
49 1942 ALA n 
49 1943 MET n 
49 1944 GLU n 
49 1945 LEU n 
49 1946 ALA n 
49 1947 GLN n 
49 1948 MET n 
49 1949 VAL n 
49 1950 THR n 
49 1951 GLN n 
49 1952 ALA n 
49 1953 MET n 
49 1954 TRP n 
49 1955 SER n 
49 1956 LYS n 
49 1957 ASP n 
49 1958 SER n 
49 1959 TYR n 
49 1960 LEU n 
49 1961 LYS n 
49 1962 GLN n 
49 1963 LEU n 
49 1964 PRO n 
49 1965 HIS n 
49 1966 PHE n 
49 1967 THR n 
49 1968 SER n 
49 1969 GLU n 
49 1970 HIS n 
49 1971 ILE n 
49 1972 LYS n 
49 1973 ARG n 
49 1974 CYS n 
49 1975 THR n 
49 1976 ASP n 
49 1977 LYS n 
49 1978 GLY n 
49 1979 VAL n 
49 1980 GLU n 
49 1981 SER n 
49 1982 VAL n 
49 1983 PHE n 
49 1984 ASP n 
49 1985 ILE n 
49 1986 MET n 
49 1987 GLU n 
49 1988 MET n 
49 1989 GLU n 
49 1990 ASP n 
49 1991 GLU n 
49 1992 GLU n 
49 1993 ARG n 
49 1994 ASN n 
49 1995 ALA n 
49 1996 LEU n 
49 1997 LEU n 
49 1998 GLN n 
49 1999 LEU n 
49 2000 THR n 
49 2001 ASP n 
49 2002 SER n 
49 2003 GLN n 
49 2004 ILE n 
49 2005 ALA n 
49 2006 ASP n 
49 2007 VAL n 
49 2008 ALA n 
49 2009 ARG n 
49 2010 PHE n 
49 2011 CYS n 
49 2012 ASN n 
49 2013 ARG n 
49 2014 TYR n 
49 2015 PRO n 
49 2016 ASN n 
49 2017 ILE n 
49 2018 GLU n 
49 2019 LEU n 
49 2020 SER n 
49 2021 TYR n 
49 2022 GLU n 
49 2023 VAL n 
49 2024 VAL n 
49 2025 ASP n 
49 2026 LYS n 
49 2027 ASP n 
49 2028 SER n 
49 2029 ILE n 
49 2030 ARG n 
49 2031 SER n 
49 2032 GLY n 
49 2033 GLY n 
49 2034 PRO n 
49 2035 VAL n 
49 2036 VAL n 
49 2037 VAL n 
49 2038 LEU n 
49 2039 VAL n 
49 2040 GLN n 
49 2041 LEU n 
49 2042 GLU n 
49 2043 ARG n 
49 2044 GLU n 
49 2045 GLU n 
49 2046 GLU n 
49 2047 VAL n 
49 2048 THR n 
49 2049 GLY n 
49 2050 PRO n 
49 2051 VAL n 
49 2052 ILE n 
49 2053 ALA n 
49 2054 PRO n 
49 2055 LEU n 
49 2056 PHE n 
49 2057 PRO n 
49 2058 GLN n 
49 2059 LYS n 
49 2060 ARG n 
49 2061 GLU n 
49 2062 GLU n 
49 2063 GLY n 
49 2064 TRP n 
49 2065 TRP n 
49 2066 VAL n 
49 2067 VAL n 
49 2068 ILE n 
49 2069 GLY n 
49 2070 ASP n 
49 2071 ALA n 
49 2072 LYS n 
49 2073 SER n 
49 2074 ASN n 
49 2075 SER n 
49 2076 LEU n 
49 2077 ILE n 
49 2078 SER n 
49 2079 ILE n 
49 2080 LYS n 
49 2081 ARG n 
49 2082 LEU n 
49 2083 THR n 
49 2084 LEU n 
49 2085 GLN n 
49 2086 GLN n 
49 2087 LYS n 
49 2088 ALA n 
49 2089 LYS n 
49 2090 VAL n 
49 2091 LYS n 
49 2092 LEU n 
49 2093 ASP n 
49 2094 PHE n 
49 2095 VAL n 
49 2096 ALA n 
49 2097 PRO n 
49 2098 ALA n 
49 2099 THR n 
49 2100 GLY n 
49 2101 ALA n 
49 2102 HIS n 
49 2103 ASN n 
49 2104 TYR n 
49 2105 THR n 
49 2106 LEU n 
49 2107 TYR n 
49 2108 PHE n 
49 2109 MET n 
49 2110 SER n 
49 2111 ASP n 
49 2112 ALA n 
49 2113 TYR n 
49 2114 MET n 
49 2115 GLY n 
49 2116 CYS n 
49 2117 ASP n 
49 2118 GLN n 
49 2119 GLU n 
49 2120 TYR n 
49 2121 LYS n 
49 2122 PHE n 
49 2123 SER n 
49 2124 VAL n 
49 2125 ASP n 
49 2126 VAL n 
49 2127 LYS n 
49 2128 GLU n 
49 2129 ALA n 
49 2130 GLU n 
49 2131 THR n 
49 2132 ASP n 
49 2133 SER n 
49 2134 ASP n 
49 2135 SER n 
49 2136 ASP n 
50 1    MET n 
50 2    ALA n 
50 3    ARG n 
50 4    ASN n 
50 5    ALA n 
50 6    GLU n 
50 7    LYS n 
50 8    ALA n 
50 9    MET n 
50 10   THR n 
50 11   ALA n 
50 12   LEU n 
50 13   ALA n 
50 14   ARG n 
50 15   PHE n 
50 16   ARG n 
50 17   GLN n 
50 18   ALA n 
50 19   GLN n 
50 20   LEU n 
50 21   GLU n 
50 22   GLU n 
50 23   GLY n 
50 24   LYS n 
50 25   VAL n 
50 26   LYS n 
50 27   GLU n 
50 28   ARG n 
50 29   ARG n 
50 30   PRO n 
50 31   PHE n 
50 32   LEU n 
50 33   ALA n 
50 34   SER n 
50 35   GLU n 
50 36   CYS n 
50 37   THR n 
50 38   GLU n 
50 39   LEU n 
50 40   PRO n 
50 41   LYS n 
50 42   ALA n 
50 43   GLU n 
50 44   LYS n 
50 45   TRP n 
50 46   ARG n 
50 47   ARG n 
50 48   GLN n 
50 49   ILE n 
50 50   ILE n 
50 51   GLY n 
50 52   GLU n 
50 53   ILE n 
50 54   SER n 
50 55   LYS n 
50 56   LYS n 
50 57   VAL n 
50 58   ALA n 
50 59   GLN n 
50 60   ILE n 
50 61   GLN n 
50 62   ASN n 
50 63   ALA n 
50 64   GLY n 
50 65   LEU n 
50 66   GLY n 
50 67   GLU n 
50 68   PHE n 
50 69   ARG n 
50 70   ILE n 
50 71   ARG n 
50 72   ASP n 
50 73   LEU n 
50 74   ASN n 
50 75   ASP n 
50 76   GLU n 
50 77   ILE n 
50 78   ASN n 
50 79   LYS n 
50 80   LEU n 
50 81   LEU n 
50 82   ARG n 
50 83   GLU n 
50 84   LYS n 
50 85   GLY n 
50 86   HIS n 
50 87   TRP n 
50 88   GLU n 
50 89   VAL n 
50 90   ARG n 
50 91   ILE n 
50 92   LYS n 
50 93   GLU n 
50 94   LEU n 
50 95   GLY n 
50 96   GLY n 
50 97   PRO n 
50 98   ASP n 
50 99   TYR n 
50 100  GLY n 
50 101  LYS n 
50 102  VAL n 
50 103  GLY n 
50 104  PRO n 
50 105  LYS n 
50 106  MET n 
50 107  LEU n 
50 108  ASP n 
50 109  HIS n 
50 110  GLU n 
50 111  GLY n 
50 112  LYS n 
50 113  GLU n 
50 114  VAL n 
50 115  PRO n 
50 116  GLY n 
50 117  ASN n 
50 118  ARG n 
50 119  GLY n 
50 120  TYR n 
50 121  LYS n 
50 122  TYR n 
50 123  PHE n 
50 124  GLY n 
50 125  ALA n 
50 126  ALA n 
50 127  LYS n 
50 128  ASP n 
50 129  LEU n 
50 130  PRO n 
50 131  GLY n 
50 132  VAL n 
50 133  ARG n 
50 134  GLU n 
50 135  LEU n 
50 136  PHE n 
50 137  GLU n 
50 138  LYS n 
50 139  GLU n 
50 140  PRO n 
50 141  LEU n 
50 142  PRO n 
50 143  PRO n 
50 144  PRO n 
50 145  ARG n 
50 146  LYS n 
50 147  THR n 
50 148  ARG n 
50 149  ALA n 
50 150  GLU n 
50 151  LEU n 
50 152  MET n 
50 153  LYS n 
50 154  ALA n 
50 155  ILE n 
50 156  ASP n 
50 157  PHE n 
50 158  GLU n 
50 159  TYR n 
50 160  TYR n 
50 161  GLY n 
50 162  TYR n 
50 163  LEU n 
50 164  ASP n 
50 165  GLU n 
50 166  ASP n 
50 167  ASP n 
50 168  GLY n 
50 169  VAL n 
50 170  ILE n 
50 171  VAL n 
50 172  PRO n 
50 173  LEU n 
50 174  GLU n 
50 175  GLN n 
50 176  GLU n 
50 177  TYR n 
50 178  GLU n 
50 179  LYS n 
50 180  LYS n 
50 181  LEU n 
50 182  ARG n 
50 183  ALA n 
50 184  GLU n 
50 185  LEU n 
50 186  VAL n 
50 187  GLU n 
50 188  LYS n 
50 189  TRP n 
50 190  LYS n 
50 191  ALA n 
50 192  GLU n 
50 193  ARG n 
50 194  GLU n 
50 195  ALA n 
50 196  ARG n 
50 197  LEU n 
50 198  ALA n 
50 199  ARG n 
50 200  GLY n 
50 201  GLU n 
50 202  LYS n 
50 203  GLU n 
50 204  GLU n 
50 205  GLU n 
50 206  GLU n 
50 207  GLU n 
50 208  GLU n 
50 209  GLU n 
50 210  GLU n 
50 211  GLU n 
50 212  ILE n 
50 213  ASN n 
50 214  ILE n 
50 215  TYR n 
50 216  ALA n 
50 217  VAL n 
50 218  THR n 
50 219  GLU n 
50 220  GLU n 
50 221  GLU n 
50 222  SER n 
50 223  ASP n 
50 224  GLU n 
50 225  GLU n 
50 226  GLY n 
50 227  SER n 
50 228  GLN n 
50 229  GLU n 
50 230  LYS n 
50 231  GLY n 
50 232  GLY n 
50 233  ASP n 
50 234  ASP n 
50 235  SER n 
50 236  GLN n 
50 237  GLN n 
50 238  LYS n 
50 239  PHE n 
50 240  ILE n 
50 241  ALA n 
50 242  HIS n 
50 243  VAL n 
50 244  PRO n 
50 245  VAL n 
50 246  PRO n 
50 247  SER n 
50 248  GLN n 
50 249  GLN n 
50 250  GLU n 
50 251  ILE n 
50 252  GLU n 
50 253  GLU n 
50 254  ALA n 
50 255  LEU n 
50 256  VAL n 
50 257  ARG n 
50 258  ARG n 
50 259  LYS n 
50 260  LYS n 
50 261  MET n 
50 262  GLU n 
50 263  LEU n 
50 264  LEU n 
50 265  GLN n 
50 266  LYS n 
50 267  TYR n 
50 268  ALA n 
50 269  SER n 
50 270  GLU n 
50 271  THR n 
50 272  LEU n 
50 273  GLN n 
50 274  ALA n 
50 275  GLN n 
50 276  SER n 
50 277  GLU n 
50 278  GLU n 
50 279  ALA n 
50 280  ARG n 
50 281  ARG n 
50 282  LEU n 
50 283  LEU n 
50 284  GLY n 
50 285  TYR n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 322  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1 188  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1 619  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1 116  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 107  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 464  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 895  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 2335 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1 972  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 536  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 514  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 579  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1 802  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 1 848  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample 1 420  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample 1 144  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample 1 229  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample 1 2752 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample 1 166  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample 1 904  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample 1 369  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample 1 472  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample 1 343  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample 1 1304 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample 1 1217 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample 1 86   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample 1 110  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample 1 125  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample 1 396  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
30 1 sample 1 501  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
31 1 sample 1 357  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
32 1 sample 1 504  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
33 1 sample 1 225  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
34 1 sample 1 855  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
35 1 sample 1 908  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
36 1 sample 1 1485 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
37 1 sample 1 255  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
38 1 sample 1 225  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
39 1 sample 1 118  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
40 1 sample 1 86   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
41 1 sample 1 92   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
42 1 sample 1 76   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
43 1 sample 1 126  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
44 1 sample 1 240  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
45 1 sample 1 119  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
46 1 sample 1 301  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
47 1 sample 1 793  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
48 1 sample 1 1041 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
49 1 sample 1 2136 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
50 1 sample 1 285  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP RBMX2_HUMAN Q9Y388    ? 1  
;MNPLTKVKLINELNEREVQLGVADKVSWHSEYKDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFC
FLCYEDQRSTILAVDNFNGIKIKGRTIRVDHVSNYRAPKDSEEIDDVTRQLQEKGCGARTPSPSLSESSEDEKPTKKHKK
DKKEKKKKKKEKEKADREVQAEQPSSSSPRRKTVKEKDDTGPKKHSSKNSERAQKSEPREGQKLPKSRTAYSGGAEDLER
ELKKEKPKHEHKSSSRREAREEKTRIRDRGRSSDAHSSWYNGRSEGRSYRSRSRSRDKSHRHKRARRSRERESSNPSDRW
RH
;
1      
2  GB  X02665.1    36516     ? 2  
;AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGA
GGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUA
UUGCAGUACCUCCAGGAACGGUGCACCC
;
259    
3  UNP BUD13_HUMAN Q9BRD0    ? 3  
;MAAAPPLSKAEYLKRYLSGADAGVDRGSESGRKRRKKRPKPGGAGGKGMRIVDDDVSWTAISTTKLEKEEEEDDGDLPVV
AEFVDERPEEVKQMEAFRSSAKWKLLGGHNEDLPSNRHFRHDTPDSSPRRVRHGTPDPSPRKDRHDTPDPSPRRARHDTP
DPSPLRGARHDSDTSPPRRIRHDSSDTSPPRRARHDSPDPSPPRRPQHNSSGASPRRVRHDSPDPSPPRRARHGSSDISS
PRRVHNNSPDTSRRTLGSSDTQQLRRARHDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEY
DPDISPPRKKQAKSHFGDKKQLDSKGDCQKATDSDLSSPRHKQSPGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTK
SSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETMAFEAEFQYAETVFRDKSGRKRNLKLERLEQ
RRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNK
KVRPRYSGPAPPPNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM
;
1      
4  GB  X01691.1    36515     ? 4  
;AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCU
UAACCCAAUUUUUUGAGCCUUGCCUUGGCAAGGCUA
;
1      
5  GB  AC234778.5  254540252 ? 5  
;GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACG
CAAAUUCGUGAAGCGUUCCAUAUUUUU
;
114523 
6  UNP SF3A2_HUMAN Q15428    ? 6  
;MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQT
NLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIE
PPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNG
LPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAP
GVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGM
HPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN
;
1      
7  UNP SF3B2_HUMAN Q13435    ? 7  
;MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAP
PPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQ
EERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMG
APVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSK
KEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVK
KEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDV
TAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPK
MGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYG
PPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSE
EEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMM
GSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQP
QDSRGGSKKYKEFKF
;
1      
8  UNP PRP8_HUMAN  Q6P2Q9    ? 8  
;MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRK
FRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRH
FKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYR
LANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLY
NNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTAN
GIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATK
FFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDS
HVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFF
MRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCW
KANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPY
ITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSR
IKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGIN
NLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFI
VQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDP
NNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKC
RTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVN
TQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHE
EDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRT
DFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTN
AQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQE
LDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYA
RAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTE
PYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWK
TAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLY
DDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVA
SLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISA
ANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLP
GQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQ
NTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALL
QEGEVYSADREDLYA
;
1      
9  UNP U5S1_HUMAN  Q15029    ? 9  
;MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETI
VQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKR
YDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTL
GSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELG
IHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIV
KTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCV
MHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEP
LHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDS
FGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
;
1      
10 UNP SNW1_HUMAN  Q13573    ? 10 
;MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKK
KMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVA
AAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKH
EEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPR
TSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE
;
1      
11 UNP PLRG1_HUMAN O43660    ? 11 
;MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHK
QYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPT
AMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKL
SLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTK
ASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKF
PDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTA
EADKTIKVYREDDTATEETHPVSWKPEIIKRKRF
;
1      
12 UNP PRP17_HUMAN O60508    ? 12 
;MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQ
YNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAE
KNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTI
LHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYG
ERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKI
VQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQS
MDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHP
HETSKVITCGWDGLIKLWD
;
1      
13 UNP CDC5L_HUMAN Q99459    ? 13 
;MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPT
QWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLA
NTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFR
KLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIA
RQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQ
VVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGL
LGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLN
VEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEM
EVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKIL
LGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKS
KF
;
1      
14 UNP CRNL1_HUMAN Q9BZJ0    ? 14 
;MTATVENLTFQKDTLGNAVDKNTSRLELRSYSLAGRHGSTEPLVLAWSSQFRRLTWGCALDALHRSPCVAASQHGVTHLI
RSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQVPLPVPRSCLFSESFVVSVSSQSRFLASVPGTGVQRSTAA
DMAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRT
VISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYME
EMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYE
RAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQY
EEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQA
SLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENC
TSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFEL
SSGKEGSLTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEE
YFDYIFPEDAANQPNLKLLAMAKLWKKQQQEKEDAEHHPDEDVDESES
;
1      
15 UNP RBM22_HUMAN Q9NW64    ? 15 
;MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNV
CQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRN
RPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLG
DTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTD
SGIKLEPVPGLPGALPPPPAAEEEASANYFNLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPI
HYPSQDPQRMGAHAGKHSSP
;
1      
16 UNP BUD31_HUMAN P41223    ? 16 
;MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIK
EGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
;
1      
17 UNP CWC15_HUMAN Q9P013    ? 17 
;MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPT
REHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRM
ENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK
;
1      
18 UNP SRRM2_HUMAN Q9UQ35    ? 18 
;MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRRLEAALVKRPNPDILDHERKRRVELRCLELEEMMEEQ
GYEEQQIQEKVATFRLMLLEKDVNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREA
KQPAPEPPKPYSLVRESSSSRSPTPKQKKKKKKKDRGRRSESSSPRRERKKSSKKKKHRSESESKKRKHRSPTPKSKRKS
KDKKRKRSRSTTPAPKSRRAHRSTSADSASSSDTSRSRSRSAAAKTHTTALAGRSPSPASGRRGEGDAPFSEPGTTSTQR
PSSPETATKQPSSPYEDKDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLATTPLSQEPVNPPSEASPT
RDRSPPKSPEKLPQSSSSESSPPSPQPTKVSRHASSSPESPKPAPAPGSHREISSSPTSKNRSHGRAKRDKSHSHTPSRR
MGRSRSPATAKRGRSRSRTPTKRGHSRSRSPQWRRSRSAQRWGRSRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRG
RSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSP
ARRSGRSRSRTPARRGRSRSRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRGRSRSRSLVRRGRSHSRTPQR
RGRSGSSSERKNKSRTSQRRSRSNSSPEMKKSRISSRRSRSLSSPRSKAKSRLSLRRSLSGSSPCPKQKSQTPPRRSRSG
SSQPKAKSRTPPRRSRSSSSPPPKQKSKTPSRQSHSSSSPHPKVKSGTPPRQGSITSPQANEQSVTPQRRSCFESSPDPE
LKSRTPSRHSCSGSSPPRVKSSTPPRQSPSRSSSPQPKVKAIISPRQRSHSGSSSPSPSRVTSRTTPRRSRSVSPCSNVE
SRLLPRYSHSGSSSPDTKVKPETPPRQSHSGSISPYPKVKAQTPPGPSLSGSKSPCPQEKSKDSLVQSCPGSLSLCAGVK
SSTPPGESYFGVSSLQLKGQSQTSPDHRSDTSSPEVRQSHSESPSLQSKSQTSPKGGRSRSSSPVTELASRSPIRQDRGE
FSASPMLKSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSL
VFKDTLRTPPRERSGAGSSPETKEQNSALPTSSQDEELMEVVEKSEEPAGQILSHLSSELKEMSTSNFESSPEVEERPAV
SLTLDQSQSQASLEAVEVPSMASSWGGPHFSPEHKELSNSPLRENSFGSPLEFRNSGPLGTEMNTGFSSEVKEDLNGPFL
NQLETDPSLDMKEQSTRSSGHSSSELSPDAVEKAGMSSNQSISSPVLDAVPRTPSRERSSSASSPEMKDGLPRTPSRRSR
SGSSPGLRDGSGTPSRHSLSGSSPGMKDIPRTPSRGRSECDSSPEPKALPQTPRPRSRSPSSPELNNKCLTPQRERSGSE
SSVDQKTVARTPLGQRSRSGSSQELDVKPSASPQERSESDSSPDSKAKTRTPLRQRSRSGSSPEVDSKSRLSPRRSRSGS
SPEVKDKPRAAPRAQSGSDSSPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSSPEPKT
KSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRG
RSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRG
RSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSR
RRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSP
VTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSA
SGSSSDRSRSATPPATRNHSGSRTPPVALNSSRMSCFSRPSMSPTPLDRCRSPGMLEPLGSSRTPMSVLQQAGGSMMDGP
GPRIPDHQRTSVPENHAQSRIALALTAISLGTARPPPSMSAAGLAARMSQVPAPVPLMSLRTAPAANLASRIPAASAAAM
NLASARTPAIPTAVNLADSRTPAAAAAMNLASPRTAVAPSAVNLADPRTPTAPAVNLAGARTPAALAALSLTGSGTPPTA
ANYPSSSRTPQAPASANLVGPRSAHATAPVNIAGSRTAAALAPASLTSARMAPALSGANLTSPRVPLSAYERVSGRTSPP
LLDRARSRTPPSAPSQSRMTSERAPSPSSRMGQAPSQSLLPPAQDQPRSPVPSAFSDQSRCLIAQTTPVAGSQSLSSGAV
ATTTSSAGDHNGMLSVPAPGVPHSDVGEPPASTGAQQPSALAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSS
SDSEGSSLPVQPEVALKRVPSPTPAPKEAVREGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
SSSSSSSSPSPAKPGPQALPKPASPKKPPPGERRSRSPRKPIDSLRDSRSLSYSPVERRRPSPQPSPRDQQSSSSERGSR
RGQRGDSRSPSHKRRRETPSPRPMRHRSSRSP
;
1      
19 UNP PPIL1_HUMAN Q9Y3C6    ? 19 
;MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK
QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKII
KAYPSG
;
1      
20 UNP SRRM1_HUMAN Q8IYB3    ? 20 
;MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNP
DSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKE
SSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPELPEPSVKVKEPSVQEATS
TSDILKVPKPEPIPEPKEPSPEKNSKKEKEKEKTRPRSRSRSKSRSRTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRR
PSPRRRTPPRRMPPPPRHRRSRSPVRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHR
PSPPATPPPKTRHSPTPQQSNRTRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGGKMAAADSVQ
QRRQYRRQNQQSSSDSGSSSSSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSPRGRRRRSPSPPPTRRRRS
PSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPP
PKQRSSPVTKRRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTSSSPPPVRRGASSSPQRRQSPSPSTRP
IRRVSRTPEPKKIKKAASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPPSPVQSQSPSTNWSPAVPVKKAKSPTPSPSPPR
NSDQEGGGKKKKKKKDKKHKKDKKHKKHKKHKKEKAVAAAAAAAVTPAAIAAATTTLAQEEPVAAPEPKKETESEAEDNL
DDLEKHLREKALRSMRKAQVSPQS
;
1      
21 PDB 6FF7        6FF7      ? 21 ? 1      
22 UNP CWC27_HUMAN Q6UX04    ? 22 
;MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTGTGSGGESIYG
APFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPHK
IKSCEVLFNPFDDIIPREIKRLKKEKPEEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDP
HLSSVPVVESEKGDAPDLVDDGEDESAEHDEYIDGDEKNLMRERIAKKLKKDTSANVKSAGEGEVEKKSVSRSEELRKEA
RQLKRELLAAKQKKVENAAKQAEKRSEEEEAPPDGAVAEYRREKQKYEALRKQQSKKGTSREDQTLALLNQFKSKLTQAI
AETPENDIPETEVEDDEGWMSHVLQFEDKSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR
;
1      
23 UNP R113A_HUMAN O15541    ? 23 
;MAEQLSPGKAVDQVCTFLFKKPGRKGAAGRRKRPACDPEPGESGSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAY
GDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQ
KYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGR
YGVYEDENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKH
RATGEGGASDLPEDPDEDAIPIT
;
1      
24 UNP SF3B1_HUMAN O75533    ? 24 
;MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQK
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQH
LTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAK
GSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGG
DSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLS
DEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLV
DVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRIL
YKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALG
IPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYG
IESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDG
VEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLG
AADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAV
VMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVG
RIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVA
ETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVY
GFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDAL
IAHYPRIYNDDKNTYIRYELDYIL
;
1      
25 UNP SF3B3_HUMAN Q15393    ? 25 
;MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVV
GSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEA
HKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPG
GSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDED
MVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDE
LDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVN
ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTG
GELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESL
CIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSW
LSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIII
ETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLV
QLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVL
IGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLD
YDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYT
TLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT
PPEVSKKLEDIRTRYAF
;
1      
26 UNP SF3B5_HUMAN Q9BWJ5    ? 26 
;MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPA
DKPEEN
;
1      
27 UNP PHF5A_HUMAN Q7RTV0    ? 27 
;MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEK
DRDGCPKIVNLGSSKTDLFYERKKYGFKKR
;
1      
28 UNP SF3B6_HUMAN Q9Y3B4    ? 28 
;MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGF
NVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
;
1      
29 UNP SNIP1_HUMAN Q8TAD8    ? 29 
;MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEPARSGHRGNRARGVSRSPPKK
KNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGREDRQHREPSEQEHRRARNSDRDRHRGHSHQRRTSNERPGSG
QGQGRDRDTQNLQAQEEEREFYNARRREHRQRNDVGGGGSESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFR
GVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVFQYRLVEYTRADGTV
GRRVKPYIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKFGFSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS
;
1      
30 UNP SF3A3_HUMAN Q12874    ? 30 
;METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNE
FAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDY
ITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHA
GAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDI
AFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLH
GLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYE
DSSGNVVNKKTYEDLKRQGLL
;
1      
31 UNP SNR40_HUMAN Q96DI7    ? 31 
;MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGST
LASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPA
RRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTG
LSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRIL
YKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
;
1      
32 UNP PRP19_HUMAN Q9UMS4    ? 32 
;MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQD
EWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPM
DLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTG
GADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDY
LLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAF
SENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTG
VAFGHHAKFIASTGMDRSLKFYSL
;
1      
33 UNP SPF27_HUMAN O75934    ? 33 
;MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIE
LLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHI
QDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
;
1      
34 UNP SYF1_HUMAN  Q9HCS7    ? 34 
;MVVMARLSRPERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRA
QVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHP
LPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLDEAAQRLATVVNDERFVSKAGKSNYQLWHELCDLISQNPDKVQSLNV
DAIIRGGLTRFTDQLGKLWCSLADYYIRSGHFEKARDVYEEAIRTVMTVRDFTQVFDSYAQFEESMIAAKMETASELGRE
EEDDVDLELRLARFEQLISRRPLLLNSVLLRQNPHHVHEWHKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVA
FAKFYEDNGQLDDARVILEKATKVNFKQVDDLASVWCQCGELELRHENYDEALRLLRKATALPARRAEYFDGSEPVQNRV
YKSLKVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFKAYERGISLFKWPNVSDIWSTY
LTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAA
EIYGVTHTRGIYQKAIEVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTI
KEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLAAEAERDQPLRAQSKILFVRS
DASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQSVPAAVFGSLKED
;
1      
35 UNP CWC22_HUMAN Q9HCG8    ? 35 
;MKSSVAQIKPSSGHDRRENLNSYQRNSSPEDRYEEQERSPRDRDYFDYSRSDYEHSRRGRSYDSSMESRNRDREKRRERE
RDTDRKRSRKSPSPGRRNPETSVTQSSSAQDEPATKKKKDELDPLLTRTGGAYIPPAKLRMMQEQITDKNSLAYQRMSWE
ALKKSINGLINKVNISNISIIIQELLQENIVRGRGLLSRSVLQAQSASPIFTHVYAALVAIINSKFPQIGELILKRLILN
FRKGYRRNDKQLCLTASKFVAHLINQNVAHEVLCLEMLTLLLERPTDDSVEVAIGFLKECGLKLTQVSPRGINAIFERLR
NILHESEIDKRVQYMIEVMFAVRKDGFKDHPIILEGLDLVEEDDQFTHMLPLEDDYNPEDVLNVFKMDPNFMENEEKYKA
IKKEILDEGDTDSNTDQDAGSSEEDEEEEEEEGEEDEEGQKVTIHDKTEINLVSFRRTIYLAIQSSLDFEECAHKLLKME
FPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKKEYMESFEGIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSL
PWSVLECIKLSEETTTSSSRIFVKIFFQELCEYMGLPKLNARLKDETLQPFFEGLLPRDNPRNTRFAINFFTSIGLGGLT
DELREHLKNTPKVIVAQKPDVEQNKSSPSSSSSASSSSESDSSDSDSDSSDSSSESSSEESDSSSISSHSSASANDVRKK
GHGKTRSKEVDKLIRNQQTNDRKQKERRQEHGHQETRTERERRSEKHRDQNSSGSNWRDPITKYTSDKDVPSERNNYSRV
ANDRDQEMHIDLENKHGDPKKKRGERRNSFSENEKHTHRIKDSENFRRKDRSKSKEMNRKHSGSRSDEDRYQNGAERRWE
KSSRYSEQSRESKKNQDRRREKSPAKQK
;
1      
36 UNP AQR_HUMAN   O60306    ? 36 
;MAAPAQPKKIVAPTVSQINAEFVTQLACKYWAPHIKKKSPFDIKVIEDIYEKEIVKSRFAIRKIMLLEFSQYLENYLWMN
YSPEVSSKAYLMSICCMVNEKFRENVPAWEIFKKKPDHFPFFFKHILKAALAETDGEFSLHEQTVLLLFLDHCFNSLEVD
LIRSQVQQLISLPMWMGLQLARLELELKKTPKLRKFWNLIKKNDEKMDPEAREQAYQERRFLSQLIQKFISVLKSVPLSE
PVTMDKVHYCERFIELMIDLEALLPTRRWFNTILDDSHLLVHCYLSNLVRREEDGHLFSQLLDMLKFYTGFEINDQTGNA
LTENEMTTIHYDRITSLQRAAFAHFPELYDFALSNVAEVDTRESLVKFFGPLSSNTLHQVASYLCLLPTLPKNEDTTFDK
EFLLELLVSRHERRISQIQQLNQMPLYPTEKIIWDENIVPTEYYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYE
IRQDIEDSVSRMKPWQSEYGGVVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADVTINLNVRDHIKDEWEGLRKHD
VCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIEDGPEPRPNLRGESRTFRVFLDPNQYQQDMTN
TIQNGAEDVYETFNIIMRRKPKENNFKAVLETIRNLMNTDCVVPDWLHDIILGYGDPSSAHYSKMPNQIATLDFNDTFLS
IEHLKASFPGHNVKVTVEDPALQIPPFRITFPVRSGKGKKRKDADVEDEDTEEAKTLIVEPHVIPNRGPYPYNQPKRNTI
QFTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNIYHNFPEQRTLIVTHSNQALNQLFEKIMALDIDERHLLRLG
HGEEELETEKDFSRYGRVNYVLARRIELLEEVKRLQKSLGVPGDASYTCETAGYFFLYQVMSRWEEYISKVKNKGSTLPD
VTEVSTFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCFRHIKKIFTQLEEFRASELLRSGLDRSKYLLVKEAKIIAMTCT
HAALKRHDLVKLGFKYDNILMEEAAQILEIETFIPLLLQNPQDGFSRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLF
TRFVRVGVPTVDLDAQGRARASLCNLYNWRYKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGVGESEPNPYFYQN
LGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNKVTTVDRFQGQQNDYILLSLVRTRA
VGHLRDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAFSQLTARPLHLHIIPTEPFPTTRKNGERPSHEVQIIKNMPQ
MANFVYNMYMHLIQTTHHYHQTLLQLPPAMVEEGEEVQNQETELETEEEAMTVQADIIPSPTDTSCRQETPAFQTDTTPS
ETGATSTPEAIPALSETTPTVVGAVSAPAEANTPQDATSAPEETK
;
1      
37 UNP RU2A_HUMAN  P09661    ? 37 
;MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIG
EGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEK
MFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTD
DGEEEMEEDTVTNGS
;
1      
38 UNP RU2B_HUMAN  P08579    ? 38 
;MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMR
IQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPE
ETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
;
1      
39 UNP SMD2_HUMAN  P62316    ? 39 
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
1      
40 UNP RUXF_HUMAN  P62306    ? 40 
;MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEE
DGEMRE
;
1      
41 UNP RUXE_HUMAN  P62304    ? 41 
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
1      
42 UNP RUXG_HUMAN  P62308    ? 42 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 1      
43 UNP SMD3_HUMAN  P62318    ? 43 
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
1      
44 UNP RSMB_HUMAN  P14678    ? 44 
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATAS
IAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

;
1      
45 UNP SMD1_HUMAN  P62314    ? 45 
;MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLL
VDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
;
1      
46 UNP PPIE_HUMAN  Q9UNP9    ? 46 
;MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVN
LAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLL
RSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG
PNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV
;
1      
47 UNP SF3A1_HUMAN Q15459    ? 47 
;MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPK
FNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSIS
AFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVL
DQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGES
EEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKP
LPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVE
ETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPP
SSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMA
PRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEW
KLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK
;
1      
48 UNP DHX16_HUMAN O60231    ? 48 
;MATPAGLERWVQDELHSVLGLSERHVAQFLIGTAQRCTSAEEFVQRLRDTDTLDLSGPARDFALRLWNKVPRKAVVEKPA
RAAEREARALLEKNRSYRLLEDSEESSEETVSRAGSSLQKKRKKRKHLRKKREEEEEEEASEKGKKKTGGSKQQTEKPES
EDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVLERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKRER
EKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEKLEATNRYHMPKETRGQPARAVDLVEEESG
APGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLP
VFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYS
IRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARF
STFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIR
ELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASAN
QRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALG
ALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLV
LLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYR
TVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKKIGKTREEL
G
;
1      
49 UNP U520_HUMAN  O75643    ? 49 
;MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHD
INKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLL
LGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKV
LRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGG
EALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLA
TYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIE
MTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ
VLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDL
FADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYL
SLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA
ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKL
LERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDK
RMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV
ELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCET
QLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICA
EFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWK
QRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRP
VPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPY
LEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYP
IYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFL
YRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKT
KVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAI
RLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLT
DSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIK
RLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD
;
1      
50 UNP ISY1_HUMAN  Q9ULR0    ? 50 
;MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKL
LREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRKTRAELMKAIDFEYY
GYLDEDDGVIVPLEQEYEKKLRAELVEKWKAEREARLARGEKEEEEEEEEEINIYAVTEEESDEEGSQEKGGDDSQQKFI
AHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEEARRLLGY
;
1      
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6FF7 1 1 ? 322  ? Q9Y388    1      ? 322    ? 1 322  
2  2  6FF7 2 1 ? 188  ? 36516     259    ? 446    ? 1 188  
3  3  6FF7 3 1 ? 619  ? Q9BRD0    1      ? 619    ? 1 619  
4  4  6FF7 5 1 ? 116  ? 36515     1      ? 116    ? 1 116  
5  5  6FF7 6 1 ? 107  ? 254540252 114523 ? 114417 ? 1 107  
6  6  6FF7 7 1 ? 464  ? Q15428    1      ? 464    ? 1 464  
7  7  6FF7 8 1 ? 895  ? Q13435    1      ? 895    ? 1 895  
8  8  6FF7 A 1 ? 2335 ? Q6P2Q9    1      ? 2335   ? 1 2335 
9  9  6FF7 B 1 ? 972  ? Q15029    1      ? 972    ? 1 972  
10 10 6FF7 C 1 ? 536  ? Q13573    1      ? 536    ? 1 536  
11 11 6FF7 D 1 ? 514  ? O43660    1      ? 514    ? 1 514  
12 12 6FF7 E 1 ? 579  ? O60508    1      ? 579    ? 1 579  
13 13 6FF7 L 1 ? 802  ? Q99459    1      ? 802    ? 1 802  
14 14 6FF7 O 1 ? 848  ? Q9BZJ0    1      ? 848    ? 1 848  
15 15 6FF7 P 1 ? 420  ? Q9NW64    1      ? 420    ? 1 420  
16 16 6FF7 Q 1 ? 144  ? P41223    1      ? 144    ? 1 144  
17 17 6FF7 R 1 ? 229  ? Q9P013    1      ? 229    ? 1 229  
18 18 6FF7 S 1 ? 2752 ? Q9UQ35    1      ? 2752   ? 1 2752 
19 19 6FF7 V 1 ? 166  ? Q9Y3C6    1      ? 166    ? 1 166  
20 20 6FF7 Y 1 ? 904  ? Q8IYB3    1      ? 904    ? 1 904  
21 21 6FF7 Z 1 ? 369  ? 6FF7      1      ? 478    ? 1 478  
22 22 6FF7 s 1 ? 472  ? Q6UX04    1      ? 472    ? 1 472  
23 23 6FF7 t 1 ? 343  ? O15541    1      ? 343    ? 1 343  
24 24 6FF7 u 1 ? 1304 ? O75533    1      ? 1304   ? 1 1304 
25 25 6FF7 v 1 ? 1217 ? Q15393    1      ? 1217   ? 1 1217 
26 26 6FF7 x 1 ? 86   ? Q9BWJ5    1      ? 86     ? 1 86   
27 27 6FF7 y 1 ? 110  ? Q7RTV0    1      ? 110    ? 1 110  
28 28 6FF7 z 1 ? 125  ? Q9Y3B4    1      ? 125    ? 1 125  
29 29 6FF7 0 1 ? 396  ? Q8TAD8    1      ? 396    ? 1 396  
30 30 6FF7 9 1 ? 501  ? Q12874    1      ? 501    ? 1 501  
31 31 6FF7 F 1 ? 357  ? Q96DI7    1      ? 357    ? 1 357  
32 32 6FF7 G 1 ? 504  ? Q9UMS4    1      ? 504    ? 1 504  
33 32 6FF7 H 1 ? 504  ? Q9UMS4    1      ? 504    ? 1 504  
34 32 6FF7 I 1 ? 504  ? Q9UMS4    1      ? 504    ? 1 504  
35 32 6FF7 J 1 ? 504  ? Q9UMS4    1      ? 504    ? 1 504  
36 33 6FF7 K 1 ? 225  ? O75934    1      ? 225    ? 1 225  
37 34 6FF7 M 1 ? 855  ? Q9HCS7    1      ? 855    ? 1 855  
38 35 6FF7 T 1 ? 908  ? Q9HCG8    1      ? 908    ? 1 908  
39 36 6FF7 U 1 ? 1485 ? O60306    1      ? 1485   ? 1 1485 
40 37 6FF7 W 1 ? 255  ? P09661    1      ? 255    ? 1 255  
41 38 6FF7 X 1 ? 225  ? P08579    1      ? 225    ? 4 225  
42 39 6FF7 a 1 ? 118  ? P62316    1      ? 118    ? 1 118  
43 40 6FF7 b 1 ? 86   ? P62306    1      ? 86     ? 1 86   
44 41 6FF7 c 1 ? 92   ? P62304    1      ? 92     ? 1 92   
45 42 6FF7 d 1 ? 76   ? P62308    1      ? 76     ? 1 76   
46 43 6FF7 e 1 ? 126  ? P62318    1      ? 126    ? 1 126  
47 44 6FF7 f 1 ? 240  ? P14678    1      ? 240    ? 1 240  
48 45 6FF7 g 1 ? 119  ? P62314    1      ? 119    ? 1 119  
49 39 6FF7 h 1 ? 118  ? P62316    1      ? 118    ? 1 118  
50 40 6FF7 i 1 ? 86   ? P62306    1      ? 86     ? 1 86   
51 41 6FF7 j 1 ? 92   ? P62304    1      ? 92     ? 1 92   
52 42 6FF7 k 1 ? 76   ? P62308    1      ? 76     ? 1 76   
53 43 6FF7 l 1 ? 126  ? P62318    1      ? 126    ? 1 126  
54 44 6FF7 m 1 ? 240  ? P14678    1      ? 240    ? 1 240  
55 45 6FF7 n 1 ? 119  ? P62314    1      ? 119    ? 1 119  
56 46 6FF7 o 1 ? 301  ? Q9UNP9    1      ? 301    ? 1 301  
57 47 6FF7 p 1 ? 793  ? Q15459    1      ? 793    ? 1 793  
58 48 6FF7 q 1 ? 1041 ? O60231    1      ? 1041   ? 2 1042 
59 49 6FF7 r 1 ? 2136 ? O75643    1      ? 2136   ? 1 2136 
60 50 6FF7 w 1 ? 285  ? Q9ULR0    1      ? 285    ? 1 285  
61 28 6FF7 N 1 ? 125  ? Q9Y3B4    1      ? 125    ? 1 125  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
40 6FF7 ASP W 89  ? UNP P09661 CYS 89  conflict 89  1 
40 6FF7 CYS W 119 ? UNP P09661 SER 119 conflict 119 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ?                                                                      
'C10 H14 N5 O7 P'   347.221 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"   ?                                                                      
'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                      ?                                                                      
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                     ?                                                                      
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ?                                                                      
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ?                                                                      
'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ?                                                                      
'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                     ?                                                                      
'C3 H7 N O2 S'      121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ?                                                                      
'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ?                                                                      
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ?                                                                      
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                      ?                                                                      
'C2 H5 N O2'        75.067  
GTP non-polymer         n "GUANOSINE-5'-TRIPHOSPHATE"  ?                                                                      
'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking' y HISTIDINE                    ?                                                                      
'C6 H10 N3 O2 1'    156.162 
IHP non-polymer         . 'INOSITOL HEXAKISPHOSPHATE'  'MYO-INOSITOL HEXAKISPHOSPHATE; INOSITOL 1,2,3,4,5,6-HEXAKISPHOSPHATE' 
'C6 H18 O24 P6'     660.035 
ILE 'L-peptide linking' y ISOLEUCINE                   ?                                                                      
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                      ?                                                                      
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                       ?                                                                      
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                   ?                                                                      
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ?                                                                      
'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ?                                                                      
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                      ?                                                                      
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                       ?                                                                      
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                    ?                                                                      
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ?                                                                      
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                     ?                                                                      
'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ?                                                                      
'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                       ?                                                                      
'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                   ?                                                                      
'Zn 2'              65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6FF7 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6FF7 
_struct.title                        'human Bact spliceosome core structure' 
_struct.pdbx_descriptor              
;RNA-binding motif protein, X-linked 2, BUD13 homolog, Splicing factor 3A subunit 2, Splicing factor 3B subunit 2, Pre-mRNA-processing-splicing factor 8, 116 kDa U5 small nuclear ribonucleoprotein component, SNW domain-containing protein 1, Pleiotropic regulator 1, Pre-mRNA-processing factor 17, Cell division cycle 5-like protein, Crooked neck-like protein 1, Pre-mRNA-splicing factor RBM22, Protein BUD31 homolog, Spliceosome-associated protein CWC15 homolog, Serine/arginine repetitive matrix protein 2, Peptidyl-prolyl cis-trans isomerase-like 1, Serine/arginine repetitive matrix protein 1, Peptidyl-prolyl cis-trans isomerase CWC27 homolog, RING finger protein 113A, Splicing factor 3B subunit 1, Splicing factor 3B subunit 3, Splicing factor 3B subunit 5, PHD finger-like domain-containing protein 5A, Splicing factor 3B subunit 6, Smad nuclear-interacting protein 1, Splicing factor 3A subunit 3, U5 small nuclear ribonucleoprotein 40 kDa protein, Pre-mRNA-processing factor 19, Pre-mRNA-splicing factor SPF27, Pre-mRNA-splicing factor SYF1, Pre-mRNA-splicing factor CWC22 homolog, Intron-binding protein aquarius, U2 small nuclear ribonucleoprotein A', U2 small nuclear ribonucleoprotein B'', Small nuclear ribonucleoprotein Sm D2, Small nuclear ribonucleoprotein F, Small nuclear ribonucleoprotein E, Small nuclear ribonucleoprotein G, Small nuclear ribonucleoprotein Sm D3, Small nuclear ribonucleoprotein-associated proteins B and B', Small nuclear ribonucleoprotein Sm D1, Peptidyl-prolyl cis-trans isomerase E, Splicing factor 3A subunit 1, Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16, U5 small nuclear ribonucleoprotein 200 kDa helicase, Pre-mRNA-splicing factor ISY1 homolog/RNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6FF7 
_struct_keywords.text            'spliceosome, human, HELA, BACT, dynamics, SPLICING' 
_struct_keywords.pdbx_keywords   SPLICING 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 32 ? 
GA N N 32 ? 
HA N N 32 ? 
IA N N 32 ? 
JA N N 33 ? 
KA N N 34 ? 
LA N N 35 ? 
MA N N 36 ? 
NA N N 37 ? 
OA N N 38 ? 
PA N N 39 ? 
QA N N 40 ? 
RA N N 41 ? 
SA N N 42 ? 
TA N N 43 ? 
UA N N 44 ? 
VA N N 45 ? 
WA N N 39 ? 
XA N N 40 ? 
YA N N 41 ? 
ZA N N 42 ? 
AB N N 43 ? 
BB N N 44 ? 
CB N N 45 ? 
DB N N 46 ? 
EB N N 47 ? 
FB N N 48 ? 
GB N N 49 ? 
HB N N 50 ? 
IB N N 28 ? 
JB N N 51 ? 
KB N N 52 ? 
LB N N 52 ? 
MB N N 52 ? 
NB N N 52 ? 
OB N N 53 ? 
PB N N 54 ? 
QB N N 51 ? 
RB N N 51 ? 
SB N N 51 ? 
TB N N 51 ? 
UB N N 51 ? 
VB N N 51 ? 
WB N N 51 ? 
XB N N 51 ? 
YB N N 51 ? 
ZB N N 51 ? 
AC N N 55 ? 
BC N N 55 ? 
CC N N 52 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 LEU A  4    ? GLY A  21   ? LEU 1 4    GLY 1 21   1 ? 18 
HELX_P HELX_P2   AA2 THR A  48   ? SER A  57   ? THR 1 48   SER 1 57   1 ? 10 
HELX_P HELX_P3   AA3 ASP A  86   ? PHE A  97   ? ASP 1 86   PHE 1 97   1 ? 12 
HELX_P HELX_P4   AA4 LEU C  501  ? MET C  518  ? LEU 3 501  MET 3 518  1 ? 18 
HELX_P HELX_P5   AA5 ASP C  530  ? GLU C  537  ? ASP 3 530  GLU 3 537  1 ? 8  
HELX_P HELX_P6   AA6 MET C  545  ? LYS C  550  ? MET 3 545  LYS 3 550  1 ? 6  
HELX_P HELX_P7   AA7 PHE C  593  ? VAL C  616  ? PHE 3 593  VAL 3 616  1 ? 24 
HELX_P HELX_P8   AA8 SER F  18   ? LYS F  42   ? SER 7 18   LYS 7 42   1 ? 25 
HELX_P HELX_P9   AA9 ASN F  65   ? LEU F  70   ? ASN 7 65   LEU 7 70   1 ? 6  
HELX_P HELX_P10  AB1 LEU F  82   ? ALA F  90   ? LEU 7 82   ALA 7 90   1 ? 9  
HELX_P HELX_P11  AB2 THR G  461  ? LEU G  468  ? THR 8 461  LEU 8 468  1 ? 8  
HELX_P HELX_P12  AB3 ASP G  484  ? ALA G  493  ? ASP 8 484  ALA 8 493  1 ? 10 
HELX_P HELX_P13  AB4 PRO G  525  ? ARG G  530  ? PRO 8 525  ARG 8 530  1 ? 6  
HELX_P HELX_P14  AB5 GLY G  532  ? GLN G  546  ? GLY 8 532  GLN 8 546  1 ? 15 
HELX_P HELX_P15  AB6 THR G  548  ? ARG G  558  ? THR 8 548  ARG 8 558  1 ? 11 
HELX_P HELX_P16  AB7 TYR G  568  ? PHE G  576  ? TYR 8 568  PHE 8 576  1 ? 9  
HELX_P HELX_P17  AB8 GLU H  28   ? TYR H  45   ? GLU A 28   TYR A 45   1 ? 18 
HELX_P HELX_P18  AB9 PRO H  63   ? GLY H  74   ? PRO A 63   GLY A 74   1 ? 12 
HELX_P HELX_P19  AC1 ASP H  84   ? ALA H  91   ? ASP A 84   ALA A 91   1 ? 8  
HELX_P HELX_P20  AC2 TYR H  94   ? GLU H  104  ? TYR A 94   GLU A 104  1 ? 11 
HELX_P HELX_P21  AC3 ILE H  136  ? ASP H  157  ? ILE A 136  ASP A 157  1 ? 22 
HELX_P HELX_P22  AC4 THR H  231  ? ALA H  242  ? THR A 231  ALA A 242  1 ? 12 
HELX_P HELX_P23  AC5 ASP H  259  ? LEU H  269  ? ASP A 259  LEU A 269  1 ? 11 
HELX_P HELX_P24  AC6 ASP H  290  ? ASP H  298  ? ASP A 290  ASP A 298  1 ? 9  
HELX_P HELX_P25  AC7 ARG H  309  ? PHE H  316  ? ARG A 309  PHE A 316  1 ? 8  
HELX_P HELX_P26  AC8 THR H  398  ? TRP H  406  ? THR A 398  TRP A 406  1 ? 9  
HELX_P HELX_P27  AC9 PRO H  440  ? LYS H  460  ? PRO A 440  LYS A 460  1 ? 21 
HELX_P HELX_P28  AD1 PHE H  473  ? ALA H  478  ? PHE A 473  ALA A 478  1 ? 6  
HELX_P HELX_P29  AD2 ASP H  488  ? LYS H  511  ? ASP A 488  LYS A 511  1 ? 24 
HELX_P HELX_P30  AD3 THR H  531  ? LYS H  536  ? THR A 531  LYS A 536  1 ? 6  
HELX_P HELX_P31  AD4 GLY H  541  ? GLY H  567  ? GLY A 541  GLY A 567  1 ? 27 
HELX_P HELX_P32  AD5 ASP H  570  ? HIS H  584  ? ASP A 570  HIS A 584  1 ? 15 
HELX_P HELX_P33  AD6 GLY H  590  ? TYR H  594  ? GLY A 590  TYR A 594  5 ? 5  
HELX_P HELX_P34  AD7 TYR H  596  ? ASN H  617  ? TYR A 596  ASN A 617  1 ? 22 
HELX_P HELX_P35  AD8 TRP H  630  ? GLU H  661  ? TRP A 630  GLU A 661  1 ? 32 
HELX_P HELX_P36  AD9 VAL H  677  ? LEU H  694  ? VAL A 677  LEU A 694  1 ? 18 
HELX_P HELX_P37  AE1 ARG H  707  ? ALA H  722  ? ARG A 707  ALA A 722  1 ? 16 
HELX_P HELX_P38  AE2 PRO H  732  ? GLY H  764  ? PRO A 732  GLY A 764  1 ? 33 
HELX_P HELX_P39  AE3 ASP H  768  ? GLY H  798  ? ASP A 768  GLY A 798  1 ? 31 
HELX_P HELX_P40  AE4 THR H  802  ? ARG H  821  ? THR A 802  ARG A 821  1 ? 20 
HELX_P HELX_P41  AE5 ASP H  835  ? GLU H  848  ? ASP A 835  GLU A 848  1 ? 14 
HELX_P HELX_P42  AE6 GLN H  858  ? ASN H  873  ? GLN A 858  ASN A 873  1 ? 16 
HELX_P HELX_P43  AE7 ASN H  873  ? THR H  887  ? ASN A 873  THR A 887  1 ? 15 
HELX_P HELX_P44  AE8 GLU H  912  ? ARG H  933  ? GLU A 912  ARG A 933  1 ? 22 
HELX_P HELX_P45  AE9 GLU H  946  ? VAL H  952  ? GLU A 946  VAL A 952  1 ? 7  
HELX_P HELX_P46  AF1 TRP H  955  ? ASN H  961  ? TRP A 955  ASN A 961  1 ? 7  
HELX_P HELX_P47  AF2 ASP H  989  ? LEU H  997  ? ASP A 989  LEU A 997  1 ? 9  
HELX_P HELX_P48  AF3 ASP H  1002 ? ASN H  1013 ? ASP A 1002 ASN A 1013 1 ? 12 
HELX_P HELX_P49  AF4 PHE H  1036 ? LEU H  1053 ? PHE A 1036 LEU A 1053 1 ? 18 
HELX_P HELX_P50  AF5 LEU H  1055 ? GLY H  1063 ? LEU A 1055 GLY A 1063 1 ? 9  
HELX_P HELX_P51  AF6 ILE H  1077 ? ALA H  1082 ? ILE A 1077 ALA A 1082 1 ? 6  
HELX_P HELX_P52  AF7 THR H  1102 ? LEU H  1114 ? THR A 1102 LEU A 1114 1 ? 13 
HELX_P HELX_P53  AF8 MET H  1143 ? ASN H  1159 ? MET A 1143 ASN A 1159 1 ? 17 
HELX_P HELX_P54  AF9 ASP H  1233 ? SER H  1251 ? ASP A 1233 SER A 1251 1 ? 19 
HELX_P HELX_P55  AG1 THR H  1255 ? THR H  1272 ? THR A 1255 THR A 1272 1 ? 18 
HELX_P HELX_P56  AG2 GLU H  1276 ? THR H  1281 ? GLU A 1276 THR A 1281 1 ? 6  
HELX_P HELX_P57  AG3 THR H  1281 ? LEU H  1303 ? THR A 1281 LEU A 1303 1 ? 23 
HELX_P HELX_P58  AG4 ASP H  1339 ? LYS H  1344 ? ASP A 1339 LYS A 1344 1 ? 6  
HELX_P HELX_P59  AG5 LEU H  1368 ? ILE H  1372 ? LEU A 1368 ILE A 1372 5 ? 5  
HELX_P HELX_P60  AG6 PRO H  1374 ? GLN H  1399 ? PRO A 1374 GLN A 1399 1 ? 26 
HELX_P HELX_P61  AG7 ARG H  1418 ? LEU H  1422 ? ARG A 1418 LEU A 1422 5 ? 5  
HELX_P HELX_P62  AG8 ASP H  1426 ? ALA H  1431 ? ASP A 1426 ALA A 1431 1 ? 6  
HELX_P HELX_P63  AG9 VAL H  1438 ? LYS H  1443 ? VAL A 1438 LYS A 1443 1 ? 6  
HELX_P HELX_P64  AH1 GLN H  1444 ? GLN H  1446 ? GLN A 1444 GLN A 1446 5 ? 3  
HELX_P HELX_P65  AH2 HIS H  1457 ? GLY H  1462 ? HIS A 1457 GLY A 1462 1 ? 6  
HELX_P HELX_P66  AH3 ASN H  1468 ? GLY H  1479 ? ASN A 1468 GLY A 1479 1 ? 12 
HELX_P HELX_P67  AH4 ASN H  1520 ? GLY H  1525 ? ASN A 1520 GLY A 1525 1 ? 6  
HELX_P HELX_P68  AH5 ASN H  1527 ? TRP H  1538 ? ASN A 1527 TRP A 1538 1 ? 12 
HELX_P HELX_P69  AH6 SER H  1539 ? ILE H  1542 ? SER A 1539 ILE A 1542 5 ? 4  
HELX_P HELX_P70  AH7 ILE H  1566 ? GLN H  1575 ? ILE A 1566 GLN A 1575 1 ? 10 
HELX_P HELX_P71  AH8 HIS H  1580 ? VAL H  1596 ? HIS A 1580 VAL A 1596 1 ? 17 
HELX_P HELX_P72  AH9 PHE H  1597 ? GLN H  1599 ? PHE A 1597 GLN A 1599 5 ? 3  
HELX_P HELX_P73  AI1 ASP H  1675 ? THR H  1689 ? ASP A 1675 THR A 1689 1 ? 15 
HELX_P HELX_P74  AI2 SER H  1722 ? ALA H  1736 ? SER A 1722 ALA A 1736 1 ? 15 
HELX_P HELX_P75  AI3 PRO H  1738 ? GLN H  1752 ? PRO A 1738 GLN A 1752 1 ? 15 
HELX_P HELX_P76  AI4 ASP H  1782 ? TYR H  1786 ? ASP A 1782 TYR A 1786 5 ? 5  
HELX_P HELX_P77  AI5 HIS H  1823 ? ALA H  1828 ? HIS A 1823 ALA A 1828 5 ? 6  
HELX_P HELX_P78  AI6 ARG H  1832 ? LEU H  1852 ? ARG A 1832 LEU A 1852 1 ? 21 
HELX_P HELX_P79  AI7 MET H  1868 ? LEU H  1876 ? MET A 1868 LEU A 1876 1 ? 9  
HELX_P HELX_P80  AI8 GLN H  1894 ? LYS H  1898 ? GLN A 1894 LYS A 1898 5 ? 5  
HELX_P HELX_P81  AI9 VAL H  1899 ? LYS H  1908 ? VAL A 1899 LYS A 1908 1 ? 10 
HELX_P HELX_P82  AJ1 SER H  1928 ? ASN H  1946 ? SER A 1928 ASN A 1946 1 ? 19 
HELX_P HELX_P83  AJ2 ASN H  1946 ? LEU H  1954 ? ASN A 1946 LEU A 1954 1 ? 9  
HELX_P HELX_P84  AJ3 THR H  1972 ? ASN H  1996 ? THR A 1972 ASN A 1996 1 ? 25 
HELX_P HELX_P85  AJ4 THR H  2003 ? GLY H  2013 ? THR A 2003 GLY A 2013 1 ? 11 
HELX_P HELX_P86  AJ5 SER H  2068 ? ARG H  2076 ? SER A 2068 ARG A 2076 1 ? 9  
HELX_P HELX_P87  AJ6 SER H  2079 ? THR H  2087 ? SER A 2079 THR A 2087 1 ? 9  
HELX_P HELX_P88  AJ7 PRO H  2107 ? CYS H  2116 ? PRO A 2107 CYS A 2116 1 ? 10 
HELX_P HELX_P89  AJ8 SER H  2189 ? ASN H  2203 ? SER A 2189 ASN A 2203 1 ? 15 
HELX_P HELX_P90  AJ9 THR H  2231 ? ASN H  2241 ? THR A 2231 ASN A 2241 1 ? 11 
HELX_P HELX_P91  AK1 LEU H  2252 ? TYR H  2256 ? LEU A 2252 TYR A 2256 5 ? 5  
HELX_P HELX_P92  AK2 MET H  2284 ? HIS H  2288 ? MET A 2284 HIS A 2288 5 ? 5  
HELX_P HELX_P93  AK3 ALA I  69   ? GLY I  74   ? ALA B 69   GLY B 74   1 ? 6  
HELX_P HELX_P94  AK4 GLU I  115  ? SER I  126  ? GLU B 115  SER B 126  1 ? 12 
HELX_P HELX_P95  AK5 GLY I  141  ? HIS I  154  ? GLY B 141  HIS B 154  1 ? 14 
HELX_P HELX_P96  AK6 LEU I  171  ? GLU I  176  ? LEU B 171  GLU B 176  1 ? 6  
HELX_P HELX_P97  AK7 HIS I  208  ? ASN I  210  ? HIS B 208  ASN B 210  5 ? 3  
HELX_P HELX_P98  AK8 PHE I  211  ? ARG I  220  ? PHE B 211  ARG B 220  1 ? 10 
HELX_P HELX_P99  AK9 MET I  236  ? GLU I  249  ? MET B 236  GLU B 249  1 ? 14 
HELX_P HELX_P100 AL1 ILE I  260  ? LEU I  265  ? ILE B 260  LEU B 265  1 ? 6  
HELX_P HELX_P101 AL2 PRO I  270  ? SER I  290  ? PRO B 270  SER B 290  1 ? 21 
HELX_P HELX_P102 AL3 THR I  319  ? ASP I  329  ? THR B 319  ASP B 329  1 ? 11 
HELX_P HELX_P103 AL4 PHE I  339  ? LEU I  343  ? PHE B 339  LEU B 343  5 ? 5  
HELX_P HELX_P104 AL5 SER I  368  ? ILE I  373  ? SER B 368  ILE B 373  1 ? 6  
HELX_P HELX_P105 AL6 ILE I  373  ? ASP I  387  ? ILE B 373  ASP B 387  1 ? 15 
HELX_P HELX_P106 AL7 SER I  391  ? GLY I  400  ? SER B 391  GLY B 400  1 ? 10 
HELX_P HELX_P107 AL8 LYS I  405  ? LYS I  409  ? LYS B 405  LYS B 409  5 ? 5  
HELX_P HELX_P108 AL9 ASN I  411  ? GLY I  425  ? ASN B 411  GLY B 425  1 ? 15 
HELX_P HELX_P109 AM1 THR I  428  ? HIS I  437  ? THR B 428  HIS B 437  1 ? 10 
HELX_P HELX_P110 AM2 GLY I  444  ? TYR I  453  ? GLY B 444  TYR B 453  1 ? 10 
HELX_P HELX_P111 AM3 ASP I  460  ? MET I  465  ? ASP B 460  MET B 465  1 ? 6  
HELX_P HELX_P112 AM4 GLU I  599  ? TYR I  614  ? GLU B 599  TYR B 614  1 ? 16 
HELX_P HELX_P113 AM5 GLY I  633  ? MET I  647  ? GLY B 633  MET B 647  1 ? 15 
HELX_P HELX_P114 AM6 GLU I  693  ? ASN I  702  ? GLU B 693  ASN B 702  1 ? 10 
HELX_P HELX_P115 AM7 ASN I  710  ? TYR I  722  ? ASN B 710  TYR B 722  1 ? 13 
HELX_P HELX_P116 AM8 ASP I  725  ? ARG I  730  ? ASP B 725  ARG B 730  1 ? 6  
HELX_P HELX_P117 AM9 GLY I  736  ? THR I  740  ? GLY B 736  THR B 740  5 ? 5  
HELX_P HELX_P118 AN1 ASP I  764  ? TRP I  772  ? ASP B 764  TRP B 772  1 ? 9  
HELX_P HELX_P119 AN2 ILE I  808  ? MET I  822  ? ILE B 808  MET B 822  1 ? 15 
HELX_P HELX_P120 AN3 VAL I  843  ? ARG I  852  ? VAL B 843  ARG B 852  1 ? 10 
HELX_P HELX_P121 AN4 ILE I  878  ? SER I  880  ? ILE B 878  SER B 880  5 ? 3  
HELX_P HELX_P122 AN5 GLY I  882  ? THR I  891  ? GLY B 882  THR B 891  1 ? 10 
HELX_P HELX_P123 AN6 HIS I  928  ? ARG I  939  ? HIS B 928  ARG B 939  1 ? 12 
HELX_P HELX_P124 AN7 TYR J  98   ? GLN J  104  ? TYR C 98   GLN C 104  1 ? 7  
HELX_P HELX_P125 AN8 LYS J  110  ? LEU J  119  ? LYS C 110  LEU C 119  5 ? 10 
HELX_P HELX_P126 AN9 ASP J  128  ? GLN J  133  ? ASP C 128  GLN C 133  1 ? 6  
HELX_P HELX_P127 AO1 ASP J  136  ? MET J  163  ? ASP C 136  MET C 163  1 ? 28 
HELX_P HELX_P128 AO2 LYS J  240  ? TRP J  245  ? LYS C 240  TRP C 245  1 ? 6  
HELX_P HELX_P129 AO3 GLU J  282  ? LYS J  297  ? GLU C 282  LYS C 297  1 ? 16 
HELX_P HELX_P130 AO4 ALA J  298  ? GLU J  326  ? ALA C 298  GLU C 326  1 ? 29 
HELX_P HELX_P131 AO5 THR L  84   ? ALA L  90   ? THR E 84   ALA E 90   1 ? 7  
HELX_P HELX_P132 AO6 ASN L  121  ? TYR L  135  ? ASN E 121  TYR E 135  1 ? 15 
HELX_P HELX_P133 AO7 VAL L  156  ? ASN L  162  ? VAL E 156  ASN E 162  1 ? 7  
HELX_P HELX_P134 AO8 GLU L  212  ? THR L  220  ? GLU E 212  THR E 220  1 ? 9  
HELX_P HELX_P135 AO9 ARG M  12   ? TYR M  26   ? ARG L 12   TYR L 26   1 ? 15 
HELX_P HELX_P136 AP1 TRP M  31   ? SER M  36   ? TRP L 31   SER L 36   1 ? 6  
HELX_P HELX_P137 AP2 SER M  42   ? TYR M  51   ? SER L 42   TYR L 51   1 ? 10 
HELX_P HELX_P138 AP3 ARG M  65   ? HIS M  73   ? ARG L 65   HIS L 73   1 ? 9  
HELX_P HELX_P139 AP4 ILE M  85   ? GLY M  90   ? ILE L 85   GLY L 90   1 ? 6  
HELX_P HELX_P140 AP5 GLN M  95   ? ALA M  108  ? GLN L 95   ALA L 108  1 ? 14 
HELX_P HELX_P141 AP6 ASP N  216  ? ASN N  238  ? ASP O 216  ASN O 238  1 ? 23 
HELX_P HELX_P142 AP7 ILE N  242  ? SER N  254  ? ILE O 242  SER O 254  1 ? 13 
HELX_P HELX_P143 AP8 ARG N  260  ? LEU N  269  ? ARG O 260  LEU O 269  1 ? 10 
HELX_P HELX_P144 AP9 ASN N  275  ? ASN N  289  ? ASN O 275  ASN O 289  1 ? 15 
HELX_P HELX_P145 AQ1 VAL N  292  ? LEU N  306  ? VAL O 292  LEU O 306  1 ? 15 
HELX_P HELX_P146 AQ2 ASN N  310  ? LEU N  323  ? ASN O 310  LEU O 323  1 ? 14 
HELX_P HELX_P147 AQ3 VAL N  326  ? TRP N  339  ? VAL O 326  TRP O 339  1 ? 14 
HELX_P HELX_P148 AQ4 GLU N  342  ? ARG N  355  ? GLU O 342  ARG O 355  1 ? 14 
HELX_P HELX_P149 AQ5 VAL N  359  ? ILE N  365  ? VAL O 359  ILE O 365  1 ? 7  
HELX_P HELX_P150 AQ6 ASP N  375  ? ILE N  380  ? ASP O 375  ILE O 380  1 ? 6  
HELX_P HELX_P151 AQ7 TYR N  391  ? PHE N  405  ? TYR O 391  PHE O 405  1 ? 15 
HELX_P HELX_P152 AQ8 HIS N  410  ? GLU N  413  ? HIS O 410  GLU O 413  5 ? 4  
HELX_P HELX_P153 AQ9 HIS N  414  ? GLN N  426  ? HIS O 414  GLN O 426  1 ? 13 
HELX_P HELX_P154 AR1 GLU N  430  ? TYR N  436  ? GLU O 430  TYR O 436  1 ? 7  
HELX_P HELX_P155 AR2 TYR N  438  ? ARG N  442  ? TYR O 438  ARG O 442  5 ? 5  
HELX_P HELX_P156 AR3 LEU N  451  ? LYS N  461  ? LEU O 451  LYS O 461  1 ? 11 
HELX_P HELX_P157 AR4 CYS O  24   ? GLY O  29   ? CYS P 24   GLY P 29   1 ? 6  
HELX_P HELX_P158 AR5 GLN O  72   ? ASN O  79   ? GLN P 72   ASN P 79   1 ? 8  
HELX_P HELX_P159 AR6 PRO O  93   ? LEU O  101  ? PRO P 93   LEU P 101  1 ? 9  
HELX_P HELX_P160 AR7 LYS O  114  ? ILE O  125  ? LYS P 114  ILE P 125  1 ? 12 
HELX_P HELX_P161 AR8 TYR O  156  ? ASN O  160  ? TYR P 156  ASN P 160  5 ? 5  
HELX_P HELX_P162 AR9 ASN O  206  ? SER O  218  ? ASN P 206  SER P 218  1 ? 13 
HELX_P HELX_P163 AS1 THR O  244  ? GLN O  254  ? THR P 244  GLN P 254  1 ? 11 
HELX_P HELX_P164 AS2 ARG O  277  ? SER O  287  ? ARG P 277  SER P 287  1 ? 11 
HELX_P HELX_P165 AS3 ILE P  18   ? GLU P  35   ? ILE Q 18   GLU Q 35   1 ? 18 
HELX_P HELX_P166 AS4 LEU P  46   ? TYR P  65   ? LEU Q 46   TYR Q 65   1 ? 20 
HELX_P HELX_P167 AS5 SER P  71   ? GLY P  82   ? SER Q 71   GLY Q 82   1 ? 12 
HELX_P HELX_P168 AS6 ASN P  87   ? LYS P  93   ? ASN Q 87   LYS Q 93   1 ? 7  
HELX_P HELX_P169 AS7 ALA Q  50   ? ARG Q  55   ? ALA R 50   ARG R 55   1 ? 6  
HELX_P HELX_P170 AS8 ARG Q  60   ? ARG Q  72   ? ARG R 60   ARG R 72   1 ? 13 
HELX_P HELX_P171 AS9 SER Q  217  ? TYR Q  227  ? SER R 217  TYR R 227  1 ? 11 
HELX_P HELX_P172 AT1 ALA S  32   ? GLY S  46   ? ALA V 32   GLY V 46   1 ? 15 
HELX_P HELX_P173 AT2 THR S  119  ? ASP S  123  ? THR V 119  ASP V 123  5 ? 5  
HELX_P HELX_P174 AT3 GLY S  135  ? MET S  144  ? GLY V 135  MET V 144  1 ? 10 
HELX_P HELX_P175 AT4 GLU T  32   ? LYS T  36   ? GLU Y 32   LYS Y 36   5 ? 5  
HELX_P HELX_P176 AT5 ASP T  39   ? VAL T  43   ? ASP Y 39   VAL Y 43   5 ? 5  
HELX_P HELX_P177 AT6 ILE T  48   ? GLY T  61   ? ILE Y 48   GLY Y 61   1 ? 14 
HELX_P HELX_P178 AT7 ASP T  65   ? LEU T  75   ? ASP Y 65   LEU Y 75   1 ? 11 
HELX_P HELX_P179 AT8 ASP T  81   ? LEU T  93   ? ASP Y 81   LEU Y 93   1 ? 13 
HELX_P HELX_P180 AT9 LYS T  96   ? ASN T  115  ? LYS Y 96   ASN Y 115  1 ? 20 
HELX_P HELX_P181 AU1 PRO T  120  ? GLU T  125  ? PRO Y 120  GLU Y 125  1 ? 6  
HELX_P HELX_P182 AU2 ALA V  33   ? GLU V  46   ? ALA s 33   GLU s 46   1 ? 14 
HELX_P HELX_P183 AU3 ALA V  120  ? ASN V  124  ? ALA s 120  ASN s 124  5 ? 5  
HELX_P HELX_P184 AU4 VAL V  138  ? ARG V  143  ? VAL s 138  ARG s 143  1 ? 6  
HELX_P HELX_P185 AU5 ASP W  129  ? LEU W  144  ? ASP t 129  LEU t 144  1 ? 16 
HELX_P HELX_P186 AU6 CYS W  202  ? GLU W  207  ? CYS t 202  GLU t 207  1 ? 6  
HELX_P HELX_P187 AU7 HIS W  228  ? ASP W  237  ? HIS t 228  ASP t 237  1 ? 10 
HELX_P HELX_P188 AU8 GLU W  283  ? THR W  293  ? GLU t 283  THR t 293  1 ? 11 
HELX_P HELX_P189 AU9 SER X  400  ? PHE X  408  ? SER u 400  PHE u 408  1 ? 9  
HELX_P HELX_P190 AV1 PHE X  475  ? LEU X  479  ? PHE u 475  LEU u 479  5 ? 5  
HELX_P HELX_P191 AV2 PRO X  489  ? ARG X  495  ? PRO u 489  ARG u 495  5 ? 7  
HELX_P HELX_P192 AV3 LYS X  496  ? ASN X  506  ? LYS u 496  ASN u 506  1 ? 11 
HELX_P HELX_P193 AV4 THR X  508  ? LYS X  522  ? THR u 508  LYS u 522  1 ? 15 
HELX_P HELX_P194 AV5 LYS X  522  ? GLY X  527  ? LYS u 522  GLY u 527  1 ? 6  
HELX_P HELX_P195 AV6 ALA X  528  ? LEU X  536  ? ALA u 528  LEU u 536  1 ? 9  
HELX_P HELX_P196 AV7 GLU X  545  ? LEU X  560  ? GLU u 545  LEU u 560  1 ? 16 
