data_6FLD
# 
_entry.id   6FLD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6FLD         
WWPDB D_1200008535 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6FLD 
_pdbx_database_status.recvd_initial_deposition_date   2018-01-25 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'De la Mora, E.' 1 ? 
'Santoni, G.'    2 ? 
'de Souza, J.'   3 ? 
'Sussman, J.'    4 ? 
'Silman, I.'     5 ? 
'Baati, R.'      6 ? 
'Weik, M.'       7 ? 
'Nachon, F.'     8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Med. Chem.' 
_citation.journal_id_ASTM           JMCMAR 
_citation.journal_id_CSD            0151 
_citation.journal_id_ISSN           1520-4804 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            61 
_citation.language                  ? 
_citation.page_first                7630 
_citation.page_last                 7639 
_citation.title                     
'Structure-Based Optimization of Nonquaternary Reactivators of Acetylcholinesterase Inhibited by Organophosphorus Nerve Agents.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.jmedchem.8b00592 
_citation.pdbx_database_id_PubMed   30125110 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Santoni, G.'    1  0000-0001-6215-998X 
primary 'de Sousa, J.'   2  ?                   
primary 'de la Mora, E.' 3  ?                   
primary 'Dias, J.'       4  ?                   
primary 'Jean, L.'       5  0000-0002-1745-4952 
primary 'Sussman, J.L.'  6  ?                   
primary 'Silman, I.'     7  ?                   
primary 'Renard, P.Y.'   8  ?                   
primary 'Brown, R.C.D.'  9  ?                   
primary 'Weik, M.'       10 ?                   
primary 'Baati, R.'      11 ?                   
primary 'Nachon, F.'     12 0000-0003-0293-2429 
# 
_cell.entry_id           6FLD 
_cell.length_a           114.010 
_cell.length_b           114.010 
_cell.length_c           136.980 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         6FLD 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                                                                         60279.078 1   
3.1.1.7 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                     221.208   3   ? ? ? 
? 
3 non-polymer syn '2-[(~{E})-hydroxyiminomethyl]-6-[4-(1,2,3,4-tetrahydroacridin-9-ylamino)butyl]pyridin-3-ol' 390.478   1   ? ? ? 
? 
4 non-polymer syn '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL'                              252.305   1   ? ? ? 
? 
5 non-polymer syn 'CHLORIDE ION'                                                                               35.453    5   ? ? ? 
? 
6 non-polymer syn 1,2-ETHANEDIOL                                                                               62.068    3   ? ? ? 
? 
7 water       nat water                                                                                        18.015    212 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEM
WNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQE
APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGE(BXT)AGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVA
EGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQI
LLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHN
VICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKT
GNPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEM
WNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQE
APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRR
RAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGV
NKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICP
LMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPN
EPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNAT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLU n 
1 3   LEU n 
1 4   LEU n 
1 5   VAL n 
1 6   ASN n 
1 7   THR n 
1 8   LYS n 
1 9   SER n 
1 10  GLY n 
1 11  LYS n 
1 12  VAL n 
1 13  MET n 
1 14  GLY n 
1 15  THR n 
1 16  ARG n 
1 17  VAL n 
1 18  PRO n 
1 19  VAL n 
1 20  LEU n 
1 21  SER n 
1 22  SER n 
1 23  HIS n 
1 24  ILE n 
1 25  SER n 
1 26  ALA n 
1 27  PHE n 
1 28  LEU n 
1 29  GLY n 
1 30  ILE n 
1 31  PRO n 
1 32  PHE n 
1 33  ALA n 
1 34  GLU n 
1 35  PRO n 
1 36  PRO n 
1 37  VAL n 
1 38  GLY n 
1 39  ASN n 
1 40  MET n 
1 41  ARG n 
1 42  PHE n 
1 43  ARG n 
1 44  ARG n 
1 45  PRO n 
1 46  GLU n 
1 47  PRO n 
1 48  LYS n 
1 49  LYS n 
1 50  PRO n 
1 51  TRP n 
1 52  SER n 
1 53  GLY n 
1 54  VAL n 
1 55  TRP n 
1 56  ASN n 
1 57  ALA n 
1 58  SER n 
1 59  THR n 
1 60  TYR n 
1 61  PRO n 
1 62  ASN n 
1 63  ASN n 
1 64  CYS n 
1 65  GLN n 
1 66  GLN n 
1 67  TYR n 
1 68  VAL n 
1 69  ASP n 
1 70  GLU n 
1 71  GLN n 
1 72  PHE n 
1 73  PRO n 
1 74  GLY n 
1 75  PHE n 
1 76  SER n 
1 77  GLY n 
1 78  SER n 
1 79  GLU n 
1 80  MET n 
1 81  TRP n 
1 82  ASN n 
1 83  PRO n 
1 84  ASN n 
1 85  ARG n 
1 86  GLU n 
1 87  MET n 
1 88  SER n 
1 89  GLU n 
1 90  ASP n 
1 91  CYS n 
1 92  LEU n 
1 93  TYR n 
1 94  LEU n 
1 95  ASN n 
1 96  ILE n 
1 97  TRP n 
1 98  VAL n 
1 99  PRO n 
1 100 SER n 
1 101 PRO n 
1 102 ARG n 
1 103 PRO n 
1 104 LYS n 
1 105 SER n 
1 106 THR n 
1 107 THR n 
1 108 VAL n 
1 109 MET n 
1 110 VAL n 
1 111 TRP n 
1 112 ILE n 
1 113 TYR n 
1 114 GLY n 
1 115 GLY n 
1 116 GLY n 
1 117 PHE n 
1 118 TYR n 
1 119 SER n 
1 120 GLY n 
1 121 SER n 
1 122 SER n 
1 123 THR n 
1 124 LEU n 
1 125 ASP n 
1 126 VAL n 
1 127 TYR n 
1 128 ASN n 
1 129 GLY n 
1 130 LYS n 
1 131 TYR n 
1 132 LEU n 
1 133 ALA n 
1 134 TYR n 
1 135 THR n 
1 136 GLU n 
1 137 GLU n 
1 138 VAL n 
1 139 VAL n 
1 140 LEU n 
1 141 VAL n 
1 142 SER n 
1 143 LEU n 
1 144 SER n 
1 145 TYR n 
1 146 ARG n 
1 147 VAL n 
1 148 GLY n 
1 149 ALA n 
1 150 PHE n 
1 151 GLY n 
1 152 PHE n 
1 153 LEU n 
1 154 ALA n 
1 155 LEU n 
1 156 HIS n 
1 157 GLY n 
1 158 SER n 
1 159 GLN n 
1 160 GLU n 
1 161 ALA n 
1 162 PRO n 
1 163 GLY n 
1 164 ASN n 
1 165 VAL n 
1 166 GLY n 
1 167 LEU n 
1 168 LEU n 
1 169 ASP n 
1 170 GLN n 
1 171 ARG n 
1 172 MET n 
1 173 ALA n 
1 174 LEU n 
1 175 GLN n 
1 176 TRP n 
1 177 VAL n 
1 178 HIS n 
1 179 ASP n 
1 180 ASN n 
1 181 ILE n 
1 182 GLN n 
1 183 PHE n 
1 184 PHE n 
1 185 GLY n 
1 186 GLY n 
1 187 ASP n 
1 188 PRO n 
1 189 LYS n 
1 190 THR n 
1 191 VAL n 
1 192 THR n 
1 193 ILE n 
1 194 PHE n 
1 195 GLY n 
1 196 GLU n 
1 197 BXT n 
1 198 ALA n 
1 199 GLY n 
1 200 GLY n 
1 201 ALA n 
1 202 SER n 
1 203 VAL n 
1 204 GLY n 
1 205 MET n 
1 206 HIS n 
1 207 ILE n 
1 208 LEU n 
1 209 SER n 
1 210 PRO n 
1 211 GLY n 
1 212 SER n 
1 213 ARG n 
1 214 ASP n 
1 215 LEU n 
1 216 PHE n 
1 217 ARG n 
1 218 ARG n 
1 219 ALA n 
1 220 ILE n 
1 221 LEU n 
1 222 GLN n 
1 223 SER n 
1 224 GLY n 
1 225 SER n 
1 226 PRO n 
1 227 ASN n 
1 228 CYS n 
1 229 PRO n 
1 230 TRP n 
1 231 ALA n 
1 232 SER n 
1 233 VAL n 
1 234 SER n 
1 235 VAL n 
1 236 ALA n 
1 237 GLU n 
1 238 GLY n 
1 239 ARG n 
1 240 ARG n 
1 241 ARG n 
1 242 ALA n 
1 243 VAL n 
1 244 GLU n 
1 245 LEU n 
1 246 GLY n 
1 247 ARG n 
1 248 ASN n 
1 249 LEU n 
1 250 ASN n 
1 251 CYS n 
1 252 ASN n 
1 253 LEU n 
1 254 ASN n 
1 255 SER n 
1 256 ASP n 
1 257 GLU n 
1 258 GLU n 
1 259 LEU n 
1 260 ILE n 
1 261 HIS n 
1 262 CYS n 
1 263 LEU n 
1 264 ARG n 
1 265 GLU n 
1 266 LYS n 
1 267 LYS n 
1 268 PRO n 
1 269 GLN n 
1 270 GLU n 
1 271 LEU n 
1 272 ILE n 
1 273 ASP n 
1 274 VAL n 
1 275 GLU n 
1 276 TRP n 
1 277 ASN n 
1 278 VAL n 
1 279 LEU n 
1 280 PRO n 
1 281 PHE n 
1 282 ASP n 
1 283 SER n 
1 284 ILE n 
1 285 PHE n 
1 286 ARG n 
1 287 PHE n 
1 288 SER n 
1 289 PHE n 
1 290 VAL n 
1 291 PRO n 
1 292 VAL n 
1 293 ILE n 
1 294 ASP n 
1 295 GLY n 
1 296 GLU n 
1 297 PHE n 
1 298 PHE n 
1 299 PRO n 
1 300 THR n 
1 301 SER n 
1 302 LEU n 
1 303 GLU n 
1 304 SER n 
1 305 MET n 
1 306 LEU n 
1 307 ASN n 
1 308 SER n 
1 309 GLY n 
1 310 ASN n 
1 311 PHE n 
1 312 LYS n 
1 313 LYS n 
1 314 THR n 
1 315 GLN n 
1 316 ILE n 
1 317 LEU n 
1 318 LEU n 
1 319 GLY n 
1 320 VAL n 
1 321 ASN n 
1 322 LYS n 
1 323 ASP n 
1 324 GLU n 
1 325 GLY n 
1 326 SER n 
1 327 PHE n 
1 328 PHE n 
1 329 LEU n 
1 330 LEU n 
1 331 TYR n 
1 332 GLY n 
1 333 ALA n 
1 334 PRO n 
1 335 GLY n 
1 336 PHE n 
1 337 SER n 
1 338 LYS n 
1 339 ASP n 
1 340 SER n 
1 341 GLU n 
1 342 SER n 
1 343 LYS n 
1 344 ILE n 
1 345 SER n 
1 346 ARG n 
1 347 GLU n 
1 348 ASP n 
1 349 PHE n 
1 350 MET n 
1 351 SER n 
1 352 GLY n 
1 353 VAL n 
1 354 LYS n 
1 355 LEU n 
1 356 SER n 
1 357 VAL n 
1 358 PRO n 
1 359 HIS n 
1 360 ALA n 
1 361 ASN n 
1 362 ASP n 
1 363 LEU n 
1 364 GLY n 
1 365 LEU n 
1 366 ASP n 
1 367 ALA n 
1 368 VAL n 
1 369 THR n 
1 370 LEU n 
1 371 GLN n 
1 372 TYR n 
1 373 THR n 
1 374 ASP n 
1 375 TRP n 
1 376 MET n 
1 377 ASP n 
1 378 ASP n 
1 379 ASN n 
1 380 ASN n 
1 381 GLY n 
1 382 ILE n 
1 383 LYS n 
1 384 ASN n 
1 385 ARG n 
1 386 ASP n 
1 387 GLY n 
1 388 LEU n 
1 389 ASP n 
1 390 ASP n 
1 391 ILE n 
1 392 VAL n 
1 393 GLY n 
1 394 ASP n 
1 395 HIS n 
1 396 ASN n 
1 397 VAL n 
1 398 ILE n 
1 399 CYS n 
1 400 PRO n 
1 401 LEU n 
1 402 MET n 
1 403 HIS n 
1 404 PHE n 
1 405 VAL n 
1 406 ASN n 
1 407 LYS n 
1 408 TYR n 
1 409 THR n 
1 410 LYS n 
1 411 PHE n 
1 412 GLY n 
1 413 ASN n 
1 414 GLY n 
1 415 THR n 
1 416 TYR n 
1 417 LEU n 
1 418 TYR n 
1 419 PHE n 
1 420 PHE n 
1 421 ASN n 
1 422 HIS n 
1 423 ARG n 
1 424 ALA n 
1 425 SER n 
1 426 ASN n 
1 427 LEU n 
1 428 VAL n 
1 429 TRP n 
1 430 PRO n 
1 431 GLU n 
1 432 TRP n 
1 433 MET n 
1 434 GLY n 
1 435 VAL n 
1 436 ILE n 
1 437 HIS n 
1 438 GLY n 
1 439 TYR n 
1 440 GLU n 
1 441 ILE n 
1 442 GLU n 
1 443 PHE n 
1 444 VAL n 
1 445 PHE n 
1 446 GLY n 
1 447 LEU n 
1 448 PRO n 
1 449 LEU n 
1 450 VAL n 
1 451 LYS n 
1 452 GLU n 
1 453 LEU n 
1 454 ASN n 
1 455 TYR n 
1 456 THR n 
1 457 ALA n 
1 458 GLU n 
1 459 GLU n 
1 460 GLU n 
1 461 ALA n 
1 462 LEU n 
1 463 SER n 
1 464 ARG n 
1 465 ARG n 
1 466 ILE n 
1 467 MET n 
1 468 HIS n 
1 469 TYR n 
1 470 TRP n 
1 471 ALA n 
1 472 THR n 
1 473 PHE n 
1 474 ALA n 
1 475 LYS n 
1 476 THR n 
1 477 GLY n 
1 478 ASN n 
1 479 PRO n 
1 480 ASN n 
1 481 GLU n 
1 482 PRO n 
1 483 HIS n 
1 484 SER n 
1 485 GLN n 
1 486 GLU n 
1 487 SER n 
1 488 LYS n 
1 489 TRP n 
1 490 PRO n 
1 491 LEU n 
1 492 PHE n 
1 493 THR n 
1 494 THR n 
1 495 LYS n 
1 496 GLU n 
1 497 GLN n 
1 498 LYS n 
1 499 PHE n 
1 500 ILE n 
1 501 ASP n 
1 502 LEU n 
1 503 ASN n 
1 504 THR n 
1 505 GLU n 
1 506 PRO n 
1 507 MET n 
1 508 LYS n 
1 509 VAL n 
1 510 HIS n 
1 511 GLN n 
1 512 ARG n 
1 513 LEU n 
1 514 ARG n 
1 515 VAL n 
1 516 GLN n 
1 517 MET n 
1 518 CYS n 
1 519 VAL n 
1 520 PHE n 
1 521 TRP n 
1 522 ASN n 
1 523 GLN n 
1 524 PHE n 
1 525 LEU n 
1 526 PRO n 
1 527 LYS n 
1 528 LEU n 
1 529 LEU n 
1 530 ASN n 
1 531 ALA n 
1 532 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   532 
_entity_src_gen.gene_src_common_name               'Pacific electric ray' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ache 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Tetronarce californica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7787 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Tetronarce californica' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7787 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TETCF 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            P04058-2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEM
WNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQE
APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRR
RAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGV
NKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICP
LMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPN
EPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNAT
;
_struct_ref.pdbx_align_begin           25 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6FLD 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 532 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  25 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  556 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       4 
_struct_ref_seq.pdbx_auth_seq_align_end       535 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PG non-polymer                  . '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL'                              ? 
'C11 H24 O6'     252.305 
ALA 'L-peptide linking'          y ALANINE                                                                                      ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                                                                     ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                                   ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                              ? 
'C4 H7 N O4'     133.103 
BXT 'L-peptide linking'          n '(2~{S})-2-azanyl-3-[ethyl(methyl)carbamoyl]oxy-propanoic acid'                              ? 
'C7 H14 N2 O4'   190.197 
CL  non-polymer                  . 'CHLORIDE ION'                                                                               ? 
'Cl -1'          35.453  
CYS 'L-peptide linking'          y CYSTEINE                                                                                     ? 
'C3 H7 N O2 S'   121.158 
DQ5 non-polymer                  . '2-[(~{E})-hydroxyiminomethyl]-6-[4-(1,2,3,4-tetrahydroacridin-9-ylamino)butyl]pyridin-3-ol' ? 
'C23 H26 N4 O2'  390.478 
EDO non-polymer                  . 1,2-ETHANEDIOL                                                                               
'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking'          y GLUTAMINE                                                                                    ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                              ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                                                                      ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                                                    ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                                                        ? 
'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                                   ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                      ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                       ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                                                                   ? 
'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                     ? 
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                                ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                      ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                                                                       ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                                                                    ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                                   ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                                     ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                                                                       ? 
'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6FLD 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.27 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.21 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.4 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 200 30 %, MES 100 mM pH 5.4.' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-11-27 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8726 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.8726 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     6FLD 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             37.320 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   40520 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.09700 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.2000 
_reflns.B_iso_Wilson_estimate        43.62 
_reflns.pdbx_redundancy              6.900 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   97.8 
_reflns_shell.Rmerge_I_obs           0.78000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.200 
_reflns_shell.pdbx_redundancy        7.00 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 6FLD 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     40520 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.200 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.32 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          0.180 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.180 
_refine.ls_R_factor_R_free                       0.210 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.900 
_refine.ls_number_reflns_R_free                  1992 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               52.40 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.310 
_refine.pdbx_overall_phase_error                 24.640 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4234 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         104 
_refine_hist.number_atoms_solvent             214 
_refine_hist.number_atoms_total               4552 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        37.32 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.012  ? ? 4489 'X-RAY DIFFRACTION' ? 
f_angle_d          1.049  ? ? 6096 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 19.422 ? ? 1645 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.073  ? ? 638  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.008  ? ? 789  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' 2.4024 2.4625 2646 0.300329890348 97.1747471224 0.364530195535 140 . . . . . 
'X-RAY DIFFRACTION' 2.4625 2.529  2731 0.276463974306 99.5839112344 0.304311925253 141 . . . . . 
'X-RAY DIFFRACTION' 2.529  2.6034 2708 0.252807087286 99.7546442341 0.287079349846 138 . . . . . 
'X-RAY DIFFRACTION' 2.6034 2.6874 2712 0.237908316435 99.6855345912 0.298697683466 141 . . . . . 
'X-RAY DIFFRACTION' 2.6874 2.7835 2744 0.219598160012 99.9306999307 0.260762858181 140 . . . . . 
'X-RAY DIFFRACTION' 2.7835 2.8949 2714 0.211740959899 99.8949579832 0.268507915961 139 . . . . . 
'X-RAY DIFFRACTION' 2.8949 3.0266 2733 0.206571397559 99.8263888889 0.237500034642 142 . . . . . 
'X-RAY DIFFRACTION' 3.0266 3.1861 2772 0.216874663865 99.8973657202 0.257062053886 148 . . . . . 
'X-RAY DIFFRACTION' 3.1861 3.3855 2716 0.198260578215 100.0         0.277966173343 139 . . . . . 
'X-RAY DIFFRACTION' 3.3855 3.6467 2768 0.174931589264 99.8628257888 0.242648431469 144 . . . . . 
'X-RAY DIFFRACTION' 3.6467 4.0133 2759 0.154126413748 99.9655291279 0.183110453268 141 . . . . . 
'X-RAY DIFFRACTION' 4.0133 4.5932 2786 0.1328674999   99.9659284497 0.142694601857 148 . . . . . 
'X-RAY DIFFRACTION' 4.5932 5.7835 2814 0.142444153565 99.9324095978 0.147459052181 143 . . . . . 
'X-RAY DIFFRACTION' 5.7835 37.323 2925 0.165143628114 99.8700032499 0.184541592543 148 . . . . . 