HELX_P HELX_P197 AV8 TYR X  570  ? GLU X  579  ? TYR u 570  GLU u 579  1 ? 10 
HELX_P HELX_P198 AV9 PRO X  580  ? LEU X  582  ? PRO u 580  LEU u 582  5 ? 3  
HELX_P HELX_P199 AW1 ASP X  586  ? GLY X  605  ? ASP u 586  GLY u 605  1 ? 20 
HELX_P HELX_P200 AW2 LEU X  606  ? MET X  613  ? LEU u 606  MET u 613  1 ? 8  
HELX_P HELX_P201 AW3 ASP X  621  ? GLY X  640  ? ASP u 621  GLY u 640  1 ? 20 
HELX_P HELX_P202 AW4 LEU X  644  ? LYS X  653  ? LEU u 644  LYS u 653  1 ? 10 
HELX_P HELX_P203 AW5 SER X  657  ? MET X  675  ? SER u 657  MET u 675  1 ? 19 
HELX_P HELX_P204 AW6 LEU X  683  ? GLU X  691  ? LEU u 683  GLU u 691  1 ? 9  
HELX_P HELX_P205 AW7 GLN X  698  ? THR X  717  ? GLN u 698  THR u 717  1 ? 20 
HELX_P HELX_P206 AW8 VAL X  727  ? HIS X  738  ? VAL u 727  HIS u 738  1 ? 12 
HELX_P HELX_P207 AW9 GLY X  740  ? ILE X  754  ? GLY u 740  ILE u 754  1 ? 15 
HELX_P HELX_P208 AX1 PRO X  755  ? MET X  757  ? PRO u 755  MET u 757  5 ? 3  
HELX_P HELX_P209 AX2 ASP X  758  ? GLU X  768  ? ASP u 758  GLU u 768  1 ? 11 
HELX_P HELX_P210 AX3 VAL X  769  ? GLU X  776  ? VAL u 769  GLU u 776  1 ? 8  
HELX_P HELX_P211 AX4 PHE X  777  ? SER X  779  ? PHE u 777  SER u 779  5 ? 3  
HELX_P HELX_P212 AX5 ASP X  781  ? CYS X  796  ? ASP u 781  CYS u 796  1 ? 16 
HELX_P HELX_P213 AX6 GLU X  802  ? ILE X  810  ? GLU u 802  ILE u 810  1 ? 9  
HELX_P HELX_P214 AX7 ILE X  810  ? PHE X  818  ? ILE u 810  PHE u 818  1 ? 9  
HELX_P HELX_P215 AX8 ASP X  826  ? VAL X  844  ? ASP u 826  VAL u 844  1 ? 19 
HELX_P HELX_P216 AX9 ALA X  846  ? VAL X  854  ? ALA u 846  VAL u 854  1 ? 9  
HELX_P HELX_P217 AY1 ASP X  855  ? ASP X  859  ? ASP u 855  ASP u 859  5 ? 5  
HELX_P HELX_P218 AY2 ALA X  861  ? LEU X  879  ? ALA u 861  LEU u 879  1 ? 19 
HELX_P HELX_P219 AY3 LEU X  888  ? GLU X  902  ? LEU u 888  GLU u 902  1 ? 15 
HELX_P HELX_P220 AY4 SER X  908  ? GLY X  922  ? SER u 908  GLY u 922  1 ? 15 
HELX_P HELX_P221 AY5 LYS X  923  ? PRO X  927  ? LYS u 923  PRO u 927  5 ? 5  
HELX_P HELX_P222 AY6 TYR X  928  ? LEU X  940  ? TYR u 928  LEU u 940  1 ? 13 
HELX_P HELX_P223 AY7 ASN X  941  ? ALA X  945  ? ASN u 941  ALA u 945  5 ? 5  
HELX_P HELX_P224 AY8 ARG X  948  ? THR X  964  ? ARG u 948  THR u 964  1 ? 17 
HELX_P HELX_P225 AY9 GLU X  968  ? TYR X  979  ? GLU u 968  TYR u 979  1 ? 12 
HELX_P HELX_P226 AZ1 TYR X  986  ? ILE X  1004 ? TYR u 986  ILE u 1004 1 ? 19 
HELX_P HELX_P227 AZ2 GLY X  1005 ? MET X  1009 ? GLY u 1005 MET u 1009 5 ? 5  
HELX_P HELX_P228 AZ3 PRO X  1012 ? THR X  1021 ? PRO u 1012 THR u 1021 1 ? 10 
HELX_P HELX_P229 AZ4 PRO X  1022 ? ASN X  1026 ? PRO u 1022 ASN u 1026 5 ? 5  
HELX_P HELX_P230 AZ5 HIS X  1028 ? GLY X  1046 ? HIS u 1028 GLY u 1046 1 ? 19 
HELX_P HELX_P231 AZ6 ARG X  1053 ? CYS X  1059 ? ARG u 1053 CYS u 1059 1 ? 7  
HELX_P HELX_P232 AZ7 PHE X  1060 ? LEU X  1065 ? PHE u 1060 LEU u 1065 1 ? 6  
HELX_P HELX_P233 AZ8 ALA X  1072 ? GLY X  1089 ? ALA u 1072 GLY u 1089 1 ? 18 
HELX_P HELX_P234 AZ9 ASP X  1092 ? ASN X  1100 ? ASP u 1092 ASN u 1100 1 ? 9  
HELX_P HELX_P235 BA1 ARG X  1109 ? THR X  1122 ? ARG u 1109 THR u 1122 1 ? 14 
HELX_P HELX_P236 BA2 VAL X  1128 ? GLU X  1135 ? VAL u 1128 GLU u 1135 1 ? 8  
HELX_P HELX_P237 BA3 TYR X  1136 ? VAL X  1138 ? TYR u 1136 VAL u 1138 5 ? 3  
HELX_P HELX_P238 BA4 GLU X  1140 ? GLY X  1159 ? GLU u 1140 GLY u 1159 1 ? 20 
HELX_P HELX_P239 BA5 GLU X  1160 ? ASP X  1164 ? GLU u 1160 ASP u 1164 5 ? 5  
HELX_P HELX_P240 BA6 TYR X  1165 ? ASP X  1179 ? TYR u 1165 ASP u 1179 1 ? 15 
HELX_P HELX_P241 BA7 ASP X  1181 ? LEU X  1197 ? ASP u 1181 LEU u 1197 1 ? 17 
HELX_P HELX_P242 BA8 CYS X  1204 ? TRP X  1216 ? CYS u 1204 TRP u 1216 1 ? 13 
HELX_P HELX_P243 BA9 PRO X  1217 ? GLU X  1221 ? PRO u 1217 GLU u 1221 5 ? 5  
HELX_P HELX_P244 BB1 SER X  1223 ? ILE X  1241 ? SER u 1223 ILE u 1241 1 ? 19 
HELX_P HELX_P245 BB2 GLY X  1242 ? LEU X  1251 ? GLY u 1242 LEU u 1251 1 ? 10 
HELX_P HELX_P246 BB3 ALA X  1258 ? SER X  1276 ? ALA u 1258 SER u 1276 1 ? 19 
HELX_P HELX_P247 BB4 GLN X  1277 ? TYR X  1284 ? GLN u 1277 TYR u 1284 5 ? 8  
HELX_P HELX_P248 BB5 TYR Y  189  ? ASP Y  195  ? TYR v 189  ASP v 195  1 ? 7  
HELX_P HELX_P249 BB6 GLY Y  198  ? ALA Y  202  ? GLY v 198  ALA v 202  5 ? 5  
HELX_P HELX_P250 BB7 ARG Y  429  ? ARG Y  432  ? ARG v 429  ARG v 432  5 ? 4  
HELX_P HELX_P251 BB8 THR Y  808  ? ALA Y  826  ? THR v 808  ALA v 826  1 ? 19 
HELX_P HELX_P252 BB9 ALA Y  836  ? GLU Y  845  ? ALA v 836  GLU v 845  1 ? 10 
HELX_P HELX_P253 BC1 PRO Y  848  ? GLY Y  853  ? PRO v 848  GLY v 853  1 ? 6  
HELX_P HELX_P254 BC2 SER Y  1134 ? HIS Y  1152 ? SER v 1134 HIS v 1152 1 ? 19 
HELX_P HELX_P255 BC3 ASP Y  1159 ? ARG Y  1164 ? ASP v 1159 ARG v 1164 1 ? 6  
HELX_P HELX_P256 BC4 GLY Y  1176 ? GLU Y  1180 ? GLY v 1176 GLU v 1180 1 ? 5  
HELX_P HELX_P257 BC5 GLN Y  1181 ? MET Y  1185 ? GLN v 1181 MET v 1185 5 ? 5  
HELX_P HELX_P258 BC6 GLU Y  1186 ? LEU Y  1197 ? GLU v 1186 LEU v 1197 1 ? 12 
HELX_P HELX_P259 BC7 THR Y  1200 ? ALA Y  1216 ? THR v 1200 ALA v 1216 1 ? 17 
HELX_P HELX_P260 BC8 THR Z  27   ? HIS Z  46   ? THR x 27   HIS x 46   1 ? 20 
HELX_P HELX_P261 BC9 HIS Z  46   ? GLU Z  57   ? HIS x 46   GLU x 57   1 ? 12 
HELX_P HELX_P262 BD1 SER Z  60   ? LYS Z  71   ? SER x 60   LYS x 71   1 ? 12 
HELX_P HELX_P263 BD2 TYR AA 51   ? GLN AA 55   ? TYR y 51   GLN y 55   5 ? 5  
HELX_P HELX_P264 BD3 LYS AA 73   ? GLN AA 78   ? LYS y 73   GLN y 78   1 ? 6  
HELX_P HELX_P265 BD4 THR AA 96   ? GLU AA 101  ? THR y 96   GLU y 101  1 ? 6  
HELX_P HELX_P266 BD5 ALA BA 32   ? TYR BA 36   ? ALA z 32   TYR z 36   1 ? 5  
HELX_P HELX_P267 BD6 SER CA 229  ? ASN CA 237  ? SER 0 229  ASN 0 237  1 ? 9  
HELX_P HELX_P268 BD7 HIS CA 276  ? GLN CA 278  ? HIS 0 276  GLN 0 278  5 ? 3  
HELX_P HELX_P269 BD8 THR DA 3    ? LYS DA 29   ? THR 9 3    LYS 9 29   1 ? 27 
HELX_P HELX_P270 BD9 ARG DA 34   ? ASP DA 40   ? ARG 9 34   ASP 9 40   1 ? 7  
HELX_P HELX_P271 BE1 GLU DA 52   ? ASP DA 63   ? GLU 9 52   ASP 9 63   1 ? 12 
HELX_P HELX_P272 BE2 ASP DA 65   ? SER DA 76   ? ASP 9 65   SER 9 76   1 ? 12 
HELX_P HELX_P273 BE3 TYR DA 85   ? HIS DA 95   ? TYR 9 85   HIS 9 95   1 ? 11 
HELX_P HELX_P274 BE4 HIS DA 98   ? VAL DA 104  ? HIS 9 98   VAL 9 104  1 ? 7  
HELX_P HELX_P275 BE5 GLU DA 118  ? GLU DA 122  ? GLU 9 118  GLU 9 122  5 ? 5  
HELX_P HELX_P276 BE6 GLN DA 125  ? GLU DA 129  ? GLN 9 125  GLU 9 129  5 ? 5  
HELX_P HELX_P277 BE7 LEU DA 142  ? ALA DA 154  ? LEU 9 142  ALA 9 154  1 ? 13 
HELX_P HELX_P278 BE8 ASP DA 159  ? GLN DA 169  ? ASP 9 159  GLN 9 169  1 ? 11 
HELX_P HELX_P279 BE9 LEU DA 170  ? ASP DA 172  ? LEU 9 170  ASP 9 172  5 ? 3  
HELX_P HELX_P280 BF1 ASN DA 179  ? LYS DA 201  ? ASN 9 179  LYS 9 201  1 ? 23 
HELX_P HELX_P281 BF2 ASP DA 205  ? LYS DA 220  ? ASP 9 205  LYS 9 220  1 ? 16 
HELX_P HELX_P282 BF3 TRP DA 221  ? GLY DA 224  ? TRP 9 221  GLY 9 224  5 ? 4  
HELX_P HELX_P283 BF4 LEU DA 255  ? ASP DA 261  ? LEU 9 255  ASP 9 261  1 ? 7  
HELX_P HELX_P284 BF5 SER DA 265  ? GLY DA 275  ? SER 9 265  GLY 9 275  1 ? 11 
HELX_P HELX_P285 BF6 GLY DA 275  ? ASN DA 304  ? GLY 9 275  ASN 9 304  1 ? 17 
HELX_P HELX_P286 BF7 PRO DA 305  ? ALA DA 321  ? PRO 9 305  ALA 9 321  1 ? 17 
HELX_P HELX_P287 BF8 LEU DA 323  ? HIS DA 339  ? LEU 9 323  HIS 9 339  1 ? 17 
HELX_P HELX_P288 BF9 PRO DA 393  ? GLY DA 401  ? PRO 9 393  GLY 9 401  1 ? 9  
HELX_P HELX_P289 BG1 GLY DA 418  ? PHE DA 426  ? GLY 9 418  PHE 9 426  1 ? 9  
HELX_P HELX_P290 BG2 GLU DA 428  ? GLY DA 439  ? GLU 9 428  GLY 9 439  1 ? 12 
HELX_P HELX_P291 BG3 GLN DA 451  ? LYS DA 463  ? GLN 9 451  LYS 9 463  1 ? 13 
HELX_P HELX_P292 BG4 GLU DA 477  ? ASP DA 481  ? GLU 9 477  ASP 9 481  5 ? 5  
HELX_P HELX_P293 BG5 ASN DA 488  ? GLY DA 499  ? ASN 9 488  GLY 9 499  1 ? 12 
HELX_P HELX_P294 BG6 ARG FA 27   ? ASN FA 37   ? ARG G 27   ASN G 37   1 ? 11 
HELX_P HELX_P295 BG7 SER FA 70   ? THR FA 133  ? SER G 70   THR G 133  1 ? 64 
HELX_P HELX_P296 BG8 GLU GA 26   ? ASN GA 37   ? GLU H 26   ASN H 37   1 ? 12 
HELX_P HELX_P297 BG9 ILE GA 71   ? LEU GA 134  ? ILE H 71   LEU H 134  1 ? 64 
HELX_P HELX_P298 BH1 GLU HA 26   ? ASN HA 37   ? GLU I 26   ASN I 37   1 ? 12 
HELX_P HELX_P299 BH2 THR HA 69   ? LEU HA 134  ? THR I 69   LEU I 134  1 ? 66 
HELX_P HELX_P300 BH3 GLU IA 26   ? ASN IA 37   ? GLU J 26   ASN J 37   1 ? 12 
HELX_P HELX_P301 BH4 SER IA 70   ? LYS IA 135  ? SER J 70   LYS J 135  1 ? 66 
HELX_P HELX_P302 BH5 GLU JA 30   ? TYR JA 43   ? GLU K 30   TYR K 43   1 ? 14 
HELX_P HELX_P303 BH6 LYS JA 47   ? ALA JA 55   ? LYS K 47   ALA K 55   1 ? 9  
HELX_P HELX_P304 BH7 ILE JA 65   ? GLN JA 77   ? ILE K 65   GLN K 77   1 ? 13 
HELX_P HELX_P305 BH8 TRP JA 103  ? GLY JA 131  ? TRP K 103  GLY K 131  1 ? 29 
HELX_P HELX_P306 BH9 ASN JA 133  ? GLN JA 212  ? ASN K 133  GLN K 212  1 ? 80 
HELX_P HELX_P307 BI1 ALA JA 216  ? GLN JA 223  ? ALA K 216  GLN K 223  1 ? 8  
HELX_P HELX_P308 BI2 GLU KA 20   ? ASN KA 31   ? GLU M 20   ASN M 31   1 ? 12 
HELX_P HELX_P309 BI3 VAL KA 35   ? LYS KA 45   ? VAL M 35   LYS M 45   1 ? 11 
HELX_P HELX_P310 BI4 PRO KA 49   ? LYS KA 62   ? PRO M 49   LYS M 62   1 ? 14 
HELX_P HELX_P311 BI5 SER KA 67   ? VAL KA 82   ? SER M 67   VAL M 82   1 ? 16 
HELX_P HELX_P312 BI6 LYS KA 83   ? ARG KA 85   ? LYS M 83   ARG M 85   5 ? 3  
HELX_P HELX_P313 BI7 VAL KA 87   ? ARG KA 101  ? VAL M 87   ARG M 101  1 ? 15 
HELX_P HELX_P314 BI8 LYS KA 108  ? LEU KA 120  ? LYS M 108  LEU M 120  1 ? 13 
HELX_P HELX_P315 BI9 VAL KA 126  ? LEU KA 137  ? VAL M 126  LEU M 137  1 ? 12 
HELX_P HELX_P316 BJ1 GLN KA 144  ? LEU KA 156  ? GLN M 144  LEU M 156  1 ? 13 
HELX_P HELX_P317 BJ2 PRO KA 160  ? PHE KA 172  ? PRO M 160  PHE M 172  1 ? 13 
HELX_P HELX_P318 BJ3 SER KA 176  ? SER KA 189  ? SER M 176  SER M 189  1 ? 14 
HELX_P HELX_P319 BJ4 LEU KA 193  ? ASP KA 206  ? LEU M 193  ASP M 206  1 ? 14 
HELX_P HELX_P320 BJ5 PHE KA 209  ? GLY KA 214  ? PHE M 209  GLY M 214  1 ? 6  
HELX_P HELX_P321 BJ6 ASN KA 217  ? GLN KA 230  ? ASN M 217  GLN M 230  1 ? 14 
HELX_P HELX_P322 BJ7 LEU KA 238  ? PHE KA 251  ? LEU M 238  PHE M 251  1 ? 14 
HELX_P HELX_P323 BJ8 LEU KA 255  ? SER KA 269  ? LEU M 255  SER M 269  1 ? 15 
HELX_P HELX_P324 BJ9 PHE KA 272  ? THR KA 285  ? PHE M 272  THR M 285  1 ? 14 
HELX_P HELX_P325 BK1 ARG KA 290  ? GLN KA 301  ? ARG M 290  GLN M 301  1 ? 12 
HELX_P HELX_P326 BK2 GLU KA 312  ? ARG KA 319  ? GLU M 312  ARG M 319  1 ? 8  
HELX_P HELX_P327 BK3 GLU KA 328  ? GLU KA 335  ? GLU M 328  GLU M 335  1 ? 8  
HELX_P HELX_P328 BK4 LEU KA 344  ? LEU KA 350  ? LEU M 344  LEU M 350  1 ? 7  
HELX_P HELX_P329 BK5 TRP KA 360  ? GLN KA 368  ? TRP M 360  GLN M 368  1 ? 9  
HELX_P HELX_P330 BK6 THR KA 377  ? GLN KA 383  ? THR M 377  GLN M 383  1 ? 7  
HELX_P HELX_P331 BK7 GLY KA 392  ? ASP KA 407  ? GLY M 392  ASP M 407  1 ? 16 
HELX_P HELX_P332 BK8 ASP KA 413  ? ALA KA 421  ? ASP M 413  ALA M 421  1 ? 9  
HELX_P HELX_P333 BK9 VAL KA 429  ? ARG KA 445  ? VAL M 429  ARG M 445  1 ? 17 
HELX_P HELX_P334 BL1 ASN KA 448  ? ARG KA 466  ? ASN M 448  ARG M 466  1 ? 19 
HELX_P HELX_P335 BL2 ASN KA 478  ? ALA KA 491  ? ASN M 478  ALA M 491  1 ? 14 
HELX_P HELX_P336 BL3 THR KA 503  ? LEU KA 513  ? THR M 503  LEU M 513  1 ? 11 
HELX_P HELX_P337 BL4 GLN KA 519  ? HIS KA 531  ? GLN M 519  HIS M 531  1 ? 13 
HELX_P HELX_P338 BL5 TYR KA 533  ? PHE KA 548  ? TYR M 533  PHE M 548  1 ? 16 
HELX_P HELX_P339 BL6 VAL KA 553  ? TYR KA 568  ? VAL M 553  TYR M 568  1 ? 16 
HELX_P HELX_P340 BL7 LEU KA 573  ? LEU KA 584  ? LEU M 573  LEU M 584  1 ? 12 
HELX_P HELX_P341 BL8 TYR KA 596  ? GLU KA 605  ? TYR M 596  GLU M 605  1 ? 10 
HELX_P HELX_P342 BL9 ARG KA 610  ? ALA KA 622  ? ARG M 610  ALA M 622  1 ? 13 
HELX_P HELX_P343 BM1 GLN KA 628  ? ILE KA 642  ? GLN M 628  ILE M 642  1 ? 15 
HELX_P HELX_P344 BM2 GLY KA 644  ? VAL KA 658  ? GLY M 644  VAL M 658  1 ? 15 
HELX_P HELX_P345 BM3 GLU KA 662  ? GLY KA 679  ? GLU M 662  GLY M 679  1 ? 18 
HELX_P HELX_P346 BM4 ILE KA 681  ? ILE KA 694  ? ILE M 681  ILE M 694  1 ? 14 
HELX_P HELX_P347 BM5 GLY KA 701  ? ARG KA 713  ? GLY M 701  ARG M 713  1 ? 13 
HELX_P HELX_P348 BM6 LYS KA 721  ? THR KA 736  ? LYS M 721  THR M 736  1 ? 16 
HELX_P HELX_P349 BM7 ASN LA 150  ? VAL LA 173  ? ASN T 150  VAL T 173  1 ? 24 
HELX_P HELX_P350 BM8 ASN LA 177  ? GLN LA 187  ? ASN T 177  GLN T 187  1 ? 11 
HELX_P HELX_P351 BM9 GLY LA 193  ? SER LA 208  ? GLY T 193  SER T 208  1 ? 16 
HELX_P HELX_P352 BN1 PHE LA 211  ? PHE LA 226  ? PHE T 211  PHE T 226  1 ? 16 
HELX_P HELX_P353 BN2 PHE LA 226  ? ASN LA 248  ? PHE T 226  ASN T 248  1 ? 23 
HELX_P HELX_P354 BN3 ASP LA 249  ? GLN LA 266  ? ASP T 249  GLN T 266  1 ? 18 
HELX_P HELX_P355 BN4 GLU LA 271  ? ARG LA 284  ? GLU T 271  ARG T 284  1 ? 14 
HELX_P HELX_P356 BN5 THR LA 286  ? SER LA 308  ? THR T 286  SER T 308  1 ? 23 
HELX_P HELX_P357 BN6 SER LA 308  ? GLU LA 325  ? SER T 308  GLU T 325  1 ? 18 
HELX_P HELX_P358 BN7 ASP LA 329  ? ASP LA 345  ? ASP T 329  ASP T 345  1 ? 17 
HELX_P HELX_P359 BN8 GLU LA 361  ? GLN LA 365  ? GLU T 361  GLN T 365  5 ? 5  
HELX_P HELX_P360 BN9 GLU LA 379  ? VAL LA 384  ? GLU T 379  VAL T 384  5 ? 6  
HELX_P HELX_P361 BO1 ASN LA 390  ? LEU LA 406  ? ASN T 390  LEU T 406  1 ? 17 
HELX_P HELX_P362 BO2 GLU LA 449  ? ILE LA 459  ? GLU T 449  ILE T 459  1 ? 11 
HELX_P HELX_P363 BO3 ASP LA 468  ? MET LA 479  ? ASP T 468  MET T 479  1 ? 12 
HELX_P HELX_P364 BO4 PRO LA 482  ? SER LA 484  ? PRO T 482  SER T 484  5 ? 3  
HELX_P HELX_P365 BO5 GLN LA 485  ? GLN LA 499  ? GLN T 485  GLN T 499  1 ? 15 
HELX_P HELX_P366 BO6 PHE LA 506  ? MET LA 516  ? PHE T 506  MET T 516  1 ? 11 
HELX_P HELX_P367 BO7 LYS LA 518  ? ASP LA 534  ? LYS T 518  ASP T 534  1 ? 17 
HELX_P HELX_P368 BO8 ASN LA 542  ? THR LA 557  ? ASN T 542  THR T 557  1 ? 16 
HELX_P HELX_P369 BO9 THR LA 576  ? SER LA 578  ? THR T 576  SER T 578  5 ? 3  
HELX_P HELX_P370 BP1 SER LA 579  ? ASP LA 605  ? SER T 579  ASP T 605  1 ? 27 
HELX_P HELX_P371 BP2 ARG LA 622  ? ILE LA 634  ? ARG T 622  ILE T 634  1 ? 13 
HELX_P HELX_P372 BP3 ALA MA 20   ? TRP MA 31   ? ALA U 20   TRP U 31   1 ? 12 
HELX_P HELX_P373 BP4 ASP MA 42   ? GLU MA 53   ? ASP U 42   GLU U 53   1 ? 12 
HELX_P HELX_P374 BP5 ALA MA 60   ? SER MA 70   ? ALA U 60   SER U 70   1 ? 11 
HELX_P HELX_P375 BP6 GLN MA 71   ? TYR MA 76   ? GLN U 71   TYR U 76   1 ? 6  
HELX_P HELX_P376 BP7 LEU MA 77   ? TYR MA 81   ? LEU U 77   TYR U 81   5 ? 5  
HELX_P HELX_P377 BP8 SER MA 87   ? GLU MA 104  ? SER U 87   GLU U 104  1 ? 18 
HELX_P HELX_P378 BP9 TRP MA 109  ? LYS MA 115  ? TRP U 109  LYS U 115  1 ? 7  
HELX_P HELX_P379 BQ1 HIS MA 118  ? ALA MA 132  ? HIS U 118  ALA U 132  1 ? 15 
HELX_P HELX_P380 BQ2 SER MA 139  ? ASN MA 155  ? SER U 139  ASN U 155  1 ? 17 
HELX_P HELX_P381 BQ3 VAL MA 159  ? SER MA 171  ? VAL U 159  SER U 171  1 ? 13 
HELX_P HELX_P382 BQ4 LEU MA 172  ? LEU MA 178  ? LEU U 172  LEU U 178  5 ? 7  
HELX_P HELX_P383 BQ5 GLN MA 179  ? THR MA 190  ? GLN U 179  THR U 190  1 ? 12 
HELX_P HELX_P384 BQ6 LYS MA 192  ? LYS MA 206  ? LYS U 192  LYS U 206  1 ? 15 
HELX_P HELX_P385 BQ7 ASP MA 208  ? ARG MA 220  ? ASP U 208  ARG U 220  1 ? 13 
HELX_P HELX_P386 BQ8 ARG MA 220  ? SER MA 235  ? ARG U 220  SER U 235  1 ? 16 
HELX_P HELX_P387 BQ9 THR MA 243  ? ALA MA 262  ? THR U 243  ALA U 262  1 ? 20 
HELX_P HELX_P388 BR1 LEU MA 263  ? SER MA 277  ? LEU U 263  SER U 277  1 ? 15 
HELX_P HELX_P389 BR2 HIS MA 278  ? LEU MA 285  ? HIS U 278  LEU U 285  1 ? 8  
HELX_P HELX_P390 BR3 SER MA 286  ? ARG MA 291  ? SER U 286  ARG U 291  1 ? 6  
HELX_P HELX_P391 BR4 GLY MA 295  ? GLY MA 310  ? GLY U 295  GLY U 310  1 ? 16 
HELX_P HELX_P392 BR5 THR MA 322  ? PHE MA 345  ? THR U 322  PHE U 345  1 ? 24 
HELX_P HELX_P393 BR6 LEU MA 348  ? SER MA 354  ? LEU U 348  SER U 354  1 ? 7  
HELX_P HELX_P394 BR7 ASN MA 355  ? ASP MA 360  ? ASN U 355  ASP U 360  1 ? 6  
HELX_P HELX_P395 BR8 THR MA 361  ? GLY MA 370  ? THR U 361  GLY U 370  1 ? 10 
HELX_P HELX_P396 BR9 SER MA 373  ? LEU MA 384  ? SER U 373  LEU U 384  1 ? 12 
HELX_P HELX_P397 BS1 ASP MA 399  ? GLU MA 412  ? ASP U 399  GLU U 412  1 ? 14 
HELX_P HELX_P398 BS2 SER MA 416  ? ASN MA 422  ? SER U 416  ASN U 422  1 ? 7  
HELX_P HELX_P399 BS3 THR MA 429  ? TRP MA 434  ? THR U 429  TRP U 434  1 ? 6  
HELX_P HELX_P400 BS4 THR MA 461  ? MET MA 492  ? THR U 461  MET U 492  1 ? 32 
HELX_P HELX_P401 BS5 ARG MA 546  ? GLU MA 554  ? ARG U 546  GLU U 554  1 ? 9  
HELX_P HELX_P402 BS6 PRO MA 582  ? GLY MA 588  ? PRO U 582  GLY U 588  1 ? 7  
HELX_P HELX_P403 BS7 ASP MA 630  ? GLY MA 645  ? ASP U 630  GLY U 645  1 ? 16 
HELX_P HELX_P404 BS8 ASP MA 648  ? THR MA 652  ? ASP U 648  THR U 652  5 ? 5  
HELX_P HELX_P405 BS9 LYS MA 667  ? THR MA 679  ? LYS U 667  THR U 679  1 ? 13 
HELX_P HELX_P406 BT1 PRO MA 684  ? LEU MA 692  ? PRO U 684  LEU U 692  1 ? 9  
HELX_P HELX_P407 BT2 HIS MA 701  ? MET MA 705  ? HIS U 701  MET U 705  5 ? 5  
HELX_P HELX_P408 BT3 SER MA 720  ? PHE MA 728  ? SER U 720  PHE U 728  1 ? 9  
HELX_P HELX_P409 BT4 TYR MA 790  ? GLN MA 794  ? TYR U 790  GLN U 794  5 ? 5  
HELX_P HELX_P410 BT5 THR MA 803  ? GLN MA 815  ? THR U 803  GLN U 815  1 ? 13 
HELX_P HELX_P411 BT6 GLY MA 828  ? PHE MA 844  ? GLY U 828  PHE U 844  1 ? 17 
HELX_P HELX_P412 BT7 SER MA 855  ? MET MA 867  ? SER U 855  MET U 867  1 ? 13 
HELX_P HELX_P413 BT8 ASP MA 872  ? ARG MA 874  ? ASP U 872  ARG U 874  5 ? 3  
HELX_P HELX_P414 BT9 SER MA 893  ? LEU MA 919  ? SER U 893  LEU U 919  1 ? 27 
HELX_P HELX_P415 BU1 THR MA 928  ? GLN MA 939  ? THR U 928  GLN U 939  1 ? 12 
HELX_P HELX_P416 BU2 GLN MA 939  ? LYS MA 952  ? GLN U 939  LYS U 952  1 ? 14 
HELX_P HELX_P417 BU3 ASP MA 960  ? PHE MA 967  ? ASP U 960  PHE U 967  1 ? 8  
HELX_P HELX_P418 BU4 SER MA 986  ? ARG MA 1012 ? SER U 986  ARG U 1012 1 ? 27 
HELX_P HELX_P419 BU5 ARG MA 1012 ? LEU MA 1017 ? ARG U 1012 LEU U 1017 1 ? 6  
HELX_P HELX_P420 BU6 SER MA 1019 ? LYS MA 1030 ? SER U 1019 LYS U 1030 1 ? 12 
HELX_P HELX_P421 BU7 CYS MA 1039 ? GLY MA 1053 ? CYS U 1039 GLY U 1053 1 ? 15 
HELX_P HELX_P422 BU8 GLU MA 1063 ? ILE MA 1067 ? GLU U 1063 ILE U 1067 5 ? 5  
HELX_P HELX_P423 BU9 LEU MA 1068 ? ILE MA 1074 ? LEU U 1068 ILE U 1074 1 ? 7  
HELX_P HELX_P424 BV1 PRO MA 1075 ? LEU MA 1078 ? PRO U 1075 LEU U 1078 5 ? 4  
HELX_P HELX_P425 BV2 MET MA 1107 ? ASN MA 1114 ? MET U 1107 ASN U 1114 1 ? 8  
HELX_P HELX_P426 BV3 SER MA 1118 ? GLY MA 1127 ? SER U 1118 GLY U 1127 1 ? 10 
HELX_P HELX_P427 BV4 ARG MA 1140 ? TRP MA 1149 ? ARG U 1140 TRP U 1149 1 ? 10 
HELX_P HELX_P428 BV5 LEU MA 1157 ? LEU MA 1163 ? LEU U 1157 LEU U 1163 1 ? 7  
HELX_P HELX_P429 BV6 PRO MA 1164 ? SER MA 1167 ? PRO U 1164 SER U 1167 5 ? 4  
HELX_P HELX_P430 BV7 ASN MA 1200 ? GLY MA 1218 ? ASN U 1200 GLY U 1218 1 ? 19 
HELX_P HELX_P431 BV8 PRO MA 1220 ? ASP MA 1222 ? PRO U 1220 ASP U 1222 5 ? 3  
HELX_P HELX_P432 BV9 TYR MA 1230 ? CYS MA 1245 ? TYR U 1230 CYS U 1245 1 ? 16 
HELX_P HELX_P433 BW1 ASP MA 1261 ? GLN MA 1264 ? ASP U 1261 GLN U 1264 5 ? 4  
HELX_P HELX_P434 BW2 VAL MA 1281 ? ARG MA 1285 ? VAL U 1281 ARG U 1285 5 ? 5  
HELX_P HELX_P435 BW3 ASP MA 1286 ? MET MA 1294 ? ASP U 1286 MET U 1294 1 ? 9  
HELX_P HELX_P436 BW4 ARG MA 1306 ? ASN MA 1312 ? ARG U 1306 ASN U 1312 1 ? 7  
HELX_P HELX_P437 BW5 CYS MA 1313 ? GLU MA 1315 ? CYS U 1313 GLU U 1315 5 ? 3  
HELX_P HELX_P438 BW6 LEU MA 1316 ? THR MA 1324 ? LEU U 1316 THR U 1324 1 ? 9  
HELX_P HELX_P439 BW7 ASN MA 1357 ? THR MA 1376 ? ASN U 1357 THR U 1376 1 ? 20 
HELX_P HELX_P440 BW8 THR NA 5    ? GLN NA 11   ? THR W 5    GLN W 11   1 ? 7  
HELX_P HELX_P441 BW9 ASN NA 36   ? ALA NA 39   ? ASN W 36   ALA W 39   5 ? 4  
HELX_P HELX_P442 BX1 GLY NA 82   ? LEU NA 87   ? GLY W 82   LEU W 87   1 ? 6  
HELX_P HELX_P443 BX2 GLU NA 102  ? LEU NA 112  ? GLU W 102  LEU W 112  5 ? 11 
HELX_P HELX_P444 BX3 ASN NA 123  ? LYS NA 128  ? ASN W 123  LYS W 128  5 ? 6  
HELX_P HELX_P445 BX4 HIS NA 130  ? VAL NA 139  ? HIS W 130  VAL W 139  1 ? 10 
HELX_P HELX_P446 BX5 LYS NA 151  ? MET NA 161  ? LYS W 151  MET W 161  1 ? 11 
HELX_P HELX_P447 BX6 LYS OA 19   ? GLN OA 33   ? LYS X 22   GLN X 36   1 ? 15 
HELX_P HELX_P448 BX7 GLU OA 58   ? LEU OA 69   ? GLU X 61   LEU X 72   1 ? 12 
HELX_P HELX_P449 BX8 SER OA 88   ? GLY OA 96   ? SER X 91   GLY X 99   1 ? 9  
HELX_P HELX_P450 BX9 MET OA 165  ? GLN OA 173  ? MET X 165  GLN X 173  1 ? 9  
HELX_P HELX_P451 BY1 ASN OA 196  ? GLN OA 208  ? ASN X 196  GLN X 208  1 ? 13 
HELX_P HELX_P452 BY2 GLY PA 27   ? ASN PA 38   ? GLY a 27   ASN a 38   1 ? 12 
HELX_P HELX_P453 BY3 GLY PA 103  ? VAL PA 106  ? GLY a 103  VAL a 106  5 ? 4  
HELX_P HELX_P454 BY4 ASN QA 6    ? LEU QA 14   ? ASN b 6    LEU b 14   1 ? 9  
HELX_P HELX_P455 BY5 ILE RA 21   ? SER RA 29   ? ILE c 21   SER c 29   1 ? 9  
HELX_P HELX_P456 BY6 HIS SA 5    ? MET SA 13   ? HIS d 5    MET d 13   1 ? 9  
HELX_P HELX_P457 BY7 VAL TA 5    ? ALA TA 13   ? VAL e 5    ALA e 13   1 ? 9  
HELX_P HELX_P458 BY8 LYS TA 84   ? GLN TA 91   ? LYS e 84   GLN e 91   1 ? 8  
HELX_P HELX_P459 BY9 LYS UA 88   ? VAL UA 95   ? LYS f 88   VAL f 95   1 ? 8  
HELX_P HELX_P460 BZ1 LEU VA 3    ? LYS VA 9    ? LEU g 3    LYS g 9    1 ? 7  
HELX_P HELX_P461 BZ2 VAL VA 83   ? VAL VA 95   ? VAL g 83   VAL g 95   1 ? 13 
HELX_P HELX_P462 BZ3 GLU WA 20   ? GLY WA 27   ? GLU h 20   GLY h 27   1 ? 8  
HELX_P HELX_P463 BZ4 LEU WA 29   ? ASN WA 39   ? LEU h 29   ASN h 39   1 ? 11 
HELX_P HELX_P464 BZ5 ASN XA 6    ? THR XA 15   ? ASN i 6    THR i 15   1 ? 10 
HELX_P HELX_P465 BZ6 GLN YA 16   ? ARG YA 28   ? GLN j 16   ARG j 28   1 ? 13 
HELX_P HELX_P466 BZ7 LEU ZA 9    ? MET ZA 13   ? LEU k 9    MET k 13   5 ? 5  
HELX_P HELX_P467 BZ8 GLY AB 4    ? ALA AB 13   ? GLY l 4    ALA l 13   1 ? 10 
HELX_P HELX_P468 BZ9 SER BB 6    ? GLN BB 11   ? SER m 6    GLN m 11   1 ? 6  
HELX_P HELX_P469 CA1 ARG BB 73   ? GLU BB 75   ? ARG m 73   GLU m 75   5 ? 3  
HELX_P HELX_P470 CA2 LYS CB 2    ? LYS CB 9    ? LYS n 2    LYS n 9    1 ? 8  
HELX_P HELX_P471 CA3 ARG CB 61   ? ASN CB 63   ? ARG n 61   ASN n 63   5 ? 3  
HELX_P HELX_P472 CA4 PRO CB 75   ? LEU CB 80   ? PRO n 75   LEU n 80   1 ? 6  
HELX_P HELX_P473 CA5 ASP DB 18   ? ALA DB 25   ? ASP o 18   ALA o 25   1 ? 8  
HELX_P HELX_P474 CA6 LEU DB 56   ? ASN DB 68   ? LEU o 56   ASN o 68   1 ? 13 
HELX_P HELX_P475 CA7 MET DB 167  ? HIS DB 178  ? MET o 167  HIS o 178  1 ? 12 
HELX_P HELX_P476 CA8 THR DB 255  ? ASP DB 259  ? THR o 255  ASP o 259  5 ? 5  
HELX_P HELX_P477 CA9 GLY DB 271  ? ALA DB 280  ? GLY o 271  ALA o 280  1 ? 10 
HELX_P HELX_P478 CB1 GLU EB 48   ? GLY EB 64   ? GLU p 48   GLY p 64   1 ? 17 
HELX_P HELX_P479 CB2 PRO EB 65   ? GLU EB 75   ? PRO p 65   GLU p 75   1 ? 11 
HELX_P HELX_P480 CB3 ASN EB 78   ? ASN EB 85   ? ASN p 78   ASN p 85   5 ? 8  
HELX_P HELX_P481 CB4 TYR EB 90   ? GLY EB 104  ? TYR p 90   GLY p 104  1 ? 15 
HELX_P HELX_P482 CB5 SER EB 160  ? GLY EB 178  ? SER p 160  GLY p 178  1 ? 19 
HELX_P HELX_P483 CB6 GLY EB 178  ? GLU EB 189  ? GLY p 178  GLU p 189  1 ? 12 
HELX_P HELX_P484 CB7 ASN EB 192  ? ARG EB 199  ? ASN p 192  ARG p 199  5 ? 8  
HELX_P HELX_P485 CB8 SER EB 203  ? THR EB 216  ? SER p 203  THR p 216  1 ? 14 
HELX_P HELX_P486 CB9 LYS EB 223  ? GLU EB 232  ? LYS p 223  GLU p 232  1 ? 10 
HELX_P HELX_P487 CC1 ARG EB 237  ? ALA EB 272  ? ARG p 237  ALA p 272  1 ? 36 
HELX_P HELX_P488 CC2 VAL FB 401  ? PRO FB 403  ? VAL q 402  PRO q 404  5 ? 3  
HELX_P HELX_P489 CC3 PHE FB 404  ? HIS FB 415  ? PHE q 405  HIS q 416  1 ? 12 
HELX_P HELX_P490 CC4 GLY FB 427  ? ILE FB 432  ? GLY q 428  ILE q 433  1 ? 6  
HELX_P HELX_P491 CC5 TYR FB 435  ? GLY FB 440  ? TYR q 436  GLY q 441  1 ? 6  
HELX_P HELX_P492 CC6 ARG FB 454  ? GLY FB 470  ? ARG q 455  GLY q 471  1 ? 17 
HELX_P HELX_P493 CC7 ASP FB 498  ? GLU FB 508  ? ASP q 499  GLU q 509  1 ? 11 
HELX_P HELX_P494 CC8 GLU FB 521  ? ARG FB 525  ? GLU q 522  ARG q 526  5 ? 5  
HELX_P HELX_P495 CC9 THR FB 526  ? ARG FB 543  ? THR q 527  ARG q 544  1 ? 18 
HELX_P HELX_P496 CD1 THR FB 557  ? PHE FB 564  ? THR q 558  PHE q 565  1 ? 8  
HELX_P HELX_P497 CD2 ASP FB 590  ? GLN FB 606  ? ASP q 591  GLN q 607  1 ? 17 
HELX_P HELX_P498 CD3 GLY FB 617  ? GLY FB 636  ? GLY q 618  GLY q 637  1 ? 20 
HELX_P HELX_P499 CD4 PRO FB 652  ? ILE FB 659  ? PRO q 653  ILE q 660  1 ? 8  
HELX_P HELX_P500 CD5 ASN FB 675  ? SER FB 680  ? ASN q 676  SER q 681  1 ? 6  
HELX_P HELX_P501 CD6 SER FB 715  ? ARG FB 725  ? SER q 716  ARG q 726  1 ? 11 
HELX_P HELX_P502 CD7 ALA FB 726  ? ARG FB 728  ? ALA q 727  ARG q 729  5 ? 3  
HELX_P HELX_P503 CD8 THR FB 739  ? HIS FB 745  ? THR q 740  HIS q 746  1 ? 7  
HELX_P HELX_P504 CD9 PRO FB 753  ? THR FB 758  ? PRO q 754  THR q 759  5 ? 6  
HELX_P HELX_P505 CE1 LEU FB 760  ? GLY FB 771  ? LEU q 761  GLY q 772  1 ? 12 
HELX_P HELX_P506 CE2 PRO FB 785  ? LEU FB 799  ? PRO q 786  LEU q 800  1 ? 15 
HELX_P HELX_P507 CE3 THR FB 809  ? ALA FB 816  ? THR q 810  ALA q 817  1 ? 8  
HELX_P HELX_P508 CE4 ASP FB 821  ? SER FB 831  ? ASP q 822  SER q 832  1 ? 11 
HELX_P HELX_P509 CE5 GLU FB 832  ? SER FB 835  ? GLU q 833  SER q 836  5 ? 4  
HELX_P HELX_P510 CE6 CYS FB 836  ? SER FB 848  ? CYS q 837  SER q 849  1 ? 13 
HELX_P HELX_P511 CE7 ASN FB 850  ? PHE FB 854  ? ASN q 851  PHE q 855  5 ? 5  
HELX_P HELX_P512 CE8 LYS FB 860  ? PHE FB 872  ? LYS q 861  PHE q 873  1 ? 13 
HELX_P HELX_P513 CE9 GLY FB 876  ? GLU FB 890  ? GLY q 877  GLU q 891  1 ? 15 
HELX_P HELX_P514 CF1 TYR FB 893  ? ASN FB 901  ? TYR q 894  ASN q 902  1 ? 9  
HELX_P HELX_P515 CF2 GLN FB 904  ? GLU FB 926  ? GLN q 905  GLU q 927  1 ? 23 
HELX_P HELX_P516 CF3 ASP FB 935  ? PHE FB 948  ? ASP q 936  PHE q 949  1 ? 14 
HELX_P HELX_P517 CF4 GLU FB 1004 ? ALA FB 1012 ? GLU q 1005 ALA q 1013 1 ? 9  
HELX_P HELX_P518 CF5 LYS FB 1017 ? LEU FB 1021 ? LYS q 1018 LEU q 1022 5 ? 5  
HELX_P HELX_P519 CF6 ASN GB 482  ? THR GB 495  ? ASN r 482  THR r 495  1 ? 14 
HELX_P HELX_P520 CF7 LYS GB 509  ? HIS GB 524  ? LYS r 509  HIS r 524  1 ? 16 
HELX_P HELX_P521 CF8 MET GB 544  ? ALA GB 560  ? MET r 544  ALA r 560  1 ? 17 
HELX_P HELX_P522 CF9 GLU GB 579  ? THR GB 583  ? GLU r 579  THR r 583  5 ? 5  
HELX_P HELX_P523 CG1 THR GB 589  ? GLY GB 600  ? THR r 589  GLY r 600  1 ? 12 
HELX_P HELX_P524 CG2 GLU GB 616  ? ASP GB 622  ? GLU r 616  ASP r 622  5 ? 7  
HELX_P HELX_P525 CG3 ARG GB 624  ? GLN GB 643  ? ARG r 624  GLN r 643  1 ? 20 
HELX_P HELX_P526 CG4 ASN GB 657  ? LEU GB 665  ? ASN r 657  LEU r 665  1 ? 9  
HELX_P HELX_P527 CG5 ASP GB 668  ? GLY GB 672  ? ASP r 668  GLY r 672  1 ? 5  
HELX_P HELX_P528 CG6 ASP GB 677  ? ARG GB 681  ? ASP r 677  ARG r 681  5 ? 5  
HELX_P HELX_P529 CG7 LYS GB 696  ? HIS GB 715  ? LYS r 696  HIS r 715  1 ? 20 
HELX_P HELX_P530 CG8 LYS GB 729  ? ALA GB 735  ? LYS r 729  ALA r 735  1 ? 7  
HELX_P HELX_P531 CG9 ARG GB 736  ? LYS GB 745  ? ARG r 736  LYS r 745  1 ? 10 
HELX_P HELX_P532 CH1 GLU GB 760  ? GLU GB 767  ? GLU r 760  GLU r 767  1 ? 8  
HELX_P HELX_P533 CH2 GLU GB 773  ? LEU GB 778  ? GLU r 773  LEU r 778  1 ? 6  
HELX_P HELX_P534 CH3 ARG GB 791  ? ASP GB 803  ? ARG r 791  ASP r 803  1 ? 13 
HELX_P HELX_P535 CH4 THR GB 812  ? GLY GB 818  ? THR r 812  GLY r 818  1 ? 7  
HELX_P HELX_P536 CH5 GLY GB 845  ? GLY GB 854  ? GLY r 845  GLY r 854  1 ? 10 
HELX_P HELX_P537 CH6 GLU GB 875  ? ASN GB 884  ? GLU r 875  ASN r 884  1 ? 10 
HELX_P HELX_P538 CH7 GLN GB 892  ? LEU GB 907  ? GLN r 892  LEU r 907  1 ? 16 
HELX_P HELX_P539 CH8 ASN GB 912  ? GLY GB 921  ? ASN r 912  GLY r 921  1 ? 10 
HELX_P HELX_P540 CH9 ALA GB 923  ? SER GB 932  ? ALA r 923  SER r 932  1 ? 10 
HELX_P HELX_P541 CI1 SER GB 932  ? GLY GB 937  ? SER r 932  GLY r 937  1 ? 6  
HELX_P HELX_P542 CI2 SER GB 939  ? ASP GB 946  ? SER r 939  ASP r 946  1 ? 8  
HELX_P HELX_P543 CI3 LEU GB 949  ? LEU GB 956  ? LEU r 949  LEU r 956  1 ? 8  
HELX_P HELX_P544 CI4 VAL GB 957  ? ASN GB 967  ? VAL r 957  ASN r 967  1 ? 11 
HELX_P HELX_P545 CI5 THR GB 982  ? TYR GB 992  ? THR r 982  TYR r 992  1 ? 11 
HELX_P HELX_P546 CI6 THR GB 994  ? LEU GB 1005 ? THR r 994  LEU r 1005 1 ? 12 
HELX_P HELX_P547 CI7 SER GB 1010 ? LEU GB 1020 ? SER r 1010 LEU r 1020 1 ? 11 
HELX_P HELX_P548 CI8 SER GB 1021 ? LYS GB 1025 ? SER r 1021 LYS r 1025 5 ? 5  
HELX_P HELX_P549 CI9 ARG GB 1030 ? GLU GB 1032 ? ARG r 1030 GLU r 1032 5 ? 3  
HELX_P HELX_P550 CJ1 GLU GB 1033 ? ARG GB 1043 ? GLU r 1033 ARG r 1043 1 ? 11 
HELX_P HELX_P551 CJ2 GLU GB 1054 ? SER GB 1068 ? GLU r 1054 SER r 1068 1 ? 15 
HELX_P HELX_P552 CJ3 GLY GB 1074 ? GLY GB 1103 ? GLY r 1074 GLY r 1103 1 ? 30 
HELX_P HELX_P553 CJ4 TRP GB 1104 ? ARG GB 1121 ? TRP r 1104 ARG r 1121 1 ? 18 
HELX_P HELX_P554 CJ5 CYS GB 1127 ? PHE GB 1132 ? CYS r 1127 PHE r 1132 5 ? 6  
HELX_P HELX_P555 CJ6 PRO GB 1136 ? LYS GB 1146 ? PRO r 1136 LYS r 1146 1 ? 11 
HELX_P HELX_P556 CJ7 PRO GB 1149 ? LEU GB 1153 ? PRO r 1149 LEU r 1153 5 ? 5  
HELX_P HELX_P557 CJ8 ASN GB 1157 ? GLU GB 1163 ? ASN r 1157 GLU r 1163 1 ? 7  
HELX_P HELX_P558 CJ9 MET GB 1167 ? LYS GB 1169 ? MET r 1167 LYS r 1169 5 ? 3  
HELX_P HELX_P559 CK1 MET GB 1170 ? PHE GB 1181 ? MET r 1170 PHE r 1181 1 ? 12 
HELX_P HELX_P560 CK2 ASN GB 1314 ? ASP GB 1323 ? ASN r 1314 ASP r 1323 1 ? 10 
HELX_P HELX_P561 CK3 ASN GB 1329 ? TYR GB 1340 ? ASN r 1329 TYR r 1340 1 ? 12 
HELX_P HELX_P562 CK4 GLY GB 1355 ? SER GB 1371 ? GLY r 1355 SER r 1371 1 ? 17 
HELX_P HELX_P563 CK5 MET GB 1382 ? PHE GB 1397 ? MET r 1382 PHE r 1397 1 ? 16 
HELX_P HELX_P564 CK6 PHE GB 1397 ? ASN GB 1402 ? PHE r 1397 ASN r 1402 1 ? 6  
HELX_P HELX_P565 CK7 GLU GB 1411 ? LEU GB 1419 ? GLU r 1411 LEU r 1419 1 ? 9  
HELX_P HELX_P566 CK8 GLU GB 1430 ? ARG GB 1438 ? GLU r 1430 ARG r 1438 1 ? 9  
HELX_P HELX_P567 CK9 ARG GB 1442 ? ASN GB 1447 ? ARG r 1442 ASN r 1447 1 ? 6  
HELX_P HELX_P568 CL1 VAL GB 1456 ? GLY GB 1461 ? VAL r 1456 GLY r 1461 5 ? 6  
HELX_P HELX_P569 CL2 GLY GB 1464 ? ILE GB 1481 ? GLY r 1464 ILE r 1481 1 ? 18 
HELX_P HELX_P570 CL3 ASN GB 1496 ? GLY GB 1505 ? ASN r 1496 GLY r 1505 1 ? 10 
HELX_P HELX_P571 CL4 SER GB 1507 ? THR GB 1509 ? SER r 1507 THR r 1509 5 ? 3  
HELX_P HELX_P572 CL5 HIS GB 1534 ? MET GB 1542 ? HIS r 1534 MET r 1542 1 ? 9  
HELX_P HELX_P573 CL6 MET GB 1542 ? SER GB 1554 ? MET r 1542 SER r 1554 1 ? 13 
HELX_P HELX_P574 CL7 LYS GB 1567 ? ASP GB 1583 ? LYS r 1567 ASP r 1583 1 ? 17 
HELX_P HELX_P575 CL8 THR GB 1593 ? GLU GB 1602 ? THR r 1593 GLU r 1602 1 ? 10 
HELX_P HELX_P576 CL9 ASP GB 1606 ? ASN GB 1615 ? ASP r 1606 ASN r 1615 1 ? 10 
HELX_P HELX_P577 CM1 SER GB 1625 ? SER GB 1638 ? SER r 1625 SER r 1638 1 ? 14 
HELX_P HELX_P578 CM2 SER GB 1649 ? TRP GB 1652 ? SER r 1649 TRP r 1652 5 ? 4  
HELX_P HELX_P579 CM3 PRO GB 1680 ? HIS GB 1690 ? PRO r 1680 HIS r 1690 1 ? 11 
HELX_P HELX_P580 CM4 LYS GB 1710 ? LEU GB 1718 ? LYS r 1710 LEU r 1718 1 ? 9  
HELX_P HELX_P581 CM5 MET GB 1732 ? THR GB 1742 ? MET r 1732 THR r 1742 1 ? 11 
HELX_P HELX_P582 CM6 ASN GB 1747 ? THR GB 1756 ? ASN r 1747 THR r 1756 1 ? 10 
HELX_P HELX_P583 CM7 THR GB 1758 ? THR GB 1765 ? THR r 1758 THR r 1765 1 ? 8  
HELX_P HELX_P584 CM8 GLN GB 1766 ? TYR GB 1771 ? GLN r 1766 TYR r 1771 5 ? 6  
HELX_P HELX_P585 CM9 SER GB 1777 ? SER GB 1799 ? SER r 1777 SER r 1799 1 ? 23 
HELX_P HELX_P586 CN1 LEU GB 1813 ? TYR GB 1823 ? LEU r 1813 TYR r 1823 1 ? 11 
HELX_P HELX_P587 CN2 ASN GB 1825 ? LEU GB 1836 ? ASN r 1825 LEU r 1836 1 ? 12 
HELX_P HELX_P588 CN3 LYS GB 1841 ? ASN GB 1851 ? LYS r 1841 ASN r 1851 1 ? 11 
HELX_P HELX_P589 CN4 ALA GB 1852 ? GLU GB 1856 ? ALA r 1852 GLU r 1856 5 ? 5  
HELX_P HELX_P590 CN5 ASN GB 1866 ? LYS GB 1874 ? ASN r 1866 LYS r 1874 1 ? 9  
HELX_P HELX_P591 CN6 ASP GB 1886 ? SER GB 1900 ? ASP r 1886 SER r 1900 1 ? 15 
HELX_P HELX_P592 CN7 SER GB 1905 ? GLY GB 1934 ? SER r 1905 GLY r 1934 1 ? 30 
HELX_P HELX_P593 CN8 TRP GB 1935 ? ALA GB 1952 ? TRP r 1935 ALA r 1952 1 ? 18 
HELX_P HELX_P594 CN9 TYR GB 1959 ? LEU GB 1963 ? TYR r 1959 LEU r 1963 5 ? 5  
HELX_P HELX_P595 CO1 THR GB 1967 ? GLY GB 1978 ? THR r 1967 GLY r 1978 1 ? 12 
HELX_P HELX_P596 CO2 THR GB 2000 ? TYR GB 2014 ? THR r 2000 TYR r 2014 1 ? 15 
HELX_P HELX_P597 CO3 ALA GB 2071 ? ASN GB 2074 ? ALA r 2071 ASN r 2074 5 ? 4  
HELX_P HELX_P598 CO4 PRO HB 40   ? ALA HB 63   ? PRO w 40   ALA w 63   1 ? 24 
HELX_P HELX_P599 CO5 GLY HB 66   ? LEU HB 94   ? GLY w 66   LEU w 94   1 ? 29 
HELX_P HELX_P600 CO6 ALA IB 32   ? ASP IB 37   ? ALA N 32   ASP N 37   1 ? 6  
HELX_P HELX_P601 CO7 GLY IB 40   ? GLY IB 43   ? GLY N 40   GLY N 43   5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1   metalc ? ? B  U   62  OP1 ? ? ? 1_555 JB ZN .   ZN ? ? 2 U   62   2 ZN 1001 1_555 ? ? ? ? ? ? ?             2.267 ? ? 
metalc2   metalc ? ? E  A   53  OP1 ? ? ? 1_555 KB MG .   MG ? ? 6 A   53   6 MG 201  1_555 ? ? ? ? ? ? ?             2.174 ? ? 
metalc3   metalc ? ? E  G   54  OP2 ? ? ? 1_555 KB MG .   MG ? ? 6 G   54   6 MG 201  1_555 ? ? ? ? ? ? ?             2.395 ? ? 
metalc4   metalc ? ? E  G   71  OP1 ? ? ? 1_555 NB MG .   MG ? ? 6 G   71   6 MG 204  1_555 ? ? ? ? ? ? ?             2.291 ? ? 
metalc5   metalc ? ? E  U   74  OP1 ? ? ? 1_555 KB MG .   MG ? ? 6 U   74   6 MG 201  1_555 ? ? ? ? ? ? ?             2.962 ? ? 
metalc6   metalc ? ? E  G   75  OP2 ? ? ? 1_555 LB MG .   MG ? ? 6 G   75   6 MG 202  1_555 ? ? ? ? ? ? ?             2.311 ? ? 
metalc7   metalc ? ? E  G   75  OP1 ? ? ? 1_555 MB MG .   MG ? ? 6 G   75   6 MG 203  1_555 ? ? ? ? ? ? ?             2.721 ? ? 
metalc8   metalc ? ? P  CYS 101 N   ? ? ? 1_555 UB ZN .   ZN ? ? Q CYS 101  Q ZN 202  1_555 ? ? ? ? ? ? ?             2.277 ? ? 
metalc9   metalc ? ? P  CYS 102 N   ? ? ? 1_555 TB ZN .   ZN ? ? Q CYS 102  Q ZN 201  1_555 ? ? ? ? ? ? ?             2.390 ? ? 
metalc10  metalc ? ? BC ADP .   O1B ? ? ? 1_555 CC MG .   MG ? ? r ADP 2202 r MG 2203 1_555 ? ? ? ? ? ? ?             2.494 ? ? 
metalc11  metalc ? ? BC ADP .   O2B ? ? ? 1_555 CC MG .   MG ? ? r ADP 2202 r MG 2203 1_555 ? ? ? ? ? ? ?             1.858 ? ? 
hydrog1   hydrog ? ? B  C   3   N3  ? ? ? 1_555 E  G  95  N1 ? ? 2 C   3    6 G  95   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog2   hydrog ? ? B  C   3   N4  ? ? ? 1_555 E  G  95  O6 ? ? 2 C   3    6 G  95   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog3   hydrog ? ? B  C   3   O2  ? ? ? 1_555 E  G  95  N2 ? ? 2 C   3    6 G  95   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog4   hydrog ? ? B  G   4   N1  ? ? ? 1_555 E  C  94  N3 ? ? 2 G   4    6 C  94   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog5   hydrog ? ? B  G   4   N2  ? ? ? 1_555 E  C  94  O2 ? ? 2 G   4    6 C  94   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog6   hydrog ? ? B  G   4   O6  ? ? ? 1_555 E  C  94  N4 ? ? 2 G   4    6 C  94   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog7   hydrog ? ? B  C   5   N3  ? ? ? 1_555 E  G  93  N1 ? ? 2 C   5    6 G  93   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog8   hydrog ? ? B  C   5   N4  ? ? ? 1_555 E  G  93  O6 ? ? 2 C   5    6 G  93   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog9   hydrog ? ? B  C   5   O2  ? ? ? 1_555 E  G  93  N2 ? ? 2 C   5    6 G  93   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog10  hydrog ? ? B  U   6   N3  ? ? ? 1_555 E  A  92  N1 ? ? 2 U   6    6 A  92   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog11  hydrog ? ? B  U   6   O4  ? ? ? 1_555 E  A  92  N6 ? ? 2 U   6    6 A  92   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog12  hydrog ? ? B  U   7   N3  ? ? ? 1_555 E  A  91  N1 ? ? 2 U   7    6 A  91   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog13  hydrog ? ? B  U   7   O4  ? ? ? 1_555 E  A  91  N6 ? ? 2 U   7    6 A  91   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog14  hydrog ? ? B  C   8   N3  ? ? ? 1_555 E  G  90  N1 ? ? 2 C   8    6 G  90   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog15  hydrog ? ? B  C   8   N4  ? ? ? 1_555 E  G  90  O6 ? ? 2 C   8    6 G  90   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog16  hydrog ? ? B  C   8   O2  ? ? ? 1_555 E  G  90  N2 ? ? 2 C   8    6 G  90   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog17  hydrog ? ? B  C   10  N3  ? ? ? 1_555 E  G  88  N1 ? ? 2 C   10   6 G  88   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog18  hydrog ? ? B  C   10  N4  ? ? ? 1_555 E  G  88  O6 ? ? 2 C   10   6 G  88   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog19  hydrog ? ? B  C   10  O2  ? ? ? 1_555 E  G  88  N2 ? ? 2 C   10   6 G  88   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog20  hydrog ? ? B  C   10  N3  ? ? ? 1_555 E  U  89  N3 ? ? 2 C   10   6 U  89   1_555 ? ? ? ? ? ? TYPE_18_PAIR  ?     ? ? 
hydrog21  hydrog ? ? B  C   10  N4  ? ? ? 1_555 E  U  89  O4 ? ? 2 C   10   6 U  89   1_555 ? ? ? ? ? ? TYPE_18_PAIR  ?     ? ? 
hydrog22  hydrog ? ? B  G   11  N1  ? ? ? 1_555 E  C  87  N3 ? ? 2 G   11   6 C  87   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog23  hydrog ? ? B  G   11  N2  ? ? ? 1_555 E  C  87  O2 ? ? 2 G   11   6 C  87   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog24  hydrog ? ? B  G   11  O6  ? ? ? 1_555 E  C  87  N4 ? ? 2 G   11   6 C  87   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog25  hydrog ? ? B  G   12  N1  ? ? ? 1_555 E  U  86  O2 ? ? 2 G   12   6 U  86   1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog26  hydrog ? ? B  G   12  O6  ? ? ? 1_555 E  U  86  N3 ? ? 2 G   12   6 U  86   1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog27  hydrog ? ? B  C   13  N4  ? ? ? 1_555 E  A  84  N1 ? ? 2 C   13   6 A  84   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ?     ? ? 
hydrog28  hydrog ? ? B  C   14  N3  ? ? ? 1_555 E  U  85  N3 ? ? 2 C   14   6 U  85   1_555 ? ? ? ? ? ? TYPE_18_PAIR  ?     ? ? 
hydrog29  hydrog ? ? B  C   14  N4  ? ? ? 1_555 E  U  85  O4 ? ? 2 C   14   6 U  85   1_555 ? ? ? ? ? ? TYPE_18_PAIR  ?     ? ? 
hydrog30  hydrog ? ? B  U   16  O4  ? ? ? 1_555 E  G  80  N2 ? ? 2 U   16   6 G  80   1_555 ? ? ? ? ? ? 'U-G MISPAIR' ?     ? ? 
hydrog31  hydrog ? ? B  G   20  N1  ? ? ? 1_555 E  C  55  N3 ? ? 2 G   20   6 C  55   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog32  hydrog ? ? B  G   20  N2  ? ? ? 1_555 E  C  55  O2 ? ? 2 G   20   6 C  55   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog33  hydrog ? ? B  G   20  O6  ? ? ? 1_555 E  C  55  N4 ? ? 2 G   20   6 C  55   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog34  hydrog ? ? B  C   21  N3  ? ? ? 1_555 E  G  54  N1 ? ? 2 C   21   6 G  54   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog35  hydrog ? ? B  C   21  N4  ? ? ? 1_555 E  G  54  O6 ? ? 2 C   21   6 G  54   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog36  hydrog ? ? B  C   21  O2  ? ? ? 1_555 E  G  54  N2 ? ? 2 C   21   6 G  54   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog37  hydrog ? ? B  U   22  N3  ? ? ? 1_555 E  A  53  N1 ? ? 2 U   22   6 A  53   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog38  hydrog ? ? B  U   22  O4  ? ? ? 1_555 E  A  53  N6 ? ? 2 U   22   6 A  53   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog39  hydrog ? ? B  G   25  N1  ? ? ? 1_555 E  U  52  O2 ? ? 2 G   25   6 U  52   1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog40  hydrog ? ? B  G   25  O6  ? ? ? 1_555 E  U  52  N3 ? ? 2 G   25   6 U  52   1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog41  hydrog ? ? B  A   26  N1  ? ? ? 1_555 E  U  51  N3 ? ? 2 A   26   6 U  51   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog42  hydrog ? ? B  A   26  N6  ? ? ? 1_555 E  U  51  O4 ? ? 2 A   26   6 U  51   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog43  hydrog ? ? B  U   27  N3  ? ? ? 1_555 E  A  50  N1 ? ? 2 U   27   6 A  50   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog44  hydrog ? ? B  U   27  O4  ? ? ? 1_555 E  A  50  N6 ? ? 2 U   27   6 A  50   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog45  hydrog ? ? B  C   28  N3  ? ? ? 1_555 E  G  49  N1 ? ? 2 C   28   6 G  49   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog46  hydrog ? ? B  C   28  N4  ? ? ? 1_555 E  G  49  O6 ? ? 2 C   28   6 G  49   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog47  hydrog ? ? B  C   28  O2  ? ? ? 1_555 E  G  49  N2 ? ? 2 C   28   6 G  49   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog48  hydrog ? ? B  U   32  O4  ? ? ? 1_555 U  C  287 N4 ? ? 2 U   32   Z C  396  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ?     ? ? 
hydrog49  hydrog ? ? B  G   33  N1  ? ? ? 1_555 U  C  286 N3 ? ? 2 G   33   Z C  395  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog50  hydrog ? ? B  G   33  N2  ? ? ? 1_555 U  C  286 O2 ? ? 2 G   33   Z C  395  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog51  hydrog ? ? B  G   33  O6  ? ? ? 1_555 U  C  286 N4 ? ? 2 G   33   Z C  395  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog52  hydrog ? ? B  U   34  N3  ? ? ? 1_555 U  G  284 O6 ? ? 2 U   34   Z G  393  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog53  hydrog ? ? B  U   34  O2  ? ? ? 1_555 U  G  284 N1 ? ? 2 U   34   Z G  393  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog54  hydrog ? ? B  A   35  N1  ? ? ? 1_555 U  U  283 N3 ? ? 2 A   35   Z U  392  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog55  hydrog ? ? B  A   35  N6  ? ? ? 1_555 U  U  283 O4 ? ? 2 A   35   Z U  392  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog56  hydrog ? ? B  G   36  N1  ? ? ? 1_555 U  C  282 N3 ? ? 2 G   36   Z C  391  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog57  hydrog ? ? B  G   36  N2  ? ? ? 1_555 U  C  282 O2 ? ? 2 G   36   Z C  391  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog58  hydrog ? ? B  G   36  O6  ? ? ? 1_555 U  C  282 N4 ? ? 2 G   36   Z C  391  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog59  hydrog ? ? B  U   37  N3  ? ? ? 1_555 U  A  281 N1 ? ? 2 U   37   Z A  390  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog60  hydrog ? ? B  U   37  O4  ? ? ? 1_555 U  A  281 N6 ? ? 2 U   37   Z A  390  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog61  hydrog ? ? B  A   38  N1  ? ? ? 1_555 U  U  280 N3 ? ? 2 A   38   Z U  389  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog62  hydrog ? ? B  A   38  N6  ? ? ? 1_555 U  U  280 O4 ? ? 2 A   38   Z U  389  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog63  hydrog ? ? B  U   39  N3  ? ? ? 1_555 U  U  279 O4 ? ? 2 U   39   Z U  388  1_555 ? ? ? ? ? ? 'U-U MISPAIR' ?     ? ? 
hydrog64  hydrog ? ? B  C   40  N4  ? ? ? 1_555 U  U  278 O2 ? ? 2 C   40   Z U  387  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ?     ? ? 
hydrog65  hydrog ? ? B  U   41  N3  ? ? ? 1_555 U  A  277 N1 ? ? 2 U   41   Z A  386  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog66  hydrog ? ? B  U   41  O4  ? ? ? 1_555 U  A  277 N6 ? ? 2 U   41   Z A  386  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog67  hydrog ? ? B  G   42  N1  ? ? ? 1_555 U  G  275 O6 ? ? 2 G   42   Z G  384  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ?     ? ? 
hydrog68  hydrog ? ? B  G   42  N2  ? ? ? 1_555 U  U  276 O2 ? ? 2 G   42   Z U  385  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ?     ? ? 
hydrog69  hydrog ? ? B  U   43  O2  ? ? ? 1_555 U  G  275 N1 ? ? 2 U   43   Z G  384  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ?     ? ? 
hydrog70  hydrog ? ? B  U   44  N3  ? ? ? 1_555 U  U  274 O4 ? ? 2 U   44   Z U  383  1_555 ? ? ? ? ? ? 'U-U MISPAIR' ?     ? ? 
hydrog71  hydrog ? ? B  C   45  N3  ? ? ? 1_555 U  U  274 N3 ? ? 2 C   45   Z U  383  1_555 ? ? ? ? ? ? TYPE_18_PAIR  ?     ? ? 
hydrog72  hydrog ? ? B  C   45  N4  ? ? ? 1_555 U  U  274 O4 ? ? 2 C   45   Z U  383  1_555 ? ? ? ? ? ? TYPE_18_PAIR  ?     ? ? 
hydrog73  hydrog ? ? B  U   49  O4  ? ? ? 1_555 B  G  63  N1 ? ? 2 U   49   2 G  63   1_555 ? ? ? ? ? ? 'U-G MISPAIR' ?     ? ? 
hydrog74  hydrog ? ? B  A   51  N1  ? ? ? 1_555 B  U  62  N3 ? ? 2 A   51   2 U  62   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog75  hydrog ? ? B  A   51  N6  ? ? ? 1_555 B  U  62  O4 ? ? 2 A   51   2 U  62   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog76  hydrog ? ? B  G   52  N1  ? ? ? 1_555 B  C  61  N3 ? ? 2 G   52   2 C  61   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog77  hydrog ? ? B  G   52  N2  ? ? ? 1_555 B  C  61  O2 ? ? 2 G   52   2 C  61   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog78  hydrog ? ? B  G   52  O6  ? ? ? 1_555 B  C  61  N4 ? ? 2 G   52   2 C  61   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog79  hydrog ? ? B  U   53  N3  ? ? ? 1_555 B  U  60  O4 ? ? 2 U   53   2 U  60   1_555 ? ? ? ? ? ? TYPE_16_PAIR  ?     ? ? 
hydrog80  hydrog ? ? B  U   53  O2  ? ? ? 1_555 B  U  60  N3 ? ? 2 U   53   2 U  60   1_555 ? ? ? ? ? ? TYPE_16_PAIR  ?     ? ? 
hydrog81  hydrog ? ? B  U   54  O2  ? ? ? 1_555 B  A  59  N6 ? ? 2 U   54   2 A  59   1_555 ? ? ? ? ? ? 'U-A PAIR'    ?     ? ? 
hydrog82  hydrog ? ? D  G   8   N2  ? ? ? 1_555 D  U  74  O4 ? ? 5 G   8    5 U  74   1_555 ? ? ? ? ? ? 'G-U MISPAIR' ?     ? ? 
hydrog83  hydrog ? ? D  U   10  N3  ? ? ? 1_555 D  A  67  N1 ? ? 5 U   10   5 A  67   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog84  hydrog ? ? D  U   10  O4  ? ? ? 1_555 D  A  67  N6 ? ? 5 U   10   5 A  67   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog85  hydrog ? ? D  U   11  N3  ? ? ? 1_555 D  A  66  N1 ? ? 5 U   11   5 A  66   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog86  hydrog ? ? D  U   11  O4  ? ? ? 1_555 D  A  66  N6 ? ? 5 U   11   5 A  66   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog87  hydrog ? ? D  U   12  N3  ? ? ? 1_555 D  G  65  O6 ? ? 5 U   12   5 G  65   1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog88  hydrog ? ? D  U   12  O2  ? ? ? 1_555 D  G  65  N1 ? ? 5 U   12   5 G  65   1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog89  hydrog ? ? D  C   13  N3  ? ? ? 1_555 D  G  64  N1 ? ? 5 C   13   5 G  64   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog90  hydrog ? ? D  C   13  N4  ? ? ? 1_555 D  G  64  O6 ? ? 5 C   13   5 G  64   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog91  hydrog ? ? D  C   13  O2  ? ? ? 1_555 D  G  64  N2 ? ? 5 C   13   5 G  64   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog92  hydrog ? ? D  U   14  N3  ? ? ? 1_555 D  A  63  N1 ? ? 5 U   14   5 A  63   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog93  hydrog ? ? D  U   14  O4  ? ? ? 1_555 D  A  63  N6 ? ? 5 U   14   5 A  63   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog94  hydrog ? ? D  C   15  N4  ? ? ? 1_555 D  A  63  N1 ? ? 5 C   15   5 A  63   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ?     ? ? 
hydrog95  hydrog ? ? D  U   17  N3  ? ? ? 1_555 D  G  60  O6 ? ? 5 U   17   5 G  60   1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog96  hydrog ? ? D  U   17  O2  ? ? ? 1_555 D  G  60  N1 ? ? 5 U   17   5 G  60   1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog97  hydrog ? ? D  C   18  N3  ? ? ? 1_555 D  G  59  N1 ? ? 5 C   18   5 G  59   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog98  hydrog ? ? D  C   18  N4  ? ? ? 1_555 D  G  59  O6 ? ? 5 C   18   5 G  59   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog99  hydrog ? ? D  C   18  O2  ? ? ? 1_555 D  G  59  N2 ? ? 5 C   18   5 G  59   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog100 hydrog ? ? D  A   19  N1  ? ? ? 1_555 D  U  58  N3 ? ? 5 A   19   5 U  58   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog101 hydrog ? ? D  A   19  N6  ? ? ? 1_555 D  U  58  O4 ? ? 5 A   19   5 U  58   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog102 hydrog ? ? D  C   23  N3  ? ? ? 1_555 D  G  57  N1 ? ? 5 C   23   5 G  57   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog103 hydrog ? ? D  C   23  N4  ? ? ? 1_555 D  G  57  O6 ? ? 5 C   23   5 G  57   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog104 hydrog ? ? D  C   23  O2  ? ? ? 1_555 D  G  57  N2 ? ? 5 C   23   5 G  57   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog105 hydrog ? ? D  G   24  N2  ? ? ? 1_555 D  C  56  O2 ? ? 5 G   24   5 C  56   1_555 ? ? ? ? ? ? 'G-C PAIR'    ?     ? ? 
hydrog106 hydrog ? ? D  A   28  N1  ? ? ? 1_555 D  U  54  N3 ? ? 5 A   28   5 U  54   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog107 hydrog ? ? D  A   28  N6  ? ? ? 1_555 D  U  54  O4 ? ? 5 A   28   5 U  54   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog108 hydrog ? ? D  A   29  N1  ? ? ? 1_555 D  U  53  N3 ? ? 5 A   29   5 U  53   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog109 hydrog ? ? D  A   29  N6  ? ? ? 1_555 D  U  53  O4 ? ? 5 A   29   5 U  53   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog110 hydrog ? ? D  A   30  N1  ? ? ? 1_555 D  U  52  N3 ? ? 5 A   30   5 U  52   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog111 hydrog ? ? D  A   30  N6  ? ? ? 1_555 D  U  52  O4 ? ? 5 A   30   5 U  52   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog112 hydrog ? ? D  U   31  N3  ? ? ? 1_555 D  A  51  N1 ? ? 5 U   31   5 A  51   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog113 hydrog ? ? D  U   31  O4  ? ? ? 1_555 D  A  51  N6 ? ? 5 U   31   5 A  51   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog114 hydrog ? ? D  C   32  N3  ? ? ? 1_555 D  G  50  N1 ? ? 5 C   32   5 G  50   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog115 hydrog ? ? D  C   32  N4  ? ? ? 1_555 D  G  50  O6 ? ? 5 C   32   5 G  50   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog116 hydrog ? ? D  C   32  O2  ? ? ? 1_555 D  G  50  N2 ? ? 5 C   32   5 G  50   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog117 hydrog ? ? D  U   33  N3  ? ? ? 1_555 D  A  49  N1 ? ? 5 U   33   5 A  49   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog118 hydrog ? ? D  U   33  O4  ? ? ? 1_555 D  A  49  N6 ? ? 5 U   33   5 A  49   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog119 hydrog ? ? D  U   34  N3  ? ? ? 1_555 D  A  48  N1 ? ? 5 U   34   5 A  48   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog120 hydrog ? ? D  U   34  O4  ? ? ? 1_555 D  A  48  N6 ? ? 5 U   34   5 A  48   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog121 hydrog ? ? D  U   35  N3  ? ? ? 1_555 D  A  47  N1 ? ? 5 U   35   5 A  47   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog122 hydrog ? ? D  U   35  O4  ? ? ? 1_555 D  A  47  N6 ? ? 5 U   35   5 A  47   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog123 hydrog ? ? D  C   36  N3  ? ? ? 1_555 D  U  46  N3 ? ? 5 C   36   5 U  46   1_555 ? ? ? ? ? ? TYPE_18_PAIR  ?     ? ? 
hydrog124 hydrog ? ? D  C   36  N4  ? ? ? 1_555 D  U  46  O4 ? ? 5 C   36   5 U  46   1_555 ? ? ? ? ? ? TYPE_18_PAIR  ?     ? ? 
hydrog125 hydrog ? ? D  G   37  N1  ? ? ? 1_555 D  C  45  N3 ? ? 5 G   37   5 C  45   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog126 hydrog ? ? D  G   37  N2  ? ? ? 1_555 D  C  45  O2 ? ? 5 G   37   5 C  45   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog127 hydrog ? ? D  G   37  O6  ? ? ? 1_555 D  C  45  N4 ? ? 5 G   37   5 C  45   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog128 hydrog ? ? D  U   41  N3  ? ? ? 1_555 U  A  241 N1 ? ? 5 U   41   Z A  241  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog129 hydrog ? ? D  U   41  O4  ? ? ? 1_555 U  A  241 N6 ? ? 5 U   41   Z A  241  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog130 hydrog ? ? D  U   42  N3  ? ? ? 1_555 U  A  240 N1 ? ? 5 U   42   Z A  240  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog131 hydrog ? ? D  U   42  O4  ? ? ? 1_555 U  A  240 N6 ? ? 5 U   42   Z A  240  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog132 hydrog ? ? D  U   42  N3  ? ? ? 1_555 U  A  241 N1 ? ? 5 U   42   Z A  241  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog133 hydrog ? ? D  U   42  O4  ? ? ? 1_555 U  A  241 N6 ? ? 5 U   42   Z A  241  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog134 hydrog ? ? D  U   43  N3  ? ? ? 1_555 U  C  239 N3 ? ? 5 U   43   Z C  239  1_555 ? ? ? ? ? ? TYPE_18_PAIR  ?     ? ? 
hydrog135 hydrog ? ? D  U   43  O4  ? ? ? 1_555 U  C  239 N4 ? ? 5 U   43   Z C  239  1_555 ? ? ? ? ? ? TYPE_18_PAIR  ?     ? ? 
hydrog136 hydrog ? ? E  G   1   N1  ? ? ? 1_555 E  C  19  O2 ? ? 6 G   1    6 C  19   1_555 ? ? ? ? ? ? 'G-C PAIR'    ?     ? ? 
hydrog137 hydrog ? ? E  U   2   N3  ? ? ? 1_555 E  A  18  N1 ? ? 6 U   2    6 A  18   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog138 hydrog ? ? E  U   2   O4  ? ? ? 1_555 E  A  18  N6 ? ? 6 U   2    6 A  18   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog139 hydrog ? ? E  G   3   N1  ? ? ? 1_555 E  C  17  N3 ? ? 6 G   3    6 C  17   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog140 hydrog ? ? E  G   3   N2  ? ? ? 1_555 E  C  17  O2 ? ? 6 G   3    6 C  17   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog141 hydrog ? ? E  G   3   O6  ? ? ? 1_555 E  C  17  N4 ? ? 6 G   3    6 C  17   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog142 hydrog ? ? E  C   4   N3  ? ? ? 1_555 E  G  16  N1 ? ? 6 C   4    6 G  16   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog143 hydrog ? ? E  C   4   N4  ? ? ? 1_555 E  G  16  O6 ? ? 6 C   4    6 G  16   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog144 hydrog ? ? E  C   4   O2  ? ? ? 1_555 E  G  16  N2 ? ? 6 C   4    6 G  16   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog145 hydrog ? ? E  U   5   N3  ? ? ? 1_555 E  A  15  N1 ? ? 6 U   5    6 A  15   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog146 hydrog ? ? E  U   5   O4  ? ? ? 1_555 E  A  15  N6 ? ? 6 U   5    6 A  15   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog147 hydrog ? ? E  G   7   N1  ? ? ? 1_555 E  C  14  N3 ? ? 6 G   7    6 C  14   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog148 hydrog ? ? E  G   7   N2  ? ? ? 1_555 E  C  14  O2 ? ? 6 G   7    6 C  14   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog149 hydrog ? ? E  G   7   O6  ? ? ? 1_555 E  C  14  N4 ? ? 6 G   7    6 C  14   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog150 hydrog ? ? E  C   8   N3  ? ? ? 1_555 E  G  13  N1 ? ? 6 C   8    6 G  13   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog151 hydrog ? ? E  C   8   N4  ? ? ? 1_555 E  G  13  O6 ? ? 6 C   8    6 G  13   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog152 hydrog ? ? E  C   8   O2  ? ? ? 1_555 E  G  13  N2 ? ? 6 C   8    6 G  13   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog153 hydrog ? ? E  U   31  N3  ? ? ? 1_555 U  A  258 N7 ? ? 6 U   31   Z A  258  1_555 ? ? ? ? ? ? 'U-A PAIR'    ?     ? ? 
hydrog154 hydrog ? ? E  U   32  N3  ? ? ? 1_555 U  U  257 O4 ? ? 6 U   32   Z U  257  1_555 ? ? ? ? ? ? TYPE_16_PAIR  ?     ? ? 
hydrog155 hydrog ? ? E  U   32  O2  ? ? ? 1_555 U  U  257 N3 ? ? 6 U   32   Z U  257  1_555 ? ? ? ? ? ? TYPE_16_PAIR  ?     ? ? 
hydrog156 hydrog ? ? E  U   32  N3  ? ? ? 1_555 U  A  258 N7 ? ? 6 U   32   Z A  258  1_555 ? ? ? ? ? ? HOOGSTEEN     ?     ? ? 
hydrog157 hydrog ? ? E  U   32  O4  ? ? ? 1_555 U  A  258 N6 ? ? 6 U   32   Z A  258  1_555 ? ? ? ? ? ? HOOGSTEEN     ?     ? ? 
hydrog158 hydrog ? ? E  G   33  N1  ? ? ? 1_555 U  U  256 O2 ? ? 6 G   33   Z U  256  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ?     ? ? 
hydrog159 hydrog ? ? E  G   34  N1  ? ? ? 1_555 U  C  255 N3 ? ? 6 G   34   Z C  255  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog160 hydrog ? ? E  G   34  N2  ? ? ? 1_555 U  C  255 O2 ? ? 6 G   34   Z C  255  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog161 hydrog ? ? E  G   34  O6  ? ? ? 1_555 U  C  255 N4 ? ? 6 G   34   Z C  255  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog162 hydrog ? ? E  A   36  N6  ? ? ? 1_555 U  A  253 N7 ? ? 6 A   36   Z A  253  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ?     ? ? 
hydrog163 hydrog ? ? E  C   37  N3  ? ? ? 1_555 U  A  252 N6 ? ? 6 C   37   Z A  252  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ?     ? ? 
hydrog164 hydrog ? ? E  G   38  N1  ? ? ? 1_555 U  C  251 N3 ? ? 6 G   38   Z C  251  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog165 hydrog ? ? E  G   38  N2  ? ? ? 1_555 U  C  251 O2 ? ? 6 G   38   Z C  251  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog166 hydrog ? ? E  G   38  O6  ? ? ? 1_555 U  C  251 N4 ? ? 6 G   38   Z C  251  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog167 hydrog ? ? E  A   39  N1  ? ? ? 1_555 U  U  250 N3 ? ? 6 A   39   Z U  250  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog168 hydrog ? ? E  A   39  N6  ? ? ? 1_555 U  U  250 O4 ? ? 6 A   39   Z U  250  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog169 hydrog ? ? E  U   40  N3  ? ? ? 1_555 U  A  249 N1 ? ? 6 U   40   Z A  249  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog170 hydrog ? ? E  U   40  O4  ? ? ? 1_555 U  A  249 N6 ? ? 6 U   40   Z A  249  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog171 hydrog ? ? E  A   41  N1  ? ? ? 1_555 U  U  248 N3 ? ? 6 A   41   Z U  248  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog172 hydrog ? ? E  A   41  N6  ? ? ? 1_555 U  U  248 O4 ? ? 6 A   41   Z U  248  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog173 hydrog ? ? E  C   42  N3  ? ? ? 1_555 U  G  247 N1 ? ? 6 C   42   Z G  247  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog174 hydrog ? ? E  C   42  N4  ? ? ? 1_555 U  G  247 O6 ? ? 6 C   42   Z G  247  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog175 hydrog ? ? E  C   42  O2  ? ? ? 1_555 U  G  247 N2 ? ? 6 C   42   Z G  247  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog176 hydrog ? ? E  G   44  N2  ? ? ? 1_555 U  A  245 N7 ? ? 6 G   44   Z A  245  1_555 ? ? ? ? ? ? TYPE_11_PAIR  ?     ? ? 
hydrog177 hydrog ? ? E  G   44  N3  ? ? ? 1_555 U  A  245 N6 ? ? 6 G   44   Z A  245  1_555 ? ? ? ? ? ? TYPE_11_PAIR  ?     ? ? 
hydrog178 hydrog ? ? E  G   46  N1  ? ? ? 1_555 E  G  54  N7 ? ? 6 G   46   6 G  54   1_555 ? ? ? ? ? ? TYPE_7_PAIR   ?     ? ? 
hydrog179 hydrog ? ? E  G   46  N2  ? ? ? 1_555 E  G  54  O6 ? ? 6 G   46   6 G  54   1_555 ? ? ? ? ? ? TYPE_7_PAIR   ?     ? ? 
hydrog180 hydrog ? ? E  A   47  N1  ? ? ? 1_555 E  A  53  N6 ? ? 6 A   47   6 A  53   1_555 ? ? ? ? ? ? TYPE_5_PAIR   ?     ? ? 
hydrog181 hydrog ? ? E  A   47  N6  ? ? ? 1_555 E  A  53  N7 ? ? 6 A   47   6 A  53   1_555 ? ? ? ? ? ? TYPE_5_PAIR   ?     ? ? 
hydrog182 hydrog ? ? E  C   55  N4  ? ? ? 1_555 E  U  74  O2 ? ? 6 C   55   6 U  74   1_555 ? ? ? ? ? ? 'C-U MISPAIR' ?     ? ? 
hydrog183 hydrog ? ? E  U   57  N3  ? ? ? 1_555 E  A  78  N1 ? ? 6 U   57   6 A  78   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog184 hydrog ? ? E  U   57  O4  ? ? ? 1_555 E  A  78  N6 ? ? 6 U   57   6 A  78   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog185 hydrog ? ? E  G   58  N1  ? ? ? 1_555 E  C  77  N3 ? ? 6 G   58   6 C  77   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog186 hydrog ? ? E  G   58  N2  ? ? ? 1_555 E  C  77  O2 ? ? 6 G   58   6 C  77   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog187 hydrog ? ? E  G   58  O6  ? ? ? 1_555 E  C  77  N4 ? ? 6 G   58   6 C  77   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog188 hydrog ? ? E  G   59  N1  ? ? ? 1_555 E  A  76  N1 ? ? 6 G   59   6 A  76   1_555 ? ? ? ? ? ? TYPE_8_PAIR   ?     ? ? 
hydrog189 hydrog ? ? E  G   59  O6  ? ? ? 1_555 E  A  76  N6 ? ? 6 G   59   6 A  76   1_555 ? ? ? ? ? ? TYPE_8_PAIR   ?     ? ? 
hydrog190 hydrog ? ? E  C   61  N3  ? ? ? 1_555 E  G  75  N1 ? ? 6 C   61   6 G  75   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog191 hydrog ? ? E  C   61  N4  ? ? ? 1_555 E  G  75  O6 ? ? 6 C   61   6 G  75   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog192 hydrog ? ? E  C   61  O2  ? ? ? 1_555 E  G  75  N2 ? ? 6 C   61   6 G  75   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog193 hydrog ? ? E  C   62  N3  ? ? ? 1_555 E  G  72  N1 ? ? 6 C   62   6 G  72   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog194 hydrog ? ? E  C   62  N4  ? ? ? 1_555 E  G  72  O6 ? ? 6 C   62   6 G  72   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog195 hydrog ? ? E  C   62  O2  ? ? ? 1_555 E  G  72  N2 ? ? 6 C   62   6 G  72   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog196 hydrog ? ? E  C   63  N3  ? ? ? 1_555 E  G  71  N1 ? ? 6 C   63   6 G  71   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog197 hydrog ? ? E  C   63  N4  ? ? ? 1_555 E  G  71  O6 ? ? 6 C   63   6 G  71   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog198 hydrog ? ? E  C   63  O2  ? ? ? 1_555 E  G  71  N2 ? ? 6 C   63   6 G  71   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog199 hydrog ? ? E  U   64  N3  ? ? ? 1_555 E  A  70  N1 ? ? 6 U   64   6 A  70   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog200 hydrog ? ? E  U   64  O4  ? ? ? 1_555 E  A  70  N6 ? ? 6 U   64   6 A  70   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog201 hydrog ? ? E  G   65  N2  ? ? ? 1_555 E  A  69  N1 ? ? 6 G   65   6 A  69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LYS 941  H  . ? LYS 941  A PRO 942  H  ? PRO 942  A 1 0.86   
2  GLU 342  K  . ? GLU 342  D PRO 343  K  ? PRO 343  D 1 -1.92  
3  HIS 381  K  . ? HIS 381  D PRO 382  K  ? PRO 382  D 1 -4.05  
4  GLY 204  O  . ? GLY 204  P ILE 205  O  ? ILE 205  P 1 0.88   
5  ASP 13   P  . ? ASP 13   Q GLY 14   P  ? GLY 14   Q 1 -4.98  
6  THR 717  X  . ? THR 717  u PRO 718  X  ? PRO 718  u 1 -1.72  
7  SER 405  Y  . ? SER 405  v PRO 406  Y  ? PRO 406  v 1 -3.57  
8  ASN 916  Y  . ? ASN 916  v PRO 917  Y  ? PRO 917  v 1 -4.43  
9  VAL 931  Y  . ? VAL 931  v ASN 932  Y  ? ASN 932  v 1 -10.64 
10 TRP 471  DA . ? TRP 471  9 GLN 472  DA ? GLN 472  9 1 25.69  
11 GLU 498  MA . ? GLU 498  U TYR 499  MA ? TYR 499  U 1 -7.85  
12 PRO 745  MA . ? PRO 745  U PRO 746  MA ? PRO 746  U 1 1.62   
13 GLY 882  MA . ? GLY 882  U GLU 883  MA ? GLU 883  U 1 1.79   
14 GLN 979  MA . ? GLN 979  U PRO 980  MA ? PRO 980  U 1 -3.48  
15 PHE 1338 MA . ? PHE 1338 U PRO 1339 MA ? PRO 1339 U 1 -4.79  
16 ALA 80   AB . ? ALA 80   l PRO 81   AB ? PRO 81   l 1 -10.65 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 3 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 5 ? 
I  ? 6 ? 
J  ? 7 ? 
K  ? 2 ? 
L  ? 2 ? 
M  ? 2 ? 
N  ? 2 ? 
O  ? 3 ? 
P  ? 4 ? 
Q  ? 3 ? 
R  ? 4 ? 
S  ? 2 ? 
T  ? 2 ? 
U  ? 4 ? 
V  ? 3 ? 
W  ? 3 ? 
X  ? 4 ? 
Y  ? 3 ? 
Z  ? 4 ? 
AA ? 2 ? 
AB ? 2 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 7 ? 
AF ? 8 ? 
AG ? 5 ? 
AH ? 4 ? 
AI ? 4 ? 
AJ ? 3 ? 
AK ? 2 ? 
AL ? 4 ? 
AM ? 2 ? 
AN ? 4 ? 
AO ? 4 ? 
AP ? 4 ? 
AQ ? 4 ? 
AR ? 2 ? 
AS ? 3 ? 
AT ? 3 ? 
AU ? 2 ? 
AV ? 2 ? 
AW ? 2 ? 
AX ? 4 ? 
AY ? 2 ? 
AZ ? 4 ? 
BA ? 4 ? 
BB ? 4 ? 
BC ? 4 ? 
BD ? 4 ? 
BE ? 2 ? 
BF ? 2 ? 
BG ? 2 ? 
BH ? 4 ? 
BI ? 3 ? 
BJ ? 3 ? 
BK ? 2 ? 
BL ? 4 ? 
BM ? 3 ? 
BN ? 4 ? 
BO ? 4 ? 
BP ? 4 ? 
BQ ? 4 ? 
BR ? 4 ? 
BS ? 2 ? 
BT ? 7 ? 
BU ? 4 ? 
BV ? 7 ? 
BW ? 5 ? 
BX ? 2 ? 
BY ? 6 ? 
BZ ? 4 ? 
CA ? 2 ? 
CB ? 5 ? 
CC ? 3 ? 
CD ? 2 ? 
CE ? 5 ? 
CF ? 2 ? 
CG ? 4 ? 
CH ? 3 ? 
CI ? 5 ? 
CJ ? 2 ? 
CK ? 5 ? 
CL ? 3 ? 
CM ? 5 ? 
CN ? 5 ? 
CO ? 2 ? 
CP ? 5 ? 
CQ ? 3 ? 
CR ? 5 ? 
CS ? 3 ? 
CT ? 5 ? 
CU ? 3 ? 
CV ? 5 ? 
CW ? 2 ? 
CX ? 5 ? 
CY ? 3 ? 
CZ ? 5 ? 
DA ? 3 ? 
DB ? 5 ? 
DC ? 3 ? 
DD ? 3 ? 
DE ? 2 ? 
DF ? 8 ? 
DG ? 8 ? 
DH ? 6 ? 
DI ? 2 ? 
DJ ? 4 ? 
DK ? 2 ? 
DL ? 8 ? 
DM ? 6 ? 
DN ? 2 ? 
DO ? 2 ? 
DP ? 3 ? 
DQ ? 4 ? 
DR ? 7 ? 
DS ? 5 ? 
DT ? 2 ? 
DU ? 2 ? 
DV ? 3 ? 
DW ? 4 ? 
DX ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? parallel      
H  4 5 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
I  4 5 ? parallel      
I  5 6 ? parallel      
J  1 2 ? parallel      
J  2 3 ? parallel      
J  3 4 ? anti-parallel 
J  4 5 ? anti-parallel 
J  5 6 ? parallel      
J  6 7 ? anti-parallel 
K  1 2 ? parallel      
L  1 2 ? anti-parallel 
M  1 2 ? parallel      
N  1 2 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AE 4 5 ? anti-parallel 
AE 5 6 ? anti-parallel 
AE 6 7 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AF 5 6 ? anti-parallel 
AF 6 7 ? anti-parallel 
AF 7 8 ? anti-parallel 
AG 1 2 ? parallel      
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AG 4 5 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AR 1 2 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AU 1 2 ? anti-parallel 
AV 1 2 ? anti-parallel 
AW 1 2 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AY 1 2 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BE 1 2 ? anti-parallel 
BF 1 2 ? anti-parallel 
BG 1 2 ? anti-parallel 
BH 1 2 ? anti-parallel 
BH 2 3 ? anti-parallel 
BH 3 4 ? anti-parallel 
BI 1 2 ? anti-parallel 
BI 2 3 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BK 1 2 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BM 1 2 ? anti-parallel 
BM 2 3 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BN 3 4 ? anti-parallel 
BO 1 2 ? anti-parallel 
BO 2 3 ? anti-parallel 
BO 3 4 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? anti-parallel 
BP 3 4 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BQ 2 3 ? anti-parallel 
BQ 3 4 ? anti-parallel 
BR 1 2 ? anti-parallel 
BR 2 3 ? anti-parallel 
BR 3 4 ? anti-parallel 
BS 1 2 ? anti-parallel 
BT 1 2 ? anti-parallel 
BT 2 3 ? anti-parallel 
BT 3 4 ? anti-parallel 
BT 4 5 ? anti-parallel 
BT 5 6 ? anti-parallel 
BT 6 7 ? anti-parallel 
BU 1 2 ? parallel      
BU 2 3 ? anti-parallel 
BU 3 4 ? anti-parallel 
BV 1 2 ? parallel      
BV 2 3 ? parallel      
BV 3 4 ? parallel      
BV 4 5 ? parallel      
BV 5 6 ? parallel      
BV 6 7 ? parallel      
BW 1 2 ? parallel      
BW 2 3 ? parallel      
BW 3 4 ? parallel      
BW 4 5 ? parallel      
BX 1 2 ? anti-parallel 
BY 1 2 ? anti-parallel 
BY 2 3 ? parallel      
BY 3 4 ? parallel      
BY 4 5 ? parallel      
BY 5 6 ? parallel      
BZ 1 2 ? anti-parallel 
BZ 2 3 ? anti-parallel 
BZ 3 4 ? anti-parallel 
CA 1 2 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CB 4 5 ? anti-parallel 
CC 1 2 ? anti-parallel 
CC 2 3 ? anti-parallel 
CD 1 2 ? anti-parallel 
CE 1 2 ? anti-parallel 
CE 2 3 ? anti-parallel 
CE 3 4 ? anti-parallel 
CE 4 5 ? anti-parallel 
CF 1 2 ? anti-parallel 
CG 1 2 ? anti-parallel 
CG 2 3 ? anti-parallel 
CG 3 4 ? anti-parallel 
CH 1 2 ? anti-parallel 
CH 2 3 ? anti-parallel 
CI 1 2 ? anti-parallel 
CI 2 3 ? anti-parallel 
CI 3 4 ? anti-parallel 
CI 4 5 ? anti-parallel 
CJ 1 2 ? anti-parallel 
CK 1 2 ? anti-parallel 
CK 2 3 ? anti-parallel 
CK 3 4 ? anti-parallel 
CK 4 5 ? anti-parallel 
CL 1 2 ? anti-parallel 
CL 2 3 ? anti-parallel 
CM 1 2 ? anti-parallel 
CM 2 3 ? anti-parallel 
CM 3 4 ? anti-parallel 
CM 4 5 ? anti-parallel 
CN 1 2 ? anti-parallel 
CN 2 3 ? anti-parallel 
CN 3 4 ? anti-parallel 
CN 4 5 ? anti-parallel 
CO 1 2 ? anti-parallel 
CP 1 2 ? anti-parallel 
CP 2 3 ? anti-parallel 
CP 3 4 ? anti-parallel 
CP 4 5 ? anti-parallel 
CQ 1 2 ? anti-parallel 
CQ 2 3 ? anti-parallel 
CR 1 2 ? anti-parallel 
CR 2 3 ? anti-parallel 
CR 3 4 ? anti-parallel 
CR 4 5 ? anti-parallel 
CS 1 2 ? anti-parallel 
CS 2 3 ? anti-parallel 
CT 1 2 ? anti-parallel 
CT 2 3 ? anti-parallel 
CT 3 4 ? anti-parallel 
CT 4 5 ? anti-parallel 
CU 1 2 ? anti-parallel 
CU 2 3 ? anti-parallel 
CV 1 2 ? anti-parallel 
CV 2 3 ? anti-parallel 
CV 3 4 ? anti-parallel 
CV 4 5 ? anti-parallel 
CW 1 2 ? anti-parallel 
CX 1 2 ? anti-parallel 
CX 2 3 ? anti-parallel 
CX 3 4 ? anti-parallel 
CX 4 5 ? anti-parallel 
CY 1 2 ? anti-parallel 
CY 2 3 ? anti-parallel 
CZ 1 2 ? anti-parallel 
CZ 2 3 ? anti-parallel 
CZ 3 4 ? anti-parallel 
CZ 4 5 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DB 3 4 ? anti-parallel 
DB 4 5 ? anti-parallel 
DC 1 2 ? anti-parallel 
DC 2 3 ? anti-parallel 
DD 1 2 ? anti-parallel 
DD 2 3 ? anti-parallel 
DE 1 2 ? anti-parallel 
DF 1 2 ? anti-parallel 
DF 2 3 ? anti-parallel 
DF 3 4 ? anti-parallel 
DF 4 5 ? anti-parallel 
DF 5 6 ? anti-parallel 
DF 6 7 ? anti-parallel 
DF 7 8 ? anti-parallel 
DG 1 2 ? parallel      
DG 2 3 ? parallel      
DG 3 4 ? parallel      
DG 4 5 ? parallel      
DG 5 6 ? parallel      
DG 6 7 ? parallel      
DG 7 8 ? anti-parallel 
DH 1 2 ? parallel      
DH 2 3 ? parallel      
DH 3 4 ? parallel      
DH 4 5 ? parallel      
DH 5 6 ? parallel      
DI 1 2 ? anti-parallel 
DJ 1 2 ? anti-parallel 
DJ 2 3 ? anti-parallel 
DJ 3 4 ? anti-parallel 
DK 1 2 ? anti-parallel 
DL 1 2 ? anti-parallel 
DL 2 3 ? anti-parallel 
DL 3 4 ? parallel      
DL 4 5 ? parallel      
DL 5 6 ? parallel      
DL 6 7 ? parallel      
DL 7 8 ? parallel      
DM 1 2 ? parallel      
DM 2 3 ? parallel      
DM 3 4 ? parallel      
DM 4 5 ? parallel      
DM 5 6 ? parallel      
DN 1 2 ? anti-parallel 
DO 1 2 ? anti-parallel 
DP 1 2 ? anti-parallel 
DP 2 3 ? anti-parallel 
DQ 1 2 ? anti-parallel 
DQ 2 3 ? anti-parallel 
DQ 3 4 ? anti-parallel 
DR 1 2 ? parallel      
DR 2 3 ? parallel      
DR 3 4 ? parallel      
DR 4 5 ? parallel      
DR 5 6 ? parallel      
DR 6 7 ? parallel      
DS 1 2 ? parallel      
DS 2 3 ? parallel      
DS 3 4 ? parallel      
DS 4 5 ? parallel      
DT 1 2 ? anti-parallel 
DU 1 2 ? anti-parallel 
DV 1 2 ? anti-parallel 
DV 2 3 ? anti-parallel 
DW 1 2 ? anti-parallel 
DW 2 3 ? anti-parallel 
DW 3 4 ? anti-parallel 
DX 1 2 ? anti-parallel 
DX 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ARG A  108  ? HIS A  111  ? ARG 1 108  HIS 1 111  
A  2 TRP A  37   ? GLY A  41   ? TRP 1 37   GLY 1 41   
A  3 CYS A  80   ? CYS A  83   ? CYS 1 80   CYS 1 83   
A  4 ASN A  64   ? LEU A  67   ? ASN 1 64   LEU 1 67   
B  1 PHE F  46   ? LYS F  48   ? PHE 7 46   LYS 7 48   
B  2 TYR F  54   ? CYS F  56   ? TYR 7 54   CYS 7 56   
B  3 THR F  61   ? HIS F  63   ? THR 7 61   HIS 7 63   
C  1 VAL H  116  ? HIS H  121  ? VAL A 116  HIS A 121  
C  2 PHE H  482  ? LEU H  487  ? PHE A 482  LEU A 487  
D  1 ARG H  227  ? GLN H  229  ? ARG A 227  GLN A 229  
D  2 SER H  415  ? ARG H  417  ? SER A 415  ARG A 417  
E  1 GLY H  895  ? PHE H  898  ? GLY A 895  PHE A 898  
E  2 PRO H  907  ? ASP H  910  ? PRO A 907  ASP A 910  
F  1 PHE H  1174 ? TYR H  1178 ? PHE A 1174 TYR A 1178 
F  2 CYS H  973  ? ARG H  980  ? CYS A 973  ARG A 980  
F  3 ARG H  1094 ? PHE H  1101 ? ARG A 1094 PHE A 1101 
F  4 ILE H  1085 ? TYR H  1091 ? ILE A 1085 TYR A 1091 
G  1 LEU H  1185 ? PHE H  1187 ? LEU A 1185 PHE A 1187 
G  2 PHE H  1192 ? PRO H  1198 ? PHE A 1192 PRO A 1198 
G  3 ARG H  1224 ? VAL H  1232 ? ARG A 1224 VAL A 1232 
G  4 ASN H  1215 ? GLN H  1217 ? ASN A 1215 GLN A 1217 
H  1 VAL H  1609 ? LYS H  1611 ? VAL A 1609 LYS A 1611 
H  2 ILE H  1629 ? LEU H  1631 ? ILE A 1629 LEU A 1631 
H  3 TYR H  1660 ? ARG H  1667 ? TYR A 1660 ARG A 1667 
H  4 VAL H  1701 ? ASP H  1706 ? VAL A 1701 ASP A 1706 
H  5 LEU H  1711 ? TYR H  1715 ? LEU A 1711 TYR A 1715 
I  1 VAL H  1915 ? ASN H  1918 ? VAL A 1915 ASN A 1918 
I  2 GLN H  1816 ? ILE H  1822 ? GLN A 1816 ILE A 1822 
I  3 GLY H  1805 ? ASN H  1811 ? GLY A 1805 ASN A 1811 
I  4 ILE H  1777 ? ASP H  1781 ? ILE A 1777 ASP A 1781 
I  5 GLN H  1860 ? VAL H  1863 ? GLN A 1860 VAL A 1863 
I  6 VAL H  1883 ? GLY H  1886 ? VAL A 1883 GLY A 1886 
J  1 GLN H  2260 ? LEU H  2263 ? GLN A 2260 LEU A 2263 
J  2 THR H  2103 ? LEU H  2106 ? THR A 2103 LEU A 2106 
J  3 VAL H  2139 ? VAL H  2146 ? VAL A 2139 VAL A 2146 
J  4 ALA H  2125 ? SER H  2132 ? ALA A 2125 SER A 2132 
J  5 TRP H  2177 ? GLN H  2181 ? TRP A 2177 GLN A 2181 
J  6 ILE H  2213 ? THR H  2219 ? ILE A 2213 THR A 2219 
J  7 SER H  2222 ? ALA H  2227 ? SER A 2222 ALA A 2227 
K  1 CYS H  2144 ? VAL H  2146 ? CYS A 2144 VAL A 2146 
K  2 PHE H  2270 ? MET H  2272 ? PHE A 2270 MET A 2272 
L  1 GLN H  2150 ? GLY H  2152 ? GLN A 2150 GLY A 2152 
L  2 VAL H  2157 ? LEU H  2159 ? VAL A 2157 LEU A 2159 
M  1 VAL I  132  ? LEU I  134  ? VAL B 132  LEU B 134  
M  2 ILE I  202  ? ASP I  204  ? ILE B 202  ASP B 204  
N  1 CYS I  476  ? THR I  478  ? CYS B 476  THR B 478  
N  2 ALA I  563  ? ILE I  565  ? ALA B 563  ILE B 565  
O  1 LYS I  480  ? SER I  483  ? LYS B 480  SER B 483  
O  2 PHE I  490  ? ARG I  495  ? PHE B 490  ARG B 495  
O  3 TRP I  549  ? LEU I  551  ? TRP B 549  LEU B 551  
P  1 ILE I  653  ? VAL I  655  ? ILE B 653  VAL B 655  
P  2 ILE I  588  ? PRO I  594  ? ILE B 588  PRO B 594  
P  3 HIS I  627  ? GLY I  631  ? HIS B 627  GLY B 631  
P  4 THR I  618  ? VAL I  621  ? THR B 618  VAL B 621  
Q  1 CYS I  663  ? VAL I  666  ? CYS B 663  VAL B 666  
Q  2 PRO I  825  ? PRO I  830  ? PRO B 825  PRO B 830  
Q  3 TRP I  904  ? ILE I  906  ? TRP B 904  ILE B 906  
R  1 PHE I  896  ? PHE I  901  ? PHE B 896  PHE B 901  
R  2 TYR I  831  ? ALA I  838  ? TYR B 831  ALA B 838  
R  3 TYR I  869  ? PRO I  876  ? TYR B 869  PRO B 876  
R  4 HIS I  856  ? ALA I  861  ? HIS B 856  ALA B 861  
S  1 THR I  686  ? PRO I  691  ? THR B 686  PRO B 691  
S  2 VAL I  787  ? ASP I  793  ? VAL B 787  ASP B 793  
T  1 TYR J  176  ? ARG J  178  ? TYR C 176  ARG C 178  
T  2 VAL J  196  ? ARG J  198  ? VAL C 196  ARG C 198  
U  1 VAL K  207  ? VAL K  212  ? VAL D 207  VAL D 212  
U  2 TRP K  218  ? SER K  223  ? TRP D 218  SER D 223  
U  3 THR K  227  ? ASP K  232  ? THR D 227  ASP D 232  
U  4 LEU K  238  ? THR K  243  ? LEU D 238  THR D 243  
V  1 GLN K  269  ? ASP K  274  ? GLN D 269  ASP D 274  
V  2 TYR K  260  ? GLY K  265  ? TYR D 260  GLY D 265  
V  3 VAL K  249  ? VAL K  254  ? VAL D 249  VAL D 254  
W  1 ALA K  312  ? ASP K  316  ? ALA D 312  ASP D 316  
W  2 VAL K  302  ? SER K  307  ? VAL D 302  SER D 307  
W  3 VAL K  291  ? LEU K  296  ? VAL D 291  LEU D 296  
X  1 VAL K  333  ? CYS K  338  ? VAL D 333  CYS D 338  
X  2 ILE K  345  ? SER K  349  ? ILE D 345  SER D 349  
X  3 THR K  353  ? TRP K  357  ? THR D 353  TRP D 357  
X  4 THR K  364  ? THR K  369  ? THR D 364  THR D 369  
Y  1 MET K  436  ? ASP K  440  ? MET D 436  ASP D 440  
Y  2 VAL K  426  ? ALA K  431  ? VAL D 426  ALA D 431  
Y  3 ILE K  416  ? VAL K  421  ? ILE D 416  VAL D 421  
Z  1 TRP K  194  ? ILE K  200  ? TRP D 194  ILE D 200  
Z  2 THR K  485  ? GLU K  491  ? THR D 485  GLU D 491  
Z  3 LEU K  477  ? GLU K  481  ? LEU D 477  GLU D 481  
Z  4 ILE K  465  ? PHE K  470  ? ILE D 465  PHE D 470  
AA 1 TYR L  137  ? LEU L  139  ? TYR E 137  LEU E 139  
AA 2 TYR L  152  ? GLY L  154  ? TYR E 152  GLY E 154  
AB 1 MET O  36   ? LYS O  38   ? MET P 36   LYS P 38   
AB 2 PHE O  55   ? TRP O  57   ? PHE P 55   TRP P 57   
AC 1 LEU O  234  ? GLY O  237  ? LEU P 234  GLY P 237  
AC 2 ASN O  299  ? TRP O  302  ? ASN P 299  TRP P 302  
AD 1 THR O  262  ? VAL O  264  ? THR P 262  VAL P 264  
AD 2 CYS O  269  ? PHE O  271  ? CYS P 269  PHE P 271  
AE 1 ASN S  13   ? GLU S  17   ? ASN V 13   GLU V 17   
AE 2 ILE S  22   ? LEU S  27   ? ILE V 22   LEU V 27   
AE 3 ILE S  128  ? GLN S  134  ? ILE V 128  GLN V 134  
AE 4 ILE S  97   ? MET S  100  ? ILE V 97   MET V 100  
AE 5 PHE S  112  ? THR S  115  ? PHE V 112  THR V 115  
AE 6 MET S  61   ? GLY S  64   ? MET V 61   GLY V 64   
AE 7 ARG S  55   ? ILE S  57   ? ARG V 55   ILE V 57   
AF 1 ARG V  56   ? VAL V  58   ? ARG s 56   VAL s 58   
AF 2 ILE V  62   ? GLY V  65   ? ILE s 62   GLY s 65   
AF 3 PHE V  113  ? THR V  116  ? PHE s 113  THR s 116  
AF 4 LEU V  98   ? MET V  101  ? LEU s 98   MET s 101  
AF 5 THR V  128  ? VAL V  133  ? THR s 128  VAL s 133  
AF 6 GLY V  22   ? LEU V  28   ? GLY s 22   LEU s 28   
AF 7 LYS V  14   ? THR V  19   ? LYS s 14   THR s 19   
AF 8 ILE V  161  ? VAL V  166  ? ILE s 161  VAL s 166  
AG 1 VAL Y  1173 ? ASP Y  1175 ? VAL v 1173 ASP v 1175 
AG 2 LEU Y  3    ? GLN Y  9    ? LEU v 3    GLN v 9    
AG 3 ILE Y  1126 ? PRO Y  1131 ? ILE v 1126 PRO v 1131 
AG 4 SER Y  1116 ? THR Y  1120 ? SER v 1116 THR v 1120 
AG 5 SER Y  1103 ? THR Y  1107 ? SER v 1103 THR v 1107 
AH 1 PHE Y  16   ? GLY Y  20   ? PHE v 16   GLY v 20   
AH 2 GLU Y  29   ? SER Y  33   ? GLU v 29   SER v 33   
AH 3 ILE Y  37   ? PRO Y  43   ? ILE v 37   PRO v 43   
AH 4 VAL Y  50   ? GLU Y  57   ? VAL v 50   GLU v 57   
AI 1 ILE Y  62   ? ARG Y  69   ? ILE v 62   ARG v 69   
AI 2 ASP Y  76   ? SER Y  82   ? ASP v 76   SER v 82   
AI 3 ARG Y  86   ? GLN Y  93   ? ARG v 86   GLN v 93   
AI 4 MET Y  98   ? THR Y  106  ? MET v 98   THR v 106  
AJ 1 PHE Y  120  ? VAL Y  123  ? PHE v 120  VAL v 123  
AJ 2 ALA Y  129  ? SER Y  133  ? ALA v 129  SER v 133  
AJ 3 LYS Y  139  ? ILE Y  143  ? LYS v 139  ILE v 143  
AK 1 LEU Y  144  ? ASP Y  147  ? LEU v 144  ASP v 147  
AK 2 ARG Y  151  ? ILE Y  154  ? ARG v 151  ILE v 154  
AL 1 THR Y  165  ? VAL Y  167  ? THR v 165  VAL v 167  
AL 2 MET Y  181  ? ASP Y  188  ? MET v 181  ASP v 188  
AL 3 THR Y  207  ? ASP Y  214  ? THR v 207  ASP v 214  
AL 4 HIS Y  219  ? PRO Y  227  ? HIS v 219  PRO v 227  
AM 1 VAL Y  170  ? VAL Y  173  ? VAL v 170  VAL v 173  
AM 2 MET Y  181  ? CYS Y  184  ? MET v 181  CYS v 184  
AN 1 ILE Y  267  ? PRO Y  270  ? ILE v 267  PRO v 270  
AN 2 TYR Y  255  ? TYR Y  258  ? TYR v 255  TYR v 258  
AN 3 GLY Y  247  ? SER Y  252  ? GLY v 247  SER v 252  
AN 4 GLY Y  232  ? VAL Y  238  ? GLY v 232  VAL v 238  
AO 1 THR Y  292  ? LYS Y  294  ? THR v 292  LYS v 294  
AO 2 PHE Y  299  ? GLN Y  304  ? PHE v 299  GLN v 304  
AO 3 ILE Y  310  ? GLU Y  316  ? ILE v 310  GLU v 316  
AO 4 GLU Y  324  ? ARG Y  326  ? GLU v 324  ARG v 326  
AP 1 ALA Y  336  ? LEU Y  342  ? ALA v 336  LEU v 342  
AP 2 PHE Y  346  ? SER Y  351  ? PHE v 346  SER v 351  
AP 3 HIS Y  356  ? ILE Y  361  ? HIS v 356  ILE v 361  
AP 4 LEU Y  395  ? LEU Y  401  ? LEU v 395  LEU v 401  
AQ 1 CYS Y  410  ? ALA Y  413  ? CYS v 410  ALA v 413  
AQ 2 GLN Y  422  ? CYS Y  427  ? GLN v 422  CYS v 427  
AQ 3 SER Y  434  ? ARG Y  439  ? SER v 434  ARG v 439  
AQ 4 ASN Y  775  ? PRO Y  780  ? ASN v 775  PRO v 780  
AR 1 VAL Y  444  ? GLU Y  446  ? VAL v 444  GLU v 446  
AR 2 LEU Y  765  ? LEU Y  767  ? LEU v 765  LEU v 767  
AS 1 ALA Y  458  ? VAL Y  462  ? ALA v 458  VAL v 462  
AS 2 TYR Y  473  ? SER Y  477  ? TYR v 473  SER v 477  
AS 3 VAL Y  484  ? SER Y  486  ? VAL v 484  SER v 486  
AT 1 SER Y  507  ? LEU Y  510  ? SER v 507  LEU v 510  
AT 2 LEU Y  516  ? VAL Y  519  ? LEU v 516  VAL v 519  
AT 3 ARG Y  525  ? ILE Y  527  ? ARG v 525  ILE v 527  
AU 1 CYS Y  547  ? VAL Y  549  ? CYS v 547  VAL v 549  
AU 2 VAL Y  554  ? ILE Y  556  ? VAL v 554  ILE v 556  
AV 1 LEU Y  605  ? GLY Y  608  ? LEU v 605  GLY v 608  
AV 2 VAL Y  614  ? ILE Y  617  ? VAL v 614  ILE v 617  
AW 1 GLY Y  672  ? LEU Y  675  ? GLY v 671  LEU v 675  
AW 2 ASP Y  688  ? THR Y  691  ? ASP v 688  THR v 691  
AX 1 LYS Y  700  ? MET Y  706  ? LYS v 700  MET v 706  
AX 2 GLN Y  709  ? MET Y  715  ? GLN v 709  MET v 715  
AX 3 SER Y  719  ? TYR Y  723  ? SER v 719  TYR v 723  
AX 4 HIS Y  730  ? PRO Y  733  ? HIS v 730  PRO v 733  
AY 1 SER Y  743  ? PHE Y  745  ? SER v 743  PHE v 745  
AY 2 GLY Y  753  ? VAL Y  755  ? GLY v 753  VAL v 755  
AZ 1 PHE Y  788  ? HIS Y  791  ? PHE v 788  HIS v 791  
AZ 2 ASN Y  796  ? HIS Y  804  ? ASN v 796  HIS v 804  
AZ 3 TRP Y  862  ? MET Y  869  ? TRP v 862  MET v 869  
AZ 4 THR Y  876  ? GLN Y  881  ? THR v 876  GLN v 881  
BA 1 GLU Y  886  ? ARG Y  895  ? GLU v 886  ARG v 895  
BA 2 TRP Y  903  ? LYS Y  911  ? TRP v 903  LYS v 911  
BA 3 GLY Y  923  ? TYR Y  928  ? GLY v 923  TYR v 928  
BA 4 PHE Y  939  ? VAL Y  945  ? PHE v 939  VAL v 945  
BB 1 ILE Y  952  ? PHE Y  955  ? ILE v 952  PHE v 955  
BB 2 ARG Y  958  ? GLY Y  962  ? ARG v 958  GLY v 962  
BB 3 LEU Y  967  ? ASP Y  971  ? LEU v 967  ASP v 971  
BB 4 LEU Y  978  ? ASN Y  983  ? LEU v 978  ASN v 983  
BC 1 ILE Y  990  ? THR Y  995  ? ILE v 990  THR v 995  
BC 2 VAL Y  1000 ? ASP Y  1004 ? VAL v 1000 ASP v 1004 
BC 3 PHE Y  1009 ? TYR Y  1014 ? PHE v 1009 TYR v 1014 
BC 4 LEU Y  1021 ? ALA Y  1025 ? LEU v 1021 ALA v 1025 
BD 1 VAL Y  1033 ? LEU Y  1038 ? VAL v 1033 LEU v 1038 
BD 2 VAL Y  1044 ? ASP Y  1048 ? VAL v 1044 ASP v 1048 
BD 3 ASN Y  1052 ? ARG Y  1057 ? ASN v 1052 ARG v 1057 
BD 4 GLU Y  1090 ? HIS Y  1096 ? GLU v 1090 HIS v 1096 
BE 1 ASP Y  309  ? PHE Y  311  ? ASP v 309  PHE v 311  
BE 2 TYR Y  329  ? THR Y  332  ? TYR v 329  THR v 332  
BF 1 ARG AA 21   ? CYS AA 23   ? ARG y 21   CYS y 23   
BF 2 GLY AA 65   ? ASP AA 68   ? GLY y 65   ASP y 68   
BG 1 PRO AA 39   ? LEU AA 42   ? PRO y 39   LEU y 42   
BG 2 TYR AA 70   ? CYS AA 72   ? TYR y 70   CYS y 72   
BH 1 VAL BA 88   ? LEU BA 90   ? VAL z 88   LEU z 90   
BH 2 LEU BA 21   ? ARG BA 24   ? LEU z 21   ARG z 24   
BH 3 THR BA 59   ? TYR BA 64   ? THR z 59   TYR z 64   
BH 4 ILE BA 45   ? VAL BA 50   ? ILE z 45   VAL z 50   
BI 1 VAL CA 272  ? TYR CA 274  ? VAL 0 272  TYR 0 274  
BI 2 ARG CA 260  ? PHE CA 264  ? ARG 0 260  PHE 0 264  
BI 3 VAL CA 368  ? LEU CA 370  ? VAL 0 368  LEU 0 370  
BJ 1 ALA CA 280  ? LEU CA 282  ? ALA 0 280  LEU 0 282  
BJ 2 ALA CA 304  ? THR CA 314  ? ALA 0 304  THR 0 314  
BJ 3 VAL CA 320  ? ASP CA 330  ? VAL 0 320  ASP 0 330  
BK 1 TYR DA 406  ? CYS DA 408  ? TYR 9 406  CYS 9 408  
BK 2 TYR DA 414  ? TYR DA 416  ? TYR 9 414  TYR 9 416  
BL 1 LEU EA 61   ? SER EA 63   ? LEU F 61   SER F 63   
BL 2 ARG EA 350  ? GLU EA 355  ? ARG F 350  GLU F 355  
BL 3 ILE EA 341  ? SER EA 346  ? ILE F 341  SER F 346  
BL 4 ILE EA 330  ? PHE EA 335  ? ILE F 330  PHE F 335  
BM 1 ILE EA 90   ? ASN EA 94   ? ILE F 90   ASN F 94   
BM 2 THR EA 80   ? GLY EA 85   ? THR F 80   GLY F 85   
BM 3 VAL EA 69   ? PHE EA 74   ? VAL F 69   PHE F 74   
BN 1 VAL EA 112  ? TYR EA 117  ? VAL F 112  TYR F 117  
BN 2 MET EA 123  ? SER EA 128  ? MET F 123  SER F 128  
BN 3 THR EA 132  ? ASP EA 137  ? THR F 132  ASP F 137  
BN 4 ARG EA 143  ? LYS EA 148  ? ARG F 143  LYS F 148  
BO 1 VAL EA 154  ? PRO EA 159  ? VAL F 154  PRO F 159  
BO 2 VAL EA 167  ? SER EA 171  ? VAL F 167  SER F 171  
BO 3 THR EA 175  ? TRP EA 179  ? THR F 175  TRP F 179  
BO 4 ALA EA 186  ? GLN EA 191  ? ALA F 186  GLN F 191  
BP 1 VAL EA 196  ? PHE EA 201  ? VAL F 196  PHE F 201  
BP 2 GLN EA 207  ? GLY EA 212  ? GLN F 207  GLY F 212  
BP 3 ILE EA 217  ? ASP EA 221  ? ILE F 217  ASP F 221  
BP 4 LEU EA 227  ? MET EA 231  ? LEU F 227  MET F 231  
BQ 1 LYS EA 275  ? GLN EA 278  ? LYS F 275  GLN F 278  
BQ 2 THR EA 258  ? ASP EA 263  ? THR F 258  ASP F 263  
BQ 3 TYR EA 249  ? ALA EA 254  ? TYR F 249  ALA F 254  
BQ 4 VAL EA 238  ? LEU EA 243  ? VAL F 238  LEU F 243  
BR 1 CYS EA 291  ? TRP EA 293  ? CYS F 291  TRP F 293  
BR 2 LYS EA 299  ? ALA EA 302  ? LYS F 299  ALA F 302  
BR 3 VAL EA 309  ? ASP EA 313  ? VAL F 309  ASP F 313  
BR 4 ILE EA 319  ? LEU EA 323  ? ILE F 319  LEU F 323  
BS 1 PRO MA 494  ? GLN MA 496  ? PRO U 494  GLN U 496  
BS 2 VAL MA 502  ? PHE MA 504  ? VAL U 502  PHE U 504  
BT 1 ALA MA 511  ? PRO MA 513  ? ALA U 511  PRO U 513  
BT 2 ILE MA 655  ? MET MA 657  ? ILE U 655  MET U 657  
BT 3 VAL MA 561  ? VAL MA 567  ? VAL U 561  VAL U 567  
BT 4 LEU MA 589  ? MET MA 600  ? LEU U 589  MET U 600  
BT 5 SER MA 622  ? LEU MA 629  ? SER U 622  LEU U 629  
BT 6 VAL MA 535  ? ASN MA 542  ? VAL U 535  ASN U 542  
BT 7 ILE MA 514  ? VAL MA 519  ? ILE U 514  VAL U 519  
BU 1 ASN MA 732  ? VAL MA 735  ? ASN U 732  VAL U 735  
BU 2 THR MA 776  ? PRO MA 781  ? THR U 776  PRO U 781  
BU 3 PHE MA 747  ? THR MA 750  ? PHE U 747  THR U 750  
BU 4 THR MA 711  ? ASN MA 715  ? THR U 711  ASN U 715  
BV 1 VAL MA 1131 ? LEU MA 1133 ? VAL U 1131 LEU U 1133 
BV 2 GLY MA 817  ? GLY MA 823  ? GLY U 817  GLY U 823  
BV 3 ARG MA 1090 ? GLY MA 1095 ? ARG U 1090 GLY U 1095 
BV 4 ASN MA 1058 ? MET MA 1061 ? ASN U 1058 MET U 1061 
BV 5 THR MA 849  ? THR MA 853  ? THR U 849  THR U 853  
BV 6 ILE MA 1034 ? THR MA 1038 ? ILE U 1034 THR U 1038 
BV 7 LEU MA 876  ? ARG MA 878  ? LEU U 876  ARG U 878  
BW 1 PHE MA 1177 ? ASN MA 1181 ? PHE U 1177 ASN U 1181 
BW 2 GLY MA 1300 ? ALA MA 1305 ? GLY U 1300 ALA U 1305 
BW 3 TYR MA 1270 ? SER MA 1274 ? TYR U 1270 SER U 1274 
BW 4 ILE MA 1224 ? THR MA 1228 ? ILE U 1224 THR U 1228 
BW 5 VAL MA 1257 ? THR MA 1259 ? VAL U 1257 THR U 1259 
BX 1 LEU MA 1330 ? ILE MA 1332 ? LEU U 1330 ILE U 1332 
BX 2 GLN MA 1353 ? ILE MA 1355 ? GLN U 1353 ILE U 1355 
BY 1 GLN NA 14   ? THR NA 16   ? GLN W 14   THR W 16   
BY 2 ARG NA 22   ? ASP NA 25   ? ARG W 22   ASP W 25   
BY 3 ALA NA 46   ? ASP NA 48   ? ALA W 46   ASP W 48   
BY 4 THR NA 68   ? LEU NA 70   ? THR W 68   LEU W 70   
BY 5 GLU NA 92   ? ILE NA 94   ? GLU W 92   ILE W 94   
BY 6 TYR NA 117  ? CYS NA 119  ? TYR W 117  CYS W 119  
BZ 1 ARG OA 80   ? TYR OA 83   ? ARG X 83   TYR X 86   
BZ 2 THR OA 8    ? ASN OA 12   ? THR X 11   ASN X 15   
BZ 3 ALA OA 52   ? PHE OA 56   ? ALA X 55   PHE X 59   
BZ 4 VAL OA 37   ? VAL OA 41   ? VAL X 40   VAL X 44   
CA 1 PHE OA 177  ? LEU OA 182  ? PHE X 177  LEU X 182  
CA 2 ALA OA 190  ? PHE OA 194  ? ALA X 190  PHE X 194  
CB 1 VAL PA 108  ? LEU PA 110  ? VAL a 108  LEU a 110  
CB 2 VAL PA 42   ? ASN PA 45   ? VAL a 42   ASN a 45   
CB 3 LYS PA 51   ? GLY PA 54   ? LYS a 51   GLY a 54   
CB 4 VAL PA 70   ? MET PA 73   ? VAL a 70   MET a 73   
CB 5 ASP PA 93   ? ILE PA 96   ? ASP a 93   ILE a 96   
CC 1 LYS PA 98   ? LEU PA 101  ? LYS a 98   LEU a 101  
CC 2 MET PA 65   ? GLU PA 68   ? MET a 65   GLU a 68   
CC 3 ARG PA 55   ? PHE PA 59   ? ARG a 55   PHE a 59   
CD 1 LYS PA 79   ? GLY PA 81   ? LYS a 79   GLY a 81   
CD 2 LYS PA 85   ? SER PA 87   ? LYS a 85   SER a 87   
CE 1 ALA QA 54   ? LEU QA 59   ? ALA b 54   LEU b 59   
CE 2 THR QA 47   ? ILE QA 51   ? THR b 47   ILE b 51   
CE 3 GLU QA 28   ? LEU QA 33   ? GLU b 28   LEU b 33   
CE 4 LYS QA 17   ? LEU QA 23   ? LYS b 17   LEU b 23   
CE 5 VAL QA 69   ? ARG QA 73   ? VAL b 69   ARG b 73   
CF 1 TYR QA 32   ? VAL QA 36   ? TYR b 32   VAL b 36   
CF 2 MET QA 42   ? ALA QA 45   ? MET b 42   ALA b 45   
CG 1 GLU RA 62   ? ILE RA 64   ? GLU c 62   ILE c 64   
CG 2 ARG RA 42   ? CYS RA 46   ? ARG c 42   CYS c 46   
CG 3 GLN RA 32   ? GLU RA 37   ? GLN c 32   GLU c 37   
CG 4 ILE RA 84   ? SER RA 89   ? ILE c 84   SER c 89   
CH 1 ARG RA 76   ? LEU RA 79   ? ARG c 76   LEU c 79   
CH 2 LEU RA 56   ? ASP RA 59   ? LEU c 56   ASP c 59   
CH 3 CYS RA 46   ? PHE RA 50   ? CYS c 46   PHE c 50   
CI 1 GLY SA 52   ? ILE SA 57   ? GLY d 52   ILE d 57   
CI 2 CYS SA 45   ? ALA SA 49   ? CYS d 45   ALA d 49   
CI 3 HIS SA 26   ? ILE SA 30   ? HIS d 26   ILE d 30   
CI 4 LYS SA 16   ? LEU SA 21   ? LYS d 16   LEU d 21   
CI 5 ILE SA 67   ? ALA SA 72   ? ILE d 67   ALA d 72   
CJ 1 ILE SA 30   ? PHE SA 34   ? ILE d 30   PHE d 34   
CJ 2 LEU SA 40   ? ASP SA 43   ? LEU d 40   ASP d 43   
CK 1 VAL TA 55   ? LEU TA 58   ? VAL e 55   LEU e 58   
CK 2 ILE TA 46   ? THR TA 49   ? ILE e 46   THR e 49   
CK 3 VAL TA 27   ? LYS TA 31   ? VAL e 27   LYS e 31   
CK 4 ILE TA 17   ? THR TA 22   ? ILE e 17   THR e 22   
CK 5 ILE TA 68   ? ILE TA 72   ? ILE e 68   ILE e 72   
CL 1 GLN TA 60   ? ILE TA 63   ? GLN e 60   ILE e 63   
CL 2 CYS TA 41   ? SER TA 44   ? CYS e 41   SER e 44   
CL 3 LYS TA 31   ? ALA TA 35   ? LYS e 31   ALA e 35   
CM 1 LEU UA 77   ? VAL UA 82   ? LEU f 77   VAL f 82   
CM 2 TYR UA 15   ? LEU UA 21   ? TYR f 15   LEU f 21   
CM 3 ILE UA 26   ? PHE UA 34   ? ILE f 26   PHE f 34   
CM 4 LEU UA 40   ? CYS UA 45   ? LEU f 40   CYS f 45   
CM 5 GLY UA 68   ? LEU UA 72   ? GLY f 68   LEU f 72   
CN 1 PRO VA 52   ? LEU VA 55   ? PRO g 52   LEU g 55   
CN 2 VAL VA 43   ? THR VA 46   ? VAL g 43   THR g 46   
CN 3 GLN VA 24   ? THR VA 28   ? GLN g 24   THR g 28   
CN 4 THR VA 14   ? LEU VA 19   ? THR g 14   LEU g 19   
CN 5 ILE VA 65   ? ILE VA 69   ? ILE g 65   ILE g 69   
CO 1 THR VA 38   ? LYS VA 41   ? THR g 38   LYS g 41   
CO 2 THR VA 57   ? ILE VA 60   ? THR g 57   ILE g 60   
CP 1 PRO WA 89   ? ILE WA 96   ? PRO h 89   ILE h 96   
CP 2 VAL WA 70   ? VAL WA 77   ? VAL h 70   VAL h 77   
CP 3 LYS WA 51   ? ARG WA 55   ? LYS h 51   ARG h 55   
CP 4 GLN WA 41   ? CYS WA 46   ? GLN h 41   CYS h 46   
CP 5 VAL WA 106  ? LEU WA 110  ? VAL h 106  LEU h 110  
CQ 1 LYS WA 98   ? LEU WA 101  ? LYS h 98   LEU h 101  
CQ 2 MET WA 65   ? GLU WA 68   ? MET h 65   GLU h 68   
CQ 3 ARG WA 55   ? PHE WA 59   ? ARG h 55   PHE h 59   
CR 1 GLY XA 57   ? GLY XA 60   ? GLY i 57   GLY i 60   
CR 2 THR XA 47   ? TYR XA 50   ? THR i 47   TYR i 50   
CR 3 GLU XA 28   ? TYR XA 32   ? GLU i 28   TYR i 32   
CR 4 PRO XA 18   ? LEU XA 23   ? PRO i 18   LEU i 23   
CR 5 VAL XA 69   ? GLY XA 74   ? VAL i 69   GLY i 74   
CS 1 VAL XA 62   ? ILE XA 64   ? VAL i 62   ILE i 64   
CS 2 MET XA 42   ? ALA XA 45   ? MET i 42   ALA i 45   
CS 3 TYR XA 32   ? VAL XA 36   ? TYR i 32   VAL i 36   
CT 1 SER YA 70   ? GLY YA 75   ? SER j 70   GLY j 75   
CT 2 ALA YA 61   ? HIS YA 65   ? ALA j 61   HIS j 65   
CT 3 MET YA 41   ? GLY YA 45   ? MET j 41   GLY j 45   
CT 4 ARG YA 30   ? LEU YA 35   ? ARG j 30   LEU j 35   
CT 5 ILE YA 84   ? VAL YA 90   ? ILE j 84   VAL j 90   
CU 1 ILE YA 77   ? LEU YA 79   ? ILE j 77   LEU j 79   
CU 2 LEU YA 56   ? ASP YA 59   ? LEU j 56   ASP j 59   
CU 3 CYS YA 46   ? PHE YA 50   ? CYS j 46   PHE j 50   
CV 1 ILE ZA 67   ? ALA ZA 72   ? ILE k 67   ALA k 72   
CV 2 LYS ZA 16   ? LEU ZA 21   ? LYS k 16   LEU k 21   
CV 3 ARG ZA 25   ? PHE ZA 34   ? ARG k 25   PHE k 34   
CV 4 LEU ZA 40   ? ASP ZA 43   ? LEU k 40   ASP k 43   
CV 5 VAL ZA 60   ? ILE ZA 62   ? VAL k 60   ILE k 62   
CW 1 CYS ZA 45   ? MET ZA 48   ? CYS k 45   MET k 48   
CW 2 GLN ZA 54   ? GLY ZA 58   ? GLN k 54   GLY k 58   
CX 1 VAL AB 55   ? LEU AB 58   ? VAL l 55   LEU l 58   
CX 2 ILE AB 46   ? THR AB 49   ? ILE l 46   THR l 49   
CX 3 VAL AB 27   ? LYS AB 31   ? VAL l 27   LYS l 31   
CX 4 ILE AB 17   ? THR AB 22   ? ILE l 17   THR l 22   
CX 5 ILE AB 68   ? ILE AB 72   ? ILE l 68   ILE l 72   
CY 1 GLN AB 60   ? ILE AB 63   ? GLN l 60   ILE l 63   
CY 2 CYS AB 41   ? SER AB 44   ? CYS l 41   SER l 44   
CY 3 LYS AB 31   ? ALA AB 35   ? LYS l 31   ALA l 35   
CZ 1 ARG BB 65   ? GLY BB 68   ? ARG m 65   GLY m 68   
CZ 2 CYS BB 45   ? PHE BB 48   ? CYS m 45   PHE m 48   
CZ 3 ILE BB 26   ? THR BB 30   ? ILE m 26   THR m 30   
CZ 4 ARG BB 16   ? ILE BB 20   ? ARG m 16   ILE m 20   
CZ 5 SER BB 79   ? GLY BB 84   ? SER m 79   GLY m 84   
DA 1 VAL BB 70   ? LEU BB 72   ? VAL m 70   LEU m 72   
DA 2 LEU BB 40   ? CYS BB 43   ? LEU m 40   CYS m 43   
DA 3 THR BB 30   ? ALA BB 33   ? THR m 30   ALA m 33   
DB 1 VAL CB 53   ? LEU CB 55   ? VAL n 53   LEU n 55   
DB 2 VAL CB 43   ? THR CB 46   ? VAL n 43   THR n 46   
DB 3 GLN CB 24   ? THR CB 28   ? GLN n 24   THR n 28   
DB 4 THR CB 14   ? LEU CB 19   ? THR n 14   LEU n 19   
DB 5 ILE CB 65   ? ILE CB 69   ? ILE n 65   ILE n 69   
DC 1 THR CB 57   ? ILE CB 60   ? THR n 57   ILE n 60   
DC 2 THR CB 38   ? LYS CB 41   ? THR n 38   LYS n 41   
DC 3 THR CB 28   ? VAL CB 32   ? THR n 28   VAL n 32   
DD 1 ALA DB 50   ? VAL DB 52   ? ALA o 50   VAL o 52   
DD 2 LEU DB 8    ? GLY DB 11   ? LEU o 8    GLY o 11   
DD 3 ARG DB 78   ? LEU DB 81   ? ARG o 78   LEU o 81   
DE 1 SER DB 70   ? LEU DB 72   ? SER o 70   LEU o 72   
DE 2 ARG DB 75   ? ILE DB 77   ? ARG o 75   ILE o 77   
DF 1 VAL DB 292  ? GLU DB 299  ? VAL o 292  GLU o 299  
DF 2 VAL DB 142  ? ILE DB 148  ? VAL o 142  ILE o 148  
DF 3 LYS DB 151  ? LEU DB 159  ? LYS o 151  LEU o 159  
DF 4 VAL DB 264  ? GLU DB 270  ? VAL o 264  GLU o 270  
DF 5 LEU DB 233  ? MET DB 236  ? LEU o 233  MET o 236  
DF 6 PHE DB 248  ? THR DB 251  ? PHE o 248  THR o 251  
DF 7 MET DB 197  ? GLY DB 200  ? MET o 197  GLY o 200  
DF 8 PHE DB 189  ? ILE DB 193  ? PHE o 189  ILE o 193  
DG 1 PRO FB 568  ? ARG FB 571  ? PRO q 569  ARG q 572  
DG 2 VAL FB 417  ? GLU FB 421  ? VAL q 418  GLU q 422  
DG 3 LYS FB 547  ? SER FB 552  ? LYS q 548  SER q 553  
DG 4 TYR FB 514  ? VAL FB 519  ? TYR q 515  VAL q 520  
DG 5 LYS FB 447  ? GLN FB 452  ? LYS q 448  GLN q 453  
DG 6 LEU FB 493  ? THR FB 497  ? LEU q 494  THR q 498  
DG 7 VAL FB 477  ? ILE FB 481  ? VAL q 478  ILE q 482  
DG 8 GLU FB 484  ? CYS FB 486  ? GLU q 485  CYS q 487  
DH 1 VAL FB 579  ? TYR FB 583  ? VAL q 580  TYR q 584  
DH 2 GLY FB 732  ? ARG FB 736  ? GLY q 733  ARG q 737  
DH 3 ILE FB 686  ? ASP FB 691  ? ILE q 687  ASP q 692  
DH 4 ASP FB 610  ? PHE FB 614  ? ASP q 611  PHE q 615  
DH 5 ARG FB 668  ? ALA FB 673  ? ARG q 669  ALA q 674  
DH 6 LEU FB 642  ? ILE FB 647  ? LEU q 643  ILE q 648  
DI 1 PHE FB 694  ? ASN FB 701  ? PHE q 695  ASN q 702  
DI 2 MET FB 706  ? PRO FB 713  ? MET q 707  PRO q 714  
DJ 1 TYR FB 959  ? THR FB 961  ? TYR q 960  THR q 962  
DJ 2 THR FB 951  ? LEU FB 954  ? THR q 952  LEU q 955  
DJ 3 TRP FB 983  ? TYR FB 986  ? TRP q 984  TYR q 987  
DJ 4 VAL FB 1000 ? GLU FB 1002 ? VAL q 1001 GLU q 1003 
DK 1 GLU FB 988  ? LEU FB 991  ? GLU q 989  LEU q 992  
DK 2 GLU FB 995  ? ARG FB 998  ? GLU q 996  ARG q 999  
DL 1 PHE GB 435  ? GLN GB 438  ? PHE r 435  GLN r 438  
DL 2 TYR GB 442  ? VAL GB 447  ? TYR r 442  VAL r 447  
DL 3 LEU GB 685  ? ILE GB 692  ? LEU r 685  ILE r 692  
DL 4 GLY GB 865  ? SER GB 872  ? GLY r 865  SER r 872  
DL 5 THR GB 825  ? LYS GB 829  ? THR r 825  LYS r 829  
DL 6 VAL GB 721  ? PHE GB 724  ? VAL r 721  PHE r 724  
DL 7 VAL GB 808  ? SER GB 811  ? VAL r 808  SER r 811  
DL 8 PHE GB 782  ? ILE GB 784  ? PHE r 782  ILE r 784  
DM 1 LEU GB 673  ? TYR GB 675  ? LEU r 673  TYR r 675  
DM 2 LEU GB 499  ? CYS GB 502  ? LEU r 499  CYS r 502  
DM 3 ARG GB 647  ? SER GB 652  ? ARG r 647  SER r 652  
DM 4 VAL GB 609  ? LEU GB 614  ? VAL r 609  LEU r 614  
DM 5 LYS GB 537  ? ILE GB 541  ? LYS r 537  ILE r 541  
DM 6 ILE GB 586  ? CYS GB 588  ? ILE r 586  CYS r 588  
DN 1 GLN GB 832  ? SER GB 835  ? GLN r 832  SER r 835  
DN 2 ARG GB 840  ? GLU GB 843  ? ARG r 840  GLU r 843  
DO 1 VAL GB 970  ? TYR GB 972  ? VAL r 970  TYR r 972  
DO 2 PHE GB 979  ? VAL GB 981  ? PHE r 979  VAL r 981  
DP 1 HIS GB 1250 ? PRO GB 1257 ? HIS r 1250 PRO r 1257 
DP 2 THR GB 1197 ? PRO GB 1206 ? THR r 1197 PRO r 1206 
DP 3 LEU GB 1184 ? THR GB 1194 ? LEU r 1184 THR r 1194 
DQ 1 GLU GB 1279 ? SER GB 1285 ? GLU r 1279 SER r 1285 
DQ 2 GLN GB 1265 ? SER GB 1272 ? GLN r 1265 SER r 1272 
DQ 3 SER GB 1218 ? GLU GB 1226 ? SER r 1218 GLU r 1226 
DQ 4 ILE GB 1233 ? LYS GB 1242 ? ILE r 1233 LYS r 1242 
DR 1 THR GB 1511 ? ASN GB 1513 ? THR r 1511 ASN r 1513 
DR 2 VAL GB 1346 ? GLY GB 1349 ? VAL r 1346 GLY r 1349 
DR 3 ARG GB 1486 ? SER GB 1491 ? ARG r 1486 SER r 1491 
DR 4 LEU GB 1450 ? ASP GB 1454 ? LEU r 1450 ASP r 1454 
DR 5 CYS GB 1376 ? THR GB 1380 ? CYS r 1376 THR r 1380 
DR 6 ILE GB 1424 ? SER GB 1427 ? ILE r 1424 SER r 1427 
DR 7 VAL GB 1405 ? LEU GB 1407 ? VAL r 1405 LEU r 1407 
DS 1 LEU GB 1523 ? PHE GB 1530 ? LEU r 1523 PHE r 1530 
DS 2 GLY GB 1700 ? GLN GB 1707 ? GLY r 1700 GLN r 1707 
DS 3 LEU GB 1660 ? MET GB 1664 ? LEU r 1660 MET r 1664 
DS 4 VAL GB 1559 ? VAL GB 1563 ? VAL r 1559 VAL r 1563 
DS 5 VAL GB 1643 ? SER GB 1647 ? VAL r 1643 SER r 1647 
DT 1 GLN GB 1667 ? ASN GB 1670 ? GLN r 1667 ASN r 1670 
DT 2 ALA GB 1675 ? ASP GB 1678 ? ALA r 1675 ASP r 1678 
DU 1 ILE GB 1802 ? GLU GB 1805 ? ILE r 1802 GLU r 1805 
DU 2 ASP GB 1809 ? PRO GB 1812 ? ASP r 1809 PRO r 1812 
DV 1 ILE GB 2017 ? VAL GB 2023 ? ILE r 2017 VAL r 2023 
DV 2 PRO GB 2034 ? ARG GB 2043 ? PRO r 2034 ARG r 2043 
DV 3 LYS GB 2087 ? VAL GB 2095 ? LYS r 2087 VAL r 2095 
DW 1 GLN GB 2118 ? VAL GB 2124 ? GLN r 2118 VAL r 2124 
DW 2 HIS GB 2102 ? SER GB 2110 ? HIS r 2102 SER r 2110 
DW 3 TRP GB 2064 ? ASP GB 2070 ? TRP r 2064 ASP r 2070 
DW 4 SER GB 2075 ? LEU GB 2082 ? SER r 2075 LEU r 2082 
DX 1 ILE IB 20   ? ILE IB 23   ? ILE N 20   ILE N 23   
DX 2 ALA IB 60   ? VAL IB 63   ? ALA N 60   VAL N 63   
DX 3 GLN IB 47   ? VAL IB 50   ? GLN N 47   VAL N 50   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ARG A  108  ? O ARG 1 108  N GLY A  41   ? N GLY 1 41   
A  2 3 O ILE A  38   ? O ILE 1 38   N LEU A  82   ? N LEU 1 82   
A  3 4 O PHE A  81   ? O PHE 1 81   N ASN A  66   ? N ASN 1 66   
B  1 2 O MET F  47   ? O MET 7 47   N GLU F  55   ? N GLU 7 55   
B  2 3 O TYR F  54   ? O TYR 7 54   N HIS F  63   ? N HIS 7 63   
C  1 2 O VAL H  116  ? O VAL A 116  N LEU H  487  ? N LEU A 487  
D  1 2 O TRP H  228  ? O TRP A 228  N GLY H  416  ? N GLY A 416  
E  1 2 O GLY H  895  ? O GLY A 895  N ASP H  910  ? N ASP A 910  
F  1 2 O PHE H  1174 ? O PHE A 1174 N GLU H  978  ? N GLU A 978  
F  2 3 O CYS H  973  ? O CYS A 973  N PHE H  1101 ? N PHE A 1101 
F  3 4 O ARG H  1094 ? O ARG A 1094 N TYR H  1091 ? N TYR A 1091 
G  1 2 O LEU H  1185 ? O LEU A 1185 N ILE H  1196 ? N ILE A 1196 
G  2 3 O GLU H  1193 ? O GLU A 1193 N ARG H  1231 ? N ARG A 1231 
G  3 4 O THR H  1225 ? O THR A 1225 N LEU H  1216 ? N LEU A 1216 
H  1 2 O GLN H  1610 ? O GLN A 1610 N LEU H  1630 ? N LEU A 1630 
H  2 3 O ILE H  1629 ? O ILE A 1629 N ILE H  1662 ? N ILE A 1662 
H  3 4 O ASP H  1663 ? O ASP A 1663 N VAL H  1701 ? N VAL A 1701 
H  4 5 O LEU H  1702 ? O LEU A 1702 N TYR H  1715 ? N TYR A 1715 
I  1 2 O VAL H  1915 ? O VAL A 1915 N LEU H  1819 ? N LEU A 1819 
I  2 3 O PHE H  1818 ? O PHE A 1818 N ILE H  1809 ? N ILE A 1809 
I  3 4 O PHE H  1808 ? O PHE A 1808 N ASP H  1781 ? N ASP A 1781 
I  4 5 O TRP H  1778 ? O TRP A 1778 N GLN H  1860 ? N GLN A 1860 
I  5 6 O ILE H  1861 ? O ILE A 1861 N VAL H  1883 ? N VAL A 1883 
J  1 2 O GLN H  2260 ? O GLN A 2260 N TYR H  2104 ? N TYR A 2104 
J  2 3 O THR H  2103 ? O THR A 2103 N LYS H  2140 ? N LYS A 2140 
J  3 4 O GLU H  2141 ? O GLU A 2141 N VAL H  2131 ? N VAL A 2131 
J  4 5 O GLY H  2126 ? O GLY A 2126 N ILE H  2178 ? N ILE A 2178 
J  5 6 O TRP H  2177 ? O TRP A 2177 N ILE H  2214 ? N ILE A 2214 
J  6 7 O THR H  2215 ? O THR A 2215 N THR H  2226 ? N THR A 2226 
K  1 2 O ILE H  2145 ? O ILE A 2145 N PHE H  2270 ? N PHE A 2270 
L  1 2 O TRP H  2151 ? O TRP A 2151 N HIS H  2158 ? N HIS A 2158 
M  1 2 O VAL I  132  ? O VAL B 132  N MET I  203  ? N MET B 203  
N  1 2 O CYS I  476  ? O CYS B 476  N ILE I  565  ? N ILE B 565  
O  1 2 O LYS I  480  ? O LYS B 480  N PHE I  493  ? N PHE B 493  
O  2 3 O GLY I  494  ? O GLY B 494  N VAL I  550  ? N VAL B 550  
P  1 2 O LYS I  654  ? O LYS B 654  N GLU I  593  ? N GLU B 593  
P  2 3 O ILE I  588  ? O ILE B 588  N GLY I  631  ? N GLY B 631  
P  3 4 O VAL I  628  ? O VAL B 628  N LYS I  620  ? N LYS B 620  
Q  1 2 O CYS I  663  ? O CYS B 663  N MET I  828  ? N MET B 828  
Q  2 3 O GLU I  829  ? O GLU B 829  N GLN I  905  ? N GLN B 905  
R  1 2 O PHE I  896  ? O PHE B 896  N GLN I  837  ? N GLN B 837  
R  2 3 O TYR I  832  ? O TYR B 832  N ILE I  875  ? N ILE B 875  
R  3 4 O THR I  870  ? O THR B 870  N ALA I  861  ? N ALA B 861  
S  1 2 O THR I  686  ? O THR B 686  N ASP I  793  ? N ASP B 793  
T  1 2 O ILE J  177  ? O ILE C 177  N ILE J  197  ? N ILE C 197  
U  1 2 O ARG K  208  ? O ARG D 208  N GLY K  222  ? N GLY D 222  
U  2 3 O PHE K  219  ? O PHE D 219  N TRP K  231  ? N TRP D 231  
U  3 4 O ILE K  228  ? O ILE D 228  N LEU K  242  ? N LEU D 242  
V  1 2 O GLN K  269  ? O GLN D 269  N GLY K  265  ? N GLY D 265  
V  2 3 O PHE K  262  ? O PHE D 262  N ILE K  253  ? N ILE D 253  
W  1 2 O ARG K  313  ? O ARG D 313  N THR K  305  ? N THR D 305  
W  2 3 O VAL K  304  ? O VAL D 304  N ASP K  295  ? N ASP D 295  
X  1 2 O ALA K  334  ? O ALA D 334  N GLY K  348  ? N GLY D 348  
X  2 3 O ILE K  345  ? O ILE D 345  N TRP K  357  ? N TRP D 357  
X  3 4 O ILE K  354  ? O ILE D 354  N LEU K  368  ? N LEU D 368  
Y  1 2 O HIS K  437  ? O HIS D 437  N SER K  429  ? N SER D 429  
Y  2 3 O VAL K  428  ? O VAL D 428  N THR K  420  ? N THR D 420  
Z  1 2 O LYS K  195  ? O LYS D 195  N ARG K  490  ? N ARG D 490  
Z  2 3 O THR K  485  ? O THR D 485  N GLU K  481  ? N GLU D 481  
Z  3 4 O LEU K  478  ? O LEU D 478  N ALA K  469  ? N ALA D 469  
AA 1 2 O ALA L  138  ? O ALA E 138  N ILE L  153  ? N ILE E 153  
AB 1 2 O THR O  37   ? O THR P 37   N ARG O  56   ? N ARG P 56   
AC 1 2 O TYR O  235  ? O TYR P 235  N LYS O  301  ? N LYS P 301  
AD 1 2 O THR O  262  ? O THR P 262  N PHE O  271  ? N PHE P 271  
AE 1 2 O VAL S  14   ? O VAL V 14   N LEU S  25   ? N LEU V 25   
AE 2 3 O VAL S  24   ? O VAL V 24   N GLN S  134  ? N GLN V 134  
AE 3 4 O PHE S  129  ? O PHE V 129  N LEU S  98   ? N LEU V 98   
AE 4 5 O ILE S  97   ? O ILE V 97   N THR S  115  ? N THR V 115  
AE 5 6 O PHE S  112  ? O PHE V 112  N GLY S  64   ? N GLY V 64   
AE 6 7 O MET S  61   ? O MET V 61   N ILE S  57   ? N ILE V 57   
AF 1 2 O ARG V  56   ? O ARG s 56   N GLN V  64   ? N GLN s 64   
AF 2 3 O VAL V  63   ? O VAL s 63   N PHE V  115  ? N PHE s 115  
AF 3 4 O PHE V  114  ? O PHE s 114  N ALA V  100  ? N ALA s 100  
AF 4 5 O VAL V  99   ? O VAL s 99   N GLY V  131  ? N GLY s 131  
AF 5 6 O LYS V  132  ? O LYS s 132  N GLU V  27   ? N GLU s 27   
AF 6 7 O GLY V  22   ? O GLY s 22   N THR V  19   ? N THR s 19   
AF 7 8 O LEU V  16   ? O LEU s 16   N GLU V  165  ? N GLU s 165  
AG 1 2 O ILE Y  1174 ? O ILE v 1174 N LEU Y  3    ? N LEU v 3    
AG 2 3 O TYR Y  4    ? O TYR v 4    N VAL Y  1130 ? N VAL v 1130 
AG 3 4 O GLY Y  1127 ? O GLY v 1127 N TYR Y  1119 ? N TYR v 1119 
AG 4 5 O SER Y  1116 ? O SER v 1116 N THR Y  1107 ? N THR v 1107 
AH 1 2 O PHE Y  16   ? O PHE v 16   N SER Y  33   ? N SER v 33   
AH 2 3 O ILE Y  30   ? O ILE v 30   N LEU Y  41   ? N LEU v 41   
AH 3 4 O LEU Y  38   ? O LEU v 38   N VAL Y  56   ? N VAL v 56   
AI 1 2 O ARG Y  63   ? O ARG v 63   N GLY Y  81   ? N GLY v 81   
AI 2 3 O ILE Y  78   ? O ILE v 78   N LEU Y  90   ? N LEU v 90   
AI 3 4 O ILE Y  87   ? O ILE v 87   N GLU Y  105  ? N GLU v 105  
AJ 1 2 O PHE Y  120  ? O PHE v 120  N SER Y  133  ? N SER v 133  
AJ 2 3 O VAL Y  130  ? O VAL v 130  N TYR Y  142  ? N TYR v 142  
AK 1 2 O ASN Y  145  ? O ASN v 145  N THR Y  153  ? N THR v 153  
AL 1 2 O LEU Y  166  ? O LEU v 166  N MET Y  187  ? N MET v 187  
AL 2 3 O PHE Y  182  ? O PHE v 182  N TYR Y  211  ? N TYR v 211  
AL 3 4 O LEU Y  208  ? O LEU v 208  N GLU Y  226  ? N GLU v 226  
AM 1 2 O VAL Y  171  ? O VAL v 171  N ALA Y  183  ? N ALA v 183  
AN 1 2 O ILE Y  267  ? O ILE v 267  N TYR Y  258  ? N TYR v 258  
AN 2 3 O TYR Y  255  ? O TYR v 255  N SER Y  252  ? N SER v 252  
AN 3 4 O GLY Y  247  ? O GLY v 247  N VAL Y  238  ? N VAL v 238  
AO 1 2 O HIS Y  293  ? O HIS v 293  N PHE Y  300  ? N PHE v 300  
AO 2 3 O PHE Y  301  ? O PHE v 301  N ILE Y  313  ? N ILE v 313  
AO 3 4 O THR Y  314  ? O THR v 314  N ARG Y  326  ? N ARG v 326  
AP 1 2 O ALA Y  337  ? O ALA v 337  N ALA Y  350  ? N ALA v 350  
AP 2 3 O LEU Y  347  ? O LEU v 347  N TYR Y  359  ? N TYR v 359  
AP 3 4 O HIS Y  356  ? O HIS v 356  N LEU Y  401  ? N LEU v 401  
AQ 1 2 O GLN Y  411  ? O GLN v 411  N TYR Y  424  ? N TYR v 424  
AQ 2 3 O LEU Y  423  ? O LEU v 423  N LEU Y  438  ? N LEU v 438  
AQ 3 4 O LEU Y  435  ? O LEU v 435  N PHE Y  779  ? N PHE v 779  
AR 1 2 O SER Y  445  ? O SER v 445  N ALA Y  766  ? N ALA v 766  
AS 1 2 O ALA Y  458  ? O ALA v 458  N SER Y  477  ? N SER v 477  
AS 2 3 O ILE Y  474  ? O ILE v 474  N LEU Y  485  ? N LEU v 485  
AT 1 2 O SER Y  507  ? O SER v 507  N VAL Y  519  ? N VAL v 519  
AT 2 3 O LEU Y  516  ? O LEU v 516  N ILE Y  527  ? N ILE v 527  
AU 1 2 O ALA Y  548  ? O ALA v 548  N VAL Y  555  ? N VAL v 555  
AV 1 2 O LEU Y  605  ? O LEU v 605  N ILE Y  617  ? N ILE v 617  
AW 1 2 O VAL Y  673  ? O VAL v 672  N ARG Y  690  ? N ARG v 690  
AX 1 2 O LYS Y  700  ? O LYS v 700  N MET Y  715  ? N MET v 715  
AX 2 3 O VAL Y  712  ? O VAL v 712  N SER Y  722  ? N SER v 722  
AX 3 4 O LEU Y  721  ? O LEU v 721  N THR Y  732  ? N THR v 732  
AY 1 2 O SER Y  743  ? O SER v 743  N VAL Y  755  ? N VAL v 755  
AZ 1 2 O VAL Y  789  ? O VAL v 789  N ILE Y  798  ? N ILE v 798  
AZ 2 3 O LEU Y  797  ? O LEU v 797  N MET Y  869  ? N MET v 869  
AZ 3 4 O ILE Y  866  ? O ILE v 866  N VAL Y  880  ? N VAL v 880  
BA 1 2 O ALA Y  887  ? O ALA v 887  N ALA Y  910  ? N ALA v 910  
BA 2 3 O VAL Y  905  ? O VAL v 905  N TYR Y  928  ? N TYR v 928  
BA 3 4 O GLY Y  923  ? O GLY v 923  N VAL Y  945  ? N VAL v 945  
BB 1 2 O ALA Y  953  ? O ALA v 953  N LEU Y  960  ? N LEU v 960  
BB 2 3 O VAL Y  959  ? O VAL v 959  N TYR Y  970  ? N TYR v 970  
BB 3 4 O LEU Y  967  ? O LEU v 967  N ASN Y  983  ? N ASN v 983  
BC 1 2 O SER Y  991  ? O SER v 991  N SER Y  1003 ? N SER v 1003 
BC 2 3 O VAL Y  1000 ? O VAL v 1000 N VAL Y  1012 ? N VAL v 1012 
BC 3 4 O TRP Y  1011 ? O TRP v 1011 N ALA Y  1025 ? N ALA v 1025 
BD 1 2 O THR Y  1034 ? O THR v 1034 N ALA Y  1047 ? N ALA v 1047 
BD 2 3 O VAL Y  1044 ? O VAL v 1044 N VAL Y  1056 ? N VAL v 1056 
BD 3 4 O ILE Y  1053 ? O ILE v 1053 N TYR Y  1095 ? N TYR v 1095 
BE 1 2 O ILE Y  310  ? O ILE v 310  N ASP Y  331  ? N ASP v 331  
BF 1 2 O LEU AA 22   ? O LEU y 22   N SER AA 67   ? N SER y 67   
BG 1 2 O CYS AA 40   ? O CYS y 40   N TYR AA 71   ? N TYR y 71   
BH 1 2 O VAL BA 88   ? O VAL z 88   N ARG BA 24   ? N ARG z 24   
BH 2 3 O LEU BA 21   ? O LEU z 21   N VAL BA 62   ? N VAL z 62   
BH 3 4 O TYR BA 61   ? O TYR z 61   N ARG BA 49   ? N ARG z 49   
BI 1 2 O MET CA 273  ? O MET 0 273  N LEU CA 261  ? N LEU 0 261  
BI 2 3 O TYR CA 262  ? O TYR 0 262  N LEU CA 370  ? N LEU 0 370  
BJ 1 2 O TYR CA 281  ? O TYR 0 281  N PHE CA 306  ? N PHE 0 306  
BJ 2 3 O VAL CA 305  ? O VAL 0 305  N ILE CA 329  ? N ILE 0 329  
BK 1 2 O TYR DA 406  ? O TYR 9 406  N TYR DA 416  ? N TYR 9 416  
BL 1 2 O LEU EA 62   ? O LEU F 62   N LEU EA 351  ? N LEU F 351  
BL 2 3 O TYR EA 352  ? O TYR F 352  N SER EA 344  ? N SER F 344  
BL 3 4 O ILE EA 343  ? O ILE F 343  N ALA EA 334  ? N ALA F 334  
BM 1 2 O LEU EA 91   ? O LEU F 91   N SER EA 83   ? N SER F 83   
BM 2 3 O ALA EA 82   ? O ALA F 82   N LYS EA 73   ? N LYS F 73   
BN 1 2 O MET EA 113  ? O MET F 113  N ALA EA 127  ? N ALA F 127  
BN 2 3 O LEU EA 124  ? O LEU F 124  N TRP EA 136  ? N TRP F 136  
BN 3 4 O VAL EA 133  ? O VAL F 133  N LEU EA 147  ? N LEU F 147  
BO 1 2 O ASN EA 155  ? O ASN F 155  N GLY EA 170  ? N GLY F 170  
BO 2 3 O VAL EA 167  ? O VAL F 167  N TRP EA 179  ? N TRP F 179  
BO 3 4 O VAL EA 176  ? O VAL F 176  N PHE EA 190  ? N PHE F 190  
BP 1 2 O LEU EA 197  ? O LEU F 197  N GLY EA 211  ? N GLY F 211  
BP 2 3 O ILE EA 208  ? O ILE F 208  N TRP EA 220  ? N TRP F 220  
BP 3 4 O ILE EA 217  ? O ILE F 217  N MET EA 231  ? N MET F 231  
BQ 1 2 O LYS EA 275  ? O LYS F 275  N VAL EA 261  ? N VAL F 261  
BQ 2 3 O ARG EA 260  ? O ARG F 260  N SER EA 252  ? N SER F 252  
BQ 3 4 O LEU EA 251  ? O LEU F 251  N SER EA 242  ? N SER F 242  
BR 1 2 O SER EA 292  ? O SER F 292  N ALA EA 301  ? N ALA F 301  
BR 2 3 O ILE EA 300  ? O ILE F 300  N TRP EA 312  ? N TRP F 312  
BR 3 4 O VAL EA 309  ? O VAL F 309  N LEU EA 323  ? N LEU F 323  
BS 1 2 O TRP MA 495  ? O TRP U 495  N VAL MA 503  ? N VAL U 503  
BT 1 2 O GLN MA 512  ? O GLN U 512  N ILE MA 656  ? N ILE U 656  
BT 2 3 O ILE MA 655  ? O ILE U 655  N ILE MA 565  ? N ILE U 565  
BT 3 4 O CYS MA 562  ? O CYS U 562  N CYS MA 595  ? N CYS U 595  
BT 4 5 O GLU MA 596  ? O GLU U 596  N PHE MA 628  ? N PHE U 628  
BT 5 6 O ARG MA 623  ? O ARG U 623  N ILE MA 541  ? N ILE U 541  
BT 6 7 O ASP MA 538  ? O ASP U 538  N THR MA 518  ? N THR U 518  
BU 1 2 O ASN MA 732  ? O ASN U 732  N LEU MA 777  ? N LEU U 777  
BU 2 3 O ILE MA 778  ? O ILE U 778  N THR MA 750  ? N THR U 750  
BU 3 4 O PHE MA 747  ? O PHE U 747  N ASN MA 715  ? N ASN U 715  
BV 1 2 O VAL MA 1131 ? O VAL U 1131 N VAL MA 822  ? N VAL U 822  
BV 2 3 O GLY MA 817  ? O GLY U 817  N TRP MA 1091 ? N TRP U 1091 
BV 3 4 O ARG MA 1090 ? O ARG U 1090 N ILE MA 1059 ? N ILE U 1059 
BV 4 5 O ASN MA 1058 ? O ASN U 1058 N LEU MA 850  ? N LEU U 850  
BV 5 6 O THR MA 849  ? O THR U 849  N ILE MA 1035 ? N ILE U 1035 
BV 6 7 O ILE MA 1034 ? O ILE U 1034 N LEU MA 877  ? N LEU U 877  
BW 1 2 O GLN MA 1178 ? O GLN U 1178 N LEU MA 1301 ? N LEU U 1301 
BW 2 3 O GLY MA 1300 ? O GLY U 1300 N ILE MA 1271 ? N ILE U 1271 
BW 3 4 O TYR MA 1270 ? O TYR U 1270 N SER MA 1225 ? N SER U 1225 
BW 4 5 O ILE MA 1226 ? O ILE U 1226 N THR MA 1258 ? N THR U 1258 
BX 1 2 O LEU MA 1330 ? O LEU U 1330 N ILE MA 1355 ? N ILE U 1355 
BY 1 2 O TYR NA 15   ? O TYR W 15   N GLU NA 23   ? N GLU W 23   
BY 2 3 O LEU NA 24   ? O LEU W 24   N ALA NA 46   ? N ALA W 46   
BY 3 4 O ILE NA 47   ? O ILE W 47   N THR NA 68   ? N THR W 68   
BY 4 5 O LEU NA 69   ? O LEU W 69   N GLU NA 92   ? N GLU W 92   
BY 5 6 O LEU NA 93   ? O LEU W 93   N TYR NA 117  ? N TYR W 117  
BZ 1 2 O ARG OA 80   ? O ARG X 83   N ASN OA 12   ? N ASN X 15   
BZ 2 3 O ILE OA 9    ? O ILE X 12   N VAL OA 54   ? N VAL X 57   
BZ 3 4 O PHE OA 53   ? O PHE X 56   N VAL OA 41   ? N VAL X 44   
CA 1 2 O LYS OA 178  ? O LYS X 178  N GLU OA 193  ? N GLU X 193  
CB 1 2 O VAL PA 108  ? O VAL a 108  N ASN PA 45   ? N ASN a 45   
CB 2 3 O VAL PA 42   ? O VAL a 42   N GLY PA 54   ? N GLY a 54   
CB 3 4 O LYS PA 51   ? O LYS a 51   N MET PA 73   ? N MET a 73   
CB 4 5 O VAL PA 70   ? O VAL a 70   N ILE PA 96   ? N ILE a 96   
CC 1 2 O MET PA 99   ? O MET a 99   N LEU PA 67   ? N LEU a 67   
CC 2 3 O VAL PA 66   ? O VAL a 66   N ALA PA 58   ? N ALA a 58   
CD 1 2 O LYS PA 79   ? O LYS a 79   N SER PA 87   ? N SER a 87   
CE 1 2 O ALA QA 54   ? O ALA b 54   N ILE QA 51   ? N ILE b 51   
CE 2 3 O GLU QA 48   ? O GLU b 48   N LYS QA 30   ? N LYS b 30   
CE 3 4 O TYR QA 29   ? O TYR b 29   N VAL QA 21   ? N VAL b 21   
CE 4 5 O MET QA 20   ? O MET b 20   N ARG QA 73   ? N ARG b 73   
CF 1 2 O TYR QA 32   ? O TYR b 32   N ALA QA 45   ? N ALA b 45   
CG 1 2 O GLU RA 62   ? O GLU c 62   N GLU RA 44   ? N GLU c 44   
CG 2 3 O ILE RA 43   ? O ILE c 43   N LEU RA 35   ? N LEU c 35   
CG 3 4 O TRP RA 34   ? O TRP c 34   N GLN RA 88   ? N GLN c 88   
CH 1 2 O ILE RA 77   ? O ILE c 77   N LEU RA 58   ? N LEU c 58   
CH 2 3 O VAL RA 57   ? O VAL c 57   N GLY RA 49   ? N GLY c 49   
CI 1 2 O GLY SA 52   ? O GLY d 52   N ALA SA 49   ? N ALA d 49   
CI 2 3 O VAL SA 46   ? O VAL d 46   N GLN SA 28   ? N GLN d 28   
CI 3 4 O VAL SA 27   ? O VAL d 27   N LEU SA 19   ? N LEU d 19   
CI 4 5 O SER SA 18   ? O SER d 18   N GLU SA 71   ? N GLU d 71   
CJ 1 2 O ILE SA 30   ? O ILE d 30   N ASP SA 43   ? N ASP d 43   
CK 1 2 O ALA TA 56   ? O ALA e 56   N VAL TA 48   ? N VAL e 48   
CK 2 3 O THR TA 47   ? O THR e 47   N ARG TA 29   ? N ARG e 29   
CK 3 4 O TYR TA 28   ? O TYR e 28   N CYS TA 20   ? N CYS e 20   
CK 4 5 O THR TA 19   ? O THR e 19   N ILE TA 72   ? N ILE e 72   
CL 1 2 O VAL TA 61   ? O VAL e 61   N MET TA 43   ? N MET e 43   
CL 2 3 O GLN TA 42   ? O GLN e 42   N GLU TA 34   ? N GLU e 34   
CM 1 2 O VAL UA 78   ? O VAL f 78   N ILE UA 20   ? N ILE f 20   
CM 2 3 O TYR UA 15   ? O TYR f 15   N PHE UA 31   ? N PHE f 31   
CM 3 4 O THR UA 30   ? O THR f 30   N CYS UA 43   ? N CYS f 43   
CM 4 5 O LEU UA 40   ? O LEU f 40   N LEU UA 72   ? N LEU f 72   
CN 1 2 O VAL VA 53   ? O VAL g 53   N MET VA 45   ? N MET g 45   
CN 2 3 O LYS VA 44   ? O LYS g 44   N HIS VA 26   ? N HIS g 26   
CN 3 4 O VAL VA 25   ? O VAL g 25   N ILE VA 17   ? N ILE g 17   
CN 4 5 O THR VA 16   ? O THR g 16   N ILE VA 69   ? N ILE g 69   
CO 1 2 O THR VA 38   ? O THR g 38   N ILE VA 60   ? N ILE g 60   
CP 1 2 O VAL WA 90   ? O VAL h 90   N GLU WA 76   ? N GLU h 76   
CP 2 3 O LYS WA 71   ? O LYS h 71   N LEU WA 53   ? N LEU h 53   
CP 3 4 O LEU WA 52   ? O LEU h 52   N ILE WA 44   ? N ILE h 44   
CP 4 5 O LEU WA 43   ? O LEU h 43   N LEU WA 110  ? N LEU h 110  
CQ 1 2 O MET WA 99   ? O MET h 99   N LEU WA 67   ? N LEU h 67   
CQ 2 3 O VAL WA 66   ? O VAL h 66   N ALA WA 58   ? N ALA h 58   
CR 1 2 O GLY XA 57   ? O GLY i 57   N GLU XA 49   ? N GLU i 49   
CR 2 3 O GLU XA 48   ? O GLU i 48   N LYS XA 30   ? N LYS i 30   
CR 3 4 O TYR XA 29   ? O TYR i 29   N VAL XA 21   ? N VAL i 21   
CR 4 5 O MET XA 20   ? O MET i 20   N ARG XA 73   ? N ARG i 73   
CS 1 2 O VAL XA 62   ? O VAL i 62   N LEU XA 44   ? N LEU i 44   
CS 2 3 O GLN XA 43   ? O GLN i 43   N SER XA 35   ? N SER i 35   
CT 1 2 O SER YA 70   ? O SER j 70   N HIS YA 65   ? N HIS j 65   
CT 2 3 O GLU YA 62   ? O GLU j 62   N GLU YA 44   ? N GLU j 44   
CT 3 4 O ILE YA 43   ? O ILE j 43   N VAL YA 33   ? N VAL j 33   
CT 4 5 O ARG YA 30   ? O ARG j 30   N VAL YA 90   ? N VAL j 90   
CU 1 2 O ILE YA 77   ? O ILE j 77   N LEU YA 58   ? N LEU j 58   
CU 2 3 O VAL YA 57   ? O VAL j 57   N GLY YA 49   ? N GLY j 49   
CV 1 2 O ILE ZA 68   ? O ILE k 68   N LYS ZA 20   ? N LYS k 20   
CV 2 3 O LEU ZA 17   ? O LEU k 17   N GLY ZA 29   ? N GLY k 29   
CV 3 4 O ILE ZA 30   ? O ILE k 30   N ASP ZA 43   ? N ASP k 43   
CV 4 5 O LEU ZA 40   ? O LEU k 40   N ILE ZA 62   ? N ILE k 62   
CW 1 2 O CYS ZA 45   ? O CYS k 45   N GLY ZA 58   ? N GLY k 58   
CX 1 2 O ALA AB 56   ? O ALA l 56   N VAL AB 48   ? N VAL l 48   
CX 2 3 O THR AB 47   ? O THR l 47   N ARG AB 29   ? N ARG l 29   
CX 3 4 O TYR AB 28   ? O TYR l 28   N CYS AB 20   ? N CYS l 20   
CX 4 5 O THR AB 19   ? O THR l 19   N ILE AB 72   ? N ILE l 72   
CY 1 2 O VAL AB 61   ? O VAL l 61   N MET AB 43   ? N MET l 43   
CY 2 3 O GLN AB 42   ? O GLN l 42   N GLU AB 34   ? N GLU l 34   
CZ 1 2 O ARG BB 65   ? O ARG m 65   N GLU BB 47   ? N GLU m 47   
CZ 2 3 O ASP BB 46   ? O ASP m 46   N ILE BB 28   ? N ILE m 28   
CZ 3 4 O PHE BB 27   ? O PHE m 27   N CYS BB 19   ? N CYS m 19   
CZ 4 5 O ARG BB 16   ? O ARG m 16   N GLY BB 84   ? N GLY m 84   
DA 1 2 O VAL BB 70   ? O VAL m 70   N LEU BB 42   ? N LEU m 42   
DA 2 3 O ILE BB 41   ? O ILE m 41   N ALA BB 33   ? N ALA m 33   
DB 1 2 O VAL CB 53   ? O VAL n 53   N MET CB 45   ? N MET n 45   
DB 2 3 O LYS CB 44   ? O LYS n 44   N HIS CB 26   ? N HIS n 26   
DB 3 4 O VAL CB 25   ? O VAL n 25   N ILE CB 17   ? N ILE n 17   
DB 4 5 O THR CB 16   ? O THR n 16   N ILE CB 69   ? N ILE n 69   
DC 1 2 O LEU CB 58   ? O LEU n 58   N LEU CB 40   ? N LEU n 40   
DC 2 3 O HIS CB 39   ? O HIS n 39   N GLY CB 31   ? N GLY n 31   
DD 1 2 O ALA DB 50   ? O ALA o 50   N VAL DB 10   ? N VAL o 10   
DD 2 3 O TYR DB 9    ? O TYR o 9    N ASN DB 80   ? N ASN o 80   
DE 1 2 O SER DB 70   ? O SER o 70   N ILE DB 77   ? N ILE o 77   
DF 1 2 O ILE DB 293  ? O ILE o 293  N LYS DB 147  ? N LYS o 147  
DF 2 3 O VAL DB 142  ? O VAL o 142  N MET DB 158  ? N MET o 158  
DF 3 4 O GLN DB 157  ? O GLN o 157  N GLU DB 270  ? N GLU o 270  
DF 4 5 O PHE DB 265  ? O PHE o 265  N LEU DB 234  ? N LEU o 234  
DF 5 6 O SER DB 235  ? O SER o 235  N PHE DB 249  ? N PHE o 249  
DF 6 7 O PHE DB 248  ? O PHE o 248  N GLY DB 200  ? N GLY o 200  
DF 7 8 O MET DB 197  ? O MET o 197  N ILE DB 193  ? N ILE o 193  
DG 1 2 O PRO FB 568  ? O PRO q 569  N ILE FB 419  ? N ILE q 420  
DG 2 3 O LEU FB 418  ? O LEU q 419  N VAL FB 548  ? N VAL q 549  
DG 3 4 O LYS FB 547  ? O LYS q 548  N VAL FB 517  ? N VAL q 518  
DG 4 5 O SER FB 515  ? O SER q 516  N LYS FB 447  ? N LYS q 448  
DG 5 6 O ILE FB 448  ? O ILE q 449  N ARG FB 494  ? N ARG q 495  
DG 6 7 O LEU FB 493  ? O LEU q 494  N GLY FB 478  ? N GLY q 479  
DG 7 8 O TYR FB 479  ? O TYR q 480  N CYS FB 486  ? N CYS q 487  
DH 1 2 O ASP FB 580  ? O ASP q 581  N GLY FB 732  ? N GLY q 733  
DH 2 3 O LYS FB 733  ? O LYS q 734  N VAL FB 689  ? N VAL q 690  
DH 3 4 O ILE FB 687  ? O ILE q 688  N ASP FB 610  ? N ASP q 611  
DH 4 5 O ILE FB 611  ? O ILE q 612  N VAL FB 671  ? N VAL q 672  
DH 5 6 O ARG FB 668  ? O ARG q 669  N LEU FB 643  ? N LEU q 644  
DI 1 2 O CYS FB 695  ? O CYS q 696  N THR FB 712  ? N THR q 713  
DJ 1 2 O ARG FB 960  ? O ARG q 961  N ARG FB 953  ? N ARG q 954  
DJ 2 3 O ALA FB 952  ? O ALA q 953  N LEU FB 984  ? N LEU q 985  
DJ 3 4 O LEU FB 985  ? O LEU q 986  N LEU FB 1001 ? N LEU q 1002 
DK 1 2 O GLU FB 988  ? O GLU q 989  N ARG FB 998  ? N ARG q 999  
DL 1 2 O PHE GB 435  ? O PHE r 435  N HIS GB 446  ? N HIS r 446  
DL 2 3 O GLU GB 443  ? O GLU r 443  N GLY GB 691  ? N GLY r 691  
DL 3 4 O GLU GB 686  ? O GLU r 686  N GLY GB 865  ? N GLY r 865  
DL 4 5 O GLU GB 866  ? O GLU r 866  N VAL GB 826  ? N VAL r 826  
DL 5 6 O THR GB 825  ? O THR r 825  N LEU GB 722  ? N LEU r 722  
DL 6 7 O VAL GB 721  ? O VAL r 721  N LEU GB 809  ? N LEU r 809  
DL 7 8 O VAL GB 808  ? O VAL r 808  N ALA GB 783  ? N ALA r 783  
DM 1 2 O PHE GB 674  ? O PHE r 674  N LEU GB 500  ? N LEU r 500  
DM 2 3 O LEU GB 499  ? O LEU r 499  N GLY GB 650  ? N GLY r 650  
DM 3 4 O ARG GB 647  ? O ARG r 647  N ILE GB 612  ? N ILE r 612  
DM 4 5 O ARG GB 610  ? O ARG r 610  N LYS GB 537  ? N LYS r 537  
DM 5 6 O TYR GB 540  ? O TYR r 540  N ILE GB 586  ? N ILE r 586  
DN 1 2 O VAL GB 833  ? O VAL r 833  N THR GB 842  ? N THR r 842  
DO 1 2 O LYS GB 971  ? O LYS r 971  N GLN GB 980  ? N GLN r 980  
DP 1 2 O HIS GB 1250 ? O HIS r 1250 N ILE GB 1204 ? N ILE r 1204 
DP 2 3 O THR GB 1197 ? O THR r 1197 N THR GB 1194 ? N THR r 1194 
DQ 1 2 O THR GB 1280 ? O THR r 1280 N VAL GB 1270 ? N VAL r 1270 
DQ 2 3 O PHE GB 1267 ? O PHE r 1267 N GLU GB 1226 ? N GLU r 1226 
DQ 3 4 O GLU GB 1219 ? O GLU r 1219 N LEU GB 1241 ? N LEU r 1241 
DR 1 2 O PHE GB 1512 ? O PHE r 1512 N PHE GB 1347 ? N PHE r 1347 
DR 2 3 O VAL GB 1346 ? O VAL r 1346 N ALA GB 1489 ? N ALA r 1489 
DR 3 4 O ARG GB 1486 ? O ARG r 1486 N PHE GB 1451 ? N PHE r 1451 
DR 4 5 O LEU GB 1450 ? O LEU r 1450 N VAL GB 1377 ? N VAL r 1377 
DR 5 6 O CYS GB 1376 ? O CYS r 1376 N ILE GB 1425 ? N ILE r 1425 
DR 6 7 O ILE GB 1424 ? O ILE r 1424 N VAL GB 1406 ? N VAL r 1406 
DS 1 2 O GLU GB 1524 ? O GLU r 1524 N GLY GB 1700 ? N GLY r 1700 
DS 2 3 O ARG GB 1701 ? O ARG r 1701 N VAL GB 1661 ? N VAL r 1661 
DS 3 4 O LEU GB 1660 ? O LEU r 1660 N ILE GB 1560 ? N ILE r 1560 
DS 4 5 O VAL GB 1559 ? O VAL r 1559 N VAL GB 1644 ? N VAL r 1644 
DT 1 2 O TYR GB 1668 ? O TYR r 1668 N VAL GB 1677 ? N VAL r 1677 
DU 1 2 O SER GB 1803 ? O SER r 1803 N ALA GB 1811 ? N ALA r 1811 
DV 1 2 O GLU GB 2018 ? O GLU r 2018 N GLU GB 2042 ? N GLU r 2042 
DV 2 3 O VAL GB 2035 ? O VAL r 2035 N PHE GB 2094 ? N PHE r 2094 
DW 1 2 O GLN GB 2118 ? O GLN r 2118 N PHE GB 2108 ? N PHE r 2108 
DW 2 3 O THR GB 2105 ? O THR r 2105 N GLY GB 2069 ? N GLY r 2069 
DW 3 4 O TRP GB 2064 ? O TRP r 2064 N LEU GB 2082 ? N LEU r 2082 
DX 1 2 O LEU IB 21   ? O LEU N 21   N VAL IB 62   ? N VAL N 62   
DX 2 3 O TYR IB 61   ? O TYR N 61   N ARG IB 49   ? N ARG N 49   
# 
_atom_sites.entry_id                    6FF7 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ASN A  1  2    ? 275.260 274.613 319.802 1.00 65.05  ? 2    ASN 1 N     1 
ATOM   2     C  CA    . ASN A  1  2    ? 274.573 275.705 320.492 1.00 65.05  ? 2    ASN 1 CA    1 
ATOM   3     C  C     . ASN A  1  2    ? 275.288 277.094 320.387 1.00 65.05  ? 2    ASN 1 C     1 
ATOM   4     O  O     . ASN A  1  2    ? 274.599 278.077 320.109 1.00 65.05  ? 2    ASN 1 O     1 
ATOM   5     C  CB    . ASN A  1  2    ? 274.315 275.316 321.964 1.00 65.05  ? 2    ASN 1 CB    1 
ATOM   6     N  N     . PRO A  1  3    ? 276.613 277.224 320.582 1.00 63.06  ? 3    PRO 1 N     1 
ATOM   7     C  CA    . PRO A  1  3    ? 277.214 278.551 320.363 1.00 63.06  ? 3    PRO 1 CA    1 
ATOM   8     C  C     . PRO A  1  3    ? 277.460 278.894 318.903 1.00 63.06  ? 3    PRO 1 C     1 
ATOM   9     O  O     . PRO A  1  3    ? 277.625 280.078 318.588 1.00 63.06  ? 3    PRO 1 O     1 
ATOM   10    C  CB    . PRO A  1  3    ? 278.541 278.470 321.128 1.00 63.06  ? 3    PRO 1 CB    1 
ATOM   11    N  N     . LEU A  1  4    ? 277.488 277.914 318.000 1.00 60.65  ? 4    LEU 1 N     1 
ATOM   12    C  CA    . LEU A  1  4    ? 277.784 278.208 316.603 1.00 60.65  ? 4    LEU 1 CA    1 
ATOM   13    C  C     . LEU A  1  4    ? 276.878 277.433 315.651 1.00 60.65  ? 4    LEU 1 C     1 
ATOM   14    O  O     . LEU A  1  4    ? 277.131 277.398 314.443 1.00 60.65  ? 4    LEU 1 O     1 
ATOM   15    C  CB    . LEU A  1  4    ? 279.267 277.937 316.311 1.00 60.65  ? 4    LEU 1 CB    1 
ATOM   16    N  N     . THR A  1  5    ? 275.815 276.815 316.176 1.00 62.97  ? 5    THR 1 N     1 
ATOM   17    C  CA    . THR A  1  5    ? 274.833 276.196 315.293 1.00 62.97  ? 5    THR 1 CA    1 
ATOM   18    C  C     . THR A  1  5    ? 273.881 277.226 314.697 1.00 62.97  ? 5    THR 1 C     1 
ATOM   19    O  O     . THR A  1  5    ? 273.190 276.923 313.717 1.00 62.97  ? 5    THR 1 O     1 
ATOM   20    C  CB    . THR A  1  5    ? 274.041 275.110 316.030 1.00 62.97  ? 5    THR 1 CB    1 
ATOM   21    N  N     . LYS A  1  6    ? 273.847 278.442 315.253 1.00 56.70  ? 6    LYS 1 N     1 
ATOM   22    C  CA    . LYS A  1  6    ? 273.055 279.508 314.653 1.00 56.70  ? 6    LYS 1 CA    1 
ATOM   23    C  C     . LYS A  1  6    ? 273.677 279.989 313.350 1.00 56.70  ? 6    LYS 1 C     1 
ATOM   24    O  O     . LYS A  1  6    ? 272.969 280.527 312.492 1.00 56.70  ? 6    LYS 1 O     1 
ATOM   25    C  CB    . LYS A  1  6    ? 272.896 280.666 315.638 1.00 56.70  ? 6    LYS 1 CB    1 
ATOM   26    N  N     . VAL A  1  7    ? 274.991 279.794 313.187 1.00 54.92  ? 7    VAL 1 N     1 
ATOM   27    C  CA    . VAL A  1  7    ? 275.638 279.978 311.888 1.00 54.92  ? 7    VAL 1 CA    1 
ATOM   28    C  C     . VAL A  1  7    ? 275.009 279.052 310.854 1.00 54.92  ? 7    VAL 1 C     1 
ATOM   29    O  O     . VAL A  1  7    ? 274.645 279.477 309.749 1.00 54.92  ? 7    VAL 1 O     1 
ATOM   30    C  CB    . VAL A  1  7    ? 277.154 279.730 312.006 1.00 54.92  ? 7    VAL 1 CB    1 
ATOM   31    N  N     . LYS A  1  8    ? 274.832 277.780 311.225 1.00 59.19  ? 8    LYS 1 N     1 
ATOM   32    C  CA    . LYS A  1  8    ? 274.208 276.810 310.332 1.00 59.19  ? 8    LYS 1 CA    1 
ATOM   33    C  C     . LYS A  1  8    ? 272.738 277.133 310.102 1.00 59.19  ? 8    LYS 1 C     1 
ATOM   34    O  O     . LYS A  1  8    ? 272.220 276.928 309.000 1.00 59.19  ? 8    LYS 1 O     1 
ATOM   35    C  CB    . LYS A  1  8    ? 274.369 275.401 310.905 1.00 59.19  ? 8    LYS 1 CB    1 
ATOM   36    N  N     . LEU A  1  9    ? 272.060 277.675 311.119 1.00 57.25  ? 9    LEU 1 N     1 
ATOM   37    C  CA    . LEU A  1  9    ? 270.653 278.051 310.968 1.00 57.25  ? 9    LEU 1 CA    1 
ATOM   38    C  C     . LEU A  1  9    ? 270.484 279.205 309.981 1.00 57.25  ? 9    LEU 1 C     1 
ATOM   39    O  O     . LEU A  1  9    ? 269.653 279.133 309.067 1.00 57.25  ? 9    LEU 1 O     1 
ATOM   40    C  CB    . LEU A  1  9    ? 270.056 278.410 312.327 1.00 57.25  ? 9    LEU 1 CB    1 
ATOM   41    N  N     . ILE A  1  10   ? 271.274 280.271 310.141 1.00 51.13  ? 10   ILE 1 N     1 
ATOM   42    C  CA    . ILE A  1  10   ? 271.186 281.414 309.235 1.00 51.13  ? 10   ILE 1 CA    1 
ATOM   43    C  C     . ILE A  1  10   ? 271.673 281.034 307.832 1.00 51.13  ? 10   ILE 1 C     1 
ATOM   44    O  O     . ILE A  1  10   ? 271.171 281.561 306.829 1.00 51.13  ? 10   ILE 1 O     1 
ATOM   45    C  CB    . ILE A  1  10   ? 271.953 282.610 309.839 1.00 51.13  ? 10   ILE 1 CB    1 
ATOM   46    N  N     . ASN A  1  11   ? 272.599 280.072 307.727 1.00 53.79  ? 11   ASN 1 N     1 
ATOM   47    C  CA    . ASN A  1  11   ? 272.984 279.563 306.413 1.00 53.79  ? 11   ASN 1 CA    1 
ATOM   48    C  C     . ASN A  1  11   ? 271.862 278.760 305.757 1.00 53.79  ? 11   ASN 1 C     1 
ATOM   49    O  O     . ASN A  1  11   ? 271.633 278.893 304.549 1.00 53.79  ? 11   ASN 1 O     1 
ATOM   50    C  CB    . ASN A  1  11   ? 274.251 278.714 306.523 1.00 53.79  ? 11   ASN 1 CB    1 
ATOM   51    N  N     . GLU A  1  12   ? 271.149 277.933 306.531 1.00 56.82  ? 12   GLU 1 N     1 
ATOM   52    C  CA    . GLU A  1  12   ? 270.040 277.165 305.971 1.00 56.82  ? 12   GLU 1 CA    1 
ATOM   53    C  C     . GLU A  1  12   ? 268.861 278.054 305.599 1.00 56.82  ? 12   GLU 1 C     1 
ATOM   54    O  O     . GLU A  1  12   ? 268.101 277.709 304.690 1.00 56.82  ? 12   GLU 1 O     1 
ATOM   55    C  CB    . GLU A  1  12   ? 269.589 276.072 306.944 1.00 56.82  ? 12   GLU 1 CB    1 
ATOM   56    N  N     . LEU A  1  13   ? 268.700 279.198 306.272 1.00 51.88  ? 13   LEU 1 N     1 
ATOM   57    C  CA    . LEU A  1  13   ? 267.708 280.184 305.840 1.00 51.88  ? 13   LEU 1 CA    1 
ATOM   58    C  C     . LEU A  1  13   ? 268.001 280.706 304.434 1.00 51.88  ? 13   LEU 1 C     1 
ATOM   59    O  O     . LEU A  1  13   ? 267.112 280.752 303.576 1.00 51.88  ? 13   LEU 1 O     1 
ATOM   60    C  CB    . LEU A  1  13   ? 267.626 281.341 306.840 1.00 51.88  ? 13   LEU 1 CB    1 
ATOM   61    N  N     . ASN A  1  14   ? 269.256 281.080 304.173 1.00 53.22  ? 14   ASN 1 N     1 
ATOM   62    C  CA    . ASN A  1  14   ? 269.610 281.575 302.846 1.00 53.22  ? 14   ASN 1 CA    1 
ATOM   63    C  C     . ASN A  1  14   ? 269.601 280.461 301.806 1.00 53.22  ? 14   ASN 1 C     1 
ATOM   64    O  O     . ASN A  1  14   ? 269.277 280.710 300.638 1.00 53.22  ? 14   ASN 1 O     1 
ATOM   65    C  CB    . ASN A  1  14   ? 270.974 282.260 302.888 1.00 53.22  ? 14   ASN 1 CB    1 
ATOM   66    N  N     . GLU A  1  15   ? 269.918 279.228 302.214 1.00 55.85  ? 15   GLU 1 N     1 
ATOM   67    C  CA    . GLU A  1  15   ? 269.830 278.104 301.286 1.00 55.85  ? 15   GLU 1 CA    1 
ATOM   68    C  C     . GLU A  1  15   ? 268.380 277.780 300.942 1.00 55.85  ? 15   GLU 1 C     1 
ATOM   69    O  O     . GLU A  1  15   ? 268.071 277.424 299.801 1.00 55.85  ? 15   GLU 1 O     1 
ATOM   70    C  CB    . GLU A  1  15   ? 270.539 276.878 301.861 1.00 55.85  ? 15   GLU 1 CB    1 
ATOM   71    N  N     . ARG A  1  16   ? 267.467 277.941 301.902 1.00 52.47  ? 16   ARG 1 N     1 
ATOM   72    C  CA    . ARG A  1  16   ? 266.053 277.735 301.611 1.00 52.47  ? 16   ARG 1 CA    1 
ATOM   73    C  C     . ARG A  1  16   ? 265.497 278.871 300.759 1.00 52.47  ? 16   ARG 1 C     1 
ATOM   74    O  O     . ARG A  1  16   ? 264.611 278.651 299.923 1.00 52.47  ? 16   ARG 1 O     1 
ATOM   75    C  CB    . ARG A  1  16   ? 265.273 277.594 302.919 1.00 52.47  ? 16   ARG 1 CB    1 
ATOM   76    N  N     . GLU A  1  17   ? 266.022 280.088 300.941 1.00 53.38  ? 17   GLU 1 N     1 
ATOM   77    C  CA    . GLU A  1  17   ? 265.619 281.210 300.095 1.00 53.38  ? 17   GLU 1 CA    1 
ATOM   78    C  C     . GLU A  1  17   ? 266.091 281.022 298.657 1.00 53.38  ? 17   GLU 1 C     1 
ATOM   79    O  O     . GLU A  1  17   ? 265.360 281.329 297.709 1.00 53.38  ? 17   GLU 1 O     1 
ATOM   80    C  CB    . GLU A  1  17   ? 266.154 282.526 300.661 1.00 53.38  ? 17   GLU 1 CB    1 
ATOM   81    N  N     . VAL A  1  18   ? 267.315 280.520 298.473 1.00 54.31  ? 18   VAL 1 N     1 
ATOM   82    C  CA    . VAL A  1  18   ? 267.812 280.315 297.117 1.00 54.31  ? 18   VAL 1 CA    1 
ATOM   83    C  C     . VAL A  1  18   ? 267.240 279.031 296.514 1.00 54.31  ? 18   VAL 1 C     1 
ATOM   84    O  O     . VAL A  1  18   ? 267.228 278.873 295.286 1.00 54.31  ? 18   VAL 1 O     1 
ATOM   85    C  CB    . VAL A  1  18   ? 269.359 280.337 297.109 1.00 54.31  ? 18   VAL 1 CB    1 
ATOM   86    N  N     . GLN A  1  19   ? 266.727 278.119 297.346 1.00 57.01  ? 19   GLN 1 N     1 
ATOM   87    C  CA    . GLN A  1  19   ? 266.099 276.909 296.827 1.00 57.01  ? 19   GLN 1 CA    1 
ATOM   88    C  C     . GLN A  1  19   ? 264.664 277.170 296.386 1.00 57.01  ? 19   GLN 1 C     1 
ATOM   89    O  O     . GLN A  1  19   ? 264.254 276.735 295.304 1.00 57.01  ? 19   GLN 1 O     1 
ATOM   90    C  CB    . GLN A  1  19   ? 266.141 275.807 297.886 1.00 57.01  ? 19   GLN 1 CB    1 
ATOM   91    N  N     . LEU A  1  20   ? 263.886 277.876 297.208 1.00 53.22  ? 20   LEU 1 N     1 
ATOM   92    C  CA    . LEU A  1  20   ? 262.489 278.139 296.886 1.00 53.22  ? 20   LEU 1 CA    1 
ATOM   93    C  C     . LEU A  1  20   ? 262.308 279.250 295.862 1.00 53.22  ? 20   LEU 1 C     1 
ATOM   94    O  O     . LEU A  1  20   ? 261.214 279.381 295.300 1.00 53.22  ? 20   LEU 1 O     1 
ATOM   95    C  CB    . LEU A  1  20   ? 261.709 278.494 298.156 1.00 53.22  ? 20   LEU 1 CB    1 
ATOM   96    N  N     . GLY A  1  21   ? 263.341 280.048 295.605 1.00 53.10  ? 21   GLY 1 N     1 
ATOM   97    C  CA    . GLY A  1  21   ? 263.236 281.131 294.647 1.00 53.10  ? 21   GLY 1 CA    1 
ATOM   98    C  C     . GLY A  1  21   ? 262.446 282.309 295.178 1.00 53.10  ? 21   GLY 1 C     1 
ATOM   99    O  O     . GLY A  1  21   ? 261.404 282.670 294.624 1.00 53.10  ? 21   GLY 1 O     1 
ATOM   100   N  N     . VAL A  1  22   ? 262.934 282.914 296.255 1.00 51.53  ? 22   VAL 1 N     1 
ATOM   101   C  CA    . VAL A  1  22   ? 262.257 284.026 296.909 1.00 51.53  ? 22   VAL 1 CA    1 
ATOM   102   C  C     . VAL A  1  22   ? 262.833 285.332 296.383 1.00 51.53  ? 22   VAL 1 C     1 
ATOM   103   O  O     . VAL A  1  22   ? 264.052 285.541 296.373 1.00 51.53  ? 22   VAL 1 O     1 
ATOM   104   C  CB    . VAL A  1  22   ? 262.392 283.927 298.445 1.00 51.53  ? 22   VAL 1 CB    1 
ATOM   105   N  N     . ALA A  1  23   ? 261.948 286.217 295.932 1.00 54.46  ? 23   ALA 1 N     1 
ATOM   106   C  CA    . ALA A  1  23   ? 262.338 287.536 295.459 1.00 54.46  ? 23   ALA 1 CA    1 
ATOM   107   C  C     . ALA A  1  23   ? 262.777 288.412 296.628 1.00 54.46  ? 23   ALA 1 C     1 
ATOM   108   O  O     . ALA A  1  23   ? 262.482 288.132 297.792 1.00 54.46  ? 23   ALA 1 O     1 
ATOM   109   C  CB    . ALA A  1  23   ? 261.188 288.203 294.704 1.00 54.46  ? 23   ALA 1 CB    1 
ATOM   110   N  N     . ASP A  1  24   ? 263.469 289.506 296.296 1.00 59.84  ? 24   ASP 1 N     1 
ATOM   111   C  CA    . ASP A  1  24   ? 264.095 290.346 297.314 1.00 59.84  ? 24   ASP 1 CA    1 
ATOM   112   C  C     . ASP A  1  24   ? 263.095 291.176 298.116 1.00 59.84  ? 24   ASP 1 C     1 
ATOM   113   O  O     . ASP A  1  24   ? 263.478 291.772 299.129 1.00 59.84  ? 24   ASP 1 O     1 
ATOM   114   C  CB    . ASP A  1  24   ? 265.141 291.257 296.664 1.00 59.84  ? 24   ASP 1 CB    1 
ATOM   115   N  N     . LYS A  1  25   ? 261.830 291.231 297.693 1.00 58.39  ? 25   LYS 1 N     1 
ATOM   116   C  CA    . LYS A  1  25   ? 260.844 292.019 298.424 1.00 58.39  ? 25   LYS 1 CA    1 
ATOM   117   C  C     . LYS A  1  25   ? 260.394 291.326 299.706 1.00 58.39  ? 25   LYS 1 C     1 
ATOM   118   O  O     . LYS A  1  25   ? 259.984 292.000 300.657 1.00 58.39  ? 25   LYS 1 O     1 
ATOM   119   C  CB    . LYS A  1  25   ? 259.639 292.313 297.530 1.00 58.39  ? 25   LYS 1 CB    1 
ATOM   120   N  N     . VAL A  1  26   ? 260.449 289.994 299.753 1.00 49.81  ? 26   VAL 1 N     1 
ATOM   121   C  CA    . VAL A  1  26   ? 259.988 289.247 300.920 1.00 49.81  ? 26   VAL 1 CA    1 
ATOM   122   C  C     . VAL A  1  26   ? 261.065 288.287 301.413 1.00 49.81  ? 26   VAL 1 C     1 
ATOM   123   O  O     . VAL A  1  26   ? 260.764 287.306 302.103 1.00 49.81  ? 26   VAL 1 O     1 
ATOM   124   C  CB    . VAL A  1  26   ? 258.683 288.482 300.616 1.00 49.81  ? 26   VAL 1 CB    1 
ATOM   125   N  N     . SER A  1  27   ? 262.324 288.560 301.077 1.00 52.01  ? 27   SER 1 N     1 
ATOM   126   C  CA    . SER A  1  27   ? 263.427 287.681 301.472 1.00 52.01  ? 27   SER 1 CA    1 
ATOM   127   C  C     . SER A  1  27   ? 264.089 288.176 302.759 1.00 52.01  ? 27   SER 1 C     1 
ATOM   128   O  O     . SER A  1  27   ? 265.263 288.546 302.775 1.00 52.01  ? 27   SER 1 O     1 
ATOM   129   C  CB    . SER A  1  27   ? 264.446 287.566 300.344 1.00 52.01  ? 27   SER 1 CB    1 