# 
_struct.entry_id                     6FLD 
_struct.title                        'Carbamylated T. californica acetylcholineterase bound to uncharged hybrid reactivator 1' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6FLD 
_struct_keywords.text            
'Acetylcholinesterase Hybrid reactivators Organophosphate inhibition Structure-based optimization, hydrolase' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 37  ? ARG A 41  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 75  ? MET A 80  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  AA3 LEU A 124 ? ASN A 128 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  AA4 GLY A 129 ? GLU A 137 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  AA5 GLY A 148 ? LEU A 153 ? GLY A 151 LEU A 156 1 ? 6  
HELX_P HELX_P6  AA6 ASN A 164 ? ILE A 181 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  AA7 GLN A 182 ? PHE A 184 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  AA8 BXT A 197 ? SER A 209 ? BXT A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  AA9 PRO A 210 ? PHE A 216 ? PRO A 213 PHE A 219 5 ? 7  
HELX_P HELX_P10 AB1 VAL A 235 ? LEU A 249 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 AB2 SER A 255 ? LYS A 266 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 AB3 LYS A 267 ? GLU A 275 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 AB4 TRP A 276 ? LEU A 279 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 AB5 SER A 301 ? GLY A 309 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 AB6 GLY A 325 ? ALA A 333 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 AB7 SER A 345 ? VAL A 357 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 AB8 ASN A 361 ? THR A 373 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 AB9 ASN A 380 ? VAL A 397 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 AC1 VAL A 397 ? LYS A 410 ? VAL A 400 LYS A 413 1 ? 14 
HELX_P HELX_P20 AC2 PRO A 430 ? GLY A 434 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 AC3 GLU A 440 ? PHE A 445 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 AC4 GLY A 446 ? ASN A 454 ? GLY A 449 ASN A 457 5 ? 9  
HELX_P HELX_P23 AC5 THR A 456 ? GLY A 477 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P24 AC6 ARG A 514 ? GLN A 523 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P25 AC7 GLN A 523 ? ASN A 530 ? GLN A 526 ASN A 533 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 64  SG  ? ? ? 1_555 A CYS 91  SG ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf2 disulf ?    ? A CYS 251 SG  ? ? ? 1_555 A CYS 262 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
covale1 covale one  ? A ASN 56  ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 59  A NAG 601 1_555 ? ? ? ? ? ? ? 1.462 ? N-Glycosylation 
covale2 covale one  ? A GLU 196 C   ? ? ? 1_555 A BXT 197 N  ? ? A GLU 199 A BXT 200 1_555 ? ? ? ? ? ? ? 1.450 ? ?               
covale3 covale both ? A BXT 197 C   ? ? ? 1_555 A ALA 198 N  ? ? A BXT 200 A ALA 201 1_555 ? ? ? ? ? ? ? 1.333 ? ?               
covale4 covale one  ? A ASN 413 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 416 A NAG 602 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale5 covale one  ? A ASN 454 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 457 A NAG 603 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           100 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    101 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.34 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 4   ? THR A 7   ? LEU A 7   THR A 10  
AA1 2  GLY A 10  ? MET A 13  ? GLY A 13  MET A 16  
AA1 3  VAL A 54  ? ASN A 56  ? VAL A 57  ASN A 59  
AA2 1  THR A 15  ? PRO A 18  ? THR A 18  PRO A 21  
AA2 2  HIS A 23  ? PRO A 31  ? HIS A 26  PRO A 34  
AA2 3  TYR A 93  ? VAL A 98  ? TYR A 96  VAL A 101 
AA2 4  VAL A 139 ? SER A 142 ? VAL A 142 SER A 145 
AA2 5  THR A 106 ? ILE A 112 ? THR A 109 ILE A 115 
AA2 6  GLY A 186 ? GLU A 196 ? GLY A 189 GLU A 199 
AA2 7  ARG A 218 ? GLN A 222 ? ARG A 221 GLN A 225 
AA2 8  ILE A 316 ? ASN A 321 ? ILE A 319 ASN A 324 
AA2 9  THR A 415 ? PHE A 420 ? THR A 418 PHE A 423 
AA2 10 LYS A 498 ? LEU A 502 ? LYS A 501 LEU A 505 
AA2 11 VAL A 509 ? GLN A 511 ? VAL A 512 GLN A 514 
AA3 1  ASN A 63  ? CYS A 64  ? ASN A 66  CYS A 67  
AA3 2  MET A 87  ? SER A 88  ? MET A 90  SER A 91  
AA4 1  VAL A 233 ? SER A 234 ? VAL A 236 SER A 237 
AA4 2  VAL A 292 ? ILE A 293 ? VAL A 295 ILE A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 5   ? N VAL A 8   O VAL A 12  ? O VAL A 15  
AA1 2  3  N MET A 13  ? N MET A 16  O TRP A 55  ? O TRP A 58  
AA2 1  2  N THR A 15  ? N THR A 18  O ALA A 26  ? O ALA A 29  
AA2 2  3  N PHE A 27  ? N PHE A 30  O ILE A 96  ? O ILE A 99  
AA2 3  4  N ASN A 95  ? N ASN A 98  O SER A 142 ? O SER A 145 
AA2 4  5  O VAL A 141 ? O VAL A 144 N MET A 109 ? N MET A 112 
AA2 5  6  N THR A 106 ? N THR A 109 O ASP A 187 ? O ASP A 190 
AA2 6  7  N ILE A 193 ? N ILE A 196 O ILE A 220 ? O ILE A 223 
AA2 7  8  N ALA A 219 ? N ALA A 222 O LEU A 317 ? O LEU A 320 
AA2 8  9  N VAL A 320 ? N VAL A 323 O PHE A 420 ? O PHE A 423 
AA2 9  10 N PHE A 419 ? N PHE A 422 O ILE A 500 ? O ILE A 503 
AA2 10 11 N PHE A 499 ? N PHE A 502 O HIS A 510 ? O HIS A 513 
AA3 1  2  N ASN A 63  ? N ASN A 66  O SER A 88  ? O SER A 91  
AA4 1  2  N VAL A 233 ? N VAL A 236 O ILE A 293 ? O ILE A 296 
# 
_atom_sites.entry_id                    6FLD 
_atom_sites.fract_transf_matrix[1][1]   0.008771 
_atom_sites.fract_transf_matrix[1][2]   0.005064 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010128 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007300 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356 2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
CL ? ? 9.50761 7.44341 1.04373  23.83732 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032 2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 4.49882 3.47563 15.80542 1.70748  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732 6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? -27.100 135.281 126.616 1.00 68.24  ? 4   SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? -26.904 135.924 127.921 1.00 78.40  ? 4   SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? -25.427 135.985 128.328 1.00 65.76  ? 4   SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? -24.692 135.004 128.188 1.00 60.11  ? 4   SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? -27.704 135.201 129.007 1.00 68.77  ? 4   SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? -27.444 135.765 130.290 1.00 78.13  ? 4   SER A OG  1 
ATOM   7    N  N   . GLU A 1 2   ? -25.007 137.138 128.853 1.00 66.68  ? 5   GLU A N   1 
ATOM   8    C  CA  . GLU A 1 2   ? -23.608 137.356 129.199 1.00 64.61  ? 5   GLU A CA  1 
ATOM   9    C  C   . GLU A 1 2   ? -23.169 136.631 130.469 1.00 60.03  ? 5   GLU A C   1 
ATOM   10   O  O   . GLU A 1 2   ? -21.975 136.664 130.782 1.00 58.63  ? 5   GLU A O   1 
ATOM   11   C  CB  . GLU A 1 2   ? -23.319 138.855 129.338 1.00 59.43  ? 5   GLU A CB  1 
ATOM   12   C  CG  . GLU A 1 2   ? -23.835 139.494 130.596 1.00 55.62  ? 5   GLU A CG  1 
ATOM   13   C  CD  . GLU A 1 2   ? -23.471 140.975 130.691 1.00 65.10  ? 5   GLU A CD  1 
ATOM   14   O  OE1 . GLU A 1 2   ? -22.411 141.377 130.175 1.00 61.03  ? 5   GLU A OE1 1 
ATOM   15   O  OE2 . GLU A 1 2   ? -24.251 141.746 131.289 1.00 77.72  ? 5   GLU A OE2 1 
ATOM   16   N  N   . LEU A 1 3   ? -24.070 135.965 131.195 1.00 56.26  ? 6   LEU A N   1 
ATOM   17   C  CA  . LEU A 1 3   ? -23.671 135.155 132.343 1.00 58.62  ? 6   LEU A CA  1 
ATOM   18   C  C   . LEU A 1 3   ? -23.508 133.682 132.003 1.00 61.23  ? 6   LEU A C   1 
ATOM   19   O  O   . LEU A 1 3   ? -23.221 132.881 132.901 1.00 63.45  ? 6   LEU A O   1 
ATOM   20   C  CB  . LEU A 1 3   ? -24.676 135.281 133.490 1.00 54.22  ? 6   LEU A CB  1 
ATOM   21   C  CG  . LEU A 1 3   ? -25.047 136.646 134.058 1.00 54.95  ? 6   LEU A CG  1 
ATOM   22   C  CD1 . LEU A 1 3   ? -26.139 136.438 135.084 1.00 59.86  ? 6   LEU A CD1 1 
ATOM   23   C  CD2 . LEU A 1 3   ? -23.852 137.346 134.680 1.00 59.56  ? 6   LEU A CD2 1 
ATOM   24   N  N   . LEU A 1 4   ? -23.707 133.299 130.747 1.00 57.96  ? 7   LEU A N   1 
ATOM   25   C  CA  . LEU A 1 4   ? -23.451 131.940 130.295 1.00 62.95  ? 7   LEU A CA  1 
ATOM   26   C  C   . LEU A 1 4   ? -22.232 131.934 129.379 1.00 60.01  ? 7   LEU A C   1 
ATOM   27   O  O   . LEU A 1 4   ? -22.061 132.837 128.553 1.00 58.58  ? 7   LEU A O   1 
ATOM   28   C  CB  . LEU A 1 4   ? -24.669 131.361 129.574 1.00 59.61  ? 7   LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 4   ? -24.901 129.875 129.853 1.00 64.93  ? 7   LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 4   ? -26.329 129.511 129.513 1.00 76.51  ? 7   LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 4   ? -23.930 129.003 129.066 1.00 64.06  ? 7   LEU A CD2 1 
ATOM   32   N  N   . VAL A 1 5   ? -21.372 130.930 129.555 1.00 56.06  ? 8   VAL A N   1 
ATOM   33   C  CA  . VAL A 1 5   ? -20.111 130.817 128.827 1.00 51.14  ? 8   VAL A CA  1 
ATOM   34   C  C   . VAL A 1 5   ? -19.830 129.339 128.601 1.00 55.07  ? 8   VAL A C   1 
ATOM   35   O  O   . VAL A 1 5   ? -19.894 128.544 129.542 1.00 59.44  ? 8   VAL A O   1 
ATOM   36   C  CB  . VAL A 1 5   ? -18.930 131.469 129.581 1.00 50.06  ? 8   VAL A CB  1 
ATOM   37   C  CG1 . VAL A 1 5   ? -17.631 131.194 128.865 1.00 49.34  ? 8   VAL A CG1 1 
ATOM   38   C  CG2 . VAL A 1 5   ? -19.124 132.970 129.755 1.00 48.79  ? 8   VAL A CG2 1 
ATOM   39   N  N   . ASN A 1 6   ? -19.548 128.965 127.349 1.00 59.93  ? 9   ASN A N   1 
ATOM   40   C  CA  . ASN A 1 6   ? -19.035 127.638 127.030 1.00 58.25  ? 9   ASN A CA  1 
ATOM   41   C  C   . ASN A 1 6   ? -17.521 127.678 127.139 1.00 56.97  ? 9   ASN A C   1 
ATOM   42   O  O   . ASN A 1 6   ? -16.883 128.616 126.656 1.00 57.18  ? 9   ASN A O   1 
ATOM   43   C  CB  . ASN A 1 6   ? -19.432 127.182 125.624 1.00 62.62  ? 9   ASN A CB  1 
ATOM   44   C  CG  . ASN A 1 6   ? -20.929 127.039 125.451 1.00 75.84  ? 9   ASN A CG  1 
ATOM   45   O  OD1 . ASN A 1 6   ? -21.671 126.960 126.427 1.00 81.36  ? 9   ASN A OD1 1 
ATOM   46   N  ND2 . ASN A 1 6   ? -21.385 127.003 124.200 1.00 76.72  ? 9   ASN A ND2 1 
ATOM   47   N  N   . THR A 1 7   ? -16.951 126.678 127.792 1.00 60.47  ? 10  THR A N   1 
ATOM   48   C  CA  . THR A 1 7   ? -15.508 126.558 127.906 1.00 60.47  ? 10  THR A CA  1 
ATOM   49   C  C   . THR A 1 7   ? -15.125 125.172 127.430 1.00 55.91  ? 10  THR A C   1 
ATOM   50   O  O   . THR A 1 7   ? -15.977 124.296 127.267 1.00 58.10  ? 10  THR A O   1 
ATOM   51   C  CB  . THR A 1 7   ? -15.008 126.782 129.346 1.00 48.21  ? 10  THR A CB  1 
ATOM   52   O  OG1 . THR A 1 7   ? -15.330 125.637 130.142 1.00 51.13  ? 10  THR A OG1 1 
ATOM   53   C  CG2 . THR A 1 7   ? -15.641 128.030 129.950 1.00 43.91  ? 10  THR A CG2 1 
ATOM   54   N  N   . LYS A 1 8   ? -13.824 124.970 127.234 1.00 55.13  ? 11  LYS A N   1 
ATOM   55   C  CA  . LYS A 1 8   ? -13.346 123.690 126.733 1.00 61.66  ? 11  LYS A CA  1 
ATOM   56   C  C   . LYS A 1 8   ? -13.723 122.518 127.642 1.00 56.66  ? 11  LYS A C   1 
ATOM   57   O  O   . LYS A 1 8   ? -13.510 121.366 127.255 1.00 62.51  ? 11  LYS A O   1 
ATOM   58   C  CB  . LYS A 1 8   ? -11.824 123.776 126.494 1.00 51.18  ? 11  LYS A CB  1 
ATOM   59   C  CG  . LYS A 1 8   ? -11.481 124.724 125.318 1.00 57.74  ? 11  LYS A CG  1 
ATOM   60   C  CD  . LYS A 1 8   ? -10.000 124.761 124.925 1.00 62.28  ? 11  LYS A CD  1 
ATOM   61   C  CE  . LYS A 1 8   ? -9.815  125.396 123.525 1.00 69.76  ? 11  LYS A CE  1 
ATOM   62   N  NZ  . LYS A 1 8   ? -8.479  126.071 123.288 1.00 62.80  ? 11  LYS A NZ  1 
ATOM   63   N  N   . SER A 1 9   ? -14.316 122.764 128.811 1.00 58.19  ? 12  SER A N   1 
ATOM   64   C  CA  . SER A 1 9   ? -14.733 121.676 129.684 1.00 60.15  ? 12  SER A CA  1 
ATOM   65   C  C   . SER A 1 9   ? -16.217 121.684 130.033 1.00 56.14  ? 12  SER A C   1 
ATOM   66   O  O   . SER A 1 9   ? -16.692 120.711 130.632 1.00 56.57  ? 12  SER A O   1 
ATOM   67   C  CB  . SER A 1 9   ? -13.901 121.679 130.978 1.00 58.73  ? 12  SER A CB  1 
ATOM   68   O  OG  . SER A 1 9   ? -13.236 122.923 131.137 1.00 69.56  ? 12  SER A OG  1 
ATOM   69   N  N   . GLY A 1 10  ? -16.961 122.721 129.670 1.00 51.10  ? 13  GLY A N   1 
ATOM   70   C  CA  . GLY A 1 10  ? -18.394 122.729 129.893 1.00 47.59  ? 13  GLY A CA  1 
ATOM   71   C  C   . GLY A 1 10  ? -18.931 124.138 129.966 1.00 54.93  ? 13  GLY A C   1 
ATOM   72   O  O   . GLY A 1 10  ? -18.188 125.117 129.987 1.00 56.32  ? 13  GLY A O   1 
ATOM   73   N  N   . LYS A 1 11  ? -20.258 124.230 129.991 1.00 57.06  ? 14  LYS A N   1 
ATOM   74   C  CA  . LYS A 1 11  ? -20.915 125.515 130.187 1.00 57.75  ? 14  LYS A CA  1 
ATOM   75   C  C   . LYS A 1 11  ? -20.829 125.902 131.656 1.00 62.68  ? 14  LYS A C   1 
ATOM   76   O  O   . LYS A 1 11  ? -20.894 125.040 132.541 1.00 55.82  ? 14  LYS A O   1 
ATOM   77   C  CB  . LYS A 1 11  ? -22.385 125.461 129.758 1.00 63.09  ? 14  LYS A CB  1 
ATOM   78   C  CG  . LYS A 1 11  ? -22.659 124.827 128.397 1.00 66.20  ? 14  LYS A CG  1 
ATOM   79   C  CD  . LYS A 1 11  ? -24.147 124.886 128.036 1.00 74.85  ? 14  LYS A CD  1 
ATOM   80   C  CE  . LYS A 1 11  ? -24.381 124.748 126.526 1.00 77.44  ? 14  LYS A CE  1 
ATOM   81   N  NZ  . LYS A 1 11  ? -24.495 126.070 125.826 1.00 77.17  ? 14  LYS A NZ  1 
ATOM   82   N  N   . VAL A 1 12  ? -20.671 127.201 131.912 1.00 56.52  ? 15  VAL A N   1 
ATOM   83   C  CA  . VAL A 1 12  ? -20.710 127.746 133.263 1.00 57.14  ? 15  VAL A CA  1 
ATOM   84   C  C   . VAL A 1 12  ? -21.712 128.894 133.293 1.00 61.58  ? 15  VAL A C   1 
ATOM   85   O  O   . VAL A 1 12  ? -21.809 129.679 132.341 1.00 54.52  ? 15  VAL A O   1 
ATOM   86   C  CB  . VAL A 1 12  ? -19.318 128.213 133.755 1.00 52.47  ? 15  VAL A CB  1 
ATOM   87   C  CG1 . VAL A 1 12  ? -18.344 127.056 133.767 1.00 53.23  ? 15  VAL A CG1 1 
ATOM   88   C  CG2 . VAL A 1 12  ? -18.779 129.346 132.898 1.00 59.05  ? 15  VAL A CG2 1 
ATOM   89   N  N   . MET A 1 13  ? -22.466 128.983 134.385 1.00 62.21  ? 16  MET A N   1 