ATOM   130   N  N     . TRP A  1  28   ? 263.273 288.258 303.821 1.00 48.17  ? 28   TRP 1 N     1 
ATOM   131   C  CA    . TRP A  1  28   ? 263.674 288.399 305.226 1.00 48.17  ? 28   TRP 1 CA    1 
ATOM   132   C  C     . TRP A  1  28   ? 264.243 289.781 305.574 1.00 48.17  ? 28   TRP 1 C     1 
ATOM   133   O  O     . TRP A  1  28   ? 264.398 290.115 306.754 1.00 48.17  ? 28   TRP 1 O     1 
ATOM   134   C  CB    . TRP A  1  28   ? 264.657 287.264 305.595 1.00 48.17  ? 28   TRP 1 CB    1 
ATOM   135   N  N     . HIS A  1  29   ? 264.476 290.637 304.579 1.00 47.94  ? 29   HIS 1 N     1 
ATOM   136   C  CA    . HIS A  1  29   ? 265.087 291.934 304.828 1.00 47.94  ? 29   HIS 1 CA    1 
ATOM   137   C  C     . HIS A  1  29   ? 264.110 293.097 304.744 1.00 47.94  ? 29   HIS 1 C     1 
ATOM   138   O  O     . HIS A  1  29   ? 264.498 294.229 305.051 1.00 47.94  ? 29   HIS 1 O     1 
ATOM   139   C  CB    . HIS A  1  29   ? 266.254 292.167 303.859 1.00 47.94  ? 29   HIS 1 CB    1 
ATOM   140   N  N     . SER A  1  30   ? 262.862 292.855 304.338 1.00 50.99  ? 30   SER 1 N     1 
ATOM   141   C  CA    . SER A  1  30   ? 261.831 293.878 304.450 1.00 50.99  ? 30   SER 1 CA    1 
ATOM   142   C  C     . SER A  1  30   ? 261.244 293.953 305.852 1.00 50.99  ? 30   SER 1 C     1 
ATOM   143   O  O     . SER A  1  30   ? 260.525 294.910 306.157 1.00 50.99  ? 30   SER 1 O     1 
ATOM   144   C  CB    . SER A  1  30   ? 260.715 293.618 303.439 1.00 50.99  ? 30   SER 1 CB    1 
ATOM   145   N  N     . GLU A  1  31   ? 261.528 292.968 306.702 1.00 46.25  ? 31   GLU 1 N     1 
ATOM   146   C  CA    . GLU A  1  31   ? 261.071 292.975 308.084 1.00 46.25  ? 31   GLU 1 CA    1 
ATOM   147   C  C     . GLU A  1  31   ? 262.033 293.697 309.014 1.00 46.25  ? 31   GLU 1 C     1 
ATOM   148   O  O     . GLU A  1  31   ? 261.633 294.112 310.108 1.00 46.25  ? 31   GLU 1 O     1 
ATOM   149   C  CB    . GLU A  1  31   ? 260.868 291.538 308.572 1.00 46.25  ? 31   GLU 1 CB    1 
ATOM   150   N  N     . TYR A  1  32   ? 263.290 293.855 308.605 1.00 46.15  ? 32   TYR 1 N     1 
ATOM   151   C  CA    . TYR A  1  32   ? 264.320 294.506 309.412 1.00 46.15  ? 32   TYR 1 CA    1 
ATOM   152   C  C     . TYR A  1  32   ? 264.754 295.836 308.809 1.00 46.15  ? 32   TYR 1 C     1 
ATOM   153   O  O     . TYR A  1  32   ? 265.935 296.191 308.851 1.00 46.15  ? 32   TYR 1 O     1 
ATOM   154   C  CB    . TYR A  1  32   ? 265.520 293.577 309.582 1.00 46.15  ? 32   TYR 1 CB    1 
ATOM   155   N  N     . LYS A  1  33   ? 263.816 296.592 308.241 1.00 49.70  ? 33   LYS 1 N     1 
ATOM   156   C  CA    . LYS A  1  33   ? 264.154 297.856 307.607 1.00 49.70  ? 33   LYS 1 CA    1 
ATOM   157   C  C     . LYS A  1  33   ? 264.360 298.950 308.655 1.00 49.70  ? 33   LYS 1 C     1 
ATOM   158   O  O     . LYS A  1  33   ? 264.100 298.766 309.850 1.00 49.70  ? 33   LYS 1 O     1 
ATOM   159   C  CB    . LYS A  1  33   ? 263.062 298.279 306.625 1.00 49.70  ? 33   LYS 1 CB    1 
ATOM   160   N  N     . ASP A  1  34   ? 264.843 300.103 308.169 1.00 53.24  ? 34   ASP 1 N     1 
ATOM   161   C  CA    . ASP A  1  34   ? 265.091 301.321 308.954 1.00 53.24  ? 34   ASP 1 CA    1 
ATOM   162   C  C     . ASP A  1  34   ? 266.056 301.081 310.114 1.00 53.24  ? 34   ASP 1 C     1 
ATOM   163   O  O     . ASP A  1  34   ? 265.911 301.673 311.187 1.00 53.24  ? 34   ASP 1 O     1 
ATOM   164   C  CB    . ASP A  1  34   ? 263.783 301.941 309.463 1.00 53.24  ? 34   ASP 1 CB    1 
ATOM   165   N  N     . SER A  1  35   ? 267.049 300.219 309.904 1.00 50.27  ? 35   SER 1 N     1 
ATOM   166   C  CA    . SER A  1  35   ? 268.001 299.870 310.956 1.00 50.27  ? 35   SER 1 CA    1 
ATOM   167   C  C     . SER A  1  35   ? 269.279 299.373 310.298 1.00 50.27  ? 35   SER 1 C     1 
ATOM   168   O  O     . SER A  1  35   ? 269.255 298.373 309.573 1.00 50.27  ? 35   SER 1 O     1 
ATOM   169   C  CB    . SER A  1  35   ? 267.423 298.813 311.892 1.00 50.27  ? 35   SER 1 CB    1 
ATOM   170   N  N     . ALA A  1  36   ? 270.388 300.068 310.549 1.00 49.17  ? 36   ALA 1 N     1 
ATOM   171   C  CA    . ALA A  1  36   ? 271.689 299.689 310.019 1.00 49.17  ? 36   ALA 1 CA    1 
ATOM   172   C  C     . ALA A  1  36   ? 272.551 298.955 311.042 1.00 49.17  ? 36   ALA 1 C     1 
ATOM   173   O  O     . ALA A  1  36   ? 273.747 298.760 310.804 1.00 49.17  ? 36   ALA 1 O     1 
ATOM   174   C  CB    . ALA A  1  36   ? 272.425 300.925 309.498 1.00 49.17  ? 36   ALA 1 CB    1 
ATOM   175   N  N     . TRP A  1  37   ? 271.967 298.532 312.159 1.00 48.97  ? 37   TRP 1 N     1 
ATOM   176   C  CA    . TRP A  1  37   ? 272.693 297.902 313.254 1.00 48.97  ? 37   TRP 1 CA    1 
ATOM   177   C  C     . TRP A  1  37   ? 272.768 296.398 313.030 1.00 48.97  ? 37   TRP 1 C     1 
ATOM   178   O  O     . TRP A  1  37   ? 271.753 295.762 312.728 1.00 48.97  ? 37   TRP 1 O     1 
ATOM   179   C  CB    . TRP A  1  37   ? 272.008 298.192 314.591 1.00 48.97  ? 37   TRP 1 CB    1 
ATOM   180   N  N     . ILE A  1  38   ? 273.965 295.831 313.183 1.00 48.49  ? 38   ILE 1 N     1 
ATOM   181   C  CA    . ILE A  1  38   ? 274.156 294.387 313.142 1.00 48.49  ? 38   ILE 1 CA    1 
ATOM   182   C  C     . ILE A  1  38   ? 274.917 293.945 314.385 1.00 48.49  ? 38   ILE 1 C     1 
ATOM   183   O  O     . ILE A  1  38   ? 275.793 294.662 314.890 1.00 48.49  ? 38   ILE 1 O     1 
ATOM   184   C  CB    . ILE A  1  38   ? 274.865 293.910 311.846 1.00 48.49  ? 38   ILE 1 CB    1 
ATOM   185   N  N     . PHE A  1  39   ? 274.567 292.758 314.868 1.00 49.80  ? 39   PHE 1 N     1 
ATOM   186   C  CA    . PHE A  1  39   ? 275.176 292.126 316.028 1.00 49.80  ? 39   PHE 1 CA    1 
ATOM   187   C  C     . PHE A  1  39   ? 276.192 291.088 315.568 1.00 49.80  ? 39   PHE 1 C     1 
ATOM   188   O  O     . PHE A  1  39   ? 275.956 290.371 314.588 1.00 49.80  ? 39   PHE 1 O     1 
ATOM   189   C  CB    . PHE A  1  39   ? 274.089 291.480 316.887 1.00 49.80  ? 39   PHE 1 CB    1 
ATOM   190   N  N     . LEU A  1  40   ? 277.316 291.011 316.273 1.00 50.28  ? 40   LEU 1 N     1 
ATOM   191   C  CA    . LEU A  1  40   ? 278.347 290.026 315.991 1.00 50.28  ? 40   LEU 1 CA    1 
ATOM   192   C  C     . LEU A  1  40   ? 278.470 289.030 317.141 1.00 50.28  ? 40   LEU 1 C     1 
ATOM   193   O  O     . LEU A  1  40   ? 278.222 289.348 318.306 1.00 50.28  ? 40   LEU 1 O     1 
ATOM   194   C  CB    . LEU A  1  40   ? 279.686 290.715 315.744 1.00 50.28  ? 40   LEU 1 CB    1 
ATOM   195   N  N     . GLY A  1  41   ? 278.871 287.809 316.801 1.00 50.86  ? 41   GLY 1 N     1 
ATOM   196   C  CA    . GLY A  1  41   ? 279.016 286.775 317.807 1.00 50.86  ? 41   GLY 1 CA    1 
ATOM   197   C  C     . GLY A  1  41   ? 280.231 285.889 317.621 1.00 50.86  ? 41   GLY 1 C     1 
ATOM   198   O  O     . GLY A  1  41   ? 280.573 285.519 316.495 1.00 50.86  ? 41   GLY 1 O     1 
ATOM   199   N  N     . GLY A  1  42   ? 280.893 285.543 318.722 1.00 50.28  ? 42   GLY 1 N     1 
ATOM   200   C  CA    . GLY A  1  42   ? 282.019 284.633 318.661 1.00 50.28  ? 42   GLY 1 CA    1 
ATOM   201   C  C     . GLY A  1  42   ? 283.345 285.263 318.303 1.00 50.28  ? 42   GLY 1 C     1 
ATOM   202   O  O     . GLY A  1  42   ? 284.231 284.570 317.793 1.00 50.28  ? 42   GLY 1 O     1 
ATOM   203   N  N     . LEU A  1  43   ? 283.512 286.560 318.559 1.00 51.66  ? 43   LEU 1 N     1 
ATOM   204   C  CA    . LEU A  1  43   ? 284.765 287.230 318.262 1.00 51.66  ? 43   LEU 1 CA    1 
ATOM   205   C  C     . LEU A  1  43   ? 285.848 286.819 319.257 1.00 51.66  ? 43   LEU 1 C     1 
ATOM   206   O  O     . LEU A  1  43   ? 285.583 286.669 320.452 1.00 51.66  ? 43   LEU 1 O     1 
ATOM   207   C  CB    . LEU A  1  43   ? 284.584 288.746 318.298 1.00 51.66  ? 43   LEU 1 CB    1 
ATOM   208   N  N     . PRO A  1  44   ? 287.074 286.614 318.781 1.00 51.30  ? 44   PRO 1 N     1 
ATOM   209   C  CA    . PRO A  1  44   ? 288.198 286.367 319.689 1.00 51.30  ? 44   PRO 1 CA    1 
ATOM   210   C  C     . PRO A  1  44   ? 288.547 287.614 320.494 1.00 51.30  ? 44   PRO 1 C     1 
ATOM   211   O  O     . PRO A  1  44   ? 288.177 288.739 320.155 1.00 51.30  ? 44   PRO 1 O     1 
ATOM   212   C  CB    . PRO A  1  44   ? 289.341 285.981 318.744 1.00 51.30  ? 44   PRO 1 CB    1 
ATOM   213   N  N     . TYR A  1  45   ? 289.288 287.391 321.576 1.00 54.28  ? 45   TYR 1 N     1 
ATOM   214   C  CA    . TYR A  1  45   ? 289.621 288.448 322.521 1.00 54.28  ? 45   TYR 1 CA    1 
ATOM   215   C  C     . TYR A  1  45   ? 290.833 289.270 322.103 1.00 54.28  ? 45   TYR 1 C     1 
ATOM   216   O  O     . TYR A  1  45   ? 291.189 290.221 322.807 1.00 54.28  ? 45   TYR 1 O     1 
ATOM   217   C  CB    . TYR A  1  45   ? 289.858 287.849 323.911 1.00 54.28  ? 45   TYR 1 CB    1 
ATOM   218   N  N     . GLU A  1  46   ? 291.473 288.935 320.985 1.00 54.41  ? 46   GLU 1 N     1 
ATOM   219   C  CA    . GLU A  1  46   ? 292.609 289.693 320.480 1.00 54.41  ? 46   GLU 1 CA    1 
ATOM   220   C  C     . GLU A  1  46   ? 292.206 290.731 319.441 1.00 54.41  ? 46   GLU 1 C     1 
ATOM   221   O  O     . GLU A  1  46   ? 293.079 291.285 318.765 1.00 54.41  ? 46   GLU 1 O     1 
ATOM   222   C  CB    . GLU A  1  46   ? 293.660 288.751 319.881 1.00 54.41  ? 46   GLU 1 CB    1 
ATOM   223   N  N     . LEU A  1  47   ? 290.914 291.004 319.298 1.00 51.48  ? 47   LEU 1 N     1 
ATOM   224   C  CA    . LEU A  1  47   ? 290.409 291.920 318.285 1.00 51.48  ? 47   LEU 1 CA    1 
ATOM   225   C  C     . LEU A  1  47   ? 290.197 293.302 318.888 1.00 51.48  ? 47   LEU 1 C     1 
ATOM   226   O  O     . LEU A  1  47   ? 289.503 293.444 319.901 1.00 51.48  ? 47   LEU 1 O     1 
ATOM   227   C  CB    . LEU A  1  47   ? 289.099 291.406 317.681 1.00 51.48  ? 47   LEU 1 CB    1 
ATOM   228   N  N     . THR A  1  48   ? 290.796 294.311 318.266 1.00 55.34  ? 48   THR 1 N     1 
ATOM   229   C  CA    . THR A  1  48   ? 290.546 295.707 318.587 1.00 55.34  ? 48   THR 1 CA    1 
ATOM   230   C  C     . THR A  1  48   ? 289.459 296.250 317.668 1.00 55.34  ? 48   THR 1 C     1 
ATOM   231   O  O     . THR A  1  48   ? 288.965 295.550 316.781 1.00 55.34  ? 48   THR 1 O     1 
ATOM   232   C  CB    . THR A  1  48   ? 291.822 296.542 318.447 1.00 55.34  ? 48   THR 1 CB    1 
ATOM   233   N  N     . GLU A  1  49   ? 289.087 297.515 317.888 1.00 58.91  ? 49   GLU 1 N     1 
ATOM   234   C  CA    . GLU A  1  49   ? 288.030 298.116 317.079 1.00 58.91  ? 49   GLU 1 CA    1 
ATOM   235   C  C     . GLU A  1  49   ? 288.505 298.387 315.654 1.00 58.91  ? 49   GLU 1 C     1 
ATOM   236   O  O     . GLU A  1  49   ? 287.712 298.326 314.705 1.00 58.91  ? 49   GLU 1 O     1 
ATOM   237   C  CB    . GLU A  1  49   ? 287.510 299.397 317.747 1.00 58.91  ? 49   GLU 1 CB    1 
ATOM   238   N  N     . GLY A  1  50   ? 289.806 298.639 315.482 1.00 56.78  ? 50   GLY 1 N     1 
ATOM   239   C  CA    . GLY A  1  50   ? 290.325 298.947 314.159 1.00 56.78  ? 50   GLY 1 CA    1 
ATOM   240   C  C     . GLY A  1  50   ? 290.343 297.737 313.247 1.00 56.78  ? 50   GLY 1 C     1 
ATOM   241   O  O     . GLY A  1  50   ? 290.062 297.841 312.052 1.00 56.78  ? 50   GLY 1 O     1 
ATOM   242   N  N     . ASP A  1  51   ? 290.646 296.565 313.809 1.00 53.29  ? 51   ASP 1 N     1 
ATOM   243   C  CA    . ASP A  1  51   ? 290.646 295.341 313.015 1.00 53.29  ? 51   ASP 1 CA    1 
ATOM   244   C  C     . ASP A  1  51   ? 289.224 294.946 312.624 1.00 53.29  ? 51   ASP 1 C     1 
ATOM   245   O  O     . ASP A  1  51   ? 288.998 294.443 311.517 1.00 53.29  ? 51   ASP 1 O     1 
ATOM   246   C  CB    . ASP A  1  51   ? 291.337 294.222 313.796 1.00 53.29  ? 51   ASP 1 CB    1 
ATOM   247   N  N     . ILE A  1  52   ? 288.252 295.202 313.509 1.00 52.28  ? 52   ILE 1 N     1 
ATOM   248   C  CA    . ILE A  1  52   ? 286.844 294.951 313.196 1.00 52.28  ? 52   ILE 1 CA    1 
ATOM   249   C  C     . ILE A  1  52   ? 286.366 295.892 312.093 1.00 52.28  ? 52   ILE 1 C     1 
ATOM   250   O  O     . ILE A  1  52   ? 285.638 295.479 311.178 1.00 52.28  ? 52   ILE 1 O     1 
ATOM   251   C  CB    . ILE A  1  52   ? 285.986 295.067 314.474 1.00 52.28  ? 52   ILE 1 CB    1 
ATOM   252   N  N     . ILE A  1  53   ? 286.798 297.159 312.145 1.00 54.47  ? 53   ILE 1 N     1 
ATOM   253   C  CA    . ILE A  1  53   ? 286.498 298.105 311.069 1.00 54.47  ? 53   ILE 1 CA    1 
ATOM   254   C  C     . ILE A  1  53   ? 287.138 297.659 309.755 1.00 54.47  ? 53   ILE 1 C     1 
ATOM   255   O  O     . ILE A  1  53   ? 286.496 297.697 308.699 1.00 54.47  ? 53   ILE 1 O     1 
ATOM   256   C  CB    . ILE A  1  53   ? 286.935 299.528 311.477 1.00 54.47  ? 53   ILE 1 CB    1 
ATOM   257   N  N     . CYS A  1  54   ? 288.380 297.166 309.806 1.00 55.42  ? 54   CYS 1 N     1 
ATOM   258   C  CA    . CYS A  1  54   ? 289.059 296.729 308.587 1.00 55.42  ? 54   CYS 1 CA    1 
ATOM   259   C  C     . CYS A  1  54   ? 288.442 295.466 307.993 1.00 55.42  ? 54   CYS 1 C     1 
ATOM   260   O  O     . CYS A  1  54   ? 288.461 295.290 306.770 1.00 55.42  ? 54   CYS 1 O     1 
ATOM   261   C  CB    . CYS A  1  54   ? 290.549 296.506 308.858 1.00 55.42  ? 54   CYS 1 CB    1 
ATOM   262   N  N     . VAL A  1  55   ? 287.889 294.582 308.819 1.00 52.47  ? 55   VAL 1 N     1 
ATOM   263   C  CA    . VAL A  1  55   ? 287.324 293.341 308.288 1.00 52.47  ? 55   VAL 1 CA    1 
ATOM   264   C  C     . VAL A  1  55   ? 285.856 293.516 307.888 1.00 52.47  ? 55   VAL 1 C     1 
ATOM   265   O  O     . VAL A  1  55   ? 285.354 292.805 307.013 1.00 52.47  ? 55   VAL 1 O     1 
ATOM   266   C  CB    . VAL A  1  55   ? 287.534 292.180 309.297 1.00 52.47  ? 55   VAL 1 CB    1 
ATOM   267   N  N     . PHE A  1  56   ? 285.135 294.485 308.461 1.00 51.68  ? 56   PHE 1 N     1 
ATOM   268   C  CA    . PHE A  1  56   ? 283.748 294.693 308.054 1.00 51.68  ? 56   PHE 1 CA    1 
ATOM   269   C  C     . PHE A  1  56   ? 283.508 295.998 307.301 1.00 51.68  ? 56   PHE 1 C     1 
ATOM   270   O  O     . PHE A  1  56   ? 282.348 296.380 307.121 1.00 51.68  ? 56   PHE 1 O     1 
ATOM   271   C  CB    . PHE A  1  56   ? 282.809 294.631 309.264 1.00 51.68  ? 56   PHE 1 CB    1 
ATOM   272   N  N     . SER A  1  57   ? 284.554 296.690 306.856 1.00 56.25  ? 57   SER 1 N     1 
ATOM   273   C  CA    . SER A  1  57   ? 284.359 297.866 306.020 1.00 56.25  ? 57   SER 1 CA    1 
ATOM   274   C  C     . SER A  1  57   ? 284.370 297.548 304.532 1.00 56.25  ? 57   SER 1 C     1 
ATOM   275   O  O     . SER A  1  57   ? 284.416 298.480 303.722 1.00 56.25  ? 57   SER 1 O     1 
ATOM   276   C  CB    . SER A  1  57   ? 285.431 298.914 306.331 1.00 56.25  ? 57   SER 1 CB    1 
ATOM   277   N  N     . GLN A  1  58   ? 284.339 296.264 304.161 1.00 54.64  ? 58   GLN 1 N     1 
ATOM   278   C  CA    . GLN A  1  58   ? 284.338 295.872 302.755 1.00 54.64  ? 58   GLN 1 CA    1 
ATOM   279   C  C     . GLN A  1  58   ? 283.065 296.303 302.043 1.00 54.64  ? 58   GLN 1 C     1 
ATOM   280   O  O     . GLN A  1  58   ? 283.120 296.695 300.871 1.00 54.64  ? 58   GLN 1 O     1 
ATOM   281   C  CB    . GLN A  1  58   ? 284.519 294.354 302.643 1.00 54.64  ? 58   GLN 1 CB    1 
ATOM   282   N  N     . TYR A  1  59   ? 281.927 296.272 302.734 1.00 50.15  ? 59   TYR 1 N     1 
ATOM   283   C  CA    . TYR A  1  59   ? 280.641 296.610 302.137 1.00 50.15  ? 59   TYR 1 CA    1 
ATOM   284   C  C     . TYR A  1  59   ? 280.156 297.982 302.589 1.00 50.15  ? 59   TYR 1 C     1 
ATOM   285   O  O     . TYR A  1  59   ? 278.974 298.303 302.433 1.00 50.15  ? 59   TYR 1 O     1 
ATOM   286   C  CB    . TYR A  1  59   ? 279.607 295.533 302.472 1.00 50.15  ? 59   TYR 1 CB    1 
ATOM   287   N  N     . GLY A  1  60   ? 281.051 298.796 303.142 1.00 54.29  ? 60   GLY 1 N     1 
ATOM   288   C  CA    . GLY A  1  60   ? 280.694 300.095 303.673 1.00 54.29  ? 60   GLY 1 CA    1 
ATOM   289   C  C     . GLY A  1  60   ? 281.272 300.316 305.055 1.00 54.29  ? 60   GLY 1 C     1 
ATOM   290   O  O     . GLY A  1  60   ? 281.361 299.378 305.853 1.00 54.29  ? 60   GLY 1 O     1 
ATOM   291   N  N     . GLU A  1  61   ? 281.670 301.550 305.347 1.00 57.68  ? 61   GLU 1 N     1 
ATOM   292   C  CA    . GLU A  1  61   ? 282.270 301.863 306.636 1.00 57.68  ? 61   GLU 1 CA    1 
ATOM   293   C  C     . GLU A  1  61   ? 281.218 301.887 307.736 1.00 57.68  ? 61   GLU 1 C     1 
ATOM   294   O  O     . GLU A  1  61   ? 280.128 302.436 307.567 1.00 57.68  ? 61   GLU 1 O     1 
ATOM   295   C  CB    . GLU A  1  61   ? 283.004 303.206 306.563 1.00 57.68  ? 61   GLU 1 CB    1 
ATOM   296   N  N     . ILE A  1  62   ? 281.548 301.269 308.865 1.00 54.19  ? 62   ILE 1 N     1 
ATOM   297   C  CA    . ILE A  1  62   ? 280.680 301.289 310.035 1.00 54.19  ? 62   ILE 1 CA    1 
ATOM   298   C  C     . ILE A  1  62   ? 280.662 302.704 310.599 1.00 54.19  ? 62   ILE 1 C     1 
ATOM   299   O  O     . ILE A  1  62   ? 281.709 303.256 310.951 1.00 54.19  ? 62   ILE 1 O     1 
ATOM   300   C  CB    . ILE A  1  62   ? 281.142 300.283 311.100 1.00 54.19  ? 62   ILE 1 CB    1 
ATOM   301   N  N     . VAL A  1  63   ? 279.469 303.298 310.674 1.00 55.86  ? 63   VAL 1 N     1 
ATOM   302   C  CA    . VAL A  1  63   ? 279.339 304.640 311.235 1.00 55.86  ? 63   VAL 1 CA    1 
ATOM   303   C  C     . VAL A  1  63   ? 279.515 304.597 312.748 1.00 55.86  ? 63   VAL 1 C     1 
ATOM   304   O  O     . VAL A  1  63   ? 280.242 305.411 313.332 1.00 55.86  ? 63   VAL 1 O     1 
ATOM   305   C  CB    . VAL A  1  63   ? 277.985 305.258 310.840 1.00 55.86  ? 63   VAL 1 CB    1 
ATOM   306   N  N     . ASN A  1  64   ? 278.872 303.632 313.405 1.00 54.17  ? 64   ASN 1 N     1 
ATOM   307   C  CA    . ASN A  1  64   ? 278.872 303.558 314.866 1.00 54.17  ? 64   ASN 1 CA    1 
ATOM   308   C  C     . ASN A  1  64   ? 279.337 302.181 315.323 1.00 54.17  ? 64   ASN 1 C     1 
ATOM   309   O  O     . ASN A  1  64   ? 278.646 301.182 315.102 1.00 54.17  ? 64   ASN 1 O     1 
ATOM   310   C  CB    . ASN A  1  64   ? 277.486 303.874 315.431 1.00 54.17  ? 64   ASN 1 CB    1 
ATOM   311   N  N     . ILE A  1  65   ? 280.497 302.135 315.978 1.00 54.20  ? 65   ILE 1 N     1 
ATOM   312   C  CA    . ILE A  1  65   ? 281.021 300.903 316.551 1.00 54.20  ? 65   ILE 1 CA    1 
ATOM   313   C  C     . ILE A  1  65   ? 280.624 300.821 318.020 1.00 54.20  ? 65   ILE 1 C     1 
ATOM   314   O  O     . ILE A  1  65   ? 280.452 301.836 318.700 1.00 54.20  ? 65   ILE 1 O     1 
ATOM   315   C  CB    . ILE A  1  65   ? 282.557 300.806 316.367 1.00 54.20  ? 65   ILE 1 CB    1 
ATOM   316   N  N     . ASN A  1  66   ? 280.477 299.591 318.521 1.00 54.67  ? 66   ASN 1 N     1 
ATOM   317   C  CA    . ASN A  1  66   ? 280.242 299.387 319.952 1.00 54.67  ? 66   ASN 1 CA    1 
ATOM   318   C  C     . ASN A  1  66   ? 280.811 298.021 320.328 1.00 54.67  ? 66   ASN 1 C     1 
ATOM   319   O  O     . ASN A  1  66   ? 280.188 296.991 320.056 1.00 54.67  ? 66   ASN 1 O     1 
ATOM   320   C  CB    . ASN A  1  66   ? 278.760 299.487 320.291 1.00 54.67  ? 66   ASN 1 CB    1 
ATOM   321   N  N     . LEU A  1  67   ? 281.989 298.021 320.943 1.00 55.87  ? 67   LEU 1 N     1 
ATOM   322   C  CA    . LEU A  1  67   ? 282.532 296.807 321.531 1.00 55.87  ? 67   LEU 1 CA    1 
ATOM   323   C  C     . LEU A  1  67   ? 282.065 296.678 322.975 1.00 55.87  ? 67   LEU 1 C     1 
ATOM   324   O  O     . LEU A  1  67   ? 281.831 297.674 323.664 1.00 55.87  ? 67   LEU 1 O     1 
ATOM   325   C  CB    . LEU A  1  67   ? 284.061 296.813 321.478 1.00 55.87  ? 67   LEU 1 CB    1 
ATOM   326   N  N     . VAL A  1  68   ? 281.928 295.437 323.433 1.00 58.19  ? 68   VAL 1 N     1 
ATOM   327   C  CA    . VAL A  1  68   ? 281.518 295.178 324.824 1.00 58.19  ? 68   VAL 1 CA    1 
ATOM   328   C  C     . VAL A  1  68   ? 282.797 295.144 325.655 1.00 58.19  ? 68   VAL 1 C     1 
ATOM   329   O  O     . VAL A  1  68   ? 283.377 294.098 325.961 1.00 58.19  ? 68   VAL 1 O     1 
ATOM   330   C  CB    . VAL A  1  68   ? 280.651 293.916 324.954 1.00 58.19  ? 68   VAL 1 CB    1 
ATOM   331   N  N     . ARG A  1  69   ? 283.245 296.332 326.044 1.00 61.06  ? 69   ARG 1 N     1 
ATOM   332   C  CA    . ARG A  1  69   ? 284.375 296.451 326.950 1.00 61.06  ? 69   ARG 1 CA    1 
ATOM   333   C  C     . ARG A  1  69   ? 283.871 296.388 328.384 1.00 61.06  ? 69   ARG 1 C     1 
ATOM   334   O  O     . ARG A  1  69   ? 282.930 297.100 328.751 1.00 61.06  ? 69   ARG 1 O     1 
ATOM   335   C  CB    . ARG A  1  69   ? 285.129 297.755 326.697 1.00 61.06  ? 69   ARG 1 CB    1 
ATOM   336   N  N     . ASP A  1  70   ? 284.482 295.521 329.187 1.00 68.31  ? 70   ASP 1 N     1 
ATOM   337   C  CA    . ASP A  1  70   ? 284.063 295.366 330.571 1.00 68.31  ? 70   ASP 1 CA    1 
ATOM   338   C  C     . ASP A  1  70   ? 284.483 296.580 331.396 1.00 68.31  ? 70   ASP 1 C     1 
ATOM   339   O  O     . ASP A  1  70   ? 285.300 297.404 330.971 1.00 68.31  ? 70   ASP 1 O     1 
ATOM   340   C  CB    . ASP A  1  70   ? 284.647 294.088 331.167 1.00 68.31  ? 70   ASP 1 CB    1 
ATOM   341   N  N     . LYS A  1  71   ? 283.891 296.688 332.588 1.00 69.90  ? 71   LYS 1 N     1 
ATOM   342   C  CA    . LYS A  1  71   ? 284.031 297.864 333.440 1.00 69.90  ? 71   LYS 1 CA    1 
ATOM   343   C  C     . LYS A  1  71   ? 285.457 298.084 333.935 1.00 69.90  ? 71   LYS 1 C     1 
ATOM   344   O  O     . LYS A  1  71   ? 286.096 299.076 333.569 1.00 69.90  ? 71   LYS 1 O     1 
ATOM   345   C  CB    . LYS A  1  71   ? 283.080 297.757 334.634 1.00 69.90  ? 71   LYS 1 CB    1 
ATOM   346   N  N     . LYS A  1  72   ? 285.967 297.173 334.762 1.00 69.21  ? 72   LYS 1 N     1 
ATOM   347   C  CA    . LYS A  1  72   ? 287.285 297.348 335.361 1.00 69.21  ? 72   LYS 1 CA    1 
ATOM   348   C  C     . LYS A  1  72   ? 288.244 296.207 335.063 1.00 69.21  ? 72   LYS 1 C     1 
ATOM   349   O  O     . LYS A  1  72   ? 289.387 296.455 334.662 1.00 69.21  ? 72   LYS 1 O     1 
ATOM   350   C  CB    . LYS A  1  72   ? 287.144 297.532 336.881 1.00 69.21  ? 72   LYS 1 CB    1 
ATOM   351   N  N     . THR A  1  73   ? 287.815 294.956 335.246 1.00 69.20  ? 73   THR 1 N     1 
ATOM   352   C  CA    . THR A  1  73   ? 288.762 293.846 335.267 1.00 69.20  ? 73   THR 1 CA    1 
ATOM   353   C  C     . THR A  1  73   ? 288.913 293.161 333.913 1.00 69.20  ? 73   THR 1 C     1 
ATOM   354   O  O     . THR A  1  73   ? 289.855 292.384 333.725 1.00 69.20  ? 73   THR 1 O     1 
ATOM   355   C  CB    . THR A  1  73   ? 288.346 292.822 336.326 1.00 69.20  ? 73   THR 1 CB    1 
ATOM   356   N  N     . GLY A  1  74   ? 288.014 293.423 332.965 1.00 68.85  ? 74   GLY 1 N     1 
ATOM   357   C  CA    . GLY A  1  74   ? 288.035 292.761 331.681 1.00 68.85  ? 74   GLY 1 CA    1 
ATOM   358   C  C     . GLY A  1  74   ? 288.480 293.672 330.550 1.00 68.85  ? 74   GLY 1 C     1 
ATOM   359   O  O     . GLY A  1  74   ? 288.744 294.863 330.727 1.00 68.85  ? 74   GLY 1 O     1 
ATOM   360   N  N     . LYS A  1  75   ? 288.559 293.082 329.358 1.00 68.71  ? 75   LYS 1 N     1 
ATOM   361   C  CA    . LYS A  1  75   ? 288.955 293.813 328.161 1.00 68.71  ? 75   LYS 1 CA    1 
ATOM   362   C  C     . LYS A  1  75   ? 287.884 293.689 327.083 1.00 68.71  ? 75   LYS 1 C     1 
ATOM   363   O  O     . LYS A  1  75   ? 287.575 294.665 326.390 1.00 68.71  ? 75   LYS 1 O     1 
ATOM   364   C  CB    . LYS A  1  75   ? 290.301 293.298 327.644 1.00 68.71  ? 75   LYS 1 CB    1 
ATOM   365   N  N     . SER A  1  76   ? 287.304 292.498 326.950 1.00 63.02  ? 76   SER 1 N     1 
ATOM   366   C  CA    . SER A  1  76   ? 286.283 292.226 325.946 1.00 63.02  ? 76   SER 1 CA    1 
ATOM   367   C  C     . SER A  1  76   ? 285.495 290.997 326.370 1.00 63.02  ? 76   SER 1 C     1 
ATOM   368   O  O     . SER A  1  76   ? 285.907 290.261 327.271 1.00 63.02  ? 76   SER 1 O     1 
ATOM   369   C  CB    . SER A  1  76   ? 286.899 292.005 324.558 1.00 63.02  ? 76   SER 1 CB    1 
ATOM   370   N  N     . LYS A  1  77   ? 284.357 290.788 325.711 1.00 60.07  ? 77   LYS 1 N     1 
ATOM   371   C  CA    . LYS A  1  77   ? 283.511 289.623 325.940 1.00 60.07  ? 77   LYS 1 CA    1 
ATOM   372   C  C     . LYS A  1  77   ? 283.330 288.762 324.701 1.00 60.07  ? 77   LYS 1 C     1 
ATOM   373   O  O     . LYS A  1  77   ? 283.384 287.533 324.796 1.00 60.07  ? 77   LYS 1 O     1 
ATOM   374   C  CB    . LYS A  1  77   ? 282.135 290.063 326.457 1.00 60.07  ? 77   LYS 1 CB    1 
ATOM   375   N  N     . GLY A  1  78   ? 283.128 289.373 323.536 1.00 55.94  ? 78   GLY 1 N     1 
ATOM   376   C  CA    . GLY A  1  78   ? 282.964 288.622 322.308 1.00 55.94  ? 78   GLY 1 CA    1 
ATOM   377   C  C     . GLY A  1  78   ? 281.906 289.194 321.386 1.00 55.94  ? 78   GLY 1 C     1 
ATOM   378   O  O     . GLY A  1  78   ? 281.841 288.833 320.208 1.00 55.94  ? 78   GLY 1 O     1 
ATOM   379   N  N     . PHE A  1  79   ? 281.067 290.082 321.912 1.00 57.34  ? 79   PHE 1 N     1 
ATOM   380   C  CA    . PHE A  1  79   ? 279.987 290.660 321.127 1.00 57.34  ? 79   PHE 1 CA    1 
ATOM   381   C  C     . PHE A  1  79   ? 280.462 291.960 320.479 1.00 57.34  ? 79   PHE 1 C     1 
ATOM   382   O  O     . PHE A  1  79   ? 281.515 292.504 320.825 1.00 57.34  ? 79   PHE 1 O     1 
ATOM   383   C  CB    . PHE A  1  79   ? 278.758 290.909 322.003 1.00 57.34  ? 79   PHE 1 CB    1 
ATOM   384   N  N     . CYS A  1  80   ? 279.674 292.470 319.531 1.00 53.22  ? 80   CYS 1 N     1 
ATOM   385   C  CA    . CYS A  1  80   ? 279.941 293.760 318.899 1.00 53.22  ? 80   CYS 1 CA    1 
ATOM   386   C  C     . CYS A  1  80   ? 278.678 294.253 318.210 1.00 53.22  ? 80   CYS 1 C     1 
ATOM   387   O  O     . CYS A  1  80   ? 277.862 293.464 317.726 1.00 53.22  ? 80   CYS 1 O     1 
ATOM   388   C  CB    . CYS A  1  80   ? 281.085 293.686 317.882 1.00 53.22  ? 80   CYS 1 CB    1 
ATOM   389   N  N     . PHE A  1  81   ? 278.542 295.577 318.163 1.00 53.77  ? 81   PHE 1 N     1 
ATOM   390   C  CA    . PHE A  1  81   ? 277.500 296.260 317.413 1.00 53.77  ? 81   PHE 1 CA    1 
ATOM   391   C  C     . PHE A  1  81   ? 278.146 297.102 316.323 1.00 53.77  ? 81   PHE 1 C     1 
ATOM   392   O  O     . PHE A  1  81   ? 279.075 297.875 316.589 1.00 53.77  ? 81   PHE 1 O     1 
ATOM   393   C  CB    . PHE A  1  81   ? 276.664 297.184 318.307 1.00 53.77  ? 81   PHE 1 CB    1 
ATOM   394   N  N     . LEU A  1  82   ? 277.643 296.964 315.098 1.00 52.06  ? 82   LEU 1 N     1 
ATOM   395   C  CA    . LEU A  1  82   ? 278.144 297.775 313.995 1.00 52.06  ? 82   LEU 1 CA    1 
ATOM   396   C  C     . LEU A  1  82   ? 276.976 298.431 313.277 1.00 52.06  ? 82   LEU 1 C     1 
ATOM   397   O  O     . LEU A  1  82   ? 276.083 297.737 312.785 1.00 52.06  ? 82   LEU 1 O     1 
ATOM   398   C  CB    . LEU A  1  82   ? 278.959 296.938 313.002 1.00 52.06  ? 82   LEU 1 CB    1 
ATOM   399   N  N     . CYS A  1  83   ? 276.985 299.760 313.216 1.00 53.59  ? 83   CYS 1 N     1 
ATOM   400   C  CA    . CYS A  1  83   ? 275.971 300.530 312.505 1.00 53.59  ? 83   CYS 1 CA    1 
ATOM   401   C  C     . CYS A  1  83   ? 276.614 301.124 311.259 1.00 53.59  ? 83   CYS 1 C     1 
ATOM   402   O  O     . CYS A  1  83   ? 277.481 302.000 311.364 1.00 53.59  ? 83   CYS 1 O     1 
ATOM   403   C  CB    . CYS A  1  83   ? 275.383 301.621 313.396 1.00 53.59  ? 83   CYS 1 CB    1 
ATOM   404   N  N     . TYR A  1  84   ? 276.186 300.638 310.092 1.00 50.97  ? 84   TYR 1 N     1 
ATOM   405   C  CA    . TYR A  1  84   ? 276.679 301.059 308.788 1.00 50.97  ? 84   TYR 1 CA    1 
ATOM   406   C  C     . TYR A  1  84   ? 275.959 302.324 308.323 1.00 50.97  ? 84   TYR 1 C     1 
ATOM   407   O  O     . TYR A  1  84   ? 275.252 302.990 309.083 1.00 50.97  ? 84   TYR 1 O     1 
ATOM   408   C  CB    . TYR A  1  84   ? 276.481 299.947 307.759 1.00 50.97  ? 84   TYR 1 CB    1 
ATOM   409   N  N     . GLU A  1  85   ? 276.143 302.658 307.043 1.00 58.33  ? 85   GLU 1 N     1 
ATOM   410   C  CA    . GLU A  1  85   ? 275.355 303.725 306.434 1.00 58.33  ? 85   GLU 1 CA    1 
ATOM   411   C  C     . GLU A  1  85   ? 273.998 303.206 305.971 1.00 58.33  ? 85   GLU 1 C     1 
ATOM   412   O  O     . GLU A  1  85   ? 272.948 303.683 306.415 1.00 58.33  ? 85   GLU 1 O     1 
ATOM   413   C  CB    . GLU A  1  85   ? 276.103 304.349 305.253 1.00 58.33  ? 85   GLU 1 CB    1 
ATOM   414   N  N     . ASP A  1  86   ? 274.005 302.221 305.076 1.00 52.84  ? 86   ASP 1 N     1 
ATOM   415   C  CA    . ASP A  1  86   ? 272.809 301.781 304.372 1.00 52.84  ? 86   ASP 1 CA    1 
ATOM   416   C  C     . ASP A  1  86   ? 272.411 300.385 304.840 1.00 52.84  ? 86   ASP 1 C     1 
ATOM   417   O  O     . ASP A  1  86   ? 273.252 299.616 305.318 1.00 52.84  ? 86   ASP 1 O     1 
ATOM   418   C  CB    . ASP A  1  86   ? 273.052 301.790 302.858 1.00 52.84  ? 86   ASP 1 CB    1 
ATOM   419   N  N     . GLN A  1  87   ? 271.121 300.064 304.701 1.00 52.24  ? 87   GLN 1 N     1 
ATOM   420   C  CA    . GLN A  1  87   ? 270.609 298.784 305.182 1.00 52.24  ? 87   GLN 1 CA    1 
ATOM   421   C  C     . GLN A  1  87   ? 270.979 297.640 304.240 1.00 52.24  ? 87   GLN 1 C     1 
ATOM   422   O  O     . GLN A  1  87   ? 271.080 296.484 304.673 1.00 52.24  ? 87   GLN 1 O     1 
ATOM   423   C  CB    . GLN A  1  87   ? 269.092 298.889 305.374 1.00 52.24  ? 87   GLN 1 CB    1 
ATOM   424   N  N     . ARG A  1  88   ? 271.206 297.940 302.957 1.00 50.92  ? 88   ARG 1 N     1 
ATOM   425   C  CA    . ARG A  1  88   ? 271.674 296.916 302.029 1.00 50.92  ? 88   ARG 1 CA    1 
ATOM   426   C  C     . ARG A  1  88   ? 273.092 296.462 302.345 1.00 50.92  ? 88   ARG 1 C     1 
ATOM   427   O  O     . ARG A  1  88   ? 273.443 295.316 302.045 1.00 50.92  ? 88   ARG 1 O     1 
ATOM   428   C  CB    . ARG A  1  88   ? 271.595 297.425 300.590 1.00 50.92  ? 88   ARG 1 CB    1 
ATOM   429   N  N     . SER A  1  89   ? 273.902 297.328 302.963 1.00 49.97  ? 89   SER 1 N     1 
ATOM   430   C  CA    . SER A  1  89   ? 275.201 296.900 303.473 1.00 49.97  ? 89   SER 1 CA    1 
ATOM   431   C  C     . SER A  1  89   ? 275.040 295.873 304.586 1.00 49.97  ? 89   SER 1 C     1 
ATOM   432   O  O     . SER A  1  89   ? 275.815 294.914 304.671 1.00 49.97  ? 89   SER 1 O     1 
ATOM   433   C  CB    . SER A  1  89   ? 275.995 298.109 303.967 1.00 49.97  ? 89   SER 1 CB    1 
ATOM   434   N  N     . THR A  1  90   ? 274.016 296.038 305.429 1.00 48.88  ? 90   THR 1 N     1 
ATOM   435   C  CA    . THR A  1  90   ? 273.737 295.048 306.465 1.00 48.88  ? 90   THR 1 CA    1 
ATOM   436   C  C     . THR A  1  90   ? 273.213 293.751 305.861 1.00 48.88  ? 90   THR 1 C     1 
ATOM   437   O  O     . THR A  1  90   ? 273.507 292.661 306.369 1.00 48.88  ? 90   THR 1 O     1 
ATOM   438   C  CB    . THR A  1  90   ? 272.735 295.606 307.474 1.00 48.88  ? 90   THR 1 CB    1 
ATOM   439   N  N     . ILE A  1  91   ? 272.443 293.856 304.769 1.00 47.64  ? 91   ILE 1 N     1 
ATOM   440   C  CA    . ILE A  1  91   ? 271.983 292.675 304.032 1.00 47.64  ? 91   ILE 1 CA    1 
ATOM   441   C  C     . ILE A  1  91   ? 273.171 291.884 303.493 1.00 47.64  ? 91   ILE 1 C     1 
ATOM   442   O  O     . ILE A  1  91   ? 273.274 290.664 303.684 1.00 47.64  ? 91   ILE 1 O     1 
ATOM   443   C  CB    . ILE A  1  91   ? 271.035 293.091 302.891 1.00 47.64  ? 91   ILE 1 CB    1 
ATOM   444   N  N     . LEU A  1  92   ? 274.102 292.582 302.838 1.00 47.64  ? 92   LEU 1 N     1 
ATOM   445   C  CA    . LEU A  1  92   ? 275.265 291.915 302.261 1.00 47.64  ? 92   LEU 1 CA    1 
ATOM   446   C  C     . LEU A  1  92   ? 276.212 291.404 303.343 1.00 47.64  ? 92   LEU 1 C     1 
ATOM   447   O  O     . LEU A  1  92   ? 276.896 290.392 303.149 1.00 47.64  ? 92   LEU 1 O     1 
ATOM   448   C  CB    . LEU A  1  92   ? 275.993 292.865 301.311 1.00 47.64  ? 92   LEU 1 CB    1 
ATOM   449   N  N     . ALA A  1  93   ? 276.243 292.071 304.500 1.00 47.73  ? 93   ALA 1 N     1 
ATOM   450   C  CA    . ALA A  1  93   ? 277.110 291.628 305.587 1.00 47.73  ? 93   ALA 1 CA    1 
ATOM   451   C  C     . ALA A  1  93   ? 276.557 290.385 306.274 1.00 47.73  ? 93   ALA 1 C     1 
ATOM   452   O  O     . ALA A  1  93   ? 277.323 289.502 306.675 1.00 47.73  ? 93   ALA 1 O     1 
ATOM   453   C  CB    . ALA A  1  93   ? 277.305 292.757 306.597 1.00 47.73  ? 93   ALA 1 CB    1 
ATOM   454   N  N     . VAL A  1  94   ? 275.232 290.293 306.426 1.00 47.17  ? 94   VAL 1 N     1 
ATOM   455   C  CA    . VAL A  1  94   ? 274.672 289.092 307.033 1.00 47.17  ? 94   VAL 1 CA    1 
ATOM   456   C  C     . VAL A  1  94   ? 274.597 287.955 306.015 1.00 47.17  ? 94   VAL 1 C     1 
ATOM   457   O  O     . VAL A  1  94   ? 274.530 286.782 306.403 1.00 47.17  ? 94   VAL 1 O     1 
ATOM   458   C  CB    . VAL A  1  94   ? 273.298 289.403 307.671 1.00 47.17  ? 94   VAL 1 CB    1 
ATOM   459   N  N     . ASP A  1  95   ? 274.649 288.263 304.714 1.00 48.14  ? 95   ASP 1 N     1 
ATOM   460   C  CA    . ASP A  1  95   ? 274.635 287.198 303.718 1.00 48.14  ? 95   ASP 1 CA    1 
ATOM   461   C  C     . ASP A  1  95   ? 276.034 286.713 303.349 1.00 48.14  ? 95   ASP 1 C     1 
ATOM   462   O  O     . ASP A  1  95   ? 276.178 285.589 302.856 1.00 48.14  ? 95   ASP 1 O     1 
ATOM   463   C  CB    . ASP A  1  95   ? 273.897 287.664 302.461 1.00 48.14  ? 95   ASP 1 CB    1 
ATOM   464   N  N     . ASN A  1  96   ? 277.071 287.523 303.572 1.00 46.71  ? 96   ASN 1 N     1 
ATOM   465   C  CA    . ASN A  1  96   ? 278.408 287.189 303.088 1.00 46.71  ? 96   ASN 1 CA    1 
ATOM   466   C  C     . ASN A  1  96   ? 279.422 286.943 304.199 1.00 46.71  ? 96   ASN 1 C     1 
ATOM   467   O  O     . ASN A  1  96   ? 280.284 286.071 304.059 1.00 46.71  ? 96   ASN 1 O     1 
ATOM   468   C  CB    . ASN A  1  96   ? 278.916 288.297 302.162 1.00 46.71  ? 96   ASN 1 CB    1 
ATOM   469   N  N     . PHE A  1  97   ? 279.362 287.700 305.291 1.00 47.65  ? 97   PHE 1 N     1 
ATOM   470   C  CA    . PHE A  1  97   ? 280.332 287.536 306.369 1.00 47.65  ? 97   PHE 1 CA    1 
ATOM   471   C  C     . PHE A  1  97   ? 279.944 286.464 307.379 1.00 47.65  ? 97   PHE 1 C     1 
ATOM   472   O  O     . PHE A  1  97   ? 280.549 286.409 308.454 1.00 47.65  ? 97   PHE 1 O     1 
ATOM   473   C  CB    . PHE A  1  97   ? 280.556 288.862 307.100 1.00 47.65  ? 97   PHE 1 CB    1 
ATOM   474   N  N     . ASN A  1  98   ? 278.964 285.620 307.077 1.00 47.15  ? 98   ASN 1 N     1 
ATOM   475   C  CA    . ASN A  1  98   ? 278.570 284.559 307.990 1.00 47.15  ? 98   ASN 1 CA    1 
ATOM   476   C  C     . ASN A  1  98   ? 279.242 283.254 307.585 1.00 47.15  ? 98   ASN 1 C     1 
ATOM   477   O  O     . ASN A  1  98   ? 279.271 282.894 306.405 1.00 47.15  ? 98   ASN 1 O     1 
ATOM   478   C  CB    . ASN A  1  98   ? 277.051 284.389 308.000 1.00 47.15  ? 98   ASN 1 CB    1 
ATOM   479   N  N     . GLY A  1  99   ? 279.783 282.546 308.577 1.00 47.60  ? 99   GLY 1 N     1 
ATOM   480   C  CA    . GLY A  1  99   ? 280.450 281.284 308.347 1.00 47.60  ? 99   GLY 1 CA    1 
ATOM   481   C  C     . GLY A  1  99   ? 281.957 281.359 308.248 1.00 47.60  ? 99   GLY 1 C     1 
ATOM   482   O  O     . GLY A  1  99   ? 282.615 280.311 308.273 1.00 47.60  ? 99   GLY 1 O     1 
ATOM   483   N  N     . ILE A  1  100  ? 282.527 282.558 308.138 1.00 47.66  ? 100  ILE 1 N     1 
ATOM   484   C  CA    . ILE A  1  100  ? 283.972 282.720 308.035 1.00 47.66  ? 100  ILE 1 CA    1 
ATOM   485   C  C     . ILE A  1  100  ? 284.597 282.561 309.414 1.00 47.66  ? 100  ILE 1 C     1 
ATOM   486   O  O     . ILE A  1  100  ? 283.902 282.616 310.435 1.00 47.66  ? 100  ILE 1 O     1 
ATOM   487   C  CB    . ILE A  1  100  ? 284.341 284.081 307.417 1.00 47.66  ? 100  ILE 1 CB    1 
ATOM   488   N  N     . LYS A  1  101  ? 285.912 282.363 309.452 1.00 48.90  ? 101  LYS 1 N     1 
ATOM   489   C  CA    . LYS A  1  101  ? 286.639 282.211 310.704 1.00 48.90  ? 101  LYS 1 CA    1 
ATOM   490   C  C     . LYS A  1  101  ? 287.851 283.131 310.696 1.00 48.90  ? 101  LYS 1 C     1 
ATOM   491   O  O     . LYS A  1  101  ? 288.457 283.360 309.644 1.00 48.90  ? 101  LYS 1 O     1 
ATOM   492   C  CB    . LYS A  1  101  ? 287.053 280.748 310.930 1.00 48.90  ? 101  LYS 1 CB    1 
ATOM   493   N  N     . ILE A  1  102  ? 288.170 283.692 311.860 1.00 49.25  ? 102  ILE 1 N     1 
ATOM   494   C  CA    . ILE A  1  102  ? 289.335 284.554 312.041 1.00 49.25  ? 102  ILE 1 CA    1 
ATOM   495   C  C     . ILE A  1  102  ? 290.054 284.063 313.290 1.00 49.25  ? 102  ILE 1 C     1 
ATOM   496   O  O     . ILE A  1  102  ? 289.568 284.274 314.410 1.00 49.25  ? 102  ILE 1 O     1 
ATOM   497   C  CB    . ILE A  1  102  ? 288.969 286.045 312.171 1.00 49.25  ? 102  ILE 1 CB    1 
ATOM   498   N  N     . LYS A  1  103  ? 291.196 283.393 313.092 1.00 51.30  ? 103  LYS 1 N     1 
ATOM   499   C  CA    . LYS A  1  103  ? 292.076 282.878 314.151 1.00 51.30  ? 103  LYS 1 CA    1 
ATOM   500   C  C     . LYS A  1  103  ? 291.324 281.919 315.083 1.00 51.30  ? 103  LYS 1 C     1 
ATOM   501   O  O     . LYS A  1  103  ? 291.078 282.201 316.259 1.00 51.30  ? 103  LYS 1 O     1 
ATOM   502   C  CB    . LYS A  1  103  ? 292.743 284.028 314.923 1.00 51.30  ? 103  LYS 1 CB    1 
ATOM   503   N  N     . GLY A  1  104  ? 290.917 280.786 314.518 1.00 48.82  ? 104  GLY 1 N     1 
ATOM   504   C  CA    . GLY A  1  104  ? 290.266 279.762 315.312 1.00 48.82  ? 104  GLY 1 CA    1 
ATOM   505   C  C     . GLY A  1  104  ? 288.751 279.801 315.305 1.00 48.82  ? 104  GLY 1 C     1 
ATOM   506   O  O     . GLY A  1  104  ? 288.114 279.237 314.409 1.00 48.82  ? 104  GLY 1 O     1 
ATOM   507   N  N     . ARG A  1  105  ? 288.172 280.442 316.322 1.00 50.34  ? 105  ARG 1 N     1 
ATOM   508   C  CA    . ARG A  1  105  ? 286.730 280.420 316.538 1.00 50.34  ? 105  ARG 1 CA    1 
ATOM   509   C  C     . ARG A  1  105  ? 285.987 281.174 315.440 1.00 50.34  ? 105  ARG 1 C     1 
ATOM   510   O  O     . ARG A  1  105  ? 286.367 282.282 315.054 1.00 50.34  ? 105  ARG 1 O     1 
ATOM   511   C  CB    . ARG A  1  105  ? 286.408 281.031 317.905 1.00 50.34  ? 105  ARG 1 CB    1 
ATOM   512   N  N     . THR A  1  106  ? 284.918 280.557 314.941 1.00 49.25  ? 106  THR 1 N     1 
ATOM   513   C  CA    . THR A  1  106  ? 284.096 281.159 313.903 1.00 49.25  ? 106  THR 1 CA    1 
ATOM   514   C  C     . THR A  1  106  ? 283.185 282.228 314.496 1.00 49.25  ? 106  THR 1 C     1 
ATOM   515   O  O     . THR A  1  106  ? 282.914 282.247 315.700 1.00 49.25  ? 106  THR 1 O     1 
ATOM   516   C  CB    . THR A  1  106  ? 283.254 280.095 313.197 1.00 49.25  ? 106  THR 1 CB    1 
ATOM   517   N  N     . ILE A  1  107  ? 282.712 283.123 313.633 1.00 48.34  ? 107  ILE 1 N     1 
ATOM   518   C  CA    . ILE A  1  107  ? 281.884 284.245 314.047 1.00 48.34  ? 107  ILE 1 CA    1 
ATOM   519   C  C     . ILE A  1  107  ? 280.524 284.153 313.356 1.00 48.34  ? 107  ILE 1 C     1 
ATOM   520   O  O     . ILE A  1  107  ? 280.330 283.393 312.408 1.00 48.34  ? 107  ILE 1 O     1 
ATOM   521   C  CB    . ILE A  1  107  ? 282.581 285.601 313.782 1.00 48.34  ? 107  ILE 1 CB    1 
ATOM   522   N  N     . ARG A  1  108  ? 279.574 284.950 313.845 1.00 50.54  ? 108  ARG 1 N     1 
ATOM   523   C  CA    . ARG A  1  108  ? 278.234 284.994 313.279 1.00 50.54  ? 108  ARG 1 CA    1 
ATOM   524   C  C     . ARG A  1  108  ? 277.752 286.436 313.217 1.00 50.54  ? 108  ARG 1 C     1 
ATOM   525   O  O     . ARG A  1  108  ? 278.134 287.280 314.033 1.00 50.54  ? 108  ARG 1 O     1 
ATOM   526   C  CB    . ARG A  1  108  ? 277.244 284.136 314.082 1.00 50.54  ? 108  ARG 1 CB    1 
ATOM   527   N  N     . VAL A  1  109  ? 276.900 286.703 312.228 1.00 47.32  ? 109  VAL 1 N     1 
ATOM   528   C  CA    . VAL A  1  109  ? 276.331 288.025 311.993 1.00 47.32  ? 109  VAL 1 CA    1 
ATOM   529   C  C     . VAL A  1  109  ? 274.815 287.909 312.094 1.00 47.32  ? 109  VAL 1 C     1 
ATOM   530   O  O     . VAL A  1  109  ? 274.214 287.004 311.506 1.00 47.32  ? 109  VAL 1 O     1 
ATOM   531   C  CB    . VAL A  1  109  ? 276.749 288.586 310.614 1.00 47.32  ? 109  VAL 1 CB    1 
ATOM   532   N  N     . ASP A  1  110  ? 274.197 288.819 312.845 1.00 47.13  ? 110  ASP 1 N     1 
ATOM   533   C  CA    . ASP A  1  110  ? 272.745 288.841 312.977 1.00 47.13  ? 110  ASP 1 CA    1 
ATOM   534   C  C     . ASP A  1  110  ? 272.315 290.304 312.971 1.00 47.13  ? 110  ASP 1 C     1 
ATOM   535   O  O     . ASP A  1  110  ? 273.149 291.208 312.956 1.00 47.13  ? 110  ASP 1 O     1 
ATOM   536   C  CB    . ASP A  1  110  ? 272.300 288.106 314.251 1.00 47.13  ? 110  ASP 1 CB    1 
ATOM   537   N  N     . HIS A  1  111  ? 271.003 290.534 312.974 1.00 46.55  ? 111  HIS 1 N     1 
ATOM   538   C  CA    . HIS A  1  111  ? 270.483 291.892 313.031 1.00 46.55  ? 111  HIS 1 CA    1 
ATOM   539   C  C     . HIS A  1  111  ? 270.091 292.260 314.462 1.00 46.55  ? 111  HIS 1 C     1 
ATOM   540   O  O     . HIS A  1  111  ? 269.907 291.402 315.330 1.00 46.55  ? 111  HIS 1 O     1 
ATOM   541   C  CB    . HIS A  1  111  ? 269.298 292.048 312.081 1.00 46.55  ? 111  HIS 1 CB    1 
ATOM   542   N  N     . VAL A  1  112  ? 269.957 293.566 314.710 1.00 47.02  ? 112  VAL 1 N     1 
ATOM   543   C  CA    . VAL A  1  112  ? 269.550 294.100 316.005 1.00 47.02  ? 112  VAL 1 CA    1 
ATOM   544   C  C     . VAL A  1  112  ? 268.156 294.712 315.936 1.00 47.02  ? 112  VAL 1 C     1 
ATOM   545   O  O     . VAL A  1  112  ? 267.241 294.286 316.648 1.00 47.02  ? 112  VAL 1 O     1 
ATOM   546   C  CB    . VAL A  1  112  ? 270.571 295.134 316.533 1.00 47.02  ? 112  VAL 1 CB    1 
ATOM   547   N  N     . SER A  1  113  ? 267.992 295.746 315.110 1.00 48.22  ? 113  SER 1 N     1 
ATOM   548   C  CA    . SER A  1  113  ? 266.766 296.369 314.616 1.00 48.22  ? 113  SER 1 CA    1 
ATOM   549   C  C     . SER A  1  113  ? 266.008 297.189 315.664 1.00 48.22  ? 113  SER 1 C     1 
ATOM   550   O  O     . SER A  1  113  ? 265.022 297.832 315.303 1.00 48.22  ? 113  SER 1 O     1 
ATOM   551   C  CB    . SER A  1  113  ? 265.782 295.364 313.980 1.00 48.22  ? 113  SER 1 CB    1 
ATOM   552   N  N     . ASN A  1  114  ? 266.412 297.201 316.938 1.00 53.43  ? 114  ASN 1 N     1 
ATOM   553   C  CA    . ASN A  1  114  ? 265.689 297.993 317.932 1.00 53.43  ? 114  ASN 1 CA    1 
ATOM   554   C  C     . ASN A  1  114  ? 266.540 299.119 318.506 1.00 53.43  ? 114  ASN 1 C     1 
ATOM   555   O  O     . ASN A  1  114  ? 266.232 300.288 318.253 1.00 53.43  ? 114  ASN 1 O     1 
ATOM   556   C  CB    . ASN A  1  114  ? 265.168 297.075 319.040 1.00 53.43  ? 114  ASN 1 CB    1 
ATOM   557   N  N     . TYR A  1  115  ? 267.642 298.808 319.193 1.00 55.60  ? 115  TYR 1 N     1 
ATOM   558   C  CA    . TYR A  1  115  ? 268.462 299.749 319.958 1.00 55.60  ? 115  TYR 1 CA    1 
ATOM   559   C  C     . TYR A  1  115  ? 269.631 298.950 320.531 1.00 55.60  ? 115  TYR 1 C     1 
ATOM   560   O  O     . TYR A  1  115  ? 269.559 297.725 320.660 1.00 55.60  ? 115  TYR 1 O     1 
ATOM   561   C  CB    . TYR A  1  115  ? 267.657 300.443 321.077 1.00 55.60  ? 115  TYR 1 CB    1 
ATOM   562   N  N     . ARG A  1  116  ? 270.710 299.656 320.875 1.00 59.06  ? 116  ARG 1 N     1 
ATOM   563   C  CA    . ARG A  1  116  ? 271.886 299.006 321.447 1.00 59.06  ? 116  ARG 1 CA    1 
ATOM   564   C  C     . ARG A  1  116  ? 271.663 298.650 322.915 1.00 59.06  ? 116  ARG 1 C     1 
ATOM   565   O  O     . ARG A  1  116  ? 271.006 299.391 323.654 1.00 59.06  ? 116  ARG 1 O     1 
ATOM   566   C  CB    . ARG A  1  116  ? 273.130 299.891 321.277 1.00 59.06  ? 116  ARG 1 CB    1 
ATOM   567   N  N     . ALA A  1  117  ? 272.179 297.499 323.342 1.00 63.09  ? 117  ALA 1 N     1 
ATOM   568   C  CA    . ALA A  1  117  ? 272.029 297.059 324.720 1.00 63.09  ? 117  ALA 1 CA    1 
ATOM   569   C  C     . ALA A  1  117  ? 273.382 296.635 325.269 1.00 63.09  ? 117  ALA 1 C     1 
ATOM   570   O  O     . ALA A  1  117  ? 274.198 296.087 324.513 1.00 63.09  ? 117  ALA 1 O     1 
ATOM   571   C  CB    . ALA A  1  117  ? 271.031 295.908 324.811 1.00 63.09  ? 117  ALA 1 CB    1 
ATOM   572   N  N     . PRO A  1  118  ? 273.678 296.883 326.551 1.00 72.03  ? 118  PRO 1 N     1 
ATOM   573   C  CA    . PRO A  1  118  ? 274.973 296.441 327.101 1.00 72.03  ? 118  PRO 1 CA    1 
ATOM   574   C  C     . PRO A  1  118  ? 275.118 294.930 327.186 1.00 72.03  ? 118  PRO 1 C     1 
ATOM   575   O  O     . PRO A  1  118  ? 276.129 294.385 326.725 1.00 72.03  ? 118  PRO 1 O     1 
ATOM   576   C  CB    . PRO A  1  118  ? 274.999 297.094 328.491 1.00 72.03  ? 118  PRO 1 CB    1 
ATOM   577   N  N     . LYS A  1  119  ? 274.131 294.233 327.759 1.00 68.67  ? 119  LYS 1 N     1 
ATOM   578   C  CA    . LYS A  1  119  ? 274.145 292.769 327.772 1.00 68.67  ? 119  LYS 1 CA    1 
ATOM   579   C  C     . LYS A  1  119  ? 272.699 292.261 327.773 1.00 68.67  ? 119  LYS 1 C     1 
ATOM   580   O  O     . LYS A  1  119  ? 271.963 292.453 328.746 1.00 68.67  ? 119  LYS 1 O     1 
ATOM   581   C  CB    . LYS A  1  119  ? 274.968 292.222 328.940 1.00 68.67  ? 119  LYS 1 CB    1 
ATOM   582   N  N     . ASP A  1  120  ? 272.287 291.679 326.648 1.00 68.30  ? 120  ASP 1 N     1 
ATOM   583   C  CA    . ASP A  1  120  ? 271.001 290.998 326.562 1.00 68.30  ? 120  ASP 1 CA    1 
ATOM   584   C  C     . ASP A  1  120  ? 271.126 289.686 325.795 1.00 68.30  ? 120  ASP 1 C     1 
ATOM   585   O  O     . ASP A  1  120  ? 270.291 288.787 325.944 1.00 68.30  ? 120  ASP 1 O     1 
ATOM   586   C  CB    . ASP A  1  120  ? 269.949 291.909 325.919 1.00 68.30  ? 120  ASP 1 CB    1 
ATOM   587   N  N     . SER A  1  121  ? 272.173 289.571 324.981 1.00 59.07  ? 121  SER 1 N     1 
ATOM   588   C  CA    . SER A  1  121  ? 272.310 288.465 324.042 1.00 59.07  ? 121  SER 1 CA    1 
ATOM   589   C  C     . SER A  1  121  ? 272.849 287.223 324.751 1.00 59.07  ? 121  SER 1 C     1 
ATOM   590   O  O     . SER A  1  121  ? 272.930 287.155 325.981 1.00 59.07  ? 121  SER 1 O     1 
ATOM   591   C  CB    . SER A  1  121  ? 273.197 288.873 322.870 1.00 59.07  ? 121  SER 1 CB    1 
ATOM   592   N  N     . GLU A  1  122  ? 273.235 286.220 323.965 1.00 59.17  ? 122  GLU 1 N     1 
ATOM   593   C  CA    . GLU A  1  122  ? 273.537 284.887 324.472 1.00 59.17  ? 122  GLU 1 CA    1 
ATOM   594   C  C     . GLU A  1  122  ? 274.988 284.547 324.146 1.00 59.17  ? 122  GLU 1 C     1 
ATOM   595   O  O     . GLU A  1  122  ? 275.365 284.455 322.973 1.00 59.17  ? 122  GLU 1 O     1 
ATOM   596   C  CB    . GLU A  1  122  ? 272.577 283.858 323.875 1.00 59.17  ? 122  GLU 1 CB    1 
ATOM   597   N  N     . GLU A  1  123  ? 275.796 284.366 325.185 1.00 64.92  ? 123  GLU 1 N     1 
ATOM   598   C  CA    . GLU A  1  123  ? 277.210 284.054 325.024 1.00 64.92  ? 123  GLU 1 CA    1 
ATOM   599   C  C     . GLU A  1  123  ? 277.397 282.559 324.780 1.00 64.92  ? 123  GLU 1 C     1 
ATOM   600   O  O     . GLU A  1  123  ? 277.541 282.121 323.638 1.00 64.92  ? 123  GLU 1 O     1 
ATOM   601   C  CB    . GLU A  1  123  ? 277.995 284.514 326.260 1.00 64.92  ? 123  GLU 1 CB    1 
ATOM   602   P  P     . C   B  2  3    ? 259.827 178.437 238.457 1.00 138.38 ? 3    C   2 P     1 
ATOM   603   O  OP1   . C   B  2  3    ? 260.182 179.631 239.264 1.00 138.38 ? 3    C   2 OP1   1 
ATOM   604   O  OP2   . C   B  2  3    ? 259.260 178.616 237.096 1.00 138.38 ? 3    C   2 OP2   1 
ATOM   605   O  "O5'" . C   B  2  3    ? 261.125 177.524 238.327 1.00 138.38 ? 3    C   2 "O5'" 1 
ATOM   606   C  "C5'" . C   B  2  3    ? 262.108 177.493 239.351 1.00 138.38 ? 3    C   2 "C5'" 1 
ATOM   607   C  "C4'" . C   B  2  3    ? 263.497 177.647 238.784 1.00 138.38 ? 3    C   2 "C4'" 1 
ATOM   608   O  "O4'" . C   B  2  3    ? 263.664 176.748 237.656 1.00 138.38 ? 3    C   2 "O4'" 1 
ATOM   609   C  "C3'" . C   B  2  3    ? 263.832 179.020 238.218 1.00 138.38 ? 3    C   2 "C3'" 1 
ATOM   610   O  "O3'" . C   B  2  3    ? 264.227 179.944 239.218 1.00 138.38 ? 3    C   2 "O3'" 1 
ATOM   611   C  "C2'" . C   B  2  3    ? 264.932 178.710 237.211 1.00 138.38 ? 3    C   2 "C2'" 1 
ATOM   612   O  "O2'" . C   B  2  3    ? 266.182 178.552 237.866 1.00 138.38 ? 3    C   2 "O2'" 1 
ATOM   613   C  "C1'" . C   B  2  3    ? 264.490 177.344 236.677 1.00 138.38 ? 3    C   2 "C1'" 1 
ATOM   614   N  N1    . C   B  2  3    ? 263.735 177.432 235.400 1.00 138.38 ? 3    C   2 N1    1 
ATOM   615   C  C2    . C   B  2  3    ? 264.399 177.681 234.186 1.00 138.38 ? 3    C   2 C2    1 
ATOM   616   O  O2    . C   B  2  3    ? 265.626 177.858 234.145 1.00 138.38 ? 3    C   2 O2    1 
ATOM   617   N  N3    . C   B  2  3    ? 263.683 177.754 233.039 1.00 138.38 ? 3    C   2 N3    1 
ATOM   618   C  C4    . C   B  2  3    ? 262.362 177.569 233.056 1.00 138.38 ? 3    C   2 C4    1 
ATOM   619   N  N4    . C   B  2  3    ? 261.705 177.646 231.898 1.00 138.38 ? 3    C   2 N4    1 
ATOM   620   C  C5    . C   B  2  3    ? 261.658 177.304 234.263 1.00 138.38 ? 3    C   2 C5    1 
ATOM   621   C  C6    . C   B  2  3    ? 262.379 177.241 235.387 1.00 138.38 ? 3    C   2 C6    1 
ATOM   622   P  P     . G   B  2  4    ? 263.654 181.446 239.213 1.00 140.73 ? 4    G   2 P     1 
ATOM   623   O  OP1   . G   B  2  4    ? 263.647 181.941 240.613 1.00 140.73 ? 4    G   2 OP1   1 
ATOM   624   O  OP2   . G   B  2  4    ? 262.394 181.452 238.427 1.00 140.73 ? 4    G   2 OP2   1 
ATOM   625   O  "O5'" . G   B  2  4    ? 264.741 182.281 238.400 1.00 140.73 ? 4    G   2 "O5'" 1 
ATOM   626   C  "C5'" . G   B  2  4    ? 266.092 182.354 238.834 1.00 140.73 ? 4    G   2 "C5'" 1 
ATOM   627   C  "C4'" . G   B  2  4    ? 267.015 182.698 237.692 1.00 140.73 ? 4    G   2 "C4'" 1 
ATOM   628   O  "O4'" . G   B  2  4    ? 266.857 181.713 236.637 1.00 140.73 ? 4    G   2 "O4'" 1 
ATOM   629   C  "C3'" . G   B  2  4    ? 266.752 184.032 237.005 1.00 140.73 ? 4    G   2 "C3'" 1 
ATOM   630   O  "O3'" . G   B  2  4    ? 267.367 185.124 237.670 1.00 140.73 ? 4    G   2 "O3'" 1 
ATOM   631   C  "C2'" . G   B  2  4    ? 267.286 183.802 235.598 1.00 140.73 ? 4    G   2 "C2'" 1 
ATOM   632   O  "O2'" . G   B  2  4    ? 268.701 183.918 235.573 1.00 140.73 ? 4    G   2 "O2'" 1 
ATOM   633   C  "C1'" . G   B  2  4    ? 266.919 182.337 235.374 1.00 140.73 ? 4    G   2 "C1'" 1 
ATOM   634   N  N9    . G   B  2  4    ? 265.603 182.184 234.727 1.00 140.73 ? 4    G   2 N9    1 
ATOM   635   C  C8    . G   B  2  4    ? 264.461 181.708 235.323 1.00 140.73 ? 4    G   2 C8    1 
ATOM   636   N  N7    . G   B  2  4    ? 263.435 181.670 234.522 1.00 140.73 ? 4    G   2 N7    1 
ATOM   637   C  C5    . G   B  2  4    ? 263.931 182.148 233.320 1.00 140.73 ? 4    G   2 C5    1 
ATOM   638   C  C6    . G   B  2  4    ? 263.277 182.335 232.079 1.00 140.73 ? 4    G   2 C6    1 
ATOM   639   O  O6    . G   B  2  4    ? 262.097 182.107 231.794 1.00 140.73 ? 4    G   2 O6    1 
ATOM   640   N  N1    . G   B  2  4    ? 264.144 182.841 231.117 1.00 140.73 ? 4    G   2 N1    1 
ATOM   641   C  C2    . G   B  2  4    ? 265.471 183.132 231.321 1.00 140.73 ? 4    G   2 C2    1 
ATOM   642   N  N2    . G   B  2  4    ? 266.141 183.613 230.265 1.00 140.73 ? 4    G   2 N2    1 
ATOM   643   N  N3    . G   B  2  4    ? 266.094 182.961 232.475 1.00 140.73 ? 4    G   2 N3    1 
ATOM   644   C  C4    . G   B  2  4    ? 265.269 182.469 233.424 1.00 140.73 ? 4    G   2 C4    1 
ATOM   645   P  P     . C   B  2  5    ? 266.629 186.550 237.750 1.00 139.54 ? 5    C   2 P     1 
ATOM   646   O  OP1   . C   B  2  5    ? 267.393 187.409 238.689 1.00 139.54 ? 5    C   2 OP1   1 
ATOM   647   O  OP2   . C   B  2  5    ? 265.184 186.304 237.989 1.00 139.54 ? 5    C   2 OP2   1 
ATOM   648   O  "O5'" . C   B  2  5    ? 266.788 187.158 236.285 1.00 139.54 ? 5    C   2 "O5'" 1 
ATOM   649   C  "C5'" . C   B  2  5    ? 268.062 187.526 235.773 1.00 139.54 ? 5    C   2 "C5'" 1 
ATOM   650   C  "C4'" . C   B  2  5    ? 267.987 187.849 234.301 1.00 139.54 ? 5    C   2 "C4'" 1 
ATOM   651   O  "O4'" . C   B  2  5    ? 267.446 186.706 233.586 1.00 139.54 ? 5    C   2 "O4'" 1 
ATOM   652   C  "C3'" . C   B  2  5    ? 267.063 188.999 233.921 1.00 139.54 ? 5    C   2 "C3'" 1 
ATOM   653   O  "O3'" . C   B  2  5    ? 267.673 190.270 234.071 1.00 139.54 ? 5    C   2 "O3'" 1 
ATOM   654   C  "C2'" . C   B  2  5    ? 266.687 188.672 232.482 1.00 139.54 ? 5    C   2 "C2'" 1 
ATOM   655   O  "O2'" . C   B  2  5    ? 267.718 189.071 231.590 1.00 139.54 ? 5    C   2 "O2'" 1 
ATOM   656   C  "C1'" . C   B  2  5    ? 266.639 187.141 232.512 1.00 139.54 ? 5    C   2 "C1'" 1 
ATOM   657   N  N1    . C   B  2  5    ? 265.266 186.604 232.694 1.00 139.54 ? 5    C   2 N1    1 
ATOM   658   C  C2    . C   B  2  5    ? 264.387 186.544 231.604 1.00 139.54 ? 5    C   2 C2    1 
ATOM   659   O  O2    . C   B  2  5    ? 264.738 186.953 230.488 1.00 139.54 ? 5    C   2 O2    1 
ATOM   660   N  N3    . C   B  2  5    ? 263.138 186.051 231.780 1.00 139.54 ? 5    C   2 N3    1 
ATOM   661   C  C4    . C   B  2  5    ? 262.751 185.609 232.977 1.00 139.54 ? 5    C   2 C4    1 
ATOM   662   N  N4    . C   B  2  5    ? 261.511 185.128 233.100 1.00 139.54 ? 5    C   2 N4    1 
ATOM   663   C  C5    . C   B  2  5    ? 263.618 185.646 234.104 1.00 139.54 ? 5    C   2 C5    1 
ATOM   664   C  C6    . C   B  2  5    ? 264.847 186.138 233.914 1.00 139.54 ? 5    C   2 C6    1 
ATOM   665   P  P     . U   B  2  6    ? 266.814 191.530 234.583 1.00 138.41 ? 6    U   2 P     1 
ATOM   666   O  OP1   . U   B  2  6    ? 267.761 192.547 235.108 1.00 138.41 ? 6    U   2 OP1   1 
ATOM   667   O  OP2   . U   B  2  6    ? 265.730 191.017 235.458 1.00 138.41 ? 6    U   2 OP2   1 
ATOM   668   O  "O5'" . U   B  2  6    ? 266.144 192.116 233.261 1.00 138.41 ? 6    U   2 "O5'" 1 
ATOM   669   C  "C5'" . U   B  2  6    ? 266.916 192.807 232.288 1.00 138.41 ? 6    U   2 "C5'" 1 
ATOM   670   C  "C4'" . U   B  2  6    ? 266.107 193.104 231.050 1.00 138.41 ? 6    U   2 "C4'" 1 
ATOM   671   O  "O4'" . U   B  2  6    ? 265.577 191.863 230.510 1.00 138.41 ? 6    U   2 "O4'" 1 
ATOM   672   C  "C3'" . U   B  2  6    ? 264.875 193.975 231.250 1.00 138.41 ? 6    U   2 "C3'" 1 
ATOM   673   O  "O3'" . U   B  2  6    ? 265.171 195.361 231.290 1.00 138.41 ? 6    U   2 "O3'" 1 
ATOM   674   C  "C2'" . U   B  2  6    ? 263.986 193.576 230.079 1.00 138.41 ? 6    U   2 "C2'" 1 
ATOM   675   O  "O2'" . U   B  2  6    ? 264.405 194.225 228.888 1.00 138.41 ? 6    U   2 "O2'" 1 
ATOM   676   C  "C1'" . U   B  2  6    ? 264.298 192.083 229.951 1.00 138.41 ? 6    U   2 "C1'" 1 
ATOM   677   N  N1    . U   B  2  6    ? 263.311 191.225 230.657 1.00 138.41 ? 6    U   2 N1    1 
ATOM   678   C  C2    . U   B  2  6    ? 262.079 190.984 230.064 1.00 138.41 ? 6    U   2 C2    1 
ATOM   679   O  O2    . U   B  2  6    ? 261.743 191.443 228.985 1.00 138.41 ? 6    U   2 O2    1 
ATOM   680   N  N3    . U   B  2  6    ? 261.233 190.175 230.787 1.00 138.41 ? 6    U   2 N3    1 
ATOM   681   C  C4    . U   B  2  6    ? 261.486 189.590 232.014 1.00 138.41 ? 6    U   2 C4    1 
ATOM   682   O  O4    . U   B  2  6    ? 260.636 188.881 232.552 1.00 138.41 ? 6    U   2 O4    1 
ATOM   683   C  C5    . U   B  2  6    ? 262.774 189.878 232.557 1.00 138.41 ? 6    U   2 C5    1 
ATOM   684   C  C6    . U   B  2  6    ? 263.613 190.657 231.875 1.00 138.41 ? 6    U   2 C6    1 
ATOM   685   P  P     . U   B  2  7    ? 264.295 196.351 232.206 1.00 126.97 ? 7    U   2 P     1 
ATOM   686   O  OP1   . U   B  2  7    ? 264.947 197.686 232.190 1.00 126.97 ? 7    U   2 OP1   1 
ATOM   687   O  OP2   . U   B  2  7    ? 264.044 195.672 233.503 1.00 126.97 ? 7    U   2 OP2   1 
ATOM   688   O  "O5'" . U   B  2  7    ? 262.904 196.473 231.437 1.00 126.97 ? 7    U   2 "O5'" 1 
ATOM   689   C  "C5'" . U   B  2  7    ? 262.809 197.167 230.201 1.00 126.97 ? 7    U   2 "C5'" 1 
ATOM   690   C  "C4'" . U   B  2  7    ? 261.455 196.979 229.561 1.00 126.97 ? 7    U   2 "C4'" 1 
ATOM   691   O  "O4'" . U   B  2  7    ? 261.205 195.564 229.352 1.00 126.97 ? 7    U   2 "O4'" 1 
ATOM   692   C  "C3'" . U   B  2  7    ? 260.259 197.448 230.376 1.00 126.97 ? 7    U   2 "C3'" 1 
ATOM   693   O  "O3'" . U   B  2  7    ? 260.037 198.845 230.284 1.00 126.97 ? 7    U   2 "O3'" 1 
ATOM   694   C  "C2'" . U   B  2  7    ? 259.119 196.612 229.809 1.00 126.97 ? 7    U   2 "C2'" 1 
ATOM   695   O  "O2'" . U   B  2  7    ? 258.652 197.163 228.586 1.00 126.97 ? 7    U   2 "O2'" 1 
ATOM   696   C  "C1'" . U   B  2  7    ? 259.827 195.289 229.503 1.00 126.97 ? 7    U   2 "C1'" 1 
ATOM   697   N  N1    . U   B  2  7    ? 259.648 194.277 230.575 1.00 126.97 ? 7    U   2 N1    1 
ATOM   698   C  C2    . U   B  2  7    ? 258.462 193.559 230.620 1.00 126.97 ? 7    U   2 C2    1 
ATOM   699   O  O2    . U   B  2  7    ? 257.548 193.717 229.826 1.00 126.97 ? 7    U   2 O2    1 
ATOM   700   N  N3    . U   B  2  7    ? 258.371 192.636 231.635 1.00 126.97 ? 7    U   2 N3    1 
ATOM   701   C  C4    . U   B  2  7    ? 259.330 192.360 232.591 1.00 126.97 ? 7    U   2 C4    1 
ATOM   702   O  O4    . U   B  2  7    ? 259.121 191.502 233.450 1.00 126.97 ? 7    U   2 O4    1 
ATOM   703   C  C5    . U   B  2  7    ? 260.525 193.135 232.478 1.00 126.97 ? 7    U   2 C5    1 
ATOM   704   C  C6    . U   B  2  7    ? 260.639 194.037 231.500 1.00 126.97 ? 7    U   2 C6    1 
ATOM   705   P  P     . C   B  2  8    ? 259.376 199.645 231.512 1.00 118.58 ? 8    C   2 P     1 
ATOM   706   O  OP1   . C   B  2  8    ? 259.555 201.098 231.264 1.00 118.58 ? 8    C   2 OP1   1 
ATOM   707   O  OP2   . C   B  2  8    ? 259.884 199.048 232.774 1.00 118.58 ? 8    C   2 OP2   1 
ATOM   708   O  "O5'" . C   B  2  8    ? 257.821 199.314 231.403 1.00 118.58 ? 8    C   2 "O5'" 1 
ATOM   709   C  "C5'" . C   B  2  8    ? 257.062 199.722 230.274 1.00 118.58 ? 8    C   2 "C5'" 1 
ATOM   710   C  "C4'" . C   B  2  8    ? 255.718 199.038 230.238 1.00 118.58 ? 8    C   2 "C4'" 1 
ATOM   711   O  "O4'" . C   B  2  8    ? 255.905 197.598 230.251 1.00 118.58 ? 8    C   2 "O4'" 1 
ATOM   712   C  "C3'" . C   B  2  8    ? 254.807 199.302 231.428 1.00 118.58 ? 8    C   2 "C3'" 1 
ATOM   713   O  "O3'" . C   B  2  8    ? 254.107 200.531 231.332 1.00 118.58 ? 8    C   2 "O3'" 1 
ATOM   714   C  "C2'" . C   B  2  8    ? 253.897 198.080 231.433 1.00 118.58 ? 8    C   2 "C2'" 1 
ATOM   715   O  "O2'" . C   B  2  8    ? 252.866 198.215 230.468 1.00 118.58 ? 8    C   2 "O2'" 1 
ATOM   716   C  "C1'" . C   B  2  8    ? 254.855 196.979 230.967 1.00 118.58 ? 8    C   2 "C1'" 1 
ATOM   717   N  N1    . C   B  2  8    ? 255.430 196.196 232.093 1.00 118.58 ? 8    C   2 N1    1 
ATOM   718   C  C2    . C   B  2  8    ? 254.680 195.161 232.675 1.00 118.58 ? 8    C   2 C2    1 
ATOM   719   O  O2    . C   B  2  8    ? 253.543 194.912 232.246 1.00 118.58 ? 8    C   2 O2    1 
ATOM   720   N  N3    . C   B  2  8    ? 255.214 194.446 233.695 1.00 118.58 ? 8    C   2 N3    1 
ATOM   721   C  C4    . C   B  2  8    ? 256.440 194.724 234.142 1.00 118.58 ? 8    C   2 C4    1 
ATOM   722   N  N4    . C   B  2  8    ? 256.933 194.000 235.150 1.00 118.58 ? 8    C   2 N4    1 
ATOM   723   C  C5    . C   B  2  8    ? 257.227 195.764 233.573 1.00 118.58 ? 8    C   2 C5    1 
ATOM   724   C  C6    . C   B  2  8    ? 256.690 196.458 232.564 1.00 118.58 ? 8    C   2 C6    1 
ATOM   725   P  P     . U   B  2  9    ? 253.769 201.373 232.659 1.00 119.64 ? 9    U   2 P     1 
ATOM   726   O  OP1   . U   B  2  9    ? 253.344 202.733 232.243 1.00 119.64 ? 9    U   2 OP1   1 
ATOM   727   O  OP2   . U   B  2  9    ? 254.905 201.215 233.602 1.00 119.64 ? 9    U   2 OP2   1 
ATOM   728   O  "O5'" . U   B  2  9    ? 252.505 200.629 233.282 1.00 119.64 ? 9    U   2 "O5'" 1 
ATOM   729   C  "C5'" . U   B  2  9    ? 251.246 200.654 232.624 1.00 119.64 ? 9    U   2 "C5'" 1 
ATOM   730   C  "C4'" . U   B  2  9    ? 250.296 199.634 233.201 1.00 119.64 ? 9    U   2 "C4'" 1 
ATOM   731   O  "O4'" . U   B  2  9    ? 250.891 198.312 233.122 1.00 119.64 ? 9    U   2 "O4'" 1 
ATOM   732   C  "C3'" . U   B  2  9    ? 249.953 199.793 234.675 1.00 119.64 ? 9    U   2 "C3'" 1 
ATOM   733   O  "O3'" . U   B  2  9    ? 248.957 200.772 234.916 1.00 119.64 ? 9    U   2 "O3'" 1 
ATOM   734   C  "C2'" . U   B  2  9    ? 249.532 198.384 235.073 1.00 119.64 ? 9    U   2 "C2'" 1 
ATOM   735   O  "O2'" . U   B  2  9    ? 248.199 198.123 234.659 1.00 119.64 ? 9    U   2 "O2'" 1 
ATOM   736   C  "C1'" . U   B  2  9    ? 250.477 197.530 234.223 1.00 119.64 ? 9    U   2 "C1'" 1 
ATOM   737   N  N1    . U   B  2  9    ? 251.674 197.076 234.977 1.00 119.64 ? 9    U   2 N1    1 
ATOM   738   C  C2    . U   B  2  9    ? 251.544 195.960 235.786 1.00 119.64 ? 9    U   2 C2    1 
ATOM   739   O  O2    . U   B  2  9    ? 250.503 195.338 235.913 1.00 119.64 ? 9    U   2 O2    1 
ATOM   740   N  N3    . U   B  2  9    ? 252.686 195.591 236.453 1.00 119.64 ? 9    U   2 N3    1 
ATOM   741   C  C4    . U   B  2  9    ? 253.923 196.198 236.396 1.00 119.64 ? 9    U   2 C4    1 
ATOM   742   O  O4    . U   B  2  9    ? 254.854 195.741 237.060 1.00 119.64 ? 9    U   2 O4    1 
ATOM   743   C  C5    . U   B  2  9    ? 253.982 197.341 235.541 1.00 119.64 ? 9    U   2 C5    1 
ATOM   744   C  C6    . U   B  2  9    ? 252.886 197.724 234.881 1.00 119.64 ? 9    U   2 C6    1 
ATOM   745   P  P     . C   B  2  10   ? 248.987 201.635 236.271 1.00 137.46 ? 10   C   2 P     1 
ATOM   746   O  OP1   . C   B  2  10   ? 247.972 202.713 236.152 1.00 137.46 ? 10   C   2 OP1   1 
ATOM   747   O  OP2   . C   B  2  10   ? 250.401 201.986 236.559 1.00 137.46 ? 10   C   2 OP2   1 
ATOM   748   O  "O5'" . C   B  2  10   ? 248.495 200.617 237.395 1.00 137.46 ? 10   C   2 "O5'" 1 
ATOM   749   C  "C5'" . C   B  2  10   ? 247.140 200.194 237.457 1.00 137.46 ? 10   C   2 "C5'" 1 
ATOM   750   C  "C4'" . C   B  2  10   ? 246.924 199.178 238.551 1.00 137.46 ? 10   C   2 "C4'" 1 
ATOM   751   O  "O4'" . C   B  2  10   ? 247.692 197.978 238.265 1.00 137.46 ? 10   C   2 "O4'" 1 
ATOM   752   C  "C3'" . C   B  2  10   ? 247.385 199.584 239.943 1.00 137.46 ? 10   C   2 "C3'" 1 
ATOM   753   O  "O3'" . C   B  2  10   ? 246.466 200.426 240.617 1.00 137.46 ? 10   C   2 "O3'" 1 
ATOM   754   C  "C2'" . C   B  2  10   ? 247.599 198.240 240.627 1.00 137.46 ? 10   C   2 "C2'" 1 
ATOM   755   O  "O2'" . C   B  2  10   ? 246.361 197.693 241.055 1.00 137.46 ? 10   C   2 "O2'" 1 
ATOM   756   C  "C1'" . C   B  2  10   ? 248.132 197.388 239.472 1.00 137.46 ? 10   C   2 "C1'" 1 
ATOM   757   N  N1    . C   B  2  10   ? 249.615 197.300 239.461 1.00 137.46 ? 10   C   2 N1    1 
ATOM   758   C  C2    . C   B  2  10   ? 250.265 196.395 240.315 1.00 137.46 ? 10   C   2 C2    1 
ATOM   759   O  O2    . C   B  2  10   ? 249.607 195.674 241.081 1.00 137.46 ? 10   C   2 O2    1 
ATOM   760   N  N3    . C   B  2  10   ? 251.617 196.322 240.297 1.00 137.46 ? 10   C   2 N3    1 
ATOM   761   C  C4    . C   B  2  10   ? 252.322 197.098 239.472 1.00 137.46 ? 10   C   2 C4    1 
ATOM   762   N  N4    . C   B  2  10   ? 253.651 196.994 239.485 1.00 137.46 ? 10   C   2 N4    1 
ATOM   763   C  C5    . C   B  2  10   ? 251.696 198.022 238.591 1.00 137.46 ? 10   C   2 C5    1 
ATOM   764   C  C6    . C   B  2  10   ? 250.361 198.083 238.619 1.00 137.46 ? 10   C   2 C6    1 
ATOM   765   P  P     . G   B  2  11   ? 247.003 201.613 241.560 1.00 153.51 ? 11   G   2 P     1 
ATOM   766   O  OP1   . G   B  2  11   ? 245.857 202.505 241.870 1.00 153.51 ? 11   G   2 OP1   1 
ATOM   767   O  OP2   . G   B  2  11   ? 248.224 202.178 240.934 1.00 153.51 ? 11   G   2 OP2   1 
ATOM   768   O  "O5'" . G   B  2  11   ? 247.435 200.879 242.908 1.00 153.51 ? 11   G   2 "O5'" 1 
ATOM   769   C  "C5'" . G   B  2  11   ? 246.461 200.331 243.785 1.00 153.51 ? 11   G   2 "C5'" 1 
ATOM   770   C  "C4'" . G   B  2  11   ? 247.054 199.284 244.695 1.00 153.51 ? 11   G   2 "C4'" 1 
ATOM   771   O  "O4'" . G   B  2  11   ? 247.928 198.411 243.933 1.00 153.51 ? 11   G   2 "O4'" 1 
ATOM   772   C  "C3'" . G   B  2  11   ? 247.939 199.789 245.825 1.00 153.51 ? 11   G   2 "C3'" 1 
ATOM   773   O  "O3'" . G   B  2  11   ? 247.208 200.261 246.944 1.00 153.51 ? 11   G   2 "O3'" 1 
ATOM   774   C  "C2'" . G   B  2  11   ? 248.800 198.573 246.133 1.00 153.51 ? 11   G   2 "C2'" 1 
ATOM   775   O  "O2'" . G   B  2  11   ? 248.073 197.625 246.901 1.00 153.51 ? 11   G   2 "O2'" 1 
ATOM   776   C  "C1'" . G   B  2  11   ? 249.015 197.998 244.735 1.00 153.51 ? 11   G   2 "C1'" 1 
ATOM   777   N  N9    . G   B  2  11   ? 250.268 198.488 244.131 1.00 153.51 ? 11   G   2 N9    1 
ATOM   778   C  C8    . G   B  2  11   ? 250.417 199.412 243.124 1.00 153.51 ? 11   G   2 C8    1 
ATOM   779   N  N7    . G   B  2  11   ? 251.667 199.634 242.816 1.00 153.51 ? 11   G   2 N7    1 
ATOM   780   C  C5    . G   B  2  11   ? 252.387 198.809 243.671 1.00 153.51 ? 11   G   2 C5    1 
ATOM   781   C  C6    . G   B  2  11   ? 253.786 198.611 243.810 1.00 153.51 ? 11   G   2 C6    1 
ATOM   782   O  O6    . G   B  2  11   ? 254.707 199.145 243.181 1.00 153.51 ? 11   G   2 O6    1 
ATOM   783   N  N1    . G   B  2  11   ? 254.078 197.680 244.804 1.00 153.51 ? 11   G   2 N1    1 
ATOM   784   C  C2    . G   B  2  11   ? 253.144 197.023 245.566 1.00 153.51 ? 11   G   2 C2    1 
ATOM   785   N  N2    . G   B  2  11   ? 253.596 196.154 246.480 1.00 153.51 ? 11   G   2 N2    1 
ATOM   786   N  N3    . G   B  2  11   ? 251.842 197.198 245.444 1.00 153.51 ? 11   G   2 N3    1 
ATOM   787   C  C4    . G   B  2  11   ? 251.536 198.098 244.487 1.00 153.51 ? 11   G   2 C4    1 
ATOM   788   P  P     . G   B  2  12   ? 247.858 201.348 247.935 1.00 164.67 ? 12   G   2 P     1 
ATOM   789   O  OP1   . G   B  2  12   ? 246.777 201.883 248.800 1.00 164.67 ? 12   G   2 OP1   1 
ATOM   790   O  OP2   . G   B  2  12   ? 248.674 202.281 247.117 1.00 164.67 ? 12   G   2 OP2   1 
ATOM   791   O  "O5'" . G   B  2  12   ? 248.850 200.502 248.853 1.00 164.67 ? 12   G   2 "O5'" 1 
ATOM   792   C  "C5'" . G   B  2  12   ? 248.357 199.499 249.730 1.00 164.67 ? 12   G   2 "C5'" 1 
ATOM   793   C  "C4'" . G   B  2  12   ? 249.477 198.766 250.428 1.00 164.67 ? 12   G   2 "C4'" 1 
ATOM   794   O  "O4'" . G   B  2  12   ? 250.294 198.061 249.457 1.00 164.67 ? 12   G   2 "O4'" 1 
ATOM   795   C  "C3'" . G   B  2  12   ? 250.473 199.626 251.187 1.00 164.67 ? 12   G   2 "C3'" 1 
ATOM   796   O  "O3'" . G   B  2  12   ? 250.002 200.035 252.458 1.00 164.67 ? 12   G   2 "O3'" 1 
ATOM   797   C  "C2'" . G   B  2  12   ? 251.702 198.730 251.251 1.00 164.67 ? 12   G   2 "C2'" 1 
ATOM   798   O  "O2'" . G   B  2  12   ? 251.552 197.743 252.261 1.00 164.67 ? 12   G   2 "O2'" 1 
ATOM   799   C  "C1'" . G   B  2  12   ? 251.640 198.038 249.888 1.00 164.67 ? 12   G   2 "C1'" 1 
ATOM   800   N  N9    . G   B  2  12   ? 252.472 198.724 248.880 1.00 164.67 ? 12   G   2 N9    1 
ATOM   801   C  C8    . G   B  2  12   ? 252.030 199.467 247.813 1.00 164.67 ? 12   G   2 C8    1 
ATOM   802   N  N7    . G   B  2  12   ? 253.000 199.952 247.088 1.00 164.67 ? 12   G   2 N7    1 
ATOM   803   C  C5    . G   B  2  12   ? 254.155 199.503 247.713 1.00 164.67 ? 12   G   2 C5    1 
ATOM   804   C  C6    . G   B  2  12   ? 255.518 199.711 247.379 1.00 164.67 ? 12   G   2 C6    1 
ATOM   805   O  O6    . G   B  2  12   ? 255.984 200.356 246.433 1.00 164.67 ? 12   G   2 O6    1 
ATOM   806   N  N1    . G   B  2  12   ? 256.373 199.078 248.277 1.00 164.67 ? 12   G   2 N1    1 