ATOM   90   C  CA  . MET A 1 13  ? -23.436 130.051 134.598 1.00 61.09  ? 16  MET A CA  1 
ATOM   91   C  C   . MET A 1 13  ? -22.954 130.879 135.781 1.00 60.16  ? 16  MET A C   1 
ATOM   92   O  O   . MET A 1 13  ? -22.928 130.395 136.919 1.00 59.37  ? 16  MET A O   1 
ATOM   93   C  CB  . MET A 1 13  ? -24.834 129.483 134.845 1.00 61.19  ? 16  MET A CB  1 
ATOM   94   C  CG  . MET A 1 13  ? -25.915 130.502 135.170 1.00 59.96  ? 16  MET A CG  1 
ATOM   95   S  SD  . MET A 1 13  ? -26.446 131.430 133.726 1.00 81.01  ? 16  MET A SD  1 
ATOM   96   C  CE  . MET A 1 13  ? -27.724 132.467 134.444 1.00 71.34  ? 16  MET A CE  1 
ATOM   97   N  N   . GLY A 1 14  ? -22.547 132.113 135.509 1.00 54.98  ? 17  GLY A N   1 
ATOM   98   C  CA  . GLY A 1 14  ? -22.114 133.024 136.541 1.00 51.66  ? 17  GLY A CA  1 
ATOM   99   C  C   . GLY A 1 14  ? -23.278 133.792 137.130 1.00 57.52  ? 17  GLY A C   1 
ATOM   100  O  O   . GLY A 1 14  ? -24.448 133.489 136.895 1.00 61.62  ? 17  GLY A O   1 
ATOM   101  N  N   . THR A 1 15  ? -22.938 134.815 137.909 1.00 54.22  ? 18  THR A N   1 
ATOM   102  C  CA  . THR A 1 15  ? -23.924 135.641 138.584 1.00 52.70  ? 18  THR A CA  1 
ATOM   103  C  C   . THR A 1 15  ? -23.608 137.114 138.345 1.00 55.94  ? 18  THR A C   1 
ATOM   104  O  O   . THR A 1 15  ? -22.450 137.495 138.149 1.00 55.30  ? 18  THR A O   1 
ATOM   105  C  CB  . THR A 1 15  ? -23.966 135.321 140.102 1.00 59.28  ? 18  THR A CB  1 
ATOM   106  O  OG1 . THR A 1 15  ? -24.968 136.118 140.751 1.00 60.17  ? 18  THR A OG1 1 
ATOM   107  C  CG2 . THR A 1 15  ? -22.611 135.586 140.752 1.00 52.17  ? 18  THR A CG2 1 
ATOM   108  N  N   . ARG A 1 16  ? -24.653 137.939 138.343 1.00 56.48  ? 19  ARG A N   1 
ATOM   109  C  CA  . ARG A 1 16  ? -24.507 139.388 138.250 1.00 55.35  ? 19  ARG A CA  1 
ATOM   110  C  C   . ARG A 1 16  ? -24.309 139.966 139.649 1.00 63.45  ? 19  ARG A C   1 
ATOM   111  O  O   . ARG A 1 16  ? -25.104 139.694 140.552 1.00 57.08  ? 19  ARG A O   1 
ATOM   112  C  CB  . ARG A 1 16  ? -25.738 140.007 137.589 1.00 51.77  ? 19  ARG A CB  1 
ATOM   113  C  CG  . ARG A 1 16  ? -25.723 141.513 137.553 1.00 54.45  ? 19  ARG A CG  1 
ATOM   114  C  CD  . ARG A 1 16  ? -26.400 142.047 136.290 1.00 69.32  ? 19  ARG A CD  1 
ATOM   115  N  NE  . ARG A 1 16  ? -25.897 143.382 135.976 1.00 73.35  ? 19  ARG A NE  1 
ATOM   116  C  CZ  . ARG A 1 16  ? -25.662 143.840 134.751 1.00 81.27  ? 19  ARG A CZ  1 
ATOM   117  N  NH1 . ARG A 1 16  ? -25.893 143.065 133.695 1.00 90.53  ? 19  ARG A NH1 1 
ATOM   118  N  NH2 . ARG A 1 16  ? -25.188 145.074 134.585 1.00 73.08  ? 19  ARG A NH2 1 
ATOM   119  N  N   . VAL A 1 17  ? -23.249 140.750 139.831 1.00 52.93  ? 20  VAL A N   1 
ATOM   120  C  CA  . VAL A 1 17  ? -22.936 141.268 141.156 1.00 59.39  ? 20  VAL A CA  1 
ATOM   121  C  C   . VAL A 1 17  ? -22.875 142.786 141.078 1.00 63.15  ? 20  VAL A C   1 
ATOM   122  O  O   . VAL A 1 17  ? -22.513 143.336 140.030 1.00 62.40  ? 20  VAL A O   1 
ATOM   123  C  CB  . VAL A 1 17  ? -21.624 140.677 141.705 1.00 62.22  ? 20  VAL A CB  1 
ATOM   124  C  CG1 . VAL A 1 17  ? -21.614 139.157 141.553 1.00 56.46  ? 20  VAL A CG1 1 
ATOM   125  C  CG2 . VAL A 1 17  ? -20.408 141.310 141.030 1.00 55.05  ? 20  VAL A CG2 1 
ATOM   126  N  N   . PRO A 1 18  ? -23.238 143.498 142.142 1.00 58.70  ? 21  PRO A N   1 
ATOM   127  C  CA  . PRO A 1 18  ? -23.164 144.960 142.128 1.00 55.28  ? 21  PRO A CA  1 
ATOM   128  C  C   . PRO A 1 18  ? -21.806 145.439 142.603 1.00 56.96  ? 21  PRO A C   1 
ATOM   129  O  O   . PRO A 1 18  ? -21.107 144.758 143.356 1.00 55.50  ? 21  PRO A O   1 
ATOM   130  C  CB  . PRO A 1 18  ? -24.267 145.362 143.113 1.00 55.74  ? 21  PRO A CB  1 
ATOM   131  C  CG  . PRO A 1 18  ? -24.285 144.238 144.104 1.00 53.83  ? 21  PRO A CG  1 
ATOM   132  C  CD  . PRO A 1 18  ? -23.855 142.983 143.376 1.00 53.33  ? 21  PRO A CD  1 
ATOM   133  N  N   . VAL A 1 19  ? -21.431 146.630 142.141 1.00 51.13  ? 22  VAL A N   1 
ATOM   134  C  CA  . VAL A 1 19  ? -20.130 147.188 142.489 1.00 53.02  ? 22  VAL A CA  1 
ATOM   135  C  C   . VAL A 1 19  ? -20.132 148.688 142.235 1.00 60.19  ? 22  VAL A C   1 
ATOM   136  O  O   . VAL A 1 19  ? -20.217 149.133 141.089 1.00 61.57  ? 22  VAL A O   1 
ATOM   137  C  CB  . VAL A 1 19  ? -18.994 146.486 141.711 1.00 56.46  ? 22  VAL A CB  1 
ATOM   138  C  CG1 . VAL A 1 19  ? -19.387 146.249 140.251 1.00 56.78  ? 22  VAL A CG1 1 
ATOM   139  C  CG2 . VAL A 1 19  ? -17.696 147.290 141.797 1.00 52.28  ? 22  VAL A CG2 1 
ATOM   140  N  N   . LEU A 1 20  ? -20.050 149.479 143.301 1.00 62.26  ? 23  LEU A N   1 
ATOM   141  C  CA  . LEU A 1 20  ? -19.898 150.930 143.194 1.00 66.07  ? 23  LEU A CA  1 
ATOM   142  C  C   . LEU A 1 20  ? -20.961 151.542 142.277 1.00 73.82  ? 23  LEU A C   1 
ATOM   143  O  O   . LEU A 1 20  ? -20.656 152.216 141.287 1.00 79.36  ? 23  LEU A O   1 
ATOM   144  C  CB  . LEU A 1 20  ? -18.493 151.285 142.707 1.00 65.60  ? 23  LEU A CB  1 
ATOM   145  C  CG  . LEU A 1 20  ? -17.335 150.807 143.571 1.00 62.73  ? 23  LEU A CG  1 
ATOM   146  C  CD1 . LEU A 1 20  ? -16.033 151.354 143.034 1.00 61.50  ? 23  LEU A CD1 1 
ATOM   147  C  CD2 . LEU A 1 20  ? -17.545 151.244 145.006 1.00 70.21  ? 23  LEU A CD2 1 
ATOM   148  N  N   . SER A 1 21  ? -22.227 151.271 142.612 1.00 71.28  ? 24  SER A N   1 
ATOM   149  C  CA  . SER A 1 21  ? -23.381 151.809 141.879 1.00 73.05  ? 24  SER A CA  1 
ATOM   150  C  C   . SER A 1 21  ? -23.365 151.399 140.402 1.00 77.85  ? 24  SER A C   1 
ATOM   151  O  O   . SER A 1 21  ? -23.728 152.176 139.514 1.00 76.83  ? 24  SER A O   1 
ATOM   152  C  CB  . SER A 1 21  ? -23.467 153.332 142.020 1.00 81.21  ? 24  SER A CB  1 
ATOM   153  O  OG  . SER A 1 21  ? -22.413 153.980 141.327 1.00 90.49  ? 24  SER A OG  1 
ATOM   154  N  N   . SER A 1 22  ? -22.938 150.171 140.138 1.00 72.74  ? 25  SER A N   1 
ATOM   155  C  CA  . SER A 1 22  ? -23.056 149.567 138.819 1.00 70.36  ? 25  SER A CA  1 
ATOM   156  C  C   . SER A 1 22  ? -23.099 148.055 139.010 1.00 72.23  ? 25  SER A C   1 
ATOM   157  O  O   . SER A 1 22  ? -23.407 147.567 140.103 1.00 70.27  ? 25  SER A O   1 
ATOM   158  C  CB  . SER A 1 22  ? -21.911 150.019 137.902 1.00 66.65  ? 25  SER A CB  1 
ATOM   159  O  OG  . SER A 1 22  ? -21.966 149.303 136.682 1.00 71.26  ? 25  SER A OG  1 
ATOM   160  N  N   . HIS A 1 23  ? -22.793 147.306 137.949 1.00 67.26  ? 26  HIS A N   1 
ATOM   161  C  CA  . HIS A 1 23  ? -22.782 145.855 138.061 1.00 67.42  ? 26  HIS A CA  1 
ATOM   162  C  C   . HIS A 1 23  ? -21.779 145.272 137.077 1.00 64.95  ? 26  HIS A C   1 
ATOM   163  O  O   . HIS A 1 23  ? -21.516 145.851 136.020 1.00 70.44  ? 26  HIS A O   1 
ATOM   164  C  CB  . HIS A 1 23  ? -24.169 145.243 137.812 1.00 69.06  ? 26  HIS A CB  1 
ATOM   165  C  CG  . HIS A 1 23  ? -25.310 146.197 138.020 1.00 82.88  ? 26  HIS A CG  1 
ATOM   166  N  ND1 . HIS A 1 23  ? -26.005 146.283 139.210 1.00 85.99  ? 26  HIS A ND1 1 
ATOM   167  C  CD2 . HIS A 1 23  ? -25.876 147.105 137.186 1.00 86.57  ? 26  HIS A CD2 1 
ATOM   168  C  CE1 . HIS A 1 23  ? -26.947 147.204 139.099 1.00 92.63  ? 26  HIS A CE1 1 
ATOM   169  N  NE2 . HIS A 1 23  ? -26.892 147.716 137.881 1.00 89.42  ? 26  HIS A NE2 1 
ATOM   170  N  N   . ILE A 1 24  ? -21.211 144.123 137.444 1.00 56.82  ? 27  ILE A N   1 
ATOM   171  C  CA  . ILE A 1 24  ? -20.346 143.337 136.577 1.00 56.53  ? 27  ILE A CA  1 
ATOM   172  C  C   . ILE A 1 24  ? -20.739 141.874 136.730 1.00 52.65  ? 27  ILE A C   1 
ATOM   173  O  O   . ILE A 1 24  ? -21.616 141.527 137.523 1.00 56.94  ? 27  ILE A O   1 
ATOM   174  C  CB  . ILE A 1 24  ? -18.841 143.533 136.878 1.00 58.41  ? 27  ILE A CB  1 
ATOM   175  C  CG1 . ILE A 1 24  ? -18.478 143.006 138.257 1.00 56.07  ? 27  ILE A CG1 1 
ATOM   176  C  CG2 . ILE A 1 24  ? -18.423 144.995 136.789 1.00 60.92  ? 27  ILE A CG2 1 
ATOM   177  C  CD1 . ILE A 1 24  ? -16.987 142.939 138.441 1.00 63.03  ? 27  ILE A CD1 1 
ATOM   178  N  N   . SER A 1 25  ? -20.093 141.015 135.947 1.00 52.91  ? 28  SER A N   1 
ATOM   179  C  CA  . SER A 1 25  ? -20.341 139.578 135.968 1.00 51.03  ? 28  SER A CA  1 
ATOM   180  C  C   . SER A 1 25  ? -19.263 138.893 136.794 1.00 50.81  ? 28  SER A C   1 
ATOM   181  O  O   . SER A 1 25  ? -18.091 139.282 136.747 1.00 52.92  ? 28  SER A O   1 
ATOM   182  C  CB  . SER A 1 25  ? -20.345 138.985 134.551 1.00 55.74  ? 28  SER A CB  1 
ATOM   183  O  OG  . SER A 1 25  ? -21.274 139.630 133.703 1.00 53.01  ? 28  SER A OG  1 
ATOM   184  N  N   . ALA A 1 26  ? -19.657 137.866 137.537 1.00 51.18  ? 29  ALA A N   1 
ATOM   185  C  CA  . ALA A 1 26  ? -18.729 137.108 138.360 1.00 45.33  ? 29  ALA A CA  1 
ATOM   186  C  C   . ALA A 1 26  ? -18.957 135.625 138.135 1.00 46.01  ? 29  ALA A C   1 
ATOM   187  O  O   . ALA A 1 26  ? -20.102 135.165 138.104 1.00 48.31  ? 29  ALA A O   1 
ATOM   188  C  CB  . ALA A 1 26  ? -18.894 137.448 139.843 1.00 47.92  ? 29  ALA A CB  1 
ATOM   189  N  N   . PHE A 1 27  ? -17.869 134.881 137.979 1.00 38.64  ? 30  PHE A N   1 
ATOM   190  C  CA  . PHE A 1 27  ? -17.931 133.434 137.792 1.00 43.25  ? 30  PHE A CA  1 
ATOM   191  C  C   . PHE A 1 27  ? -17.125 132.807 138.925 1.00 48.07  ? 30  PHE A C   1 
ATOM   192  O  O   . PHE A 1 27  ? -15.893 132.733 138.858 1.00 47.42  ? 30  PHE A O   1 
ATOM   193  C  CB  . PHE A 1 27  ? -17.408 133.035 136.401 1.00 51.89  ? 30  PHE A CB  1 
ATOM   194  C  CG  . PHE A 1 27  ? -18.201 133.632 135.268 1.00 42.29  ? 30  PHE A CG  1 
ATOM   195  C  CD1 . PHE A 1 27  ? -18.009 134.951 134.889 1.00 46.29  ? 30  PHE A CD1 1 
ATOM   196  C  CD2 . PHE A 1 27  ? -19.161 132.881 134.608 1.00 45.41  ? 30  PHE A CD2 1 
ATOM   197  C  CE1 . PHE A 1 27  ? -18.748 135.514 133.856 1.00 44.42  ? 30  PHE A CE1 1 
ATOM   198  C  CE2 . PHE A 1 27  ? -19.904 133.431 133.577 1.00 48.00  ? 30  PHE A CE2 1 
ATOM   199  C  CZ  . PHE A 1 27  ? -19.699 134.751 133.204 1.00 46.24  ? 30  PHE A CZ  1 
ATOM   200  N  N   . LEU A 1 28  ? -17.820 132.357 139.965 1.00 43.87  ? 31  LEU A N   1 
ATOM   201  C  CA  . LEU A 1 28  ? -17.184 131.936 141.202 1.00 42.84  ? 31  LEU A CA  1 
ATOM   202  C  C   . LEU A 1 28  ? -17.131 130.416 141.285 1.00 45.42  ? 31  LEU A C   1 
ATOM   203  O  O   . LEU A 1 28  ? -18.141 129.736 141.083 1.00 45.07  ? 31  LEU A O   1 
ATOM   204  C  CB  . LEU A 1 28  ? -17.933 132.522 142.398 1.00 45.36  ? 31  LEU A CB  1 
ATOM   205  C  CG  . LEU A 1 28  ? -18.193 134.024 142.221 1.00 48.61  ? 31  LEU A CG  1 
ATOM   206  C  CD1 . LEU A 1 28  ? -18.977 134.599 143.386 1.00 43.27  ? 31  LEU A CD1 1 
ATOM   207  C  CD2 . LEU A 1 28  ? -16.898 134.814 141.982 1.00 44.98  ? 31  LEU A CD2 1 
ATOM   208  N  N   . GLY A 1 29  ? -15.949 129.889 141.577 1.00 41.52  ? 32  GLY A N   1 
ATOM   209  C  CA  . GLY A 1 29  ? -15.812 128.470 141.819 1.00 41.65  ? 32  GLY A CA  1 
ATOM   210  C  C   . GLY A 1 29  ? -15.832 127.602 140.584 1.00 44.07  ? 32  GLY A C   1 
ATOM   211  O  O   . GLY A 1 29  ? -16.499 126.562 140.575 1.00 45.36  ? 32  GLY A O   1 
ATOM   212  N  N   . ILE A 1 30  ? -15.109 127.990 139.541 1.00 44.26  ? 33  ILE A N   1 
ATOM   213  C  CA  . ILE A 1 30  ? -14.961 127.137 138.363 1.00 39.80  ? 33  ILE A CA  1 
ATOM   214  C  C   . ILE A 1 30  ? -13.873 126.101 138.645 1.00 41.87  ? 33  ILE A C   1 
ATOM   215  O  O   . ILE A 1 30  ? -12.749 126.482 139.001 1.00 43.71  ? 33  ILE A O   1 
ATOM   216  C  CB  . ILE A 1 30  ? -14.613 127.968 137.134 1.00 42.59  ? 33  ILE A CB  1 
ATOM   217  C  CG1 . ILE A 1 30  ? -15.778 128.874 136.750 1.00 41.65  ? 33  ILE A CG1 1 
ATOM   218  C  CG2 . ILE A 1 30  ? -14.255 127.063 135.971 1.00 40.95  ? 33  ILE A CG2 1 
ATOM   219  C  CD1 . ILE A 1 30  ? -15.446 129.874 135.652 1.00 42.65  ? 33  ILE A CD1 1 
ATOM   220  N  N   . PRO A 1 31  ? -14.149 124.813 138.481 1.00 45.24  ? 34  PRO A N   1 
ATOM   221  C  CA  . PRO A 1 31  ? -13.099 123.811 138.701 1.00 43.94  ? 34  PRO A CA  1 
ATOM   222  C  C   . PRO A 1 31  ? -12.076 123.840 137.576 1.00 47.53  ? 34  PRO A C   1 
ATOM   223  O  O   . PRO A 1 31  ? -12.431 123.970 136.402 1.00 51.30  ? 34  PRO A O   1 
ATOM   224  C  CB  . PRO A 1 31  ? -13.874 122.489 138.723 1.00 47.50  ? 34  PRO A CB  1 
ATOM   225  C  CG  . PRO A 1 31  ? -15.067 122.757 137.842 1.00 52.32  ? 34  PRO A CG  1 
ATOM   226  C  CD  . PRO A 1 31  ? -15.391 124.224 137.946 1.00 45.53  ? 34  PRO A CD  1 
ATOM   227  N  N   . PHE A 1 32  ? -10.791 123.757 137.938 1.00 45.59  ? 35  PHE A N   1 
ATOM   228  C  CA  . PHE A 1 32  ? -9.740  123.652 136.935 1.00 44.95  ? 35  PHE A CA  1 
ATOM   229  C  C   . PHE A 1 32  ? -8.929  122.370 137.061 1.00 51.03  ? 35  PHE A C   1 
ATOM   230  O  O   . PHE A 1 32  ? -8.007  122.152 136.257 1.00 52.15  ? 35  PHE A O   1 
ATOM   231  C  CB  . PHE A 1 32  ? -8.812  124.882 136.970 1.00 46.91  ? 35  PHE A CB  1 
ATOM   232  C  CG  . PHE A 1 32  ? -8.003  125.026 138.236 1.00 41.76  ? 35  PHE A CG  1 
ATOM   233  C  CD1 . PHE A 1 32  ? -6.775  124.378 138.380 1.00 39.43  ? 35  PHE A CD1 1 
ATOM   234  C  CD2 . PHE A 1 32  ? -8.445  125.847 139.263 1.00 41.70  ? 35  PHE A CD2 1 
ATOM   235  C  CE1 . PHE A 1 32  ? -6.015  124.531 139.539 1.00 44.41  ? 35  PHE A CE1 1 
ATOM   236  C  CE2 . PHE A 1 32  ? -7.691  126.001 140.435 1.00 39.17  ? 35  PHE A CE2 1 
ATOM   237  C  CZ  . PHE A 1 32  ? -6.479  125.345 140.574 1.00 36.91  ? 35  PHE A CZ  1 
ATOM   238  N  N   . ALA A 1 33  ? -9.262  121.502 138.016 1.00 44.26  ? 36  ALA A N   1 
ATOM   239  C  CA  . ALA A 1 33  ? -8.575  120.230 138.179 1.00 45.20  ? 36  ALA A CA  1 
ATOM   240  C  C   . ALA A 1 33  ? -9.562  119.207 138.721 1.00 52.57  ? 36  ALA A C   1 
ATOM   241  O  O   . ALA A 1 33  ? -10.638 119.554 139.216 1.00 52.27  ? 36  ALA A O   1 
ATOM   242  C  CB  . ALA A 1 33  ? -7.362  120.353 139.116 1.00 40.02  ? 36  ALA A CB  1 
ATOM   243  N  N   . GLU A 1 34  ? -9.203  117.938 138.602 1.00 50.32  ? 37  GLU A N   1 
ATOM   244  C  CA  . GLU A 1 34  ? -9.907  116.927 139.371 1.00 52.21  ? 37  GLU A CA  1 
ATOM   245  C  C   . GLU A 1 34  ? -9.638  117.150 140.862 1.00 51.61  ? 37  GLU A C   1 