ATOM   807   C  C2    . G   B  2  12   ? 255.964 198.336 249.358 1.00 164.67 ? 12   G   2 C2    1 
ATOM   808   N  N2    . G   B  2  12   ? 256.937 197.801 250.110 1.00 164.67 ? 12   G   2 N2    1 
ATOM   809   N  N3    . G   B  2  12   ? 254.696 198.134 249.680 1.00 164.67 ? 12   G   2 N3    1 
ATOM   810   C  C4    . G   B  2  12   ? 253.848 198.741 248.820 1.00 164.67 ? 12   G   2 C4    1 
ATOM   811   P  P     . C   B  2  13   ? 250.579 201.372 253.136 1.00 167.37 ? 13   C   2 P     1 
ATOM   812   O  OP1   . C   B  2  13   ? 251.472 200.971 254.252 1.00 167.37 ? 13   C   2 OP1   1 
ATOM   813   O  OP2   . C   B  2  13   ? 249.439 202.286 253.399 1.00 167.37 ? 13   C   2 OP2   1 
ATOM   814   O  "O5'" . C   B  2  13   ? 251.480 202.021 251.994 1.00 167.37 ? 13   C   2 "O5'" 1 
ATOM   815   C  "C5'" . C   B  2  13   ? 252.010 203.334 252.139 1.00 167.37 ? 13   C   2 "C5'" 1 
ATOM   816   C  "C4'" . C   B  2  13   ? 253.514 203.348 252.013 1.00 167.37 ? 13   C   2 "C4'" 1 
ATOM   817   O  "O4'" . C   B  2  13   ? 253.894 202.808 250.716 1.00 167.37 ? 13   C   2 "O4'" 1 
ATOM   818   C  "C3'" . C   B  2  13   ? 254.159 204.730 252.105 1.00 167.37 ? 13   C   2 "C3'" 1 
ATOM   819   O  "O3'" . C   B  2  13   ? 255.437 204.614 252.728 1.00 167.37 ? 13   C   2 "O3'" 1 
ATOM   820   C  "C2'" . C   B  2  13   ? 254.343 205.112 250.640 1.00 167.37 ? 13   C   2 "C2'" 1 
ATOM   821   O  "O2'" . C   B  2  13   ? 255.361 206.061 250.403 1.00 167.37 ? 13   C   2 "O2'" 1 
ATOM   822   C  "C1'" . C   B  2  13   ? 254.671 203.760 250.014 1.00 167.37 ? 13   C   2 "C1'" 1 
ATOM   823   N  N1    . C   B  2  13   ? 254.387 203.662 248.569 1.00 167.37 ? 13   C   2 N1    1 
ATOM   824   C  C2    . C   B  2  13   ? 253.084 203.629 248.027 1.00 167.37 ? 13   C   2 C2    1 
ATOM   825   O  O2    . C   B  2  13   ? 252.072 203.679 248.744 1.00 167.37 ? 13   C   2 O2    1 
ATOM   826   N  N3    . C   B  2  13   ? 252.939 203.541 246.683 1.00 167.37 ? 13   C   2 N3    1 
ATOM   827   C  C4    . C   B  2  13   ? 254.003 203.487 245.882 1.00 167.37 ? 13   C   2 C4    1 
ATOM   828   N  N4    . C   B  2  13   ? 253.796 203.400 244.566 1.00 167.37 ? 13   C   2 N4    1 
ATOM   829   C  C5    . C   B  2  13   ? 255.328 203.521 246.397 1.00 167.37 ? 13   C   2 C5    1 
ATOM   830   C  C6    . C   B  2  13   ? 255.464 203.607 247.725 1.00 167.37 ? 13   C   2 C6    1 
ATOM   831   P  P     . C   B  2  14   ? 255.789 205.504 254.018 1.00 174.44 ? 14   C   2 P     1 
ATOM   832   O  OP1   . C   B  2  14   ? 256.974 204.904 254.682 1.00 174.44 ? 14   C   2 OP1   1 
ATOM   833   O  OP2   . C   B  2  14   ? 254.538 205.707 254.793 1.00 174.44 ? 14   C   2 OP2   1 
ATOM   834   O  "O5'" . C   B  2  14   ? 256.225 206.908 253.407 1.00 174.44 ? 14   C   2 "O5'" 1 
ATOM   835   C  "C5'" . C   B  2  14   ? 256.687 207.954 254.248 1.00 174.44 ? 14   C   2 "C5'" 1 
ATOM   836   C  "C4'" . C   B  2  14   ? 258.106 208.338 253.915 1.00 174.44 ? 14   C   2 "C4'" 1 
ATOM   837   O  "O4'" . C   B  2  14   ? 258.915 207.140 253.785 1.00 174.44 ? 14   C   2 "O4'" 1 
ATOM   838   C  "C3'" . C   B  2  14   ? 258.311 209.068 252.596 1.00 174.44 ? 14   C   2 "C3'" 1 
ATOM   839   O  "O3'" . C   B  2  14   ? 258.022 210.453 252.695 1.00 174.44 ? 14   C   2 "O3'" 1 
ATOM   840   C  "C2'" . C   B  2  14   ? 259.769 208.763 252.269 1.00 174.44 ? 14   C   2 "C2'" 1 
ATOM   841   O  "O2'" . C   B  2  14   ? 260.637 209.610 253.006 1.00 174.44 ? 14   C   2 "O2'" 1 
ATOM   842   C  "C1'" . C   B  2  14   ? 259.914 207.335 252.806 1.00 174.44 ? 14   C   2 "C1'" 1 
ATOM   843   N  N1    . C   B  2  14   ? 259.768 206.299 251.751 1.00 174.44 ? 14   C   2 N1    1 
ATOM   844   C  C2    . C   B  2  14   ? 260.872 205.979 250.948 1.00 174.44 ? 14   C   2 C2    1 
ATOM   845   O  O2    . C   B  2  14   ? 261.950 206.568 251.120 1.00 174.44 ? 14   C   2 O2    1 
ATOM   846   N  N3    . C   B  2  14   ? 260.742 205.029 249.991 1.00 174.44 ? 14   C   2 N3    1 
ATOM   847   C  C4    . C   B  2  14   ? 259.579 204.401 249.816 1.00 174.44 ? 14   C   2 C4    1 
ATOM   848   N  N4    . C   B  2  14   ? 259.504 203.474 248.858 1.00 174.44 ? 14   C   2 N4    1 
ATOM   849   C  C5    . C   B  2  14   ? 258.441 204.697 250.616 1.00 174.44 ? 14   C   2 C5    1 
ATOM   850   C  C6    . C   B  2  14   ? 258.583 205.635 251.560 1.00 174.44 ? 14   C   2 C6    1 
ATOM   851   P  P     . U   B  2  15   ? 257.807 211.359 251.382 1.00 147.72 ? 15   U   2 P     1 
ATOM   852   O  OP1   . U   B  2  15   ? 256.528 212.090 251.542 1.00 147.72 ? 15   U   2 OP1   1 
ATOM   853   O  OP2   . U   B  2  15   ? 258.014 210.548 250.155 1.00 147.72 ? 15   U   2 OP2   1 
ATOM   854   O  "O5'" . U   B  2  15   ? 258.976 212.435 251.481 1.00 147.72 ? 15   U   2 "O5'" 1 
ATOM   855   C  "C5'" . U   B  2  15   ? 259.296 213.044 252.724 1.00 147.72 ? 15   U   2 "C5'" 1 
ATOM   856   C  "C4'" . U   B  2  15   ? 259.408 214.541 252.591 1.00 147.72 ? 15   U   2 "C4'" 1 
ATOM   857   O  "O4'" . U   B  2  15   ? 260.263 214.854 251.461 1.00 147.72 ? 15   U   2 "O4'" 1 
ATOM   858   C  "C3'" . U   B  2  15   ? 258.112 215.287 252.301 1.00 147.72 ? 15   U   2 "C3'" 1 
ATOM   859   O  "O3'" . U   B  2  15   ? 257.363 215.569 253.475 1.00 147.72 ? 15   U   2 "O3'" 1 
ATOM   860   C  "C2'" . U   B  2  15   ? 258.597 216.549 251.591 1.00 147.72 ? 15   U   2 "C2'" 1 
ATOM   861   O  "O2'" . U   B  2  15   ? 259.025 217.521 252.533 1.00 147.72 ? 15   U   2 "O2'" 1 
ATOM   862   C  "C1'" . U   B  2  15   ? 259.825 216.037 250.832 1.00 147.72 ? 15   U   2 "C1'" 1 
ATOM   863   N  N1    . U   B  2  15   ? 259.548 215.754 249.402 1.00 147.72 ? 15   U   2 N1    1 
ATOM   864   C  C2    . U   B  2  15   ? 259.624 216.814 248.515 1.00 147.72 ? 15   U   2 C2    1 
ATOM   865   O  O2    . U   B  2  15   ? 259.896 217.952 248.859 1.00 147.72 ? 15   U   2 O2    1 
ATOM   866   N  N3    . U   B  2  15   ? 259.368 216.497 247.204 1.00 147.72 ? 15   U   2 N3    1 
ATOM   867   C  C4    . U   B  2  15   ? 259.053 215.255 246.694 1.00 147.72 ? 15   U   2 C4    1 
ATOM   868   O  O4    . U   B  2  15   ? 258.848 215.130 245.485 1.00 147.72 ? 15   U   2 O4    1 
ATOM   869   C  C5    . U   B  2  15   ? 258.998 214.210 247.668 1.00 147.72 ? 15   U   2 C5    1 
ATOM   870   C  C6    . U   B  2  15   ? 259.245 214.488 248.953 1.00 147.72 ? 15   U   2 C6    1 
ATOM   871   P  P     . U   B  2  16   ? 256.004 214.776 253.827 1.00 139.18 ? 16   U   2 P     1 
ATOM   872   O  OP1   . U   B  2  16   ? 255.285 215.581 254.846 1.00 139.18 ? 16   U   2 OP1   1 
ATOM   873   O  OP2   . U   B  2  16   ? 256.331 213.362 254.135 1.00 139.18 ? 16   U   2 OP2   1 
ATOM   874   O  "O5'" . U   B  2  16   ? 255.138 214.831 252.489 1.00 139.18 ? 16   U   2 "O5'" 1 
ATOM   875   C  "C5'" . U   B  2  16   ? 254.295 215.941 252.208 1.00 139.18 ? 16   U   2 "C5'" 1 
ATOM   876   C  "C4'" . U   B  2  16   ? 254.877 216.789 251.108 1.00 139.18 ? 16   U   2 "C4'" 1 
ATOM   877   O  "O4'" . U   B  2  16   ? 254.331 216.403 249.823 1.00 139.18 ? 16   U   2 "O4'" 1 
ATOM   878   C  "C3'" . U   B  2  16   ? 254.618 218.283 251.163 1.00 139.18 ? 16   U   2 "C3'" 1 
ATOM   879   O  "O3'" . U   B  2  16   ? 255.403 218.959 252.131 1.00 139.18 ? 16   U   2 "O3'" 1 
ATOM   880   C  "C2'" . U   B  2  16   ? 254.921 218.710 249.728 1.00 139.18 ? 16   U   2 "C2'" 1 
ATOM   881   O  "O2'" . U   B  2  16   ? 256.321 218.841 249.536 1.00 139.18 ? 16   U   2 "O2'" 1 
ATOM   882   C  "C1'" . U   B  2  16   ? 254.447 217.488 248.926 1.00 139.18 ? 16   U   2 "C1'" 1 
ATOM   883   N  N1    . U   B  2  16   ? 253.173 217.722 248.196 1.00 139.18 ? 16   U   2 N1    1 
ATOM   884   C  C2    . U   B  2  16   ? 253.116 217.198 246.919 1.00 139.18 ? 16   U   2 C2    1 
ATOM   885   O  O2    . U   B  2  16   ? 254.023 216.541 246.437 1.00 139.18 ? 16   U   2 O2    1 
ATOM   886   N  N3    . U   B  2  16   ? 251.951 217.438 246.232 1.00 139.18 ? 16   U   2 N3    1 
ATOM   887   C  C4    . U   B  2  16   ? 250.862 218.162 246.670 1.00 139.18 ? 16   U   2 C4    1 
ATOM   888   O  O4    . U   B  2  16   ? 249.882 218.287 245.934 1.00 139.18 ? 16   U   2 O4    1 
ATOM   889   C  C5    . U   B  2  16   ? 250.996 218.691 247.990 1.00 139.18 ? 16   U   2 C5    1 
ATOM   890   C  C6    . U   B  2  16   ? 252.120 218.471 248.680 1.00 139.18 ? 16   U   2 C6    1 
ATOM   891   P  P     . U   B  2  17   ? 254.708 219.658 253.404 1.00 124.90 ? 17   U   2 P     1 
ATOM   892   O  OP1   . U   B  2  17   ? 255.778 220.304 254.205 1.00 124.90 ? 17   U   2 OP1   1 
ATOM   893   O  OP2   . U   B  2  17   ? 253.812 218.665 254.049 1.00 124.90 ? 17   U   2 OP2   1 
ATOM   894   O  "O5'" . U   B  2  17   ? 253.792 220.810 252.787 1.00 124.90 ? 17   U   2 "O5'" 1 
ATOM   895   C  "C5'" . U   B  2  17   ? 252.537 221.131 253.382 1.00 124.90 ? 17   U   2 "C5'" 1 
ATOM   896   C  "C4'" . U   B  2  17   ? 252.123 222.573 253.173 1.00 124.90 ? 17   U   2 "C4'" 1 
ATOM   897   O  "O4'" . U   B  2  17   ? 253.029 223.465 253.882 1.00 124.90 ? 17   U   2 "O4'" 1 
ATOM   898   C  "C3'" . U   B  2  17   ? 252.080 223.070 251.724 1.00 124.90 ? 17   U   2 "C3'" 1 
ATOM   899   O  "O3'" . U   B  2  17   ? 250.976 223.963 251.574 1.00 124.90 ? 17   U   2 "O3'" 1 
ATOM   900   C  "C2'" . U   B  2  17   ? 253.377 223.864 251.606 1.00 124.90 ? 17   U   2 "C2'" 1 
ATOM   901   O  "O2'" . U   B  2  17   ? 253.381 224.855 250.600 1.00 124.90 ? 17   U   2 "O2'" 1 
ATOM   902   C  "C1'" . U   B  2  17   ? 253.480 224.472 252.998 1.00 124.90 ? 17   U   2 "C1'" 1 
ATOM   903   N  N1    . U   B  2  17   ? 254.837 224.882 253.384 1.00 124.90 ? 17   U   2 N1    1 
ATOM   904   C  C2    . U   B  2  17   ? 255.178 226.204 253.170 1.00 124.90 ? 17   U   2 C2    1 
ATOM   905   O  O2    . U   B  2  17   ? 254.409 227.013 252.680 1.00 124.90 ? 17   U   2 O2    1 
ATOM   906   N  N3    . U   B  2  17   ? 256.453 226.546 253.544 1.00 124.90 ? 17   U   2 N3    1 
ATOM   907   C  C4    . U   B  2  17   ? 257.399 225.714 254.103 1.00 124.90 ? 17   U   2 C4    1 
ATOM   908   O  O4    . U   B  2  17   ? 258.509 226.164 254.391 1.00 124.90 ? 17   U   2 O4    1 
ATOM   909   C  C5    . U   B  2  17   ? 256.963 224.365 254.293 1.00 124.90 ? 17   U   2 C5    1 
ATOM   910   C  C6    . U   B  2  17   ? 255.729 223.999 253.938 1.00 124.90 ? 17   U   2 C6    1 
ATOM   911   P  P     . U   B  2  18   ? 250.257 224.142 250.148 1.00 144.48 ? 18   U   2 P     1 
ATOM   912   O  OP1   . U   B  2  18   ? 248.829 223.783 250.316 1.00 144.48 ? 18   U   2 OP1   1 
ATOM   913   O  OP2   . U   B  2  18   ? 251.083 223.454 249.123 1.00 144.48 ? 18   U   2 OP2   1 
ATOM   914   O  "O5'" . U   B  2  18   ? 250.339 225.709 249.867 1.00 144.48 ? 18   U   2 "O5'" 1 
ATOM   915   C  "C5'" . U   B  2  18   ? 249.737 226.275 248.707 1.00 144.48 ? 18   U   2 "C5'" 1 
ATOM   916   C  "C4'" . U   B  2  18   ? 248.843 227.443 249.051 1.00 144.48 ? 18   U   2 "C4'" 1 
ATOM   917   O  "O4'" . U   B  2  18   ? 248.188 227.185 250.324 1.00 144.48 ? 18   U   2 "O4'" 1 
ATOM   918   C  "C3'" . U   B  2  18   ? 249.547 228.791 249.201 1.00 144.48 ? 18   U   2 "C3'" 1 
ATOM   919   O  "O3'" . U   B  2  18   ? 248.675 229.830 248.758 1.00 144.48 ? 18   U   2 "O3'" 1 
ATOM   920   C  "C2'" . U   B  2  18   ? 249.739 228.902 250.710 1.00 144.48 ? 18   U   2 "C2'" 1 
ATOM   921   O  "O2'" . U   B  2  18   ? 249.874 230.223 251.189 1.00 144.48 ? 18   U   2 "O2'" 1 
ATOM   922   C  "C1'" . U   B  2  18   ? 248.467 228.239 251.226 1.00 144.48 ? 18   U   2 "C1'" 1 
ATOM   923   N  N1    . U   B  2  18   ? 248.594 227.671 252.576 1.00 144.48 ? 18   U   2 N1    1 
ATOM   924   C  C2    . U   B  2  18   ? 247.828 228.232 253.578 1.00 144.48 ? 18   U   2 C2    1 
ATOM   925   O  O2    . U   B  2  18   ? 247.064 229.162 253.383 1.00 144.48 ? 18   U   2 O2    1 
ATOM   926   N  N3    . U   B  2  18   ? 247.989 227.663 254.817 1.00 144.48 ? 18   U   2 N3    1 
ATOM   927   C  C4    . U   B  2  18   ? 248.822 226.613 255.146 1.00 144.48 ? 18   U   2 C4    1 
ATOM   928   O  O4    . U   B  2  18   ? 248.857 226.210 256.310 1.00 144.48 ? 18   U   2 O4    1 
ATOM   929   C  C5    . U   B  2  18   ? 249.582 226.089 254.053 1.00 144.48 ? 18   U   2 C5    1 
ATOM   930   C  C6    . U   B  2  18   ? 249.446 226.624 252.836 1.00 144.48 ? 18   U   2 C6    1 
ATOM   931   P  P     . G   B  2  19   ? 249.271 231.113 247.995 1.00 90.57  ? 19   G   2 P     1 
ATOM   932   O  OP1   . G   B  2  19   ? 248.970 232.316 248.812 1.00 90.57  ? 19   G   2 OP1   1 
ATOM   933   O  OP2   . G   B  2  19   ? 248.827 231.057 246.579 1.00 90.57  ? 19   G   2 OP2   1 
ATOM   934   O  "O5'" . G   B  2  19   ? 250.845 230.875 248.029 1.00 90.57  ? 19   G   2 "O5'" 1 
ATOM   935   C  "C5'" . G   B  2  19   ? 251.644 231.112 246.876 1.00 90.57  ? 19   G   2 "C5'" 1 
ATOM   936   C  "C4'" . G   B  2  19   ? 252.261 229.835 246.362 1.00 90.57  ? 19   G   2 "C4'" 1 
ATOM   937   O  "O4'" . G   B  2  19   ? 251.202 228.880 246.076 1.00 90.57  ? 19   G   2 "O4'" 1 
ATOM   938   C  "C3'" . G   B  2  19   ? 253.066 229.978 245.074 1.00 90.57  ? 19   G   2 "C3'" 1 
ATOM   939   O  "O3'" . G   B  2  19   ? 254.162 229.064 245.092 1.00 90.57  ? 19   G   2 "O3'" 1 
ATOM   940   C  "C2'" . G   B  2  19   ? 252.065 229.562 244.001 1.00 90.57  ? 19   G   2 "C2'" 1 
ATOM   941   O  "O2'" . G   B  2  19   ? 252.649 229.078 242.809 1.00 90.57  ? 19   G   2 "O2'" 1 
ATOM   942   C  "C1'" . G   B  2  19   ? 251.269 228.478 244.721 1.00 90.57  ? 19   G   2 "C1'" 1 
ATOM   943   N  N9    . G   B  2  19   ? 249.899 228.328 244.225 1.00 90.57  ? 19   G   2 N9    1 
ATOM   944   C  C8    . G   B  2  19   ? 249.046 229.344 243.865 1.00 90.57  ? 19   G   2 C8    1 
ATOM   945   N  N7    . G   B  2  19   ? 247.883 228.918 243.456 1.00 90.57  ? 19   G   2 N7    1 
ATOM   946   C  C5    . G   B  2  19   ? 247.972 227.536 243.549 1.00 90.57  ? 19   G   2 C5    1 
ATOM   947   C  C6    . G   B  2  19   ? 247.017 226.533 243.241 1.00 90.57  ? 19   G   2 C6    1 
ATOM   948   O  O6    . G   B  2  19   ? 245.865 226.671 242.811 1.00 90.57  ? 19   G   2 O6    1 
ATOM   949   N  N1    . G   B  2  19   ? 247.519 225.258 243.482 1.00 90.57  ? 19   G   2 N1    1 
ATOM   950   C  C2    . G   B  2  19   ? 248.777 224.982 243.957 1.00 90.57  ? 19   G   2 C2    1 
ATOM   951   N  N2    . G   B  2  19   ? 249.073 223.684 244.122 1.00 90.57  ? 19   G   2 N2    1 
ATOM   952   N  N3    . G   B  2  19   ? 249.677 225.907 244.248 1.00 90.57  ? 19   G   2 N3    1 
ATOM   953   C  C4    . G   B  2  19   ? 249.211 227.154 244.022 1.00 90.57  ? 19   G   2 C4    1 
ATOM   954   P  P     . G   B  2  20   ? 255.669 229.620 245.043 1.00 42.29  ? 20   G   2 P     1 
ATOM   955   O  OP1   . G   B  2  20   ? 256.554 228.509 244.611 1.00 42.29  ? 20   G   2 OP1   1 
ATOM   956   O  OP2   . G   B  2  20   ? 255.948 230.340 246.310 1.00 42.29  ? 20   G   2 OP2   1 
ATOM   957   O  "O5'" . G   B  2  20   ? 255.642 230.691 243.867 1.00 42.29  ? 20   G   2 "O5'" 1 
ATOM   958   C  "C5'" . G   B  2  20   ? 255.786 230.281 242.517 1.00 42.29  ? 20   G   2 "C5'" 1 
ATOM   959   C  "C4'" . G   B  2  20   ? 255.668 231.442 241.563 1.00 42.29  ? 20   G   2 "C4'" 1 
ATOM   960   O  "O4'" . G   B  2  20   ? 254.284 231.866 241.448 1.00 42.29  ? 20   G   2 "O4'" 1 
ATOM   961   C  "C3'" . G   B  2  20   ? 256.397 232.716 241.947 1.00 42.29  ? 20   G   2 "C3'" 1 
ATOM   962   O  "O3'" . G   B  2  20   ? 257.793 232.668 241.720 1.00 42.29  ? 20   G   2 "O3'" 1 
ATOM   963   C  "C2'" . G   B  2  20   ? 255.677 233.758 241.106 1.00 42.29  ? 20   G   2 "C2'" 1 
ATOM   964   O  "O2'" . G   B  2  20   ? 256.103 233.691 239.753 1.00 42.29  ? 20   G   2 "O2'" 1 
ATOM   965   C  "C1'" . G   B  2  20   ? 254.236 233.255 241.182 1.00 42.29  ? 20   G   2 "C1'" 1 
ATOM   966   N  N9    . G   B  2  20   ? 253.480 233.937 242.251 1.00 42.29  ? 20   G   2 N9    1 
ATOM   967   C  C8    . G   B  2  20   ? 253.031 233.413 243.440 1.00 42.29  ? 20   G   2 C8    1 
ATOM   968   N  N7    . G   B  2  20   ? 252.396 234.286 244.175 1.00 42.29  ? 20   G   2 N7    1 
ATOM   969   C  C5    . G   B  2  20   ? 252.427 235.458 243.429 1.00 42.29  ? 20   G   2 C5    1 
ATOM   970   C  C6    . G   B  2  20   ? 251.901 236.749 243.704 1.00 42.29  ? 20   G   2 C6    1 
ATOM   971   O  O6    . G   B  2  20   ? 251.278 237.129 244.700 1.00 42.29  ? 20   G   2 O6    1 
ATOM   972   N  N1    . G   B  2  20   ? 252.158 237.651 242.674 1.00 42.29  ? 20   G   2 N1    1 
ATOM   973   C  C2    . G   B  2  20   ? 252.837 237.350 241.520 1.00 42.29  ? 20   G   2 C2    1 
ATOM   974   N  N2    . G   B  2  20   ? 253.000 238.337 240.626 1.00 42.29  ? 20   G   2 N2    1 
ATOM   975   N  N3    . G   B  2  20   ? 253.328 236.153 241.255 1.00 42.29  ? 20   G   2 N3    1 
ATOM   976   C  C4    . G   B  2  20   ? 253.096 235.260 242.243 1.00 42.29  ? 20   G   2 C4    1 
ATOM   977   P  P     . C   B  2  21   ? 258.784 233.479 242.691 1.00 37.02  ? 21   C   2 P     1 
ATOM   978   O  OP1   . C   B  2  21   ? 260.172 233.050 242.414 1.00 37.02  ? 21   C   2 OP1   1 
ATOM   979   O  OP2   . C   B  2  21   ? 258.248 233.389 244.072 1.00 37.02  ? 21   C   2 OP2   1 
ATOM   980   O  "O5'" . C   B  2  21   ? 258.652 234.992 242.212 1.00 37.02  ? 21   C   2 "O5'" 1 
ATOM   981   C  "C5'" . C   B  2  21   ? 258.978 235.375 240.884 1.00 37.02  ? 21   C   2 "C5'" 1 
ATOM   982   C  "C4'" . C   B  2  21   ? 258.426 236.740 240.565 1.00 37.02  ? 21   C   2 "C4'" 1 
ATOM   983   O  "O4'" . C   B  2  21   ? 257.026 236.799 240.945 1.00 37.02  ? 21   C   2 "O4'" 1 
ATOM   984   C  "C3'" . C   B  2  21   ? 259.063 237.895 241.318 1.00 37.02  ? 21   C   2 "C3'" 1 
ATOM   985   O  "O3'" . C   B  2  21   ? 260.276 238.325 240.729 1.00 37.02  ? 21   C   2 "O3'" 1 
ATOM   986   C  "C2'" . C   B  2  21   ? 257.965 238.954 241.312 1.00 37.02  ? 21   C   2 "C2'" 1 
ATOM   987   O  "O2'" . C   B  2  21   ? 257.941 239.643 240.071 1.00 37.02  ? 21   C   2 "O2'" 1 
ATOM   988   C  "C1'" . C   B  2  21   ? 256.702 238.093 241.411 1.00 37.02  ? 21   C   2 "C1'" 1 
ATOM   989   N  N1    . C   B  2  21   ? 256.167 237.992 242.792 1.00 37.02  ? 21   C   2 N1    1 
ATOM   990   C  C2    . C   B  2  21   ? 255.341 239.013 243.286 1.00 37.02  ? 21   C   2 C2    1 
ATOM   991   O  O2    . C   B  2  21   ? 255.082 239.987 242.562 1.00 37.02  ? 21   C   2 O2    1 
ATOM   992   N  N3    . C   B  2  21   ? 254.850 238.911 244.544 1.00 37.02  ? 21   C   2 N3    1 
ATOM   993   C  C4    . C   B  2  21   ? 255.143 237.851 245.300 1.00 37.02  ? 21   C   2 C4    1 
ATOM   994   N  N4    . C   B  2  21   ? 254.638 237.790 246.534 1.00 37.02  ? 21   C   2 N4    1 
ATOM   995   C  C5    . C   B  2  21   ? 255.972 236.798 244.826 1.00 37.02  ? 21   C   2 C5    1 
ATOM   996   C  C6    . C   B  2  21   ? 256.448 236.909 243.583 1.00 37.02  ? 21   C   2 C6    1 
ATOM   997   P  P     . U   B  2  22   ? 261.314 239.207 241.577 1.00 37.02  ? 22   U   2 P     1 
ATOM   998   O  OP1   . U   B  2  22   ? 262.661 239.057 240.970 1.00 37.02  ? 22   U   2 OP1   1 
ATOM   999   O  OP2   . U   B  2  22   ? 261.113 238.895 243.014 1.00 37.02  ? 22   U   2 OP2   1 
ATOM   1000  O  "O5'" . U   B  2  22   ? 260.826 240.702 241.331 1.00 37.02  ? 22   U   2 "O5'" 1 
ATOM   1001  C  "C5'" . U   B  2  22   ? 261.222 241.744 242.205 1.00 37.02  ? 22   U   2 "C5'" 1 
ATOM   1002  C  "C4'" . U   B  2  22   ? 260.224 242.874 242.209 1.00 37.02  ? 22   U   2 "C4'" 1 
ATOM   1003  O  "O4'" . U   B  2  22   ? 258.893 242.354 242.442 1.00 37.02  ? 22   U   2 "O4'" 1 
ATOM   1004  C  "C3'" . U   B  2  22   ? 260.414 243.924 243.294 1.00 37.02  ? 22   U   2 "C3'" 1 
ATOM   1005  O  "O3'" . U   B  2  22   ? 261.377 244.901 242.932 1.00 37.02  ? 22   U   2 "O3'" 1 
ATOM   1006  C  "C2'" . U   B  2  22   ? 259.013 244.506 243.461 1.00 37.02  ? 22   U   2 "C2'" 1 
ATOM   1007  O  "O2'" . U   B  2  22   ? 258.766 245.507 242.487 1.00 37.02  ? 22   U   2 "O2'" 1 
ATOM   1008  C  "C1'" . U   B  2  22   ? 258.120 243.300 243.148 1.00 37.02  ? 22   U   2 "C1'" 1 
ATOM   1009  N  N1    . U   B  2  22   ? 257.548 242.657 244.355 1.00 37.02  ? 22   U   2 N1    1 
ATOM   1010  C  C2    . U   B  2  22   ? 256.444 243.242 244.957 1.00 37.02  ? 22   U   2 C2    1 
ATOM   1011  O  O2    . U   B  2  22   ? 255.923 244.271 244.559 1.00 37.02  ? 22   U   2 O2    1 
ATOM   1012  N  N3    . U   B  2  22   ? 255.962 242.587 246.063 1.00 37.02  ? 22   U   2 N3    1 
ATOM   1013  C  C4    . U   B  2  22   ? 256.458 241.416 246.604 1.00 37.02  ? 22   U   2 C4    1 
ATOM   1014  O  O4    . U   B  2  22   ? 255.926 240.926 247.600 1.00 37.02  ? 22   U   2 O4    1 
ATOM   1015  C  C5    . U   B  2  22   ? 257.591 240.870 245.922 1.00 37.02  ? 22   U   2 C5    1 
ATOM   1016  C  C6    . U   B  2  22   ? 258.081 241.490 244.847 1.00 37.02  ? 22   U   2 C6    1 
ATOM   1017  P  P     . A   B  2  23   ? 262.910 244.762 243.394 1.00 37.02  ? 23   A   2 P     1 
ATOM   1018  O  OP1   . A   B  2  23   ? 263.757 244.877 242.180 1.00 37.02  ? 23   A   2 OP1   1 
ATOM   1019  O  OP2   . A   B  2  23   ? 263.040 243.565 244.262 1.00 37.02  ? 23   A   2 OP2   1 
ATOM   1020  O  "O5'" . A   B  2  23   ? 263.158 246.057 244.287 1.00 37.02  ? 23   A   2 "O5'" 1 
ATOM   1021  C  "C5'" . A   B  2  23   ? 264.349 246.205 245.045 1.00 37.02  ? 23   A   2 "C5'" 1 
ATOM   1022  C  "C4'" . A   B  2  23   ? 264.043 246.353 246.513 1.00 37.02  ? 23   A   2 "C4'" 1 
ATOM   1023  O  "O4'" . A   B  2  23   ? 263.274 247.566 246.726 1.00 37.02  ? 23   A   2 "O4'" 1 
ATOM   1024  C  "C3'" . A   B  2  23   ? 263.175 245.256 247.115 1.00 37.02  ? 23   A   2 "C3'" 1 
ATOM   1025  O  "O3'" . A   B  2  23   ? 263.853 244.039 247.424 1.00 37.02  ? 23   A   2 "O3'" 1 
ATOM   1026  C  "C2'" . A   B  2  23   ? 262.524 245.952 248.306 1.00 37.02  ? 23   A   2 "C2'" 1 
ATOM   1027  O  "O2'" . A   B  2  23   ? 263.417 246.015 249.407 1.00 37.02  ? 23   A   2 "O2'" 1 
ATOM   1028  C  "C1'" . A   B  2  23   ? 262.334 247.370 247.762 1.00 37.02  ? 23   A   2 "C1'" 1 
ATOM   1029  N  N9    . A   B  2  23   ? 260.973 247.614 247.232 1.00 37.02  ? 23   A   2 N9    1 
ATOM   1030  C  C8    . A   B  2  23   ? 260.280 246.947 246.246 1.00 37.02  ? 23   A   2 C8    1 
ATOM   1031  N  N7    . A   B  2  23   ? 259.084 247.423 246.005 1.00 37.02  ? 23   A   2 N7    1 
ATOM   1032  C  C5    . A   B  2  23   ? 258.977 248.486 246.887 1.00 37.02  ? 23   A   2 C5    1 
ATOM   1033  C  C6    . A   B  2  23   ? 257.949 249.413 247.137 1.00 37.02  ? 23   A   2 C6    1 
ATOM   1034  N  N6    . A   B  2  23   ? 256.782 249.414 246.488 1.00 37.02  ? 23   A   2 N6    1 
ATOM   1035  N  N1    . A   B  2  23   ? 258.160 250.353 248.087 1.00 37.02  ? 23   A   2 N1    1 
ATOM   1036  C  C2    . A   B  2  23   ? 259.329 250.360 248.743 1.00 37.02  ? 23   A   2 C2    1 
ATOM   1037  N  N3    . A   B  2  23   ? 260.369 249.541 248.595 1.00 37.02  ? 23   A   2 N3    1 
ATOM   1038  C  C4    . A   B  2  23   ? 260.130 248.619 247.643 1.00 37.02  ? 23   A   2 C4    1 
ATOM   1039  P  P     . A   B  2  24   ? 265.405 243.979 247.861 1.00 30.96  ? 24   A   2 P     1 
ATOM   1040  O  OP1   . A   B  2  24   ? 265.633 244.899 249.003 1.00 30.96  ? 24   A   2 OP1   1 
ATOM   1041  O  OP2   . A   B  2  24   ? 266.285 244.017 246.664 1.00 30.96  ? 24   A   2 OP2   1 
ATOM   1042  O  "O5'" . A   B  2  24   ? 265.566 242.499 248.425 1.00 30.96  ? 24   A   2 "O5'" 1 
ATOM   1043  C  "C5'" . A   B  2  24   ? 265.623 242.241 249.823 1.00 30.96  ? 24   A   2 "C5'" 1 
ATOM   1044  C  "C4'" . A   B  2  24   ? 265.426 240.774 250.116 1.00 30.96  ? 24   A   2 "C4'" 1 
ATOM   1045  O  "O4'" . A   B  2  24   ? 266.031 240.447 251.397 1.00 30.96  ? 24   A   2 "O4'" 1 
ATOM   1046  C  "C3'" . A   B  2  24   ? 263.971 240.324 250.196 1.00 30.96  ? 24   A   2 "C3'" 1 
ATOM   1047  O  "O3'" . A   B  2  24   ? 263.805 239.043 249.593 1.00 30.96  ? 24   A   2 "O3'" 1 
ATOM   1048  C  "C2'" . A   B  2  24   ? 263.712 240.230 251.696 1.00 30.96  ? 24   A   2 "C2'" 1 
ATOM   1049  O  "O2'" . A   B  2  24   ? 262.711 239.304 252.062 1.00 30.96  ? 24   A   2 "O2'" 1 
ATOM   1050  C  "C1'" . A   B  2  24   ? 265.079 239.829 252.240 1.00 30.96  ? 24   A   2 "C1'" 1 
ATOM   1051  N  N9    . A   B  2  24   ? 265.307 240.308 253.606 1.00 30.96  ? 24   A   2 N9    1 
ATOM   1052  C  C8    . A   B  2  24   ? 264.754 241.433 254.165 1.00 30.96  ? 24   A   2 C8    1 
ATOM   1053  N  N7    . A   B  2  24   ? 265.108 241.643 255.408 1.00 30.96  ? 24   A   2 N7    1 
ATOM   1054  C  C5    . A   B  2  24   ? 265.948 240.577 255.693 1.00 30.96  ? 24   A   2 C5    1 
ATOM   1055  C  C6    . A   B  2  24   ? 266.658 240.213 256.852 1.00 30.96  ? 24   A   2 C6    1 
ATOM   1056  N  N6    . A   B  2  24   ? 266.629 240.917 257.985 1.00 30.96  ? 24   A   2 N6    1 
ATOM   1057  N  N1    . A   B  2  24   ? 267.408 239.087 256.811 1.00 30.96  ? 24   A   2 N1    1 
ATOM   1058  C  C2    . A   B  2  24   ? 267.440 238.375 255.677 1.00 30.96  ? 24   A   2 C2    1 
ATOM   1059  N  N3    . A   B  2  24   ? 266.818 238.621 254.525 1.00 30.96  ? 24   A   2 N3    1 
ATOM   1060  C  C4    . A   B  2  24   ? 266.078 239.742 254.595 1.00 30.96  ? 24   A   2 C4    1 
ATOM   1061  P  P     . G   B  2  25   ? 262.473 238.744 248.744 1.00 37.02  ? 25   G   2 P     1 
ATOM   1062  O  OP1   . G   B  2  25   ? 261.654 237.761 249.498 1.00 37.02  ? 25   G   2 OP1   1 
ATOM   1063  O  OP2   . G   B  2  25   ? 262.879 238.446 247.348 1.00 37.02  ? 25   G   2 OP2   1 
ATOM   1064  O  "O5'" . G   B  2  25   ? 261.694 240.138 248.748 1.00 37.02  ? 25   G   2 "O5'" 1 
ATOM   1065  C  "C5'" . G   B  2  25   ? 260.399 240.249 249.325 1.00 37.02  ? 25   G   2 "C5'" 1 
ATOM   1066  C  "C4'" . G   B  2  25   ? 259.848 241.651 249.221 1.00 37.02  ? 25   G   2 "C4'" 1 
ATOM   1067  O  "O4'" . G   B  2  25   ? 258.405 241.575 249.062 1.00 37.02  ? 25   G   2 "O4'" 1 
ATOM   1068  C  "C3'" . G   B  2  25   ? 260.042 242.546 250.442 1.00 37.02  ? 25   G   2 "C3'" 1 
ATOM   1069  O  "O3'" . G   B  2  25   ? 261.304 243.192 250.488 1.00 37.02  ? 25   G   2 "O3'" 1 
ATOM   1070  C  "C2'" . G   B  2  25   ? 258.874 243.512 250.334 1.00 37.02  ? 25   G   2 "C2'" 1 
ATOM   1071  O  "O2'" . G   B  2  25   ? 259.129 244.500 249.346 1.00 37.02  ? 25   G   2 "O2'" 1 
ATOM   1072  C  "C1'" . G   B  2  25   ? 257.779 242.588 249.818 1.00 37.02  ? 25   G   2 "C1'" 1 
ATOM   1073  N  N9    . G   B  2  25   ? 257.051 241.938 250.924 1.00 37.02  ? 25   G   2 N9    1 
ATOM   1074  C  C8    . G   B  2  25   ? 257.085 240.600 251.240 1.00 37.02  ? 25   G   2 C8    1 
ATOM   1075  N  N7    . G   B  2  25   ? 256.348 240.294 252.269 1.00 37.02  ? 25   G   2 N7    1 
ATOM   1076  C  C5    . G   B  2  25   ? 255.792 241.503 252.659 1.00 37.02  ? 25   G   2 C5    1 
ATOM   1077  C  C6    . G   B  2  25   ? 254.903 241.797 253.722 1.00 37.02  ? 25   G   2 C6    1 
ATOM   1078  O  O6    . G   B  2  25   ? 254.420 241.018 254.551 1.00 37.02  ? 25   G   2 O6    1 
ATOM   1079  N  N1    . G   B  2  25   ? 254.585 243.150 253.765 1.00 37.02  ? 25   G   2 N1    1 
ATOM   1080  C  C2    . G   B  2  25   ? 255.063 244.101 252.898 1.00 37.02  ? 25   G   2 C2    1 
ATOM   1081  N  N2    . G   B  2  25   ? 254.642 245.358 253.102 1.00 37.02  ? 25   G   2 N2    1 
ATOM   1082  N  N3    . G   B  2  25   ? 255.891 243.840 251.903 1.00 37.02  ? 25   G   2 N3    1 
ATOM   1083  C  C4    . G   B  2  25   ? 256.218 242.531 251.845 1.00 37.02  ? 25   G   2 C4    1 
ATOM   1084  P  P     . A   B  2  26   ? 261.955 243.592 251.905 1.00 37.02  ? 26   A   2 P     1 
ATOM   1085  O  OP1   . A   B  2  26   ? 263.344 244.057 251.667 1.00 37.02  ? 26   A   2 OP1   1 
ATOM   1086  O  OP2   . A   B  2  26   ? 261.678 242.499 252.868 1.00 37.02  ? 26   A   2 OP2   1 
ATOM   1087  O  "O5'" . A   B  2  26   ? 261.084 244.819 252.425 1.00 37.02  ? 26   A   2 "O5'" 1 
ATOM   1088  C  "C5'" . A   B  2  26   ? 261.140 246.099 251.814 1.00 37.02  ? 26   A   2 "C5'" 1 
ATOM   1089  C  "C4'" . A   B  2  26   ? 260.236 247.068 252.533 1.00 37.02  ? 26   A   2 "C4'" 1 
ATOM   1090  O  "O4'" . A   B  2  26   ? 258.875 246.561 252.512 1.00 37.02  ? 26   A   2 "O4'" 1 
ATOM   1091  C  "C3'" . A   B  2  26   ? 260.537 247.265 254.012 1.00 37.02  ? 26   A   2 "C3'" 1 
ATOM   1092  O  "O3'" . A   B  2  26   ? 261.575 248.202 254.245 1.00 37.02  ? 26   A   2 "O3'" 1 
ATOM   1093  C  "C2'" . A   B  2  26   ? 259.188 247.684 254.578 1.00 37.02  ? 26   A   2 "C2'" 1 
ATOM   1094  O  "O2'" . A   B  2  26   ? 258.928 249.052 254.297 1.00 37.02  ? 26   A   2 "O2'" 1 
ATOM   1095  C  "C1'" . A   B  2  26   ? 258.235 246.832 253.742 1.00 37.02  ? 26   A   2 "C1'" 1 
ATOM   1096  N  N9    . A   B  2  26   ? 257.927 245.542 254.392 1.00 37.02  ? 26   A   2 N9    1 
ATOM   1097  C  C8    . A   B  2  26   ? 258.516 244.331 254.127 1.00 37.02  ? 26   A   2 C8    1 
ATOM   1098  N  N7    . A   B  2  26   ? 258.059 243.340 254.846 1.00 37.02  ? 26   A   2 N7    1 
ATOM   1099  C  C5    . A   B  2  26   ? 257.097 243.940 255.641 1.00 37.02  ? 26   A   2 C5    1 
ATOM   1100  C  C6    . A   B  2  26   ? 256.240 243.421 256.623 1.00 37.02  ? 26   A   2 C6    1 
ATOM   1101  N  N6    . A   B  2  26   ? 256.241 242.135 256.970 1.00 37.02  ? 26   A   2 N6    1 
ATOM   1102  N  N1    . A   B  2  26   ? 255.391 244.271 257.245 1.00 37.02  ? 26   A   2 N1    1 
ATOM   1103  C  C2    . A   B  2  26   ? 255.398 245.565 256.890 1.00 37.02  ? 26   A   2 C2    1 
ATOM   1104  N  N3    . A   B  2  26   ? 256.161 246.169 255.975 1.00 37.02  ? 26   A   2 N3    1 
ATOM   1105  C  C4    . A   B  2  26   ? 256.998 245.296 255.379 1.00 37.02  ? 26   A   2 C4    1 
ATOM   1106  P  P     . U   B  2  27   ? 262.414 248.152 255.615 1.00 32.83  ? 27   U   2 P     1 
ATOM   1107  O  OP1   . U   B  2  27   ? 263.723 248.813 255.378 1.00 32.83  ? 27   U   2 OP1   1 
ATOM   1108  O  OP2   . U   B  2  27   ? 262.378 246.758 256.127 1.00 32.83  ? 27   U   2 OP2   1 
ATOM   1109  O  "O5'" . U   B  2  27   ? 261.571 249.064 256.612 1.00 32.83  ? 27   U   2 "O5'" 1 
ATOM   1110  C  "C5'" . U   B  2  27   ? 261.708 248.927 258.018 1.00 32.83  ? 27   U   2 "C5'" 1 
ATOM   1111  C  "C4'" . U   B  2  27   ? 260.364 248.952 258.701 1.00 32.83  ? 27   U   2 "C4'" 1 
ATOM   1112  O  "O4'" . U   B  2  27   ? 259.445 248.075 257.996 1.00 32.83  ? 27   U   2 "O4'" 1 
ATOM   1113  C  "C3'" . U   B  2  27   ? 260.335 248.440 260.133 1.00 32.83  ? 27   U   2 "C3'" 1 
ATOM   1114  O  "O3'" . U   B  2  27   ? 260.761 249.402 261.082 1.00 32.83  ? 27   U   2 "O3'" 1 
ATOM   1115  C  "C2'" . U   B  2  27   ? 258.884 248.015 260.304 1.00 32.83  ? 27   U   2 "C2'" 1 
ATOM   1116  O  "O2'" . U   B  2  27   ? 258.055 249.143 260.544 1.00 32.83  ? 27   U   2 "O2'" 1 
ATOM   1117  C  "C1'" . U   B  2  27   ? 258.560 247.465 258.913 1.00 32.83  ? 27   U   2 "C1'" 1 
ATOM   1118  N  N1    . U   B  2  27   ? 258.720 245.991 258.831 1.00 32.83  ? 27   U   2 N1    1 
ATOM   1119  C  C2    . U   B  2  27   ? 257.741 245.178 259.387 1.00 32.83  ? 27   U   2 C2    1 
ATOM   1120  O  O2    . U   B  2  27   ? 256.740 245.592 259.951 1.00 32.83  ? 27   U   2 O2    1 
ATOM   1121  N  N3    . U   B  2  27   ? 257.965 243.830 259.269 1.00 32.83  ? 27   U   2 N3    1 
ATOM   1122  C  C4    . U   B  2  27   ? 259.038 243.217 258.653 1.00 32.83  ? 27   U   2 C4    1 
ATOM   1123  O  O4    . U   B  2  27   ? 259.108 241.988 258.619 1.00 32.83  ? 27   U   2 O4    1 
ATOM   1124  C  C5    . U   B  2  27   ? 260.003 244.114 258.103 1.00 32.83  ? 27   U   2 C5    1 
ATOM   1125  C  C6    . U   B  2  27   ? 259.811 245.430 258.205 1.00 32.83  ? 27   U   2 C6    1 
ATOM   1126  P  P     . C   B  2  28   ? 261.573 248.941 262.391 1.00 40.78  ? 28   C   2 P     1 
ATOM   1127  O  OP1   . C   B  2  28   ? 262.035 250.161 263.100 1.00 40.78  ? 28   C   2 OP1   1 
ATOM   1128  O  OP2   . C   B  2  28   ? 262.565 247.917 261.973 1.00 40.78  ? 28   C   2 OP2   1 
ATOM   1129  O  "O5'" . C   B  2  28   ? 260.479 248.222 263.300 1.00 40.78  ? 28   C   2 "O5'" 1 
ATOM   1130  C  "C5'" . C   B  2  28   ? 259.373 248.946 263.833 1.00 40.78  ? 28   C   2 "C5'" 1 
ATOM   1131  C  "C4'" . C   B  2  28   ? 258.416 248.052 264.587 1.00 40.78  ? 28   C   2 "C4'" 1 
ATOM   1132  O  "O4'" . C   B  2  28   ? 258.122 246.877 263.782 1.00 40.78  ? 28   C   2 "O4'" 1 
ATOM   1133  C  "C3'" . C   B  2  28   ? 258.934 247.537 265.929 1.00 40.78  ? 28   C   2 "C3'" 1 
ATOM   1134  O  "O3'" . C   B  2  28   ? 257.889 247.506 266.899 1.00 40.78  ? 28   C   2 "O3'" 1 
ATOM   1135  C  "C2'" . C   B  2  28   ? 259.386 246.116 265.608 1.00 40.78  ? 28   C   2 "C2'" 1 
ATOM   1136  O  "O2'" . C   B  2  28   ? 259.357 245.226 266.703 1.00 40.78  ? 28   C   2 "O2'" 1 
ATOM   1137  C  "C1'" . C   B  2  28   ? 258.401 245.704 264.522 1.00 40.78  ? 28   C   2 "C1'" 1 
ATOM   1138  N  N1    . C   B  2  28   ? 258.955 244.697 263.608 1.00 40.78  ? 28   C   2 N1    1 
ATOM   1139  C  C2    . C   B  2  28   ? 258.520 243.374 263.711 1.00 40.78  ? 28   C   2 C2    1 
ATOM   1140  O  O2    . C   B  2  28   ? 257.661 243.092 264.560 1.00 40.78  ? 28   C   2 O2    1 
ATOM   1141  N  N3    . C   B  2  28   ? 259.038 242.444 262.877 1.00 40.78  ? 28   C   2 N3    1 
ATOM   1142  C  C4    . C   B  2  28   ? 259.959 242.794 261.979 1.00 40.78  ? 28   C   2 C4    1 
ATOM   1143  N  N4    . C   B  2  28   ? 260.449 241.848 261.176 1.00 40.78  ? 28   C   2 N4    1 
ATOM   1144  C  C5    . C   B  2  28   ? 260.427 244.134 261.859 1.00 40.78  ? 28   C   2 C5    1 
ATOM   1145  C  C6    . C   B  2  28   ? 259.905 245.043 262.690 1.00 40.78  ? 28   C   2 C6    1 
ATOM   1146  P  P     . A   B  2  29   ? 258.243 247.786 268.443 1.00 36.60  ? 29   A   2 P     1 
ATOM   1147  O  OP1   . A   B  2  29   ? 257.015 248.220 269.147 1.00 36.60  ? 29   A   2 OP1   1 
ATOM   1148  O  OP2   . A   B  2  29   ? 259.446 248.655 268.484 1.00 36.60  ? 29   A   2 OP2   1 
ATOM   1149  O  "O5'" . A   B  2  29   ? 258.642 246.353 269.013 1.00 36.60  ? 29   A   2 "O5'" 1 
ATOM   1150  C  "C5'" . A   B  2  29   ? 257.650 245.476 269.537 1.00 36.60  ? 29   A   2 "C5'" 1 
ATOM   1151  C  "C4'" . A   B  2  29   ? 258.242 244.263 270.219 1.00 36.60  ? 29   A   2 "C4'" 1 
ATOM   1152  O  "O4'" . A   B  2  29   ? 258.750 243.330 269.225 1.00 36.60  ? 29   A   2 "O4'" 1 
ATOM   1153  C  "C3'" . A   B  2  29   ? 259.396 244.525 271.190 1.00 36.60  ? 29   A   2 "C3'" 1 
ATOM   1154  O  "O3'" . A   B  2  29   ? 259.279 243.636 272.299 1.00 36.60  ? 29   A   2 "O3'" 1 
ATOM   1155  C  "C2'" . A   B  2  29   ? 260.625 244.135 270.372 1.00 36.60  ? 29   A   2 "C2'" 1 
ATOM   1156  O  "O2'" . A   B  2  29   ? 261.745 243.752 271.141 1.00 36.60  ? 29   A   2 "O2'" 1 
ATOM   1157  C  "C1'" . A   B  2  29   ? 260.080 242.975 269.549 1.00 36.60  ? 29   A   2 "C1'" 1 
ATOM   1158  N  N9    . A   B  2  29   ? 260.810 242.713 268.307 1.00 36.60  ? 29   A   2 N9    1 
ATOM   1159  C  C8    . A   B  2  29   ? 261.757 243.484 267.678 1.00 36.60  ? 29   A   2 C8    1 
ATOM   1160  N  N7    . A   B  2  29   ? 262.220 242.950 266.573 1.00 36.60  ? 29   A   2 N7    1 
ATOM   1161  C  C5    . A   B  2  29   ? 261.537 241.746 266.474 1.00 36.60  ? 29   A   2 C5    1 
ATOM   1162  C  C6    . A   B  2  29   ? 261.565 240.701 265.532 1.00 36.60  ? 29   A   2 C6    1 
ATOM   1163  N  N6    . A   B  2  29   ? 262.347 240.698 264.450 1.00 36.60  ? 29   A   2 N6    1 
ATOM   1164  N  N1    . A   B  2  29   ? 260.750 239.641 265.739 1.00 36.60  ? 29   A   2 N1    1 
ATOM   1165  C  C2    . A   B  2  29   ? 259.960 239.633 266.822 1.00 36.60  ? 29   A   2 C2    1 
ATOM   1166  N  N3    . A   B  2  29   ? 259.845 240.552 267.775 1.00 36.60  ? 29   A   2 N3    1 
ATOM   1167  C  C4    . A   B  2  29   ? 260.668 241.589 267.537 1.00 36.60  ? 29   A   2 C4    1 
ATOM   1168  P  P     . A   B  2  30   ? 258.752 244.178 273.715 1.00 60.18  ? 30   A   2 P     1 
ATOM   1169  O  OP1   . A   B  2  30   ? 258.819 243.059 274.689 1.00 60.18  ? 30   A   2 OP1   1 
ATOM   1170  O  OP2   . A   B  2  30   ? 257.463 244.881 273.491 1.00 60.18  ? 30   A   2 OP2   1 
ATOM   1171  O  "O5'" . A   B  2  30   ? 259.840 245.261 274.136 1.00 60.18  ? 30   A   2 "O5'" 1 
ATOM   1172  C  "C5'" . A   B  2  30   ? 259.868 245.787 275.457 1.00 60.18  ? 30   A   2 "C5'" 1 
ATOM   1173  C  "C4'" . A   B  2  30   ? 261.279 246.035 275.927 1.00 60.18  ? 30   A   2 "C4'" 1 
ATOM   1174  O  "O4'" . A   B  2  30   ? 261.725 247.329 275.434 1.00 60.18  ? 30   A   2 "O4'" 1 
ATOM   1175  C  "C3'" . A   B  2  30   ? 261.449 246.077 277.442 1.00 60.18  ? 30   A   2 "C3'" 1 
ATOM   1176  O  "O3'" . A   B  2  30   ? 262.739 245.578 277.790 1.00 60.18  ? 30   A   2 "O3'" 1 
ATOM   1177  C  "C2'" . A   B  2  30   ? 261.373 247.568 277.747 1.00 60.18  ? 30   A   2 "C2'" 1 
ATOM   1178  O  "O2'" . A   B  2  30   ? 262.017 247.952 278.943 1.00 60.18  ? 30   A   2 "O2'" 1 
ATOM   1179  C  "C1'" . A   B  2  30   ? 262.057 248.170 276.524 1.00 60.18  ? 30   A   2 "C1'" 1 
ATOM   1180  N  N9    . A   B  2  30   ? 261.622 249.539 276.220 1.00 60.18  ? 30   A   2 N9    1 
ATOM   1181  C  C8    . A   B  2  30   ? 262.261 250.693 276.603 1.00 60.18  ? 30   A   2 C8    1 
ATOM   1182  N  N7    . A   B  2  30   ? 261.659 251.792 276.221 1.00 60.18  ? 30   A   2 N7    1 
ATOM   1183  C  C5    . A   B  2  30   ? 260.537 251.335 275.548 1.00 60.18  ? 30   A   2 C5    1 
ATOM   1184  C  C6    . A   B  2  30   ? 259.483 252.009 274.902 1.00 60.18  ? 30   A   2 C6    1 
ATOM   1185  N  N6    . A   B  2  30   ? 259.393 253.338 274.827 1.00 60.18  ? 30   A   2 N6    1 
ATOM   1186  N  N1    . A   B  2  30   ? 258.513 251.265 274.322 1.00 60.18  ? 30   A   2 N1    1 
ATOM   1187  C  C2    . A   B  2  30   ? 258.594 249.930 274.389 1.00 60.18  ? 30   A   2 C2    1 
ATOM   1188  N  N3    . A   B  2  30   ? 259.531 249.188 274.973 1.00 60.18  ? 30   A   2 N3    1 
ATOM   1189  C  C4    . A   B  2  30   ? 260.489 249.949 275.544 1.00 60.18  ? 30   A   2 C4    1 
ATOM   1190  P  P     . G   B  2  31   ? 262.878 244.142 278.495 1.00 82.21  ? 31   G   2 P     1 
ATOM   1191  O  OP1   . G   B  2  31   ? 264.150 243.527 278.037 1.00 82.21  ? 31   G   2 OP1   1 
ATOM   1192  O  OP2   . G   B  2  31   ? 261.597 243.415 278.303 1.00 82.21  ? 31   G   2 OP2   1 
ATOM   1193  O  "O5'" . G   B  2  31   ? 263.022 244.487 280.043 1.00 82.21  ? 31   G   2 "O5'" 1 
ATOM   1194  C  "C5'" . G   B  2  31   ? 262.150 243.903 281.006 1.00 82.21  ? 31   G   2 "C5'" 1 
ATOM   1195  C  "C4'" . G   B  2  31   ? 262.347 244.508 282.374 1.00 82.21  ? 31   G   2 "C4'" 1 
ATOM   1196  O  "O4'" . G   B  2  31   ? 262.494 245.948 282.242 1.00 82.21  ? 31   G   2 "O4'" 1 
ATOM   1197  C  "C3'" . G   B  2  31   ? 261.197 244.287 283.355 1.00 82.21  ? 31   G   2 "C3'" 1 
ATOM   1198  O  "O3'" . G   B  2  31   ? 261.716 244.230 284.684 1.00 82.21  ? 31   G   2 "O3'" 1 
ATOM   1199  C  "C2'" . G   B  2  31   ? 260.391 245.573 283.204 1.00 82.21  ? 31   G   2 "C2'" 1 
ATOM   1200  O  "O2'" . G   B  2  31   ? 259.571 245.886 284.309 1.00 82.21  ? 31   G   2 "O2'" 1 
ATOM   1201  C  "C1'" . G   B  2  31   ? 261.505 246.598 283.017 1.00 82.21  ? 31   G   2 "C1'" 1 
ATOM   1202  N  N9    . G   B  2  31   ? 261.100 247.817 282.313 1.00 82.21  ? 31   G   2 N9    1 
ATOM   1203  C  C8    . G   B  2  31   ? 259.842 248.165 281.886 1.00 82.21  ? 31   G   2 C8    1 
ATOM   1204  N  N7    . G   B  2  31   ? 259.810 249.328 281.292 1.00 82.21  ? 31   G   2 N7    1 
ATOM   1205  C  C5    . G   B  2  31   ? 261.123 249.776 281.336 1.00 82.21  ? 31   G   2 C5    1 
ATOM   1206  C  C6    . G   B  2  31   ? 261.709 250.974 280.849 1.00 82.21  ? 31   G   2 C6    1 
ATOM   1207  O  O6    . G   B  2  31   ? 261.162 251.916 280.263 1.00 82.21  ? 31   G   2 O6    1 
ATOM   1208  N  N1    . G   B  2  31   ? 263.076 251.018 281.106 1.00 82.21  ? 31   G   2 N1    1 
ATOM   1209  C  C2    . G   B  2  31   ? 263.792 250.037 281.746 1.00 82.21  ? 31   G   2 C2    1 
ATOM   1210  N  N2    . G   B  2  31   ? 265.105 250.264 281.900 1.00 82.21  ? 31   G   2 N2    1 
ATOM   1211  N  N3    . G   B  2  31   ? 263.259 248.916 282.203 1.00 82.21  ? 31   G   2 N3    1 
ATOM   1212  C  C4    . G   B  2  31   ? 261.931 248.854 281.967 1.00 82.21  ? 31   G   2 C4    1 
ATOM   1213  P  P     . U   B  2  32   ? 262.121 242.833 285.370 1.00 65.28  ? 32   U   2 P     1 
ATOM   1214  O  OP1   . U   B  2  32   ? 262.706 241.915 284.360 1.00 65.28  ? 32   U   2 OP1   1 
ATOM   1215  O  OP2   . U   B  2  32   ? 260.962 242.375 286.178 1.00 65.28  ? 32   U   2 OP2   1 
ATOM   1216  O  "O5'" . U   B  2  32   ? 263.282 243.252 286.376 1.00 65.28  ? 32   U   2 "O5'" 1 
ATOM   1217  C  "C5'" . U   B  2  32   ? 264.340 244.095 285.943 1.00 65.28  ? 32   U   2 "C5'" 1 
ATOM   1218  C  "C4'" . U   B  2  32   ? 264.333 245.418 286.668 1.00 65.28  ? 32   U   2 "C4'" 1 
ATOM   1219  O  "O4'" . U   B  2  32   ? 263.023 246.034 286.561 1.00 65.28  ? 32   U   2 "O4'" 1 
ATOM   1220  C  "C3'" . U   B  2  32   ? 264.590 245.359 288.165 1.00 65.28  ? 32   U   2 "C3'" 1 
ATOM   1221  O  "O3'" . U   B  2  32   ? 265.966 245.251 288.480 1.00 65.28  ? 32   U   2 "O3'" 1 
ATOM   1222  C  "C2'" . U   B  2  32   ? 263.945 246.645 288.668 1.00 65.28  ? 32   U   2 "C2'" 1 
ATOM   1223  O  "O2'" . U   B  2  32   ? 264.803 247.755 288.453 1.00 65.28  ? 32   U   2 "O2'" 1 
ATOM   1224  C  "C1'" . U   B  2  32   ? 262.740 246.775 287.730 1.00 65.28  ? 32   U   2 "C1'" 1 
ATOM   1225  N  N1    . U   B  2  32   ? 261.482 246.271 288.334 1.00 65.28  ? 32   U   2 N1    1 
ATOM   1226  C  C2    . U   B  2  32   ? 260.780 247.123 289.171 1.00 65.28  ? 32   U   2 C2    1 
ATOM   1227  O  O2    . U   B  2  32   ? 261.148 248.255 289.437 1.00 65.28  ? 32   U   2 O2    1 
ATOM   1228  N  N3    . U   B  2  32   ? 259.622 246.602 289.696 1.00 65.28  ? 32   U   2 N3    1 
ATOM   1229  C  C4    . U   B  2  32   ? 259.097 245.346 289.476 1.00 65.28  ? 32   U   2 C4    1 
ATOM   1230  O  O4    . U   B  2  32   ? 258.041 245.024 290.023 1.00 65.28  ? 32   U   2 O4    1 
ATOM   1231  C  C5    . U   B  2  32   ? 259.873 244.525 288.599 1.00 65.28  ? 32   U   2 C5    1 
ATOM   1232  C  C6    . U   B  2  32   ? 261.003 245.006 288.072 1.00 65.28  ? 32   U   2 C6    1 
ATOM   1233  P  P     . G   B  2  33   ? 266.487 244.056 289.418 1.00 44.83  ? 33   G   2 P     1 
ATOM   1234  O  OP1   . G   B  2  33   ? 267.966 243.991 289.302 1.00 44.83  ? 33   G   2 OP1   1 
ATOM   1235  O  OP2   . G   B  2  33   ? 265.673 242.850 289.121 1.00 44.83  ? 33   G   2 OP2   1 
ATOM   1236  O  "O5'" . G   B  2  33   ? 266.128 244.543 290.890 1.00 44.83  ? 33   G   2 "O5'" 1 
ATOM   1237  C  "C5'" . G   B  2  33   ? 266.670 245.749 291.407 1.00 44.83  ? 33   G   2 "C5'" 1 
ATOM   1238  C  "C4'" . G   B  2  33   ? 265.921 246.214 292.629 1.00 44.83  ? 33   G   2 "C4'" 1 
ATOM   1239  O  "O4'" . G   B  2  33   ? 264.581 246.632 292.254 1.00 44.83  ? 33   G   2 "O4'" 1 
ATOM   1240  C  "C3'" . G   B  2  33   ? 265.686 245.168 293.708 1.00 44.83  ? 33   G   2 "C3'" 1 
ATOM   1241  O  "O3'" . G   B  2  33   ? 266.810 244.948 294.543 1.00 44.83  ? 33   G   2 "O3'" 1 
ATOM   1242  C  "C2'" . G   B  2  33   ? 264.480 245.728 294.442 1.00 44.83  ? 33   G   2 "C2'" 1 
ATOM   1243  O  "O2'" . G   B  2  33   ? 264.862 246.801 295.290 1.00 44.83  ? 33   G   2 "O2'" 1 
ATOM   1244  C  "C1'" . G   B  2  33   ? 263.669 246.297 293.280 1.00 44.83  ? 33   G   2 "C1'" 1 
ATOM   1245  N  N9    . G   B  2  33   ? 262.711 245.309 292.748 1.00 44.83  ? 33   G   2 N9    1 
ATOM   1246  C  C8    . G   B  2  33   ? 262.729 244.736 291.500 1.00 44.83  ? 33   G   2 C8    1 
ATOM   1247  N  N7    . G   B  2  33   ? 261.754 243.891 291.306 1.00 44.83  ? 33   G   2 N7    1 
ATOM   1248  C  C5    . G   B  2  33   ? 261.046 243.904 292.499 1.00 44.83  ? 33   G   2 C5    1 
ATOM   1249  C  C6    . G   B  2  33   ? 259.884 243.188 292.888 1.00 44.83  ? 33   G   2 C6    1 
ATOM   1250  O  O6    . G   B  2  33   ? 259.224 242.371 292.236 1.00 44.83  ? 33   G   2 O6    1 
ATOM   1251  N  N1    . G   B  2  33   ? 259.496 243.498 294.188 1.00 44.83  ? 33   G   2 N1    1 
ATOM   1252  C  C2    . G   B  2  33   ? 260.145 244.384 295.010 1.00 44.83  ? 33   G   2 C2    1 
ATOM   1253  N  N2    . G   B  2  33   ? 259.632 244.562 296.234 1.00 44.83  ? 33   G   2 N2    1 
ATOM   1254  N  N3    . G   B  2  33   ? 261.222 245.058 294.658 1.00 44.83  ? 33   G   2 N3    1 
ATOM   1255  C  C4    . G   B  2  33   ? 261.622 244.773 293.401 1.00 44.83  ? 33   G   2 C4    1 
ATOM   1256  P  P     . U   B  2  34   ? 267.094 243.480 295.135 1.00 43.83  ? 34   U   2 P     1 
ATOM   1257  O  OP1   . U   B  2  34   ? 268.398 243.514 295.843 1.00 43.83  ? 34   U   2 OP1   1 
ATOM   1258  O  OP2   . U   B  2  34   ? 266.877 242.498 294.042 1.00 43.83  ? 34   U   2 OP2   1 
ATOM   1259  O  "O5'" . U   B  2  34   ? 265.948 243.263 296.220 1.00 43.83  ? 34   U   2 "O5'" 1 
ATOM   1260  C  "C5'" . U   B  2  34   ? 265.907 244.046 297.404 1.00 43.83  ? 34   U   2 "C5'" 1 
ATOM   1261  C  "C4'" . U   B  2  34   ? 264.815 243.589 298.337 1.00 43.83  ? 34   U   2 "C4'" 1 
ATOM   1262  O  "O4'" . U   B  2  34   ? 263.522 243.680 297.683 1.00 43.83  ? 34   U   2 "O4'" 1 
ATOM   1263  C  "C3'" . U   B  2  34   ? 264.887 242.142 298.791 1.00 43.83  ? 34   U   2 "C3'" 1 
ATOM   1264  O  "O3'" . U   B  2  34   ? 265.837 241.927 299.819 1.00 43.83  ? 34   U   2 "O3'" 1 
ATOM   1265  C  "C2'" . U   B  2  34   ? 263.450 241.859 299.212 1.00 43.83  ? 34   U   2 "C2'" 1 
ATOM   1266  O  "O2'" . U   B  2  34   ? 263.188 242.400 300.498 1.00 43.83  ? 34   U   2 "O2'" 1 
ATOM   1267  C  "C1'" . U   B  2  34   ? 262.664 242.669 298.177 1.00 43.83  ? 34   U   2 "C1'" 1 
ATOM   1268  N  N1    . U   B  2  34   ? 262.178 241.837 297.046 1.00 43.83  ? 34   U   2 N1    1 
ATOM   1269  C  C2    . U   B  2  34   ? 261.027 241.084 297.235 1.00 43.83  ? 34   U   2 C2    1 
ATOM   1270  O  O2    . U   B  2  34   ? 260.398 241.066 298.280 1.00 43.83  ? 34   U   2 O2    1 
ATOM   1271  N  N3    . U   B  2  34   ? 260.625 240.337 296.153 1.00 43.83  ? 34   U   2 N3    1 
ATOM   1272  C  C4    . U   B  2  34   ? 261.241 240.268 294.920 1.00 43.83  ? 34   U   2 C4    1 
ATOM   1273  O  O4    . U   B  2  34   ? 260.762 239.550 294.042 1.00 43.83  ? 34   U   2 O4    1 
ATOM   1274  C  C5    . U   B  2  34   ? 262.418 241.072 294.798 1.00 43.83  ? 34   U   2 C5    1 
ATOM   1275  C  C6    . U   B  2  34   ? 262.831 241.810 295.834 1.00 43.83  ? 34   U   2 C6    1 
ATOM   1276  P  P     . A   B  2  35   ? 266.678 240.558 299.859 1.00 29.96  ? 35   A   2 P     1 
ATOM   1277  O  OP1   . A   B  2  35   ? 267.779 240.721 300.842 1.00 29.96  ? 35   A   2 OP1   1 
ATOM   1278  O  OP2   . A   B  2  35   ? 266.992 240.171 298.461 1.00 29.96  ? 35   A   2 OP2   1 
ATOM   1279  O  "O5'" . A   B  2  35   ? 265.647 239.494 300.442 1.00 29.96  ? 35   A   2 "O5'" 1 
ATOM   1280  C  "C5'" . A   B  2  35   ? 265.119 239.641 301.751 1.00 29.96  ? 35   A   2 "C5'" 1 
ATOM   1281  C  "C4'" . A   B  2  35   ? 263.996 238.670 302.012 1.00 29.96  ? 35   A   2 "C4'" 1 
ATOM   1282  O  "O4'" . A   B  2  35   ? 262.830 239.027 301.224 1.00 29.96  ? 35   A   2 "O4'" 1 
ATOM   1283  C  "C3'" . A   B  2  35   ? 264.256 237.223 301.631 1.00 29.96  ? 35   A   2 "C3'" 1 
ATOM   1284  O  "O3'" . A   B  2  35   ? 265.057 236.527 302.566 1.00 29.96  ? 35   A   2 "O3'" 1 
ATOM   1285  C  "C2'" . A   B  2  35   ? 262.846 236.669 301.497 1.00 29.96  ? 35   A   2 "C2'" 1 
ATOM   1286  O  "O2'" . A   B  2  35   ? 262.276 236.435 302.776 1.00 29.96  ? 35   A   2 "O2'" 1 
ATOM   1287  C  "C1'" . A   B  2  35   ? 262.126 237.856 300.858 1.00 29.96  ? 35   A   2 "C1'" 1 
ATOM   1288  N  N9    . A   B  2  35   ? 262.105 237.749 299.387 1.00 29.96  ? 35   A   2 N9    1 
ATOM   1289  C  C8    . A   B  2  35   ? 262.843 238.450 298.466 1.00 29.96  ? 35   A   2 C8    1 
ATOM   1290  N  N7    . A   B  2  35   ? 262.595 238.117 297.222 1.00 29.96  ? 35   A   2 N7    1 
ATOM   1291  C  C5    . A   B  2  35   ? 261.632 237.124 297.333 1.00 29.96  ? 35   A   2 C5    1 
ATOM   1292  C  C6    . A   B  2  35   ? 260.943 236.349 296.382 1.00 29.96  ? 35   A   2 C6    1 
ATOM   1293  N  N6    . A   B  2  35   ? 261.126 236.456 295.064 1.00 29.96  ? 35   A   2 N6    1 
ATOM   1294  N  N1    . A   B  2  35   ? 260.044 235.444 296.833 1.00 29.96  ? 35   A   2 N1    1 
ATOM   1295  C  C2    . A   B  2  35   ? 259.852 235.325 298.153 1.00 29.96  ? 35   A   2 C2    1 
ATOM   1296  N  N3    . A   B  2  35   ? 260.436 235.996 299.141 1.00 29.96  ? 35   A   2 N3    1 
ATOM   1297  C  C4    . A   B  2  35   ? 261.323 236.886 298.660 1.00 29.96  ? 35   A   2 C4    1 
ATOM   1298  P  P     . G   B  2  36   ? 266.194 235.518 302.045 1.00 31.92  ? 36   G   2 P     1 
ATOM   1299  O  OP1   . G   B  2  36   ? 266.976 235.077 303.227 1.00 31.92  ? 36   G   2 OP1   1 
ATOM   1300  O  OP2   . G   B  2  36   ? 266.885 236.157 300.896 1.00 31.92  ? 36   G   2 OP2   1 
ATOM   1301  O  "O5'" . G   B  2  36   ? 265.377 234.264 301.497 1.00 31.92  ? 36   G   2 "O5'" 1 
ATOM   1302  C  "C5'" . G   B  2  36   ? 264.686 233.410 302.395 1.00 31.92  ? 36   G   2 "C5'" 1 
ATOM   1303  C  "C4'" . G   B  2  36   ? 263.617 232.595 301.710 1.00 31.92  ? 36   G   2 "C4'" 1 
ATOM   1304  O  "O4'" . G   B  2  36   ? 262.846 233.421 300.800 1.00 31.92  ? 36   G   2 "O4'" 1 
ATOM   1305  C  "C3'" . G   B  2  36   ? 264.078 231.444 300.833 1.00 31.92  ? 36   G   2 "C3'" 1 
ATOM   1306  O  "O3'" . G   B  2  36   ? 264.490 230.304 301.569 1.00 31.92  ? 36   G   2 "O3'" 1 
ATOM   1307  C  "C2'" . G   B  2  36   ? 262.851 231.191 299.967 1.00 31.92  ? 36   G   2 "C2'" 1 
ATOM   1308  O  "O2'" . G   B  2  36   ? 261.875 230.447 300.679 1.00 31.92  ? 36   G   2 "O2'" 1 
ATOM   1309  C  "C1'" . G   B  2  36   ? 262.318 232.614 299.766 1.00 31.92  ? 36   G   2 "C1'" 1 
ATOM   1310  N  N9    . G   B  2  36   ? 262.692 233.156 298.445 1.00 31.92  ? 36   G   2 N9    1 
ATOM   1311  C  C8    . G   B  2  36   ? 263.662 234.065 298.094 1.00 31.92  ? 36   G   2 C8    1 
ATOM   1312  N  N7    . G   B  2  36   ? 263.701 234.291 296.804 1.00 31.92  ? 36   G   2 N7    1 
ATOM   1313  C  C5    . G   B  2  36   ? 262.705 233.479 296.270 1.00 31.92  ? 36   G   2 C5    1 
ATOM   1314  C  C6    . G   B  2  36   ? 262.259 233.280 294.931 1.00 31.92  ? 36   G   2 C6    1 
ATOM   1315  O  O6    . G   B  2  36   ? 262.666 233.797 293.883 1.00 31.92  ? 36   G   2 O6    1 
ATOM   1316  N  N1    . G   B  2  36   ? 261.216 232.358 294.865 1.00 31.92  ? 36   G   2 N1    1 
ATOM   1317  C  C2    . G   B  2  36   ? 260.671 231.712 295.945 1.00 31.92  ? 36   G   2 C2    1 
ATOM   1318  N  N2    . G   B  2  36   ? 259.671 230.854 295.709 1.00 31.92  ? 36   G   2 N2    1 
ATOM   1319  N  N3    . G   B  2  36   ? 261.072 231.890 297.186 1.00 31.92  ? 36   G   2 N3    1 
ATOM   1320  C  C4    . G   B  2  36   ? 262.082 232.776 297.275 1.00 31.92  ? 36   G   2 C4    1 
ATOM   1321  P  P     . U   B  2  37   ? 265.556 229.279 300.937 1.00 33.17  ? 37   U   2 P     1 
ATOM   1322  O  OP1   . U   B  2  37   ? 266.025 228.380 302.022 1.00 33.17  ? 37   U   2 OP1   1 
ATOM   1323  O  OP2   . U   B  2  37   ? 266.543 230.063 300.153 1.00 33.17  ? 37   U   2 OP2   1 
ATOM   1324  O  "O5'" . U   B  2  37   ? 264.706 228.409 299.908 1.00 33.17  ? 37   U   2 "O5'" 1 
ATOM   1325  C  "C5'" . U   B  2  37   ? 263.674 227.548 300.364 1.00 33.17  ? 37   U   2 "C5'" 1 
ATOM   1326  C  "C4'" . U   B  2  37   ? 262.799 227.070 299.232 1.00 33.17  ? 37   U   2 "C4'" 1 
ATOM   1327  O  "O4'" . U   B  2  37   ? 262.314 228.199 298.460 1.00 33.17  ? 37   U   2 "O4'" 1 
ATOM   1328  C  "C3'" . U   B  2  37   ? 263.457 226.178 298.193 1.00 33.17  ? 37   U   2 "C3'" 1 
ATOM   1329  O  "O3'" . U   B  2  37   ? 263.594 224.834 298.621 1.00 33.17  ? 37   U   2 "O3'" 1 
ATOM   1330  C  "C2'" . U   B  2  37   ? 262.538 226.342 296.989 1.00 33.17  ? 37   U   2 "C2'" 1 
ATOM   1331  O  "O2'" . U   B  2  37   ? 261.377 225.538 297.132 1.00 33.17  ? 37   U   2 "O2'" 1 
ATOM   1332  C  "C1'" . U   B  2  37   ? 262.125 227.812 297.114 1.00 33.17  ? 37   U   2 "C1'" 1 
ATOM   1333  N  N1    . U   B  2  37   ? 262.913 228.704 296.227 1.00 33.17  ? 37   U   2 N1    1 
ATOM   1334  C  C2    . U   B  2  37   ? 262.523 228.803 294.900 1.00 33.17  ? 37   U   2 C2    1 
ATOM   1335  O  O2    . U   B  2  37   ? 261.574 228.197 294.433 1.00 33.17  ? 37   U   2 O2    1 
ATOM   1336  N  N3    . U   B  2  37   ? 263.285 229.642 294.122 1.00 33.17  ? 37   U   2 N3    1 
ATOM   1337  C  C4    . U   B  2  37   ? 264.376 230.382 294.532 1.00 33.17  ? 37   U   2 C4    1 
ATOM   1338  O  O4    . U   B  2  37   ? 264.972 231.100 293.727 1.00 33.17  ? 37   U   2 O4    1 
ATOM   1339  C  C5    . U   B  2  37   ? 264.716 230.229 295.913 1.00 33.17  ? 37   U   2 C5    1 
ATOM   1340  C  C6    . U   B  2  37   ? 263.992 229.421 296.692 1.00 33.17  ? 37   U   2 C6    1 
ATOM   1341  P  P     . A   B  2  38   ? 264.753 223.904 298.007 1.00 34.09  ? 38   A   2 P     1 
ATOM   1342  O  OP1   . A   B  2  38   ? 264.930 222.738 298.910 1.00 34.09  ? 38   A   2 OP1   1 
ATOM   1343  O  OP2   . A   B  2  38   ? 265.916 224.769 297.688 1.00 34.09  ? 38   A   2 OP2   1 
ATOM   1344  O  "O5'" . A   B  2  38   ? 264.140 223.374 296.635 1.00 34.09  ? 38   A   2 "O5'" 1 
ATOM   1345  C  "C5'" . A   B  2  38   ? 262.964 222.577 296.623 1.00 34.09  ? 38   A   2 "C5'" 1 
ATOM   1346  C  "C4'" . A   B  2  38   ? 262.336 222.530 295.253 1.00 34.09  ? 38   A   2 "C4'" 1 
ATOM   1347  O  "O4'" . A   B  2  38   ? 262.078 223.881 294.783 1.00 34.09  ? 38   A   2 "O4'" 1 
ATOM   1348  C  "C3'" . A   B  2  38   ? 263.180 221.915 294.147 1.00 34.09  ? 38   A   2 "C3'" 1 
ATOM   1349  O  "O3'" . A   B  2  38   ? 263.165 220.498 294.146 1.00 34.09  ? 38   A   2 "O3'" 1 
ATOM   1350  C  "C2'" . A   B  2  38   ? 262.578 222.538 292.897 1.00 34.09  ? 38   A   2 "C2'" 1 
ATOM   1351  O  "O2'" . A   B  2  38   ? 261.342 221.919 292.574 1.00 34.09  ? 38   A   2 "O2'" 1 
ATOM   1352  C  "C1'" . A   B  2  38   ? 262.293 223.955 293.388 1.00 34.09  ? 38   A   2 "C1'" 1 
ATOM   1353  N  N9    . A   B  2  38   ? 263.445 224.841 293.144 1.00 34.09  ? 38   A   2 N9    1 
ATOM   1354  C  C8    . A   B  2  38   ? 264.323 225.348 294.069 1.00 34.09  ? 38   A   2 C8    1 
ATOM   1355  N  N7    . A   B  2  38   ? 265.262 226.102 293.554 1.00 34.09  ? 38   A   2 N7    1 
ATOM   1356  C  C5    . A   B  2  38   ? 264.986 226.082 292.195 1.00 34.09  ? 38   A   2 C5    1 
ATOM   1357  C  C6    . A   B  2  38   ? 265.615 226.686 291.094 1.00 34.09  ? 38   A   2 C6    1 
ATOM   1358  N  N6    . A   B  2  38   ? 266.696 227.457 291.213 1.00 34.09  ? 38   A   2 N6    1 
ATOM   1359  N  N1    . A   B  2  38   ? 265.093 226.472 289.861 1.00 34.09  ? 38   A   2 N1    1 
ATOM   1360  C  C2    . A   B  2  38   ? 264.008 225.694 289.751 1.00 34.09  ? 38   A   2 C2    1 
ATOM   1361  N  N3    . A   B  2  38   ? 263.329 225.073 290.714 1.00 34.09  ? 38   A   2 N3    1 
ATOM   1362  C  C4    . A   B  2  38   ? 263.873 225.308 291.924 1.00 34.09  ? 38   A   2 C4    1 
ATOM   1363  P  P     . U   B  2  39   ? 264.523 219.679 293.883 1.00 37.10  ? 39   U   2 P     1 
ATOM   1364  O  OP1   . U   B  2  39   ? 264.248 218.239 294.119 1.00 37.10  ? 39   U   2 OP1   1 
ATOM   1365  O  OP2   . U   B  2  39   ? 265.615 220.349 294.634 1.00 37.10  ? 39   U   2 OP2   1 
ATOM   1366  O  "O5'" . U   B  2  39   ? 264.804 219.879 292.327 1.00 37.10  ? 39   U   2 "O5'" 1 
ATOM   1367  C  "C5'" . U   B  2  39   ? 263.895 219.388 291.354 1.00 37.10  ? 39   U   2 "C5'" 1 
ATOM   1368  C  "C4'" . U   B  2  39   ? 264.119 220.028 290.007 1.00 37.10  ? 39   U   2 "C4'" 1 
ATOM   1369  O  "O4'" . U   B  2  39   ? 264.183 221.471 290.151 1.00 37.10  ? 39   U   2 "O4'" 1 
ATOM   1370  C  "C3'" . U   B  2  39   ? 265.418 219.673 289.302 1.00 37.10  ? 39   U   2 "C3'" 1 
ATOM   1371  O  "O3'" . U   B  2  39   ? 265.367 218.417 288.646 1.00 37.10  ? 39   U   2 "O3'" 1 
ATOM   1372  C  "C2'" . U   B  2  39   ? 265.615 220.851 288.355 1.00 37.10  ? 39   U   2 "C2'" 1 
ATOM   1373  O  "O2'" . U   B  2  39   ? 264.803 220.707 287.199 1.00 37.10  ? 39   U   2 "O2'" 1 
ATOM   1374  C  "C1'" . U   B  2  39   ? 265.066 222.012 289.189 1.00 37.10  ? 39   U   2 "C1'" 1 
ATOM   1375  N  N1    . U   B  2  39   ? 266.135 222.775 289.882 1.00 37.10  ? 39   U   2 N1    1 
ATOM   1376  C  C2    . U   B  2  39   ? 266.809 223.743 289.156 1.00 37.10  ? 39   U   2 C2    1 
ATOM   1377  O  O2    . U   B  2  39   ? 266.570 223.994 287.987 1.00 37.10  ? 39   U   2 O2    1 
ATOM   1378  N  N3    . U   B  2  39   ? 267.783 224.419 289.849 1.00 37.10  ? 39   U   2 N3    1 
ATOM   1379  C  C4    . U   B  2  39   ? 268.149 224.236 291.166 1.00 37.10  ? 39   U   2 C4    1 
ATOM   1380  O  O4    . U   B  2  39   ? 269.050 224.926 291.646 1.00 37.10  ? 39   U   2 O4    1 
ATOM   1381  C  C5    . U   B  2  39   ? 267.409 223.222 291.851 1.00 37.10  ? 39   U   2 C5    1 
ATOM   1382  C  C6    . U   B  2  39   ? 266.453 222.549 291.204 1.00 37.10  ? 39   U   2 C6    1 
ATOM   1383  P  P     . C   B  2  40   ? 266.726 217.667 288.233 1.00 52.38  ? 40   C   2 P     1 
ATOM   1384  O  OP1   . C   B  2  40   ? 266.412 216.233 288.006 1.00 52.38  ? 40   C   2 OP1   1 
ATOM   1385  O  OP2   . C   B  2  40   ? 267.780 218.049 289.207 1.00 52.38  ? 40   C   2 OP2   1 
ATOM   1386  O  "O5'" . C   B  2  40   ? 267.109 218.312 286.828 1.00 52.38  ? 40   C   2 "O5'" 1 
ATOM   1387  C  "C5'" . C   B  2  40   ? 268.451 218.309 286.368 1.00 52.38  ? 40   C   2 "C5'" 1 
ATOM   1388  C  "C4'" . C   B  2  40   ? 268.631 219.225 285.185 1.00 52.38  ? 40   C   2 "C4'" 1 
ATOM   1389  O  "O4'" . C   B  2  40   ? 268.201 220.568 285.532 1.00 52.38  ? 40   C   2 "O4'" 1 
ATOM   1390  C  "C3'" . C   B  2  40   ? 270.061 219.412 284.705 1.00 52.38  ? 40   C   2 "C3'" 1 
ATOM   1391  O  "O3'" . C   B  2  40   ? 270.523 218.346 283.894 1.00 52.38  ? 40   C   2 "O3'" 1 
ATOM   1392  C  "C2'" . C   B  2  40   ? 269.998 220.752 283.983 1.00 52.38  ? 40   C   2 "C2'" 1 
ATOM   1393  O  "O2'" . C   B  2  40   ? 269.443 220.597 282.686 1.00 52.38  ? 40   C   2 "O2'" 1 
ATOM   1394  C  "C1'" . C   B  2  40   ? 268.995 221.519 284.850 1.00 52.38  ? 40   C   2 "C1'" 1 
ATOM   1395  N  N1    . C   B  2  40   ? 269.651 222.409 285.843 1.00 52.38  ? 40   C   2 N1    1 
ATOM   1396  C  C2    . C   B  2  40   ? 270.119 223.667 285.435 1.00 52.38  ? 40   C   2 C2    1 
ATOM   1397  O  O2    . C   B  2  40   ? 269.988 224.025 284.254 1.00 52.38  ? 40   C   2 O2    1 
ATOM   1398  N  N3    . C   B  2  40   ? 270.712 224.478 286.342 1.00 52.38  ? 40   C   2 N3    1 
ATOM   1399  C  C4    . C   B  2  40   ? 270.847 224.091 287.610 1.00 52.38  ? 40   C   2 C4    1 
ATOM   1400  N  N4    . C   B  2  40   ? 271.439 224.930 288.463 1.00 52.38  ? 40   C   2 N4    1 
ATOM   1401  C  C5    . C   B  2  40   ? 270.381 222.824 288.059 1.00 52.38  ? 40   C   2 C5    1 
ATOM   1402  C  C6    . C   B  2  40   ? 269.795 222.031 287.154 1.00 52.38  ? 40   C   2 C6    1 
ATOM   1403  P  P     . U   B  2  41   ? 271.970 217.704 284.164 1.00 72.71  ? 41   U   2 P     1 
ATOM   1404  O  OP1   . U   B  2  41   ? 272.070 216.441 283.398 1.00 72.71  ? 41   U   2 OP1   1 
ATOM   1405  O  OP2   . U   B  2  41   ? 272.202 217.691 285.631 1.00 72.71  ? 41   U   2 OP2   1 
ATOM   1406  O  "O5'" . U   B  2  41   ? 272.984 218.747 283.518 1.00 72.71  ? 41   U   2 "O5'" 1 
ATOM   1407  C  "C5'" . U   B  2  41   ? 272.918 219.078 282.138 1.00 72.71  ? 41   U   2 "C5'" 1 
ATOM   1408  C  "C4'" . U   B  2  41   ? 273.682 220.344 281.848 1.00 72.71  ? 41   U   2 "C4'" 1 
ATOM   1409  O  "O4'" . U   B  2  41   ? 273.083 221.443 282.584 1.00 72.71  ? 41   U   2 "O4'" 1 
ATOM   1410  C  "C3'" . U   B  2  41   ? 275.138 220.346 282.292 1.00 72.71  ? 41   U   2 "C3'" 1 
ATOM   1411  O  "O3'" . U   B  2  41   ? 276.001 219.721 281.357 1.00 72.71  ? 41   U   2 "O3'" 1 
ATOM   1412  C  "C2'" . U   B  2  41   ? 275.429 221.827 282.499 1.00 72.71  ? 41   U   2 "C2'" 1 
ATOM   1413  O  "O2'" . U   B  2  41   ? 275.696 222.464 281.258 1.00 72.71  ? 41   U   2 "O2'" 1 
ATOM   1414  C  "C1'" . U   B  2  41   ? 274.084 222.338 283.023 1.00 72.71  ? 41   U   2 "C1'" 1 
ATOM   1415  N  N1    . U   B  2  41   ? 274.032 222.425 284.504 1.00 72.71  ? 41   U   2 N1    1 
ATOM   1416  C  C2    . U   B  2  41   ? 274.597 223.530 285.121 1.00 72.71  ? 41   U   2 C2    1 
ATOM   1417  O  O2    . U   B  2  41   ? 275.147 224.433 284.513 1.00 72.71  ? 41   U   2 O2    1 
ATOM   1418  N  N3    . U   B  2  41   ? 274.502 223.543 286.491 1.00 72.71  ? 41   U   2 N3    1 
ATOM   1419  C  C4    . U   B  2  41   ? 273.909 222.593 287.298 1.00 72.71  ? 41   U   2 C4    1 
ATOM   1420  O  O4    . U   B  2  41   ? 273.904 222.748 288.520 1.00 72.71  ? 41   U   2 O4    1 
ATOM   1421  C  C5    . U   B  2  41   ? 273.343 221.488 286.594 1.00 72.71  ? 41   U   2 C5    1 
ATOM   1422  C  C6    . U   B  2  41   ? 273.419 221.450 285.262 1.00 72.71  ? 41   U   2 C6    1 
ATOM   1423  P  P     . G   B  2  42   ? 277.111 218.670 281.852 1.00 112.13 ? 42   G   2 P     1 
ATOM   1424  O  OP1   . G   B  2  42   ? 277.791 218.125 280.649 1.00 112.13 ? 42   G   2 OP1   1 
ATOM   1425  O  OP2   . G   B  2  42   ? 276.479 217.744 282.826 1.00 112.13 ? 42   G   2 OP2   1 
ATOM   1426  O  "O5'" . G   B  2  42   ? 278.171 219.566 282.632 1.00 112.13 ? 42   G   2 "O5'" 1 
ATOM   1427  C  "C5'" . G   B  2  42   ? 278.966 220.518 281.940 1.00 112.13 ? 42   G   2 "C5'" 1 
ATOM   1428  C  "C4'" . G   B  2  42   ? 279.680 221.436 282.897 1.00 112.13 ? 42   G   2 "C4'" 1 
ATOM   1429  O  "O4'" . G   B  2  42   ? 278.708 222.175 283.681 1.00 112.13 ? 42   G   2 "O4'" 1 
ATOM   1430  C  "C3'" . G   B  2  42   ? 280.557 220.758 283.938 1.00 112.13 ? 42   G   2 "C3'" 1 
ATOM   1431  O  "O3'" . G   B  2  42   ? 281.835 220.400 283.439 1.00 112.13 ? 42   G   2 "O3'" 1 
ATOM   1432  C  "C2'" . G   B  2  42   ? 280.608 221.793 285.053 1.00 112.13 ? 42   G   2 "C2'" 1 
ATOM   1433  O  "O2'" . G   B  2  42   ? 281.526 222.828 284.736 1.00 112.13 ? 42   G   2 "O2'" 1 
ATOM   1434  C  "C1'" . G   B  2  42   ? 279.193 222.368 284.993 1.00 112.13 ? 42   G   2 "C1'" 1 
ATOM   1435  N  N9    . G   B  2  42   ? 278.277 221.696 285.935 1.00 112.13 ? 42   G   2 N9    1 
ATOM   1436  C  C8    . G   B  2  42   ? 277.226 220.868 285.617 1.00 112.13 ? 42   G   2 C8    1 
ATOM   1437  N  N7    . G   B  2  42   ? 276.588 220.422 286.665 1.00 112.13 ? 42   G   2 N7    1 
ATOM   1438  C  C5    . G   B  2  42   ? 277.255 220.990 287.742 1.00 112.13 ? 42   G   2 C5    1 
ATOM   1439  C  C6    . G   B  2  42   ? 277.020 220.873 289.137 1.00 112.13 ? 42   G   2 C6    1 
ATOM   1440  O  O6    . G   B  2  42   ? 276.145 220.220 289.720 1.00 112.13 ? 42   G   2 O6    1 
ATOM   1441  N  N1    . G   B  2  42   ? 277.935 221.617 289.875 1.00 112.13 ? 42   G   2 N1    1 
ATOM   1442  C  C2    . G   B  2  42   ? 278.946 222.377 289.341 1.00 112.13 ? 42   G   2 C2    1 
ATOM   1443  N  N2    . G   B  2  42   ? 279.733 223.028 290.209 1.00 112.13 ? 42   G   2 N2    1 
ATOM   1444  N  N3    . G   B  2  42   ? 279.174 222.494 288.046 1.00 112.13 ? 42   G   2 N3    1 
ATOM   1445  C  C4    . G   B  2  42   ? 278.299 221.780 287.308 1.00 112.13 ? 42   G   2 C4    1 
ATOM   1446  P  P     . U   B  2  43   ? 282.413 218.919 283.679 1.00 134.32 ? 43   U   2 P     1 
ATOM   1447  O  OP1   . U   B  2  43   ? 283.741 218.832 283.021 1.00 134.32 ? 43   U   2 OP1   1 
ATOM   1448  O  OP2   . U   B  2  43   ? 281.350 217.947 283.318 1.00 134.32 ? 43   U   2 OP2   1 
ATOM   1449  O  "O5'" . U   B  2  43   ? 282.639 218.838 285.254 1.00 134.32 ? 43   U   2 "O5'" 1 
ATOM   1450  C  "C5'" . U   B  2  43   ? 283.586 219.676 285.902 1.00 134.32 ? 43   U   2 "C5'" 1 
ATOM   1451  C  "C4'" . U   B  2  43   ? 283.355 219.717 287.391 1.00 134.32 ? 43   U   2 "C4'" 1 
ATOM   1452  O  "O4'" . U   B  2  43   ? 282.009 220.191 287.664 1.00 134.32 ? 43   U   2 "O4'" 1 
ATOM   1453  C  "C3'" . U   B  2  43   ? 283.424 218.379 288.108 1.00 134.32 ? 43   U   2 "C3'" 1 
ATOM   1454  O  "O3'" . U   B  2  43   ? 284.750 217.958 288.376 1.00 134.32 ? 43   U   2 "O3'" 1 
ATOM   1455  C  "C2'" . U   B  2  43   ? 282.591 218.629 289.358 1.00 134.32 ? 43   U   2 "C2'" 1 
ATOM   1456  O  "O2'" . U   B  2  43   ? 283.342 219.345 290.328 1.00 134.32 ? 43   U   2 "O2'" 1 
ATOM   1457  C  "C1'" . U   B  2  43   ? 281.496 219.553 288.816 1.00 134.32 ? 43   U   2 "C1'" 1 
ATOM   1458  N  N1    . U   B  2  43   ? 280.254 218.822 288.453 1.00 134.32 ? 43   U   2 N1    1 
ATOM   1459  C  C2    . U   B  2  43   ? 279.376 218.472 289.467 1.00 134.32 ? 43   U   2 C2    1 
ATOM   1460  O  O2    . U   B  2  43   ? 279.566 218.725 290.645 1.00 134.32 ? 43   U   2 O2    1 
ATOM   1461  N  N3    . U   B  2  43   ? 278.247 217.805 289.059 1.00 134.32 ? 43   U   2 N3    1 
ATOM   1462  C  C4    . U   B  2  43   ? 277.901 217.455 287.771 1.00 134.32 ? 43   U   2 C4    1 
ATOM   1463  O  O4    . U   B  2  43   ? 276.846 216.853 287.566 1.00 134.32 ? 43   U   2 O4    1 
ATOM   1464  C  C5    . U   B  2  43   ? 278.850 217.851 286.777 1.00 134.32 ? 43   U   2 C5    1 
ATOM   1465  C  C6    . U   B  2  43   ? 279.957 218.505 287.144 1.00 134.32 ? 43   U   2 C6    1 
ATOM   1466  P  P     . U   B  2  44   ? 285.407 216.771 287.514 1.00 150.67 ? 44   U   2 P     1 
ATOM   1467  O  OP1   . U   B  2  44   ? 286.702 217.260 286.975 1.00 150.67 ? 44   U   2 OP1   1 
ATOM   1468  O  OP2   . U   B  2  44   ? 284.373 216.253 286.582 1.00 150.67 ? 44   U   2 OP2   1 
ATOM   1469  O  "O5'" . U   B  2  44   ? 285.718 215.635 288.587 1.00 150.67 ? 44   U   2 "O5'" 1 
ATOM   1470  C  "C5'" . U   B  2  44   ? 286.755 215.801 289.542 1.00 150.67 ? 44   U   2 "C5'" 1 
ATOM   1471  C  "C4'" . U   B  2  44   ? 286.232 215.683 290.951 1.00 150.67 ? 44   U   2 "C4'" 1 
ATOM   1472  O  "O4'" . U   B  2  44   ? 285.006 216.447 291.077 1.00 150.67 ? 44   U   2 "O4'" 1 
ATOM   1473  C  "C3'" . U   B  2  44   ? 285.843 214.286 291.408 1.00 150.67 ? 44   U   2 "C3'" 1 
ATOM   1474  O  "O3'" . U   B  2  44   ? 286.953 213.504 291.813 1.00 150.67 ? 44   U   2 "O3'" 1 
ATOM   1475  C  "C2'" . U   B  2  44   ? 284.843 214.564 292.528 1.00 150.67 ? 44   U   2 "C2'" 1 
ATOM   1476  O  "O2'" . U   B  2  44   ? 285.518 214.867 293.740 1.00 150.67 ? 44   U   2 "O2'" 1 
ATOM   1477  C  "C1'" . U   B  2  44   ? 284.155 215.839 292.025 1.00 150.67 ? 44   U   2 "C1'" 1 
ATOM   1478  N  N1    . U   B  2  44   ? 282.825 215.586 291.412 1.00 150.67 ? 44   U   2 N1    1 
ATOM   1479  C  C2    . U   B  2  44   ? 281.730 215.855 292.211 1.00 150.67 ? 44   U   2 C2    1 
ATOM   1480  O  O2    . U   B  2  44   ? 281.833 216.278 293.349 1.00 150.67 ? 44   U   2 O2    1 
ATOM   1481  N  N3    . U   B  2  44   ? 280.508 215.622 291.630 1.00 150.67 ? 44   U   2 N3    1 
ATOM   1482  C  C4    . U   B  2  44   ? 280.266 215.149 290.357 1.00 150.67 ? 44   U   2 C4    1 