ATOM   246  O  O   . GLU A 1 34  ? -8.520  117.510 141.246 1.00 42.79  ? 37  GLU A O   1 
ATOM   247  C  CB  . GLU A 1 34  ? -9.458  115.524 138.957 1.00 56.20  ? 37  GLU A CB  1 
ATOM   248  C  CG  . GLU A 1 34  ? -10.042 115.023 137.637 1.00 59.73  ? 37  GLU A CG  1 
ATOM   249  C  CD  . GLU A 1 34  ? -11.546 114.824 137.711 1.00 64.47  ? 37  GLU A CD  1 
ATOM   250  O  OE1 . GLU A 1 34  ? -12.290 115.685 137.188 1.00 65.29  ? 37  GLU A OE1 1 
ATOM   251  O  OE2 . GLU A 1 34  ? -11.986 113.815 138.307 1.00 69.19  ? 37  GLU A OE2 1 
ATOM   252  N  N   . PRO A 1 35  ? -10.637 116.967 141.719 1.00 53.96  ? 38  PRO A N   1 
ATOM   253  C  CA  . PRO A 1 35  ? -10.417 117.124 143.170 1.00 55.38  ? 38  PRO A CA  1 
ATOM   254  C  C   . PRO A 1 35  ? -9.283  116.235 143.649 1.00 55.41  ? 38  PRO A C   1 
ATOM   255  O  O   . PRO A 1 35  ? -9.331  115.008 143.478 1.00 56.16  ? 38  PRO A O   1 
ATOM   256  C  CB  . PRO A 1 35  ? -11.763 116.699 143.776 1.00 53.03  ? 38  PRO A CB  1 
ATOM   257  C  CG  . PRO A 1 35  ? -12.770 117.009 142.679 1.00 55.07  ? 38  PRO A CG  1 
ATOM   258  C  CD  . PRO A 1 35  ? -12.055 116.740 141.383 1.00 51.51  ? 38  PRO A CD  1 
ATOM   259  N  N   . PRO A 1 36  ? -8.234  116.815 144.250 1.00 50.92  ? 39  PRO A N   1 
ATOM   260  C  CA  . PRO A 1 36  ? -7.044  116.018 144.628 1.00 44.90  ? 39  PRO A CA  1 
ATOM   261  C  C   . PRO A 1 36  ? -7.254  115.247 145.925 1.00 58.04  ? 39  PRO A C   1 
ATOM   262  O  O   . PRO A 1 36  ? -6.618  115.491 146.958 1.00 56.55  ? 39  PRO A O   1 
ATOM   263  C  CB  . PRO A 1 36  ? -5.960  117.093 144.753 1.00 43.43  ? 39  PRO A CB  1 
ATOM   264  C  CG  . PRO A 1 36  ? -6.710  118.312 145.234 1.00 48.18  ? 39  PRO A CG  1 
ATOM   265  C  CD  . PRO A 1 36  ? -8.087  118.241 144.596 1.00 44.52  ? 39  PRO A CD  1 
ATOM   266  N  N   . VAL A 1 37  ? -8.162  114.273 145.890 1.00 57.40  ? 40  VAL A N   1 
ATOM   267  C  CA  . VAL A 1 37  ? -8.601  113.584 147.093 1.00 56.17  ? 40  VAL A CA  1 
ATOM   268  C  C   . VAL A 1 37  ? -8.255  112.096 146.999 1.00 60.63  ? 40  VAL A C   1 
ATOM   269  O  O   . VAL A 1 37  ? -7.911  111.571 145.935 1.00 54.83  ? 40  VAL A O   1 
ATOM   270  C  CB  . VAL A 1 37  ? -10.105 113.778 147.341 1.00 51.89  ? 40  VAL A CB  1 
ATOM   271  C  CG1 . VAL A 1 37  ? -10.436 115.253 147.347 1.00 53.91  ? 40  VAL A CG1 1 
ATOM   272  C  CG2 . VAL A 1 37  ? -10.895 113.059 146.266 1.00 52.21  ? 40  VAL A CG2 1 
ATOM   273  N  N   . GLY A 1 38  ? -8.345  111.423 148.147 1.00 49.22  ? 41  GLY A N   1 
ATOM   274  C  CA  . GLY A 1 38  ? -8.168  109.978 148.179 1.00 52.88  ? 41  GLY A CA  1 
ATOM   275  C  C   . GLY A 1 38  ? -6.727  109.604 147.911 1.00 59.30  ? 41  GLY A C   1 
ATOM   276  O  O   . GLY A 1 38  ? -5.802  110.114 148.551 1.00 52.59  ? 41  GLY A O   1 
ATOM   277  N  N   . ASN A 1 39  ? -6.511  108.712 146.945 1.00 60.59  ? 42  ASN A N   1 
ATOM   278  C  CA  . ASN A 1 39  ? -5.132  108.404 146.603 1.00 58.82  ? 42  ASN A CA  1 
ATOM   279  C  C   . ASN A 1 39  ? -4.522  109.462 145.691 1.00 56.59  ? 42  ASN A C   1 
ATOM   280  O  O   . ASN A 1 39  ? -3.357  109.330 145.302 1.00 54.53  ? 42  ASN A O   1 
ATOM   281  C  CB  . ASN A 1 39  ? -5.022  107.002 145.992 1.00 59.36  ? 42  ASN A CB  1 
ATOM   282  C  CG  . ASN A 1 39  ? -5.749  106.870 144.661 1.00 76.81  ? 42  ASN A CG  1 
ATOM   283  O  OD1 . ASN A 1 39  ? -6.718  107.584 144.382 1.00 77.21  ? 42  ASN A OD1 1 
ATOM   284  N  ND2 . ASN A 1 39  ? -5.287  105.933 143.835 1.00 75.47  ? 42  ASN A ND2 1 
ATOM   285  N  N   . MET A 1 40  ? -5.263  110.530 145.388 1.00 47.68  ? 43  MET A N   1 
ATOM   286  C  CA  . MET A 1 40  ? -4.690  111.693 144.727 1.00 49.79  ? 43  MET A CA  1 
ATOM   287  C  C   . MET A 1 40  ? -4.085  112.711 145.696 1.00 55.22  ? 43  MET A C   1 
ATOM   288  O  O   . MET A 1 40  ? -3.467  113.679 145.237 1.00 52.57  ? 43  MET A O   1 
ATOM   289  C  CB  . MET A 1 40  ? -5.746  112.385 143.858 1.00 54.07  ? 43  MET A CB  1 
ATOM   290  C  CG  . MET A 1 40  ? -6.352  111.501 142.762 1.00 56.07  ? 43  MET A CG  1 
ATOM   291  S  SD  . MET A 1 40  ? -6.479  112.377 141.190 1.00 81.51  ? 43  MET A SD  1 
ATOM   292  C  CE  . MET A 1 40  ? -4.756  112.300 140.650 1.00 59.32  ? 43  MET A CE  1 
ATOM   293  N  N   . ARG A 1 41  ? -4.172  112.495 146.989 1.00 49.79  ? 44  ARG A N   1 
ATOM   294  C  CA  . ARG A 1 41  ? -3.565  113.426 147.887 1.00 49.03  ? 44  ARG A CA  1 
ATOM   295  C  C   . ARG A 1 41  ? -2.096  113.348 147.683 1.00 50.22  ? 44  ARG A C   1 
ATOM   296  O  O   . ARG A 1 41  ? -1.558  112.299 147.660 1.00 48.31  ? 44  ARG A O   1 
ATOM   297  C  CB  . ARG A 1 41  ? -3.888  113.075 149.317 1.00 46.89  ? 44  ARG A CB  1 
ATOM   298  C  CG  . ARG A 1 41  ? -3.260  113.983 150.328 1.00 51.94  ? 44  ARG A CG  1 
ATOM   299  C  CD  . ARG A 1 41  ? -3.394  113.495 151.740 1.00 51.77  ? 44  ARG A CD  1 
ATOM   300  N  NE  . ARG A 1 41  ? -4.737  113.626 152.220 1.00 50.81  ? 44  ARG A NE  1 
ATOM   301  C  CZ  . ARG A 1 41  ? -5.142  113.163 153.375 1.00 55.07  ? 44  ARG A CZ  1 
ATOM   302  N  NH1 . ARG A 1 41  ? -4.306  112.558 154.160 1.00 55.63  ? 44  ARG A NH1 1 
ATOM   303  N  NH2 . ARG A 1 41  ? -6.379  113.306 153.738 1.00 50.01  ? 44  ARG A NH2 1 
ATOM   304  N  N   . PHE A 1 42  ? -1.479  114.494 147.512 1.00 42.18  ? 45  PHE A N   1 
ATOM   305  C  CA  . PHE A 1 42  ? -0.063  114.615 147.348 1.00 43.33  ? 45  PHE A CA  1 
ATOM   306  C  C   . PHE A 1 42  ? 0.401   114.555 145.924 1.00 53.62  ? 45  PHE A C   1 
ATOM   307  O  O   . PHE A 1 42  ? 1.472   115.003 145.616 1.00 52.84  ? 45  PHE A O   1 
ATOM   308  C  CB  . PHE A 1 42  ? 0.620   113.519 148.129 1.00 50.16  ? 45  PHE A CB  1 
ATOM   309  C  CG  . PHE A 1 42  ? 0.372   113.579 149.592 1.00 51.62  ? 45  PHE A CG  1 
ATOM   310  C  CD1 . PHE A 1 42  ? 0.465   114.756 150.250 1.00 48.62  ? 45  PHE A CD1 1 
ATOM   311  C  CD2 . PHE A 1 42  ? 0.043   112.468 150.290 1.00 51.89  ? 45  PHE A CD2 1 
ATOM   312  C  CE1 . PHE A 1 42  ? 0.233   114.831 151.578 1.00 52.39  ? 45  PHE A CE1 1 
ATOM   313  C  CE2 . PHE A 1 42  ? -0.192  112.535 151.621 1.00 51.32  ? 45  PHE A CE2 1 
ATOM   314  C  CZ  . PHE A 1 42  ? -0.094  113.719 152.264 1.00 49.57  ? 45  PHE A CZ  1 
ATOM   315  N  N   . ARG A 1 43  ? -0.450  114.048 145.058 1.00 49.07  ? 46  ARG A N   1 
ATOM   316  C  CA  . ARG A 1 43  ? -0.161  113.888 143.649 1.00 56.10  ? 46  ARG A CA  1 
ATOM   317  C  C   . ARG A 1 43  ? -0.215  115.177 142.857 1.00 49.29  ? 46  ARG A C   1 
ATOM   318  O  O   . ARG A 1 43  ? -0.749  116.145 143.282 1.00 48.55  ? 46  ARG A O   1 
ATOM   319  C  CB  . ARG A 1 43  ? -1.104  112.851 143.020 1.00 50.87  ? 46  ARG A CB  1 
ATOM   320  C  CG  . ARG A 1 43  ? -0.619  111.404 143.073 1.00 63.23  ? 46  ARG A CG  1 
ATOM   321  C  CD  . ARG A 1 43  ? -1.240  110.435 142.063 1.00 68.58  ? 46  ARG A CD  1 
ATOM   322  N  NE  . ARG A 1 43  ? -0.609  110.490 140.738 1.00 88.30  ? 46  ARG A NE  1 
ATOM   323  C  CZ  . ARG A 1 43  ? 0.245   109.599 140.229 1.00 86.87  ? 46  ARG A CZ  1 
ATOM   324  N  NH1 . ARG A 1 43  ? 0.597   108.522 140.898 1.00 81.75  ? 46  ARG A NH1 1 
ATOM   325  N  NH2 . ARG A 1 43  ? 0.757   109.783 139.032 1.00 75.25  ? 46  ARG A NH2 1 
ATOM   326  N  N   . ARG A 1 44  ? 0.367   115.160 141.686 1.00 51.60  ? 47  ARG A N   1 
ATOM   327  C  CA  . ARG A 1 44  ? 0.319   116.280 140.804 1.00 47.30  ? 47  ARG A CA  1 
ATOM   328  C  C   . ARG A 1 44  ? -1.114  116.394 140.383 1.00 40.37  ? 47  ARG A C   1 
ATOM   329  O  O   . ARG A 1 44  ? -1.780  115.427 140.310 1.00 41.01  ? 47  ARG A O   1 
ATOM   330  C  CB  . ARG A 1 44  ? 1.163   115.992 139.595 1.00 50.97  ? 47  ARG A CB  1 
ATOM   331  C  CG  . ARG A 1 44  ? 2.612   115.735 139.910 1.00 59.95  ? 47  ARG A CG  1 
ATOM   332  C  CD  . ARG A 1 44  ? 3.438   115.505 138.656 1.00 65.17  ? 47  ARG A CD  1 
ATOM   333  N  NE  . ARG A 1 44  ? 4.874   115.548 138.895 1.00 70.87  ? 47  ARG A NE  1 
ATOM   334  C  CZ  . ARG A 1 44  ? 5.624   114.487 139.138 1.00 67.88  ? 47  ARG A CZ  1 
ATOM   335  N  NH1 . ARG A 1 44  ? 5.080   113.294 139.180 1.00 67.49  ? 47  ARG A NH1 1 
ATOM   336  N  NH2 . ARG A 1 44  ? 6.915   114.615 139.323 1.00 55.85  ? 47  ARG A NH2 1 
ATOM   337  N  N   . PRO A 1 45  ? -1.597  117.582 140.122 1.00 36.30  ? 48  PRO A N   1 
ATOM   338  C  CA  . PRO A 1 45  ? -2.999  117.720 139.718 1.00 45.18  ? 48  PRO A CA  1 
ATOM   339  C  C   . PRO A 1 45  ? -3.236  117.175 138.313 1.00 48.68  ? 48  PRO A C   1 
ATOM   340  O  O   . PRO A 1 45  ? -2.363  117.216 137.441 1.00 40.26  ? 48  PRO A O   1 
ATOM   341  C  CB  . PRO A 1 45  ? -3.241  119.235 139.772 1.00 40.90  ? 48  PRO A CB  1 
ATOM   342  C  CG  . PRO A 1 45  ? -1.899  119.833 139.465 1.00 36.73  ? 48  PRO A CG  1 
ATOM   343  C  CD  . PRO A 1 45  ? -0.879  118.873 140.086 1.00 40.17  ? 48  PRO A CD  1 
ATOM   344  N  N   . GLU A 1 46  ? -4.435  116.643 138.117 1.00 47.21  ? 49  GLU A N   1 
ATOM   345  C  CA  . GLU A 1 46  ? -4.996  116.244 136.841 1.00 53.96  ? 49  GLU A CA  1 
ATOM   346  C  C   . GLU A 1 46  ? -6.043  117.257 136.401 1.00 51.54  ? 49  GLU A C   1 
ATOM   347  O  O   . GLU A 1 46  ? -6.742  117.833 137.242 1.00 49.88  ? 49  GLU A O   1 
ATOM   348  C  CB  . GLU A 1 46  ? -5.649  114.858 136.919 1.00 54.91  ? 49  GLU A CB  1 
ATOM   349  C  CG  . GLU A 1 46  ? -4.724  113.757 137.402 1.00 60.37  ? 49  GLU A CG  1 
ATOM   350  C  CD  . GLU A 1 46  ? -3.460  113.640 136.566 1.00 74.51  ? 49  GLU A CD  1 
ATOM   351  O  OE1 . GLU A 1 46  ? -3.521  113.902 135.334 1.00 78.93  ? 49  GLU A OE1 1 
ATOM   352  O  OE2 . GLU A 1 46  ? -2.404  113.290 137.147 1.00 76.38  ? 49  GLU A OE2 1 
ATOM   353  N  N   . PRO A 1 47  ? -6.185  117.497 135.101 1.00 46.55  ? 50  PRO A N   1 
ATOM   354  C  CA  . PRO A 1 47  ? -7.184  118.469 134.645 1.00 46.06  ? 50  PRO A CA  1 
ATOM   355  C  C   . PRO A 1 47  ? -8.598  118.003 134.950 1.00 49.23  ? 50  PRO A C   1 
ATOM   356  O  O   . PRO A 1 47  ? -8.877  116.808 135.063 1.00 46.38  ? 50  PRO A O   1 
ATOM   357  C  CB  . PRO A 1 47  ? -6.935  118.562 133.134 1.00 52.29  ? 50  PRO A CB  1 
ATOM   358  C  CG  . PRO A 1 47  ? -6.166  117.333 132.790 1.00 48.22  ? 50  PRO A CG  1 
ATOM   359  C  CD  . PRO A 1 47  ? -5.361  116.981 133.999 1.00 51.22  ? 50  PRO A CD  1 
ATOM   360  N  N   . LYS A 1 48  ? -9.487  118.977 135.120 1.00 48.68  ? 51  LYS A N   1 
ATOM   361  C  CA  . LYS A 1 48  ? -10.892 118.689 135.372 1.00 48.67  ? 51  LYS A CA  1 
ATOM   362  C  C   . LYS A 1 48  ? -11.512 117.973 134.175 1.00 59.63  ? 51  LYS A C   1 
ATOM   363  O  O   . LYS A 1 48  ? -11.493 118.495 133.054 1.00 54.54  ? 51  LYS A O   1 
ATOM   364  C  CB  . LYS A 1 48  ? -11.633 119.994 135.652 1.00 49.00  ? 51  LYS A CB  1 
ATOM   365  C  CG  . LYS A 1 48  ? -13.142 119.857 135.829 1.00 50.80  ? 51  LYS A CG  1 
ATOM   366  C  CD  . LYS A 1 48  ? -13.486 118.888 136.957 1.00 51.95  ? 51  LYS A CD  1 
ATOM   367  C  CE  . LYS A 1 48  ? -14.928 119.050 137.397 1.00 53.00  ? 51  LYS A CE  1 
ATOM   368  N  NZ  . LYS A 1 48  ? -15.270 118.122 138.508 1.00 63.22  ? 51  LYS A NZ  1 
ATOM   369  N  N   . LYS A 1 49  ? -12.049 116.775 134.408 1.00 61.73  ? 52  LYS A N   1 
ATOM   370  C  CA  . LYS A 1 49  ? -12.788 116.089 133.360 1.00 52.01  ? 52  LYS A CA  1 
ATOM   371  C  C   . LYS A 1 49  ? -13.949 116.967 132.912 1.00 57.68  ? 52  LYS A C   1 
ATOM   372  O  O   . LYS A 1 49  ? -14.546 117.674 133.736 1.00 58.74  ? 52  LYS A O   1 
ATOM   373  C  CB  . LYS A 1 49  ? -13.335 114.746 133.839 1.00 57.60  ? 52  LYS A CB  1 
ATOM   374  C  CG  . LYS A 1 49  ? -12.306 113.655 134.083 1.00 65.48  ? 52  LYS A CG  1 
ATOM   375  C  CD  . LYS A 1 49  ? -12.974 112.465 134.785 1.00 70.21  ? 52  LYS A CD  1 
ATOM   376  C  CE  . LYS A 1 49  ? -11.966 111.557 135.476 1.00 75.42  ? 52  LYS A CE  1 
ATOM   377  N  NZ  . LYS A 1 49  ? -11.130 110.789 134.511 1.00 75.58  ? 52  LYS A NZ  1 
ATOM   378  N  N   . PRO A 1 50  ? -14.281 116.964 131.623 1.00 59.03  ? 53  PRO A N   1 
ATOM   379  C  CA  . PRO A 1 50  ? -15.416 117.761 131.149 1.00 57.80  ? 53  PRO A CA  1 
ATOM   380  C  C   . PRO A 1 50  ? -16.722 117.290 131.762 1.00 62.43  ? 53  PRO A C   1 
ATOM   381  O  O   . PRO A 1 50  ? -16.909 116.107 132.057 1.00 64.90  ? 53  PRO A O   1 
ATOM   382  C  CB  . PRO A 1 50  ? -15.399 117.533 129.636 1.00 62.19  ? 53  PRO A CB  1 
ATOM   383  C  CG  . PRO A 1 50  ? -13.968 117.208 129.334 1.00 60.09  ? 53  PRO A CG  1 
ATOM   384  C  CD  . PRO A 1 50  ? -13.480 116.423 130.512 1.00 59.83  ? 53  PRO A CD  1 
ATOM   385  N  N   . TRP A 1 51  ? -17.629 118.241 131.956 1.00 61.76  ? 54  TRP A N   1 
ATOM   386  C  CA  . TRP A 1 51  ? -18.921 117.985 132.566 1.00 64.74  ? 54  TRP A CA  1 
ATOM   387  C  C   . TRP A 1 51  ? -20.020 118.345 131.579 1.00 69.19  ? 54  TRP A C   1 
ATOM   388  O  O   . TRP A 1 51  ? -19.868 119.253 130.755 1.00 69.59  ? 54  TRP A O   1 
ATOM   389  C  CB  . TRP A 1 51  ? -19.112 118.797 133.863 1.00 61.00  ? 54  TRP A CB  1 
ATOM   390  C  CG  . TRP A 1 51  ? -19.109 120.274 133.619 1.00 59.35  ? 54  TRP A CG  1 
ATOM   391  C  CD1 . TRP A 1 51  ? -20.166 121.045 133.227 1.00 60.41  ? 54  TRP A CD1 1 
ATOM   392  C  CD2 . TRP A 1 51  ? -17.987 121.157 133.720 1.00 59.82  ? 54  TRP A CD2 1 
ATOM   393  N  NE1 . TRP A 1 51  ? -19.771 122.354 133.080 1.00 56.54  ? 54  TRP A NE1 1 
ATOM   394  C  CE2 . TRP A 1 51  ? -18.438 122.449 133.379 1.00 58.14  ? 54  TRP A CE2 1 
ATOM   395  C  CE3 . TRP A 1 51  ? -16.644 120.981 134.067 1.00 56.33  ? 54  TRP A CE3 1 
ATOM   396  C  CZ2 . TRP A 1 51  ? -17.599 123.555 133.382 1.00 57.34  ? 54  TRP A CZ2 1 
ATOM   397  C  CZ3 . TRP A 1 51  ? -15.815 122.083 134.071 1.00 56.31  ? 54  TRP A CZ3 1 
ATOM   398  C  CH2 . TRP A 1 51  ? -16.295 123.353 133.731 1.00 54.02  ? 54  TRP A CH2 1 
ATOM   399  N  N   . SER A 1 52  ? -21.127 117.624 131.670 1.00 76.06  ? 55  SER A N   1 
ATOM   400  C  CA  . SER A 1 52  ? -22.330 117.992 130.946 1.00 80.33  ? 55  SER A CA  1 
ATOM   401  C  C   . SER A 1 52  ? -23.176 118.923 131.812 1.00 77.43  ? 55  SER A C   1 
ATOM   402  O  O   . SER A 1 52  ? -22.944 119.083 133.011 1.00 76.97  ? 55  SER A O   1 
ATOM   403  C  CB  . SER A 1 52  ? -23.111 116.740 130.546 1.00 83.49  ? 55  SER A CB  1 
ATOM   404  O  OG  . SER A 1 52  ? -23.104 115.793 131.606 1.00 87.58  ? 55  SER A OG  1 
ATOM   405  N  N   . GLY A 1 53  ? -24.161 119.545 131.195 1.00 73.80  ? 56  GLY A N   1 
ATOM   406  C  CA  . GLY A 1 53  ? -24.962 120.497 131.919 1.00 70.13  ? 56  GLY A CA  1 
ATOM   407  C  C   . GLY A 1 53  ? -24.224 121.806 132.111 1.00 69.88  ? 56  GLY A C   1 
ATOM   408  O  O   . GLY A 1 53  ? -23.161 122.060 131.534 1.00 70.81  ? 56  GLY A O   1 
ATOM   409  N  N   . VAL A 1 54  ? -24.816 122.656 132.943 1.00 66.11  ? 57  VAL A N   1 
ATOM   410  C  CA  . VAL A 1 54  ? -24.272 123.971 133.254 1.00 66.20  ? 57  VAL A CA  1 
ATOM   411  C  C   . VAL A 1 54  ? -23.716 123.939 134.671 1.00 68.51  ? 57  VAL A C   1 
ATOM   412  O  O   . VAL A 1 54  ? -24.373 123.438 135.593 1.00 70.31  ? 57  VAL A O   1 
ATOM   413  C  CB  . VAL A 1 54  ? -25.334 125.073 133.102 1.00 62.84  ? 57  VAL A CB  1 
ATOM   414  C  CG1 . VAL A 1 54  ? -24.716 126.425 133.346 1.00 59.00  ? 57  VAL A CG1 1 
ATOM   415  C  CG2 . VAL A 1 54  ? -25.960 125.019 131.712 1.00 65.29  ? 57  VAL A CG2 1 
ATOM   416  N  N   . TRP A 1 55  ? -22.506 124.464 134.841 1.00 64.02  ? 58  TRP A N   1 
ATOM   417  C  CA  . TRP A 1 55  ? -21.905 124.561 136.162 1.00 59.52  ? 58  TRP A CA  1 
ATOM   418  C  C   . TRP A 1 55  ? -22.427 125.817 136.855 1.00 62.09  ? 58  TRP A C   1 
ATOM   419  O  O   . TRP A 1 55  ? -22.298 126.926 136.323 1.00 62.72  ? 58  TRP A O   1 
ATOM   420  C  CB  . TRP A 1 55  ? -20.380 124.582 136.058 1.00 55.95  ? 58  TRP A CB  1 
ATOM   421  C  CG  . TRP A 1 55  ? -19.702 124.411 137.387 1.00 59.38  ? 58  TRP A CG  1 
ATOM   422  C  CD1 . TRP A 1 55  ? -19.493 125.374 138.331 1.00 50.60  ? 58  TRP A CD1 1 
ATOM   423  C  CD2 . TRP A 1 55  ? -19.160 123.198 137.923 1.00 54.01  ? 58  TRP A CD2 1 
ATOM   424  N  NE1 . TRP A 1 55  ? -18.847 124.838 139.412 1.00 57.29  ? 58  TRP A NE1 1 
ATOM   425  C  CE2 . TRP A 1 55  ? -18.635 123.503 139.191 1.00 53.21  ? 58  TRP A CE2 1 
ATOM   426  C  CE3 . TRP A 1 55  ? -19.064 121.886 137.450 1.00 57.11  ? 58  TRP A CE3 1 
ATOM   427  C  CZ2 . TRP A 1 55  ? -18.020 122.545 139.998 1.00 47.60  ? 58  TRP A CZ2 1 
ATOM   428  C  CZ3 . TRP A 1 55  ? -18.454 120.932 138.252 1.00 57.81  ? 58  TRP A CZ3 1 
ATOM   429  C  CH2 . TRP A 1 55  ? -17.942 121.268 139.513 1.00 52.74  ? 58  TRP A CH2 1 
ATOM   430  N  N   . ASN A 1 56  ? -23.039 125.640 138.027 1.00 62.52  ? 59  ASN A N   1 
ATOM   431  C  CA  . ASN A 1 56  ? -23.493 126.762 138.848 1.00 66.41  ? 59  ASN A CA  1 
ATOM   432  C  C   . ASN A 1 56  ? -22.253 127.475 139.375 1.00 63.50  ? 59  ASN A C   1 
ATOM   433  O  O   . ASN A 1 56  ? -21.592 126.999 140.299 1.00 69.49  ? 59  ASN A O   1 
ATOM   434  C  CB  . ASN A 1 56  ? -24.397 126.266 139.978 1.00 68.43  ? 59  ASN A CB  1 
ATOM   435  C  CG  . ASN A 1 56  ? -25.076 127.401 140.751 1.00 73.48  ? 59  ASN A CG  1 
ATOM   436  O  OD1 . ASN A 1 56  ? -24.965 128.569 140.379 1.00 74.68  ? 59  ASN A OD1 1 
ATOM   437  N  ND2 . ASN A 1 56  ? -25.794 127.046 141.837 1.00 87.39  ? 59  ASN A ND2 1 
ATOM   438  N  N   . ALA A 1 57  ? -21.902 128.600 138.757 1.00 57.53  ? 60  ALA A N   1 
ATOM   439  C  CA  . ALA A 1 57  ? -20.748 129.371 139.200 1.00 54.28  ? 60  ALA A CA  1 
ATOM   440  C  C   . ALA A 1 57  ? -21.199 130.677 139.835 1.00 56.59  ? 60  ALA A C   1 
ATOM   441  O  O   . ALA A 1 57  ? -20.663 131.746 139.523 1.00 54.95  ? 60  ALA A O   1 
ATOM   442  C  CB  . ALA A 1 57  ? -19.794 129.648 138.034 1.00 48.65  ? 60  ALA A CB  1 
ATOM   443  N  N   . SER A 1 58  ? -22.186 130.607 140.726 1.00 61.49  ? 61  SER A N   1 
ATOM   444  C  CA  . SER A 1 58  ? -22.737 131.806 141.345 1.00 62.72  ? 61  SER A CA  1 
ATOM   445  C  C   . SER A 1 58  ? -22.216 132.058 142.757 1.00 57.63  ? 61  SER A C   1 
ATOM   446  O  O   . SER A 1 58  ? -22.399 133.165 143.278 1.00 56.42  ? 61  SER A O   1 
ATOM   447  C  CB  . SER A 1 58  ? -24.270 131.725 141.374 1.00 62.73  ? 61  SER A CB  1 
ATOM   448  O  OG  . SER A 1 58  ? -24.702 130.615 142.140 1.00 69.48  ? 61  SER A OG  1 
ATOM   449  N  N   . THR A 1 59  ? -21.568 131.078 143.387 1.00 55.60  ? 62  THR A N   1 
ATOM   450  C  CA  . THR A 1 59  ? -21.126 131.211 144.769 1.00 58.95  ? 62  THR A CA  1 
ATOM   451  C  C   . THR A 1 59  ? -19.683 130.741 144.916 1.00 55.19  ? 62  THR A C   1 
ATOM   452  O  O   . THR A 1 59  ? -19.246 129.796 144.250 1.00 58.13  ? 62  THR A O   1 
ATOM   453  C  CB  . THR A 1 59  ? -22.013 130.403 145.729 1.00 57.38  ? 62  THR A CB  1 
ATOM   454  O  OG1 . THR A 1 59  ? -21.794 129.006 145.513 1.00 59.58  ? 62  THR A OG1 1 
ATOM   455  C  CG2 . THR A 1 59  ? -23.479 130.703 145.499 1.00 64.26  ? 62  THR A CG2 1 
ATOM   456  N  N   . TYR A 1 60  ? -18.952 131.418 145.803 1.00 47.15  ? 63  TYR A N   1 
ATOM   457  C  CA  . TYR A 1 60  ? -17.585 131.086 146.195 1.00 47.44  ? 63  TYR A CA  1 
ATOM   458  C  C   . TYR A 1 60  ? -17.403 129.594 146.481 1.00 46.98  ? 63  TYR A C   1 
ATOM   459  O  O   . TYR A 1 60  ? -18.311 128.957 147.023 1.00 46.38  ? 63  TYR A O   1 
ATOM   460  C  CB  . TYR A 1 60  ? -17.210 131.893 147.434 1.00 44.72  ? 63  TYR A CB  1 
ATOM   461  C  CG  . TYR A 1 60  ? -16.548 133.221 147.160 1.00 45.80  ? 63  TYR A CG  1 
ATOM   462  C  CD1 . TYR A 1 60  ? -15.647 133.373 146.123 1.00 50.16  ? 63  TYR A CD1 1 
ATOM   463  C  CD2 . TYR A 1 60  ? -16.817 134.318 147.953 1.00 46.30  ? 63  TYR A CD2 1 
ATOM   464  C  CE1 . TYR A 1 60  ? -15.028 134.592 145.892 1.00 48.80  ? 63  TYR A CE1 1 
ATOM   465  C  CE2 . TYR A 1 60  ? -16.213 135.530 147.733 1.00 43.10  ? 63  TYR A CE2 1 
ATOM   466  C  CZ  . TYR A 1 60  ? -15.318 135.665 146.704 1.00 48.82  ? 63  TYR A CZ  1 
ATOM   467  O  OH  . TYR A 1 60  ? -14.704 136.879 146.501 1.00 55.15  ? 63  TYR A OH  1 
ATOM   468  N  N   . PRO A 1 61  ? -16.240 128.993 146.134 1.00 51.44  ? 64  PRO A N   1 
ATOM   469  C  CA  . PRO A 1 61  ? -15.997 127.580 146.479 1.00 46.54  ? 64  PRO A CA  1 
ATOM   470  C  C   . PRO A 1 61  ? -15.405 127.382 147.864 1.00 47.35  ? 64  PRO A C   1 
ATOM   471  O  O   . PRO A 1 61  ? -15.106 128.350 148.560 1.00 46.36  ? 64  PRO A O   1 
ATOM   472  C  CB  . PRO A 1 61  ? -14.981 127.141 145.423 1.00 37.72  ? 64  PRO A CB  1 
ATOM   473  C  CG  . PRO A 1 61  ? -14.155 128.374 145.249 1.00 42.88  ? 64  PRO A CG  1 
ATOM   474  C  CD  . PRO A 1 61  ? -15.149 129.538 145.306 1.00 42.23  ? 64  PRO A CD  1 
ATOM   475  N  N   . ASN A 1 62  ? -15.178 126.119 148.225 1.00 46.41  ? 65  ASN A N   1 
ATOM   476  C  CA  . ASN A 1 62  ? -14.444 125.751 149.426 1.00 47.55  ? 65  ASN A CA  1 
ATOM   477  C  C   . ASN A 1 62  ? -13.012 126.278 149.402 1.00 49.73  ? 65  ASN A C   1 
ATOM   478  O  O   . ASN A 1 62  ? -12.389 126.405 148.344 1.00 51.11  ? 65  ASN A O   1 
ATOM   479  C  CB  . ASN A 1 62  ? -14.404 124.233 149.565 1.00 48.46  ? 65  ASN A CB  1 
ATOM   480  C  CG  . ASN A 1 62  ? -15.777 123.629 149.651 1.00 54.99  ? 65  ASN A CG  1 
ATOM   481  O  OD1 . ASN A 1 62  ? -16.698 124.220 150.227 1.00 55.32  ? 65  ASN A OD1 1 
ATOM   482  N  ND2 . ASN A 1 62  ? -15.932 122.445 149.068 1.00 56.40  ? 65  ASN A ND2 1 
ATOM   483  N  N   . ASN A 1 63  ? -12.478 126.567 150.593 1.00 45.19  ? 66  ASN A N   1 
ATOM   484  C  CA  . ASN A 1 63  ? -11.056 126.839 150.738 1.00 41.32  ? 66  ASN A CA  1 
ATOM   485  C  C   . ASN A 1 63  ? -10.312 125.528 150.965 1.00 39.05  ? 66  ASN A C   1 
ATOM   486  O  O   . ASN A 1 63  ? -10.899 124.521 151.365 1.00 44.89  ? 66  ASN A O   1 
ATOM   487  C  CB  . ASN A 1 63  ? -10.795 127.813 151.887 1.00 41.67  ? 66  ASN A CB  1 
ATOM   488  C  CG  . ASN A 1 63  ? -11.623 129.083 151.782 1.00 43.38  ? 66  ASN A CG  1 
ATOM   489  O  OD1 . ASN A 1 63  ? -12.211 129.535 152.767 1.00 47.75  ? 66  ASN A OD1 1 
ATOM   490  N  ND2 . ASN A 1 63  ? -11.665 129.671 150.596 1.00 40.49  ? 66  ASN A ND2 1 
ATOM   491  N  N   . CYS A 1 64  ? -9.009  125.538 150.682 1.00 38.27  ? 67  CYS A N   1 
ATOM   492  C  CA  . CYS A 1 64  ? -8.209  124.340 150.903 1.00 34.86  ? 67  CYS A CA  1 
ATOM   493  C  C   . CYS A 1 64  ? -8.013  124.103 152.405 1.00 47.45  ? 67  CYS A C   1 
ATOM   494  O  O   . CYS A 1 64  ? -8.172  125.006 153.238 1.00 39.67  ? 67  CYS A O   1 
ATOM   495  C  CB  . CYS A 1 64  ? -6.864  124.447 150.181 1.00 36.20  ? 67  CYS A CB  1 
ATOM   496  S  SG  . CYS A 1 64  ? -7.018  124.563 148.328 0.74 37.49  ? 67  CYS A SG  1 
ATOM   497  N  N   . GLN A 1 65  ? -7.709  122.849 152.744 1.00 44.86  ? 68  GLN A N   1 
ATOM   498  C  CA  . GLN A 1 65  ? -7.493  122.452 154.125 1.00 40.98  ? 68  GLN A CA  1 
ATOM   499  C  C   . GLN A 1 65  ? -6.223  123.100 154.650 1.00 42.90  ? 68  GLN A C   1 
ATOM   500  O  O   . GLN A 1 65  ? -5.138  122.872 154.110 1.00 42.44  ? 68  GLN A O   1 
ATOM   501  C  CB  . GLN A 1 65  ? -7.404  120.932 154.225 1.00 41.00  ? 68  GLN A CB  1 
ATOM   502  C  CG  . GLN A 1 65  ? -8.747  120.215 154.033 1.00 44.46  ? 68  GLN A CG  1 
ATOM   503  C  CD  . GLN A 1 65  ? -9.588  120.158 155.311 1.00 54.36  ? 68  GLN A CD  1 
ATOM   504  O  OE1 . GLN A 1 65  ? -9.306  120.852 156.290 1.00 46.17  ? 68  GLN A OE1 1 
ATOM   505  N  NE2 . GLN A 1 65  ? -10.629 119.324 155.301 1.00 54.13  ? 68  GLN A NE2 1 
ATOM   506  N  N   . GLN A 1 66  ? -6.350  123.903 155.707 1.00 43.26  ? 69  GLN A N   1 
ATOM   507  C  CA  . GLN A 1 66  ? -5.210  124.661 156.198 1.00 42.05  ? 69  GLN A CA  1 
ATOM   508  C  C   . GLN A 1 66  ? -5.291  124.852 157.706 1.00 47.34  ? 69  GLN A C   1 
ATOM   509  O  O   . GLN A 1 66  ? -6.347  124.696 158.329 1.00 43.35  ? 69  GLN A O   1 
ATOM   510  C  CB  . GLN A 1 66  ? -5.124  126.031 155.526 1.00 41.62  ? 69  GLN A CB  1 
ATOM   511  C  CG  . GLN A 1 66  ? -6.406  126.850 155.623 1.00 36.87  ? 69  GLN A CG  1 
ATOM   512  C  CD  . GLN A 1 66  ? -6.406  128.026 154.666 1.00 43.74  ? 69  GLN A CD  1 
ATOM   513  O  OE1 . GLN A 1 66  ? -5.852  129.085 154.963 1.00 41.76  ? 69  GLN A OE1 1 
ATOM   514  N  NE2 . GLN A 1 66  ? -7.003  127.834 153.488 1.00 44.10  ? 69  GLN A NE2 1 
ATOM   515  N  N   . TYR A 1 67  ? -4.136  125.193 158.274 1.00 46.10  ? 70  TYR A N   1 
ATOM   516  C  CA  . TYR A 1 67  ? -4.063  125.764 159.609 1.00 42.31  ? 70  TYR A CA  1 
ATOM   517  C  C   . TYR A 1 67  ? -4.936  127.012 159.683 1.00 47.87  ? 70  TYR A C   1 
ATOM   518  O  O   . TYR A 1 67  ? -5.003  127.799 158.735 1.00 48.27  ? 70  TYR A O   1 
ATOM   519  C  CB  . TYR A 1 67  ? -2.599  126.093 159.925 1.00 43.06  ? 70  TYR A CB  1 
ATOM   520  C  CG  . TYR A 1 67  ? -2.345  126.843 161.210 1.00 43.66  ? 70  TYR A CG  1 
ATOM   521  C  CD1 . TYR A 1 67  ? -2.194  126.155 162.419 1.00 45.97  ? 70  TYR A CD1 1 
ATOM   522  C  CD2 . TYR A 1 67  ? -2.230  128.234 161.222 1.00 42.90  ? 70  TYR A CD2 1 
ATOM   523  C  CE1 . TYR A 1 67  ? -1.962  126.828 163.609 1.00 45.78  ? 70  TYR A CE1 1 
ATOM   524  C  CE2 . TYR A 1 67  ? -1.995  128.921 162.412 1.00 46.11  ? 70  TYR A CE2 1 
ATOM   525  C  CZ  . TYR A 1 67  ? -1.862  128.203 163.603 1.00 47.66  ? 70  TYR A CZ  1 
ATOM   526  O  OH  . TYR A 1 67  ? -1.620  128.844 164.794 1.00 50.55  ? 70  TYR A OH  1 
ATOM   527  N  N   . VAL A 1 68  ? -5.637  127.177 160.802 1.00 42.55  ? 71  VAL A N   1 
ATOM   528  C  CA  . VAL A 1 68  ? -6.442  128.366 161.063 1.00 44.26  ? 71  VAL A CA  1 
ATOM   529  C  C   . VAL A 1 68  ? -5.882  129.093 162.284 1.00 50.28  ? 71  VAL A C   1 
ATOM   530  O  O   . VAL A 1 68  ? -5.728  128.494 163.357 1.00 43.59  ? 71  VAL A O   1 
ATOM   531  C  CB  . VAL A 1 68  ? -7.920  128.003 161.270 1.00 50.59  ? 71  VAL A CB  1 
ATOM   532  C  CG1 . VAL A 1 68  ? -8.756  129.266 161.488 1.00 45.37  ? 71  VAL A CG1 1 
ATOM   533  C  CG2 . VAL A 1 68  ? -8.414  127.185 160.081 1.00 47.44  ? 71  VAL A CG2 1 
ATOM   534  N  N   . ASP A 1 69  ? -5.579  130.382 162.108 1.00 47.73  ? 72  ASP A N   1 
ATOM   535  C  CA  . ASP A 1 69  ? -5.047  131.232 163.167 1.00 42.47  ? 72  ASP A CA  1 
ATOM   536  C  C   . ASP A 1 69  ? -6.137  131.525 164.198 1.00 47.14  ? 72  ASP A C   1 
ATOM   537  O  O   . ASP A 1 69  ? -7.170  132.114 163.865 1.00 48.25  ? 72  ASP A O   1 
ATOM   538  C  CB  . ASP A 1 69  ? -4.505  132.519 162.540 1.00 41.20  ? 72  ASP A CB  1 
ATOM   539  C  CG  . ASP A 1 69  ? -4.078  133.564 163.563 1.00 50.06  ? 72  ASP A CG  1 
ATOM   540  O  OD1 . ASP A 1 69  ? -3.842  133.232 164.742 1.00 46.54  ? 72  ASP A OD1 1 
ATOM   541  O  OD2 . ASP A 1 69  ? -3.969  134.747 163.174 1.00 46.98  ? 72  ASP A OD2 1 
ATOM   542  N  N   . GLU A 1 70  ? -5.906  131.102 165.451 1.00 48.91  ? 73  GLU A N   1 
ATOM   543  C  CA  . GLU A 1 70  ? -6.799  131.371 166.576 1.00 45.23  ? 73  GLU A CA  1 
ATOM   544  C  C   . GLU A 1 70  ? -6.104  132.146 167.697 1.00 51.31  ? 73  GLU A C   1 
ATOM   545  O  O   . GLU A 1 70  ? -6.586  132.145 168.842 1.00 52.22  ? 73  GLU A O   1 
ATOM   546  C  CB  . GLU A 1 70  ? -7.374  130.066 167.129 1.00 43.31  ? 73  GLU A CB  1 
ATOM   547  C  CG  . GLU A 1 70  ? -8.117  129.203 166.132 1.00 56.46  ? 73  GLU A CG  1 
ATOM   548  C  CD  . GLU A 1 70  ? -8.056  127.704 166.477 1.00 66.23  ? 73  GLU A CD  1 
ATOM   549  O  OE1 . GLU A 1 70  ? -8.085  127.352 167.682 1.00 61.28  ? 73  GLU A OE1 1 
ATOM   550  O  OE2 . GLU A 1 70  ? -7.965  126.874 165.537 1.00 73.33  ? 73  GLU A OE2 1 
ATOM   551  N  N   . GLN A 1 71  ? -4.983  132.811 167.399 1.00 44.36  ? 74  GLN A N   1 
ATOM   552  C  CA  . GLN A 1 71  ? -4.280  133.577 168.426 1.00 45.27  ? 74  GLN A CA  1 
ATOM   553  C  C   . GLN A 1 71  ? -5.157  134.669 169.025 1.00 45.83  ? 74  GLN A C   1 
ATOM   554  O  O   . GLN A 1 71  ? -5.063  134.959 170.222 1.00 57.35  ? 74  GLN A O   1 
ATOM   555  C  CB  . GLN A 1 71  ? -3.011  134.197 167.849 1.00 45.83  ? 74  GLN A CB  1 
ATOM   556  C  CG  . GLN A 1 71  ? -1.770  133.391 168.076 1.00 49.19  ? 74  GLN A CG  1 
ATOM   557  C  CD  . GLN A 1 71  ? -1.351  133.393 169.527 1.00 58.87  ? 74  GLN A CD  1 