ATOM   1483  O  O4    . U   B  2  44   ? 279.105 214.988 289.980 1.00 150.67 ? 44   U   2 O4    1 
ATOM   1484  C  C5    . U   B  2  44   ? 281.444 214.891 289.589 1.00 150.67 ? 44   U   2 C5    1 
ATOM   1485  C  C6    . U   B  2  44   ? 282.648 215.112 290.128 1.00 150.67 ? 44   U   2 C6    1 
ATOM   1486  P  P     . C   B  2  45   ? 286.873 211.899 291.756 1.00 152.81 ? 45   C   2 P     1 
ATOM   1487  O  OP1   . C   B  2  45   ? 288.114 211.399 291.111 1.00 152.81 ? 45   C   2 OP1   1 
ATOM   1488  O  OP2   . C   B  2  45   ? 285.551 211.521 291.194 1.00 152.81 ? 45   C   2 OP2   1 
ATOM   1489  O  "O5'" . C   B  2  45   ? 286.900 211.461 293.287 1.00 152.81 ? 45   C   2 "O5'" 1 
ATOM   1490  C  "C5'" . C   B  2  45   ? 286.101 210.384 293.753 1.00 152.81 ? 45   C   2 "C5'" 1 
ATOM   1491  C  "C4'" . C   B  2  45   ? 285.532 210.678 295.117 1.00 152.81 ? 45   C   2 "C4'" 1 
ATOM   1492  O  "O4'" . C   B  2  45   ? 284.887 211.978 295.105 1.00 152.81 ? 45   C   2 "O4'" 1 
ATOM   1493  C  "C3'" . C   B  2  45   ? 284.447 209.732 295.609 1.00 152.81 ? 45   C   2 "C3'" 1 
ATOM   1494  O  "O3'" . C   B  2  45   ? 284.966 208.532 296.154 1.00 152.81 ? 45   C   2 "O3'" 1 
ATOM   1495  C  "C2'" . C   B  2  45   ? 283.689 210.586 296.620 1.00 152.81 ? 45   C   2 "C2'" 1 
ATOM   1496  O  "O2'" . C   B  2  45   ? 284.370 210.612 297.866 1.00 152.81 ? 45   C   2 "O2'" 1 
ATOM   1497  C  "C1'" . C   B  2  45   ? 283.784 211.978 295.987 1.00 152.81 ? 45   C   2 "C1'" 1 
ATOM   1498  N  N1    . C   B  2  45   ? 282.560 212.358 295.239 1.00 152.81 ? 45   C   2 N1    1 
ATOM   1499  C  C2    . C   B  2  45   ? 281.510 212.957 295.944 1.00 152.81 ? 45   C   2 C2    1 
ATOM   1500  O  O2    . C   B  2  45   ? 281.629 213.147 297.164 1.00 152.81 ? 45   C   2 O2    1 
ATOM   1501  N  N3    . C   B  2  45   ? 280.385 213.316 295.283 1.00 152.81 ? 45   C   2 N3    1 
ATOM   1502  C  C4    . C   B  2  45   ? 280.282 213.103 293.971 1.00 152.81 ? 45   C   2 C4    1 
ATOM   1503  N  N4    . C   B  2  45   ? 279.150 213.472 293.366 1.00 152.81 ? 45   C   2 N4    1 
ATOM   1504  C  C5    . C   B  2  45   ? 281.331 212.498 293.222 1.00 152.81 ? 45   C   2 C5    1 
ATOM   1505  C  C6    . C   B  2  45   ? 282.438 212.151 293.889 1.00 152.81 ? 45   C   2 C6    1 
ATOM   1506  P  P     . A   B  2  48   ? 291.518 200.952 300.551 1.00 148.70 ? 48   A   2 P     1 
ATOM   1507  O  OP1   . A   B  2  48   ? 292.078 200.905 299.176 1.00 148.70 ? 48   A   2 OP1   1 
ATOM   1508  O  OP2   . A   B  2  48   ? 290.158 201.505 300.773 1.00 148.70 ? 48   A   2 OP2   1 
ATOM   1509  O  "O5'" . A   B  2  48   ? 292.534 201.763 301.472 1.00 148.70 ? 48   A   2 "O5'" 1 
ATOM   1510  C  "C5'" . A   B  2  48   ? 293.428 201.081 302.345 1.00 148.70 ? 48   A   2 "C5'" 1 
ATOM   1511  C  "C4'" . A   B  2  48   ? 293.324 201.565 303.774 1.00 148.70 ? 48   A   2 "C4'" 1 
ATOM   1512  O  "O4'" . A   B  2  48   ? 294.035 202.825 303.919 1.00 148.70 ? 48   A   2 "O4'" 1 
ATOM   1513  C  "C3'" . A   B  2  48   ? 291.907 201.802 304.304 1.00 148.70 ? 48   A   2 "C3'" 1 
ATOM   1514  O  "O3'" . A   B  2  48   ? 291.826 201.367 305.661 1.00 148.70 ? 48   A   2 "O3'" 1 
ATOM   1515  C  "C2'" . A   B  2  48   ? 291.766 203.324 304.246 1.00 148.70 ? 48   A   2 "C2'" 1 
ATOM   1516  O  "O2'" . A   B  2  48   ? 290.847 203.864 305.171 1.00 148.70 ? 48   A   2 "O2'" 1 
ATOM   1517  C  "C1'" . A   B  2  48   ? 293.193 203.780 304.533 1.00 148.70 ? 48   A   2 "C1'" 1 
ATOM   1518  N  N9    . A   B  2  48   ? 293.522 205.100 303.987 1.00 148.70 ? 48   A   2 N9    1 
ATOM   1519  C  C8    . A   B  2  48   ? 292.702 205.950 303.287 1.00 148.70 ? 48   A   2 C8    1 
ATOM   1520  N  N7    . A   B  2  48   ? 293.281 207.072 302.931 1.00 148.70 ? 48   A   2 N7    1 
ATOM   1521  C  C5    . A   B  2  48   ? 294.569 206.954 303.434 1.00 148.70 ? 48   A   2 C5    1 
ATOM   1522  C  C6    . A   B  2  48   ? 295.688 207.805 303.399 1.00 148.70 ? 48   A   2 C6    1 
ATOM   1523  N  N6    . A   B  2  48   ? 295.688 209.002 302.806 1.00 148.70 ? 48   A   2 N6    1 
ATOM   1524  N  N1    . A   B  2  48   ? 296.825 207.384 304.000 1.00 148.70 ? 48   A   2 N1    1 
ATOM   1525  C  C2    . A   B  2  48   ? 296.836 206.185 304.598 1.00 148.70 ? 48   A   2 C2    1 
ATOM   1526  N  N3    . A   B  2  48   ? 295.848 205.297 304.697 1.00 148.70 ? 48   A   2 N3    1 
ATOM   1527  C  C4    . A   B  2  48   ? 294.731 205.746 304.091 1.00 148.70 ? 48   A   2 C4    1 
ATOM   1528  P  P     . U   B  2  49   ? 290.934 200.085 306.046 1.00 153.79 ? 49   U   2 P     1 
ATOM   1529  O  OP1   . U   B  2  49   ? 290.860 199.204 304.853 1.00 153.79 ? 49   U   2 OP1   1 
ATOM   1530  O  OP2   . U   B  2  49   ? 289.681 200.570 306.677 1.00 153.79 ? 49   U   2 OP2   1 
ATOM   1531  O  "O5'" . U   B  2  49   ? 291.794 199.336 307.159 1.00 153.79 ? 49   U   2 "O5'" 1 
ATOM   1532  C  "C5'" . U   B  2  49   ? 291.197 198.398 308.049 1.00 153.79 ? 49   U   2 "C5'" 1 
ATOM   1533  C  "C4'" . U   B  2  49   ? 291.374 198.807 309.493 1.00 153.79 ? 49   U   2 "C4'" 1 
ATOM   1534  O  "O4'" . U   B  2  49   ? 292.571 199.625 309.611 1.00 153.79 ? 49   U   2 "O4'" 1 
ATOM   1535  C  "C3'" . U   B  2  49   ? 290.236 199.641 310.074 1.00 153.79 ? 49   U   2 "C3'" 1 
ATOM   1536  O  "O3'" . U   B  2  49   ? 290.132 199.383 311.474 1.00 153.79 ? 49   U   2 "O3'" 1 
ATOM   1537  C  "C2'" . U   B  2  49   ? 290.733 201.065 309.862 1.00 153.79 ? 49   U   2 "C2'" 1 
ATOM   1538  O  "O2'" . U   B  2  49   ? 290.154 202.023 310.723 1.00 153.79 ? 49   U   2 "O2'" 1 
ATOM   1539  C  "C1'" . U   B  2  49   ? 292.229 200.902 310.120 1.00 153.79 ? 49   U   2 "C1'" 1 
ATOM   1540  N  N1    . U   B  2  49   ? 293.072 201.905 309.451 1.00 153.79 ? 49   U   2 N1    1 
ATOM   1541  C  C2    . U   B  2  49   ? 293.195 203.158 310.022 1.00 153.79 ? 49   U   2 C2    1 
ATOM   1542  O  O2    . U   B  2  49   ? 292.630 203.489 311.050 1.00 153.79 ? 49   U   2 O2    1 
ATOM   1543  N  N3    . U   B  2  49   ? 294.001 204.029 309.333 1.00 153.79 ? 49   U   2 N3    1 
ATOM   1544  C  C4    . U   B  2  49   ? 294.694 203.783 308.167 1.00 153.79 ? 49   U   2 C4    1 
ATOM   1545  O  O4    . U   B  2  49   ? 295.384 204.675 307.672 1.00 153.79 ? 49   U   2 O4    1 
ATOM   1546  C  C5    . U   B  2  49   ? 294.524 202.463 307.645 1.00 153.79 ? 49   U   2 C5    1 
ATOM   1547  C  C6    . U   B  2  49   ? 293.742 201.594 308.291 1.00 153.79 ? 49   U   2 C6    1 
ATOM   1548  P  P     . C   B  2  50   ? 288.735 198.918 312.116 1.00 138.97 ? 50   C   2 P     1 
ATOM   1549  O  OP1   . C   B  2  50   ? 288.586 197.458 311.890 1.00 138.97 ? 50   C   2 OP1   1 
ATOM   1550  O  OP2   . C   B  2  50   ? 287.679 199.846 311.641 1.00 138.97 ? 50   C   2 OP2   1 
ATOM   1551  O  "O5'" . C   B  2  50   ? 288.935 199.156 313.679 1.00 138.97 ? 50   C   2 "O5'" 1 
ATOM   1552  C  "C5'" . C   B  2  50   ? 288.968 200.469 314.222 1.00 138.97 ? 50   C   2 "C5'" 1 
ATOM   1553  C  "C4'" . C   B  2  50   ? 290.004 200.592 315.312 1.00 138.97 ? 50   C   2 "C4'" 1 
ATOM   1554  O  "O4'" . C   B  2  50   ? 291.242 201.105 314.755 1.00 138.97 ? 50   C   2 "O4'" 1 
ATOM   1555  C  "C3'" . C   B  2  50   ? 289.678 201.563 316.436 1.00 138.97 ? 50   C   2 "C3'" 1 
ATOM   1556  O  "O3'" . C   B  2  50   ? 288.801 201.016 317.404 1.00 138.97 ? 50   C   2 "O3'" 1 
ATOM   1557  C  "C2'" . C   B  2  50   ? 291.056 201.911 316.987 1.00 138.97 ? 50   C   2 "C2'" 1 
ATOM   1558  O  "O2'" . C   B  2  50   ? 291.523 200.888 317.854 1.00 138.97 ? 50   C   2 "O2'" 1 
ATOM   1559  C  "C1'" . C   B  2  50   ? 291.912 201.895 315.716 1.00 138.97 ? 50   C   2 "C1'" 1 
ATOM   1560  N  N1    . C   B  2  50   ? 292.144 203.253 315.162 1.00 138.97 ? 50   C   2 N1    1 
ATOM   1561  C  C2    . C   B  2  50   ? 293.209 204.009 315.671 1.00 138.97 ? 50   C   2 C2    1 
ATOM   1562  O  O2    . C   B  2  50   ? 293.923 203.529 316.565 1.00 138.97 ? 50   C   2 O2    1 
ATOM   1563  N  N3    . C   B  2  50   ? 293.440 205.248 315.179 1.00 138.97 ? 50   C   2 N3    1 
ATOM   1564  C  C4    . C   B  2  50   ? 292.662 205.745 314.218 1.00 138.97 ? 50   C   2 C4    1 
ATOM   1565  N  N4    . C   B  2  50   ? 292.930 206.972 313.765 1.00 138.97 ? 50   C   2 N4    1 
ATOM   1566  C  C5    . C   B  2  50   ? 291.574 205.004 313.677 1.00 138.97 ? 50   C   2 C5    1 
ATOM   1567  C  C6    . C   B  2  50   ? 291.357 203.778 314.170 1.00 138.97 ? 50   C   2 C6    1 
ATOM   1568  P  P     . A   B  2  51   ? 287.400 201.736 317.723 1.00 139.45 ? 51   A   2 P     1 
ATOM   1569  O  OP1   . A   B  2  51   ? 286.636 200.862 318.649 1.00 139.45 ? 51   A   2 OP1   1 
ATOM   1570  O  OP2   . A   B  2  51   ? 286.791 202.149 316.433 1.00 139.45 ? 51   A   2 OP2   1 
ATOM   1571  O  "O5'" . A   B  2  51   ? 287.812 203.053 318.518 1.00 139.45 ? 51   A   2 "O5'" 1 
ATOM   1572  C  "C5'" . A   B  2  51   ? 288.329 202.976 319.838 1.00 139.45 ? 51   A   2 "C5'" 1 
ATOM   1573  C  "C4'" . A   B  2  51   ? 288.834 204.314 320.315 1.00 139.45 ? 51   A   2 "C4'" 1 
ATOM   1574  O  "O4'" . A   B  2  51   ? 289.955 204.736 319.494 1.00 139.45 ? 51   A   2 "O4'" 1 
ATOM   1575  C  "C3'" . A   B  2  51   ? 287.852 205.472 320.219 1.00 139.45 ? 51   A   2 "C3'" 1 
ATOM   1576  O  "O3'" . A   B  2  51   ? 286.923 205.505 321.289 1.00 139.45 ? 51   A   2 "O3'" 1 
ATOM   1577  C  "C2'" . A   B  2  51   ? 288.774 206.682 320.169 1.00 139.45 ? 51   A   2 "C2'" 1 
ATOM   1578  O  "O2'" . A   B  2  51   ? 289.262 206.996 321.465 1.00 139.45 ? 51   A   2 "O2'" 1 
ATOM   1579  C  "C1'" . A   B  2  51   ? 289.935 206.139 319.336 1.00 139.45 ? 51   A   2 "C1'" 1 
ATOM   1580  N  N9    . A   B  2  51   ? 289.771 206.447 317.903 1.00 139.45 ? 51   A   2 N9    1 
ATOM   1581  C  C8    . A   B  2  51   ? 289.286 205.627 316.914 1.00 139.45 ? 51   A   2 C8    1 
ATOM   1582  N  N7    . A   B  2  51   ? 289.256 206.189 315.730 1.00 139.45 ? 51   A   2 N7    1 
ATOM   1583  C  C5    . A   B  2  51   ? 289.753 207.464 315.956 1.00 139.45 ? 51   A   2 C5    1 
ATOM   1584  C  C6    . A   B  2  51   ? 289.980 208.563 315.108 1.00 139.45 ? 51   A   2 C6    1 
ATOM   1585  N  N6    . A   B  2  51   ? 289.723 208.552 313.798 1.00 139.45 ? 51   A   2 N6    1 
ATOM   1586  N  N1    . A   B  2  51   ? 290.487 209.691 315.657 1.00 139.45 ? 51   A   2 N1    1 
ATOM   1587  C  C2    . A   B  2  51   ? 290.749 209.715 316.971 1.00 139.45 ? 51   A   2 C2    1 
ATOM   1588  N  N3    . A   B  2  51   ? 290.578 208.746 317.867 1.00 139.45 ? 51   A   2 N3    1 
ATOM   1589  C  C4    . A   B  2  51   ? 290.073 207.639 317.291 1.00 139.45 ? 51   A   2 C4    1 
ATOM   1590  P  P     . G   B  2  52   ? 285.344 205.470 320.990 1.00 131.20 ? 52   G   2 P     1 
ATOM   1591  O  OP1   . G   B  2  52   ? 284.682 204.754 322.110 1.00 131.20 ? 52   G   2 OP1   1 
ATOM   1592  O  OP2   . G   B  2  52   ? 285.153 204.991 319.598 1.00 131.20 ? 52   G   2 OP2   1 
ATOM   1593  O  "O5'" . G   B  2  52   ? 284.900 207.000 321.050 1.00 131.20 ? 52   G   2 "O5'" 1 
ATOM   1594  C  "C5'" . G   B  2  52   ? 284.909 207.714 322.278 1.00 131.20 ? 52   G   2 "C5'" 1 
ATOM   1595  C  "C4'" . G   B  2  52   ? 285.493 209.094 322.111 1.00 131.20 ? 52   G   2 "C4'" 1 
ATOM   1596  O  "O4'" . G   B  2  52   ? 286.661 209.023 321.252 1.00 131.20 ? 52   G   2 "O4'" 1 
ATOM   1597  C  "C3'" . G   B  2  52   ? 284.601 210.125 321.434 1.00 131.20 ? 52   G   2 "C3'" 1 
ATOM   1598  O  "O3'" . G   B  2  52   ? 283.665 210.715 322.320 1.00 131.20 ? 52   G   2 "O3'" 1 
ATOM   1599  C  "C2'" . G   B  2  52   ? 285.610 211.116 320.870 1.00 131.20 ? 52   G   2 "C2'" 1 
ATOM   1600  O  "O2'" . G   B  2  52   ? 286.090 211.980 321.890 1.00 131.20 ? 52   G   2 "O2'" 1 
ATOM   1601  C  "C1'" . G   B  2  52   ? 286.746 210.184 320.454 1.00 131.20 ? 52   G   2 "C1'" 1 
ATOM   1602  N  N9    . G   B  2  52   ? 286.643 209.792 319.036 1.00 131.20 ? 52   G   2 N9    1 
ATOM   1603  C  C8    . G   B  2  52   ? 286.117 208.632 318.519 1.00 131.20 ? 52   G   2 C8    1 
ATOM   1604  N  N7    . G   B  2  52   ? 286.168 208.584 317.215 1.00 131.20 ? 52   G   2 N7    1 
ATOM   1605  C  C5    . G   B  2  52   ? 286.761 209.785 316.850 1.00 131.20 ? 52   G   2 C5    1 
ATOM   1606  C  C6    . G   B  2  52   ? 287.082 210.306 315.569 1.00 131.20 ? 52   G   2 C6    1 
ATOM   1607  O  O6    . G   B  2  52   ? 286.901 209.797 314.457 1.00 131.20 ? 52   G   2 O6    1 
ATOM   1608  N  N1    . G   B  2  52   ? 287.674 211.562 315.658 1.00 131.20 ? 52   G   2 N1    1 
ATOM   1609  C  C2    . G   B  2  52   ? 287.928 212.232 316.830 1.00 131.20 ? 52   G   2 C2    1 
ATOM   1610  N  N2    . G   B  2  52   ? 288.507 213.436 316.713 1.00 131.20 ? 52   G   2 N2    1 
ATOM   1611  N  N3    . G   B  2  52   ? 287.634 211.759 318.029 1.00 131.20 ? 52   G   2 N3    1 
ATOM   1612  C  C4    . G   B  2  52   ? 287.058 210.541 317.963 1.00 131.20 ? 52   G   2 C4    1 
ATOM   1613  P  P     . U   B  2  53   ? 282.216 211.166 321.788 1.00 115.76 ? 53   U   2 P     1 
ATOM   1614  O  OP1   . U   B  2  53   ? 281.401 211.569 322.962 1.00 115.76 ? 53   U   2 OP1   1 
ATOM   1615  O  OP2   . U   B  2  53   ? 281.713 210.110 320.873 1.00 115.76 ? 53   U   2 OP2   1 
ATOM   1616  O  "O5'" . U   B  2  53   ? 282.506 212.471 320.921 1.00 115.76 ? 53   U   2 "O5'" 1 
ATOM   1617  C  "C5'" . U   B  2  53   ? 282.983 213.664 321.527 1.00 115.76 ? 53   U   2 "C5'" 1 
ATOM   1618  C  "C4'" . U   B  2  53   ? 283.138 214.771 320.515 1.00 115.76 ? 53   U   2 "C4'" 1 
ATOM   1619  O  "O4'" . U   B  2  53   ? 284.077 214.366 319.485 1.00 115.76 ? 53   U   2 "O4'" 1 
ATOM   1620  C  "C3'" . U   B  2  53   ? 281.881 215.141 319.745 1.00 115.76 ? 53   U   2 "C3'" 1 
ATOM   1621  O  "O3'" . U   B  2  53   ? 281.028 216.008 320.472 1.00 115.76 ? 53   U   2 "O3'" 1 
ATOM   1622  C  "C2'" . U   B  2  53   ? 282.437 215.760 318.469 1.00 115.76 ? 53   U   2 "C2'" 1 
ATOM   1623  O  "O2'" . U   B  2  53   ? 282.826 217.107 318.692 1.00 115.76 ? 53   U   2 "O2'" 1 
ATOM   1624  C  "C1'" . U   B  2  53   ? 283.700 214.923 318.242 1.00 115.76 ? 53   U   2 "C1'" 1 
ATOM   1625  N  N1    . U   B  2  53   ? 283.498 213.825 317.262 1.00 115.76 ? 53   U   2 N1    1 
ATOM   1626  C  C2    . U   B  2  53   ? 283.541 214.132 315.910 1.00 115.76 ? 53   U   2 C2    1 
ATOM   1627  O  O2    . U   B  2  53   ? 283.726 215.257 315.477 1.00 115.76 ? 53   U   2 O2    1 
ATOM   1628  N  N3    . U   B  2  53   ? 283.354 213.065 315.065 1.00 115.76 ? 53   U   2 N3    1 
ATOM   1629  C  C4    . U   B  2  53   ? 283.138 211.749 315.416 1.00 115.76 ? 53   U   2 C4    1 
ATOM   1630  O  O4    . U   B  2  53   ? 282.987 210.901 314.536 1.00 115.76 ? 53   U   2 O4    1 
ATOM   1631  C  C5    . U   B  2  53   ? 283.114 211.509 316.825 1.00 115.76 ? 53   U   2 C5    1 
ATOM   1632  C  C6    . U   B  2  53   ? 283.293 212.526 317.673 1.00 115.76 ? 53   U   2 C6    1 
ATOM   1633  P  P     . U   B  2  54   ? 279.550 215.531 320.888 1.00 93.65  ? 54   U   2 P     1 
ATOM   1634  O  OP1   . U   B  2  54   ? 278.992 216.532 321.831 1.00 93.65  ? 54   U   2 OP1   1 
ATOM   1635  O  OP2   . U   B  2  54   ? 279.624 214.104 321.291 1.00 93.65  ? 54   U   2 OP2   1 
ATOM   1636  O  "O5'" . U   B  2  54   ? 278.722 215.617 319.530 1.00 93.65  ? 54   U   2 "O5'" 1 
ATOM   1637  C  "C5'" . U   B  2  54   ? 278.660 216.827 318.790 1.00 93.65  ? 54   U   2 "C5'" 1 
ATOM   1638  C  "C4'" . U   B  2  54   ? 278.413 216.564 317.327 1.00 93.65  ? 54   U   2 "C4'" 1 
ATOM   1639  O  "O4'" . U   B  2  54   ? 279.476 215.732 316.792 1.00 93.65  ? 54   U   2 "O4'" 1 
ATOM   1640  C  "C3'" . U   B  2  54   ? 277.145 215.794 316.996 1.00 93.65  ? 54   U   2 "C3'" 1 
ATOM   1641  O  "O3'" . U   B  2  54   ? 275.986 216.609 316.995 1.00 93.65  ? 54   U   2 "O3'" 1 
ATOM   1642  C  "C2'" . U   B  2  54   ? 277.470 215.183 315.639 1.00 93.65  ? 54   U   2 "C2'" 1 
ATOM   1643  O  "O2'" . U   B  2  54   ? 277.306 216.142 314.605 1.00 93.65  ? 54   U   2 "O2'" 1 
ATOM   1644  C  "C1'" . U   B  2  54   ? 278.964 214.881 315.787 1.00 93.65  ? 54   U   2 "C1'" 1 
ATOM   1645  N  N1    . U   B  2  54   ? 279.229 213.469 316.160 1.00 93.65  ? 54   U   2 N1    1 
ATOM   1646  C  C2    . U   B  2  54   ? 279.243 212.526 315.146 1.00 93.65  ? 54   U   2 C2    1 
ATOM   1647  O  O2    . U   B  2  54   ? 279.045 212.797 313.973 1.00 93.65  ? 54   U   2 O2    1 
ATOM   1648  N  N3    . U   B  2  54   ? 279.497 211.239 315.550 1.00 93.65  ? 54   U   2 N3    1 
ATOM   1649  C  C4    . U   B  2  54   ? 279.738 210.799 316.835 1.00 93.65  ? 54   U   2 C4    1 
ATOM   1650  O  O4    . U   B  2  54   ? 279.951 209.603 317.037 1.00 93.65  ? 54   U   2 O4    1 
ATOM   1651  C  C5    . U   B  2  54   ? 279.711 211.828 317.828 1.00 93.65  ? 54   U   2 C5    1 
ATOM   1652  C  C6    . U   B  2  54   ? 279.469 213.091 317.464 1.00 93.65  ? 54   U   2 C6    1 
ATOM   1653  P  P     . U   B  2  55   ? 274.609 216.052 317.609 1.00 62.17  ? 55   U   2 P     1 
ATOM   1654  O  OP1   . U   B  2  55   ? 273.669 217.194 317.745 1.00 62.17  ? 55   U   2 OP1   1 
ATOM   1655  O  OP2   . U   B  2  55   ? 274.936 215.224 318.798 1.00 62.17  ? 55   U   2 OP2   1 
ATOM   1656  O  "O5'" . U   B  2  55   ? 274.049 215.085 316.475 1.00 62.17  ? 55   U   2 "O5'" 1 
ATOM   1657  C  "C5'" . U   B  2  55   ? 273.785 215.574 315.168 1.00 62.17  ? 55   U   2 "C5'" 1 
ATOM   1658  C  "C4'" . U   B  2  55   ? 273.607 214.448 314.182 1.00 62.17  ? 55   U   2 "C4'" 1 
ATOM   1659  O  "O4'" . U   B  2  55   ? 274.857 213.727 314.017 1.00 62.17  ? 55   U   2 "O4'" 1 
ATOM   1660  C  "C3'" . U   B  2  55   ? 272.617 213.368 314.579 1.00 62.17  ? 55   U   2 "C3'" 1 
ATOM   1661  O  "O3'" . U   B  2  55   ? 271.266 213.736 314.375 1.00 62.17  ? 55   U   2 "O3'" 1 
ATOM   1662  C  "C2'" . U   B  2  55   ? 273.071 212.181 313.739 1.00 62.17  ? 55   U   2 "C2'" 1 
ATOM   1663  O  "O2'" . U   B  2  55   ? 272.617 212.311 312.400 1.00 62.17  ? 55   U   2 "O2'" 1 
ATOM   1664  C  "C1'" . U   B  2  55   ? 274.592 212.363 313.755 1.00 62.17  ? 55   U   2 "C1'" 1 
ATOM   1665  N  N1    . U   B  2  55   ? 275.253 211.525 314.788 1.00 62.17  ? 55   U   2 N1    1 
ATOM   1666  C  C2    . U   B  2  55   ? 275.518 210.204 314.467 1.00 62.17  ? 55   U   2 C2    1 
ATOM   1667  O  O2    . U   B  2  55   ? 275.235 209.704 313.391 1.00 62.17  ? 55   U   2 O2    1 
ATOM   1668  N  N3    . U   B  2  55   ? 276.129 209.473 315.455 1.00 62.17  ? 55   U   2 N3    1 
ATOM   1669  C  C4    . U   B  2  55   ? 276.499 209.911 316.709 1.00 62.17  ? 55   U   2 C4    1 
ATOM   1670  O  O4    . U   B  2  55   ? 277.044 209.129 317.489 1.00 62.17  ? 55   U   2 O4    1 
ATOM   1671  C  C5    . U   B  2  55   ? 276.198 211.284 316.969 1.00 62.17  ? 55   U   2 C5    1 
ATOM   1672  C  C6    . U   B  2  55   ? 275.605 212.022 316.025 1.00 62.17  ? 55   U   2 C6    1 
ATOM   1673  P  P     . A   B  2  56   ? 270.163 213.331 315.469 1.00 36.42  ? 56   A   2 P     1 
ATOM   1674  O  OP1   . A   B  2  56   ? 268.826 213.660 314.916 1.00 36.42  ? 56   A   2 OP1   1 
ATOM   1675  O  OP2   . A   B  2  56   ? 270.577 213.901 316.776 1.00 36.42  ? 56   A   2 OP2   1 
ATOM   1676  O  "O5'" . A   B  2  56   ? 270.293 211.746 315.563 1.00 36.42  ? 56   A   2 "O5'" 1 
ATOM   1677  C  "C5'" . A   B  2  56   ? 269.848 211.038 316.710 1.00 36.42  ? 56   A   2 "C5'" 1 
ATOM   1678  C  "C4'" . A   B  2  56   ? 269.257 209.705 316.331 1.00 36.42  ? 56   A   2 "C4'" 1 
ATOM   1679  O  "O4'" . A   B  2  56   ? 268.157 209.907 315.408 1.00 36.42  ? 56   A   2 "O4'" 1 
ATOM   1680  C  "C3'" . A   B  2  56   ? 270.191 208.751 315.604 1.00 36.42  ? 56   A   2 "C3'" 1 
ATOM   1681  O  "O3'" . A   B  2  56   ? 271.016 208.020 316.494 1.00 36.42  ? 56   A   2 "O3'" 1 
ATOM   1682  C  "C2'" . A   B  2  56   ? 269.232 207.873 314.808 1.00 36.42  ? 56   A   2 "C2'" 1 
ATOM   1683  O  "O2'" . A   B  2  56   ? 268.685 206.852 315.629 1.00 36.42  ? 56   A   2 "O2'" 1 
ATOM   1684  C  "C1'" . A   B  2  56   ? 268.118 208.862 314.461 1.00 36.42  ? 56   A   2 "C1'" 1 
ATOM   1685  N  N9    . A   B  2  56   ? 268.266 209.448 313.114 1.00 36.42  ? 56   A   2 N9    1 
ATOM   1686  C  C8    . A   B  2  56   ? 268.473 210.773 312.818 1.00 36.42  ? 56   A   2 C8    1 
ATOM   1687  N  N7    . A   B  2  56   ? 268.554 211.027 311.536 1.00 36.42  ? 56   A   2 N7    1 
ATOM   1688  C  C5    . A   B  2  56   ? 268.380 209.786 310.944 1.00 36.42  ? 56   A   2 C5    1 
ATOM   1689  C  C6    . A   B  2  56   ? 268.357 209.373 309.600 1.00 36.42  ? 56   A   2 C6    1 
ATOM   1690  N  N6    . A   B  2  56   ? 268.522 210.208 308.571 1.00 36.42  ? 56   A   2 N6    1 
ATOM   1691  N  N1    . A   B  2  56   ? 268.165 208.060 309.341 1.00 36.42  ? 56   A   2 N1    1 
ATOM   1692  C  C2    . A   B  2  56   ? 268.000 207.216 310.368 1.00 36.42  ? 56   A   2 C2    1 
ATOM   1693  N  N3    . A   B  2  56   ? 268.000 207.486 311.672 1.00 36.42  ? 56   A   2 N3    1 
ATOM   1694  C  C4    . A   B  2  56   ? 268.196 208.800 311.900 1.00 36.42  ? 56   A   2 C4    1 
ATOM   1695  P  P     . A   B  2  57   ? 272.599 208.284 316.538 1.00 49.54  ? 57   A   2 P     1 
ATOM   1696  O  OP1   . A   B  2  57   ? 273.089 207.921 317.892 1.00 49.54  ? 57   A   2 OP1   1 
ATOM   1697  O  OP2   . A   B  2  57   ? 272.848 209.649 316.012 1.00 49.54  ? 57   A   2 OP2   1 
ATOM   1698  O  "O5'" . A   B  2  57   ? 273.190 207.227 315.504 1.00 49.54  ? 57   A   2 "O5'" 1 
ATOM   1699  C  "C5'" . A   B  2  57   ? 272.958 205.837 315.678 1.00 49.54  ? 57   A   2 "C5'" 1 
ATOM   1700  C  "C4'" . A   B  2  57   ? 272.742 205.142 314.358 1.00 49.54  ? 57   A   2 "C4'" 1 
ATOM   1701  O  "O4'" . A   B  2  57   ? 271.601 205.727 313.677 1.00 49.54  ? 57   A   2 "O4'" 1 
ATOM   1702  C  "C3'" . A   B  2  57   ? 273.873 205.264 313.349 1.00 49.54  ? 57   A   2 "C3'" 1 
ATOM   1703  O  "O3'" . A   B  2  57   ? 274.937 204.361 313.590 1.00 49.54  ? 57   A   2 "O3'" 1 
ATOM   1704  C  "C2'" . A   B  2  57   ? 273.158 205.034 312.025 1.00 49.54  ? 57   A   2 "C2'" 1 
ATOM   1705  O  "O2'" . A   B  2  57   ? 272.901 203.652 311.827 1.00 49.54  ? 57   A   2 "O2'" 1 
ATOM   1706  C  "C1'" . A   B  2  57   ? 271.828 205.740 312.282 1.00 49.54  ? 57   A   2 "C1'" 1 
ATOM   1707  N  N9    . A   B  2  57   ? 271.859 207.143 311.827 1.00 49.54  ? 57   A   2 N9    1 
ATOM   1708  C  C8    . A   B  2  57   ? 272.069 208.271 312.581 1.00 49.54  ? 57   A   2 C8    1 
ATOM   1709  N  N7    . A   B  2  57   ? 272.045 209.384 311.890 1.00 49.54  ? 57   A   2 N7    1 
ATOM   1710  C  C5    . A   B  2  57   ? 271.807 208.959 310.591 1.00 49.54  ? 57   A   2 C5    1 
ATOM   1711  C  C6    . A   B  2  57   ? 271.669 209.648 309.373 1.00 49.54  ? 57   A   2 C6    1 
ATOM   1712  N  N6    . A   B  2  57   ? 271.753 210.976 309.262 1.00 49.54  ? 57   A   2 N6    1 
ATOM   1713  N  N1    . A   B  2  57   ? 271.434 208.920 308.257 1.00 49.54  ? 57   A   2 N1    1 
ATOM   1714  C  C2    . A   B  2  57   ? 271.348 207.587 308.356 1.00 49.54  ? 57   A   2 C2    1 
ATOM   1715  N  N3    . A   B  2  57   ? 271.461 206.828 309.444 1.00 49.54  ? 57   A   2 N3    1 
ATOM   1716  C  C4    . A   B  2  57   ? 271.692 207.581 310.536 1.00 49.54  ? 57   A   2 C4    1 
ATOM   1717  P  P     . U   B  2  58   ? 276.457 204.867 313.466 1.00 64.43  ? 58   U   2 P     1 
ATOM   1718  O  OP1   . U   B  2  58   ? 277.288 203.730 312.995 1.00 64.43  ? 58   U   2 OP1   1 
ATOM   1719  O  OP2   . U   B  2  58   ? 276.813 205.565 314.727 1.00 64.43  ? 58   U   2 OP2   1 
ATOM   1720  O  "O5'" . U   B  2  58   ? 276.398 205.955 312.305 1.00 64.43  ? 58   U   2 "O5'" 1 
ATOM   1721  C  "C5'" . U   B  2  58   ? 277.205 205.834 311.143 1.00 64.43  ? 58   U   2 "C5'" 1 
ATOM   1722  C  "C4'" . U   B  2  58   ? 276.392 206.019 309.887 1.00 64.43  ? 58   U   2 "C4'" 1 
ATOM   1723  O  "O4'" . U   B  2  58   ? 275.363 207.019 310.111 1.00 64.43  ? 58   U   2 "O4'" 1 
ATOM   1724  C  "C3'" . U   B  2  58   ? 277.149 206.536 308.674 1.00 64.43  ? 58   U   2 "C3'" 1 
ATOM   1725  O  "O3'" . U   B  2  58   ? 277.871 205.526 307.991 1.00 64.43  ? 58   U   2 "O3'" 1 
ATOM   1726  C  "C2'" . U   B  2  58   ? 276.047 207.174 307.837 1.00 64.43  ? 58   U   2 "C2'" 1 
ATOM   1727  O  "O2'" . U   B  2  58   ? 275.324 206.184 307.121 1.00 64.43  ? 58   U   2 "O2'" 1 
ATOM   1728  C  "C1'" . U   B  2  58   ? 275.132 207.749 308.923 1.00 64.43  ? 58   U   2 "C1'" 1 
ATOM   1729  N  N1    . U   B  2  58   ? 275.383 209.189 309.185 1.00 64.43  ? 58   U   2 N1    1 
ATOM   1730  C  C2    . U   B  2  58   ? 274.838 210.122 308.316 1.00 64.43  ? 58   U   2 C2    1 
ATOM   1731  O  O2    . U   B  2  58   ? 274.165 209.828 307.341 1.00 64.43  ? 58   U   2 O2    1 
ATOM   1732  N  N3    . U   B  2  58   ? 275.106 211.433 308.625 1.00 64.43  ? 58   U   2 N3    1 
ATOM   1733  C  C4    . U   B  2  58   ? 275.844 211.907 309.689 1.00 64.43  ? 58   U   2 C4    1 
ATOM   1734  O  O4    . U   B  2  58   ? 275.996 213.121 309.829 1.00 64.43  ? 58   U   2 O4    1 
ATOM   1735  C  C5    . U   B  2  58   ? 276.371 210.890 310.543 1.00 64.43  ? 58   U   2 C5    1 
ATOM   1736  C  C6    . U   B  2  58   ? 276.125 209.605 310.269 1.00 64.43  ? 58   U   2 C6    1 
ATOM   1737  P  P     . A   B  2  59   ? 279.329 205.845 307.396 1.00 80.94  ? 59   A   2 P     1 
ATOM   1738  O  OP1   . A   B  2  59   ? 279.757 204.683 306.575 1.00 80.94  ? 59   A   2 OP1   1 
ATOM   1739  O  OP2   . A   B  2  59   ? 280.189 206.311 308.514 1.00 80.94  ? 59   A   2 OP2   1 
ATOM   1740  O  "O5'" . A   B  2  59   ? 279.082 207.077 306.417 1.00 80.94  ? 59   A   2 "O5'" 1 
ATOM   1741  C  "C5'" . A   B  2  59   ? 280.142 207.951 306.060 1.00 80.94  ? 59   A   2 "C5'" 1 
ATOM   1742  C  "C4'" . A   B  2  59   ? 279.617 209.265 305.535 1.00 80.94  ? 59   A   2 "C4'" 1 
ATOM   1743  O  "O4'" . A   B  2  59   ? 278.651 209.814 306.469 1.00 80.94  ? 59   A   2 "O4'" 1 
ATOM   1744  C  "C3'" . A   B  2  59   ? 280.645 210.374 305.370 1.00 80.94  ? 59   A   2 "C3'" 1 
ATOM   1745  O  "O3'" . A   B  2  59   ? 281.385 210.267 304.167 1.00 80.94  ? 59   A   2 "O3'" 1 
ATOM   1746  C  "C2'" . A   B  2  59   ? 279.792 211.633 305.453 1.00 80.94  ? 59   A   2 "C2'" 1 
ATOM   1747  O  "O2'" . A   B  2  59   ? 279.124 211.868 304.222 1.00 80.94  ? 59   A   2 "O2'" 1 
ATOM   1748  C  "C1'" . A   B  2  59   ? 278.751 211.222 306.495 1.00 80.94  ? 59   A   2 "C1'" 1 
ATOM   1749  N  N9    . A   B  2  59   ? 279.139 211.637 307.857 1.00 80.94  ? 59   A   2 N9    1 
ATOM   1750  C  C8    . A   B  2  59   ? 279.619 210.844 308.870 1.00 80.94  ? 59   A   2 C8    1 
ATOM   1751  N  N7    . A   B  2  59   ? 279.878 211.498 309.976 1.00 80.94  ? 59   A   2 N7    1 
ATOM   1752  C  C5    . A   B  2  59   ? 279.546 212.810 309.670 1.00 80.94  ? 59   A   2 C5    1 
ATOM   1753  C  C6    . A   B  2  59   ? 279.590 214.002 310.416 1.00 80.94  ? 59   A   2 C6    1 
ATOM   1754  N  N6    . A   B  2  59   ? 280.006 214.066 311.682 1.00 80.94  ? 59   A   2 N6    1 
ATOM   1755  N  N1    . A   B  2  59   ? 279.187 215.143 309.810 1.00 80.94  ? 59   A   2 N1    1 
ATOM   1756  C  C2    . A   B  2  59   ? 278.767 215.090 308.539 1.00 80.94  ? 59   A   2 C2    1 
ATOM   1757  N  N3    . A   B  2  59   ? 278.681 214.029 307.737 1.00 80.94  ? 59   A   2 N3    1 
ATOM   1758  C  C4    . A   B  2  59   ? 279.089 212.912 308.368 1.00 80.94  ? 59   A   2 C4    1 
ATOM   1759  P  P     . U   B  2  60   ? 284.209 213.169 305.592 1.00 109.12 ? 60   U   2 P     1 
ATOM   1760  O  OP1   . U   B  2  60   ? 284.621 212.760 304.225 1.00 109.12 ? 60   U   2 OP1   1 
ATOM   1761  O  OP2   . U   B  2  60   ? 283.953 212.131 306.623 1.00 109.12 ? 60   U   2 OP2   1 
ATOM   1762  O  "O5'" . U   B  2  60   ? 285.312 214.166 306.162 1.00 109.12 ? 60   U   2 "O5'" 1 
ATOM   1763  C  "C5'" . U   B  2  60   ? 285.456 215.476 305.633 1.00 109.12 ? 60   U   2 "C5'" 1 
ATOM   1764  C  "C4'" . U   B  2  60   ? 285.644 216.495 306.728 1.00 109.12 ? 60   U   2 "C4'" 1 
ATOM   1765  O  "O4'" . U   B  2  60   ? 284.468 216.520 307.577 1.00 109.12 ? 60   U   2 "O4'" 1 
ATOM   1766  C  "C3'" . U   B  2  60   ? 286.791 216.231 307.691 1.00 109.12 ? 60   U   2 "C3'" 1 
ATOM   1767  O  "O3'" . U   B  2  60   ? 288.046 216.649 307.181 1.00 109.12 ? 60   U   2 "O3'" 1 
ATOM   1768  C  "C2'" . U   B  2  60   ? 286.360 216.985 308.944 1.00 109.12 ? 60   U   2 "C2'" 1 
ATOM   1769  O  "O2'" . U   B  2  60   ? 286.647 218.370 308.821 1.00 109.12 ? 60   U   2 "O2'" 1 
ATOM   1770  C  "C1'" . U   B  2  60   ? 284.839 216.801 308.910 1.00 109.12 ? 60   U   2 "C1'" 1 
ATOM   1771  N  N1    . U   B  2  60   ? 284.370 215.699 309.786 1.00 109.12 ? 60   U   2 N1    1 
ATOM   1772  C  C2    . U   B  2  60   ? 284.193 215.975 311.132 1.00 109.12 ? 60   U   2 C2    1 
ATOM   1773  O  O2    . U   B  2  60   ? 284.410 217.069 311.626 1.00 109.12 ? 60   U   2 O2    1 
ATOM   1774  N  N3    . U   B  2  60   ? 283.752 214.919 311.890 1.00 109.12 ? 60   U   2 N3    1 
ATOM   1775  C  C4    . U   B  2  60   ? 283.469 213.641 311.456 1.00 109.12 ? 60   U   2 C4    1 
ATOM   1776  O  O4    . U   B  2  60   ? 283.080 212.797 312.265 1.00 109.12 ? 60   U   2 O4    1 
ATOM   1777  C  C5    . U   B  2  60   ? 283.671 213.432 310.056 1.00 109.12 ? 60   U   2 C5    1 
ATOM   1778  C  C6    . U   B  2  60   ? 284.097 214.442 309.292 1.00 109.12 ? 60   U   2 C6    1 
ATOM   1779  P  P     . C   B  2  61   ? 289.302 215.646 307.191 1.00 127.32 ? 61   C   2 P     1 
ATOM   1780  O  OP1   . C   B  2  61   ? 290.250 216.085 306.137 1.00 127.32 ? 61   C   2 OP1   1 
ATOM   1781  O  OP2   . C   B  2  61   ? 288.779 214.256 307.177 1.00 127.32 ? 61   C   2 OP2   1 
ATOM   1782  O  "O5'" . C   B  2  61   ? 289.987 215.898 308.607 1.00 127.32 ? 61   C   2 "O5'" 1 
ATOM   1783  C  "C5'" . C   B  2  61   ? 290.376 217.203 309.009 1.00 127.32 ? 61   C   2 "C5'" 1 
ATOM   1784  C  "C4'" . C   B  2  61   ? 290.353 217.343 310.510 1.00 127.32 ? 61   C   2 "C4'" 1 
ATOM   1785  O  "O4'" . C   B  2  61   ? 289.024 217.026 311.004 1.00 127.32 ? 61   C   2 "O4'" 1 
ATOM   1786  C  "C3'" . C   B  2  61   ? 291.267 216.400 311.278 1.00 127.32 ? 61   C   2 "C3'" 1 
ATOM   1787  O  "O3'" . C   B  2  61   ? 292.610 216.851 311.331 1.00 127.32 ? 61   C   2 "O3'" 1 
ATOM   1788  C  "C2'" . C   B  2  61   ? 290.594 216.318 312.643 1.00 127.32 ? 61   C   2 "C2'" 1 
ATOM   1789  O  "O2'" . C   B  2  61   ? 290.912 217.457 313.429 1.00 127.32 ? 61   C   2 "O2'" 1 
ATOM   1790  C  "C1'" . C   B  2  61   ? 289.112 216.391 312.262 1.00 127.32 ? 61   C   2 "C1'" 1 
ATOM   1791  N  N1    . C   B  2  61   ? 288.469 215.054 312.176 1.00 127.32 ? 61   C   2 N1    1 
ATOM   1792  C  C2    . C   B  2  61   ? 288.040 214.417 313.350 1.00 127.32 ? 61   C   2 C2    1 
ATOM   1793  O  O2    . C   B  2  61   ? 288.209 214.963 314.451 1.00 127.32 ? 61   C   2 O2    1 
ATOM   1794  N  N3    . C   B  2  61   ? 287.451 213.200 313.273 1.00 127.32 ? 61   C   2 N3    1 
ATOM   1795  C  C4    . C   B  2  61   ? 287.269 212.616 312.088 1.00 127.32 ? 61   C   2 C4    1 
ATOM   1796  N  N4    . C   B  2  61   ? 286.682 211.417 312.061 1.00 127.32 ? 61   C   2 N4    1 
ATOM   1797  C  C5    . C   B  2  61   ? 287.685 213.235 310.876 1.00 127.32 ? 61   C   2 C5    1 
ATOM   1798  C  C6    . C   B  2  61   ? 288.266 214.437 310.969 1.00 127.32 ? 61   C   2 C6    1 
ATOM   1799  P  P     . U   B  2  62   ? 293.758 216.079 310.511 1.00 144.68 ? 62   U   2 P     1 
ATOM   1800  O  OP1   . U   B  2  62   ? 294.569 217.093 309.790 1.00 144.68 ? 62   U   2 OP1   1 
ATOM   1801  O  OP2   . U   B  2  62   ? 293.116 214.977 309.751 1.00 144.68 ? 62   U   2 OP2   1 
ATOM   1802  O  "O5'" . U   B  2  62   ? 294.674 215.427 311.640 1.00 144.68 ? 62   U   2 "O5'" 1 
ATOM   1803  C  "C5'" . U   B  2  62   ? 295.304 216.232 312.627 1.00 144.68 ? 62   U   2 "C5'" 1 
ATOM   1804  C  "C4'" . U   B  2  62   ? 294.954 215.767 314.018 1.00 144.68 ? 62   U   2 "C4'" 1 
ATOM   1805  O  "O4'" . U   B  2  62   ? 293.520 215.564 314.106 1.00 144.68 ? 62   U   2 "O4'" 1 
ATOM   1806  C  "C3'" . U   B  2  62   ? 295.544 214.431 314.444 1.00 144.68 ? 62   U   2 "C3'" 1 
ATOM   1807  O  "O3'" . U   B  2  62   ? 296.880 214.537 314.905 1.00 144.68 ? 62   U   2 "O3'" 1 
ATOM   1808  C  "C2'" . U   B  2  62   ? 294.567 213.955 315.513 1.00 144.68 ? 62   U   2 "C2'" 1 
ATOM   1809  O  "O2'" . U   B  2  62   ? 294.836 214.587 316.756 1.00 144.68 ? 62   U   2 "O2'" 1 
ATOM   1810  C  "C1'" . U   B  2  62   ? 293.236 214.491 314.978 1.00 144.68 ? 62   U   2 "C1'" 1 
ATOM   1811  N  N1    . U   B  2  62   ? 292.451 213.462 314.250 1.00 144.68 ? 62   U   2 N1    1 
ATOM   1812  C  C2    . U   B  2  62   ? 291.587 212.693 315.006 1.00 144.68 ? 62   U   2 C2    1 
ATOM   1813  O  O2    . U   B  2  62   ? 291.460 212.832 316.211 1.00 144.68 ? 62   U   2 O2    1 
ATOM   1814  N  N3    . U   B  2  62   ? 290.873 211.754 314.303 1.00 144.68 ? 62   U   2 N3    1 
ATOM   1815  C  C4    . U   B  2  62   ? 290.929 211.506 312.948 1.00 144.68 ? 62   U   2 C4    1 
ATOM   1816  O  O4    . U   B  2  62   ? 290.221 210.622 312.463 1.00 144.68 ? 62   U   2 O4    1 
ATOM   1817  C  C5    . U   B  2  62   ? 291.842 212.340 312.230 1.00 144.68 ? 62   U   2 C5    1 
ATOM   1818  C  C6    . U   B  2  62   ? 292.549 213.264 312.889 1.00 144.68 ? 62   U   2 C6    1 
ATOM   1819  P  P     . G   B  2  63   ? 298.027 213.592 314.292 1.00 144.07 ? 63   G   2 P     1 
ATOM   1820  O  OP1   . G   B  2  63   ? 299.297 213.897 314.999 1.00 144.07 ? 63   G   2 OP1   1 
ATOM   1821  O  OP2   . G   B  2  63   ? 297.967 213.697 312.812 1.00 144.07 ? 63   G   2 OP2   1 
ATOM   1822  O  "O5'" . G   B  2  63   ? 297.579 212.119 314.701 1.00 144.07 ? 63   G   2 "O5'" 1 
ATOM   1823  C  "C5'" . G   B  2  63   ? 297.572 211.706 316.061 1.00 144.07 ? 63   G   2 "C5'" 1 
ATOM   1824  C  "C4'" . G   B  2  63   ? 297.341 210.221 316.184 1.00 144.07 ? 63   G   2 "C4'" 1 
ATOM   1825  O  "O4'" . G   B  2  63   ? 296.058 209.874 315.596 1.00 144.07 ? 63   G   2 "O4'" 1 
ATOM   1826  C  "C3'" . G   B  2  63   ? 298.335 209.331 315.454 1.00 144.07 ? 63   G   2 "C3'" 1 
ATOM   1827  O  "O3'" . G   B  2  63   ? 299.541 209.134 316.170 1.00 144.07 ? 63   G   2 "O3'" 1 
ATOM   1828  C  "C2'" . G   B  2  63   ? 297.538 208.054 315.240 1.00 144.07 ? 63   G   2 "C2'" 1 
ATOM   1829  O  "O2'" . G   B  2  63   ? 297.481 207.291 316.436 1.00 144.07 ? 63   G   2 "O2'" 1 
ATOM   1830  C  "C1'" . G   B  2  63   ? 296.145 208.616 314.959 1.00 144.07 ? 63   G   2 "C1'" 1 
ATOM   1831  N  N9    . G   B  2  63   ? 295.902 208.809 313.515 1.00 144.07 ? 63   G   2 N9    1 
ATOM   1832  C  C8    . G   B  2  63   ? 295.681 210.011 312.886 1.00 144.07 ? 63   G   2 C8    1 
ATOM   1833  N  N7    . G   B  2  63   ? 295.492 209.895 311.601 1.00 144.07 ? 63   G   2 N7    1 
ATOM   1834  C  C5    . G   B  2  63   ? 295.591 208.532 311.361 1.00 144.07 ? 63   G   2 C5    1 
ATOM   1835  C  C6    . G   B  2  63   ? 295.475 207.805 310.147 1.00 144.07 ? 63   G   2 C6    1 
ATOM   1836  O  O6    . G   B  2  63   ? 295.254 208.236 309.009 1.00 144.07 ? 63   G   2 O6    1 
ATOM   1837  N  N1    . G   B  2  63   ? 295.644 206.439 310.349 1.00 144.07 ? 63   G   2 N1    1 
ATOM   1838  C  C2    . G   B  2  63   ? 295.892 205.846 311.562 1.00 144.07 ? 63   G   2 C2    1 
ATOM   1839  N  N2    . G   B  2  63   ? 296.028 204.512 311.565 1.00 144.07 ? 63   G   2 N2    1 
ATOM   1840  N  N3    . G   B  2  63   ? 296.000 206.513 312.696 1.00 144.07 ? 63   G   2 N3    1 
ATOM   1841  C  C4    . G   B  2  63   ? 295.842 207.845 312.531 1.00 144.07 ? 63   G   2 C4    1 
ATOM   1842  P  P     . A   B  2  64   ? 300.934 208.997 315.380 1.00 143.24 ? 64   A   2 P     1 
ATOM   1843  O  OP1   . A   B  2  64   ? 302.027 208.941 316.384 1.00 143.24 ? 64   A   2 OP1   1 
ATOM   1844  O  OP2   . A   B  2  64   ? 300.965 210.036 314.319 1.00 143.24 ? 64   A   2 OP2   1 
ATOM   1845  O  "O5'" . A   B  2  64   ? 300.844 207.572 314.672 1.00 143.24 ? 64   A   2 "O5'" 1 
ATOM   1846  C  "C5'" . A   B  2  64   ? 300.911 206.374 315.433 1.00 143.24 ? 64   A   2 "C5'" 1 
ATOM   1847  C  "C4'" . A   B  2  64   ? 301.032 205.158 314.548 1.00 143.24 ? 64   A   2 "C4'" 1 
ATOM   1848  O  "O4'" . A   B  2  64   ? 299.797 204.952 313.815 1.00 143.24 ? 64   A   2 "O4'" 1 
ATOM   1849  C  "C3'" . A   B  2  64   ? 302.096 205.221 313.464 1.00 143.24 ? 64   A   2 "C3'" 1 
ATOM   1850  O  "O3'" . A   B  2  64   ? 303.397 204.938 313.949 1.00 143.24 ? 64   A   2 "O3'" 1 
ATOM   1851  C  "C2'" . A   B  2  64   ? 301.591 204.209 312.444 1.00 143.24 ? 64   A   2 "C2'" 1 
ATOM   1852  O  "O2'" . A   B  2  64   ? 301.895 202.885 312.858 1.00 143.24 ? 64   A   2 "O2'" 1 
ATOM   1853  C  "C1'" . A   B  2  64   ? 300.078 204.410 312.541 1.00 143.24 ? 64   A   2 "C1'" 1 
ATOM   1854  N  N9    . A   B  2  64   ? 299.574 205.337 311.510 1.00 143.24 ? 64   A   2 N9    1 
ATOM   1855  C  C8    . A   B  2  64   ? 299.209 206.652 311.662 1.00 143.24 ? 64   A   2 C8    1 
ATOM   1856  N  N7    . A   B  2  64   ? 298.797 207.218 310.554 1.00 143.24 ? 64   A   2 N7    1 
ATOM   1857  C  C5    . A   B  2  64   ? 298.898 206.207 309.608 1.00 143.24 ? 64   A   2 C5    1 
ATOM   1858  C  C6    . A   B  2  64   ? 298.614 206.157 308.231 1.00 143.24 ? 64   A   2 C6    1 
ATOM   1859  N  N6    . A   B  2  64   ? 298.148 207.197 307.535 1.00 143.24 ? 64   A   2 N6    1 
ATOM   1860  N  N1    . A   B  2  64   ? 298.826 204.989 307.581 1.00 143.24 ? 64   A   2 N1    1 
ATOM   1861  C  C2    . A   B  2  64   ? 299.293 203.939 308.270 1.00 143.24 ? 64   A   2 C2    1 
ATOM   1862  N  N3    . A   B  2  64   ? 299.596 203.865 309.565 1.00 143.24 ? 64   A   2 N3    1 
ATOM   1863  C  C4    . A   B  2  64   ? 299.375 205.042 310.182 1.00 143.24 ? 64   A   2 C4    1 
ATOM   1864  N  N     . GLY C  3  500  ? 272.868 306.363 307.714 1.00 55.84  ? 500  GLY 3 N     1 
ATOM   1865  C  CA    . GLY C  3  500  ? 273.797 307.466 307.557 1.00 55.84  ? 500  GLY 3 CA    1 
ATOM   1866  C  C     . GLY C  3  500  ? 273.798 308.048 306.157 1.00 55.84  ? 500  GLY 3 C     1 
ATOM   1867  O  O     . GLY C  3  500  ? 273.967 309.254 305.975 1.00 55.84  ? 500  GLY 3 O     1 
ATOM   1868  N  N     . LEU C  3  501  ? 273.606 307.182 305.164 1.00 67.29  ? 501  LEU 3 N     1 
ATOM   1869  C  CA    . LEU C  3  501  ? 273.578 307.594 303.766 1.00 67.29  ? 501  LEU 3 CA    1 
ATOM   1870  C  C     . LEU C  3  501  ? 272.245 307.323 303.082 1.00 67.29  ? 501  LEU 3 C     1 
ATOM   1871  O  O     . LEU C  3  501  ? 271.978 307.934 302.040 1.00 67.29  ? 501  LEU 3 O     1 
ATOM   1872  C  CB    . LEU C  3  501  ? 274.719 306.903 302.992 1.00 67.29  ? 501  LEU 3 CB    1 
ATOM   1873  N  N     . ALA C  3  502  ? 271.391 306.462 303.644 1.00 66.96  ? 502  ALA 3 N     1 
ATOM   1874  C  CA    . ALA C  3  502  ? 270.078 306.215 303.054 1.00 66.96  ? 502  ALA 3 CA    1 
ATOM   1875  C  C     . ALA C  3  502  ? 269.182 307.444 303.159 1.00 66.96  ? 502  ALA 3 C     1 
ATOM   1876  O  O     . ALA C  3  502  ? 268.402 307.730 302.244 1.00 66.96  ? 502  ALA 3 O     1 
ATOM   1877  C  CB    . ALA C  3  502  ? 269.420 305.012 303.728 1.00 66.96  ? 502  ALA 3 CB    1 
ATOM   1878  N  N     . GLN C  3  503  ? 269.290 308.190 304.262 1.00 69.44  ? 503  GLN 3 N     1 
ATOM   1879  C  CA    . GLN C  3  503  ? 268.551 309.444 304.379 1.00 69.44  ? 503  GLN 3 CA    1 
ATOM   1880  C  C     . GLN C  3  503  ? 269.106 310.507 303.439 1.00 69.44  ? 503  GLN 3 C     1 
ATOM   1881  O  O     . GLN C  3  503  ? 268.349 311.344 302.934 1.00 69.44  ? 503  GLN 3 O     1 
ATOM   1882  C  CB    . GLN C  3  503  ? 268.578 309.941 305.824 1.00 69.44  ? 503  GLN 3 CB    1 
ATOM   1883  N  N     . SER C  3  504  ? 270.416 310.476 303.176 1.00 68.08  ? 504  SER 3 N     1 
ATOM   1884  C  CA    . SER C  3  504  ? 270.999 311.376 302.185 1.00 68.08  ? 504  SER 3 CA    1 
ATOM   1885  C  C     . SER C  3  504  ? 270.511 311.029 300.784 1.00 68.08  ? 504  SER 3 C     1 
ATOM   1886  O  O     . SER C  3  504  ? 270.240 311.919 299.969 1.00 68.08  ? 504  SER 3 O     1 
ATOM   1887  C  CB    . SER C  3  504  ? 272.524 311.316 302.256 1.00 68.08  ? 504  SER 3 CB    1 
ATOM   1888  N  N     . ARG C  3  505  ? 270.380 309.731 300.495 1.00 73.33  ? 505  ARG 3 N     1 
ATOM   1889  C  CA    . ARG C  3  505  ? 269.790 309.282 299.240 1.00 73.33  ? 505  ARG 3 CA    1 
ATOM   1890  C  C     . ARG C  3  505  ? 268.325 309.685 299.129 1.00 73.33  ? 505  ARG 3 C     1 
ATOM   1891  O  O     . ARG C  3  505  ? 267.870 310.022 298.030 1.00 73.33  ? 505  ARG 3 O     1 
ATOM   1892  C  CB    . ARG C  3  505  ? 269.955 307.760 299.116 1.00 73.33  ? 505  ARG 3 CB    1 
ATOM   1893  N  N     . GLN C  3  506  ? 267.590 309.681 300.246 1.00 70.69  ? 506  GLN 3 N     1 
ATOM   1894  C  CA    . GLN C  3  506  ? 266.204 310.140 300.227 1.00 70.69  ? 506  GLN 3 CA    1 
ATOM   1895  C  C     . GLN C  3  506  ? 266.125 311.641 299.973 1.00 70.69  ? 506  GLN 3 C     1 
ATOM   1896  O  O     . GLN C  3  506  ? 265.250 312.107 299.238 1.00 70.69  ? 506  GLN 3 O     1 
ATOM   1897  C  CB    . GLN C  3  506  ? 265.500 309.773 301.533 1.00 70.69  ? 506  GLN 3 CB    1 
ATOM   1898  N  N     . GLN C  3  507  ? 267.051 312.410 300.556 1.00 74.02  ? 507  GLN 3 N     1 
ATOM   1899  C  CA    . GLN C  3  507  ? 267.094 313.848 300.296 1.00 74.02  ? 507  GLN 3 CA    1 
ATOM   1900  C  C     . GLN C  3  507  ? 267.439 314.144 298.838 1.00 74.02  ? 507  GLN 3 C     1 
ATOM   1901  O  O     . GLN C  3  507  ? 266.848 315.044 298.224 1.00 74.02  ? 507  GLN 3 O     1 
ATOM   1902  C  CB    . GLN C  3  507  ? 268.095 314.526 301.232 1.00 74.02  ? 507  GLN 3 CB    1 
ATOM   1903  N  N     . GLN C  3  508  ? 268.366 313.372 298.261 1.00 74.04  ? 508  GLN 3 N     1 
ATOM   1904  C  CA    . GLN C  3  508  ? 268.729 313.555 296.856 1.00 74.04  ? 508  GLN 3 CA    1 
ATOM   1905  C  C     . GLN C  3  508  ? 267.577 313.182 295.927 1.00 74.04  ? 508  GLN 3 C     1 
ATOM   1906  O  O     . GLN C  3  508  ? 267.300 313.892 294.951 1.00 74.04  ? 508  GLN 3 O     1 
ATOM   1907  C  CB    . GLN C  3  508  ? 269.980 312.742 296.515 1.00 74.04  ? 508  GLN 3 CB    1 
ATOM   1908  N  N     . GLN C  3  509  ? 266.875 312.081 296.222 1.00 74.04  ? 509  GLN 3 N     1 
ATOM   1909  C  CA    . GLN C  3  509  ? 265.764 311.710 295.351 1.00 74.04  ? 509  GLN 3 CA    1 
ATOM   1910  C  C     . GLN C  3  509  ? 264.571 312.641 295.537 1.00 74.04  ? 509  GLN 3 C     1 
ATOM   1911  O  O     . GLN C  3  509  ? 263.830 312.872 294.581 1.00 74.04  ? 509  GLN 3 O     1 
ATOM   1912  C  CB    . GLN C  3  509  ? 265.353 310.248 295.558 1.00 74.04  ? 509  GLN 3 CB    1 
ATOM   1913  N  N     . ASN C  3  510  ? 264.410 313.249 296.719 1.00 74.68  ? 510  ASN 3 N     1 
ATOM   1914  C  CA    . ASN C  3  510  ? 263.332 314.220 296.888 1.00 74.68  ? 510  ASN 3 CA    1 
ATOM   1915  C  C     . ASN C  3  510  ? 263.649 315.552 296.214 1.00 74.68  ? 510  ASN 3 C     1 
ATOM   1916  O  O     . ASN C  3  510  ? 262.742 316.206 295.686 1.00 74.68  ? 510  ASN 3 O     1 
ATOM   1917  C  CB    . ASN C  3  510  ? 263.003 314.428 298.368 1.00 74.68  ? 510  ASN 3 CB    1 
ATOM   1918  N  N     . VAL C  3  511  ? 264.919 315.976 296.196 1.00 75.07  ? 511  VAL 3 N     1 
ATOM   1919  C  CA    . VAL C  3  511  ? 265.220 317.232 295.506 1.00 75.07  ? 511  VAL 3 CA    1 
ATOM   1920  C  C     . VAL C  3  511  ? 265.199 317.027 293.988 1.00 75.07  ? 511  VAL 3 C     1 
ATOM   1921  O  O     . VAL C  3  511  ? 264.768 317.917 293.236 1.00 75.07  ? 511  VAL 3 O     1 
ATOM   1922  C  CB    . VAL C  3  511  ? 266.540 317.854 296.022 1.00 75.07  ? 511  VAL 3 CB    1 
ATOM   1923  N  N     . GLU C  3  512  ? 265.570 315.826 293.514 1.00 74.88  ? 512  GLU 3 N     1 
ATOM   1924  C  CA    . GLU C  3  512  ? 265.388 315.513 292.098 1.00 74.88  ? 512  GLU 3 CA    1 
ATOM   1925  C  C     . GLU C  3  512  ? 263.910 315.384 291.749 1.00 74.88  ? 512  GLU 3 C     1 
ATOM   1926  O  O     . GLU C  3  512  ? 263.486 315.785 290.658 1.00 74.88  ? 512  GLU 3 O     1 
ATOM   1927  C  CB    . GLU C  3  512  ? 266.144 314.238 291.725 1.00 74.88  ? 512  GLU 3 CB    1 
ATOM   1928  N  N     . ASP C  3  513  ? 263.112 314.866 292.686 1.00 70.24  ? 513  ASP 3 N     1 
ATOM   1929  C  CA    . ASP C  3  513  ? 261.666 314.788 292.526 1.00 70.24  ? 513  ASP 3 CA    1 
ATOM   1930  C  C     . ASP C  3  513  ? 261.054 316.179 292.405 1.00 70.24  ? 513  ASP 3 C     1 
ATOM   1931  O  O     . ASP C  3  513  ? 260.206 316.421 291.537 1.00 70.24  ? 513  ASP 3 O     1 
ATOM   1932  C  CB    . ASP C  3  513  ? 261.089 314.037 293.728 1.00 70.24  ? 513  ASP 3 CB    1 
ATOM   1933  N  N     . ALA C  3  514  ? 261.520 317.115 293.235 1.00 73.82  ? 514  ALA 3 N     1 
ATOM   1934  C  CA    . ALA C  3  514  ? 260.998 318.477 293.214 1.00 73.82  ? 514  ALA 3 CA    1 
ATOM   1935  C  C     . ALA C  3  514  ? 261.390 319.208 291.935 1.00 73.82  ? 514  ALA 3 C     1 
ATOM   1936  O  O     . ALA C  3  514  ? 260.580 319.950 291.363 1.00 73.82  ? 514  ALA 3 O     1 
ATOM   1937  C  CB    . ALA C  3  514  ? 261.491 319.241 294.442 1.00 30.00  ? 514  ALA 3 CB    1 
ATOM   1938  N  N     . MET C  3  515  ? 262.626 319.007 291.461 1.00 74.08  ? 515  MET 3 N     1 
ATOM   1939  C  CA    . MET C  3  515  ? 263.031 319.705 290.242 1.00 74.08  ? 515  MET 3 CA    1 
ATOM   1940  C  C     . MET C  3  515  ? 262.405 319.069 289.003 1.00 74.08  ? 515  MET 3 C     1 
ATOM   1941  O  O     . MET C  3  515  ? 262.239 319.739 287.978 1.00 74.08  ? 515  MET 3 O     1 
ATOM   1942  C  CB    . MET C  3  515  ? 264.560 319.770 290.127 1.00 74.08  ? 515  MET 3 CB    1 
ATOM   1943  N  N     . LYS C  3  516  ? 262.042 317.782 289.072 1.00 68.67  ? 516  LYS 3 N     1 
ATOM   1944  C  CA    . LYS C  3  516  ? 261.333 317.172 287.951 1.00 68.67  ? 516  LYS 3 CA    1 
ATOM   1945  C  C     . LYS C  3  516  ? 259.838 317.470 287.965 1.00 68.67  ? 516  LYS 3 C     1 
ATOM   1946  O  O     . LYS C  3  516  ? 259.194 317.380 286.915 1.00 68.67  ? 516  LYS 3 O     1 
ATOM   1947  C  CB    . LYS C  3  516  ? 261.549 315.658 287.933 1.00 30.00  ? 516  LYS 3 CB    1 
ATOM   1948  N  N     . GLU C  3  517  ? 259.267 317.806 289.122 1.00 64.12  ? 517  GLU 3 N     1 
ATOM   1949  C  CA    . GLU C  3  517  ? 257.834 318.069 289.220 1.00 64.12  ? 517  GLU 3 CA    1 
ATOM   1950  C  C     . GLU C  3  517  ? 257.481 319.547 289.090 1.00 64.12  ? 517  GLU 3 C     1 
ATOM   1951  O  O     . GLU C  3  517  ? 256.682 319.919 288.227 1.00 64.12  ? 517  GLU 3 O     1 
ATOM   1952  C  CB    . GLU C  3  517  ? 257.301 317.513 290.542 1.00 64.12  ? 517  GLU 3 CB    1 
ATOM   1953  N  N     . MET C  3  518  ? 258.059 320.402 289.938 1.00 76.21  ? 518  MET 3 N     1 
ATOM   1954  C  CA    . MET C  3  518  ? 257.568 321.772 290.050 1.00 76.21  ? 518  MET 3 CA    1 
ATOM   1955  C  C     . MET C  3  518  ? 258.010 322.682 288.909 1.00 76.21  ? 518  MET 3 C     1 
ATOM   1956  O  O     . MET C  3  518  ? 257.518 323.812 288.825 1.00 76.21  ? 518  MET 3 O     1 
ATOM   1957  C  CB    . MET C  3  518  ? 258.003 322.381 291.386 1.00 76.21  ? 518  MET 3 CB    1 
ATOM   1958  N  N     . GLN C  3  519  ? 258.912 322.234 288.036 1.00 74.51  ? 519  GLN 3 N     1 
ATOM   1959  C  CA    . GLN C  3  519  ? 259.406 323.095 286.967 1.00 74.51  ? 519  GLN 3 CA    1 
ATOM   1960  C  C     . GLN C  3  519  ? 259.333 322.419 285.602 1.00 74.51  ? 519  GLN 3 C     1 
ATOM   1961  O  O     . GLN C  3  519  ? 259.251 323.097 284.573 1.00 74.51  ? 519  GLN 3 O     1 
ATOM   1962  C  CB    . GLN C  3  519  ? 260.847 323.536 287.251 1.00 74.51  ? 519  GLN 3 CB    1 
ATOM   1963  N  N     . LYS C  3  520  ? 259.358 321.084 285.580 1.00 65.99  ? 520  LYS 3 N     1 
ATOM   1964  C  CA    . LYS C  3  520  ? 259.430 320.386 284.306 1.00 65.99  ? 520  LYS 3 CA    1 
ATOM   1965  C  C     . LYS C  3  520  ? 258.053 319.895 283.867 1.00 65.99  ? 520  LYS 3 C     1 
ATOM   1966  O  O     . LYS C  3  520  ? 257.192 319.612 284.706 1.00 65.99  ? 520  LYS 3 O     1 
ATOM   1967  C  CB    . LYS C  3  520  ? 260.395 319.200 284.405 1.00 65.99  ? 520  LYS 3 CB    1 
ATOM   1968  N  N     . PRO C  3  521  ? 257.805 319.787 282.546 1.00 51.42  ? 521  PRO 3 N     1 
ATOM   1969  C  CA    . PRO C  3  521  ? 256.503 319.286 282.079 1.00 51.42  ? 521  PRO 3 CA    1 
ATOM   1970  C  C     . PRO C  3  521  ? 256.325 317.783 282.248 1.00 51.42  ? 521  PRO 3 C     1 
ATOM   1971  O  O     . PRO C  3  521  ? 257.172 317.103 282.836 1.00 51.42  ? 521  PRO 3 O     1 
ATOM   1972  C  CB    . PRO C  3  521  ? 256.488 319.686 280.598 1.00 51.42  ? 521  PRO 3 CB    1 
ATOM   1973  N  N     . LEU C  3  522  ? 255.212 317.259 281.727 1.00 44.08  ? 522  LEU 3 N     1 
ATOM   1974  C  CA    . LEU C  3  522  ? 254.876 315.852 281.930 1.00 44.08  ? 522  LEU 3 CA    1 
ATOM   1975  C  C     . LEU C  3  522  ? 255.757 314.944 281.077 1.00 44.08  ? 522  LEU 3 C     1 
ATOM   1976  O  O     . LEU C  3  522  ? 256.173 313.869 281.525 1.00 44.08  ? 522  LEU 3 O     1 
ATOM   1977  C  CB    . LEU C  3  522  ? 253.389 315.627 281.629 1.00 44.08  ? 522  LEU 3 CB    1 
ATOM   1978  N  N     . ALA C  3  523  ? 256.037 315.349 279.842 1.00 44.77  ? 523  ALA 3 N     1 
ATOM   1979  C  CA    . ALA C  3  523  ? 256.878 314.581 278.937 1.00 44.77  ? 523  ALA 3 CA    1 
ATOM   1980  C  C     . ALA C  3  523  ? 258.068 315.420 278.495 1.00 44.77  ? 523  ALA 3 C     1 
ATOM   1981  O  O     . ALA C  3  523  ? 257.927 316.615 278.217 1.00 44.77  ? 523  ALA 3 O     1 
ATOM   1982  C  CB    . ALA C  3  523  ? 256.086 314.112 277.713 1.00 44.77  ? 523  ALA 3 CB    1 
ATOM   1983  N  N     . ARG C  3  524  ? 259.240 314.793 278.430 1.00 47.86  ? 524  ARG 3 N     1 
ATOM   1984  C  CA    . ARG C  3  524  ? 260.452 315.447 277.952 1.00 47.86  ? 524  ARG 3 CA    1 
ATOM   1985  C  C     . ARG C  3  524  ? 260.653 315.092 276.483 1.00 47.86  ? 524  ARG 3 C     1 
ATOM   1986  O  O     . ARG C  3  524  ? 260.396 313.955 276.070 1.00 47.86  ? 524  ARG 3 O     1 
ATOM   1987  C  CB    . ARG C  3  524  ? 261.674 315.063 278.794 1.00 47.86  ? 524  ARG 3 CB    1 
ATOM   1988  N  N     . TYR C  3  525  ? 261.068 316.076 275.693 1.00 43.31  ? 525  TYR 3 N     1 
ATOM   1989  C  CA    . TYR C  3  525  ? 261.279 315.876 274.266 1.00 43.31  ? 525  TYR 3 CA    1 
ATOM   1990  C  C     . TYR C  3  525  ? 262.743 315.530 274.005 1.00 43.31  ? 525  TYR 3 C     1 
ATOM   1991  O  O     . TYR C  3  525  ? 263.515 315.237 274.922 1.00 43.31  ? 525  TYR 3 O     1 
ATOM   1992  C  CB    . TYR C  3  525  ? 260.827 317.109 273.489 1.00 43.31  ? 525  TYR 3 CB    1 
ATOM   1993  N  N     . ILE C  3  526  ? 263.133 315.550 272.728 1.00 45.10  ? 526  ILE 3 N     1 
ATOM   1994  C  CA    . ILE C  3  526  ? 264.511 315.248 272.356 1.00 45.10  ? 526  ILE 3 CA    1 
ATOM   1995  C  C     . ILE C  3  526  ? 265.442 316.380 272.776 1.00 45.10  ? 526  ILE 3 C     1 
ATOM   1996  O  O     . ILE C  3  526  ? 266.515 316.134 273.342 1.00 45.10  ? 526  ILE 3 O     1 
ATOM   1997  C  CB    . ILE C  3  526  ? 264.612 314.957 270.841 1.00 45.10  ? 526  ILE 3 CB    1 
ATOM   1998  N  N     . ASP C  3  527  ? 265.039 317.632 272.546 1.00 54.15  ? 527  ASP 3 N     1 
ATOM   1999  C  CA    . ASP C  3  527  ? 265.918 318.765 272.840 1.00 54.15  ? 527  ASP 3 CA    1 
ATOM   2000  C  C     . ASP C  3  527  ? 265.991 319.024 274.343 1.00 54.15  ? 527  ASP 3 C     1 
ATOM   2001  O  O     . ASP C  3  527  ? 267.055 318.878 274.954 1.00 54.15  ? 527  ASP 3 O     1 
ATOM   2002  C  CB    . ASP C  3  527  ? 265.414 320.005 272.088 1.00 54.15  ? 527  ASP 3 CB    1 
ATOM   2003  N  N     . ASP C  3  528  ? 264.875 319.474 274.938 1.00 58.92  ? 528  ASP 3 N     1 
ATOM   2004  C  CA    . ASP C  3  528  ? 264.612 319.559 276.381 1.00 58.92  ? 528  ASP 3 CA    1 
ATOM   2005  C  C     . ASP C  3  528  ? 265.506 320.560 277.134 1.00 58.92  ? 528  ASP 3 C     1 
ATOM   2006  O  O     . ASP C  3  528  ? 265.274 320.831 278.319 1.00 58.92  ? 528  ASP 3 O     1 
ATOM   2007  C  CB    . ASP C  3  528  ? 264.710 318.145 276.992 1.00 58.92  ? 528  ASP 3 CB    1 
ATOM   2008  N  N     . GLU C  3  529  ? 266.503 321.142 276.449 1.00 62.90  ? 529  GLU 3 N     1 
ATOM   2009  C  CA    . GLU C  3  529  ? 267.564 322.008 276.998 1.00 62.90  ? 529  GLU 3 CA    1 
ATOM   2010  C  C     . GLU C  3  529  ? 268.372 321.349 278.126 1.00 62.90  ? 529  GLU 3 C     1 
ATOM   2011  O  O     . GLU C  3  529  ? 269.084 322.036 278.864 1.00 62.90  ? 529  GLU 3 O     1 
ATOM   2012  C  CB    . GLU C  3  529  ? 267.012 323.364 277.461 1.00 62.90  ? 529  GLU 3 CB    1 
ATOM   2013  N  N     . ASP C  3  530  ? 268.287 320.032 278.276 1.00 62.54  ? 530  ASP 3 N     1 
ATOM   2014  C  CA    . ASP C  3  530  ? 269.073 319.251 279.223 1.00 62.54  ? 530  ASP 3 CA    1 
ATOM   2015  C  C     . ASP C  3  530  ? 269.720 318.041 278.565 1.00 62.54  ? 530  ASP 3 C     1 
ATOM   2016  O  O     . ASP C  3  530  ? 270.854 317.694 278.902 1.00 62.54  ? 530  ASP 3 O     1 
ATOM   2017  C  CB    . ASP C  3  530  ? 268.172 318.803 280.394 1.00 62.54  ? 530  ASP 3 CB    1 
ATOM   2018  N  N     . LEU C  3  531  ? 269.031 317.404 277.616 1.00 57.76  ? 531  LEU 3 N     1 
ATOM   2019  C  CA    . LEU C  3  531  ? 269.508 316.147 277.052 1.00 57.76  ? 531  LEU 3 CA    1 
ATOM   2020  C  C     . LEU C  3  531  ? 270.537 316.358 275.951 1.00 57.76  ? 531  LEU 3 C     1 
ATOM   2021  O  O     . LEU C  3  531  ? 271.433 315.524 275.783 1.00 57.76  ? 531  LEU 3 O     1 
ATOM   2022  C  CB    . LEU C  3  531  ? 268.326 315.336 276.528 1.00 57.76  ? 531  LEU 3 CB    1 
ATOM   2023  N  N     . ASP C  3  532  ? 270.439 317.455 275.198 1.00 63.59  ? 532  ASP 3 N     1 
ATOM   2024  C  CA    . ASP C  3  532  ? 271.494 317.780 274.247 1.00 63.59  ? 532  ASP 3 CA    1 
ATOM   2025  C  C     . ASP C  3  532  ? 272.740 318.331 274.926 1.00 63.59  ? 532  ASP 3 C     1 
ATOM   2026  O  O     . ASP C  3  532  ? 273.792 318.405 274.282 1.00 63.59  ? 532  ASP 3 O     1 
ATOM   2027  C  CB    . ASP C  3  532  ? 270.982 318.771 273.201 1.00 63.59  ? 532  ASP 3 CB    1 
ATOM   2028  N  N     . ARG C  3  533  ? 272.648 318.721 276.197 1.00 62.86  ? 533  ARG 3 N     1 
ATOM   2029  C  CA    . ARG C  3  533  ? 273.821 319.021 277.006 1.00 62.86  ? 533  ARG 3 CA    1 
ATOM   2030  C  C     . ARG C  3  533  ? 274.465 317.750 277.547 1.00 62.86  ? 533  ARG 3 C     1 
ATOM   2031  O  O     . ARG C  3  533  ? 275.695 317.622 277.534 1.00 62.86  ? 533  ARG 3 O     1 
ATOM   2032  C  CB    . ARG C  3  533  ? 273.438 319.949 278.162 1.00 62.86  ? 533  ARG 3 CB    1 
ATOM   2033  N  N     . MET C  3  534  ? 273.645 316.802 278.011 1.00 62.47  ? 534  MET 3 N     1 
ATOM   2034  C  CA    . MET C  3  534  ? 274.167 315.534 278.515 1.00 62.47  ? 534  MET 3 CA    1 
ATOM   2035  C  C     . MET C  3  534  ? 274.769 314.699 277.392 1.00 62.47  ? 534  MET 3 C     1 
ATOM   2036  O  O     . MET C  3  534  ? 275.742 313.967 277.605 1.00 62.47  ? 534  MET 3 O     1 
ATOM   2037  C  CB    . MET C  3  534  ? 273.062 314.756 279.230 1.00 62.47  ? 534  MET 3 CB    1 
ATOM   2038  N  N     . LEU C  3  535  ? 274.202 314.799 276.184 1.00 62.67  ? 535  LEU 3 N     1 
ATOM   2039  C  CA    . LEU C  3  535  ? 274.745 314.072 275.039 1.00 62.67  ? 535  LEU 3 CA    1 
ATOM   2040  C  C     . LEU C  3  535  ? 276.094 314.637 274.613 1.00 62.67  ? 535  LEU 3 C     1 
ATOM   2041  O  O     . LEU C  3  535  ? 276.951 313.893 274.123 1.00 62.67  ? 535  LEU 3 O     1 
ATOM   2042  C  CB    . LEU C  3  535  ? 273.739 314.102 273.881 1.00 62.67  ? 535  LEU 3 CB    1 
ATOM   2043  N  N     . ARG C  3  536  ? 276.304 315.942 274.790 1.00 60.73  ? 536  ARG 3 N     1 
ATOM   2044  C  CA    . ARG C  3  536  ? 277.624 316.520 274.579 1.00 60.73  ? 536  ARG 3 CA    1 
ATOM   2045  C  C     . ARG C  3  536  ? 278.545 316.299 275.771 1.00 60.73  ? 536  ARG 3 C     1 
ATOM   2046  O  O     . ARG C  3  536  ? 279.762 316.472 275.638 1.00 60.73  ? 536  ARG 3 O     1 
ATOM   2047  C  CB    . ARG C  3  536  ? 277.506 318.016 274.277 1.00 60.73  ? 536  ARG 3 CB    1 
ATOM   2048  N  N     . GLU C  3  537  ? 277.996 315.922 276.926 1.00 59.93  ? 537  GLU 3 N     1 
ATOM   2049  C  CA    . GLU C  3  537  ? 278.795 315.572 278.091 1.00 59.93  ? 537  GLU 3 CA    1 
ATOM   2050  C  C     . GLU C  3  537  ? 278.867 314.070 278.342 1.00 59.93  ? 537  GLU 3 C     1 
ATOM   2051  O  O     . GLU C  3  537  ? 279.139 313.661 279.476 1.00 59.93  ? 537  GLU 3 O     1 
ATOM   2052  C  CB    . GLU C  3  537  ? 278.251 316.278 279.340 1.00 59.93  ? 537  GLU 3 CB    1 
ATOM   2053  N  N     . GLN C  3  538  ? 278.629 313.240 277.327 1.00 61.89  ? 538  GLN 3 N     1 
ATOM   2054  C  CA    . GLN C  3  538  ? 278.803 311.803 277.481 1.00 61.89  ? 538  GLN 3 CA    1 
ATOM   2055  C  C     . GLN C  3  538  ? 280.283 311.432 277.477 1.00 61.89  ? 538  GLN 3 C     1 
ATOM   2056  O  O     . GLN C  3  538  ? 281.153 312.226 277.105 1.00 61.89  ? 538  GLN 3 O     1 
ATOM   2057  C  CB    . GLN C  3  538  ? 278.090 311.035 276.366 1.00 61.89  ? 538  GLN 3 CB    1 
ATOM   2058  N  N     . GLU C  3  539  ? 280.561 310.204 277.916 1.00 66.60  ? 539  GLU 3 N     1 
ATOM   2059  C  CA    . GLU C  3  539  ? 281.909 309.654 277.854 1.00 66.60  ? 539  GLU 3 CA    1 
ATOM   2060  C  C     . GLU C  3  539  ? 282.305 309.421 276.400 1.00 66.60  ? 539  GLU 3 C     1 
ATOM   2061  O  O     . GLU C  3  539  ? 283.249 310.053 275.911 1.00 66.60  ? 539  GLU 3 O     1 
ATOM   2062  C  CB    . GLU C  3  539  ? 281.993 308.361 278.673 1.00 66.60  ? 539  GLU 3 CB    1 
ATOM   2063  N  N     . ARG C  3  540  ? 281.569 308.536 275.717 1.00 66.38  ? 540  ARG 3 N     1 
ATOM   2064  C  CA    . ARG C  3  540  ? 281.699 308.247 274.282 1.00 66.38  ? 540  ARG 3 CA    1 
ATOM   2065  C  C     . ARG C  3  540  ? 283.122 307.788 273.936 1.00 66.38  ? 540  ARG 3 C     1 
ATOM   2066  O  O     . ARG C  3  540  ? 283.922 308.517 273.345 1.00 66.38  ? 540  ARG 3 O     1 
ATOM   2067  C  CB    . ARG C  3  540  ? 281.250 309.447 273.436 1.00 66.38  ? 540  ARG 3 CB    1 
ATOM   2068  N  N     . GLU C  3  541  ? 283.433 306.580 274.416 1.00 69.97  ? 541  GLU 3 N     1 
ATOM   2069  C  CA    . GLU C  3  541  ? 284.744 305.972 274.204 1.00 69.97  ? 541  GLU 3 CA    1 
ATOM   2070  C  C     . GLU C  3  541  ? 285.034 305.785 272.718 1.00 69.97  ? 541  GLU 3 C     1 
ATOM   2071  O  O     . GLU C  3  541  ? 284.132 305.563 271.905 1.00 69.97  ? 541  GLU 3 O     1 
ATOM   2072  C  CB    . GLU C  3  541  ? 284.832 304.632 274.946 1.00 69.97  ? 541  GLU 3 CB    1 
ATOM   2073  N  N     . GLY C  3  542  ? 286.314 305.884 272.370 1.00 65.97  ? 542  GLY 3 N     1 
ATOM   2074  C  CA    . GLY C  3  542  ? 286.726 305.942 270.983 1.00 65.97  ? 542  GLY 3 CA    1 
ATOM   2075  C  C     . GLY C  3  542  ? 287.050 307.368 270.592 1.00 65.97  ? 542  GLY 3 C     1 
ATOM   2076  O  O     . GLY C  3  542  ? 286.904 307.760 269.430 1.00 65.97  ? 542  GLY 3 O     1 
ATOM   2077  N  N     . ASP C  3  543  ? 287.496 308.152 271.570 1.00 63.63  ? 543  ASP 3 N     1 
ATOM   2078  C  CA    . ASP C  3  543  ? 287.771 309.578 271.390 1.00 63.63  ? 543  ASP 3 CA    1 
ATOM   2079  C  C     . ASP C  3  543  ? 289.263 309.836 271.540 1.00 63.63  ? 543  ASP 3 C     1 
ATOM   2080  O  O     . ASP C  3  543  ? 289.813 309.690 272.646 1.00 63.63  ? 543  ASP 3 O     1 
ATOM   2081  C  CB    . ASP C  3  543  ? 286.979 310.407 272.400 1.00 63.63  ? 543  ASP 3 CB    1 
ATOM   2082  N  N     . PRO C  3  544  ? 289.964 310.212 270.464 1.00 62.75  ? 544  PRO 3 N     1 
ATOM   2083  C  CA    . PRO C  3  544  ? 291.399 310.520 270.584 1.00 62.75  ? 544  PRO 3 CA    1 
ATOM   2084  C  C     . PRO C  3  544  ? 291.698 311.816 271.322 1.00 62.75  ? 544  PRO 3 C     1 
ATOM   2085  O  O     . PRO C  3  544  ? 292.859 312.042 271.686 1.00 62.75  ? 544  PRO 3 O     1 
ATOM   2086  C  CB    . PRO C  3  544  ? 291.862 310.607 269.123 1.00 62.75  ? 544  PRO 3 CB    1 
ATOM   2087  N  N     . MET C  3  545  ? 290.701 312.669 271.557 1.00 68.40  ? 545  MET 3 N     1 
ATOM   2088  C  CA    . MET C  3  545  ? 290.894 313.945 272.234 1.00 68.40  ? 545  MET 3 CA    1 
ATOM   2089  C  C     . MET C  3  545  ? 290.892 313.824 273.755 1.00 68.40  ? 545  MET 3 C     1 
ATOM   2090  O  O     . MET C  3  545  ? 290.904 314.853 274.440 1.00 68.40  ? 545  MET 3 O     1 
ATOM   2091  C  CB    . MET C  3  545  ? 289.812 314.936 271.793 1.00 68.40  ? 545  MET 3 CB    1 
ATOM   2092  N  N     . ALA C  3  546  ? 290.871 312.604 274.296 1.00 68.01  ? 546  ALA 3 N     1 
ATOM   2093  C  CA    . ALA C  3  546  ? 290.868 312.424 275.744 1.00 68.01  ? 546  ALA 3 CA    1 
ATOM   2094  C  C     . ALA C  3  546  ? 292.237 312.732 276.339 1.00 68.01  ? 546  ALA 3 C     1 
ATOM   2095  O  O     . ALA C  3  546  ? 292.345 313.420 277.360 1.00 68.01  ? 546  ALA 3 O     1 
ATOM   2096  C  CB    . ALA C  3  546  ? 290.430 311.001 276.094 1.00 68.01  ? 546  ALA 3 CB    1 
ATOM   2097  N  N     . ASN C  3  547  ? 293.300 312.228 275.709 1.00 70.48  ? 547  ASN 3 N     1 
ATOM   2098  C  CA    . ASN C  3  547  ? 294.653 312.485 276.189 1.00 70.48  ? 547  ASN 3 CA    1 
ATOM   2099  C  C     . ASN C  3  547  ? 295.158 313.876 275.828 1.00 70.48  ? 547  ASN 3 C     1 
ATOM   2100  O  O     . ASN C  3  547  ? 296.204 314.287 276.341 1.00 70.48  ? 547  ASN 3 O     1 
ATOM   2101  C  CB    . ASN C  3  547  ? 295.614 311.428 275.640 1.00 70.48  ? 547  ASN 3 CB    1 
ATOM   2102  N  N     . PHE C  3  548  ? 294.451 314.603 274.958 1.00 71.23  ? 548  PHE 3 N     1 
ATOM   2103  C  CA    . PHE C  3  548  ? 294.842 315.967 274.625 1.00 71.23  ? 548  PHE 3 CA    1 
ATOM   2104  C  C     . PHE C  3  548  ? 294.579 316.937 275.770 1.00 71.23  ? 548  PHE 3 C     1 
ATOM   2105  O  O     . PHE C  3  548  ? 295.310 317.923 275.912 1.00 71.23  ? 548  PHE 3 O     1 
ATOM   2106  C  CB    . PHE C  3  548  ? 294.104 316.425 273.364 1.00 71.23  ? 548  PHE 3 CB    1 
ATOM   2107  N  N     . ILE C  3  549  ? 293.564 316.675 276.590 1.00 73.51  ? 549  ILE 3 N     1 
ATOM   2108  C  CA    . ILE C  3  549  ? 293.228 317.558 277.698 1.00 73.51  ? 549  ILE 3 CA    1 
ATOM   2109  C  C     . ILE C  3  549  ? 293.524 316.947 279.061 1.00 73.51  ? 549  ILE 3 C     1 
ATOM   2110  O  O     . ILE C  3  549  ? 293.614 317.694 280.049 1.00 73.51  ? 549  ILE 3 O     1 
ATOM   2111  C  CB    . ILE C  3  549  ? 291.751 317.999 277.625 1.00 73.51  ? 549  ILE 3 CB    1 
ATOM   2112  N  N     . LYS C  3  550  ? 293.682 315.630 279.164 1.00 80.45  ? 550  LYS 3 N     1 
ATOM   2113  C  CA    . LYS C  3  550  ? 293.940 314.969 280.434 1.00 80.45  ? 550  LYS 3 CA    1 
ATOM   2114  C  C     . LYS C  3  550  ? 295.367 314.437 280.471 1.00 80.45  ? 550  LYS 3 C     1 
ATOM   2115  O  O     . LYS C  3  550  ? 295.837 313.821 279.510 1.00 80.45  ? 550  LYS 3 O     1 
ATOM   2116  C  CB    . LYS C  3  550  ? 292.949 313.824 280.665 1.00 80.45  ? 550  LYS 3 CB    1 
ATOM   2117  N  N     . LYS C  3  551  ? 296.051 314.681 281.589 1.00 89.89  ? 551  LYS 3 N     1 
ATOM   2118  C  CA    . LYS C  3  551  ? 297.422 314.207 281.750 1.00 89.89  ? 551  LYS 3 CA    1 
ATOM   2119  C  C     . LYS C  3  551  ? 297.455 312.717 282.072 1.00 89.89  ? 551  LYS 3 C     1 
ATOM   2120  O  O     . LYS C  3  551  ? 298.011 311.916 281.312 1.00 89.89  ? 551  LYS 3 O     1 
ATOM   2121  C  CB    . LYS C  3  551  ? 298.127 315.012 282.845 1.00 89.89  ? 551  LYS 3 CB    1 
ATOM   2122  N  N     . ASN C  3  552  ? 296.852 312.330 283.194 1.00 92.17  ? 552  ASN 3 N     1 
ATOM   2123  C  CA    . ASN C  3  552  ? 296.841 310.943 283.636 1.00 92.17  ? 552  ASN 3 CA    1 
ATOM   2124  C  C     . ASN C  3  552  ? 295.664 310.765 284.585 1.00 92.17  ? 552  ASN 3 C     1 
ATOM   2125  O  O     . ASN C  3  552  ? 295.179 311.728 285.184 1.00 92.17  ? 552  ASN 3 O     1 
ATOM   2126  C  CB    . ASN C  3  552  ? 298.164 310.564 284.319 1.00 92.17  ? 552  ASN 3 CB    1 
ATOM   2127  N  N     . LYS C  3  553  ? 295.208 309.519 284.711 1.00 84.08  ? 553  LYS 3 N     1 
ATOM   2128  C  CA    . LYS C  3  553  ? 294.130 309.201 285.639 1.00 84.08  ? 553  LYS 3 CA    1 
ATOM   2129  C  C     . LYS C  3  553  ? 294.648 309.222 287.071 1.00 84.08  ? 553  LYS 3 C     1 
ATOM   2130  O  O     . LYS C  3  553  ? 294.977 308.174 287.636 1.00 84.08  ? 553  LYS 3 O     1 
ATOM   2131  C  CB    . LYS C  3  553  ? 293.519 307.837 285.309 1.00 84.08  ? 553  LYS 3 CB    1 
ATOM   2132  N  N     . ALA C  3  554  ? 294.718 310.410 287.666 1.00 93.35  ? 554  ALA 3 N     1 
ATOM   2133  C  CA    . ALA C  3  554  ? 295.283 310.583 288.995 1.00 93.35  ? 554  ALA 3 CA    1 
ATOM   2134  C  C     . ALA C  3  554  ? 294.221 310.291 290.055 1.00 93.35  ? 554  ALA 3 C     1 
ATOM   2135  O  O     . ALA C  3  554  ? 293.108 309.852 289.752 1.00 93.35  ? 554  ALA 3 O     1 
ATOM   2136  C  CB    . ALA C  3  554  ? 295.862 311.988 289.141 1.00 93.35  ? 554  ALA 3 CB    1 
ATOM   2137  N  N     . LYS C  3  555  ? 294.558 310.538 291.319 1.00 91.76  ? 555  LYS 3 N     1 
ATOM   2138  C  CA    . LYS C  3  555  ? 293.660 310.256 292.434 1.00 91.76  ? 555  LYS 3 CA    1 
ATOM   2139  C  C     . LYS C  3  555  ? 293.527 311.513 293.282 1.00 91.76  ? 555  LYS 3 C     1 
ATOM   2140  O  O     . LYS C  3  555  ? 294.402 311.809 294.100 1.00 91.76  ? 555  LYS 3 O     1 
ATOM   2141  C  CB    . LYS C  3  555  ? 294.170 309.083 293.273 1.00 91.76  ? 555  LYS 3 CB    1 
ATOM   2142  N  N     . GLU C  3  556  ? 292.436 312.246 293.085 1.00 100.36 ? 556  GLU 3 N     1 
ATOM   2143  C  CA    . GLU C  3  556  ? 292.095 313.383 293.924 1.00 100.36 ? 556  GLU 3 CA    1 
ATOM   2144  C  C     . GLU C  3  556  ? 291.262 312.893 295.107 1.00 100.36 ? 556  GLU 3 C     1 
ATOM   2145  O  O     . GLU C  3  556  ? 291.183 311.693 295.384 1.00 100.36 ? 556  GLU 3 O     1 
ATOM   2146  C  CB    . GLU C  3  556  ? 291.359 314.447 293.112 1.00 100.36 ? 556  GLU 3 CB    1 
ATOM   2147  N  N     . ASN C  3  557  ? 290.627 313.820 295.826 1.00 99.47  ? 557  ASN 3 N     1 
ATOM   2148  C  CA    . ASN C  3  557  ? 289.729 313.467 296.927 1.00 99.47  ? 557  ASN 3 CA    1 
ATOM   2149  C  C     . ASN C  3  557  ? 288.348 313.136 296.352 1.00 99.47  ? 557  ASN 3 C     1 
ATOM   2150  O  O     . ASN C  3  557  ? 287.363 313.854 296.534 1.00 99.47  ? 557  ASN 3 O     1 
ATOM   2151  C  CB    . ASN C  3  557  ? 289.665 314.597 297.946 1.00 99.47  ? 557  ASN 3 CB    1 
ATOM   2152  N  N     . LYS C  3  558  ? 288.294 312.008 295.640 1.00 96.45  ? 558  LYS 3 N     1 
ATOM   2153  C  CA    . LYS C  3  558  ? 287.066 311.541 294.995 1.00 96.45  ? 558  LYS 3 CA    1 
ATOM   2154  C  C     . LYS C  3  558  ? 286.349 310.601 295.958 1.00 96.45  ? 558  LYS 3 C     1 
ATOM   2155  O  O     . LYS C  3  558  ? 286.569 309.388 295.980 1.00 96.45  ? 558  LYS 3 O     1 
ATOM   2156  C  CB    . LYS C  3  558  ? 287.381 310.860 293.669 1.00 96.45  ? 558  LYS 3 CB    1 
ATOM   2157  N  N     . ASN C  3  559  ? 285.470 311.183 296.769 1.00 89.34  ? 559  ASN 3 N     1 
ATOM   2158  C  CA    . ASN C  3  559  ? 284.741 310.423 297.772 1.00 89.34  ? 559  ASN 3 CA    1 
ATOM   2159  C  C     . ASN C  3  559  ? 283.421 311.132 298.038 1.00 89.34  ? 559  ASN 3 C     1 