ATOM   558  O  OE1 . GLN A 1 71  ? -1.370  134.434 170.191 1.00 61.51  ? 74  GLN A OE1 1 
ATOM   559  N  NE2 . GLN A 1 71  ? -0.982  132.221 170.038 1.00 53.21  ? 74  GLN A NE2 1 
ATOM   560  N  N   . PHE A 1 72  ? -6.005  135.292 168.216 1.00 41.71  ? 75  PHE A N   1 
ATOM   561  C  CA  . PHE A 1 72  ? -6.798  136.454 168.621 1.00 44.52  ? 75  PHE A CA  1 
ATOM   562  C  C   . PHE A 1 72  ? -8.253  136.233 168.227 1.00 48.04  ? 75  PHE A C   1 
ATOM   563  O  O   . PHE A 1 72  ? -8.759  136.875 167.302 1.00 49.34  ? 75  PHE A O   1 
ATOM   564  C  CB  . PHE A 1 72  ? -6.255  137.733 167.977 1.00 40.89  ? 75  PHE A CB  1 
ATOM   565  C  CG  . PHE A 1 72  ? -4.797  137.973 168.246 1.00 40.70  ? 75  PHE A CG  1 
ATOM   566  C  CD1 . PHE A 1 72  ? -4.360  138.316 169.520 1.00 32.50  ? 75  PHE A CD1 1 
ATOM   567  C  CD2 . PHE A 1 72  ? -3.857  137.844 167.226 1.00 31.54  ? 75  PHE A CD2 1 
ATOM   568  C  CE1 . PHE A 1 72  ? -3.000  138.536 169.770 1.00 35.60  ? 75  PHE A CE1 1 
ATOM   569  C  CE2 . PHE A 1 72  ? -2.507  138.046 167.463 1.00 36.20  ? 75  PHE A CE2 1 
ATOM   570  C  CZ  . PHE A 1 72  ? -2.072  138.398 168.741 1.00 42.81  ? 75  PHE A CZ  1 
ATOM   571  N  N   . PRO A 1 73  ? -8.961  135.339 168.919 1.00 55.85  ? 76  PRO A N   1 
ATOM   572  C  CA  . PRO A 1 73  ? -10.304 134.946 168.461 1.00 59.51  ? 76  PRO A CA  1 
ATOM   573  C  C   . PRO A 1 73  ? -11.274 136.123 168.416 1.00 60.47  ? 76  PRO A C   1 
ATOM   574  O  O   . PRO A 1 73  ? -11.325 136.956 169.329 1.00 45.68  ? 76  PRO A O   1 
ATOM   575  C  CB  . PRO A 1 73  ? -10.726 133.895 169.491 1.00 52.93  ? 76  PRO A CB  1 
ATOM   576  C  CG  . PRO A 1 73  ? -9.436  133.341 169.983 1.00 53.96  ? 76  PRO A CG  1 
ATOM   577  C  CD  . PRO A 1 73  ? -8.537  134.543 170.081 1.00 52.58  ? 76  PRO A CD  1 
ATOM   578  N  N   . GLY A 1 74  ? -12.024 136.206 167.315 1.00 61.92  ? 77  GLY A N   1 
ATOM   579  C  CA  . GLY A 1 74  ? -12.907 137.330 167.084 1.00 66.92  ? 77  GLY A CA  1 
ATOM   580  C  C   . GLY A 1 74  ? -12.240 138.626 166.647 1.00 61.42  ? 77  GLY A C   1 
ATOM   581  O  O   . GLY A 1 74  ? -12.950 139.565 166.269 1.00 61.12  ? 77  GLY A O   1 
ATOM   582  N  N   . PHE A 1 75  ? -10.911 138.723 166.692 1.00 47.33  ? 78  PHE A N   1 
ATOM   583  C  CA  . PHE A 1 75  ? -10.220 139.930 166.256 1.00 46.49  ? 78  PHE A CA  1 
ATOM   584  C  C   . PHE A 1 75  ? -10.217 139.996 164.728 1.00 49.33  ? 78  PHE A C   1 
ATOM   585  O  O   . PHE A 1 75  ? -9.864  139.021 164.059 1.00 50.48  ? 78  PHE A O   1 
ATOM   586  C  CB  . PHE A 1 75  ? -8.799  139.937 166.819 1.00 44.28  ? 78  PHE A CB  1 
ATOM   587  C  CG  . PHE A 1 75  ? -7.989  141.146 166.449 1.00 46.60  ? 78  PHE A CG  1 
ATOM   588  C  CD1 . PHE A 1 75  ? -8.432  142.424 166.756 1.00 43.95  ? 78  PHE A CD1 1 
ATOM   589  C  CD2 . PHE A 1 75  ? -6.755  141.000 165.830 1.00 43.20  ? 78  PHE A CD2 1 
ATOM   590  C  CE1 . PHE A 1 75  ? -7.669  143.539 166.426 1.00 39.33  ? 78  PHE A CE1 1 
ATOM   591  C  CE2 . PHE A 1 75  ? -5.987  142.106 165.509 1.00 37.17  ? 78  PHE A CE2 1 
ATOM   592  C  CZ  . PHE A 1 75  ? -6.448  143.376 165.807 1.00 38.85  ? 78  PHE A CZ  1 
ATOM   593  N  N   . SER A 1 76  ? -10.636 141.138 164.175 1.00 44.51  ? 79  SER A N   1 
ATOM   594  C  CA  . SER A 1 76  ? -10.769 141.244 162.723 1.00 45.18  ? 79  SER A CA  1 
ATOM   595  C  C   . SER A 1 76  ? -9.418  141.272 162.023 1.00 45.88  ? 79  SER A C   1 
ATOM   596  O  O   . SER A 1 76  ? -9.304  140.771 160.897 1.00 45.77  ? 79  SER A O   1 
ATOM   597  C  CB  . SER A 1 76  ? -11.571 142.488 162.342 1.00 35.78  ? 79  SER A CB  1 
ATOM   598  O  OG  . SER A 1 76  ? -10.843 143.659 162.648 1.00 48.74  ? 79  SER A OG  1 
ATOM   599  N  N   . GLY A 1 77  ? -8.393  141.851 162.660 1.00 44.86  ? 80  GLY A N   1 
ATOM   600  C  CA  . GLY A 1 77  ? -7.076  141.908 162.045 1.00 40.48  ? 80  GLY A CA  1 
ATOM   601  C  C   . GLY A 1 77  ? -6.525  140.547 161.672 1.00 42.20  ? 80  GLY A C   1 
ATOM   602  O  O   . GLY A 1 77  ? -5.842  140.405 160.651 1.00 44.20  ? 80  GLY A O   1 
ATOM   603  N  N   . SER A 1 78  ? -6.820  139.526 162.473 1.00 41.31  ? 81  SER A N   1 
ATOM   604  C  CA  . SER A 1 78  ? -6.324  138.186 162.189 1.00 45.11  ? 81  SER A CA  1 
ATOM   605  C  C   . SER A 1 78  ? -7.334  137.357 161.411 1.00 50.42  ? 81  SER A C   1 
ATOM   606  O  O   . SER A 1 78  ? -6.952  136.595 160.510 1.00 49.89  ? 81  SER A O   1 
ATOM   607  C  CB  . SER A 1 78  ? -5.929  137.460 163.488 1.00 46.10  ? 81  SER A CB  1 
ATOM   608  O  OG  . SER A 1 78  ? -6.966  137.430 164.468 1.00 45.03  ? 81  SER A OG  1 
ATOM   609  N  N   . GLU A 1 79  ? -8.622  137.507 161.712 1.00 45.33  ? 82  GLU A N   1 
ATOM   610  C  CA  . GLU A 1 79  ? -9.593  136.601 161.120 1.00 49.55  ? 82  GLU A CA  1 
ATOM   611  C  C   . GLU A 1 79  ? -9.942  136.967 159.687 1.00 47.48  ? 82  GLU A C   1 
ATOM   612  O  O   . GLU A 1 79  ? -10.421 136.104 158.948 1.00 52.23  ? 82  GLU A O   1 
ATOM   613  C  CB  . GLU A 1 79  ? -10.847 136.524 161.993 1.00 53.47  ? 82  GLU A CB  1 
ATOM   614  C  CG  . GLU A 1 79  ? -10.839 135.291 162.898 1.00 50.84  ? 82  GLU A CG  1 
ATOM   615  C  CD  . GLU A 1 79  ? -11.554 135.525 164.198 1.00 66.25  ? 82  GLU A CD  1 
ATOM   616  O  OE1 . GLU A 1 79  ? -12.359 136.474 164.228 1.00 71.87  ? 82  GLU A OE1 1 
ATOM   617  O  OE2 . GLU A 1 79  ? -11.310 134.782 165.188 1.00 67.53  ? 82  GLU A OE2 1 
ATOM   618  N  N   . MET A 1 80  ? -9.670  138.199 159.259 1.00 45.82  ? 83  MET A N   1 
ATOM   619  C  CA  . MET A 1 80  ? -9.851  138.547 157.857 1.00 41.21  ? 83  MET A CA  1 
ATOM   620  C  C   . MET A 1 80  ? -8.922  137.753 156.933 1.00 46.50  ? 83  MET A C   1 
ATOM   621  O  O   . MET A 1 80  ? -9.099  137.799 155.708 1.00 45.01  ? 83  MET A O   1 
ATOM   622  C  CB  . MET A 1 80  ? -9.630  140.052 157.665 1.00 40.09  ? 83  MET A CB  1 
ATOM   623  C  CG  . MET A 1 80  ? -8.179  140.490 157.802 1.00 38.41  ? 83  MET A CG  1 
ATOM   624  S  SD  . MET A 1 80  ? -7.909  142.249 157.464 1.00 45.70  ? 83  MET A SD  1 
ATOM   625  C  CE  . MET A 1 80  ? -8.010  142.320 155.683 1.00 41.45  ? 83  MET A CE  1 
ATOM   626  N  N   . TRP A 1 81  ? -7.943  137.035 157.483 1.00 44.42  ? 84  TRP A N   1 
ATOM   627  C  CA  . TRP A 1 81  ? -7.036  136.205 156.705 1.00 41.08  ? 84  TRP A CA  1 
ATOM   628  C  C   . TRP A 1 81  ? -7.395  134.723 156.729 1.00 42.52  ? 84  TRP A C   1 
ATOM   629  O  O   . TRP A 1 81  ? -6.872  133.965 155.906 1.00 44.81  ? 84  TRP A O   1 
ATOM   630  C  CB  . TRP A 1 81  ? -5.603  136.405 157.208 1.00 37.10  ? 84  TRP A CB  1 
ATOM   631  C  CG  . TRP A 1 81  ? -5.196  137.840 157.135 1.00 41.01  ? 84  TRP A CG  1 
ATOM   632  C  CD1 . TRP A 1 81  ? -4.963  138.683 158.175 1.00 45.80  ? 84  TRP A CD1 1 
ATOM   633  C  CD2 . TRP A 1 81  ? -5.001  138.611 155.942 1.00 44.59  ? 84  TRP A CD2 1 
ATOM   634  N  NE1 . TRP A 1 81  ? -4.627  139.936 157.706 1.00 45.12  ? 84  TRP A NE1 1 
ATOM   635  C  CE2 . TRP A 1 81  ? -4.640  139.914 156.339 1.00 44.32  ? 84  TRP A CE2 1 
ATOM   636  C  CE3 . TRP A 1 81  ? -5.090  138.322 154.579 1.00 43.05  ? 84  TRP A CE3 1 
ATOM   637  C  CZ2 . TRP A 1 81  ? -4.368  140.927 155.421 1.00 43.45  ? 84  TRP A CZ2 1 
ATOM   638  C  CZ3 . TRP A 1 81  ? -4.818  139.333 153.668 1.00 48.80  ? 84  TRP A CZ3 1 
ATOM   639  C  CH2 . TRP A 1 81  ? -4.461  140.617 154.094 1.00 43.85  ? 84  TRP A CH2 1 
ATOM   640  N  N   . ASN A 1 82  ? -8.287  134.301 157.625 1.00 42.68  ? 85  ASN A N   1 
ATOM   641  C  CA  . ASN A 1 82  ? -8.669  132.905 157.784 1.00 43.89  ? 85  ASN A CA  1 
ATOM   642  C  C   . ASN A 1 82  ? -9.660  132.467 156.705 1.00 44.40  ? 85  ASN A C   1 
ATOM   643  O  O   . ASN A 1 82  ? -10.303 133.300 156.061 1.00 41.35  ? 85  ASN A O   1 
ATOM   644  C  CB  . ASN A 1 82  ? -9.293  132.695 159.159 1.00 43.81  ? 85  ASN A CB  1 
ATOM   645  C  CG  . ASN A 1 82  ? -8.262  132.637 160.273 1.00 48.94  ? 85  ASN A CG  1 
ATOM   646  O  OD1 . ASN A 1 82  ? -7.114  132.227 160.066 1.00 45.07  ? 85  ASN A OD1 1 
ATOM   647  N  ND2 . ASN A 1 82  ? -8.675  133.036 161.469 1.00 43.93  ? 85  ASN A ND2 1 
ATOM   648  N  N   . PRO A 1 83  ? -9.817  131.156 156.503 1.00 42.78  ? 86  PRO A N   1 
ATOM   649  C  CA  . PRO A 1 83  ? -10.829 130.664 155.551 1.00 47.02  ? 86  PRO A CA  1 
ATOM   650  C  C   . PRO A 1 83  ? -12.231 131.113 155.937 1.00 46.05  ? 86  PRO A C   1 
ATOM   651  O  O   . PRO A 1 83  ? -12.701 130.848 157.045 1.00 48.25  ? 86  PRO A O   1 
ATOM   652  C  CB  . PRO A 1 83  ? -10.685 129.140 155.647 1.00 43.52  ? 86  PRO A CB  1 
ATOM   653  C  CG  . PRO A 1 83  ? -9.317  128.917 156.146 1.00 39.67  ? 86  PRO A CG  1 
ATOM   654  C  CD  . PRO A 1 83  ? -8.979  130.063 157.030 1.00 44.77  ? 86  PRO A CD  1 
ATOM   655  N  N   . ASN A 1 84  ? -12.911 131.781 155.003 1.00 44.45  ? 87  ASN A N   1 
ATOM   656  C  CA  . ASN A 1 84  ? -14.291 132.210 155.206 1.00 42.05  ? 87  ASN A CA  1 
ATOM   657  C  C   . ASN A 1 84  ? -15.311 131.294 154.520 1.00 48.25  ? 87  ASN A C   1 
ATOM   658  O  O   . ASN A 1 84  ? -16.485 131.661 154.407 1.00 51.77  ? 87  ASN A O   1 
ATOM   659  C  CB  . ASN A 1 84  ? -14.463 133.654 154.732 1.00 37.87  ? 87  ASN A CB  1 
ATOM   660  C  CG  . ASN A 1 84  ? -14.090 133.835 153.250 1.00 49.26  ? 87  ASN A CG  1 
ATOM   661  O  OD1 . ASN A 1 84  ? -13.713 132.882 152.572 1.00 43.81  ? 87  ASN A OD1 1 
ATOM   662  N  ND2 . ASN A 1 84  ? -14.202 135.061 152.757 1.00 37.54  ? 87  ASN A ND2 1 
ATOM   663  N  N   . ARG A 1 85  ? -14.879 130.134 154.029 1.00 44.19  ? 88  ARG A N   1 
ATOM   664  C  CA  A ARG A 1 85  ? -15.770 129.119 153.490 0.45 45.20  ? 88  ARG A CA  1 
ATOM   665  C  CA  B ARG A 1 85  ? -15.742 129.111 153.457 0.55 45.36  ? 88  ARG A CA  1 
ATOM   666  C  C   . ARG A 1 85  ? -15.401 127.785 154.124 1.00 45.52  ? 88  ARG A C   1 
ATOM   667  O  O   . ARG A 1 85  ? -14.431 127.680 154.873 1.00 47.64  ? 88  ARG A O   1 
ATOM   668  C  CB  A ARG A 1 85  ? -15.689 129.044 151.951 0.45 47.41  ? 88  ARG A CB  1 
ATOM   669  C  CB  B ARG A 1 85  ? -15.567 128.993 151.927 0.55 47.37  ? 88  ARG A CB  1 
ATOM   670  C  CG  A ARG A 1 85  ? -16.220 130.286 151.214 0.45 46.30  ? 88  ARG A CG  1 
ATOM   671  C  CG  B ARG A 1 85  ? -15.665 130.306 151.148 0.55 45.62  ? 88  ARG A CG  1 
ATOM   672  C  CD  A ARG A 1 85  ? -17.704 130.519 151.504 0.45 45.46  ? 88  ARG A CD  1 
ATOM   673  C  CD  B ARG A 1 85  ? -17.092 130.840 151.097 0.55 44.90  ? 88  ARG A CD  1 
ATOM   674  N  NE  A ARG A 1 85  ? -18.255 131.669 150.790 0.45 43.99  ? 88  ARG A NE  1 
ATOM   675  N  NE  B ARG A 1 85  ? -17.985 129.947 150.364 0.55 44.29  ? 88  ARG A NE  1 
ATOM   676  C  CZ  A ARG A 1 85  ? -18.449 132.869 151.330 0.45 44.86  ? 88  ARG A CZ  1 
ATOM   677  C  CZ  B ARG A 1 85  ? -19.257 130.220 150.092 0.55 47.06  ? 88  ARG A CZ  1 
ATOM   678  N  NH1 A ARG A 1 85  ? -18.134 133.088 152.600 0.45 46.30  ? 88  ARG A NH1 1 
ATOM   679  N  NH1 B ARG A 1 85  ? -19.795 131.367 150.490 0.55 45.45  ? 88  ARG A NH1 1 
ATOM   680  N  NH2 A ARG A 1 85  ? -18.959 133.853 150.602 0.45 41.34  ? 88  ARG A NH2 1 
ATOM   681  N  NH2 B ARG A 1 85  ? -19.992 129.347 149.413 0.55 46.81  ? 88  ARG A NH2 1 
ATOM   682  N  N   . GLU A 1 86  ? -16.192 126.754 153.837 1.00 50.84  ? 89  GLU A N   1 
ATOM   683  C  CA  . GLU A 1 86  ? -15.870 125.435 154.367 1.00 43.88  ? 89  GLU A CA  1 
ATOM   684  C  C   . GLU A 1 86  ? -14.533 124.966 153.796 1.00 48.40  ? 89  GLU A C   1 
ATOM   685  O  O   . GLU A 1 86  ? -14.227 125.184 152.619 1.00 48.83  ? 89  GLU A O   1 
ATOM   686  C  CB  . GLU A 1 86  ? -16.986 124.442 154.031 1.00 48.76  ? 89  GLU A CB  1 
ATOM   687  C  CG  . GLU A 1 86  ? -16.923 123.114 154.783 1.00 56.78  ? 89  GLU A CG  1 
ATOM   688  N  N   . MET A 1 87  ? -13.704 124.379 154.649 1.00 45.30  ? 90  MET A N   1 
ATOM   689  C  CA  . MET A 1 87  ? -12.450 123.814 154.187 1.00 44.14  ? 90  MET A CA  1 
ATOM   690  C  C   . MET A 1 87  ? -12.691 122.413 153.647 1.00 50.06  ? 90  MET A C   1 
ATOM   691  O  O   . MET A 1 87  ? -13.601 121.702 154.084 1.00 45.10  ? 90  MET A O   1 
ATOM   692  C  CB  . MET A 1 87  ? -11.416 123.768 155.310 1.00 39.17  ? 90  MET A CB  1 
ATOM   693  C  CG  . MET A 1 87  ? -10.896 125.136 155.740 1.00 48.73  ? 90  MET A CG  1 
ATOM   694  S  SD  . MET A 1 87  ? -9.462  125.041 156.855 1.00 49.01  ? 90  MET A SD  1 
ATOM   695  C  CE  . MET A 1 87  ? -10.138 124.044 158.187 1.00 38.20  ? 90  MET A CE  1 
ATOM   696  N  N   . SER A 1 88  ? -11.865 122.018 152.687 1.00 46.94  ? 91  SER A N   1 
ATOM   697  C  CA  . SER A 1 88  ? -12.048 120.748 152.006 1.00 46.37  ? 91  SER A CA  1 
ATOM   698  C  C   . SER A 1 88  ? -10.802 120.468 151.192 1.00 50.53  ? 91  SER A C   1 
ATOM   699  O  O   . SER A 1 88  ? -10.114 121.399 150.763 1.00 51.28  ? 91  SER A O   1 
ATOM   700  C  CB  . SER A 1 88  ? -13.279 120.775 151.089 1.00 44.89  ? 91  SER A CB  1 
ATOM   701  O  OG  . SER A 1 88  ? -13.494 119.500 150.524 1.00 50.58  ? 91  SER A OG  1 
ATOM   702  N  N   . GLU A 1 89  ? -10.510 119.183 150.989 1.00 45.75  ? 92  GLU A N   1 
ATOM   703  C  CA  . GLU A 1 89  ? -9.451  118.843 150.049 1.00 46.60  ? 92  GLU A CA  1 
ATOM   704  C  C   . GLU A 1 89  ? -9.884  119.054 148.605 1.00 50.84  ? 92  GLU A C   1 
ATOM   705  O  O   . GLU A 1 89  ? -9.029  119.202 147.724 1.00 48.72  ? 92  GLU A O   1 
ATOM   706  C  CB  . GLU A 1 89  ? -9.013  117.405 150.240 1.00 49.97  ? 92  GLU A CB  1 
ATOM   707  C  CG  . GLU A 1 89  ? -8.023  117.221 151.337 1.00 46.61  ? 92  GLU A CG  1 
ATOM   708  C  CD  . GLU A 1 89  ? -7.640  115.777 151.472 1.00 54.93  ? 92  GLU A CD  1 
ATOM   709  O  OE1 . GLU A 1 89  ? -6.552  115.402 150.978 1.00 48.28  ? 92  GLU A OE1 1 
ATOM   710  O  OE2 . GLU A 1 89  ? -8.447  115.017 152.056 1.00 61.14  ? 92  GLU A OE2 1 
ATOM   711  N  N   . ASP A 1 90  ? -11.188 119.063 148.352 1.00 50.08  ? 93  ASP A N   1 
ATOM   712  C  CA  . ASP A 1 90  ? -11.743 119.423 147.052 1.00 52.04  ? 93  ASP A CA  1 
ATOM   713  C  C   . ASP A 1 90  ? -11.806 120.942 147.003 1.00 47.91  ? 93  ASP A C   1 
ATOM   714  O  O   . ASP A 1 90  ? -12.821 121.549 147.349 1.00 50.49  ? 93  ASP A O   1 
ATOM   715  C  CB  . ASP A 1 90  ? -13.118 118.788 146.878 1.00 55.34  ? 93  ASP A CB  1 
ATOM   716  C  CG  . ASP A 1 90  ? -13.766 119.119 145.541 1.00 54.36  ? 93  ASP A CG  1 
ATOM   717  O  OD1 . ASP A 1 90  ? -13.165 119.839 144.713 1.00 56.63  ? 93  ASP A OD1 1 
ATOM   718  O  OD2 . ASP A 1 90  ? -14.902 118.651 145.324 1.00 57.06  ? 93  ASP A OD2 1 
ATOM   719  N  N   . CYS A 1 91  ? -10.705 121.568 146.566 1.00 44.55  ? 94  CYS A N   1 
ATOM   720  C  CA  . CYS A 1 91  ? -10.603 123.023 146.617 1.00 46.06  ? 94  CYS A CA  1 
ATOM   721  C  C   . CYS A 1 91  ? -10.002 123.687 145.375 1.00 45.99  ? 94  CYS A C   1 
ATOM   722  O  O   . CYS A 1 91  ? -9.847  124.914 145.376 1.00 38.47  ? 94  CYS A O   1 
ATOM   723  C  CB  . CYS A 1 91  ? -9.785  123.446 147.858 1.00 38.31  ? 94  CYS A CB  1 
ATOM   724  S  SG  . CYS A 1 91  ? -8.061  122.854 147.882 1.00 44.16  ? 94  CYS A SG  1 
ATOM   725  N  N   . LEU A 1 92  ? -9.697  122.942 144.308 1.00 48.58  ? 95  LEU A N   1 
ATOM   726  C  CA  . LEU A 1 92  ? -8.993  123.502 143.150 1.00 43.12  ? 95  LEU A CA  1 
ATOM   727  C  C   . LEU A 1 92  ? -9.998  124.162 142.209 1.00 43.56  ? 95  LEU A C   1 
ATOM   728  O  O   . LEU A 1 92  ? -10.528 123.545 141.279 1.00 43.73  ? 95  LEU A O   1 
ATOM   729  C  CB  . LEU A 1 92  ? -8.167  122.425 142.455 1.00 42.18  ? 95  LEU A CB  1 
ATOM   730  C  CG  . LEU A 1 92  ? -7.093  121.799 143.360 1.00 41.82  ? 95  LEU A CG  1 
ATOM   731  C  CD1 . LEU A 1 92  ? -6.166  120.883 142.590 1.00 37.64  ? 95  LEU A CD1 1 
ATOM   732  C  CD2 . LEU A 1 92  ? -6.285  122.865 144.116 1.00 40.59  ? 95  LEU A CD2 1 
ATOM   733  N  N   . TYR A 1 93  ? -10.248 125.448 142.461 1.00 41.47  ? 96  TYR A N   1 
ATOM   734  C  CA  . TYR A 1 93  ? -11.228 126.250 141.741 1.00 41.49  ? 96  TYR A CA  1 
ATOM   735  C  C   . TYR A 1 93  ? -10.646 127.639 141.529 1.00 42.49  ? 96  TYR A C   1 
ATOM   736  O  O   . TYR A 1 93  ? -9.714  128.052 142.221 1.00 42.81  ? 96  TYR A O   1 
ATOM   737  C  CB  . TYR A 1 93  ? -12.569 126.359 142.505 1.00 43.63  ? 96  TYR A CB  1 
ATOM   738  C  CG  . TYR A 1 93  ? -13.234 125.027 142.752 1.00 47.94  ? 96  TYR A CG  1 
ATOM   739  C  CD1 . TYR A 1 93  ? -12.878 124.238 143.848 1.00 40.65  ? 96  TYR A CD1 1 
ATOM   740  C  CD2 . TYR A 1 93  ? -14.209 124.543 141.881 1.00 46.65  ? 96  TYR A CD2 1 
ATOM   741  C  CE1 . TYR A 1 93  ? -13.464 122.998 144.063 1.00 46.30  ? 96  TYR A CE1 1 
ATOM   742  C  CE2 . TYR A 1 93  ? -14.811 123.305 142.092 1.00 47.94  ? 96  TYR A CE2 1 
ATOM   743  C  CZ  . TYR A 1 93  ? -14.439 122.536 143.184 1.00 54.41  ? 96  TYR A CZ  1 
ATOM   744  O  OH  . TYR A 1 93  ? -15.041 121.307 143.390 1.00 56.00  ? 96  TYR A OH  1 
ATOM   745  N  N   . LEU A 1 94  ? -11.223 128.372 140.580 1.00 40.73  ? 97  LEU A N   1 
ATOM   746  C  CA  . LEU A 1 94  ? -10.811 129.742 140.311 1.00 41.08  ? 97  LEU A CA  1 
ATOM   747  C  C   . LEU A 1 94  ? -12.052 130.617 140.172 1.00 39.76  ? 97  LEU A C   1 
ATOM   748  O  O   . LEU A 1 94  ? -13.165 130.123 139.964 1.00 39.45  ? 97  LEU A O   1 
ATOM   749  C  CB  . LEU A 1 94  ? -9.897  129.822 139.056 1.00 35.83  ? 97  LEU A CB  1 
ATOM   750  C  CG  . LEU A 1 94  ? -10.320 129.208 137.723 1.00 41.51  ? 97  LEU A CG  1 
ATOM   751  C  CD1 . LEU A 1 94  ? -11.322 130.093 136.993 1.00 39.69  ? 97  LEU A CD1 1 
ATOM   752  C  CD2 . LEU A 1 94  ? -9.106  128.923 136.825 1.00 40.75  ? 97  LEU A CD2 1 
ATOM   753  N  N   . ASN A 1 95  ? -11.852 131.926 140.312 1.00 35.80  ? 98  ASN A N   1 
ATOM   754  C  CA  . ASN A 1 95  ? -12.926 132.905 140.243 1.00 37.11  ? 98  ASN A CA  1 
ATOM   755  C  C   . ASN A 1 95  ? -12.570 133.975 139.232 1.00 41.12  ? 98  ASN A C   1 
ATOM   756  O  O   . ASN A 1 95  ? -11.399 134.326 139.073 1.00 44.61  ? 98  ASN A O   1 
ATOM   757  C  CB  . ASN A 1 95  ? -13.169 133.579 141.595 1.00 43.12  ? 98  ASN A CB  1 
ATOM   758  C  CG  . ASN A 1 95  ? -13.142 132.602 142.729 1.00 45.49  ? 98  ASN A CG  1 
ATOM   759  O  OD1 . ASN A 1 95  ? -14.050 131.787 142.876 1.00 49.48  ? 98  ASN A OD1 1 
ATOM   760  N  ND2 . ASN A 1 95  ? -12.085 132.650 143.526 1.00 43.92  ? 98  ASN A ND2 1 
ATOM   761  N  N   . ILE A 1 96  ? -13.592 134.508 138.563 1.00 40.72  ? 99  ILE A N   1 
ATOM   762  C  CA  . ILE A 1 96  ? -13.397 135.465 137.479 1.00 42.45  ? 99  ILE A CA  1 
ATOM   763  C  C   . ILE A 1 96  ? -14.431 136.576 137.603 1.00 41.52  ? 99  ILE A C   1 
ATOM   764  O  O   . ILE A 1 96  ? -15.634 136.306 137.697 1.00 42.95  ? 99  ILE A O   1 
ATOM   765  C  CB  . ILE A 1 96  ? -13.505 134.805 136.086 1.00 41.18  ? 99  ILE A CB  1 
ATOM   766  C  CG1 . ILE A 1 96  ? -12.792 133.447 136.024 1.00 38.88  ? 99  ILE A CG1 1 
ATOM   767  C  CG2 . ILE A 1 96  ? -12.950 135.739 135.008 1.00 38.73  ? 99  ILE A CG2 1 
ATOM   768  C  CD1 . ILE A 1 96  ? -12.974 132.736 134.636 1.00 44.59  ? 99  ILE A CD1 1 
ATOM   769  N  N   . TRP A 1 97  ? -13.968 137.820 137.590 1.00 37.66  ? 100 TRP A N   1 
ATOM   770  C  CA  . TRP A 1 97  ? -14.835 138.985 137.473 1.00 44.48  ? 100 TRP A CA  1 
ATOM   771  C  C   . TRP A 1 97  ? -14.652 139.581 136.083 1.00 48.35  ? 100 TRP A C   1 
ATOM   772  O  O   . TRP A 1 97  ? -13.527 139.921 135.694 1.00 46.14  ? 100 TRP A O   1 
ATOM   773  C  CB  . TRP A 1 97  ? -14.523 140.018 138.555 1.00 40.87  ? 100 TRP A CB  1 
ATOM   774  C  CG  . TRP A 1 97  ? -14.896 139.570 139.944 1.00 51.52  ? 100 TRP A CG  1 
ATOM   775  C  CD1 . TRP A 1 97  ? -16.053 139.860 140.613 1.00 53.12  ? 100 TRP A CD1 1 
ATOM   776  C  CD2 . TRP A 1 97  ? -14.109 138.756 140.840 1.00 53.15  ? 100 TRP A CD2 1 
ATOM   777  N  NE1 . TRP A 1 97  ? -16.037 139.281 141.866 1.00 52.28  ? 100 TRP A NE1 1 
ATOM   778  C  CE2 . TRP A 1 97  ? -14.859 138.600 142.032 1.00 54.35  ? 100 TRP A CE2 1 
ATOM   779  C  CE3 . TRP A 1 97  ? -12.847 138.149 140.751 1.00 43.81  ? 100 TRP A CE3 1 
ATOM   780  C  CZ2 . TRP A 1 97  ? -14.388 137.856 143.129 1.00 45.77  ? 100 TRP A CZ2 1 
ATOM   781  C  CZ3 . TRP A 1 97  ? -12.385 137.411 141.833 1.00 49.29  ? 100 TRP A CZ3 1 
ATOM   782  C  CH2 . TRP A 1 97  ? -13.156 137.277 143.013 1.00 45.55  ? 100 TRP A CH2 1 
ATOM   783  N  N   . VAL A 1 98  ? -15.749 139.712 135.337 1.00 49.96  ? 101 VAL A N   1 
ATOM   784  C  CA  . VAL A 1 98  ? -15.717 140.163 133.955 1.00 47.88  ? 101 VAL A CA  1 
ATOM   785  C  C   . VAL A 1 98  ? -16.488 141.477 133.834 1.00 47.44  ? 101 VAL A C   1 
ATOM   786  O  O   . VAL A 1 98  ? -17.678 141.516 134.146 1.00 47.88  ? 101 VAL A O   1 
ATOM   787  C  CB  . VAL A 1 98  ? -16.302 139.128 132.983 1.00 44.38  ? 101 VAL A CB  1 
ATOM   788  C  CG1 . VAL A 1 98  ? -16.228 139.672 131.564 1.00 51.02  ? 101 VAL A CG1 1 
ATOM   789  C  CG2 . VAL A 1 98  ? -15.565 137.804 133.093 1.00 43.90  ? 101 VAL A CG2 1 
ATOM   790  N  N   . PRO A 1 99  ? -15.858 142.559 133.346 1.00 53.47  ? 102 PRO A N   1 
ATOM   791  C  CA  . PRO A 1 99  ? -16.582 143.824 133.132 1.00 58.55  ? 102 PRO A CA  1 
ATOM   792  C  C   . PRO A 1 99  ? -17.876 143.662 132.342 1.00 56.75  ? 102 PRO A C   1 
ATOM   793  O  O   . PRO A 1 99  ? -18.038 142.700 131.583 1.00 52.49  ? 102 PRO A O   1 
ATOM   794  C  CB  . PRO A 1 99  ? -15.571 144.676 132.350 1.00 54.26  ? 102 PRO A CB  1 
ATOM   795  C  CG  . PRO A 1 99  ? -14.248 144.113 132.700 1.00 54.18  ? 102 PRO A CG  1 
ATOM   796  C  CD  . PRO A 1 99  ? -14.463 142.639 132.885 1.00 52.81  ? 102 PRO A CD  1 
ATOM   797  N  N   . SER A 1 100 ? -18.809 144.592 132.520 1.00 61.04  ? 103 SER A N   1 
ATOM   798  C  CA  . SER A 1 100 ? -20.089 144.534 131.837 1.00 61.38  ? 103 SER A CA  1 
ATOM   799  C  C   . SER A 1 100 ? -20.282 145.789 130.993 1.00 61.37  ? 103 SER A C   1 
ATOM   800  O  O   . SER A 1 100 ? -20.131 146.908 131.507 1.00 62.52  ? 103 SER A O   1 
ATOM   801  C  CB  . SER A 1 100 ? -21.243 144.387 132.836 1.00 64.56  ? 103 SER A CB  1 
ATOM   802  O  OG  . SER A 1 100 ? -22.361 143.757 132.235 1.00 67.26  ? 103 SER A OG  1 
ATOM   803  N  N   . PRO A 1 101 ? -20.604 145.656 129.700 1.00 54.76  ? 104 PRO A N   1 
ATOM   804  C  CA  . PRO A 1 101 ? -20.814 144.362 129.038 1.00 56.46  ? 104 PRO A CA  1 
ATOM   805  C  C   . PRO A 1 101 ? -19.508 143.619 128.758 1.00 49.68  ? 104 PRO A C   1 
ATOM   806  O  O   . PRO A 1 101 ? -18.433 144.230 128.772 1.00 41.03  ? 104 PRO A O   1 
ATOM   807  C  CB  . PRO A 1 101 ? -21.502 144.752 127.721 1.00 55.37  ? 104 PRO A CB  1 
ATOM   808  C  CG  . PRO A 1 101 ? -20.964 146.117 127.432 1.00 49.95  ? 104 PRO A CG  1 
ATOM   809  C  CD  . PRO A 1 101 ? -20.833 146.789 128.787 1.00 49.43  ? 104 PRO A CD  1 
ATOM   810  N  N   . ARG A 1 102 ? -19.625 142.323 128.492 1.00 43.22  ? 105 ARG A N   1 
ATOM   811  C  CA  . ARG A 1 102 ? -18.474 141.461 128.292 1.00 46.74  ? 105 ARG A CA  1 
ATOM   812  C  C   . ARG A 1 102 ? -17.537 142.052 127.241 1.00 49.35  ? 105 ARG A C   1 
ATOM   813  O  O   . ARG A 1 102 ? -17.960 142.270 126.092 1.00 57.55  ? 105 ARG A O   1 
ATOM   814  C  CB  . ARG A 1 102 ? -18.932 140.067 127.875 1.00 45.18  ? 105 ARG A CB  1 
ATOM   815  C  CG  . ARG A 1 102 ? -17.806 139.078 127.789 1.00 43.29  ? 105 ARG A CG  1 
ATOM   816  C  CD  . ARG A 1 102 ? -18.273 137.823 127.125 1.00 42.82  ? 105 ARG A CD  1 
ATOM   817  N  NE  . ARG A 1 102 ? -19.250 137.094 127.921 1.00 48.33  ? 105 ARG A NE  1 
ATOM   818  C  CZ  . ARG A 1 102 ? -19.889 136.013 127.479 1.00 59.80  ? 105 ARG A CZ  1 
ATOM   819  N  NH1 . ARG A 1 102 ? -19.664 135.571 126.236 1.00 55.14  ? 105 ARG A NH1 1 
ATOM   820  N  NH2 . ARG A 1 102 ? -20.762 135.385 128.260 1.00 50.80  ? 105 ARG A NH2 1 
ATOM   821  N  N   . PRO A 1 103 ? -16.292 142.356 127.590 1.00 54.06  ? 106 PRO A N   1 
ATOM   822  C  CA  . PRO A 1 103 ? -15.360 142.880 126.584 1.00 49.01  ? 106 PRO A CA  1 
ATOM   823  C  C   . PRO A 1 103 ? -15.090 141.841 125.508 1.00 50.81  ? 106 PRO A C   1 
ATOM   824  O  O   . PRO A 1 103 ? -15.402 140.654 125.642 1.00 52.40  ? 106 PRO A O   1 
ATOM   825  C  CB  . PRO A 1 103 ? -14.094 143.213 127.392 1.00 52.77  ? 106 PRO A CB  1 
ATOM   826  C  CG  . PRO A 1 103 ? -14.223 142.427 128.674 1.00 48.73  ? 106 PRO A CG  1 
ATOM   827  C  CD  . PRO A 1 103 ? -15.696 142.293 128.938 1.00 49.63  ? 106 PRO A CD  1 
ATOM   828  N  N   . LYS A 1 104 ? -14.515 142.301 124.402 1.00 44.09  ? 107 LYS A N   1 
ATOM   829  C  CA  . LYS A 1 104 ? -14.121 141.336 123.381 1.00 51.17  ? 107 LYS A CA  1 
ATOM   830  C  C   . LYS A 1 104 ? -12.760 140.720 123.697 1.00 48.84  ? 107 LYS A C   1 
ATOM   831  O  O   . LYS A 1 104 ? -12.589 139.499 123.593 1.00 45.40  ? 107 LYS A O   1 
ATOM   832  C  CB  . LYS A 1 104 ? -14.108 142.000 122.002 1.00 45.16  ? 107 LYS A CB  1 
ATOM   833  C  CG  . LYS A 1 104 ? -15.397 142.741 121.654 1.00 50.02  ? 107 LYS A CG  1 
ATOM   834  C  CD  . LYS A 1 104 ? -16.627 141.866 121.896 1.00 54.43  ? 107 LYS A CD  1 
ATOM   835  C  CE  . LYS A 1 104 ? -17.914 142.623 121.583 1.00 57.06  ? 107 LYS A CE  1 
ATOM   836  N  NZ  . LYS A 1 104 ? -19.092 141.707 121.544 1.00 64.53  ? 107 LYS A NZ  1 
ATOM   837  N  N   . SER A 1 105 ? -11.795 141.546 124.113 1.00 44.78  ? 108 SER A N   1 
ATOM   838  C  CA  . SER A 1 105 ? -10.433 141.082 124.329 1.00 47.60  ? 108 SER A CA  1 
ATOM   839  C  C   . SER A 1 105 ? -9.676  142.079 125.198 1.00 56.03  ? 108 SER A C   1 
ATOM   840  O  O   . SER A 1 105 ? -9.105  143.044 124.685 1.00 61.88  ? 108 SER A O   1 
ATOM   841  C  CB  . SER A 1 105 ? -9.725  140.895 122.989 1.00 47.60  ? 108 SER A CB  1 
ATOM   842  O  OG  . SER A 1 105 ? -8.388  140.468 123.161 1.00 54.85  ? 108 SER A OG  1 
ATOM   843  N  N   . THR A 1 106 ? -9.665  141.879 126.512 1.00 52.17  ? 109 THR A N   1 
ATOM   844  C  CA  . THR A 1 106 ? -9.034  142.845 127.394 1.00 49.96  ? 109 THR A CA  1 
ATOM   845  C  C   . THR A 1 106 ? -8.057  142.146 128.331 1.00 44.83  ? 109 THR A C   1 
ATOM   846  O  O   . THR A 1 106 ? -8.087  140.925 128.503 1.00 44.93  ? 109 THR A O   1 
ATOM   847  C  CB  . THR A 1 106 ? -10.084 143.658 128.166 1.00 48.80  ? 109 THR A CB  1 
ATOM   848  O  OG1 . THR A 1 106 ? -9.466  144.835 128.707 1.00 57.94  ? 109 THR A OG1 1 
ATOM   849  C  CG2 . THR A 1 106 ? -10.712 142.838 129.273 1.00 51.12  ? 109 THR A CG2 1 
ATOM   850  N  N   . THR A 1 107 ? -7.155  142.950 128.890 1.00 45.33  ? 110 THR A N   1 
ATOM   851  C  CA  . THR A 1 107 ? -6.105  142.470 129.783 1.00 47.74  ? 110 THR A CA  1 
ATOM   852  C  C   . THR A 1 107 ? -6.661  141.602 130.907 1.00 46.15  ? 110 THR A C   1 
ATOM   853  O  O   . THR A 1 107 ? -7.725  141.883 131.463 1.00 45.29  ? 110 THR A O   1 
ATOM   854  C  CB  . THR A 1 107 ? -5.356  143.670 130.368 1.00 47.10  ? 110 THR A CB  1 
ATOM   855  O  OG1 . THR A 1 107 ? -4.859  144.459 129.286 1.00 57.79  ? 110 THR A OG1 1 
ATOM   856  C  CG2 . THR A 1 107 ? -4.179  143.217 131.222 1.00 50.64  ? 110 THR A CG2 1 
ATOM   857  N  N   . VAL A 1 108 ? -5.927  140.533 131.227 1.00 44.41  ? 111 VAL A N   1 
ATOM   858  C  CA  . VAL A 1 108 ? -6.266  139.602 132.299 1.00 43.21  ? 111 VAL A CA  1 
ATOM   859  C  C   . VAL A 1 108 ? -5.240  139.731 133.419 1.00 39.46  ? 111 VAL A C   1 
ATOM   860  O  O   . VAL A 1 108 ? -4.036  139.862 133.161 1.00 38.97  ? 111 VAL A O   1 
ATOM   861  C  CB  . VAL A 1 108 ? -6.309  138.153 131.775 1.00 46.43  ? 111 VAL A CB  1 
ATOM   862  C  CG1 . VAL A 1 108 ? -6.465  137.157 132.924 1.00 42.59  ? 111 VAL A CG1 1 
ATOM   863  C  CG2 . VAL A 1 108 ? -7.424  137.995 130.787 1.00 47.32  ? 111 VAL A CG2 1 
ATOM   864  N  N   . MET A 1 109 ? -5.716  139.678 134.665 1.00 41.33  ? 112 MET A N   1 
ATOM   865  C  CA  . MET A 1 109 ? -4.852  139.645 135.844 1.00 35.19  ? 112 MET A CA  1 
ATOM   866  C  C   . MET A 1 109 ? -5.229  138.447 136.704 1.00 35.78  ? 112 MET A C   1 
ATOM   867  O  O   . MET A 1 109 ? -6.408  138.254 137.021 1.00 38.12  ? 112 MET A O   1 
ATOM   868  C  CB  . MET A 1 109 ? -4.962  140.943 136.645 1.00 39.45  ? 112 MET A CB  1 
ATOM   869  C  CG  . MET A 1 109 ? -4.449  142.167 135.882 1.00 41.23  ? 112 MET A CG  1 