ATOM   2160  O  O     . ASN C  3  559  ? 283.259 312.315 297.728 1.00 89.34  ? 559  ASN 3 O     1 
ATOM   2161  C  CB    . ASN C  3  559  ? 285.568 310.273 299.059 1.00 89.34  ? 559  ASN 3 CB    1 
ATOM   2162  N  N     . LYS C  3  560  ? 282.468 310.386 298.605 1.00 86.24  ? 560  LYS 3 N     1 
ATOM   2163  C  CA    . LYS C  3  560  ? 281.169 310.964 298.940 1.00 86.24  ? 560  LYS 3 CA    1 
ATOM   2164  C  C     . LYS C  3  560  ? 281.299 311.958 300.088 1.00 86.24  ? 560  LYS 3 C     1 
ATOM   2165  O  O     . LYS C  3  560  ? 280.593 312.972 300.133 1.00 86.24  ? 560  LYS 3 O     1 
ATOM   2166  C  CB    . LYS C  3  560  ? 280.167 309.861 299.297 1.00 86.24  ? 560  LYS 3 CB    1 
ATOM   2167  N  N     . LYS C  3  561  ? 282.197 311.678 301.028 1.00 87.56  ? 561  LYS 3 N     1 
ATOM   2168  C  CA    . LYS C  3  561  ? 282.492 312.588 302.121 1.00 87.56  ? 561  LYS 3 CA    1 
ATOM   2169  C  C     . LYS C  3  561  ? 283.823 313.294 301.869 1.00 87.56  ? 561  LYS 3 C     1 
ATOM   2170  O  O     . LYS C  3  561  ? 284.441 313.162 300.810 1.00 87.56  ? 561  LYS 3 O     1 
ATOM   2171  C  CB    . LYS C  3  561  ? 282.510 311.836 303.451 1.00 87.56  ? 561  LYS 3 CB    1 
ATOM   2172  N  N     . VAL C  3  562  ? 284.271 314.063 302.865 1.00 86.76  ? 562  VAL 3 N     1 
ATOM   2173  C  CA    . VAL C  3  562  ? 285.564 314.733 302.793 1.00 86.76  ? 562  VAL 3 CA    1 
ATOM   2174  C  C     . VAL C  3  562  ? 286.717 313.760 302.998 1.00 86.76  ? 562  VAL 3 C     1 
ATOM   2175  O  O     . VAL C  3  562  ? 287.804 313.961 302.438 1.00 86.76  ? 562  VAL 3 O     1 
ATOM   2176  C  CB    . VAL C  3  562  ? 285.569 315.879 303.832 1.00 86.76  ? 562  VAL 3 CB    1 
ATOM   2177  N  N     . ARG C  3  563  ? 286.480 312.679 303.744 1.00 86.94  ? 563  ARG 3 N     1 
ATOM   2178  C  CA    . ARG C  3  563  ? 287.507 311.710 304.099 1.00 86.94  ? 563  ARG 3 CA    1 
ATOM   2179  C  C     . ARG C  3  563  ? 287.980 310.943 302.860 1.00 86.94  ? 563  ARG 3 C     1 
ATOM   2180  O  O     . ARG C  3  563  ? 287.221 310.769 301.904 1.00 86.94  ? 563  ARG 3 O     1 
ATOM   2181  C  CB    . ARG C  3  563  ? 286.968 310.740 305.155 1.00 86.94  ? 563  ARG 3 CB    1 
ATOM   2182  N  N     . PRO C  3  564  ? 289.242 310.500 302.843 1.00 79.95  ? 564  PRO 3 N     1 
ATOM   2183  C  CA    . PRO C  3  564  ? 289.784 309.833 301.649 1.00 79.95  ? 564  PRO 3 CA    1 
ATOM   2184  C  C     . PRO C  3  564  ? 289.163 308.463 301.404 1.00 79.95  ? 564  PRO 3 C     1 
ATOM   2185  O  O     . PRO C  3  564  ? 288.431 307.908 302.226 1.00 79.95  ? 564  PRO 3 O     1 
ATOM   2186  C  CB    . PRO C  3  564  ? 291.279 309.709 301.958 1.00 79.95  ? 564  PRO 3 CB    1 
ATOM   2187  N  N     . ARG C  3  565  ? 289.488 307.913 300.236 1.00 76.11  ? 565  ARG 3 N     1 
ATOM   2188  C  CA    . ARG C  3  565  ? 288.897 306.677 299.749 1.00 76.11  ? 565  ARG 3 CA    1 
ATOM   2189  C  C     . ARG C  3  565  ? 290.003 305.646 299.539 1.00 76.11  ? 565  ARG 3 C     1 
ATOM   2190  O  O     . ARG C  3  565  ? 291.178 305.989 299.378 1.00 76.11  ? 565  ARG 3 O     1 
ATOM   2191  C  CB    . ARG C  3  565  ? 288.108 306.932 298.442 1.00 76.11  ? 565  ARG 3 CB    1 
ATOM   2192  N  N     . TYR C  3  566  ? 289.606 304.371 299.582 1.00 65.22  ? 566  TYR 3 N     1 
ATOM   2193  C  CA    . TYR C  3  566  ? 290.484 303.243 299.293 1.00 65.22  ? 566  TYR 3 CA    1 
ATOM   2194  C  C     . TYR C  3  566  ? 291.041 303.332 297.875 1.00 65.22  ? 566  TYR 3 C     1 
ATOM   2195  O  O     . TYR C  3  566  ? 290.422 303.905 296.974 1.00 65.22  ? 566  TYR 3 O     1 
ATOM   2196  C  CB    . TYR C  3  566  ? 289.691 301.947 299.485 1.00 65.22  ? 566  TYR 3 CB    1 
ATOM   2197  N  N     . SER C  3  567  ? 292.221 302.746 297.679 1.00 68.06  ? 567  SER 3 N     1 
ATOM   2198  C  CA    . SER C  3  567  ? 292.929 302.857 296.411 1.00 68.06  ? 567  SER 3 CA    1 
ATOM   2199  C  C     . SER C  3  567  ? 292.316 301.923 295.365 1.00 68.06  ? 567  SER 3 C     1 
ATOM   2200  O  O     . SER C  3  567  ? 291.275 301.295 295.574 1.00 68.06  ? 567  SER 3 O     1 
ATOM   2201  C  CB    . SER C  3  567  ? 294.413 302.558 296.608 1.00 68.06  ? 567  SER 3 CB    1 
ATOM   2202  N  N     . GLY C  3  568  ? 292.977 301.837 294.210 1.00 65.96  ? 568  GLY 3 N     1 
ATOM   2203  C  CA    . GLY C  3  568  ? 292.493 301.043 293.101 1.00 65.96  ? 568  GLY 3 CA    1 
ATOM   2204  C  C     . GLY C  3  568  ? 293.065 299.654 292.830 1.00 65.96  ? 568  GLY 3 C     1 
ATOM   2205  O  O     . GLY C  3  568  ? 293.698 299.454 291.789 1.00 65.96  ? 568  GLY 3 O     1 
ATOM   2206  N  N     . PRO C  3  569  ? 292.891 298.658 293.738 1.00 60.24  ? 569  PRO 3 N     1 
ATOM   2207  C  CA    . PRO C  3  569  ? 292.807 297.273 293.248 1.00 60.24  ? 569  PRO 3 CA    1 
ATOM   2208  C  C     . PRO C  3  569  ? 291.380 296.910 292.866 1.00 60.24  ? 569  PRO 3 C     1 
ATOM   2209  O  O     . PRO C  3  569  ? 290.509 297.784 292.839 1.00 60.24  ? 569  PRO 3 O     1 
ATOM   2210  C  CB    . PRO C  3  569  ? 293.317 296.438 294.429 1.00 60.24  ? 569  PRO 3 CB    1 
ATOM   2211  N  N     . ALA C  3  570  ? 291.128 295.636 292.555 1.00 53.40  ? 570  ALA 3 N     1 
ATOM   2212  C  CA    . ALA C  3  570  ? 289.815 295.169 292.115 1.00 53.40  ? 570  ALA 3 CA    1 
ATOM   2213  C  C     . ALA C  3  570  ? 289.074 294.480 293.255 1.00 53.40  ? 570  ALA 3 C     1 
ATOM   2214  O  O     . ALA C  3  570  ? 289.475 293.393 293.697 1.00 53.40  ? 570  ALA 3 O     1 
ATOM   2215  C  CB    . ALA C  3  570  ? 289.957 294.222 290.920 1.00 53.40  ? 570  ALA 3 CB    1 
ATOM   2216  N  N     . PRO C  3  571  ? 287.993 295.064 293.767 1.00 61.24  ? 571  PRO 3 N     1 
ATOM   2217  C  CA    . PRO C  3  571  ? 287.147 294.349 294.726 1.00 61.24  ? 571  PRO 3 CA    1 
ATOM   2218  C  C     . PRO C  3  571  ? 286.112 293.506 294.004 1.00 61.24  ? 571  PRO 3 C     1 
ATOM   2219  O  O     . PRO C  3  571  ? 285.751 293.806 292.856 1.00 61.24  ? 571  PRO 3 O     1 
ATOM   2220  C  CB    . PRO C  3  571  ? 286.483 295.484 295.518 1.00 61.24  ? 571  PRO 3 CB    1 
ATOM   2221  N  N     . PRO C  3  572  ? 285.624 292.435 294.626 1.00 52.58  ? 572  PRO 3 N     1 
ATOM   2222  C  CA    . PRO C  3  572  ? 284.558 291.637 294.006 1.00 52.58  ? 572  PRO 3 CA    1 
ATOM   2223  C  C     . PRO C  3  572  ? 283.239 292.387 294.012 1.00 52.58  ? 572  PRO 3 C     1 
ATOM   2224  O  O     . PRO C  3  572  ? 282.977 293.193 294.918 1.00 52.58  ? 572  PRO 3 O     1 
ATOM   2225  C  CB    . PRO C  3  572  ? 284.488 290.385 294.895 1.00 52.58  ? 572  PRO 3 CB    1 
ATOM   2226  N  N     . PRO C  3  573  ? 282.388 292.163 293.015 1.00 47.42  ? 573  PRO 3 N     1 
ATOM   2227  C  CA    . PRO C  3  573  ? 281.060 292.782 293.021 1.00 47.42  ? 573  PRO 3 CA    1 
ATOM   2228  C  C     . PRO C  3  573  ? 280.137 292.102 294.021 1.00 47.42  ? 573  PRO 3 C     1 
ATOM   2229  O  O     . PRO C  3  573  ? 280.322 290.944 294.400 1.00 47.42  ? 573  PRO 3 O     1 
ATOM   2230  C  CB    . PRO C  3  573  ? 280.570 292.580 291.583 1.00 47.42  ? 573  PRO 3 CB    1 
ATOM   2231  N  N     . ASN C  3  574  ? 279.124 292.859 294.458 1.00 51.88  ? 574  ASN 3 N     1 
ATOM   2232  C  CA    . ASN C  3  574  ? 278.242 292.385 295.518 1.00 51.88  ? 574  ASN 3 CA    1 
ATOM   2233  C  C     . ASN C  3  574  ? 276.769 292.728 295.291 1.00 51.88  ? 574  ASN 3 C     1 
ATOM   2234  O  O     . ASN C  3  574  ? 276.038 292.881 296.272 1.00 51.88  ? 574  ASN 3 O     1 
ATOM   2235  C  CB    . ASN C  3  574  ? 278.712 292.946 296.868 1.00 51.88  ? 574  ASN 3 CB    1 
ATOM   2236  N  N     . ARG C  3  575  ? 276.358 292.946 294.030 1.00 49.72  ? 575  ARG 3 N     1 
ATOM   2237  C  CA    . ARG C  3  575  ? 275.009 293.164 293.476 1.00 49.72  ? 575  ARG 3 CA    1 
ATOM   2238  C  C     . ARG C  3  575  ? 274.431 294.535 293.836 1.00 49.72  ? 575  ARG 3 C     1 
ATOM   2239  O  O     . ARG C  3  575  ? 273.504 295.011 293.173 1.00 49.72  ? 575  ARG 3 O     1 
ATOM   2240  C  CB    . ARG C  3  575  ? 274.009 292.072 293.920 1.00 49.72  ? 575  ARG 3 CB    1 
ATOM   2241  N  N     . PHE C  3  576  ? 275.049 295.218 294.800 1.00 52.44  ? 576  PHE 3 N     1 
ATOM   2242  C  CA    . PHE C  3  576  ? 274.582 296.489 295.351 1.00 52.44  ? 576  PHE 3 CA    1 
ATOM   2243  C  C     . PHE C  3  576  ? 275.832 297.358 295.415 1.00 52.44  ? 576  PHE 3 C     1 
ATOM   2244  O  O     . PHE C  3  576  ? 276.661 297.151 296.304 1.00 52.44  ? 576  PHE 3 O     1 
ATOM   2245  C  CB    . PHE C  3  576  ? 273.975 296.310 296.740 1.00 52.44  ? 576  PHE 3 CB    1 
ATOM   2246  N  N     . TRP C  3  579  ? 275.959 298.304 294.489 1.00 53.34  ? 579  TRP 3 N     1 
ATOM   2247  C  CA    . TRP C  3  579  ? 277.210 299.030 294.252 1.00 53.34  ? 579  TRP 3 CA    1 
ATOM   2248  C  C     . TRP C  3  579  ? 277.607 299.872 295.460 1.00 53.34  ? 579  TRP 3 C     1 
ATOM   2249  O  O     . TRP C  3  579  ? 276.967 300.898 295.724 1.00 53.34  ? 579  TRP 3 O     1 
ATOM   2250  C  CB    . TRP C  3  579  ? 277.071 299.900 293.010 1.00 53.34  ? 579  TRP 3 CB    1 
ATOM   2251  N  N     . PRO C  3  580  ? 278.641 299.479 296.218 1.00 61.19  ? 580  PRO 3 N     1 
ATOM   2252  C  CA    . PRO C  3  580  ? 278.809 300.016 297.573 1.00 61.19  ? 580  PRO 3 CA    1 
ATOM   2253  C  C     . PRO C  3  580  ? 279.722 301.225 297.649 1.00 61.19  ? 580  PRO 3 C     1 
ATOM   2254  O  O     . PRO C  3  580  ? 280.364 301.616 296.669 1.00 61.19  ? 580  PRO 3 O     1 
ATOM   2255  C  CB    . PRO C  3  580  ? 279.431 298.833 298.321 1.00 61.19  ? 580  PRO 3 CB    1 
ATOM   2256  N  N     . GLY C  3  581  ? 279.772 301.817 298.837 1.00 67.38  ? 581  GLY 3 N     1 
ATOM   2257  C  CA    . GLY C  3  581  ? 280.842 302.716 299.212 1.00 67.38  ? 581  GLY 3 CA    1 
ATOM   2258  C  C     . GLY C  3  581  ? 281.969 301.930 299.850 1.00 67.38  ? 581  GLY 3 C     1 
ATOM   2259  O  O     . GLY C  3  581  ? 282.091 301.911 301.077 1.00 67.38  ? 581  GLY 3 O     1 
ATOM   2260  N  N     . TYR C  3  582  ? 282.764 301.229 299.040 1.00 68.81  ? 582  TYR 3 N     1 
ATOM   2261  C  CA    . TYR C  3  582  ? 283.861 300.431 299.574 1.00 68.81  ? 582  TYR 3 CA    1 
ATOM   2262  C  C     . TYR C  3  582  ? 285.072 301.309 299.881 1.00 68.81  ? 582  TYR 3 C     1 
ATOM   2263  O  O     . TYR C  3  582  ? 285.582 302.022 299.013 1.00 68.81  ? 582  TYR 3 O     1 
ATOM   2264  C  CB    . TYR C  3  582  ? 284.224 299.289 298.600 1.00 68.81  ? 582  TYR 3 CB    1 
ATOM   2265  N  N     . ARG C  3  583  ? 285.500 301.277 301.143 1.00 70.20  ? 583  ARG 3 N     1 
ATOM   2266  C  CA    . ARG C  3  583  ? 286.701 301.972 301.600 1.00 70.20  ? 583  ARG 3 CA    1 
ATOM   2267  C  C     . ARG C  3  583  ? 287.171 301.338 302.905 1.00 70.20  ? 583  ARG 3 C     1 
ATOM   2268  O  O     . ARG C  3  583  ? 286.472 300.519 303.509 1.00 70.20  ? 583  ARG 3 O     1 
ATOM   2269  C  CB    . ARG C  3  583  ? 286.481 303.482 301.769 1.00 70.20  ? 583  ARG 3 CB    1 
ATOM   2270  N  N     . TRP C  3  584  ? 288.374 301.749 303.327 1.00 68.75  ? 584  TRP 3 N     1 
ATOM   2271  C  CA    . TRP C  3  584  ? 289.100 301.201 304.484 1.00 68.75  ? 584  TRP 3 CA    1 
ATOM   2272  C  C     . TRP C  3  584  ? 289.264 299.680 304.424 1.00 68.75  ? 584  TRP 3 C     1 
ATOM   2273  O  O     . TRP C  3  584  ? 288.670 298.937 305.211 1.00 68.75  ? 584  TRP 3 O     1 
ATOM   2274  C  CB    . TRP C  3  584  ? 288.482 301.633 305.819 1.00 68.75  ? 584  TRP 3 CB    1 
ATOM   2275  N  N     . ASP C  3  585  ? 290.064 299.231 303.447 1.00 58.29  ? 585  ASP 3 N     1 
ATOM   2276  C  CA    . ASP C  3  585  ? 290.692 297.900 303.426 1.00 58.29  ? 585  ASP 3 CA    1 
ATOM   2277  C  C     . ASP C  3  585  ? 289.666 296.768 303.304 1.00 58.29  ? 585  ASP 3 C     1 
ATOM   2278  O  O     . ASP C  3  585  ? 289.575 295.892 304.165 1.00 58.29  ? 585  ASP 3 O     1 
ATOM   2279  C  CB    . ASP C  3  585  ? 291.588 297.705 304.657 1.00 58.29  ? 585  ASP 3 CB    1 
ATOM   2280  N  N     . GLY C  3  586  ? 288.885 296.788 302.226 1.00 57.68  ? 586  GLY 3 N     1 
ATOM   2281  C  CA    . GLY C  3  586  ? 287.960 295.706 301.937 1.00 57.68  ? 586  GLY 3 CA    1 
ATOM   2282  C  C     . GLY C  3  586  ? 288.521 294.623 301.033 1.00 57.68  ? 586  GLY 3 C     1 
ATOM   2283  O  O     . GLY C  3  586  ? 288.106 294.509 299.876 1.00 57.68  ? 586  GLY 3 O     1 
ATOM   2284  N  N     . VAL C  3  587  ? 289.459 293.821 301.541 1.00 58.08  ? 587  VAL 3 N     1 
ATOM   2285  C  CA    . VAL C  3  587  ? 290.160 292.836 300.720 1.00 58.08  ? 587  VAL 3 CA    1 
ATOM   2286  C  C     . VAL C  3  587  ? 289.481 291.462 300.723 1.00 58.08  ? 587  VAL 3 C     1 
ATOM   2287  O  O     . VAL C  3  587  ? 289.835 290.578 301.513 1.00 58.08  ? 587  VAL 3 O     1 
ATOM   2288  C  CB    . VAL C  3  587  ? 291.643 292.754 301.141 1.00 58.08  ? 587  VAL 3 CB    1 
ATOM   2289  N  N     . ASP C  3  588  ? 288.479 291.320 299.837 1.00 60.54  ? 588  ASP 3 N     1 
ATOM   2290  C  CA    . ASP C  3  588  ? 287.920 290.072 299.249 1.00 60.54  ? 588  ASP 3 CA    1 
ATOM   2291  C  C     . ASP C  3  588  ? 287.844 288.859 300.190 1.00 60.54  ? 588  ASP 3 C     1 
ATOM   2292  O  O     . ASP C  3  588  ? 288.223 287.741 299.833 1.00 60.54  ? 588  ASP 3 O     1 
ATOM   2293  C  CB    . ASP C  3  588  ? 288.635 289.720 297.922 1.00 60.54  ? 588  ASP 3 CB    1 
ATOM   2294  N  N     . ARG C  3  589  ? 287.305 289.062 301.389 1.00 51.60  ? 589  ARG 3 N     1 
ATOM   2295  C  CA    . ARG C  3  589  ? 287.035 287.957 302.306 1.00 51.60  ? 589  ARG 3 CA    1 
ATOM   2296  C  C     . ARG C  3  589  ? 285.525 287.774 302.456 1.00 51.60  ? 589  ARG 3 C     1 
ATOM   2297  O  O     . ARG C  3  589  ? 284.792 288.744 302.688 1.00 51.60  ? 589  ARG 3 O     1 
ATOM   2298  C  CB    . ARG C  3  589  ? 287.739 288.148 303.661 1.00 51.60  ? 589  ARG 3 CB    1 
ATOM   2299  N  N     . SER C  3  590  ? 285.069 286.531 302.283 1.00 44.18  ? 590  SER 3 N     1 
ATOM   2300  C  CA    . SER C  3  590  ? 283.653 286.178 302.293 1.00 44.18  ? 590  SER 3 CA    1 
ATOM   2301  C  C     . SER C  3  590  ? 283.525 284.663 302.385 1.00 44.18  ? 590  SER 3 C     1 
ATOM   2302  O  O     . SER C  3  590  ? 284.522 283.937 302.398 1.00 44.18  ? 590  SER 3 O     1 
ATOM   2303  C  CB    . SER C  3  590  ? 282.926 286.691 301.043 1.00 44.18  ? 590  SER 3 CB    1 
ATOM   2304  N  N     . ASN C  3  591  ? 282.275 284.195 302.450 1.00 42.76  ? 591  ASN 3 N     1 
ATOM   2305  C  CA    . ASN C  3  591  ? 282.008 282.760 302.448 1.00 42.76  ? 591  ASN 3 CA    1 
ATOM   2306  C  C     . ASN C  3  591  ? 281.725 282.204 301.055 1.00 42.76  ? 591  ASN 3 C     1 
ATOM   2307  O  O     . ASN C  3  591  ? 281.694 280.979 300.892 1.00 42.76  ? 591  ASN 3 O     1 
ATOM   2308  C  CB    . ASN C  3  591  ? 280.843 282.436 303.395 1.00 42.76  ? 591  ASN 3 CB    1 
ATOM   2309  N  N     . GLY C  3  592  ? 281.515 283.064 300.062 1.00 41.27  ? 592  GLY 3 N     1 
ATOM   2310  C  CA    . GLY C  3  592  ? 281.199 282.618 298.720 1.00 41.27  ? 592  GLY 3 CA    1 
ATOM   2311  C  C     . GLY C  3  592  ? 279.710 282.532 298.452 1.00 41.27  ? 592  GLY 3 C     1 
ATOM   2312  O  O     . GLY C  3  592  ? 279.224 281.531 297.917 1.00 41.27  ? 592  GLY 3 O     1 
ATOM   2313  N  N     . PHE C  3  593  ? 278.976 283.579 298.820 1.00 43.05  ? 593  PHE 3 N     1 
ATOM   2314  C  CA    . PHE C  3  593  ? 277.536 283.658 298.605 1.00 43.05  ? 593  PHE 3 CA    1 
ATOM   2315  C  C     . PHE C  3  593  ? 277.161 284.543 297.429 1.00 43.05  ? 593  PHE 3 C     1 
ATOM   2316  O  O     . PHE C  3  593  ? 276.127 284.316 296.794 1.00 43.05  ? 593  PHE 3 O     1 
ATOM   2317  C  CB    . PHE C  3  593  ? 276.844 284.169 299.877 1.00 43.05  ? 593  PHE 3 CB    1 
ATOM   2318  N  N     . GLU C  3  594  ? 277.986 285.545 297.120 1.00 44.54  ? 594  GLU 3 N     1 
ATOM   2319  C  CA    . GLU C  3  594  ? 277.736 286.390 295.957 1.00 44.54  ? 594  GLU 3 CA    1 
ATOM   2320  C  C     . GLU C  3  594  ? 277.954 285.618 294.663 1.00 44.54  ? 594  GLU 3 C     1 
ATOM   2321  O  O     . GLU C  3  594  ? 277.097 285.629 293.770 1.00 44.54  ? 594  GLU 3 O     1 
ATOM   2322  C  CB    . GLU C  3  594  ? 278.644 287.619 295.998 1.00 44.54  ? 594  GLU 3 CB    1 
ATOM   2323  N  N     . GLN C  3  595  ? 279.101 284.937 294.553 1.00 42.99  ? 595  GLN 3 N     1 
ATOM   2324  C  CA    . GLN C  3  595  ? 279.449 284.206 293.337 1.00 42.99  ? 595  GLN 3 CA    1 
ATOM   2325  C  C     . GLN C  3  595  ? 278.500 283.036 293.098 1.00 42.99  ? 595  GLN 3 C     1 
ATOM   2326  O  O     . GLN C  3  595  ? 278.141 282.744 291.949 1.00 42.99  ? 595  GLN 3 O     1 
ATOM   2327  C  CB    . GLN C  3  595  ? 280.899 283.725 293.430 1.00 42.99  ? 595  GLN 3 CB    1 
ATOM   2328  N  N     . LYS C  3  596  ? 278.037 282.399 294.179 1.00 41.75  ? 596  LYS 3 N     1 
ATOM   2329  C  CA    . LYS C  3  596  ? 277.149 281.245 294.062 1.00 41.75  ? 596  LYS 3 CA    1 
ATOM   2330  C  C     . LYS C  3  596  ? 275.790 281.644 293.501 1.00 41.75  ? 596  LYS 3 C     1 
ATOM   2331  O  O     . LYS C  3  596  ? 275.283 281.018 292.563 1.00 41.75  ? 596  LYS 3 O     1 
ATOM   2332  C  CB    . LYS C  3  596  ? 276.992 280.571 295.425 1.00 41.75  ? 596  LYS 3 CB    1 
ATOM   2333  N  N     . ARG C  3  597  ? 275.200 282.716 294.027 1.00 45.28  ? 597  ARG 3 N     1 
ATOM   2334  C  CA    . ARG C  3  597  ? 273.895 283.111 293.514 1.00 45.28  ? 597  ARG 3 CA    1 
ATOM   2335  C  C     . ARG C  3  597  ? 274.004 283.879 292.199 1.00 45.28  ? 597  ARG 3 C     1 
ATOM   2336  O  O     . ARG C  3  597  ? 273.034 283.910 291.434 1.00 45.28  ? 597  ARG 3 O     1 
ATOM   2337  C  CB    . ARG C  3  597  ? 273.126 283.920 294.555 1.00 45.28  ? 597  ARG 3 CB    1 
ATOM   2338  N  N     . PHE C  3  598  ? 275.165 284.474 291.898 1.00 44.43  ? 598  PHE 3 N     1 
ATOM   2339  C  CA    . PHE C  3  598  ? 275.381 285.019 290.557 1.00 44.43  ? 598  PHE 3 CA    1 
ATOM   2340  C  C     . PHE C  3  598  ? 275.424 283.905 289.514 1.00 44.43  ? 598  PHE 3 C     1 
ATOM   2341  O  O     . PHE C  3  598  ? 274.824 284.022 288.436 1.00 44.43  ? 598  PHE 3 O     1 
ATOM   2342  C  CB    . PHE C  3  598  ? 276.665 285.850 290.516 1.00 44.43  ? 598  PHE 3 CB    1 
ATOM   2343  N  N     . ALA C  3  599  ? 276.107 282.800 289.837 1.00 44.43  ? 599  ALA 3 N     1 
ATOM   2344  C  CA    . ALA C  3  599  ? 276.076 281.622 288.975 1.00 44.43  ? 599  ALA 3 CA    1 
ATOM   2345  C  C     . ALA C  3  599  ? 274.679 281.014 288.915 1.00 44.43  ? 599  ALA 3 C     1 
ATOM   2346  O  O     . ALA C  3  599  ? 274.271 280.493 287.873 1.00 44.43  ? 599  ALA 3 O     1 
ATOM   2347  C  CB    . ALA C  3  599  ? 277.090 280.587 289.463 1.00 44.43  ? 599  ALA 3 CB    1 
ATOM   2348  N  N     . ARG C  3  600  ? 273.923 281.101 290.016 1.00 47.17  ? 600  ARG 3 N     1 
ATOM   2349  C  CA    . ARG C  3  600  ? 272.551 280.595 290.043 1.00 47.17  ? 600  ARG 3 CA    1 
ATOM   2350  C  C     . ARG C  3  600  ? 271.646 281.400 289.114 1.00 47.17  ? 600  ARG 3 C     1 
ATOM   2351  O  O     . ARG C  3  600  ? 270.847 280.830 288.364 1.00 47.17  ? 600  ARG 3 O     1 
ATOM   2352  C  CB    . ARG C  3  600  ? 272.022 280.617 291.484 1.00 47.17  ? 600  ARG 3 CB    1 
ATOM   2353  N  N     . LEU C  3  601  ? 271.756 282.732 289.149 1.00 44.15  ? 601  LEU 3 N     1 
ATOM   2354  C  CA    . LEU C  3  601  ? 270.901 283.558 288.301 1.00 44.15  ? 601  LEU 3 CA    1 
ATOM   2355  C  C     . LEU C  3  601  ? 271.324 283.482 286.839 1.00 44.15  ? 601  LEU 3 C     1 
ATOM   2356  O  O     . LEU C  3  601  ? 270.467 283.526 285.947 1.00 44.15  ? 601  LEU 3 O     1 
ATOM   2357  C  CB    . LEU C  3  601  ? 270.880 285.009 288.806 1.00 44.15  ? 601  LEU 3 CB    1 
ATOM   2358  N  N     . ALA C  3  602  ? 272.627 283.327 286.574 1.00 41.40  ? 602  ALA 3 N     1 
ATOM   2359  C  CA    . ALA C  3  602  ? 273.079 283.101 285.204 1.00 41.40  ? 602  ALA 3 CA    1 
ATOM   2360  C  C     . ALA C  3  602  ? 272.612 281.746 284.682 1.00 41.40  ? 602  ALA 3 C     1 
ATOM   2361  O  O     . ALA C  3  602  ? 272.211 281.623 283.517 1.00 41.40  ? 602  ALA 3 O     1 
ATOM   2362  C  CB    . ALA C  3  602  ? 274.600 283.209 285.134 1.00 41.40  ? 602  ALA 3 CB    1 
ATOM   2363  N  N     . SER C  3  603  ? 272.633 280.720 285.541 1.00 45.65  ? 603  SER 3 N     1 
ATOM   2364  C  CA    . SER C  3  603  ? 272.124 279.409 285.155 1.00 45.65  ? 603  SER 3 CA    1 
ATOM   2365  C  C     . SER C  3  603  ? 270.617 279.442 284.950 1.00 45.65  ? 603  SER 3 C     1 
ATOM   2366  O  O     . SER C  3  603  ? 270.094 278.738 284.084 1.00 45.65  ? 603  SER 3 O     1 
ATOM   2367  C  CB    . SER C  3  603  ? 272.500 278.368 286.210 1.00 45.65  ? 603  SER 3 CB    1 
ATOM   2368  N  N     . LYS C  3  604  ? 269.906 280.267 285.724 1.00 46.47  ? 604  LYS 3 N     1 
ATOM   2369  C  CA    . LYS C  3  604  ? 268.466 280.423 285.534 1.00 46.47  ? 604  LYS 3 CA    1 
ATOM   2370  C  C     . LYS C  3  604  ? 268.163 281.107 284.205 1.00 46.47  ? 604  LYS 3 C     1 
ATOM   2371  O  O     . LYS C  3  604  ? 267.254 280.692 283.472 1.00 46.47  ? 604  LYS 3 O     1 
ATOM   2372  C  CB    . LYS C  3  604  ? 267.866 281.204 286.709 1.00 46.47  ? 604  LYS 3 CB    1 
ATOM   2373  N  N     . LYS C  3  605  ? 268.933 282.150 283.871 1.00 45.15  ? 605  LYS 3 N     1 
ATOM   2374  C  CA    . LYS C  3  605  ? 268.791 282.817 282.581 1.00 45.15  ? 605  LYS 3 CA    1 
ATOM   2375  C  C     . LYS C  3  605  ? 269.188 281.919 281.415 1.00 45.15  ? 605  LYS 3 C     1 
ATOM   2376  O  O     . LYS C  3  605  ? 268.705 282.125 280.297 1.00 45.15  ? 605  LYS 3 O     1 
ATOM   2377  C  CB    . LYS C  3  605  ? 269.620 284.105 282.549 1.00 45.15  ? 605  LYS 3 CB    1 
ATOM   2378  N  N     . ALA C  3  606  ? 270.055 280.932 281.649 1.00 43.33  ? 606  ALA 3 N     1 
ATOM   2379  C  CA    . ALA C  3  606  ? 270.373 279.963 280.605 1.00 43.33  ? 606  ALA 3 CA    1 
ATOM   2380  C  C     . ALA C  3  606  ? 269.283 278.902 280.463 1.00 43.33  ? 606  ALA 3 C     1 
ATOM   2381  O  O     . ALA C  3  606  ? 268.926 278.514 279.343 1.00 43.33  ? 606  ALA 3 O     1 
ATOM   2382  C  CB    . ALA C  3  606  ? 271.725 279.306 280.894 1.00 43.33  ? 606  ALA 3 CB    1 
ATOM   2383  N  N     . VAL C  3  607  ? 268.739 278.415 281.584 1.00 46.20  ? 607  VAL 3 N     1 
ATOM   2384  C  CA    . VAL C  3  607  ? 267.780 277.320 281.482 1.00 46.20  ? 607  VAL 3 CA    1 
ATOM   2385  C  C     . VAL C  3  607  ? 266.407 277.826 281.067 1.00 46.20  ? 607  VAL 3 C     1 
ATOM   2386  O  O     . VAL C  3  607  ? 265.608 277.051 280.543 1.00 46.20  ? 607  VAL 3 O     1 
ATOM   2387  C  CB    . VAL C  3  607  ? 267.688 276.489 282.779 1.00 46.20  ? 607  VAL 3 CB    1 
ATOM   2388  N  N     . GLU C  3  608  ? 266.107 279.119 281.246 1.00 50.66  ? 608  GLU 3 N     1 
ATOM   2389  C  CA    . GLU C  3  608  ? 264.867 279.627 280.657 1.00 50.66  ? 608  GLU 3 CA    1 
ATOM   2390  C  C     . GLU C  3  608  ? 264.991 279.724 279.138 1.00 50.66  ? 608  GLU 3 C     1 
ATOM   2391  O  O     . GLU C  3  608  ? 264.026 279.453 278.410 1.00 50.66  ? 608  GLU 3 O     1 
ATOM   2392  C  CB    . GLU C  3  608  ? 264.473 280.972 281.285 1.00 50.66  ? 608  GLU 3 CB    1 
ATOM   2393  N  N     . GLU C  3  609  ? 266.195 280.044 278.648 1.00 46.65  ? 609  GLU 3 N     1 
ATOM   2394  C  CA    . GLU C  3  609  ? 266.460 280.049 277.213 1.00 46.65  ? 609  GLU 3 CA    1 
ATOM   2395  C  C     . GLU C  3  609  ? 266.389 278.646 276.627 1.00 46.65  ? 609  GLU 3 C     1 
ATOM   2396  O  O     . GLU C  3  609  ? 265.837 278.457 275.538 1.00 46.65  ? 609  GLU 3 O     1 
ATOM   2397  C  CB    . GLU C  3  609  ? 267.833 280.670 276.943 1.00 46.65  ? 609  GLU 3 CB    1 
ATOM   2398  N  N     . LEU C  3  610  ? 266.927 277.650 277.335 1.00 43.31  ? 610  LEU 3 N     1 
ATOM   2399  C  CA    . LEU C  3  610  ? 266.811 276.277 276.848 1.00 43.31  ? 610  LEU 3 CA    1 
ATOM   2400  C  C     . LEU C  3  610  ? 265.408 275.710 277.051 1.00 43.31  ? 610  LEU 3 C     1 
ATOM   2401  O  O     . LEU C  3  610  ? 264.978 274.838 276.290 1.00 43.31  ? 610  LEU 3 O     1 
ATOM   2402  C  CB    . LEU C  3  610  ? 267.851 275.369 277.508 1.00 43.31  ? 610  LEU 3 CB    1 
ATOM   2403  N  N     . ALA C  3  611  ? 264.666 276.201 278.048 1.00 46.08  ? 611  ALA 3 N     1 
ATOM   2404  C  CA    . ALA C  3  611  ? 263.315 275.706 278.279 1.00 46.08  ? 611  ALA 3 CA    1 
ATOM   2405  C  C     . ALA C  3  611  ? 262.337 276.248 277.249 1.00 46.08  ? 611  ALA 3 C     1 
ATOM   2406  O  O     . ALA C  3  611  ? 261.391 275.546 276.874 1.00 46.08  ? 611  ALA 3 O     1 
ATOM   2407  C  CB    . ALA C  3  611  ? 262.856 276.069 279.690 1.00 46.08  ? 611  ALA 3 CB    1 
ATOM   2408  N  N     . TYR C  3  612  ? 262.551 277.481 276.776 1.00 37.31  ? 612  TYR 3 N     1 
ATOM   2409  C  CA    . TYR C  3  612  ? 261.756 277.987 275.661 1.00 37.31  ? 612  TYR 3 CA    1 
ATOM   2410  C  C     . TYR C  3  612  ? 262.012 277.176 274.395 1.00 37.31  ? 612  TYR 3 C     1 
ATOM   2411  O  O     . TYR C  3  612  ? 261.078 276.876 273.640 1.00 37.31  ? 612  TYR 3 O     1 
ATOM   2412  C  CB    . TYR C  3  612  ? 262.051 279.468 275.421 1.00 37.31  ? 612  TYR 3 CB    1 
ATOM   2413  N  N     . LYS C  3  613  ? 263.277 276.804 274.160 1.00 38.08  ? 613  LYS 3 N     1 
ATOM   2414  C  CA    . LYS C  3  613  ? 263.637 275.916 273.056 1.00 38.08  ? 613  LYS 3 CA    1 
ATOM   2415  C  C     . LYS C  3  613  ? 262.956 274.559 273.190 1.00 38.08  ? 613  LYS 3 C     1 
ATOM   2416  O  O     . LYS C  3  613  ? 262.386 274.039 272.227 1.00 38.08  ? 613  LYS 3 O     1 
ATOM   2417  C  CB    . LYS C  3  613  ? 265.156 275.733 272.998 1.00 38.08  ? 613  LYS 3 CB    1 
ATOM   2418  N  N     . TRP C  3  614  ? 263.000 273.984 274.396 1.00 48.80  ? 614  TRP 3 N     1 
ATOM   2419  C  CA    . TRP C  3  614  ? 262.407 272.675 274.655 1.00 48.80  ? 614  TRP 3 CA    1 
ATOM   2420  C  C     . TRP C  3  614  ? 260.889 272.704 274.533 1.00 48.80  ? 614  TRP 3 C     1 
ATOM   2421  O  O     . TRP C  3  614  ? 260.272 271.686 274.195 1.00 48.80  ? 614  TRP 3 O     1 
ATOM   2422  C  CB    . TRP C  3  614  ? 262.820 272.201 276.050 1.00 48.80  ? 614  TRP 3 CB    1 
ATOM   2423  N  N     . SER C  3  615  ? 260.271 273.856 274.800 1.00 40.71  ? 615  SER 3 N     1 
ATOM   2424  C  CA    . SER C  3  615  ? 258.824 273.970 274.664 1.00 40.71  ? 615  SER 3 CA    1 
ATOM   2425  C  C     . SER C  3  615  ? 258.415 274.247 273.221 1.00 40.71  ? 615  SER 3 C     1 
ATOM   2426  O  O     . SER C  3  615  ? 257.301 273.899 272.812 1.00 40.71  ? 615  SER 3 O     1 
ATOM   2427  C  CB    . SER C  3  615  ? 258.300 275.069 275.587 1.00 40.71  ? 615  SER 3 CB    1 
ATOM   2428  N  N     . VAL C  3  616  ? 259.295 274.868 272.434 1.00 34.72  ? 616  VAL 3 N     1 
ATOM   2429  C  CA    . VAL C  3  616  ? 258.944 275.324 271.094 1.00 34.72  ? 616  VAL 3 CA    1 
ATOM   2430  C  C     . VAL C  3  616  ? 259.302 274.283 270.026 1.00 34.72  ? 616  VAL 3 C     1 
ATOM   2431  O  O     . VAL C  3  616  ? 259.184 274.564 268.823 1.00 34.72  ? 616  VAL 3 O     1 
ATOM   2432  C  CB    . VAL C  3  616  ? 259.587 276.702 270.807 1.00 34.72  ? 616  VAL 3 CB    1 
ATOM   2433  N  N     . GLU C  3  617  ? 259.671 273.061 270.443 1.00 37.60  ? 617  GLU 3 N     1 
ATOM   2434  C  CA    . GLU C  3  617  ? 260.224 272.050 269.535 1.00 37.60  ? 617  GLU 3 CA    1 
ATOM   2435  C  C     . GLU C  3  617  ? 259.227 271.629 268.458 1.00 37.60  ? 617  GLU 3 C     1 
ATOM   2436  O  O     . GLU C  3  617  ? 259.433 271.886 267.266 1.00 37.60  ? 617  GLU 3 O     1 
ATOM   2437  C  CB    . GLU C  3  617  ? 260.673 270.817 270.327 1.00 37.60  ? 617  GLU 3 CB    1 
ATOM   2438  N  N     . ASP C  3  618  ? 258.127 270.998 268.860 1.00 38.82  ? 618  ASP 3 N     1 
ATOM   2439  C  CA    . ASP C  3  618  ? 257.210 270.432 267.878 1.00 38.82  ? 618  ASP 3 CA    1 
ATOM   2440  C  C     . ASP C  3  618  ? 256.020 271.331 267.572 1.00 38.82  ? 618  ASP 3 C     1 
ATOM   2441  O  O     . ASP C  3  618  ? 254.980 270.818 267.144 1.00 38.82  ? 618  ASP 3 O     1 
ATOM   2442  C  CB    . ASP C  3  618  ? 256.727 269.062 268.351 1.00 38.82  ? 618  ASP 3 CB    1 
ATOM   2443  N  N     . MET C  3  619  ? 256.137 272.639 267.773 1.00 28.00  ? 619  MET 3 N     1 
ATOM   2444  C  CA    . MET C  3  619  ? 255.048 273.555 267.457 1.00 28.00  ? 619  MET 3 CA    1 
ATOM   2445  C  C     . MET C  3  619  ? 255.160 274.068 266.025 1.00 28.00  ? 619  MET 3 C     1 
ATOM   2446  O  O     . MET C  3  619  ? 255.200 273.286 265.075 1.00 28.00  ? 619  MET 3 O     1 
ATOM   2447  C  CB    . MET C  3  619  ? 255.034 274.731 268.435 1.00 28.00  ? 619  MET 3 CB    1 
ATOM   2448  P  P     . U   D  4  5    ? 201.158 283.978 165.815 1.00 171.97 ? 5    U   5 P     1 
ATOM   2449  O  OP1   . U   D  4  5    ? 200.492 283.394 167.007 1.00 171.97 ? 5    U   5 OP1   1 
ATOM   2450  O  OP2   . U   D  4  5    ? 202.183 285.037 165.994 1.00 171.97 ? 5    U   5 OP2   1 
ATOM   2451  O  "O5'" . U   D  4  5    ? 201.818 282.787 164.989 1.00 171.97 ? 5    U   5 "O5'" 1 
ATOM   2452  C  "C5'" . U   D  4  5    ? 201.011 281.807 164.352 1.00 171.97 ? 5    U   5 "C5'" 1 
ATOM   2453  C  "C4'" . U   D  4  5    ? 201.837 280.645 163.862 1.00 171.97 ? 5    U   5 "C4'" 1 
ATOM   2454  O  "O4'" . U   D  4  5    ? 202.743 281.090 162.819 1.00 171.97 ? 5    U   5 "O4'" 1 
ATOM   2455  C  "C3'" . U   D  4  5    ? 202.750 279.995 164.891 1.00 171.97 ? 5    U   5 "C3'" 1 
ATOM   2456  O  "O3'" . U   D  4  5    ? 202.068 279.084 165.735 1.00 171.97 ? 5    U   5 "O3'" 1 
ATOM   2457  C  "C2'" . U   D  4  5    ? 203.822 279.344 164.025 1.00 171.97 ? 5    U   5 "C2'" 1 
ATOM   2458  O  "O2'" . U   D  4  5    ? 203.360 278.109 163.498 1.00 171.97 ? 5    U   5 "O2'" 1 
ATOM   2459  C  "C1'" . U   D  4  5    ? 203.943 280.347 162.872 1.00 171.97 ? 5    U   5 "C1'" 1 
ATOM   2460  N  N1    . U   D  4  5    ? 205.085 281.279 163.037 1.00 171.97 ? 5    U   5 N1    1 
ATOM   2461  C  C2    . U   D  4  5    ? 206.336 280.843 162.633 1.00 171.97 ? 5    U   5 C2    1 
ATOM   2462  O  O2    . U   D  4  5    ? 206.539 279.737 162.160 1.00 171.97 ? 5    U   5 O2    1 
ATOM   2463  N  N3    . U   D  4  5    ? 207.353 281.749 162.804 1.00 171.97 ? 5    U   5 N3    1 
ATOM   2464  C  C4    . U   D  4  5    ? 207.256 283.024 163.322 1.00 171.97 ? 5    U   5 C4    1 
ATOM   2465  O  O4    . U   D  4  5    ? 208.267 283.721 163.412 1.00 171.97 ? 5    U   5 O4    1 
ATOM   2466  C  C5    . U   D  4  5    ? 205.934 283.406 163.713 1.00 171.97 ? 5    U   5 C5    1 
ATOM   2467  C  C6    . U   D  4  5    ? 204.924 282.545 163.556 1.00 171.97 ? 5    U   5 C6    1 
ATOM   2468  P  P     . C   D  4  6    ? 202.501 278.926 167.274 1.00 177.81 ? 6    C   5 P     1 
ATOM   2469  O  OP1   . C   D  4  6    ? 201.326 278.426 168.034 1.00 177.81 ? 6    C   5 OP1   1 
ATOM   2470  O  OP2   . C   D  4  6    ? 203.166 280.185 167.696 1.00 177.81 ? 6    C   5 OP2   1 
ATOM   2471  O  "O5'" . C   D  4  6    ? 203.599 277.773 167.248 1.00 177.81 ? 6    C   5 "O5'" 1 
ATOM   2472  C  "C5'" . C   D  4  6    ? 203.317 276.512 166.659 1.00 177.81 ? 6    C   5 "C5'" 1 
ATOM   2473  C  "C4'" . C   D  4  6    ? 204.582 275.786 166.278 1.00 177.81 ? 6    C   5 "C4'" 1 
ATOM   2474  O  "O4'" . C   D  4  6    ? 205.384 276.627 165.408 1.00 177.81 ? 6    C   5 "O4'" 1 
ATOM   2475  C  "C3'" . C   D  4  6    ? 205.521 275.436 167.422 1.00 177.81 ? 6    C   5 "C3'" 1 
ATOM   2476  O  "O3'" . C   D  4  6    ? 205.131 274.264 168.118 1.00 177.81 ? 6    C   5 "O3'" 1 
ATOM   2477  C  "C2'" . C   D  4  6    ? 206.871 275.314 166.725 1.00 177.81 ? 6    C   5 "C2'" 1 
ATOM   2478  O  "O2'" . C   D  4  6    ? 206.998 274.047 166.095 1.00 177.81 ? 6    C   5 "O2'" 1 
ATOM   2479  C  "C1'" . C   D  4  6    ? 206.757 276.386 165.636 1.00 177.81 ? 6    C   5 "C1'" 1 
ATOM   2480  N  N1    . C   D  4  6    ? 207.421 277.662 166.008 1.00 177.81 ? 6    C   5 N1    1 
ATOM   2481  C  C2    . C   D  4  6    ? 208.800 277.794 165.793 1.00 177.81 ? 6    C   5 C2    1 
ATOM   2482  O  O2    . C   D  4  6    ? 209.437 276.847 165.306 1.00 177.81 ? 6    C   5 O2    1 
ATOM   2483  N  N3    . C   D  4  6    ? 209.415 278.953 166.124 1.00 177.81 ? 6    C   5 N3    1 
ATOM   2484  C  C4    . C   D  4  6    ? 208.715 279.961 166.645 1.00 177.81 ? 6    C   5 C4    1 
ATOM   2485  N  N4    . C   D  4  6    ? 209.368 281.084 166.954 1.00 177.81 ? 6    C   5 N4    1 
ATOM   2486  C  C5    . C   D  4  6    ? 207.313 279.862 166.872 1.00 177.81 ? 6    C   5 C5    1 
ATOM   2487  C  C6    . C   D  4  6    ? 206.717 278.711 166.539 1.00 177.81 ? 6    C   5 C6    1 
ATOM   2488  P  P     . U   D  4  7    ? 205.565 274.051 169.650 1.00 175.05 ? 7    U   5 P     1 
ATOM   2489  O  OP1   . U   D  4  7    ? 204.720 272.973 170.224 1.00 175.05 ? 7    U   5 OP1   1 
ATOM   2490  O  OP2   . U   D  4  7    ? 205.603 275.383 170.307 1.00 175.05 ? 7    U   5 OP2   1 
ATOM   2491  O  "O5'" . U   D  4  7    ? 207.059 273.508 169.555 1.00 175.05 ? 7    U   5 "O5'" 1 
ATOM   2492  C  "C5'" . U   D  4  7    ? 207.895 273.469 170.701 1.00 175.05 ? 7    U   5 "C5'" 1 
ATOM   2493  C  "C4'" . U   D  4  7    ? 209.245 274.076 170.417 1.00 175.05 ? 7    U   5 "C4'" 1 
ATOM   2494  O  "O4'" . U   D  4  7    ? 209.076 275.337 169.720 1.00 175.05 ? 7    U   5 "O4'" 1 
ATOM   2495  C  "C3'" . U   D  4  7    ? 210.081 274.433 171.637 1.00 175.05 ? 7    U   5 "C3'" 1 
ATOM   2496  O  "O3'" . U   D  4  7    ? 210.773 273.318 172.170 1.00 175.05 ? 7    U   5 "O3'" 1 
ATOM   2497  C  "C2'" . U   D  4  7    ? 210.999 275.531 171.110 1.00 175.05 ? 7    U   5 "C2'" 1 
ATOM   2498  O  "O2'" . U   D  4  7    ? 212.099 274.972 170.407 1.00 175.05 ? 7    U   5 "O2'" 1 
ATOM   2499  C  "C1'" . U   D  4  7    ? 210.090 276.242 170.102 1.00 175.05 ? 7    U   5 "C1'" 1 
ATOM   2500  N  N1    . U   D  4  7    ? 209.459 277.469 170.648 1.00 175.05 ? 7    U   5 N1    1 
ATOM   2501  C  C2    . U   D  4  7    ? 210.198 278.640 170.640 1.00 175.05 ? 7    U   5 C2    1 
ATOM   2502  O  O2    . U   D  4  7    ? 211.341 278.709 170.218 1.00 175.05 ? 7    U   5 O2    1 
ATOM   2503  N  N3    . U   D  4  7    ? 209.552 279.740 171.150 1.00 175.05 ? 7    U   5 N3    1 
ATOM   2504  C  C4    . U   D  4  7    ? 208.269 279.795 171.653 1.00 175.05 ? 7    U   5 C4    1 
ATOM   2505  O  O4    . U   D  4  7    ? 207.828 280.864 172.077 1.00 175.05 ? 7    U   5 O4    1 
ATOM   2506  C  C5    . U   D  4  7    ? 207.566 278.550 171.623 1.00 175.05 ? 7    U   5 C5    1 
ATOM   2507  C  C6    . U   D  4  7    ? 208.169 277.463 171.131 1.00 175.05 ? 7    U   5 C6    1 
ATOM   2508  P  P     . G   D  4  8    ? 211.344 273.358 173.671 1.00 167.20 ? 8    G   5 P     1 
ATOM   2509  O  OP1   . G   D  4  8    ? 212.686 273.992 173.638 1.00 167.20 ? 8    G   5 OP1   1 
ATOM   2510  O  OP2   . G   D  4  8    ? 211.187 272.004 174.259 1.00 167.20 ? 8    G   5 OP2   1 
ATOM   2511  O  "O5'" . G   D  4  8    ? 210.353 274.344 174.434 1.00 167.20 ? 8    G   5 "O5'" 1 
ATOM   2512  C  "C5'" . G   D  4  8    ? 210.863 275.406 175.234 1.00 167.20 ? 8    G   5 "C5'" 1 
ATOM   2513  C  "C4'" . G   D  4  8    ? 209.891 275.847 176.305 1.00 167.20 ? 8    G   5 "C4'" 1 
ATOM   2514  O  "O4'" . G   D  4  8    ? 208.702 276.418 175.693 1.00 167.20 ? 8    G   5 "O4'" 1 
ATOM   2515  C  "C3'" . G   D  4  8    ? 209.403 274.760 177.265 1.00 167.20 ? 8    G   5 "C3'" 1 
ATOM   2516  O  "O3'" . G   D  4  8    ? 209.282 275.313 178.575 1.00 167.20 ? 8    G   5 "O3'" 1 
ATOM   2517  C  "C2'" . G   D  4  8    ? 208.009 274.436 176.731 1.00 167.20 ? 8    G   5 "C2'" 1 
ATOM   2518  O  "O2'" . G   D  4  8    ? 207.121 273.901 177.690 1.00 167.20 ? 8    G   5 "O2'" 1 
ATOM   2519  C  "C1'" . G   D  4  8    ? 207.550 275.804 176.236 1.00 167.20 ? 8    G   5 "C1'" 1 
ATOM   2520  N  N9    . G   D  4  8    ? 206.516 275.758 175.200 1.00 167.20 ? 8    G   5 N9    1 
ATOM   2521  C  C8    . G   D  4  8    ? 205.985 274.646 174.593 1.00 167.20 ? 8    G   5 C8    1 
ATOM   2522  N  N7    . G   D  4  8    ? 205.070 274.936 173.707 1.00 167.20 ? 8    G   5 N7    1 
ATOM   2523  C  C5    . G   D  4  8    ? 204.991 276.322 173.733 1.00 167.20 ? 8    G   5 C5    1 
ATOM   2524  C  C6    . G   D  4  8    ? 204.174 277.214 172.990 1.00 167.20 ? 8    G   5 C6    1 
ATOM   2525  O  O6    . G   D  4  8    ? 203.326 276.949 172.129 1.00 167.20 ? 8    G   5 O6    1 
ATOM   2526  N  N1    . G   D  4  8    ? 204.419 278.540 173.334 1.00 167.20 ? 8    G   5 N1    1 
ATOM   2527  C  C2    . G   D  4  8    ? 205.332 278.958 174.271 1.00 167.20 ? 8    G   5 C2    1 
ATOM   2528  N  N2    . G   D  4  8    ? 205.423 280.282 174.461 1.00 167.20 ? 8    G   5 N2    1 
ATOM   2529  N  N3    . G   D  4  8    ? 206.099 278.137 174.970 1.00 167.20 ? 8    G   5 N3    1 
ATOM   2530  C  C4    . G   D  4  8    ? 205.876 276.844 174.653 1.00 167.20 ? 8    G   5 C4    1 
ATOM   2531  P  P     . G   D  4  9    ? 210.460 275.130 179.653 1.00 137.48 ? 9    G   5 P     1 
ATOM   2532  O  OP1   . G   D  4  9    ? 211.774 275.221 178.966 1.00 137.48 ? 9    G   5 OP1   1 
ATOM   2533  O  OP2   . G   D  4  9    ? 210.142 273.922 180.455 1.00 137.48 ? 9    G   5 OP2   1 
ATOM   2534  O  "O5'" . G   D  4  9    ? 210.308 276.406 180.595 1.00 137.48 ? 9    G   5 "O5'" 1 
ATOM   2535  C  "C5'" . G   D  4  9    ? 211.433 276.971 181.261 1.00 137.48 ? 9    G   5 "C5'" 1 
ATOM   2536  C  "C4'" . G   D  4  9    ? 211.214 277.053 182.752 1.00 137.48 ? 9    G   5 "C4'" 1 
ATOM   2537  O  "O4'" . G   D  4  9    ? 209.787 277.138 183.019 1.00 137.48 ? 9    G   5 "O4'" 1 
ATOM   2538  C  "C3'" . G   D  4  9    ? 211.716 275.850 183.546 1.00 137.48 ? 9    G   5 "C3'" 1 
ATOM   2539  O  "O3'" . G   D  4  9    ? 212.059 276.277 184.865 1.00 137.48 ? 9    G   5 "O3'" 1 
ATOM   2540  C  "C2'" . G   D  4  9    ? 210.470 274.976 183.624 1.00 137.48 ? 9    G   5 "C2'" 1 
ATOM   2541  O  "O2'" . G   D  4  9    ? 210.475 274.037 184.677 1.00 137.48 ? 9    G   5 "O2'" 1 
ATOM   2542  C  "C1'" . G   D  4  9    ? 209.389 276.035 183.814 1.00 137.48 ? 9    G   5 "C1'" 1 
ATOM   2543  N  N9    . G   D  4  9    ? 208.037 275.641 183.410 1.00 137.48 ? 9    G   5 N9    1 
ATOM   2544  C  C8    . G   D  4  9    ? 207.329 276.125 182.337 1.00 137.48 ? 9    G   5 C8    1 
ATOM   2545  N  N7    . G   D  4  9    ? 206.130 275.620 182.243 1.00 137.48 ? 9    G   5 N7    1 
ATOM   2546  C  C5    . G   D  4  9    ? 206.033 274.763 183.330 1.00 137.48 ? 9    G   5 C5    1 
ATOM   2547  C  C6    . G   D  4  9    ? 204.962 273.933 183.753 1.00 137.48 ? 9    G   5 C6    1 
ATOM   2548  O  O6    . G   D  4  9    ? 203.850 273.783 183.238 1.00 137.48 ? 9    G   5 O6    1 
ATOM   2549  N  N1    . G   D  4  9    ? 205.285 273.228 184.906 1.00 137.48 ? 9    G   5 N1    1 
ATOM   2550  C  C2    . G   D  4  9    ? 206.484 273.309 185.567 1.00 137.48 ? 9    G   5 C2    1 
ATOM   2551  N  N2    . G   D  4  9    ? 206.604 272.550 186.664 1.00 137.48 ? 9    G   5 N2    1 
ATOM   2552  N  N3    . G   D  4  9    ? 207.490 274.079 185.187 1.00 137.48 ? 9    G   5 N3    1 
ATOM   2553  C  C4    . G   D  4  9    ? 207.196 274.777 184.070 1.00 137.48 ? 9    G   5 C4    1 
ATOM   2554  P  P     . U   D  4  10   ? 213.531 276.819 185.222 1.00 102.04 ? 10   U   5 P     1 
ATOM   2555  O  OP1   . U   D  4  10   ? 214.236 277.266 183.993 1.00 102.04 ? 10   U   5 OP1   1 
ATOM   2556  O  OP2   . U   D  4  10   ? 214.176 275.800 186.087 1.00 102.04 ? 10   U   5 OP2   1 
ATOM   2557  O  "O5'" . U   D  4  10   ? 213.245 278.102 186.124 1.00 102.04 ? 10   U   5 "O5'" 1 
ATOM   2558  C  "C5'" . U   D  4  10   ? 213.808 278.216 187.423 1.00 102.04 ? 10   U   5 "C5'" 1 
ATOM   2559  C  "C4'" . U   D  4  10   ? 212.859 278.870 188.398 1.00 102.04 ? 10   U   5 "C4'" 1 
ATOM   2560  O  "O4'" . U   D  4  10   ? 211.486 278.689 187.964 1.00 102.04 ? 10   U   5 "O4'" 1 
ATOM   2561  C  "C3'" . U   D  4  10   ? 212.886 278.307 189.810 1.00 102.04 ? 10   U   5 "C3'" 1 
ATOM   2562  O  "O3'" . U   D  4  10   ? 213.939 278.848 190.590 1.00 102.04 ? 10   U   5 "O3'" 1 
ATOM   2563  C  "C2'" . U   D  4  10   ? 211.501 278.651 190.345 1.00 102.04 ? 10   U   5 "C2'" 1 
ATOM   2564  O  "O2'" . U   D  4  10   ? 211.460 279.994 190.804 1.00 102.04 ? 10   U   5 "O2'" 1 
ATOM   2565  C  "C1'" . U   D  4  10   ? 210.636 278.544 189.085 1.00 102.04 ? 10   U   5 "C1'" 1 
ATOM   2566  N  N1    . U   D  4  10   ? 209.893 277.261 188.951 1.00 102.04 ? 10   U   5 N1    1 
ATOM   2567  C  C2    . U   D  4  10   ? 208.946 276.797 189.878 1.00 102.04 ? 10   U   5 C2    1 
ATOM   2568  O  O2    . U   D  4  10   ? 208.638 277.338 190.929 1.00 102.04 ? 10   U   5 O2    1 
ATOM   2569  N  N3    . U   D  4  10   ? 208.356 275.597 189.543 1.00 102.04 ? 10   U   5 N3    1 
ATOM   2570  C  C4    . U   D  4  10   ? 208.574 274.840 188.411 1.00 102.04 ? 10   U   5 C4    1 
ATOM   2571  O  O4    . U   D  4  10   ? 207.970 273.782 188.248 1.00 102.04 ? 10   U   5 O4    1 
ATOM   2572  C  C5    . U   D  4  10   ? 209.529 275.387 187.505 1.00 102.04 ? 10   U   5 C5    1 
ATOM   2573  C  C6    . U   D  4  10   ? 210.123 276.542 187.800 1.00 102.04 ? 10   U   5 C6    1 
ATOM   2574  P  P     . U   D  4  11   ? 214.519 278.037 191.849 1.00 70.52  ? 11   U   5 P     1 
ATOM   2575  O  OP1   . U   D  4  11   ? 215.779 278.697 192.276 1.00 70.52  ? 11   U   5 OP1   1 
ATOM   2576  O  OP2   . U   D  4  11   ? 214.526 276.593 191.502 1.00 70.52  ? 11   U   5 OP2   1 
ATOM   2577  O  "O5'" . U   D  4  11   ? 213.433 278.262 192.993 1.00 70.52  ? 11   U   5 "O5'" 1 
ATOM   2578  C  "C5'" . U   D  4  11   ? 213.428 277.446 194.153 1.00 70.52  ? 11   U   5 "C5'" 1 
ATOM   2579  C  "C4'" . U   D  4  11   ? 212.064 277.377 194.793 1.00 70.52  ? 11   U   5 "C4'" 1 
ATOM   2580  O  "O4'" . U   D  4  11   ? 211.043 277.199 193.777 1.00 70.52  ? 11   U   5 "O4'" 1 
ATOM   2581  C  "C3'" . U   D  4  11   ? 211.858 276.208 195.741 1.00 70.52  ? 11   U   5 "C3'" 1 
ATOM   2582  O  "O3'" . U   D  4  11   ? 212.360 276.474 197.036 1.00 70.52  ? 11   U   5 "O3'" 1 
ATOM   2583  C  "C2'" . U   D  4  11   ? 210.351 275.999 195.712 1.00 70.52  ? 11   U   5 "C2'" 1 
ATOM   2584  O  "O2'" . U   D  4  11   ? 209.698 276.921 196.571 1.00 70.52  ? 11   U   5 "O2'" 1 
ATOM   2585  C  "C1'" . U   D  4  11   ? 210.013 276.363 194.264 1.00 70.52  ? 11   U   5 "C1'" 1 
ATOM   2586  N  N1    . U   D  4  11   ? 209.879 275.199 193.346 1.00 70.52  ? 11   U   5 N1    1 
ATOM   2587  C  C2    . U   D  4  11   ? 208.901 274.210 193.490 1.00 70.52  ? 11   U   5 C2    1 
ATOM   2588  O  O2    . U   D  4  11   ? 208.080 274.142 194.392 1.00 70.52  ? 11   U   5 O2    1 
ATOM   2589  N  N3    . U   D  4  11   ? 208.921 273.236 192.515 1.00 70.52  ? 11   U   5 N3    1 
ATOM   2590  C  C4    . U   D  4  11   ? 209.766 273.147 191.426 1.00 70.52  ? 11   U   5 C4    1 
ATOM   2591  O  O4    . U   D  4  11   ? 209.664 272.213 190.630 1.00 70.52  ? 11   U   5 O4    1 
ATOM   2592  C  C5    . U   D  4  11   ? 210.723 274.201 191.337 1.00 70.52  ? 11   U   5 C5    1 
ATOM   2593  C  C6    . U   D  4  11   ? 210.732 275.157 192.266 1.00 70.52  ? 11   U   5 C6    1 
ATOM   2594  P  P     . U   D  4  12   ? 213.376 275.450 197.734 1.00 61.32  ? 12   U   5 P     1 
ATOM   2595  O  OP1   . U   D  4  12   ? 214.143 276.224 198.740 1.00 61.32  ? 12   U   5 OP1   1 
ATOM   2596  O  OP2   . U   D  4  12   ? 214.107 274.718 196.668 1.00 61.32  ? 12   U   5 OP2   1 
ATOM   2597  O  "O5'" . U   D  4  12   ? 212.422 274.412 198.478 1.00 61.32  ? 12   U   5 "O5'" 1 
ATOM   2598  C  "C5'" . U   D  4  12   ? 211.296 274.856 199.221 1.00 61.32  ? 12   U   5 "C5'" 1 
ATOM   2599  C  "C4'" . U   D  4  12   ? 210.286 273.751 199.402 1.00 61.32  ? 12   U   5 "C4'" 1 
ATOM   2600  O  "O4'" . U   D  4  12   ? 209.510 273.588 198.186 1.00 61.32  ? 12   U   5 "O4'" 1 
ATOM   2601  C  "C3'" . U   D  4  12   ? 210.855 272.366 199.661 1.00 61.32  ? 12   U   5 "C3'" 1 
ATOM   2602  O  "O3'" . U   D  4  12   ? 211.239 272.168 201.010 1.00 61.32  ? 12   U   5 "O3'" 1 
ATOM   2603  C  "C2'" . U   D  4  12   ? 209.727 271.450 199.205 1.00 61.32  ? 12   U   5 "C2'" 1 
ATOM   2604  O  "O2'" . U   D  4  12   ? 208.723 271.356 200.205 1.00 61.32  ? 12   U   5 "O2'" 1 
ATOM   2605  C  "C1'" . U   D  4  12   ? 209.157 272.229 198.019 1.00 61.32  ? 12   U   5 "C1'" 1 
ATOM   2606  N  N1    . U   D  4  12   ? 209.667 271.755 196.707 1.00 61.32  ? 12   U   5 N1    1 
ATOM   2607  C  C2    . U   D  4  12   ? 209.096 270.629 196.133 1.00 61.32  ? 12   U   5 C2    1 
ATOM   2608  O  O2    . U   D  4  12   ? 208.202 269.976 196.646 1.00 61.32  ? 12   U   5 O2    1 
ATOM   2609  N  N3    . U   D  4  12   ? 209.621 270.274 194.915 1.00 61.32  ? 12   U   5 N3    1 
ATOM   2610  C  C4    . U   D  4  12   ? 210.625 270.906 194.213 1.00 61.32  ? 12   U   5 C4    1 
ATOM   2611  O  O4    . U   D  4  12   ? 210.984 270.458 193.123 1.00 61.32  ? 12   U   5 O4    1 
ATOM   2612  C  C5    . U   D  4  12   ? 211.160 272.059 194.863 1.00 61.32  ? 12   U   5 C5    1 
ATOM   2613  C  C6    . U   D  4  12   ? 210.669 272.430 196.049 1.00 61.32  ? 12   U   5 C6    1 
ATOM   2614  P  P     . C   D  4  13   ? 212.456 271.180 201.363 1.00 67.26  ? 13   C   5 P     1 
ATOM   2615  O  OP1   . C   D  4  13   ? 212.814 271.393 202.788 1.00 67.26  ? 13   C   5 OP1   1 
ATOM   2616  O  OP2   . C   D  4  13   ? 213.495 271.335 200.313 1.00 67.26  ? 13   C   5 OP2   1 
ATOM   2617  O  "O5'" . C   D  4  13   ? 211.823 269.724 201.225 1.00 67.26  ? 13   C   5 "O5'" 1 
ATOM   2618  C  "C5'" . C   D  4  13   ? 210.752 269.316 202.064 1.00 67.26  ? 13   C   5 "C5'" 1 
ATOM   2619  C  "C4'" . C   D  4  13   ? 210.142 268.016 201.603 1.00 67.26  ? 13   C   5 "C4'" 1 
ATOM   2620  O  "O4'" . C   D  4  13   ? 209.566 268.170 200.278 1.00 67.26  ? 13   C   5 "O4'" 1 
ATOM   2621  C  "C3'" . C   D  4  13   ? 211.093 266.841 201.452 1.00 67.26  ? 13   C   5 "C3'" 1 
ATOM   2622  O  "O3'" . C   D  4  13   ? 211.402 266.220 202.688 1.00 67.26  ? 13   C   5 "O3'" 1 
ATOM   2623  C  "C2'" . C   D  4  13   ? 210.340 265.929 200.494 1.00 67.26  ? 13   C   5 "C2'" 1 
ATOM   2624  O  "O2'" . C   D  4  13   ? 209.341 265.200 201.190 1.00 67.26  ? 13   C   5 "O2'" 1 
ATOM   2625  C  "C1'" . C   D  4  13   ? 209.643 266.943 199.579 1.00 67.26  ? 13   C   5 "C1'" 1 
ATOM   2626  N  N1    . C   D  4  13   ? 210.351 267.155 198.289 1.00 67.26  ? 13   C   5 N1    1 
ATOM   2627  C  C2    . C   D  4  13   ? 210.280 266.199 197.258 1.00 67.26  ? 13   C   5 C2    1 
ATOM   2628  O  O2    . C   D  4  13   ? 209.634 265.152 197.429 1.00 67.26  ? 13   C   5 O2    1 
ATOM   2629  N  N3    . C   D  4  13   ? 210.935 266.433 196.093 1.00 67.26  ? 13   C   5 N3    1 
ATOM   2630  C  C4    . C   D  4  13   ? 211.626 267.562 195.921 1.00 67.26  ? 13   C   5 C4    1 
ATOM   2631  N  N4    . C   D  4  13   ? 212.256 267.754 194.759 1.00 67.26  ? 13   C   5 N4    1 
ATOM   2632  C  C5    . C   D  4  13   ? 211.709 268.549 196.940 1.00 67.26  ? 13   C   5 C5    1 
ATOM   2633  C  C6    . C   D  4  13   ? 211.061 268.305 198.085 1.00 67.26  ? 13   C   5 C6    1 
ATOM   2634  P  P     . U   D  4  14   ? 212.708 265.292 202.826 1.00 71.77  ? 14   U   5 P     1 
ATOM   2635  O  OP1   . U   D  4  14   ? 213.013 265.148 204.272 1.00 71.77  ? 14   U   5 OP1   1 
ATOM   2636  O  OP2   . U   D  4  14   ? 213.748 265.824 201.910 1.00 71.77  ? 14   U   5 OP2   1 
ATOM   2637  O  "O5'" . U   D  4  14   ? 212.242 263.871 202.271 1.00 71.77  ? 14   U   5 "O5'" 1 
ATOM   2638  C  "C5'" . U   D  4  14   ? 213.113 262.750 202.334 1.00 71.77  ? 14   U   5 "C5'" 1 
ATOM   2639  C  "C4'" . U   D  4  14   ? 212.795 261.721 201.278 1.00 71.77  ? 14   U   5 "C4'" 1 
ATOM   2640  O  "O4'" . U   D  4  14   ? 211.994 262.322 200.226 1.00 71.77  ? 14   U   5 "O4'" 1 
ATOM   2641  C  "C3'" . U   D  4  14   ? 213.991 261.135 200.539 1.00 71.77  ? 14   U   5 "C3'" 1 
ATOM   2642  O  "O3'" . U   D  4  14   ? 214.659 260.111 201.259 1.00 71.77  ? 14   U   5 "O3'" 1 
ATOM   2643  C  "C2'" . U   D  4  14   ? 213.367 260.650 199.241 1.00 71.77  ? 14   U   5 "C2'" 1 
ATOM   2644  O  "O2'" . U   D  4  14   ? 212.688 259.419 199.441 1.00 71.77  ? 14   U   5 "O2'" 1 
ATOM   2645  C  "C1'" . U   D  4  14   ? 212.322 261.741 198.980 1.00 71.77  ? 14   U   5 "C1'" 1 
ATOM   2646  N  N1    . U   D  4  14   ? 212.821 262.811 198.078 1.00 71.77  ? 14   U   5 N1    1 
ATOM   2647  C  C2    . U   D  4  14   ? 213.070 262.543 196.736 1.00 71.77  ? 14   U   5 C2    1 
ATOM   2648  O  O2    . U   D  4  14   ? 212.921 261.467 196.175 1.00 71.77  ? 14   U   5 O2    1 
ATOM   2649  N  N3    . U   D  4  14   ? 213.515 263.613 196.009 1.00 71.77  ? 14   U   5 N3    1 
ATOM   2650  C  C4    . U   D  4  14   ? 213.753 264.897 196.448 1.00 71.77  ? 14   U   5 C4    1 
ATOM   2651  O  O4    . U   D  4  14   ? 214.167 265.746 195.657 1.00 71.77  ? 14   U   5 O4    1 
ATOM   2652  C  C5    . U   D  4  14   ? 213.471 265.103 197.833 1.00 71.77  ? 14   U   5 C5    1 
ATOM   2653  C  C6    . U   D  4  14   ? 213.023 264.083 198.571 1.00 71.77  ? 14   U   5 C6    1 
ATOM   2654  P  P     . C   D  4  15   ? 216.199 259.765 200.937 1.00 83.88  ? 15   C   5 P     1 
ATOM   2655  O  OP1   . C   D  4  15   ? 216.755 259.032 202.102 1.00 83.88  ? 15   C   5 OP1   1 
ATOM   2656  O  OP2   . C   D  4  15   ? 216.862 261.011 200.477 1.00 83.88  ? 15   C   5 OP2   1 
ATOM   2657  O  "O5'" . C   D  4  15   ? 216.136 258.748 199.709 1.00 83.88  ? 15   C   5 "O5'" 1 
ATOM   2658  C  "C5'" . C   D  4  15   ? 216.821 257.498 199.761 1.00 83.88  ? 15   C   5 "C5'" 1 
ATOM   2659  C  "C4'" . C   D  4  15   ? 217.209 257.003 198.387 1.00 83.88  ? 15   C   5 "C4'" 1 
ATOM   2660  O  "O4'" . C   D  4  15   ? 216.630 257.880 197.379 1.00 83.88  ? 15   C   5 "O4'" 1 
ATOM   2661  C  "C3'" . C   D  4  15   ? 218.711 256.977 198.104 1.00 83.88  ? 15   C   5 "C3'" 1 
ATOM   2662  O  "O3'" . C   D  4  15   ? 218.997 255.912 197.192 1.00 83.88  ? 15   C   5 "O3'" 1 
ATOM   2663  C  "C2'" . C   D  4  15   ? 218.928 258.311 197.402 1.00 83.88  ? 15   C   5 "C2'" 1 
ATOM   2664  O  "O2'" . C   D  4  15   ? 220.080 258.369 196.600 1.00 83.88  ? 15   C   5 "O2'" 1 
ATOM   2665  C  "C1'" . C   D  4  15   ? 217.661 258.407 196.565 1.00 83.88  ? 15   C   5 "C1'" 1 
ATOM   2666  N  N1    . C   D  4  15   ? 217.287 259.769 196.162 1.00 83.88  ? 15   C   5 N1    1 
ATOM   2667  C  C2    . C   D  4  15   ? 217.041 259.995 194.806 1.00 83.88  ? 15   C   5 C2    1 
ATOM   2668  O  O2    . C   D  4  15   ? 217.159 259.053 194.009 1.00 83.88  ? 15   C   5 O2    1 
ATOM   2669  N  N3    . C   D  4  15   ? 216.682 261.230 194.395 1.00 83.88  ? 15   C   5 N3    1 
ATOM   2670  C  C4    . C   D  4  15   ? 216.565 262.214 195.284 1.00 83.88  ? 15   C   5 C4    1 
ATOM   2671  N  N4    . C   D  4  15   ? 216.219 263.415 194.821 1.00 83.88  ? 15   C   5 N4    1 
ATOM   2672  C  C5    . C   D  4  15   ? 216.808 262.016 196.675 1.00 83.88  ? 15   C   5 C5    1 
ATOM   2673  C  C6    . C   D  4  15   ? 217.163 260.785 197.069 1.00 83.88  ? 15   C   5 C6    1 
ATOM   2674  P  P     . U   D  4  16   ? 220.466 255.259 197.118 1.00 87.17  ? 16   U   5 P     1 
ATOM   2675  O  OP1   . U   D  4  16   ? 220.343 253.919 196.490 1.00 87.17  ? 16   U   5 OP1   1 
ATOM   2676  O  OP2   . U   D  4  16   ? 221.088 255.387 198.461 1.00 87.17  ? 16   U   5 OP2   1 
ATOM   2677  O  "O5'" . U   D  4  16   ? 221.265 256.210 196.114 1.00 87.17  ? 16   U   5 "O5'" 1 
ATOM   2678  C  "C5'" . U   D  4  16   ? 221.295 255.954 194.714 1.00 87.17  ? 16   U   5 "C5'" 1 
ATOM   2679  C  "C4'" . U   D  4  16   ? 222.117 256.985 193.974 1.00 87.17  ? 16   U   5 "C4'" 1 
ATOM   2680  O  "O4'" . U   D  4  16   ? 221.364 258.219 193.837 1.00 87.17  ? 16   U   5 "O4'" 1 
ATOM   2681  C  "C3'" . U   D  4  16   ? 223.410 257.408 194.650 1.00 87.17  ? 16   U   5 "C3'" 1 
ATOM   2682  O  "O3'" . U   D  4  16   ? 224.475 256.499 194.429 1.00 87.17  ? 16   U   5 "O3'" 1 
ATOM   2683  C  "C2'" . U   D  4  16   ? 223.657 258.806 194.081 1.00 87.17  ? 16   U   5 "C2'" 1 
ATOM   2684  O  "O2'" . U   D  4  16   ? 224.257 258.724 192.797 1.00 87.17  ? 16   U   5 "O2'" 1 
ATOM   2685  C  "C1'" . U   D  4  16   ? 222.230 259.338 193.910 1.00 87.17  ? 16   U   5 "C1'" 1 
ATOM   2686  N  N1    . U   D  4  16   ? 221.770 260.198 195.034 1.00 87.17  ? 16   U   5 N1    1 
ATOM   2687  C  C2    . U   D  4  16   ? 220.570 260.856 194.817 1.00 87.17  ? 16   U   5 C2    1 
ATOM   2688  O  O2    . U   D  4  16   ? 219.927 260.747 193.789 1.00 87.17  ? 16   U   5 O2    1 
ATOM   2689  N  N3    . U   D  4  16   ? 220.121 261.628 195.859 1.00 87.17  ? 16   U   5 N3    1 
ATOM   2690  C  C4    . U   D  4  16   ? 220.737 261.830 197.074 1.00 87.17  ? 16   U   5 C4    1 
ATOM   2691  O  O4    . U   D  4  16   ? 220.205 262.565 197.908 1.00 87.17  ? 16   U   5 O4    1 
ATOM   2692  C  C5    . U   D  4  16   ? 221.975 261.132 197.231 1.00 87.17  ? 16   U   5 C5    1 
ATOM   2693  C  C6    . U   D  4  16   ? 222.440 260.376 196.232 1.00 87.17  ? 16   U   5 C6    1 
ATOM   2694  P  P     . U   D  4  17   ? 225.113 255.683 195.659 1.00 81.39  ? 17   U   5 P     1 
ATOM   2695  O  OP1   . U   D  4  17   ? 224.373 254.403 195.794 1.00 81.39  ? 17   U   5 OP1   1 
ATOM   2696  O  OP2   . U   D  4  17   ? 225.204 256.603 196.821 1.00 81.39  ? 17   U   5 OP2   1 
ATOM   2697  O  "O5'" . U   D  4  17   ? 226.595 255.348 195.176 1.00 81.39  ? 17   U   5 "O5'" 1 
ATOM   2698  C  "C5'" . U   D  4  17   ? 227.696 256.154 195.575 1.00 81.39  ? 17   U   5 "C5'" 1 
ATOM   2699  C  "C4'" . U   D  4  17   ? 228.071 257.147 194.505 1.00 81.39  ? 17   U   5 "C4'" 1 
ATOM   2700  O  "O4'" . U   D  4  17   ? 226.937 258.008 194.228 1.00 81.39  ? 17   U   5 "O4'" 1 
ATOM   2701  C  "C3'" . U   D  4  17   ? 229.192 258.116 194.854 1.00 81.39  ? 17   U   5 "C3'" 1 
ATOM   2702  O  "O3'" . U   D  4  17   ? 230.485 257.560 194.685 1.00 81.39  ? 17   U   5 "O3'" 1 
ATOM   2703  C  "C2'" . U   D  4  17   ? 228.910 259.300 193.937 1.00 81.39  ? 17   U   5 "C2'" 1 
ATOM   2704  O  "O2'" . U   D  4  17   ? 229.389 259.043 192.625 1.00 81.39  ? 17   U   5 "O2'" 1 
ATOM   2705  C  "C1'" . U   D  4  17   ? 227.382 259.306 193.899 1.00 81.39  ? 17   U   5 "C1'" 1 
ATOM   2706  N  N1    . U   D  4  17   ? 226.781 260.282 194.844 1.00 81.39  ? 17   U   5 N1    1 
ATOM   2707  C  C2    . U   D  4  17   ? 226.588 261.569 194.378 1.00 81.39  ? 17   U   5 C2    1 
ATOM   2708  O  O2    . U   D  4  17   ? 226.892 261.917 193.250 1.00 81.39  ? 17   U   5 O2    1 
ATOM   2709  N  N3    . U   D  4  17   ? 226.024 262.439 195.280 1.00 81.39  ? 17   U   5 N3    1 
ATOM   2710  C  C4    . U   D  4  17   ? 225.639 262.163 196.576 1.00 81.39  ? 17   U   5 C4    1 
ATOM   2711  O  O4    . U   D  4  17   ? 225.145 263.052 197.270 1.00 81.39  ? 17   U   5 O4    1 
ATOM   2712  C  C5    . U   D  4  17   ? 225.867 260.813 196.987 1.00 81.39  ? 17   U   5 C5    1 
ATOM   2713  C  C6    . U   D  4  17   ? 226.411 259.946 196.130 1.00 81.39  ? 17   U   5 C6    1 
ATOM   2714  P  P     . C   D  4  18   ? 231.715 258.092 195.572 1.00 74.67  ? 18   C   5 P     1 
ATOM   2715  O  OP1   . C   D  4  18   ? 232.834 257.126 195.435 1.00 74.67  ? 18   C   5 OP1   1 
ATOM   2716  O  OP2   . C   D  4  18   ? 231.194 258.424 196.923 1.00 74.67  ? 18   C   5 OP2   1 
ATOM   2717  O  "O5'" . C   D  4  18   ? 232.148 259.454 194.865 1.00 74.67  ? 18   C   5 "O5'" 1 
ATOM   2718  C  "C5'" . C   D  4  18   ? 232.635 259.460 193.531 1.00 74.67  ? 18   C   5 "C5'" 1 
ATOM   2719  C  "C4'" . C   D  4  18   ? 232.633 260.851 192.945 1.00 74.67  ? 18   C   5 "C4'" 1 
ATOM   2720  O  "O4'" . C   D  4  18   ? 231.294 261.409 193.007 1.00 74.67  ? 18   C   5 "O4'" 1 
ATOM   2721  C  "C3'" . C   D  4  18   ? 233.490 261.880 193.663 1.00 74.67  ? 18   C   5 "C3'" 1 
ATOM   2722  O  "O3'" . C   D  4  18   ? 234.865 261.794 193.333 1.00 74.67  ? 18   C   5 "O3'" 1 
ATOM   2723  C  "C2'" . C   D  4  18   ? 232.842 263.196 193.251 1.00 74.67  ? 18   C   5 "C2'" 1 
ATOM   2724  O  "O2'" . C   D  4  18   ? 233.251 263.570 191.944 1.00 74.67  ? 18   C   5 "O2'" 1 
ATOM   2725  C  "C1'" . C   D  4  18   ? 231.362 262.807 193.202 1.00 74.67  ? 18   C   5 "C1'" 1 
ATOM   2726  N  N1    . C   D  4  18   ? 230.632 263.168 194.444 1.00 74.67  ? 18   C   5 N1    1 
ATOM   2727  C  C2    . C   D  4  18   ? 230.157 264.479 194.596 1.00 74.67  ? 18   C   5 C2    1 
ATOM   2728  O  O2    . C   D  4  18   ? 230.354 265.312 193.698 1.00 74.67  ? 18   C   5 O2    1 
ATOM   2729  N  N3    . C   D  4  18   ? 229.489 264.817 195.724 1.00 74.67  ? 18   C   5 N3    1 
ATOM   2730  C  C4    . C   D  4  18   ? 229.280 263.914 196.682 1.00 74.67  ? 18   C   5 C4    1 
ATOM   2731  N  N4    . C   D  4  18   ? 228.615 264.298 197.774 1.00 74.67  ? 18   C   5 N4    1 
ATOM   2732  C  C5    . C   D  4  18   ? 229.745 262.574 196.561 1.00 74.67  ? 18   C   5 C5    1 
ATOM   2733  C  C6    . C   D  4  18   ? 230.403 262.254 195.440 1.00 74.67  ? 18   C   5 C6    1 
ATOM   2734  P  P     . A   D  4  19   ? 235.972 261.828 194.498 1.00 63.52  ? 19   A   5 P     1 
ATOM   2735  O  OP1   . A   D  4  19   ? 237.269 262.220 193.891 1.00 63.52  ? 19   A   5 OP1   1 
ATOM   2736  O  OP2   . A   D  4  19   ? 235.872 260.560 195.264 1.00 63.52  ? 19   A   5 OP2   1 
ATOM   2737  O  "O5'" . A   D  4  19   ? 235.492 263.015 195.447 1.00 63.52  ? 19   A   5 "O5'" 1 
ATOM   2738  C  "C5'" . A   D  4  19   ? 236.153 264.276 195.438 1.00 63.52  ? 19   A   5 "C5'" 1 
ATOM   2739  C  "C4'" . A   D  4  19   ? 235.199 265.403 195.125 1.00 63.52  ? 19   A   5 "C4'" 1 
ATOM   2740  O  "O4'" . A   D  4  19   ? 233.954 265.193 195.847 1.00 63.52  ? 19   A   5 "O4'" 1 
ATOM   2741  C  "C3'" . A   D  4  19   ? 235.685 266.797 195.514 1.00 63.52  ? 19   A   5 "C3'" 1 
ATOM   2742  O  "O3'" . A   D  4  19   ? 235.158 267.751 194.591 1.00 63.52  ? 19   A   5 "O3'" 1 
ATOM   2743  C  "C2'" . A   D  4  19   ? 235.035 267.000 196.878 1.00 63.52  ? 19   A   5 "C2'" 1 
ATOM   2744  O  "O2'" . A   D  4  19   ? 234.876 268.349 197.260 1.00 63.52  ? 19   A   5 "O2'" 1 
ATOM   2745  C  "C1'" . A   D  4  19   ? 233.692 266.309 196.675 1.00 63.52  ? 19   A   5 "C1'" 1 
ATOM   2746  N  N9    . A   D  4  19   ? 233.062 265.835 197.909 1.00 63.52  ? 19   A   5 N9    1 
ATOM   2747  C  C8    . A   D  4  19   ? 233.198 264.611 198.517 1.00 63.52  ? 19   A   5 C8    1 
ATOM   2748  N  N7    . A   D  4  19   ? 232.487 264.484 199.612 1.00 63.52  ? 19   A   5 N7    1 
ATOM   2749  C  C5    . A   D  4  19   ? 231.835 265.704 199.727 1.00 63.52  ? 19   A   5 C5    1 
ATOM   2750  C  C6    . A   D  4  19   ? 230.929 266.219 200.673 1.00 63.52  ? 19   A   5 C6    1 
ATOM   2751  N  N6    . A   D  4  19   ? 230.502 265.534 201.736 1.00 63.52  ? 19   A   5 N6    1 
ATOM   2752  N  N1    . A   D  4  19   ? 230.469 267.478 200.488 1.00 63.52  ? 19   A   5 N1    1 
ATOM   2753  C  C2    . A   D  4  19   ? 230.891 268.174 199.424 1.00 63.52  ? 19   A   5 C2    1 
ATOM   2754  N  N3    . A   D  4  19   ? 231.739 267.798 198.470 1.00 63.52  ? 19   A   5 N3    1 
ATOM   2755  C  C4    . A   D  4  19   ? 232.173 266.542 198.680 1.00 63.52  ? 19   A   5 C4    1 
ATOM   2756  P  P     . G   D  4  20   ? 235.960 268.104 193.244 1.00 75.18  ? 20   G   5 P     1 
ATOM   2757  O  OP1   . G   D  4  20   ? 235.710 269.532 192.924 1.00 75.18  ? 20   G   5 OP1   1 
ATOM   2758  O  OP2   . G   D  4  20   ? 235.639 267.067 192.229 1.00 75.18  ? 20   G   5 OP2   1 
ATOM   2759  O  "O5'" . G   D  4  20   ? 237.489 267.932 193.655 1.00 75.18  ? 20   G   5 "O5'" 1 
ATOM   2760  C  "C5'" . G   D  4  20   ? 238.460 268.917 193.315 1.00 75.18  ? 20   G   5 "C5'" 1 
ATOM   2761  C  "C4'" . G   D  4  20   ? 238.667 269.903 194.438 1.00 75.18  ? 20   G   5 "C4'" 1 
ATOM   2762  O  "O4'" . G   D  4  20   ? 238.300 269.276 195.698 1.00 75.18  ? 20   G   5 "O4'" 1 
ATOM   2763  C  "C3'" . G   D  4  20   ? 240.098 270.405 194.613 1.00 75.18  ? 20   G   5 "C3'" 1 
ATOM   2764  O  "O3'" . G   D  4  20   ? 240.073 271.756 195.070 1.00 75.18  ? 20   G   5 "O3'" 1 
ATOM   2765  C  "C2'" . G   D  4  20   ? 240.633 269.507 195.723 1.00 75.18  ? 20   G   5 "C2'" 1 
ATOM   2766  O  "O2'" . G   D  4  20   ? 241.712 270.053 196.453 1.00 75.18  ? 20   G   5 "O2'" 1 
ATOM   2767  C  "C1'" . G   D  4  20   ? 239.393 269.331 196.594 1.00 75.18  ? 20   G   5 "C1'" 1 
ATOM   2768  N  N9    . G   D  4  20   ? 239.390 268.103 197.392 1.00 75.18  ? 20   G   5 N9    1 
ATOM   2769  C  C8    . G   D  4  20   ? 239.813 266.856 196.999 1.00 75.18  ? 20   G   5 C8    1 
ATOM   2770  N  N7    . G   D  4  20   ? 239.686 265.956 197.936 1.00 75.18  ? 20   G   5 N7    1 
ATOM   2771  C  C5    . G   D  4  20   ? 239.148 266.651 199.011 1.00 75.18  ? 20   G   5 C5    1 
ATOM   2772  C  C6    . G   D  4  20   ? 238.791 266.204 200.309 1.00 75.18  ? 20   G   5 C6    1 
ATOM   2773  O  O6    . G   D  4  20   ? 238.883 265.065 200.782 1.00 75.18  ? 20   G   5 O6    1 
ATOM   2774  N  N1    . G   D  4  20   ? 238.280 267.240 201.085 1.00 75.18  ? 20   G   5 N1    1 
ATOM   2775  C  C2    . G   D  4  20   ? 238.132 268.540 200.668 1.00 75.18  ? 20   G   5 C2    1 
ATOM   2776  N  N2    . G   D  4  20   ? 237.620 269.395 201.565 1.00 75.18  ? 20   G   5 N2    1 
ATOM   2777  N  N3    . G   D  4  20   ? 238.461 268.970 199.461 1.00 75.18  ? 20   G   5 N3    1 
ATOM   2778  C  C4    . G   D  4  20   ? 238.959 267.979 198.691 1.00 75.18  ? 20   G   5 C4    1 
ATOM   2779  P  P     . A   D  4  21   ? 241.104 272.832 194.471 1.00 69.52  ? 21   A   5 P     1 
ATOM   2780  O  OP1   . A   D  4  21   ? 240.540 273.355 193.200 1.00 69.52  ? 21   A   5 OP1   1 
ATOM   2781  O  OP2   . A   D  4  21   ? 242.458 272.222 194.478 1.00 69.52  ? 21   A   5 OP2   1 
ATOM   2782  O  "O5'" . A   D  4  21   ? 241.090 274.015 195.536 1.00 69.52  ? 21   A   5 "O5'" 1 
ATOM   2783  C  "C5'" . A   D  4  21   ? 240.037 274.130 196.489 1.00 69.52  ? 21   A   5 "C5'" 1 
ATOM   2784  C  "C4'" . A   D  4  21   ? 239.247 275.400 196.289 1.00 69.52  ? 21   A   5 "C4'" 1 
ATOM   2785  O  "O4'" . A   D  4  21   ? 237.992 275.081 195.624 1.00 69.52  ? 21   A   5 "O4'" 1 
ATOM   2786  C  "C3'" . A   D  4  21   ? 238.874 276.147 197.569 1.00 69.52  ? 21   A   5 "C3'" 1 
ATOM   2787  O  "O3'" . A   D  4  21   ? 238.886 277.553 197.323 1.00 69.52  ? 21   A   5 "O3'" 1 
ATOM   2788  C  "C2'" . A   D  4  21   ? 237.441 275.692 197.822 1.00 69.52  ? 21   A   5 "C2'" 1 
ATOM   2789  O  "O2'" . A   D  4  21   ? 236.665 276.588 198.589 1.00 69.52  ? 21   A   5 "O2'" 1 
ATOM   2790  C  "C1'" . A   D  4  21   ? 236.909 275.560 196.397 1.00 69.52  ? 21   A   5 "C1'" 1 
ATOM   2791  N  N9    . A   D  4  21   ? 235.779 274.636 196.250 1.00 69.52  ? 21   A   5 N9    1 
ATOM   2792  C  C8    . A   D  4  21   ? 234.535 274.954 195.762 1.00 69.52  ? 21   A   5 C8    1 
ATOM   2793  N  N7    . A   D  4  21   ? 233.696 273.949 195.734 1.00 69.52  ? 21   A   5 N7    1 
ATOM   2794  C  C5    . A   D  4  21   ? 234.436 272.891 196.240 1.00 69.52  ? 21   A   5 C5    1 
ATOM   2795  C  C6    . A   D  4  21   ? 234.116 271.541 196.469 1.00 69.52  ? 21   A   5 C6    1 
ATOM   2796  N  N6    . A   D  4  21   ? 232.920 271.010 196.205 1.00 69.52  ? 21   A   5 N6    1 
ATOM   2797  N  N1    . A   D  4  21   ? 235.077 270.740 196.984 1.00 69.52  ? 21   A   5 N1    1 
ATOM   2798  C  C2    . A   D  4  21   ? 236.279 271.263 197.252 1.00 69.52  ? 21   A   5 C2    1 
ATOM   2799  N  N3    . A   D  4  21   ? 236.697 272.514 197.077 1.00 69.52  ? 21   A   5 N3    1 
ATOM   2800  C  C4    . A   D  4  21   ? 235.721 273.293 196.566 1.00 69.52  ? 21   A   5 C4    1 
ATOM   2801  P  P     . U   D  4  22   ? 240.029 278.482 197.968 1.00 65.89  ? 22   U   5 P     1 
ATOM   2802  O  OP1   . U   D  4  22   ? 239.718 279.893 197.626 1.00 65.89  ? 22   U   5 OP1   1 
ATOM   2803  O  OP2   . U   D  4  22   ? 241.348 277.910 197.595 1.00 65.89  ? 22   U   5 OP2   1 
ATOM   2804  O  "O5'" . U   D  4  22   ? 239.841 278.303 199.540 1.00 65.89  ? 22   U   5 "O5'" 1 
ATOM   2805  C  "C5'" . U   D  4  22   ? 238.655 278.744 200.195 1.00 65.89  ? 22   U   5 "C5'" 1 
ATOM   2806  C  "C4'" . U   D  4  22   ? 238.764 278.616 201.693 1.00 65.89  ? 22   U   5 "C4'" 1 
ATOM   2807  O  "O4'" . U   D  4  22   ? 239.393 279.815 202.221 1.00 65.89  ? 22   U   5 "O4'" 1 
ATOM   2808  C  "C3'" . U   D  4  22   ? 237.434 278.476 202.428 1.00 65.89  ? 22   U   5 "C3'" 1 
ATOM   2809  O  "O3'" . U   D  4  22   ? 237.617 277.677 203.598 1.00 65.89  ? 22   U   5 "O3'" 1 
ATOM   2810  C  "C2'" . U   D  4  22   ? 237.127 279.913 202.835 1.00 65.89  ? 22   U   5 "C2'" 1 
ATOM   2811  O  "O2'" . U   D  4  22   ? 236.263 280.037 203.945 1.00 65.89  ? 22   U   5 "O2'" 1 
ATOM   2812  C  "C1'" . U   D  4  22   ? 238.523 280.449 203.141 1.00 65.89  ? 22   U   5 "C1'" 1 
ATOM   2813  N  N1    . U   D  4  22   ? 238.655 281.902 202.960 1.00 20.00  ? 22   U   5 N1    1 
ATOM   2814  C  C2    . U   D  4  22   ? 238.945 282.669 204.071 1.00 20.00  ? 22   U   5 C2    1 
ATOM   2815  O  O2    . U   D  4  22   ? 239.091 282.193 205.183 1.00 20.00  ? 22   U   5 O2    1 
ATOM   2816  N  N3    . U   D  4  22   ? 239.056 284.016 203.829 1.00 20.00  ? 22   U   5 N3    1 
ATOM   2817  C  C4    . U   D  4  22   ? 238.910 284.658 202.616 1.00 20.00  ? 22   U   5 C4    1 
ATOM   2818  O  O4    . U   D  4  22   ? 239.041 285.881 202.558 1.00 20.00  ? 22   U   5 O4    1 
ATOM   2819  C  C5    . U   D  4  22   ? 238.612 283.793 201.515 1.00 20.00  ? 22   U   5 C5    1 
ATOM   2820  C  C6    . U   D  4  22   ? 238.498 282.477 201.721 1.00 20.00  ? 22   U   5 C6    1 
ATOM   2821  P  P     . C   D  4  23   ? 237.582 276.071 203.511 1.00 50.66  ? 23   C   5 P     1 
ATOM   2822  O  OP1   . C   D  4  23   ? 236.938 275.563 204.748 1.00 50.66  ? 23   C   5 OP1   1 
ATOM   2823  O  OP2   . C   D  4  23   ? 238.941 275.593 203.148 1.00 50.66  ? 23   C   5 OP2   1 
ATOM   2824  O  "O5'" . C   D  4  23   ? 236.607 275.759 202.290 1.00 50.66  ? 23   C   5 "O5'" 1 
ATOM   2825  C  "C5'" . C   D  4  23   ? 235.231 275.474 202.504 1.00 50.66  ? 23   C   5 "C5'" 1 
ATOM   2826  C  "C4'" . C   D  4  23   ? 234.656 274.673 201.364 1.00 50.66  ? 23   C   5 "C4'" 1 
ATOM   2827  O  "O4'" . C   D  4  23   ? 234.931 273.265 201.564 1.00 50.66  ? 23   C   5 "O4'" 1 
ATOM   2828  C  "C3'" . C   D  4  23   ? 233.145 274.731 201.198 1.00 50.66  ? 23   C   5 "C3'" 1 
ATOM   2829  O  "O3'" . C   D  4  23   ? 232.711 275.904 200.534 1.00 50.66  ? 23   C   5 "O3'" 1 
ATOM   2830  C  "C2'" . C   D  4  23   ? 232.831 273.443 200.438 1.00 50.66  ? 23   C   5 "C2'" 1 
ATOM   2831  O  "O2'" . C   D  4  23   ? 233.010 273.627 199.042 1.00 50.66  ? 23   C   5 "O2'" 1 
ATOM   2832  C  "C1'" . C   D  4  23   ? 233.925 272.493 200.946 1.00 50.66  ? 23   C   5 "C1'" 1 
ATOM   2833  N  N1    . C   D  4  23   ? 233.439 271.421 201.858 1.00 50.66  ? 23   C   5 N1    1 
ATOM   2834  C  C2    . C   D  4  23   ? 232.995 271.614 203.183 1.00 50.66  ? 23   C   5 C2    1 
ATOM   2835  O  O2    . C   D  4  23   ? 232.993 272.729 203.719 1.00 50.66  ? 23   C   5 O2    1 
ATOM   2836  N  N3    . C   D  4  23   ? 232.575 270.543 203.899 1.00 50.66  ? 23   C   5 N3    1 
ATOM   2837  C  C4    . C   D  4  23   ? 232.566 269.324 203.364 1.00 50.66  ? 23   C   5 C4    1 
ATOM   2838  N  N4    . C   D  4  23   ? 232.141 268.306 204.117 1.00 50.66  ? 23   C   5 N4    1 
ATOM   2839  C  C5    . C   D  4  23   ? 233.004 269.094 202.034 1.00 50.66  ? 23   C   5 C5    1 
ATOM   2840  C  C6    . C   D  4  23   ? 233.417 270.157 201.335 1.00 50.66  ? 23   C   5 C6    1 
ATOM   2841  P  P     . G   D  4  24   ? 231.363 276.646 200.999 1.00 40.39  ? 24   G   5 P     1 
ATOM   2842  O  OP1   . G   D  4  24   ? 230.208 275.843 200.524 1.00 40.39  ? 24   G   5 OP1   1 
ATOM   2843  O  OP2   . G   D  4  24   ? 231.474 278.075 200.612 1.00 40.39  ? 24   G   5 OP2   1 
ATOM   2844  O  "O5'" . G   D  4  24   ? 231.402 276.566 202.591 1.00 40.39  ? 24   G   5 "O5'" 1 
ATOM   2845  C  "C5'" . G   D  4  24   ? 230.253 276.907 203.361 1.00 40.39  ? 24   G   5 "C5'" 1 
ATOM   2846  C  "C4'" . G   D  4  24   ? 230.603 277.468 204.722 1.00 40.39  ? 24   G   5 "C4'" 1 
ATOM   2847  O  "O4'" . G   D  4  24   ? 230.891 276.383 205.648 1.00 40.39  ? 24   G   5 "O4'" 1 
ATOM   2848  C  "C3'" . G   D  4  24   ? 231.805 278.415 204.780 1.00 40.39  ? 24   G   5 "C3'" 1 
ATOM   2849  O  "O3'" . G   D  4  24   ? 231.529 279.468 205.702 1.00 40.39  ? 24   G   5 "O3'" 1 
ATOM   2850  C  "C2'" . G   D  4  24   ? 232.911 277.528 205.350 1.00 40.39  ? 24   G   5 "C2'" 1 
ATOM   2851  O  "O2'" . G   D  4  24   ? 233.936 278.227 206.023 1.00 40.39  ? 24   G   5 "O2'" 1 
ATOM   2852  C  "C1'" . G   D  4  24   ? 232.121 276.633 206.297 1.00 40.39  ? 24   G   5 "C1'" 1 
ATOM   2853  N  N9    . G   D  4  24   ? 232.764 275.351 206.600 1.00 20.00  ? 24   G   5 N9    1 
ATOM   2854  C  C8    . G   D  4  24   ? 233.855 274.801 205.975 1.00 20.00  ? 24   G   5 C8    1 
ATOM   2855  N  N7    . G   D  4  24   ? 234.202 273.647 206.477 1.00 20.00  ? 24   G   5 N7    1 
ATOM   2856  C  C5    . G   D  4  24   ? 233.288 273.422 207.496 1.00 20.00  ? 24   G   5 C5    1 
ATOM   2857  C  C6    . G   D  4  24   ? 233.160 272.331 208.397 1.00 20.00  ? 24   G   5 C6    1 
ATOM   2858  O  O6    . G   D  4  24   ? 233.855 271.310 208.475 1.00 20.00  ? 24   G   5 O6    1 
ATOM   2859  N  N1    . G   D  4  24   ? 232.094 272.509 209.271 1.00 20.00  ? 24   G   5 N1    1 
ATOM   2860  C  C2    . G   D  4  24   ? 231.256 273.596 209.281 1.00 20.00  ? 24   G   5 C2    1 
ATOM   2861  N  N2    . G   D  4  24   ? 230.282 273.587 210.203 1.00 20.00  ? 24   G   5 N2    1 
ATOM   2862  N  N3    . G   D  4  24   ? 231.364 274.618 208.447 1.00 20.00  ? 24   G   5 N3    1 
ATOM   2863  C  C4    . G   D  4  24   ? 232.395 274.467 207.588 1.00 20.00  ? 24   G   5 C4    1 
ATOM   2864  P  P     . C   D  4  25   ? 231.044 280.906 205.172 1.00 34.63  ? 25   C   5 P     1 
ATOM   2865  O  OP1   . C   D  4  25   ? 229.711 281.187 205.763 1.00 34.63  ? 25   C   5 OP1   1 
ATOM   2866  O  OP2   . C   D  4  25   ? 231.213 280.930 203.697 1.00 34.63  ? 25   C   5 OP2   1 
ATOM   2867  O  "O5'" . C   D  4  25   ? 232.092 281.927 205.805 1.00 34.63  ? 25   C   5 "O5'" 1 
ATOM   2868  C  "C5'" . C   D  4  25   ? 233.492 281.735 205.636 1.00 34.63  ? 25   C   5 "C5'" 1 
ATOM   2869  C  "C4'" . C   D  4  25   ? 234.297 282.822 206.307 1.00 34.63  ? 25   C   5 "C4'" 1 
ATOM   2870  O  "O4'" . C   D  4  25   ? 235.228 283.392 205.344 1.00 34.63  ? 25   C   5 "O4'" 1 
ATOM   2871  C  "C3'" . C   D  4  25   ? 233.490 283.999 206.855 1.00 34.63  ? 25   C   5 "C3'" 1 
ATOM   2872  O  "O3'" . C   D  4  25   ? 234.166 284.526 207.995 1.00 34.63  ? 25   C   5 "O3'" 1 
ATOM   2873  C  "C2'" . C   D  4  25   ? 233.580 285.009 205.720 1.00 34.63  ? 25   C   5 "C2'" 1 
ATOM   2874  O  "O2'" . C   D  4  25   ? 233.354 286.351 206.097 1.00 34.63  ? 25   C   5 "O2'" 1 
ATOM   2875  C  "C1'" . C   D  4  25   ? 235.012 284.786 205.251 1.00 34.63  ? 25   C   5 "C1'" 1 
ATOM   2876  N  N1    . C   D  4  25   ? 235.268 285.220 203.873 1.00 34.63  ? 25   C   5 N1    1 
ATOM   2877  C  C2    . C   D  4  25   ? 235.928 286.437 203.698 1.00 34.63  ? 25   C   5 C2    1 
ATOM   2878  O  O2    . C   D  4  25   ? 236.265 287.089 204.697 1.00 34.63  ? 25   C   5 O2    1 
ATOM   2879  N  N3    . C   D  4  25   ? 236.180 286.871 202.447 1.00 34.63  ? 25   C   5 N3    1 
ATOM   2880  C  C4    . C   D  4  25   ? 235.800 286.135 201.405 1.00 34.63  ? 25   C   5 C4    1 
ATOM   2881  N  N4    . C   D  4  25   ? 236.074 286.617 200.197 1.00 34.63  ? 25   C   5 N4    1 
ATOM   2882  C  C5    . C   D  4  25   ? 235.123 284.889 201.552 1.00 34.63  ? 25   C   5 C5    1 
ATOM   2883  C  C6    . C   D  4  25   ? 234.878 284.470 202.800 1.00 34.63  ? 25   C   5 C6    1 
ATOM   2884  P  P     . A   D  4  26   ? 233.348 285.260 209.166 1.00 25.55  ? 26   A   5 P     1 
ATOM   2885  O  OP1   . A   D  4  26   ? 231.938 285.400 208.735 1.00 25.55  ? 26   A   5 OP1   1 
ATOM   2886  O  OP2   . A   D  4  26   ? 234.101 286.478 209.556 1.00 25.55  ? 26   A   5 OP2   1 
ATOM   2887  O  "O5'" . A   D  4  26   ? 233.426 284.228 210.374 1.00 25.55  ? 26   A   5 "O5'" 1 
ATOM   2888  C  "C5'" . A   D  4  26   ? 234.670 283.652 210.749 1.00 25.55  ? 26   A   5 "C5'" 1 
ATOM   2889  C  "C4'" . A   D  4  26   ? 234.540 282.782 211.971 1.00 25.55  ? 26   A   5 "C4'" 1 
ATOM   2890  O  "O4'" . A   D  4  26   ? 233.446 281.847 211.752 1.00 25.55  ? 26   A   5 "O4'" 1 
ATOM   2891  C  "C3'" . A   D  4  26   ? 235.779 281.941 212.282 1.00 25.55  ? 26   A   5 "C3'" 1 
ATOM   2892  O  "O3'" . A   D  4  26   ? 236.186 281.977 213.679 1.00 25.55  ? 26   A   5 "O3'" 1 
ATOM   2893  C  "C2'" . A   D  4  26   ? 235.417 280.547 211.753 1.00 25.55  ? 26   A   5 "C2'" 1 
ATOM   2894  O  "O2'" . A   D  4  26   ? 236.048 279.481 212.430 1.00 25.55  ? 26   A   5 "O2'" 1 
ATOM   2895  C  "C1'" . A   D  4  26   ? 233.895 280.515 211.915 1.00 25.55  ? 26   A   5 "C1'" 1 
ATOM   2896  N  N9    . A   D  4  26   ? 233.185 279.658 210.963 1.00 25.55  ? 26   A   5 N9    1 
ATOM   2897  C  C8    . A   D  4  26   ? 233.420 279.469 209.625 1.00 25.55  ? 26   A   5 C8    1 
ATOM   2898  N  N7    . A   D  4  26   ? 232.587 278.625 209.063 1.00 25.55  ? 26   A   5 N7    1 
ATOM   2899  C  C5    . A   D  4  26   ? 231.755 278.232 210.103 1.00 25.55  ? 26   A   5 C5    1 
ATOM   2900  C  C6    . A   D  4  26   ? 230.655 277.356 210.175 1.00 25.55  ? 26   A   5 C6    1 
ATOM   2901  N  N6    . A   D  4  26   ? 230.182 276.674 209.131 1.00 25.55  ? 26   A   5 N6    1 
ATOM   2902  N  N1    . A   D  4  26   ? 230.044 277.197 211.372 1.00 25.55  ? 26   A   5 N1    1 
ATOM   2903  C  C2    . A   D  4  26   ? 230.505 277.876 212.430 1.00 25.55  ? 26   A   5 C2    1 
ATOM   2904  N  N3    . A   D  4  26   ? 231.526 278.730 212.484 1.00 25.55  ? 26   A   5 N3    1 
ATOM   2905  C  C4    . A   D  4  26   ? 232.110 278.865 211.278 1.00 25.55  ? 26   A   5 C4    1 
ATOM   2906  P  P     . U   D  4  27   ? 235.341 281.468 214.971 1.00 32.49  ? 27   U   5 P     1 
ATOM   2907  O  OP1   . U   D  4  27   ? 233.895 281.807 214.956 1.00 32.49  ? 27   U   5 OP1   1 
ATOM   2908  O  OP2   . U   D  4  27   ? 236.131 281.929 216.137 1.00 32.49  ? 27   U   5 OP2   1 
ATOM   2909  O  "O5'" . U   D  4  27   ? 235.488 279.883 214.939 1.00 32.49  ? 27   U   5 "O5'" 1 
ATOM   2910  C  "C5'" . U   D  4  27   ? 234.388 279.032 215.252 1.00 32.49  ? 27   U   5 "C5'" 1 
ATOM   2911  C  "C4'" . U   D  4  27   ? 234.841 277.648 215.651 1.00 32.49  ? 27   U   5 "C4'" 1 
ATOM   2912  O  "O4'" . U   D  4  27   ? 234.574 276.710 214.572 1.00 32.49  ? 27   U   5 "O4'" 1 
ATOM   2913  C  "C3'" . U   D  4  27   ? 236.327 277.519 215.979 1.00 32.49  ? 27   U   5 "C3'" 1 
ATOM   2914  O  "O3'" . U   D  4  27   ? 236.501 276.589 217.048 1.00 32.49  ? 27   U   5 "O3'" 1 
ATOM   2915  C  "C2'" . U   D  4  27   ? 236.909 276.940 214.689 1.00 32.49  ? 27   U   5 "C2'" 1 
ATOM   2916  O  "O2'" . U   D  4  27   ? 238.109 276.215 214.858 1.00 32.49  ? 27   U   5 "O2'" 1 
ATOM   2917  C  "C1'" . U   D  4  27   ? 235.769 276.046 214.207 1.00 32.49  ? 27   U   5 "C1'" 1 
ATOM   2918  N  N1    . U   D  4  27   ? 235.737 275.835 212.751 1.00 32.49  ? 27   U   5 N1    1 
ATOM   2919  C  C2    . U   D  4  27   ? 236.566 274.882 212.188 1.00 32.49  ? 27   U   5 C2    1 
ATOM   2920  O  O2    . U   D  4  27   ? 237.347 274.206 212.837 1.00 32.49  ? 27   U   5 O2    1 
ATOM   2921  N  N3    . U   D  4  27   ? 236.458 274.756 210.824 1.00 32.49  ? 27   U   5 N3    1 
ATOM   2922  C  C4    . U   D  4  27   ? 235.619 275.459 209.984 1.00 32.49  ? 27   U   5 C4    1 
ATOM   2923  O  O4    . U   D  4  27   ? 235.636 275.228 208.774 1.00 32.49  ? 27   U   5 O4    1 
ATOM   2924  C  C5    . U   D  4  27   ? 234.787 276.417 210.642 1.00 32.49  ? 27   U   5 C5    1 
ATOM   2925  C  C6    . U   D  4  27   ? 234.871 276.561 211.968 1.00 32.49  ? 27   U   5 C6    1 
ATOM   2926  P  P     . A   D  4  28   ? 236.446 277.073 218.583 1.00 20.44  ? 28   A   5 P     1 
ATOM   2927  O  OP1   . A   D  4  28   ? 235.626 278.301 218.737 1.00 20.44  ? 28   A   5 OP1   1 
ATOM   2928  O  OP2   . A   D  4  28   ? 237.831 277.076 219.109 1.00 20.44  ? 28   A   5 OP2   1 
ATOM   2929  O  "O5'" . A   D  4  28   ? 235.689 275.881 219.313 1.00 20.44  ? 28   A   5 "O5'" 1 
ATOM   2930  C  "C5'" . A   D  4  28   ? 236.286 274.597 219.384 1.00 20.44  ? 28   A   5 "C5'" 1 
ATOM   2931  C  "C4'" . A   D  4  28   ? 235.269 273.520 219.648 1.00 20.44  ? 28   A   5 "C4'" 1 
ATOM   2932  O  "O4'" . A   D  4  28   ? 234.522 273.235 218.435 1.00 20.44  ? 28   A   5 "O4'" 1 
ATOM   2933  C  "C3'" . A   D  4  28   ? 235.842 272.172 220.051 1.00 20.44  ? 28   A   5 "C3'" 1 
ATOM   2934  O  "O3'" . A   D  4  28   ? 236.194 272.111 221.421 1.00 20.44  ? 28   A   5 "O3'" 1 
ATOM   2935  C  "C2'" . A   D  4  28   ? 234.733 271.212 219.653 1.00 20.44  ? 28   A   5 "C2'" 1 
ATOM   2936  O  "O2'" . A   D  4  28   ? 233.673 271.254 220.597 1.00 20.44  ? 28   A   5 "O2'" 1 
ATOM   2937  C  "C1'" . A   D  4  28   ? 234.246 271.851 218.353 1.00 20.44  ? 28   A   5 "C1'" 1 
ATOM   2938  N  N9    . A   D  4  28   ? 234.948 271.313 217.171 1.00 20.44  ? 28   A   5 N9    1 
ATOM   2939  C  C8    . A   D  4  28   ? 235.737 272.026 216.303 1.00 20.44  ? 28   A   5 C8    1 
ATOM   2940  N  N7    . A   D  4  28   ? 236.244 271.312 215.330 1.00 20.44  ? 28   A   5 N7    1 
ATOM   2941  C  C5    . A   D  4  28   ? 235.754 270.038 215.570 1.00 20.44  ? 28   A   5 C5    1 
ATOM   2942  C  C6    . A   D  4  28   ? 235.926 268.817 214.892 1.00 20.44  ? 28   A   5 C6    1 
ATOM   2943  N  N6    . A   D  4  28   ? 236.669 268.685 213.792 1.00 20.44  ? 28   A   5 N6    1 
ATOM   2944  N  N1    . A   D  4  28   ? 235.303 267.722 215.385 1.00 20.44  ? 28   A   5 N1    1 
ATOM   2945  C  C2    . A   D  4  28   ? 234.557 267.848 216.490 1.00 20.44  ? 28   A   5 C2    1 
ATOM   2946  N  N3    . A   D  4  28   ? 234.318 268.942 217.211 1.00 20.44  ? 28   A   5 N3    1 
ATOM   2947  C  C4    . A   D  4  28   ? 234.951 270.017 216.699 1.00 20.44  ? 28   A   5 C4    1 
ATOM   2948  P  P     . A   D  4  29   ? 237.715 271.820 221.847 1.00 37.02  ? 29   A   5 P     1 
ATOM   2949  O  OP1   . A   D  4  29   ? 238.019 272.628 223.055 1.00 37.02  ? 29   A   5 OP1   1 
ATOM   2950  O  OP2   . A   D  4  29   ? 238.569 271.958 220.640 1.00 37.02  ? 29   A   5 OP2   1 
ATOM   2951  O  "O5'" . A   D  4  29   ? 237.701 270.285 222.264 1.00 37.02  ? 29   A   5 "O5'" 1 
ATOM   2952  C  "C5'" . A   D  4  29   ? 236.707 269.787 223.145 1.00 37.02  ? 29   A   5 "C5'" 1 
ATOM   2953  C  "C4'" . A   D  4  29   ? 236.206 268.435 222.709 1.00 37.02  ? 29   A   5 "C4'" 1 
ATOM   2954  O  "O4'" . A   D  4  29   ? 235.691 268.513 221.354 1.00 37.02  ? 29   A   5 "O4'" 1 
ATOM   2955  C  "C3'" . A   D  4  29   ? 237.243 267.327 222.643 1.00 37.02  ? 29   A   5 "C3'" 1 
ATOM   2956  O  "O3'" . A   D  4  29   ? 237.531 266.762 223.909 1.00 37.02  ? 29   A   5 "O3'" 1 
ATOM   2957  C  "C2'" . A   D  4  29   ? 236.615 266.349 221.661 1.00 37.02  ? 29   A   5 "C2'" 1 
ATOM   2958  O  "O2'" . A   D  4  29   ? 235.596 265.590 222.293 1.00 37.02  ? 29   A   5 "O2'" 1 
ATOM   2959  C  "C1'" . A   D  4  29   ? 235.953 267.305 220.670 1.00 37.02  ? 29   A   5 "C1'" 1 
ATOM   2960  N  N9    . A   D  4  29   ? 236.823 267.595 219.513 1.00 37.02  ? 29   A   5 N9    1 
ATOM   2961  C  C8    . A   D  4  29   ? 237.484 268.762 219.217 1.00 37.02  ? 29   A   5 C8    1 
ATOM   2962  N  N7    . A   D  4  29   ? 238.184 268.708 218.109 1.00 37.02  ? 29   A   5 N7    1 
ATOM   2963  C  C5    . A   D  4  29   ? 237.967 267.419 217.644 1.00 37.02  ? 29   A   5 C5    1 
ATOM   2964  C  C6    . A   D  4  29   ? 238.425 266.723 216.509 1.00 37.02  ? 29   A   5 C6    1 
ATOM   2965  N  N6    . A   D  4  29   ? 239.237 267.254 215.590 1.00 37.02  ? 29   A   5 N6    1 
ATOM   2966  N  N1    . A   D  4  29   ? 238.018 265.444 216.344 1.00 37.02  ? 29   A   5 N1    1 
ATOM   2967  C  C2    . A   D  4  29   ? 237.204 264.899 217.258 1.00 37.02  ? 29   A   5 C2    1 
ATOM   2968  N  N3    . A   D  4  29   ? 236.708 265.452 218.361 1.00 37.02  ? 29   A   5 N3    1 
ATOM   2969  C  C4    . A   D  4  29   ? 237.131 266.722 218.498 1.00 37.02  ? 29   A   5 C4    1 
ATOM   2970  P  P     . A   D  4  30   ? 239.023 266.280 224.254 1.00 37.02  ? 30   A   5 P     1 
ATOM   2971  O  OP1   . A   D  4  30   ? 239.131 266.145 225.728 1.00 37.02  ? 30   A   5 OP1   1 
ATOM   2972  O  OP2   . A   D  4  30   ? 239.976 267.150 223.518 1.00 37.02  ? 30   A   5 OP2   1 
ATOM   2973  O  "O5'" . A   D  4  30   ? 239.106 264.821 223.621 1.00 37.02  ? 30   A   5 "O5'" 1 
ATOM   2974  C  "C5'" . A   D  4  30   ? 238.186 263.812 224.007 1.00 37.02  ? 30   A   5 "C5'" 1 
ATOM   2975  C  "C4'" . A   D  4  30   ? 238.173 262.672 223.022 1.00 37.02  ? 30   A   5 "C4'" 1 
ATOM   2976  O  "O4'" . A   D  4  30   ? 237.743 263.148 221.721 1.00 37.02  ? 30   A   5 "O4'" 1 
ATOM   2977  C  "C3'" . A   D  4  30   ? 239.516 262.017 222.751 1.00 37.02  ? 30   A   5 "C3'" 1 
ATOM   2978  O  "O3'" . A   D  4  30   ? 239.874 261.077 223.748 1.00 37.02  ? 30   A   5 "O3'" 1 
ATOM   2979  C  "C2'" . A   D  4  30   ? 239.316 261.404 221.372 1.00 37.02  ? 30   A   5 "C2'" 1 
ATOM   2980  O  "O2'" . A   D  4  30   ? 238.579 260.193 221.464 1.00 37.02  ? 30   A   5 "O2'" 1 
ATOM   2981  C  "C1'" . A   D  4  30   ? 238.431 262.455 220.702 1.00 37.02  ? 30   A   5 "C1'" 1 
ATOM   2982  N  N9    . A   D  4  30   ? 239.216 263.431 219.925 1.00 37.02  ? 30   A   5 N9    1 
ATOM   2983  C  C8    . A   D  4  30   ? 239.462 264.742 220.248 1.00 37.02  ? 30   A   5 C8    1 
ATOM   2984  N  N7    . A   D  4  30   ? 240.187 265.381 219.365 1.00 37.02  ? 30   A   5 N7    1 
ATOM   2985  C  C5    . A   D  4  30   ? 240.436 264.425 218.391 1.00 37.02  ? 30   A   5 C5    1 
ATOM   2986  C  C6    . A   D  4  30   ? 241.150 264.465 217.179 1.00 37.02  ? 30   A   5 C6    1 
ATOM   2987  N  N6    . A   D  4  30   ? 241.779 265.550 216.723 1.00 37.02  ? 30   A   5 N6    1 
ATOM   2988  N  N1    . A   D  4  30   ? 241.204 263.333 216.441 1.00 37.02  ? 30   A   5 N1    1 
ATOM   2989  C  C2    . A   D  4  30   ? 240.581 262.235 216.890 1.00 37.02  ? 30   A   5 C2    1 
ATOM   2990  N  N3    . A   D  4  30   ? 239.876 262.077 218.008 1.00 37.02  ? 30   A   5 N3    1 
ATOM   2991  C  C4    . A   D  4  30   ? 239.842 263.218 218.721 1.00 37.02  ? 30   A   5 C4    1 
ATOM   2992  P  P     . U   D  4  31   ? 241.407 260.922 224.197 1.00 37.02  ? 31   U   5 P     1 
ATOM   2993  O  OP1   . U   D  4  31   ? 241.428 260.260 225.527 1.00 37.02  ? 31   U   5 OP1   1 
ATOM   2994  O  OP2   . U   D  4  31   ? 242.078 262.233 224.012 1.00 37.02  ? 31   U   5 OP2   1 
ATOM   2995  O  "O5'" . U   D  4  31   ? 242.011 259.906 223.132 1.00 37.02  ? 31   U   5 "O5'" 1 
ATOM   2996  C  "C5'" . U   D  4  31   ? 241.383 258.657 222.887 1.00 37.02  ? 31   U   5 "C5'" 1 
ATOM   2997  C  "C4'" . U   D  4  31   ? 241.902 258.021 221.624 1.00 37.02  ? 31   U   5 "C4'" 1 
ATOM   2998  O  "O4'" . U   D  4  31   ? 241.440 258.766 220.464 1.00 37.02  ? 31   U   5 "O4'" 1 
ATOM   2999  C  "C3'" . U   D  4  31   ? 243.410 258.010 221.461 1.00 37.02  ? 31   U   5 "C3'" 1 
ATOM   3000  O  "O3'" . U   D  4  31   ? 244.067 257.020 222.231 1.00 37.02  ? 31   U   5 "O3'" 1 
ATOM   3001  C  "C2'" . U   D  4  31   ? 243.571 257.845 219.957 1.00 37.02  ? 31   U   5 "C2'" 1 
ATOM   3002  O  "O2'" . U   D  4  31   ? 243.340 256.498 219.573 1.00 37.02  ? 31   U   5 "O2'" 1 
ATOM   3003  C  "C1'" . U   D  4  31   ? 242.414 258.703 219.439 1.00 37.02  ? 31   U   5 "C1'" 1 
ATOM   3004  N  N1    . U   D  4  31   ? 242.854 260.078 219.086 1.00 37.02  ? 31   U   5 N1    1 
ATOM   3005  C  C2    . U   D  4  31   ? 243.444 260.262 217.845 1.00 37.02  ? 31   U   5 C2    1 
ATOM   3006  O  O2    . U   D  4  31   ? 243.609 259.364 217.035 1.00 37.02  ? 31   U   5 O2    1 
ATOM   3007  N  N3    . U   D  4  31   ? 243.840 261.547 217.568 1.00 37.02  ? 31   U   5 N3    1 
ATOM   3008  C  C4    . U   D  4  31   ? 243.717 262.652 218.383 1.00 37.02  ? 31   U   5 C4    1 
ATOM   3009  O  O4    . U   D  4  31   ? 244.122 263.746 217.988 1.00 37.02  ? 31   U   5 O4    1 
ATOM   3010  C  C5    . U   D  4  31   ? 243.102 262.390 219.646 1.00 37.02  ? 31   U   5 C5    1 
ATOM   3011  C  C6    . U   D  4  31   ? 242.703 261.150 219.942 1.00 37.02  ? 31   U   5 C6    1 
ATOM   3012  P  P     . C   D  4  32   ? 245.388 257.416 223.057 1.00 29.09  ? 32   C   5 P     1 
ATOM   3013  O  OP1   . C   D  4  32   ? 245.365 256.730 224.372 1.00 29.09  ? 32   C   5 OP1   1 
ATOM   3014  O  OP2   . C   D  4  32   ? 245.499 258.897 223.024 1.00 29.09  ? 32   C   5 OP2   1 
ATOM   3015  O  "O5'" . C   D  4  32   ? 246.583 256.835 222.178 1.00 29.09  ? 32   C   5 "O5'" 1 
ATOM   3016  C  "C5'" . C   D  4  32   ? 246.391 255.723 221.316 1.00 29.09  ? 32   C   5 "C5'" 1 
ATOM   3017  C  "C4'" . C   D  4  32   ? 247.210 255.859 220.056 1.00 29.09  ? 32   C   5 "C4'" 1 
ATOM   3018  O  "O4'" . C   D  4  32   ? 246.636 256.886 219.204 1.00 29.09  ? 32   C   5 "O4'" 1 
ATOM   3019  C  "C3'" . C   D  4  32   ? 248.648 256.307 220.253 1.00 29.09  ? 32   C   5 "C3'" 1 
ATOM   3020  O  "O3'" . C   D  4  32   ? 249.509 255.249 220.634 1.00 29.09  ? 32   C   5 "O3'" 1 
ATOM   3021  C  "C2'" . C   D  4  32   ? 248.994 256.927 218.904 1.00 29.09  ? 32   C   5 "C2'" 1 
ATOM   3022  O  "O2'" . C   D  4  32   ? 249.300 255.917 217.954 1.00 29.09  ? 32   C   5 "O2'" 1 
ATOM   3023  C  "C1'" . C   D  4  32   ? 247.661 257.568 218.510 1.00 29.09  ? 32   C   5 "C1'" 1 
ATOM   3024  N  N1    . C   D  4  32   ? 247.591 259.016 218.841 1.00 29.09  ? 32   C   5 N1    1 
ATOM   3025  C  C2    . C   D  4  32   ? 248.195 259.954 217.990 1.00 29.09  ? 32   C   5 C2    1 
ATOM   3026  O  O2    . C   D  4  32   ? 248.792 259.575 216.970 1.00 29.09  ? 32   C   5 O2    1 
ATOM   3027  N  N3    . C   D  4  32   ? 248.123 261.271 218.295 1.00 29.09  ? 32   C   5 N3    1 
ATOM   3028  C  C4    . C   D  4  32   ? 247.478 261.676 219.389 1.00 29.09  ? 32   C   5 C4    1 
ATOM   3029  N  N4    . C   D  4  32   ? 247.435 262.985 219.644 1.00 29.09  ? 32   C   5 N4    1 
ATOM   3030  C  C5    . C   D  4  32   ? 246.849 260.755 220.271 1.00 29.09  ? 32   C   5 C5    1 
ATOM   3031  C  C6    . C   D  4  32   ? 246.927 259.456 219.958 1.00 29.09  ? 32   C   5 C6    1 
ATOM   3032  P  P     . U   D  4  33   ? 250.580 255.470 221.810 1.00 31.39  ? 33   U   5 P     1 
ATOM   3033  O  OP1   . U   D  4  33   ? 251.031 254.134 222.275 1.00 31.39  ? 33   U   5 OP1   1 
ATOM   3034  O  OP2   . U   D  4  33   ? 250.000 256.433 222.781 1.00 31.39  ? 33   U   5 OP2   1 
ATOM   3035  O  "O5'" . U   D  4  33   ? 251.805 256.180 221.080 1.00 31.39  ? 33   U   5 "O5'" 1 
ATOM   3036  C  "C5'" . U   D  4  33   ? 252.385 255.610 219.916 1.00 31.39  ? 33   U   5 "C5'" 1 
ATOM   3037  C  "C4'" . U   D  4  33   ? 253.186 256.628 219.146 1.00 31.39  ? 33   U   5 "C4'" 1 
ATOM   3038  O  "O4'" . U   D  4  33   ? 252.302 257.620 218.565 1.00 31.39  ? 33   U   5 "O4'" 1 
ATOM   3039  C  "C3'" . U   D  4  33   ? 254.172 257.448 219.958 1.00 31.39  ? 33   U   5 "C3'" 1 
ATOM   3040  O  "O3'" . U   D  4  33   ? 255.378 256.756 220.225 1.00 31.39  ? 33   U   5 "O3'" 1 
ATOM   3041  C  "C2'" . U   D  4  33   ? 254.359 258.691 219.099 1.00 31.39  ? 33   U   5 "C2'" 1 
ATOM   3042  O  "O2'" . U   D  4  33   ? 255.270 258.434 218.041 1.00 31.39  ? 33   U   5 "O2'" 1 
ATOM   3043  C  "C1'" . U   D  4  33   ? 252.959 258.869 218.502 1.00 31.39  ? 33   U   5 "C1'" 1 
ATOM   3044  N  N1    . U   D  4  33   ? 252.154 259.885 219.226 1.00 31.39  ? 33   U   5 N1    1 
ATOM   3045  C  C2    . U   D  4  33   ? 252.337 261.210 218.872 1.00 31.39  ? 33   U   5 C2    1 
ATOM   3046  O  O2    . U   D  4  33   ? 253.117 261.570 218.006 1.00 31.39  ? 33   U   5 O2    1 
ATOM   3047  N  N3    . U   D  4  33   ? 251.569 262.112 219.567 1.00 31.39  ? 33   U   5 N3    1 
ATOM   3048  C  C4    . U   D  4  33   ? 250.655 261.833 220.561 1.00 31.39  ? 33   U   5 C4    1 
ATOM   3049  O  O4    . U   D  4  33   ? 250.040 262.758 221.094 1.00 31.39  ? 33   U   5 O4    1 
ATOM   3050  C  C5    . U   D  4  33   ? 250.520 260.444 220.871 1.00 31.39  ? 33   U   5 C5    1 
ATOM   3051  C  C6    . U   D  4  33   ? 251.252 259.543 220.209 1.00 31.39  ? 33   U   5 C6    1 
ATOM   3052  P  P     . U   D  4  34   ? 255.977 256.722 221.714 1.00 30.19  ? 34   U   5 P     1 
ATOM   3053  O  OP1   . U   D  4  34   ? 256.819 255.511 221.841 1.00 30.19  ? 34   U   5 OP1   1 
ATOM   3054  O  OP2   . U   D  4  34   ? 254.862 256.952 222.668 1.00 30.19  ? 34   U   5 OP2   1 
ATOM   3055  O  "O5'" . U   D  4  34   ? 256.949 257.981 221.770 1.00 30.19  ? 34   U   5 "O5'" 1 
ATOM   3056  C  "C5'" . U   D  4  34   ? 256.508 259.218 222.306 1.00 30.19  ? 34   U   5 "C5'" 1 
ATOM   3057  C  "C4'" . U   D  4  34   ? 257.078 260.382 221.539 1.00 30.19  ? 34   U   5 "C4'" 1 
ATOM   3058  O  "O4'" . U   D  4  34   ? 256.020 261.040 220.796 1.00 30.19  ? 34   U   5 "O4'" 1 
ATOM   3059  C  "C3'" . U   D  4  34   ? 257.687 261.490 222.382 1.00 30.19  ? 34   U   5 "C3'" 1 
ATOM   3060  O  "O3'" . U   D  4  34   ? 259.012 261.199 222.789 1.00 30.19  ? 34   U   5 "O3'" 1 
ATOM   3061  C  "C2'" . U   D  4  34   ? 257.577 262.707 221.471 1.00 30.19  ? 34   U   5 "C2'" 1 
ATOM   3062  O  "O2'" . U   D  4  34   ? 258.627 262.715 220.515 1.00 30.19  ? 34   U   5 "O2'" 1 
ATOM   3063  C  "C1'" . U   D  4  34   ? 256.259 262.430 220.740 1.00 30.19  ? 34   U   5 "C1'" 1 
ATOM   3064  N  N1    . U   D  4  34   ? 255.101 263.139 221.339 1.00 30.19  ? 34   U   5 N1    1 
ATOM   3065  C  C2    . U   D  4  34   ? 254.901 264.465 220.997 1.00 30.19  ? 34   U   5 C2    1 
ATOM   3066  O  O2    . U   D  4  34   ? 255.632 265.081 220.240 1.00 30.19  ? 34   U   5 O2    1 
ATOM   3067  N  N3    . U   D  4  34   ? 253.807 265.057 221.580 1.00 30.19  ? 34   U   5 N3    1 
ATOM   3068  C  C4    . U   D  4  34   ? 252.906 264.475 222.447 1.00 30.19  ? 34   U   5 C4    1 
ATOM   3069  O  O4    . U   D  4  34   ? 251.969 265.141 222.889 1.00 30.19  ? 34   U   5 O4    1 
ATOM   3070  C  C5    . U   D  4  34   ? 253.173 263.104 222.749 1.00 30.19  ? 34   U   5 C5    1 
ATOM   3071  C  C6    . U   D  4  34   ? 254.228 262.502 222.195 1.00 30.19  ? 34   U   5 C6    1 
ATOM   3072  P  P     . U   D  4  35   ? 259.584 261.799 224.163 1.00 32.10  ? 35   U   5 P     1 
ATOM   3073  O  OP1   . U   D  4  35   ? 260.817 261.051 224.518 1.00 32.10  ? 35   U   5 OP1   1 
ATOM   3074  O  OP2   . U   D  4  35   ? 258.464 261.872 225.136 1.00 32.10  ? 35   U   5 OP2   1 
ATOM   3075  O  "O5'" . U   D  4  35   ? 260.001 263.287 223.781 1.00 32.10  ? 35   U   5 "O5'" 1 
ATOM   3076  C  "C5'" . U   D  4  35   ? 260.252 264.252 224.790 1.00 32.10  ? 35   U   5 "C5'" 1 
ATOM   3077  C  "C4'" . U   D  4  35   ? 259.952 265.646 224.305 1.00 32.10  ? 35   U   5 "C4'" 1 
ATOM   3078  O  "O4'" . U   D  4  35   ? 258.700 265.652 223.570 1.00 32.10  ? 35   U   5 "O4'" 1 
ATOM   3079  C  "C3'" . U   D  4  35   ? 259.747 266.688 225.391 1.00 32.10  ? 35   U   5 "C3'" 1 
ATOM   3080  O  "O3'" . U   D  4  35   ? 260.965 267.188 225.914 1.00 32.10  ? 35   U   5 "O3'" 1 
ATOM   3081  C  "C2'" . U   D  4  35   ? 258.895 267.741 224.693 1.00 32.10  ? 35   U   5 "C2'" 1 
ATOM   3082  O  "O2'" . U   D  4  35   ? 259.701 268.579 223.879 1.00 32.10  ? 35   U   5 "O2'" 1 
ATOM   3083  C  "C1'" . U   D  4  35   ? 258.022 266.874 223.780 1.00 32.10  ? 35   U   5 "C1'" 1 
ATOM   3084  N  N1    . U   D  4  35   ? 256.684 266.588 224.358 1.00 32.10  ? 35   U   5 N1    1 
ATOM   3085  C  C2    . U   D  4  35   ? 255.705 267.565 224.267 1.00 32.10  ? 35   U   5 C2    1 
ATOM   3086  O  O2    . U   D  4  35   ? 255.882 268.654 223.748 1.00 32.10  ? 35   U   5 O2    1 
ATOM   3087  N  N3    . U   D  4  35   ? 254.492 267.226 224.816 1.00 32.10  ? 35   U   5 N3    1 
ATOM   3088  C  C4    . U   D  4  35   ? 254.154 266.038 225.429 1.00 32.10  ? 35   U   5 C4    1 
ATOM   3089  O  O4    . U   D  4  35   ? 253.015 265.886 225.874 1.00 32.10  ? 35   U   5 O4    1 
ATOM   3090  C  C5    . U   D  4  35   ? 255.211 265.077 225.480 1.00 32.10  ? 35   U   5 C5    1 
ATOM   3091  C  C6    . U   D  4  35   ? 256.402 265.378 224.953 1.00 32.10  ? 35   U   5 C6    1 
ATOM   3092  P  P     . C   D  4  36   ? 261.243 267.107 227.492 1.00 34.21  ? 36   C   5 P     1 
ATOM   3093  O  OP1   . C   D  4  36   ? 261.862 268.386 227.925 1.00 34.21  ? 36   C   5 OP1   1 
ATOM   3094  O  OP2   . C   D  4  36   ? 261.935 265.823 227.773 1.00 34.21  ? 36   C   5 OP2   1 
ATOM   3095  O  "O5'" . C   D  4  36   ? 259.782 267.019 228.119 1.00 34.21  ? 36   C   5 "O5'" 1 
ATOM   3096  C  "C5'" . C   D  4  36   ? 259.442 267.756 229.282 1.00 34.21  ? 36   C   5 "C5'" 1 
ATOM   3097  C  "C4'" . C   D  4  36   ? 258.702 269.023 228.934 1.00 34.21  ? 36   C   5 "C4'" 1 
ATOM   3098  O  "O4'" . C   D  4  36   ? 257.611 268.726 228.023 1.00 34.21  ? 36   C   5 "O4'" 1 
ATOM   3099  C  "C3'" . C   D  4  36   ? 258.032 269.732 230.098 1.00 34.21  ? 36   C   5 "C3'" 1 
ATOM   3100  O  "O3'" . C   D  4  36   ? 258.936 270.535 230.835 1.00 34.21  ? 36   C   5 "O3'" 1 
ATOM   3101  C  "C2'" . C   D  4  36   ? 256.923 270.527 229.419 1.00 34.21  ? 36   C   5 "C2'" 1 
ATOM   3102  O  "O2'" . C   D  4  36   ? 257.437 271.726 228.858 1.00 34.21  ? 36   C   5 "O2'" 1 
ATOM   3103  C  "C1'" . C   D  4  36   ? 256.523 269.590 228.274 1.00 34.21  ? 36   C   5 "C1'" 1 
ATOM   3104  N  N1    . C   D  4  36   ? 255.321 268.770 228.574 1.00 34.21  ? 36   C   5 N1    1 
ATOM   3105  C  C2    . C   D  4  36   ? 254.037 269.335 228.511 1.00 34.21  ? 36   C   5 C2    1 
ATOM   3106  O  O2    . C   D  4  36   ? 253.893 270.534 228.223 1.00 34.21  ? 36   C   5 O2    1 
ATOM   3107  N  N3    . C   D  4  36   ? 252.960 268.559 228.777 1.00 34.21  ? 36   C   5 N3    1 
ATOM   3108  C  C4    . C   D  4  36   ? 253.114 267.271 229.086 1.00 34.21  ? 36   C   5 C4    1 
ATOM   3109  N  N4    . C   D  4  36   ? 252.021 266.548 229.339 1.00 34.21  ? 36   C   5 N4    1 
ATOM   3110  C  C5    . C   D  4  36   ? 254.400 266.665 229.149 1.00 34.21  ? 36   C   5 C5    1 
ATOM   3111  C  C6    . C   D  4  36   ? 255.456 267.443 228.883 1.00 34.21  ? 36   C   5 C6    1 
ATOM   3112  P  P     . G   D  4  37   ? 259.141 270.282 232.407 1.00 32.40  ? 37   G   5 P     1 
ATOM   3113  O  OP1   . G   D  4  37   ? 260.332 271.051 232.847 1.00 32.40  ? 37   G   5 OP1   1 
ATOM   3114  O  OP2   . G   D  4  37   ? 259.076 268.819 232.651 1.00 32.40  ? 37   G   5 OP2   1 
ATOM   3115  O  "O5'" . G   D  4  37   ? 257.854 270.947 233.066 1.00 32.40  ? 37   G   5 "O5'" 1 
ATOM   3116  C  "C5'" . G   D  4  37   ? 257.557 272.319 232.855 1.00 32.40  ? 37   G   5 "C5'" 1 
ATOM   3117  C  "C4'" . G   D  4  37   ? 256.192 272.669 233.387 1.00 32.40  ? 37   G   5 "C4'" 1 
ATOM   3118  O  "O4'" . G   D  4  37   ? 255.171 272.286 232.430 1.00 32.40  ? 37   G   5 "O4'" 1 
ATOM   3119  C  "C3'" . G   D  4  37   ? 255.781 271.959 234.665 1.00 32.40  ? 37   G   5 "C3'" 1 
ATOM   3120  O  "O3'" . G   D  4  37   ? 256.338 272.543 235.826 1.00 32.40  ? 37   G   5 "O3'" 1 
ATOM   3121  C  "C2'" . G   D  4  37   ? 254.261 272.027 234.609 1.00 32.40  ? 37   G   5 "C2'" 1 
ATOM   3122  O  "O2'" . G   D  4  37   ? 253.803 273.313 235.000 1.00 32.40  ? 37   G   5 "O2'" 1 
ATOM   3123  C  "C1'" . G   D  4  37   ? 254.009 271.860 233.110 1.00 32.40  ? 37   G   5 "C1'" 1 
ATOM   3124  N  N9    . G   D  4  37   ? 253.739 270.458 232.744 1.00 32.40  ? 37   G   5 N9    1 
ATOM   3125  C  C8    . G   D  4  37   ? 254.631 269.551 232.226 1.00 32.40  ? 37   G   5 C8    1 
ATOM   3126  N  N7    . G   D  4  37   ? 254.100 268.381 232.001 1.00 32.40  ? 37   G   5 N7    1 
ATOM   3127  C  C5    . G   D  4  37   ? 252.776 268.524 232.394 1.00 32.40  ? 37   G   5 C5    1 
ATOM   3128  C  C6    . G   D  4  37   ? 251.709 267.590 232.384 1.00 32.40  ? 37   G   5 C6    1 
ATOM   3129  O  O6    . G   D  4  37   ? 251.722 266.410 232.012 1.00 32.40  ? 37   G   5 O6    1 
ATOM   3130  N  N1    . G   D  4  37   ? 250.532 268.151 232.868 1.00 32.40  ? 37   G   5 N1    1 
ATOM   3131  C  C2    . G   D  4  37   ? 250.398 269.445 233.307 1.00 32.40  ? 37   G   5 C2    1 
ATOM   3132  N  N2    . G   D  4  37   ? 249.178 269.797 233.739 1.00 32.40  ? 37   G   5 N2    1 
ATOM   3133  N  N3    . G   D  4  37   ? 251.385 270.326 233.323 1.00 32.40  ? 37   G   5 N3    1 
ATOM   3134  C  C4    . G   D  4  37   ? 252.537 269.801 232.856 1.00 32.40  ? 37   G   5 C4    1 
ATOM   3135  P  P     . C   D  4  38   ? 256.409 271.700 237.189 1.00 26.46  ? 38   C   5 P     1 
ATOM   3136  O  OP1   . C   D  4  38   ? 257.675 272.058 237.876 1.00 26.46  ? 38   C   5 OP1   1 
ATOM   3137  O  OP2   . C   D  4  38   ? 256.133 270.277 236.865 1.00 26.46  ? 38   C   5 OP2   1 
ATOM   3138  O  "O5'" . C   D  4  38   ? 255.184 272.256 238.042 1.00 26.46  ? 38   C   5 "O5'" 1 
ATOM   3139  C  "C5'" . C   D  4  38   ? 254.553 271.448 239.022 1.00 26.46  ? 38   C   5 "C5'" 1 
ATOM   3140  C  "C4'" . C   D  4  38   ? 253.051 271.520 238.913 1.00 26.46  ? 38   C   5 "C4'" 1 
ATOM   3141  O  "O4'" . C   D  4  38   ? 252.641 271.195 237.559 1.00 26.46  ? 38   C   5 "O4'" 1 
ATOM   3142  C  "C3'" . C   D  4  38   ? 252.279 270.538 239.779 1.00 26.46  ? 38   C   5 "C3'" 1 
ATOM   3143  O  "O3'" . C   D  4  38   ? 252.137 270.977 241.118 1.00 26.46  ? 38   C   5 "O3'" 1 
ATOM   3144  C  "C2'" . C   D  4  38   ? 250.955 270.403 239.039 1.00 26.46  ? 38   C   5 "C2'" 1 
ATOM   3145  O  "O2'" . C   D  4  38   ? 250.103 271.501 239.331 1.00 26.46  ? 38   C   5 "O2'" 1 
ATOM   3146  C  "C1'" . C   D  4  38   ? 251.403 270.513 237.578 1.00 26.46  ? 38   C   5 "C1'" 1 
ATOM   3147  N  N1    . C   D  4  38   ? 251.569 269.193 236.918 1.00 26.46  ? 38   C   5 N1    1 
ATOM   3148  C  C2    . C   D  4  38   ? 250.445 268.469 236.485 1.00 26.46  ? 38   C   5 C2    1 
ATOM   3149  O  O2    . C   D  4  38   ? 249.301 268.920 236.654 1.00 26.46  ? 38   C   5 O2    1 
ATOM   3150  N  N3    . C   D  4  38   ? 250.624 267.274 235.875 1.00 26.46  ? 38   C   5 N3    1 
ATOM   3151  C  C4    . C   D  4  38   ? 251.849 266.787 235.685 1.00 26.46  ? 38   C   5 C4    1 
ATOM   3152  N  N4    . C   D  4  38   ? 251.968 265.603 235.080 1.00 26.46  ? 38   C   5 N4    1 
ATOM   3153  C  C5    . C   D  4  38   ? 253.008 267.497 236.105 1.00 26.46  ? 38   C   5 C5    1 
ATOM   3154  C  C6    . C   D  4  38   ? 252.821 268.678 236.704 1.00 26.46  ? 38   C   5 C6    1 
ATOM   3155  P  P     . C   D  4  39   ? 252.429 269.965 242.329 1.00 24.79  ? 39   C   5 P     1 
ATOM   3156  O  OP1   . C   D  4  39   ? 251.731 270.473 243.537 1.00 24.79  ? 39   C   5 OP1   1 
ATOM   3157  O  OP2   . C   D  4  39   ? 253.891 269.710 242.376 1.00 24.79  ? 39   C   5 OP2   1 
ATOM   3158  O  "O5'" . C   D  4  39   ? 251.711 268.617 241.877 1.00 24.79  ? 39   C   5 "O5'" 1 
ATOM   3159  C  "C5'" . C   D  4  39   ? 252.129 267.366 242.398 1.00 24.79  ? 39   C   5 "C5'" 1 
ATOM   3160  C  "C4'" . C   D  4  39   ? 251.579 266.216 241.593 1.00 24.79  ? 39   C   5 "C4'" 1 
ATOM   3161  O  "O4'" . C   D  4  39   ? 251.761 266.475 240.176 1.00 24.79  ? 39   C   5 "O4'" 1 
ATOM   3162  C  "C3'" . C   D  4  39   ? 252.261 264.877 241.812 1.00 24.79  ? 39   C   5 "C3'" 1 
ATOM   3163  O  "O3'" . C   D  4  39   ? 251.820 264.213 242.982 1.00 24.79  ? 39   C   5 "O3'" 1 
ATOM   3164  C  "C2'" . C   D  4  39   ? 251.952 264.128 240.522 1.00 24.79  ? 39   C   5 "C2'" 1 
ATOM   3165  O  "O2'" . C   D  4  39   ? 250.633 263.604 240.550 1.00 24.79  ? 39   C   5 "O2'" 1 
ATOM   3166  C  "C1'" . C   D  4  39   ? 251.999 265.262 239.492 1.00 24.79  ? 39   C   5 "C1'" 1 
ATOM   3167  N  N1    . C   D  4  39   ? 253.305 265.350 238.789 1.00 24.79  ? 39   C   5 N1    1 
ATOM   3168  C  C2    . C   D  4  39   ? 253.565 264.491 237.711 1.00 24.79  ? 39   C   5 C2    1 
ATOM   3169  O  O2    . C   D  4  39   ? 252.709 263.664 237.358 1.00 24.79  ? 39   C   5 O2    1 
ATOM   3170  N  N3    . C   D  4  39   ? 254.752 264.579 237.066 1.00 24.79  ? 39   C   5 N3    1 
ATOM   3171  C  C4    . C   D  4  39   ? 255.663 265.473 237.449 1.00 24.79  ? 39   C   5 C4    1 
ATOM   3172  N  N4    . C   D  4  39   ? 256.818 265.517 236.781 1.00 24.79  ? 39   C   5 N4    1 
ATOM   3173  C  C5    . C   D  4  39   ? 255.431 266.362 238.536 1.00 24.79  ? 39   C   5 C5    1 
ATOM   3174  C  C6    . C   D  4  39   ? 254.253 266.267 239.163 1.00 24.79  ? 39   C   5 C6    1 
ATOM   3175  P  P     . U   D  4  40   ? 252.865 263.903 244.160 1.00 26.40  ? 40   U   5 P     1 
ATOM   3176  O  OP1   . U   D  4  40   ? 252.149 263.249 245.283 1.00 26.40  ? 40   U   5 OP1   1 
ATOM   3177  O  OP2   . U   D  4  40   ? 253.649 265.134 244.399 1.00 26.40  ? 40   U   5 OP2   1 
ATOM   3178  O  "O5'" . U   D  4  40   ? 253.866 262.850 243.515 1.00 26.40  ? 40   U   5 "O5'" 1 
ATOM   3179  C  "C5'" . U   D  4  40   ? 254.345 261.747 244.273 1.00 26.40  ? 40   U   5 "C5'" 1 
ATOM   3180  C  "C4'" . U   D  4  40   ? 253.887 260.432 243.694 1.00 26.40  ? 40   U   5 "C4'" 1 
ATOM   3181  O  "O4'" . U   D  4  40   ? 252.895 259.841 244.581 1.00 26.40  ? 40   U   5 "O4'" 1 
ATOM   3182  C  "C3'" . U   D  4  40   ? 253.235 260.508 242.312 1.00 26.40  ? 40   U   5 "C3'" 1 
ATOM   3183  O  "O3'" . U   D  4  40   ? 253.574 259.333 241.573 1.00 26.40  ? 40   U   5 "O3'" 1 
ATOM   3184  C  "C2'" . U   D  4  40   ? 251.745 260.500 242.650 1.00 26.40  ? 40   U   5 "C2'" 1 
ATOM   3185  O  "O2'" . U   D  4  40   ? 250.894 260.063 241.612 1.00 26.40  ? 40   U   5 "O2'" 1 
ATOM   3186  C  "C1'" . U   D  4  40   ? 251.712 259.567 243.856 1.00 26.40  ? 40   U   5 "C1'" 1 
ATOM   3187  N  N1    . U   D  4  40   ? 250.558 259.781 244.743 1.00 26.40  ? 40   U   5 N1    1 
ATOM   3188  C  C2    . U   D  4  40   ? 250.132 258.715 245.514 1.00 26.40  ? 40   U   5 C2    1 
ATOM   3189  O  O2    . U   D  4  40   ? 250.682 257.628 245.501 1.00 26.40  ? 40   U   5 O2    1 
ATOM   3190  N  N3    . U   D  4  40   ? 249.043 258.976 246.309 1.00 26.40  ? 40   U   5 N3    1 
ATOM   3191  C  C4    . U   D  4  40   ? 248.346 260.163 246.402 1.00 26.40  ? 40   U   5 C4    1 
ATOM   3192  O  O4    . U   D  4  40   ? 247.382 260.243 247.164 1.00 26.40  ? 40   U   5 O4    1 
ATOM   3193  C  C5    . U   D  4  40   ? 248.840 261.213 245.567 1.00 26.40  ? 40   U   5 C5    1 
ATOM   3194  C  C6    . U   D  4  40   ? 249.900 260.989 244.786 1.00 26.40  ? 40   U   5 C6    1 
ATOM   3195  P  P     . U   D  4  41   ? 253.538 259.317 239.962 1.00 30.54  ? 41   U   5 P     1 
ATOM   3196  O  OP1   . U   D  4  41   ? 254.935 259.269 239.465 1.00 30.54  ? 41   U   5 OP1   1 
ATOM   3197  O  OP2   . U   D  4  41   ? 252.645 260.399 239.478 1.00 30.54  ? 41   U   5 OP2   1 
ATOM   3198  O  "O5'" . U   D  4  41   ? 252.841 257.922 239.636 1.00 30.54  ? 41   U   5 "O5'" 1 
ATOM   3199  C  "C5'" . U   D  4  41   ? 252.323 257.125 240.691 1.00 30.54  ? 41   U   5 "C5'" 1 
ATOM   3200  C  "C4'" . U   D  4  41   ? 251.234 256.191 240.227 1.00 30.54  ? 41   U   5 "C4'" 1 
ATOM   3201  O  "O4'" . U   D  4  41   ? 250.384 255.857 241.359 1.00 30.54  ? 41   U   5 "O4'" 1 
ATOM   3202  C  "C3'" . U   D  4  41   ? 250.266 256.746 239.193 1.00 30.54  ? 41   U   5 "C3'" 1 
ATOM   3203  O  "O3'" . U   D  4  41   ? 250.765 256.679 237.868 1.00 30.54  ? 41   U   5 "O3'" 1 
ATOM   3204  C  "C2'" . U   D  4  41   ? 249.016 255.905 239.418 1.00 30.54  ? 41   U   5 "C2'" 1 
ATOM   3205  O  "O2'" . U   D  4  41   ? 249.149 254.634 238.800 1.00 30.54  ? 41   U   5 "O2'" 1 
ATOM   3206  C  "C1'" . U   D  4  41   ? 249.045 255.708 240.935 1.00 30.54  ? 41   U   5 "C1'" 1 
ATOM   3207  N  N1    . U   D  4  41   ? 248.192 256.689 241.654 1.00 30.54  ? 41   U   5 N1    1 
ATOM   3208  C  C2    . U   D  4  41   ? 246.833 256.436 241.758 1.00 30.54  ? 41   U   5 C2    1 
ATOM   3209  O  O2    . U   D  4  41   ? 246.300 255.445 241.287 1.00 30.54  ? 41   U   5 O2    1 
ATOM   3210  N  N3    . U   D  4  41   ? 246.110 257.390 242.440 1.00 30.54  ? 41   U   5 N3    1 
ATOM   3211  C  C4    . U   D  4  41   ? 246.600 258.546 243.015 1.00 30.54  ? 41   U   5 C4    1 
ATOM   3212  O  O4    . U   D  4  41   ? 245.852 259.325 243.601 1.00 30.54  ? 41   U   5 O4    1 
ATOM   3213  C  C5    . U   D  4  41   ? 248.002 258.735 242.864 1.00 30.54  ? 41   U   5 C5    1 
ATOM   3214  C  C6    . U   D  4  41   ? 248.724 257.824 242.218 1.00 30.54  ? 41   U   5 C6    1 
ATOM   3215  P  P     . U   D  4  42   ? 250.377 257.815 236.798 1.00 30.95  ? 42   U   5 P     1 
ATOM   3216  O  OP1   . U   D  4  42   ? 251.179 257.582 235.571 1.00 30.95  ? 42   U   5 OP1   1 
ATOM   3217  O  OP2   . U   D  4  42   ? 250.443 259.133 237.479 1.00 30.95  ? 42   U   5 OP2   1 
ATOM   3218  O  "O5'" . U   D  4  42   ? 248.850 257.519 236.450 1.00 30.95  ? 42   U   5 "O5'" 1 
ATOM   3219  C  "C5'" . U   D  4  42   ? 248.474 256.334 235.763 1.00 30.95  ? 42   U   5 "C5'" 1 
ATOM   3220  C  "C4'" . U   D  4  42   ? 246.984 256.109 235.820 1.00 30.95  ? 42   U   5 "C4'" 1 
ATOM   3221  O  "O4'" . U   D  4  42   ? 246.545 256.049 237.202 1.00 30.95  ? 42   U   5 "O4'" 1 
ATOM   3222  C  "C3'" . U   D  4  42   ? 246.120 257.199 235.208 1.00 30.95  ? 42   U   5 "C3'" 1 
ATOM   3223  O  "O3'" . U   D  4  42   ? 246.029 257.104 233.797 1.00 30.95  ? 42   U   5 "O3'" 1 
ATOM   3224  C  "C2'" . U   D  4  42   ? 244.785 257.005 235.917 1.00 30.95  ? 42   U   5 "C2'" 1 
ATOM   3225  O  "O2'" . U   D  4  42   ? 244.051 255.946 235.324 1.00 30.95  ? 42   U   5 "O2'" 1 
ATOM   3226  C  "C1'" . U   D  4  42   ? 245.232 256.561 237.313 1.00 30.95  ? 42   U   5 "C1'" 1 
ATOM   3227  N  N1    . U   D  4  42   ? 245.215 257.669 238.300 1.00 30.95  ? 42   U   5 N1    1 
ATOM   3228  C  C2    . U   D  4  42   ? 244.005 257.986 238.901 1.00 30.95  ? 42   U   5 C2    1 
ATOM   3229  O  O2    . U   D  4  42   ? 242.965 257.400 238.655 1.00 30.95  ? 42   U   5 O2    1 
ATOM   3230  N  N3    . U   D  4  42   ? 244.048 259.019 239.808 1.00 30.95  ? 42   U   5 N3    1 
ATOM   3231  C  C4    . U   D  4  42   ? 245.161 259.752 240.169 1.00 30.95  ? 42   U   5 C4    1 
ATOM   3232  O  O4    . U   D  4  42   ? 245.061 260.655 241.001 1.00 30.95  ? 42   U   5 O4    1 
ATOM   3233  C  C5    . U   D  4  42   ? 246.370 259.366 239.510 1.00 30.95  ? 42   U   5 C5    1 
ATOM   3234  C  C6    . U   D  4  42   ? 246.357 258.365 238.625 1.00 30.95  ? 42   U   5 C6    1 
ATOM   3235  P  P     . U   D  4  43   ? 245.805 258.424 232.908 1.00 37.02  ? 43   U   5 P     1 
ATOM   3236  O  OP1   . U   D  4  43   ? 246.192 258.106 231.511 1.00 37.02  ? 43   U   5 OP1   1 
ATOM   3237  O  OP2   . U   D  4  43   ? 246.449 259.565 233.608 1.00 37.02  ? 43   U   5 OP2   1 
ATOM   3238  O  "O5'" . U   D  4  43   ? 244.228 258.652 232.941 1.00 37.02  ? 43   U   5 "O5'" 1 
ATOM   3239  C  "C5'" . U   D  4  43   ? 243.341 257.696 232.379 1.00 37.02  ? 43   U   5 "C5'" 1 
ATOM   3240  C  "C4'" . U   D  4  43   ? 241.945 257.845 232.928 1.00 37.02  ? 43   U   5 "C4'" 1 
ATOM   3241  O  "O4'" . U   D  4  43   ? 241.992 257.854 234.379 1.00 37.02  ? 43   U   5 "O4'" 1 
ATOM   3242  C  "C3'" . U   D  4  43   ? 241.220 259.133 232.575 1.00 37.02  ? 43   U   5 "C3'" 1 
ATOM   3243  O  "O3'" . U   D  4  43   ? 240.632 259.101 231.286 1.00 37.02  ? 43   U   5 "O3'" 1 
ATOM   3244  C  "C2'" . U   D  4  43   ? 240.205 259.271 233.705 1.00 37.02  ? 43   U   5 "C2'" 1 
ATOM   3245  O  "O2'" . U   D  4  43   ? 239.074 258.445 233.467 1.00 37.02  ? 43   U   5 "O2'" 1 
ATOM   3246  C  "C1'" . U   D  4  43   ? 240.982 258.697 234.892 1.00 37.02  ? 43   U   5 "C1'" 1 
ATOM   3247  N  N1    . U   D  4  43   ? 241.606 259.747 235.734 1.00 37.02  ? 43   U   5 N1    1 
ATOM   3248  C  C2    . U   D  4  43   ? 240.817 260.341 236.704 1.00 37.02  ? 43   U   5 C2    1 
ATOM   3249  O  O2    . U   D  4  43   ? 239.649 260.045 236.888 1.00 37.02  ? 43   U   5 O2    1 
ATOM   3250  N  N3    . U   D  4  43   ? 241.445 261.302 237.457 1.00 37.02  ? 43   U   5 N3    1 
ATOM   3251  C  C4    . U   D  4  43   ? 242.753 261.724 237.350 1.00 37.02  ? 43   U   5 C4    1 
ATOM   3252  O  O4    . U   D  4  43   ? 243.171 262.603 238.105 1.00 37.02  ? 43   U   5 O4    1 
ATOM   3253  C  C5    . U   D  4  43   ? 243.507 261.065 236.330 1.00 37.02  ? 43   U   5 C5    1 
ATOM   3254  C  C6    . U   D  4  43   ? 242.922 260.125 235.582 1.00 37.02  ? 43   U   5 C6    1 
ATOM   3255  P  P     . A   D  4  44   ? 240.591 260.428 230.381 1.00 37.02  ? 44   A   5 P     1 
ATOM   3256  O  OP1   . A   D  4  44   ? 239.841 260.116 229.138 1.00 37.02  ? 44   A   5 OP1   1 
ATOM   3257  O  OP2   . A   D  4  44   ? 241.973 260.964 230.289 1.00 37.02  ? 44   A   5 OP2   1 
ATOM   3258  O  "O5'" . A   D  4  44   ? 239.723 261.454 231.237 1.00 37.02  ? 44   A   5 "O5'" 1 
ATOM   3259  C  "C5'" . A   D  4  44   ? 240.310 262.629 231.774 1.00 37.02  ? 44   A   5 "C5'" 1 
ATOM   3260  C  "C4'" . A   D  4  44   ? 239.388 263.317 232.748 1.00 37.02  ? 44   A   5 "C4'" 1 
ATOM   3261  O  "O4'" . A   D  4  44   ? 239.793 263.022 234.112 1.00 37.02  ? 44   A   5 "O4'" 1 
ATOM   3262  C  "C3'" . A   D  4  44   ? 239.394 264.834 232.689 1.00 37.02  ? 44   A   5 "C3'" 1 
ATOM   3263  O  "O3'" . A   D  4  44   ? 238.618 265.356 231.627 1.00 37.02  ? 44   A   5 "O3'" 1 
ATOM   3264  C  "C2'" . A   D  4  44   ? 238.899 265.221 234.073 1.00 37.02  ? 44   A   5 "C2'" 1 
ATOM   3265  O  "O2'" . A   D  4  44   ? 237.493 265.051 234.169 1.00 37.02  ? 44   A   5 "O2'" 1 
ATOM   3266  C  "C1'" . A   D  4  44   ? 239.573 264.153 234.932 1.00 37.02  ? 44   A   5 "C1'" 1 
ATOM   3267  N  N9    . A   D  4  44   ? 240.858 264.625 235.497 1.00 37.02  ? 44   A   5 N9    1 
ATOM   3268  C  C8    . A   D  4  44   ? 240.966 265.423 236.608 1.00 37.02  ? 44   A   5 C8    1 
ATOM   3269  N  N7    . A   D  4  44   ? 242.192 265.741 236.937 1.00 37.02  ? 44   A   5 N7    1 
ATOM   3270  C  C5    . A   D  4  44   ? 242.959 265.120 235.965 1.00 37.02  ? 44   A   5 C5    1 
ATOM   3271  C  C6    . A   D  4  44   ? 244.350 265.077 235.755 1.00 37.02  ? 44   A   5 C6    1 
ATOM   3272  N  N6    . A   D  4  44   ? 245.233 265.693 236.544 1.00 37.02  ? 44   A   5 N6    1 
ATOM   3273  N  N1    . A   D  4  44   ? 244.815 264.374 234.698 1.00 37.02  ? 44   A   5 N1    1 
ATOM   3274  C  C2    . A   D  4  44   ? 243.934 263.754 233.904 1.00 37.02  ? 44   A   5 C2    1 
ATOM   3275  N  N3    . A   D  4  44   ? 242.607 263.726 234.003 1.00 37.02  ? 44   A   5 N3    1 
ATOM   3276  C  C4    . A   D  4  44   ? 242.160 264.434 235.061 1.00 37.02  ? 44   A   5 C4    1 
ATOM   3277  P  P     . C   D  4  45   ? 239.319 266.284 230.522 1.00 37.02  ? 45   C   5 P     1 
ATOM   3278  O  OP1   . C   D  4  45   ? 238.336 267.312 230.104 1.00 37.02  ? 45   C   5 OP1   1 
ATOM   3279  O  OP2   . C   D  4  45   ? 239.956 265.408 229.506 1.00 37.02  ? 45   C   5 OP2   1 
ATOM   3280  O  "O5'" . C   D  4  45   ? 240.470 267.027 231.335 1.00 37.02  ? 45   C   5 "O5'" 1 
ATOM   3281  C  "C5'" . C   D  4  45   ? 241.821 266.998 230.901 1.00 37.02  ? 45   C   5 "C5'" 1 
ATOM   3282  C  "C4'" . C   D  4  45   ? 242.706 267.753 231.859 1.00 37.02  ? 45   C   5 "C4'" 1 
ATOM   3283  O  "O4'" . C   D  4  45   ? 243.508 266.828 232.637 1.00 37.02  ? 45   C   5 "O4'" 1 
ATOM   3284  C  "C3'" . C   D  4  45   ? 243.726 268.686 231.235 1.00 37.02  ? 45   C   5 "C3'" 1 
ATOM   3285  O  "O3'" . C   D  4  45   ? 243.157 269.915 230.823 1.00 37.02  ? 45   C   5 "O3'" 1 
ATOM   3286  C  "C2'" . C   D  4  45   ? 244.764 268.829 232.342 1.00 37.02  ? 45   C   5 "C2'" 1 
ATOM   3287  O  "O2'" . C   D  4  45   ? 244.330 269.766 233.317 1.00 37.02  ? 45   C   5 "O2'" 1 
ATOM   3288  C  "C1'" . C   D  4  45   ? 244.742 267.431 232.971 1.00 37.02  ? 45   C   5 "C1'" 1 
ATOM   3289  N  N1    . C   D  4  45   ? 245.854 266.568 232.500 1.00 37.02  ? 45   C   5 N1    1 
ATOM   3290  C  C2    . C   D  4  45   ? 247.100 266.670 233.134 1.00 37.02  ? 45   C   5 C2    1 
ATOM   3291  O  O2    . C   D  4  45   ? 247.247 267.475 234.065 1.00 37.02  ? 45   C   5 O2    1 
ATOM   3292  N  N3    . C   D  4  45   ? 248.122 265.887 232.719 1.00 37.02  ? 45   C   5 N3    1 
ATOM   3293  C  C4    . C   D  4  45   ? 247.944 265.025 231.717 1.00 37.02  ? 45   C   5 C4    1 
ATOM   3294  N  N4    . C   D  4  45   ? 248.983 264.276 231.344 1.00 37.02  ? 45   C   5 N4    1 
ATOM   3295  C  C5    . C   D  4  45   ? 246.691 264.895 231.053 1.00 37.02  ? 45   C   5 C5    1 
ATOM   3296  C  C6    . C   D  4  45   ? 245.687 265.674 231.475 1.00 37.02  ? 45   C   5 C6    1 
ATOM   3297  P  P     . U   D  4  46   ? 243.391 270.458 229.330 1.00 28.85  ? 46   U   5 P     1 
ATOM   3298  O  OP1   . U   D  4  46   ? 242.175 271.198 228.908 1.00 28.85  ? 46   U   5 OP1   1 
ATOM   3299  O  OP2   . U   D  4  46   ? 243.889 269.331 228.501 1.00 28.85  ? 46   U   5 OP2   1 
ATOM   3300  O  "O5'" . U   D  4  46   ? 244.576 271.506 229.495 1.00 28.85  ? 46   U   5 "O5'" 1 
ATOM   3301  C  "C5'" . U   D  4  46   ? 244.650 272.351 230.634 1.00 28.85  ? 46   U   5 "C5'" 1 
ATOM   3302  C  "C4'" . U   D  4  46   ? 246.071 272.773 230.896 1.00 28.85  ? 46   U   5 "C4'" 1 
ATOM   3303  O  "O4'" . U   D  4  46   ? 246.810 271.664 231.471 1.00 28.85  ? 46   U   5 "O4'" 1 
ATOM   3304  C  "C3'" . U   D  4  46   ? 246.868 273.149 229.657 1.00 28.85  ? 46   U   5 "C3'" 1 
ATOM   3305  O  "O3'" . U   D  4  46   ? 246.629 274.479 229.236 1.00 28.85  ? 46   U   5 "O3'" 1 
ATOM   3306  C  "C2'" . U   D  4  46   ? 248.306 272.885 230.083 1.00 28.85  ? 46   U   5 "C2'" 1 
ATOM   3307  O  "O2'" . U   D  4  46   ? 248.801 273.961 230.867 1.00 28.85  ? 46   U   5 "O2'" 1 
ATOM   3308  C  "C1'" . U   D  4  46   ? 248.138 271.664 230.992 1.00 28.85  ? 46   U   5 "C1'" 1 
ATOM   3309  N  N1    . U   D  4  46   ? 248.392 270.378 230.295 1.00 28.85  ? 46   U   5 N1    1 
ATOM   3310  C  C2    . U   D  4  46   ? 249.700 269.980 230.066 1.00 28.85  ? 46   U   5 C2    1 
ATOM   3311  O  O2    . U   D  4  46   ? 250.678 270.634 230.390 1.00 28.85  ? 46   U   5 O2    1 
ATOM   3312  N  N3    . U   D  4  46   ? 249.833 268.772 229.429 1.00 28.85  ? 46   U   5 N3    1 
ATOM   3313  C  C4    . U   D  4  46   ? 248.825 267.929 229.011 1.00 28.85  ? 46   U   5 C4    1 
ATOM   3314  O  O4    . U   D  4  46   ? 249.114 266.873 228.447 1.00 28.85  ? 46   U   5 O4    1 
ATOM   3315  C  C5    . U   D  4  46   ? 247.506 268.399 229.283 1.00 28.85  ? 46   U   5 C5    1 
ATOM   3316  C  C6    . U   D  4  46   ? 247.347 269.569 229.903 1.00 28.85  ? 46   U   5 C6    1 
ATOM   3317  P  P     . A   D  4  47   ? 245.948 274.762 227.810 1.00 35.55  ? 47   A   5 P     1 
ATOM   3318  O  OP1   . A   D  4  47   ? 244.682 275.502 228.043 1.00 35.55  ? 47   A   5 OP1   1 
ATOM   3319  O  OP2   . A   D  4  47   ? 245.924 273.487 227.049 1.00 35.55  ? 47   A   5 OP2   1 
ATOM   3320  O  "O5'" . A   D  4  47   ? 246.972 275.746 227.090 1.00 35.55  ? 47   A   5 "O5'" 1 
ATOM   3321  C  "C5'" . A   D  4  47   ? 248.304 275.886 227.573 1.00 35.55  ? 47   A   5 "C5'" 1 
ATOM   3322  C  "C4'" . A   D  4  47   ? 249.331 275.468 226.547 1.00 35.55  ? 47   A   5 "C4'" 1 
ATOM   3323  O  "O4'" . A   D  4  47   ? 249.759 274.098 226.798 1.00 35.55  ? 47   A   5 "O4'" 1 
ATOM   3324  C  "C3'" . A   D  4  47   ? 248.878 275.512 225.084 1.00 35.55  ? 47   A   5 "C3'" 1 
ATOM   3325  O  "O3'" . A   D  4  47   ? 249.974 275.938 224.276 1.00 35.55  ? 47   A   5 "O3'" 1 
ATOM   3326  C  "C2'" . A   D  4  47   ? 248.588 274.044 224.782 1.00 35.55  ? 47   A   5 "C2'" 1 
ATOM   3327  O  "O2'" . A   D  4  47   ? 248.652 273.696 223.416 1.00 35.55  ? 47   A   5 "O2'" 1 
ATOM   3328  C  "C1'" . A   D  4  47   ? 249.683 273.367 225.592 1.00 35.55  ? 47   A   5 "C1'" 1 
ATOM   3329  N  N9    . A   D  4  47   ? 249.479 271.942 225.868 1.00 35.55  ? 47   A   5 N9    1 
ATOM   3330  C  C8    . A   D  4  47   ? 248.350 271.253 226.236 1.00 35.55  ? 47   A   5 C8    1 
ATOM   3331  N  N7    . A   D  4  47   ? 248.552 269.962 226.377 1.00 35.55  ? 47   A   5 N7    1 
ATOM   3332  C  C5    . A   D  4  47   ? 249.898 269.792 226.074 1.00 35.55  ? 47   A   5 C5    1 
ATOM   3333  C  C6    . A   D  4  47   ? 250.752 268.670 226.031 1.00 35.55  ? 47   A   5 C6    1 
ATOM   3334  N  N6    . A   D  4  47   ? 250.370 267.422 226.304 1.00 35.55  ? 47   A   5 N6    1 
ATOM   3335  N  N1    . A   D  4  47   ? 252.045 268.868 225.686 1.00 35.55  ? 47   A   5 N1    1 
ATOM   3336  C  C2    . A   D  4  47   ? 252.460 270.109 225.404 1.00 35.55  ? 47   A   5 C2    1 
ATOM   3337  N  N3    . A   D  4  47   ? 251.755 271.236 225.409 1.00 35.55  ? 47   A   5 N3    1 
ATOM   3338  C  C4    . A   D  4  47   ? 250.475 271.006 225.756 1.00 35.55  ? 47   A   5 C4    1 
ATOM   3339  P  P     . A   D  4  48   ? 249.811 277.175 223.265 1.00 35.24  ? 48   A   5 P     1 
ATOM   3340  O  OP1   . A   D  4  48   ? 250.471 278.357 223.876 1.00 35.24  ? 48   A   5 OP1   1 
ATOM   3341  O  OP2   . A   D  4  48   ? 248.386 277.252 222.858 1.00 35.24  ? 48   A   5 OP2   1 
ATOM   3342  O  "O5'" . A   D  4  48   ? 250.668 276.745 221.992 1.00 35.24  ? 48   A   5 "O5'" 1 
ATOM   3343  C  "C5'" . A   D  4  48   ? 250.383 275.545 221.288 1.00 35.24  ? 48   A   5 "C5'" 1 
ATOM   3344  C  "C4'" . A   D  4  48   ? 251.645 274.889 220.786 1.00 35.24  ? 48   A   5 "C4'" 1 
ATOM   3345  O  "O4'" . A   D  4  48   ? 252.218 274.056 221.829 1.00 35.24  ? 48   A   5 "O4'" 1 
ATOM   3346  C  "C3'" . A   D  4  48   ? 251.484 273.936 219.614 1.00 35.24  ? 48   A   5 "C3'" 1 
ATOM   3347  O  "O3'" . A   D  4  48   ? 251.361 274.589 218.365 1.00 35.24  ? 48   A   5 "O3'" 1 
ATOM   3348  C  "C2'" . A   D  4  48   ? 252.724 273.065 219.736 1.00 35.24  ? 48   A   5 "C2'" 1 
ATOM   3349  O  "O2'" . A   D  4  48   ? 253.874 273.761 219.276 1.00 35.24  ? 48   A   5 "O2'" 1 
ATOM   3350  C  "C1'" . A   D  4  48   ? 252.825 272.916 221.252 1.00 35.24  ? 48   A   5 "C1'" 1 
ATOM   3351  N  N9    . A   D  4  48   ? 252.111 271.712 221.714 1.00 35.24  ? 48   A   5 N9    1 
ATOM   3352  C  C8    . A   D  4  48   ? 250.864 271.627 222.282 1.00 35.24  ? 48   A   5 C8    1 
ATOM   3353  N  N7    . A   D  4  48   ? 250.500 270.402 222.574 1.00 35.24  ? 48   A   5 N7    1 
ATOM   3354  C  C5    . A   D  4  48   ? 251.577 269.629 222.162 1.00 35.24  ? 48   A   5 C5    1 
ATOM   3355  C  C6    . A   D  4  48   ? 251.826 268.246 222.197 1.00 35.24  ? 48   A   5 C6    1 
ATOM   3356  N  N6    . A   D  4  48   ? 250.960 267.353 222.683 1.00 35.24  ? 48   A   5 N6    1 
ATOM   3357  N  N1    . A   D  4  48   ? 253.007 267.802 221.708 1.00 35.24  ? 48   A   5 N1    1 
ATOM   3358  C  C2    . A   D  4  48   ? 253.882 268.691 221.218 1.00 35.24  ? 48   A   5 C2    1 
ATOM   3359  N  N3    . A   D  4  48   ? 253.760 270.015 221.135 1.00 35.24  ? 48   A   5 N3    1 
ATOM   3360  C  C4    . A   D  4  48   ? 252.576 270.423 221.630 1.00 35.24  ? 48   A   5 C4    1 
ATOM   3361  P  P     . A   D  4  49   ? 250.488 273.915 217.196 1.00 29.32  ? 49   A   5 P     1 
ATOM   3362  O  OP1   . A   D  4  49   ? 250.212 274.952 216.174 1.00 29.32  ? 49   A   5 OP1   1 
ATOM   3363  O  OP2   . A   D  4  49   ? 249.359 273.185 217.826 1.00 29.32  ? 49   A   5 OP2   1 
ATOM   3364  O  "O5'" . A   D  4  49   ? 251.473 272.842 216.553 1.00 29.32  ? 49   A   5 "O5'" 1 
ATOM   3365  C  "C5'" . A   D  4  49   ? 252.713 273.242 215.989 1.00 29.32  ? 49   A   5 "C5'" 1 
ATOM   3366  C  "C4'" . A   D  4  49   ? 253.620 272.062 215.754 1.00 29.32  ? 49   A   5 "C4'" 1 
ATOM   3367  O  "O4'" . A   D  4  49   ? 253.919 271.409 217.016 1.00 29.32  ? 49   A   5 "O4'" 1 
ATOM   3368  C  "C3'" . A   D  4  49   ? 253.052 270.947 214.892 1.00 29.32  ? 49   A   5 "C3'" 1 
ATOM   3369  O  "O3'" . A   D  4  49   ? 253.125 271.224 213.505 1.00 29.32  ? 49   A   5 "O3'" 1 
ATOM   3370  C  "C2'" . A   D  4  49   ? 253.880 269.745 215.323 1.00 29.32  ? 49   A   5 "C2'" 1 
ATOM   3371  O  "O2'" . A   D  4  49   ? 255.168 269.783 214.726 1.00 29.32  ? 49   A   5 "O2'" 1 
ATOM   3372  C  "C1'" . A   D  4  49   ? 254.035 270.014 216.820 1.00 29.32  ? 49   A   5 "C1'" 1 
ATOM   3373  N  N9    . A   D  4  49   ? 252.986 269.340 217.608 1.00 29.32  ? 49   A   5 N9    1 
ATOM   3374  C  C8    . A   D  4  49   ? 251.883 269.903 218.200 1.00 29.32  ? 49   A   5 C8    1 
ATOM   3375  N  N7    . A   D  4  49   ? 251.125 269.043 218.837 1.00 29.32  ? 49   A   5 N7    1 
ATOM   3376  C  C5    . A   D  4  49   ? 251.771 267.831 218.649 1.00 29.32  ? 49   A   5 C5    1 
ATOM   3377  C  C6    . A   D  4  49   ? 251.483 266.520 219.072 1.00 29.32  ? 49   A   5 C6    1 
ATOM   3378  N  N6    . A   D  4  49   ? 250.415 266.199 219.805 1.00 29.32  ? 49   A   5 N6    1 
ATOM   3379  N  N1    . A   D  4  49   ? 252.338 265.535 218.712 1.00 29.32  ? 49   A   5 N1    1 
ATOM   3380  C  C2    . A   D  4  49   ? 253.413 265.846 217.975 1.00 29.32  ? 49   A   5 C2    1 
ATOM   3381  N  N3    . A   D  4  49   ? 253.789 267.040 217.520 1.00 29.32  ? 49   A   5 N3    1 
ATOM   3382  C  C4    . A   D  4  49   ? 252.920 267.997 217.894 1.00 29.32  ? 49   A   5 C4    1 
ATOM   3383  P  P     . G   D  4  50   ? 251.939 270.754 212.528 1.00 32.71  ? 50   G   5 P     1 
ATOM   3384  O  OP1   . G   D  4  50   ? 252.092 271.472 211.237 1.00 32.71  ? 50   G   5 OP1   1 
ATOM   3385  O  OP2   . G   D  4  50   ? 250.660 270.853 213.276 1.00 32.71  ? 50   G   5 OP2   1 
ATOM   3386  O  "O5'" . G   D  4  50   ? 252.242 269.211 212.274 1.00 32.71  ? 50   G   5 "O5'" 1 
ATOM   3387  C  "C5'" . G   D  4  50   ? 253.468 268.798 211.690 1.00 32.71  ? 50   G   5 "C5'" 1 
ATOM   3388  C  "C4'" . G   D  4  50   ? 253.702 267.320 211.877 1.00 32.71  ? 50   G   5 "C4'" 1 
ATOM   3389  O  "O4'" . G   D  4  50   ? 253.822 267.013 213.290 1.00 32.71  ? 50   G   5 "O4'" 1 
ATOM   3390  C  "C3'" . G   D  4  50   ? 252.590 266.402 211.396 1.00 32.71  ? 50   G   5 "C3'" 1 
ATOM   3391  O  "O3'" . G   D  4  50   ? 252.624 266.179 209.997 1.00 32.71  ? 50   G   5 "O3'" 1 
ATOM   3392  C  "C2'" . G   D  4  50   ? 252.820 265.144 212.220 1.00 32.71  ? 50   G   5 "C2'" 1 
ATOM   3393  O  "O2'" . G   D  4  50   ? 253.886 264.377 211.679 1.00 32.71  ? 50   G   5 "O2'" 1 
ATOM   3394  C  "C1'" . G   D  4  50   ? 253.279 265.735 213.553 1.00 32.71  ? 50   G   5 "C1'" 1 
ATOM   3395  N  N9    . G   D  4  50   ? 252.165 265.882 214.508 1.00 32.71  ? 50   G   5 N9    1 
ATOM   3396  C  C8    . G   D  4  50   ? 251.567 267.051 214.909 1.00 32.71  ? 50   G   5 C8    1 
ATOM   3397  N  N7    . G   D  4  50   ? 250.605 266.868 215.771 1.00 32.71  ? 50   G   5 N7    1 
ATOM   3398  C  C5    . G   D  4  50   ? 250.566 265.493 215.951 1.00 32.71  ? 50   G   5 C5    1 
ATOM   3399  C  C6    . G   D  4  50   ? 249.726 264.700 216.774 1.00 32.71  ? 50   G   5 C6    1 
ATOM   3400  O  O6    . G   D  4  50   ? 248.818 265.068 217.528 1.00 32.71  ? 50   G   5 O6    1 
ATOM   3401  N  N1    . G   D  4  50   ? 250.022 263.346 216.656 1.00 32.71  ? 50   G   5 N1    1 
ATOM   3402  C  C2    . G   D  4  50   ? 251.003 262.820 215.852 1.00 32.71  ? 50   G   5 C2    1 
ATOM   3403  N  N2    . G   D  4  50   ? 251.138 261.487 215.875 1.00 32.71  ? 50   G   5 N2    1 
ATOM   3404  N  N3    . G   D  4  50   ? 251.794 263.549 215.083 1.00 32.71  ? 50   G   5 N3    1 
ATOM   3405  C  C4    . G   D  4  50   ? 251.523 264.868 215.180 1.00 32.71  ? 50   G   5 C4    1 
ATOM   3406  P  P     . A   D  4  51   ? 251.256 266.140 209.155 1.00 31.04  ? 51   A   5 P     1 
ATOM   3407  O  OP1   . A   D  4  51   ? 251.600 265.963 207.721 1.00 31.04  ? 51   A   5 OP1   1 
ATOM   3408  O  OP2   . A   D  4  51   ? 250.427 267.299 209.574 1.00 31.04  ? 51   A   5 OP2   1 
ATOM   3409  O  "O5'" . A   D  4  51   ? 250.533 264.813 209.658 1.00 31.04  ? 51   A   5 "O5'" 1 
ATOM   3410  C  "C5'" . A   D  4  51   ? 251.068 263.526 209.362 1.00 31.04  ? 51   A   5 "C5'" 1 
ATOM   3411  C  "C4'" . A   D  4  51   ? 250.114 262.408 209.718 1.00 31.04  ? 51   A   5 "C4'" 1 
ATOM   3412  O  "O4'" . A   D  4  51   ? 249.833 262.434 211.148 1.00 31.04  ? 51   A   5 "O4'" 1 
ATOM   3413  C  "C3'" . A   D  4  51   ? 248.754 262.443 209.015 1.00 31.04  ? 51   A   5 "C3'" 1 
ATOM   3414  O  "O3'" . A   D  4  51   ? 248.332 261.109 208.722 1.00 31.04  ? 51   A   5 "O3'" 1 
ATOM   3415  C  "C2'" . A   D  4  51   ? 247.841 263.036 210.084 1.00 31.04  ? 51   A   5 "C2'" 1 
ATOM   3416  O  "O2'" . A   D  4  51   ? 246.476 262.713 209.940 1.00 31.04  ? 51   A   5 "O2'" 1 
ATOM   3417  C  "C1'" . A   D  4  51   ? 248.434 262.435 211.350 1.00 31.04  ? 51   A   5 "C1'" 1 
ATOM   3418  N  N9    . A   D  4  51   ? 248.113 263.181 212.569 1.00 31.04  ? 51   A   5 N9    1 
ATOM   3419  C  C8    . A   D  4  51   ? 248.346 264.503 212.857 1.00 31.04  ? 51   A   5 C8    1 
ATOM   3420  N  N7    . A   D  4  51   ? 247.917 264.865 214.043 1.00 31.04  ? 51   A   5 N7    1 
ATOM   3421  C  C5    . A   D  4  51   ? 247.358 263.706 214.565 1.00 31.04  ? 51   A   5 C5    1 
ATOM   3422  C  C6    . A   D  4  51   ? 246.728 263.411 215.789 1.00 31.04  ? 51   A   5 C6    1 
ATOM   3423  N  N6    . A   D  4  51   ? 246.541 264.304 216.763 1.00 31.04  ? 51   A   5 N6    1 
ATOM   3424  N  N1    . A   D  4  51   ? 246.286 262.148 215.985 1.00 31.04  ? 51   A   5 N1    1 
ATOM   3425  C  C2    . A   D  4  51   ? 246.466 261.238 215.019 1.00 31.04  ? 51   A   5 C2    1 
ATOM   3426  N  N3    . A   D  4  51   ? 247.041 261.397 213.829 1.00 31.04  ? 51   A   5 N3    1 
ATOM   3427  C  C4    . A   D  4  51   ? 247.470 262.662 213.665 1.00 31.04  ? 51   A   5 C4    1 
ATOM   3428  P  P     . U   D  4  52   ? 247.370 260.817 207.465 1.00 26.26  ? 52   U   5 P     1 
ATOM   3429  O  OP1   . U   D  4  52   ? 247.170 259.348 207.371 1.00 26.26  ? 52   U   5 OP1   1 
ATOM   3430  O  OP2   . U   D  4  52   ? 247.912 261.553 206.295 1.00 26.26  ? 52   U   5 OP2   1 
ATOM   3431  O  "O5'" . U   D  4  52   ? 245.988 261.500 207.875 1.00 26.26  ? 52   U   5 "O5'" 1 
ATOM   3432  C  "C5'" . U   D  4  52   ? 244.758 260.794 207.814 1.00 26.26  ? 52   U   5 "C5'" 1 
ATOM   3433  C  "C4'" . U   D  4  52   ? 244.433 260.116 209.123 1.00 26.26  ? 52   U   5 "C4'" 1 
ATOM   3434  O  "O4'" . U   D  4  52   ? 244.947 260.885 210.239 1.00 26.26  ? 52   U   5 "O4'" 1 
ATOM   3435  C  "C3'" . U   D  4  52   ? 242.959 259.951 209.448 1.00 26.26  ? 52   U   5 "C3'" 1 
ATOM   3436  O  "O3'" . U   D  4  52   ? 242.356 258.880 208.746 1.00 26.26  ? 52   U   5 "O3'" 1 
ATOM   3437  C  "C2'" . U   D  4  52   ? 242.974 259.762 210.961 1.00 26.26  ? 52   U   5 "C2'" 1 
ATOM   3438  O  "O2'" . U   D  4  52   ? 243.316 258.425 211.295 1.00 26.26  ? 52   U   5 "O2'" 1 
ATOM   3439  C  "C1'" . U   D  4  52   ? 244.132 260.676 211.376 1.00 26.26  ? 52   U   5 "C1'" 1 
ATOM   3440  N  N1    . U   D  4  52   ? 243.673 261.982 211.909 1.00 26.26  ? 52   U   5 N1    1 
ATOM   3441  C  C2    . U   D  4  52   ? 243.352 262.036 213.254 1.00 26.26  ? 52   U   5 C2    1 
ATOM   3442  O  O2    . U   D  4  52   ? 243.426 261.071 213.995 1.00 26.26  ? 52   U   5 O2    1 
ATOM   3443  N  N3    . U   D  4  52   ? 242.937 263.263 213.708 1.00 26.26  ? 52   U   5 N3    1 
ATOM   3444  C  C4    . U   D  4  52   ? 242.813 264.423 212.974 1.00 26.26  ? 52   U   5 C4    1 
ATOM   3445  O  O4    . U   D  4  52   ? 242.423 265.452 213.528 1.00 26.26  ? 52   U   5 O4    1 
ATOM   3446  C  C5    . U   D  4  52   ? 243.162 264.291 211.594 1.00 26.26  ? 52   U   5 C5    1 
ATOM   3447  C  C6    . U   D  4  52   ? 243.568 263.107 211.123 1.00 26.26  ? 52   U   5 C6    1 
ATOM   3448  P  P     . U   D  4  53   ? 241.415 259.173 207.477 1.00 27.70  ? 53   U   5 P     1 
ATOM   3449  O  OP1   . U   D  4  53   ? 241.746 258.182 206.422 1.00 27.70  ? 53   U   5 OP1   1 
ATOM   3450  O  OP2   . U   D  4  53   ? 241.488 260.624 207.171 1.00 27.70  ? 53   U   5 OP2   1 
ATOM   3451  O  "O5'" . U   D  4  53   ? 239.947 258.866 208.008 1.00 27.70  ? 53   U   5 "O5'" 1 
ATOM   3452  C  "C5'" . U   D  4  53   ? 239.192 259.857 208.688 1.00 27.70  ? 53   U   5 "C5'" 1 
ATOM   3453  C  "C4'" . U   D  4  53   ? 238.745 259.371 210.042 1.00 27.70  ? 53   U   5 "C4'" 1 
ATOM   3454  O  "O4'" . U   D  4  53   ? 239.639 259.886 211.064 1.00 27.70  ? 53   U   5 "O4'" 1 
ATOM   3455  C  "C3'" . U   D  4  53   ? 237.369 259.832 210.494 1.00 27.70  ? 53   U   5 "C3'" 1 
ATOM   3456  O  "O3'" . U   D  4  53   ? 236.316 259.066 209.936 1.00 27.70  ? 53   U   5 "O3'" 1 
ATOM   3457  C  "C2'" . U   D  4  53   ? 237.466 259.728 212.009 1.00 27.70  ? 53   U   5 "C2'" 1 
ATOM   3458  O  "O2'" . U   D  4  53   ? 237.306 258.381 212.431 1.00 27.70  ? 53   U   5 "O2'" 1 
ATOM   3459  C  "C1'" . U   D  4  53   ? 238.919 260.140 212.252 1.00 27.70  ? 53   U   5 "C1'" 1 
ATOM   3460  N  N1    . U   D  4  53   ? 239.057 261.576 212.602 1.00 27.70  ? 53   U   5 N1    1 
ATOM   3461  C  C2    . U   D  4  53   ? 238.781 261.965 213.904 1.00 27.70  ? 53   U   5 C2    1 
ATOM   3462  O  O2    . U   D  4  53   ? 238.422 261.193 214.778 1.00 27.70  ? 53   U   5 O2    1 
ATOM   3463  N  N3    . U   D  4  53   ? 238.935 263.306 214.156 1.00 27.70  ? 53   U   5 N3    1 
ATOM   3464  C  C4    . U   D  4  53   ? 239.333 264.284 213.268 1.00 27.70  ? 53   U   5 C4    1 
ATOM   3465  O  O4    . U   D  4  53   ? 239.423 265.452 213.649 1.00 27.70  ? 53   U   5 O4    1 
ATOM   3466  C  C5    . U   D  4  53   ? 239.602 263.809 211.947 1.00 27.70  ? 53   U   5 C5    1 
ATOM   3467  C  C6    . U   D  4  53   ? 239.465 262.510 211.673 1.00 27.70  ? 53   U   5 C6    1 
ATOM   3468  P  P     . U   D  4  54   ? 234.941 259.779 209.509 1.00 37.02  ? 54   U   5 P     1 
ATOM   3469  O  OP1   . U   D  4  54   ? 234.110 258.778 208.794 1.00 37.02  ? 54   U   5 OP1   1 
ATOM   3470  O  OP2   . U   D  4  54   ? 235.275 261.066 208.848 1.00 37.02  ? 54   U   5 OP2   1 
ATOM   3471  O  "O5'" . U   D  4  54   ? 234.230 260.105 210.897 1.00 37.02  ? 54   U   5 "O5'" 1 
ATOM   3472  C  "C5'" . U   D  4  54   ? 233.801 259.059 211.756 1.00 37.02  ? 54   U   5 "C5'" 1 
ATOM   3473  C  "C4'" . U   D  4  54   ? 233.469 259.572 213.134 1.00 37.02  ? 54   U   5 "C4'" 1 
ATOM   3474  O  "O4'" . U   D  4  54   ? 234.647 260.175 213.739 1.00 37.02  ? 54   U   5 "O4'" 1 
ATOM   3475  C  "C3'" . U   D  4  54   ? 232.429 260.677 213.206 1.00 37.02  ? 54   U   5 "C3'" 1 
ATOM   3476  O  "O3'" . U   D  4  54   ? 231.094 260.227 213.062 1.00 37.02  ? 54   U   5 "O3'" 1 
ATOM   3477  C  "C2'" . U   D  4  54   ? 232.729 261.310 214.555 1.00 37.02  ? 54   U   5 "C2'" 1 
ATOM   3478  O  "O2'" . U   D  4  54   ? 232.233 260.501 215.611 1.00 37.02  ? 54   U   5 "O2'" 1 
ATOM   3479  C  "C1'" . U   D  4  54   ? 234.258 261.247 214.576 1.00 37.02  ? 54   U   5 "C1'" 1 
ATOM   3480  N  N1    . U   D  4  54   ? 234.876 262.507 214.085 1.00 37.02  ? 54   U   5 N1    1 
ATOM   3481  C  C2    . U   D  4  54   ? 234.926 263.594 214.947 1.00 37.02  ? 54   U   5 C2    1 
ATOM   3482  O  O2    . U   D  4  54   ? 234.499 263.580 216.090 1.00 37.02  ? 54   U   5 O2    1 
ATOM   3483  N  N3    . U   D  4  54   ? 235.506 264.726 214.428 1.00 37.02  ? 54   U   5 N3    1 
ATOM   3484  C  C4    . U   D  4  54   ? 236.033 264.896 213.166 1.00 37.02  ? 54   U   5 C4    1 
ATOM   3485  O  O4    . U   D  4  54   ? 236.523 265.982 212.853 1.00 37.02  ? 54   U   5 O4    1 
ATOM   3486  C  C5    . U   D  4  54   ? 235.949 263.739 212.333 1.00 37.02  ? 54   U   5 C5    1 
ATOM   3487  C  C6    . U   D  4  54   ? 235.393 262.622 212.810 1.00 37.02  ? 54   U   5 C6    1 
ATOM   3488  P  P     . C   D  4  55   ? 230.164 260.871 211.920 1.00 25.25  ? 55   C   5 P     1 
ATOM   3489  O  OP1   . C   D  4  55   ? 229.183 259.859 211.467 1.00 25.25  ? 55   C   5 OP1   1 
ATOM   3490  O  OP2   . C   D  4  55   ? 231.068 261.492 210.919 1.00 25.25  ? 55   C   5 OP2   1 
ATOM   3491  O  "O5'" . C   D  4  55   ? 229.388 262.057 212.651 1.00 25.25  ? 55   C   5 "O5'" 1 
ATOM   3492  C  "C5'" . C   D  4  55   ? 229.013 261.976 214.020 1.00 25.25  ? 55   C   5 "C5'" 1 
ATOM   3493  C  "C4'" . C   D  4  55   ? 229.128 263.324 214.686 1.00 25.25  ? 55   C   5 "C4'" 1 
ATOM   3494  O  "O4'" . C   D  4  55   ? 230.526 263.704 214.734 1.00 25.25  ? 55   C   5 "O4'" 1 
ATOM   3495  C  "C3'" . C   D  4  55   ? 228.446 264.477 213.960 1.00 25.25  ? 55   C   5 "C3'" 1 
ATOM   3496  O  "O3'" . C   D  4  55   ? 227.068 264.584 214.274 1.00 25.25  ? 55   C   5 "O3'" 1 
ATOM   3497  C  "C2'" . C   D  4  55   ? 229.269 265.691 214.382 1.00 25.25  ? 55   C   5 "C2'" 1 
ATOM   3498  O  "O2'" . C   D  4  55   ? 228.852 266.162 215.655 1.00 25.25  ? 55   C   5 "O2'" 1 
ATOM   3499  C  "C1'" . C   D  4  55   ? 230.669 265.089 214.524 1.00 25.25  ? 55   C   5 "C1'" 1 
ATOM   3500  N  N1    . C   D  4  55   ? 231.532 265.312 213.334 1.00 25.25  ? 55   C   5 N1    1 
ATOM   3501  C  C2    . C   D  4  55   ? 232.357 266.438 213.332 1.00 25.25  ? 55   C   5 C2    1 
ATOM   3502  O  O2    . C   D  4  55   ? 232.324 267.193 214.311 1.00 25.25  ? 55   C   5 O2    1 
ATOM   3503  N  N3    . C   D  4  55   ? 233.166 266.679 212.274 1.00 25.25  ? 55   C   5 N3    1 
ATOM   3504  C  C4    . C   D  4  55   ? 233.179 265.842 211.236 1.00 25.25  ? 55   C   5 C4    1 
ATOM   3505  N  N4    . C   D  4  55   ? 233.991 266.119 210.213 1.00 25.25  ? 55   C   5 N4    1 
ATOM   3506  C  C5    . C   D  4  55   ? 232.357 264.681 211.202 1.00 25.25  ? 55   C   5 C5    1 
ATOM   3507  C  C6    . C   D  4  55   ? 231.568 264.458 212.260 1.00 25.25  ? 55   C   5 C6    1 
ATOM   3508  P  P     . C   D  4  56   ? 226.018 265.072 213.160 1.00 30.91  ? 56   C   5 P     1 
ATOM   3509  O  OP1   . C   D  4  56   ? 224.667 264.610 213.567 1.00 30.91  ? 56   C   5 OP1   1 
ATOM   3510  O  OP2   . C   D  4  56   ? 226.548 264.693 211.826 1.00 30.91  ? 56   C   5 OP2   1 
ATOM   3511  O  "O5'" . C   D  4  56   ? 226.054 266.660 213.266 1.00 30.91  ? 56   C   5 "O5'" 1 
ATOM   3512  C  "C5'" . C   D  4  56   ? 225.492 267.332 214.383 1.00 30.91  ? 56   C   5 "C5'" 1 
ATOM   3513  C  "C4'" . C   D  4  5