ATOM   870  S  SD  . MET A 1 109 ? -4.626  143.726 136.780 1.00 47.78  ? 112 MET A SD  1 
ATOM   871  C  CE  . MET A 1 109 ? -3.354  143.529 138.019 1.00 38.24  ? 112 MET A CE  1 
ATOM   872  N  N   . VAL A 1 110 ? -4.239  137.632 137.065 1.00 36.56  ? 113 VAL A N   1 
ATOM   873  C  CA  . VAL A 1 110 ? -4.463  136.411 137.837 1.00 39.43  ? 113 VAL A CA  1 
ATOM   874  C  C   . VAL A 1 110 ? -3.812  136.575 139.211 1.00 38.23  ? 113 VAL A C   1 
ATOM   875  O  O   . VAL A 1 110 ? -2.580  136.651 139.325 1.00 37.15  ? 113 VAL A O   1 
ATOM   876  C  CB  . VAL A 1 110 ? -3.924  135.167 137.118 1.00 39.40  ? 113 VAL A CB  1 
ATOM   877  C  CG1 . VAL A 1 110 ? -4.190  133.925 137.971 1.00 36.24  ? 113 VAL A CG1 1 
ATOM   878  C  CG2 . VAL A 1 110 ? -4.552  135.015 135.716 1.00 32.10  ? 113 VAL A CG2 1 
ATOM   879  N  N   . TRP A 1 111 ? -4.641  136.605 140.255 1.00 37.83  ? 114 TRP A N   1 
ATOM   880  C  CA  . TRP A 1 111 ? -4.172  136.753 141.633 1.00 35.72  ? 114 TRP A CA  1 
ATOM   881  C  C   . TRP A 1 111 ? -3.762  135.410 142.233 1.00 36.54  ? 114 TRP A C   1 
ATOM   882  O  O   . TRP A 1 111 ? -4.526  134.440 142.183 1.00 34.38  ? 114 TRP A O   1 
ATOM   883  C  CB  . TRP A 1 111 ? -5.262  137.385 142.503 1.00 33.13  ? 114 TRP A CB  1 
ATOM   884  C  CG  . TRP A 1 111 ? -4.884  137.553 143.977 1.00 35.38  ? 114 TRP A CG  1 
ATOM   885  C  CD1 . TRP A 1 111 ? -5.418  136.882 145.050 1.00 34.69  ? 114 TRP A CD1 1 
ATOM   886  C  CD2 . TRP A 1 111 ? -3.900  138.449 144.519 1.00 37.10  ? 114 TRP A CD2 1 
ATOM   887  N  NE1 . TRP A 1 111 ? -4.827  137.312 146.226 1.00 39.52  ? 114 TRP A NE1 1 
ATOM   888  C  CE2 . TRP A 1 111 ? -3.896  138.272 145.928 1.00 37.40  ? 114 TRP A CE2 1 
ATOM   889  C  CE3 . TRP A 1 111 ? -3.025  139.382 143.955 1.00 35.41  ? 114 TRP A CE3 1 
ATOM   890  C  CZ2 . TRP A 1 111 ? -3.044  138.984 146.769 1.00 35.38  ? 114 TRP A CZ2 1 
ATOM   891  C  CZ3 . TRP A 1 111 ? -2.183  140.101 144.798 1.00 37.58  ? 114 TRP A CZ3 1 
ATOM   892  C  CH2 . TRP A 1 111 ? -2.198  139.892 146.191 1.00 39.35  ? 114 TRP A CH2 1 
ATOM   893  N  N   . ILE A 1 112 ? -2.570  135.374 142.836 1.00 36.01  ? 115 ILE A N   1 
ATOM   894  C  CA  . ILE A 1 112 ? -2.068  134.230 143.592 1.00 35.09  ? 115 ILE A CA  1 
ATOM   895  C  C   . ILE A 1 112 ? -1.936  134.635 145.065 1.00 36.90  ? 115 ILE A C   1 
ATOM   896  O  O   . ILE A 1 112 ? -1.077  135.458 145.413 1.00 39.44  ? 115 ILE A O   1 
ATOM   897  C  CB  . ILE A 1 112 ? -0.724  133.755 143.029 1.00 31.24  ? 115 ILE A CB  1 
ATOM   898  C  CG1 . ILE A 1 112 ? -0.855  133.522 141.517 1.00 39.14  ? 115 ILE A CG1 1 
ATOM   899  C  CG2 . ILE A 1 112 ? -0.263  132.514 143.755 1.00 32.95  ? 115 ILE A CG2 1 
ATOM   900  C  CD1 . ILE A 1 112 ? 0.277   132.722 140.896 1.00 33.35  ? 115 ILE A CD1 1 
ATOM   901  N  N   . TYR A 1 113 ? -2.732  134.036 145.955 1.00 37.99  ? 116 TYR A N   1 
ATOM   902  C  CA  . TYR A 1 113 ? -2.704  134.479 147.359 1.00 39.29  ? 116 TYR A CA  1 
ATOM   903  C  C   . TYR A 1 113 ? -1.448  134.010 148.099 1.00 37.57  ? 116 TYR A C   1 
ATOM   904  O  O   . TYR A 1 113 ? -0.820  133.002 147.755 1.00 34.96  ? 116 TYR A O   1 
ATOM   905  C  CB  . TYR A 1 113 ? -3.951  134.018 148.129 1.00 31.80  ? 116 TYR A CB  1 
ATOM   906  C  CG  . TYR A 1 113 ? -4.229  132.524 148.111 1.00 37.69  ? 116 TYR A CG  1 
ATOM   907  C  CD1 . TYR A 1 113 ? -3.423  131.619 148.821 1.00 35.02  ? 116 TYR A CD1 1 
ATOM   908  C  CD2 . TYR A 1 113 ? -5.325  132.021 147.424 1.00 33.00  ? 116 TYR A CD2 1 
ATOM   909  C  CE1 . TYR A 1 113 ? -3.689  130.249 148.804 1.00 35.13  ? 116 TYR A CE1 1 
ATOM   910  C  CE2 . TYR A 1 113 ? -5.601  130.665 147.401 1.00 32.67  ? 116 TYR A CE2 1 
ATOM   911  C  CZ  . TYR A 1 113 ? -4.784  129.781 148.081 1.00 38.41  ? 116 TYR A CZ  1 
ATOM   912  O  OH  . TYR A 1 113 ? -5.080  128.433 148.032 1.00 36.67  ? 116 TYR A OH  1 
ATOM   913  N  N   . GLY A 1 114 ? -1.086  134.766 149.131 1.00 39.45  ? 117 GLY A N   1 
ATOM   914  C  CA  . GLY A 1 114 ? -0.016  134.396 150.036 1.00 39.96  ? 117 GLY A CA  1 
ATOM   915  C  C   . GLY A 1 114 ? -0.521  133.646 151.253 1.00 38.27  ? 117 GLY A C   1 
ATOM   916  O  O   . GLY A 1 114 ? -1.655  133.161 151.294 1.00 39.77  ? 117 GLY A O   1 
ATOM   917  N  N   . GLY A 1 115 ? 0.340   133.566 152.272 1.00 47.75  ? 118 GLY A N   1 
ATOM   918  C  CA  . GLY A 1 115 ? 0.061   132.776 153.461 1.00 36.95  ? 118 GLY A CA  1 
ATOM   919  C  C   . GLY A 1 115 ? 1.094   131.696 153.735 1.00 38.44  ? 118 GLY A C   1 
ATOM   920  O  O   . GLY A 1 115 ? 0.774   130.638 154.287 1.00 41.26  ? 118 GLY A O   1 
ATOM   921  N  N   . GLY A 1 116 ? 2.335   131.946 153.321 1.00 33.74  ? 119 GLY A N   1 
ATOM   922  C  CA  . GLY A 1 116 ? 3.492   131.164 153.708 1.00 37.28  ? 119 GLY A CA  1 
ATOM   923  C  C   . GLY A 1 116 ? 3.479   129.739 153.235 1.00 35.00  ? 119 GLY A C   1 
ATOM   924  O  O   . GLY A 1 116 ? 4.186   128.900 153.796 1.00 38.22  ? 119 GLY A O   1 
ATOM   925  N  N   . PHE A 1 117 ? 2.680   129.436 152.218 1.00 36.72  ? 120 PHE A N   1 
ATOM   926  C  CA  . PHE A 1 117 ? 2.502   128.109 151.654 1.00 37.23  ? 120 PHE A CA  1 
ATOM   927  C  C   . PHE A 1 117 ? 1.828   127.156 152.635 1.00 41.17  ? 120 PHE A C   1 
ATOM   928  O  O   . PHE A 1 117 ? 1.632   125.981 152.289 1.00 39.45  ? 120 PHE A O   1 
ATOM   929  C  CB  . PHE A 1 117 ? 3.827   127.502 151.162 1.00 37.07  ? 120 PHE A CB  1 
ATOM   930  C  CG  . PHE A 1 117 ? 4.494   128.298 150.047 1.00 41.56  ? 120 PHE A CG  1 
ATOM   931  C  CD1 . PHE A 1 117 ? 3.981   128.280 148.751 1.00 35.76  ? 120 PHE A CD1 1 
ATOM   932  C  CD2 . PHE A 1 117 ? 5.637   129.049 150.297 1.00 39.24  ? 120 PHE A CD2 1 
ATOM   933  C  CE1 . PHE A 1 117 ? 4.601   129.002 147.714 1.00 38.77  ? 120 PHE A CE1 1 
ATOM   934  C  CE2 . PHE A 1 117 ? 6.257   129.765 149.279 1.00 41.76  ? 120 PHE A CE2 1 
ATOM   935  C  CZ  . PHE A 1 117 ? 5.743   129.741 147.979 1.00 37.00  ? 120 PHE A CZ  1 
ATOM   936  N  N   . TYR A 1 118 ? 1.457   127.617 153.841 1.00 35.07  ? 121 TYR A N   1 
ATOM   937  C  CA  . TYR A 1 118 ? 0.698   126.802 154.782 1.00 39.02  ? 121 TYR A CA  1 
ATOM   938  C  C   . TYR A 1 118 ? -0.761  127.222 154.901 1.00 40.40  ? 121 TYR A C   1 
ATOM   939  O  O   . TYR A 1 118 ? -1.537  126.513 155.553 1.00 40.20  ? 121 TYR A O   1 
ATOM   940  C  CB  . TYR A 1 118 ? 1.338   126.830 156.187 1.00 38.63  ? 121 TYR A CB  1 
ATOM   941  C  CG  . TYR A 1 118 ? 1.197   128.160 156.910 1.00 39.39  ? 121 TYR A CG  1 
ATOM   942  C  CD1 . TYR A 1 118 ? 0.065   128.447 157.686 1.00 35.17  ? 121 TYR A CD1 1 
ATOM   943  C  CD2 . TYR A 1 118 ? 2.190   129.134 156.810 1.00 33.59  ? 121 TYR A CD2 1 
ATOM   944  C  CE1 . TYR A 1 118 ? -0.067  129.663 158.337 1.00 34.55  ? 121 TYR A CE1 1 
ATOM   945  C  CE2 . TYR A 1 118 ? 2.064   130.346 157.453 1.00 37.60  ? 121 TYR A CE2 1 
ATOM   946  C  CZ  . TYR A 1 118 ? 0.936   130.608 158.219 1.00 41.35  ? 121 TYR A CZ  1 
ATOM   947  O  OH  . TYR A 1 118 ? 0.823   131.820 158.862 1.00 42.21  ? 121 TYR A OH  1 
ATOM   948  N  N   . SER A 1 119 ? -1.155  128.349 154.310 1.00 38.53  ? 122 SER A N   1 
ATOM   949  C  CA  . SER A 1 119 ? -2.520  128.853 154.448 1.00 43.41  ? 122 SER A CA  1 
ATOM   950  C  C   . SER A 1 119 ? -2.838  129.758 153.259 1.00 42.35  ? 122 SER A C   1 
ATOM   951  O  O   . SER A 1 119 ? -1.983  130.020 152.409 1.00 38.67  ? 122 SER A O   1 
ATOM   952  C  CB  . SER A 1 119 ? -2.700  129.608 155.770 1.00 37.59  ? 122 SER A CB  1 
ATOM   953  O  OG  . SER A 1 119 ? -1.927  130.798 155.792 1.00 35.66  ? 122 SER A OG  1 
ATOM   954  N  N   . GLY A 1 120 ? -4.074  130.260 153.229 1.00 39.73  ? 123 GLY A N   1 
ATOM   955  C  CA  . GLY A 1 120 ? -4.510  131.212 152.216 1.00 40.28  ? 123 GLY A CA  1 
ATOM   956  C  C   . GLY A 1 120 ? -5.801  130.815 151.511 1.00 38.70  ? 123 GLY A C   1 
ATOM   957  O  O   . GLY A 1 120 ? -6.151  129.638 151.408 1.00 36.38  ? 123 GLY A O   1 
ATOM   958  N  N   . SER A 1 121 ? -6.525  131.818 151.025 1.00 36.92  ? 124 SER A N   1 
ATOM   959  C  CA  . SER A 1 121 ? -7.811  131.568 150.390 1.00 40.20  ? 124 SER A CA  1 
ATOM   960  C  C   . SER A 1 121 ? -8.057  132.603 149.309 1.00 39.54  ? 124 SER A C   1 
ATOM   961  O  O   . SER A 1 121 ? -7.722  133.780 149.481 1.00 40.93  ? 124 SER A O   1 
ATOM   962  C  CB  . SER A 1 121 ? -8.965  131.615 151.395 1.00 39.11  ? 124 SER A CB  1 
ATOM   963  O  OG  . SER A 1 121 ? -8.770  130.670 152.415 1.00 49.30  ? 124 SER A OG  1 
ATOM   964  N  N   . SER A 1 122 ? -8.672  132.163 148.211 1.00 38.04  ? 125 SER A N   1 
ATOM   965  C  CA  . SER A 1 122 ? -9.012  133.066 147.118 1.00 42.29  ? 125 SER A CA  1 
ATOM   966  C  C   . SER A 1 122 ? -10.305 133.818 147.371 1.00 47.12  ? 125 SER A C   1 
ATOM   967  O  O   . SER A 1 122 ? -10.643 134.718 146.593 1.00 44.84  ? 125 SER A O   1 
ATOM   968  C  CB  . SER A 1 122 ? -9.148  132.290 145.817 1.00 42.47  ? 125 SER A CB  1 
ATOM   969  O  OG  . SER A 1 122 ? -10.344 131.537 145.860 1.00 46.25  ? 125 SER A OG  1 
ATOM   970  N  N   . THR A 1 123 ? -11.017 133.470 148.444 1.00 45.17  ? 126 THR A N   1 
ATOM   971  C  CA  . THR A 1 123 ? -12.355 133.964 148.731 1.00 47.83  ? 126 THR A CA  1 
ATOM   972  C  C   . THR A 1 123 ? -12.384 135.032 149.822 1.00 44.25  ? 126 THR A C   1 
ATOM   973  O  O   . THR A 1 123 ? -13.472 135.446 150.228 1.00 42.30  ? 126 THR A O   1 
ATOM   974  C  CB  . THR A 1 123 ? -13.264 132.792 149.117 1.00 44.88  ? 126 THR A CB  1 
ATOM   975  O  OG1 . THR A 1 123 ? -12.782 132.193 150.323 1.00 40.92  ? 126 THR A OG1 1 
ATOM   976  C  CG2 . THR A 1 123 ? -13.239 131.736 148.019 1.00 45.83  ? 126 THR A CG2 1 
ATOM   977  N  N   . LEU A 1 124 ? -11.225 135.505 150.284 1.00 41.93  ? 127 LEU A N   1 
ATOM   978  C  CA  . LEU A 1 124 ? -11.198 136.559 151.290 1.00 42.54  ? 127 LEU A CA  1 
ATOM   979  C  C   . LEU A 1 124 ? -11.806 137.846 150.745 1.00 43.74  ? 127 LEU A C   1 
ATOM   980  O  O   . LEU A 1 124 ? -11.816 138.108 149.538 1.00 48.19  ? 127 LEU A O   1 
ATOM   981  C  CB  . LEU A 1 124 ? -9.766  136.839 151.764 1.00 42.18  ? 127 LEU A CB  1 
ATOM   982  C  CG  . LEU A 1 124 ? -8.985  135.652 152.336 1.00 39.16  ? 127 LEU A CG  1 
ATOM   983  C  CD1 . LEU A 1 124 ? -7.658  136.100 152.909 1.00 32.23  ? 127 LEU A CD1 1 
ATOM   984  C  CD2 . LEU A 1 124 ? -9.822  134.895 153.344 1.00 35.51  ? 127 LEU A CD2 1 
ATOM   985  N  N   . ASP A 1 125 ? -12.280 138.679 151.666 1.00 47.45  ? 128 ASP A N   1 
ATOM   986  C  CA  . ASP A 1 125 ? -12.898 139.940 151.279 1.00 47.22  ? 128 ASP A CA  1 
ATOM   987  C  C   . ASP A 1 125 ? -11.892 140.897 150.661 1.00 48.42  ? 128 ASP A C   1 
ATOM   988  O  O   . ASP A 1 125 ? -12.241 141.633 149.729 1.00 51.90  ? 128 ASP A O   1 
ATOM   989  C  CB  . ASP A 1 125 ? -13.582 140.582 152.486 1.00 52.29  ? 128 ASP A CB  1 
ATOM   990  C  CG  . ASP A 1 125 ? -14.813 139.830 152.900 1.00 50.12  ? 128 ASP A CG  1 
ATOM   991  O  OD1 . ASP A 1 125 ? -15.201 138.904 152.159 1.00 63.56  ? 128 ASP A OD1 1 
ATOM   992  O  OD2 . ASP A 1 125 ? -15.385 140.151 153.954 1.00 67.83  ? 128 ASP A OD2 1 
ATOM   993  N  N   . VAL A 1 126 ? -10.650 140.923 151.166 1.00 43.38  ? 129 VAL A N   1 
ATOM   994  C  CA  . VAL A 1 126 ? -9.629  141.776 150.553 1.00 47.82  ? 129 VAL A CA  1 
ATOM   995  C  C   . VAL A 1 126 ? -9.210  141.321 149.162 1.00 43.38  ? 129 VAL A C   1 
ATOM   996  O  O   . VAL A 1 126 ? -8.484  142.060 148.491 1.00 46.94  ? 129 VAL A O   1 
ATOM   997  C  CB  . VAL A 1 126 ? -8.317  141.901 151.360 1.00 45.03  ? 129 VAL A CB  1 
ATOM   998  C  CG1 . VAL A 1 126 ? -8.397  143.049 152.311 1.00 44.53  ? 129 VAL A CG1 1 
ATOM   999  C  CG2 . VAL A 1 126 ? -7.966  140.593 152.054 1.00 40.98  ? 129 VAL A CG2 1 
ATOM   1000 N  N   . TYR A 1 127 ? -9.622  140.132 148.714 1.00 40.75  ? 130 TYR A N   1 
ATOM   1001 C  CA  . TYR A 1 127 ? -9.252  139.630 147.395 1.00 43.44  ? 130 TYR A CA  1 
ATOM   1002 C  C   . TYR A 1 127 ? -10.411 139.690 146.406 1.00 48.17  ? 130 TYR A C   1 
ATOM   1003 O  O   . TYR A 1 127 ? -10.331 139.073 145.340 1.00 43.15  ? 130 TYR A O   1 
ATOM   1004 C  CB  . TYR A 1 127 ? -8.733  138.187 147.476 1.00 41.04  ? 130 TYR A CB  1 
ATOM   1005 C  CG  . TYR A 1 127 ? -7.508  137.952 148.335 1.00 39.52  ? 130 TYR A CG  1 
ATOM   1006 C  CD1 . TYR A 1 127 ? -6.625  138.982 148.651 1.00 37.25  ? 130 TYR A CD1 1 
ATOM   1007 C  CD2 . TYR A 1 127 ? -7.244  136.683 148.838 1.00 38.21  ? 130 TYR A CD2 1 
ATOM   1008 C  CE1 . TYR A 1 127 ? -5.508  138.745 149.449 1.00 36.86  ? 130 TYR A CE1 1 
ATOM   1009 C  CE2 . TYR A 1 127 ? -6.146  136.432 149.623 1.00 35.79  ? 130 TYR A CE2 1 
ATOM   1010 C  CZ  . TYR A 1 127 ? -5.276  137.458 149.932 1.00 41.83  ? 130 TYR A CZ  1 
ATOM   1011 O  OH  . TYR A 1 127 ? -4.179  137.173 150.726 1.00 40.15  ? 130 TYR A OH  1 
ATOM   1012 N  N   . ASN A 1 128 ? -11.490 140.396 146.747 1.00 49.90  ? 131 ASN A N   1 
ATOM   1013 C  CA  . ASN A 1 128 ? -12.683 140.490 145.910 1.00 43.57  ? 131 ASN A CA  1 
ATOM   1014 C  C   . ASN A 1 128 ? -12.360 141.324 144.673 1.00 48.60  ? 131 ASN A C   1 
ATOM   1015 O  O   . ASN A 1 128 ? -12.152 142.538 144.768 1.00 51.29  ? 131 ASN A O   1 
ATOM   1016 C  CB  . ASN A 1 128 ? -13.817 141.105 146.728 1.00 48.49  ? 131 ASN A CB  1 
ATOM   1017 C  CG  . ASN A 1 128 ? -15.150 141.146 145.989 1.00 55.49  ? 131 ASN A CG  1 
ATOM   1018 O  OD1 . ASN A 1 128 ? -15.279 140.673 144.863 1.00 50.42  ? 131 ASN A OD1 1 
ATOM   1019 N  ND2 . ASN A 1 128 ? -16.159 141.711 146.645 1.00 62.02  ? 131 ASN A ND2 1 
ATOM   1020 N  N   . GLY A 1 129 ? -12.310 140.677 143.510 1.00 44.28  ? 132 GLY A N   1 
ATOM   1021 C  CA  . GLY A 1 129 ? -11.822 141.345 142.325 1.00 48.49  ? 132 GLY A CA  1 
ATOM   1022 C  C   . GLY A 1 129 ? -12.765 142.311 141.642 1.00 49.99  ? 132 GLY A C   1 
ATOM   1023 O  O   . GLY A 1 129 ? -12.375 142.911 140.636 1.00 50.86  ? 132 GLY A O   1 
ATOM   1024 N  N   . LYS A 1 130 ? -13.983 142.503 142.158 1.00 46.20  ? 133 LYS A N   1 
ATOM   1025 C  CA  . LYS A 1 130 ? -14.979 143.260 141.410 1.00 47.30  ? 133 LYS A CA  1 
ATOM   1026 C  C   . LYS A 1 130 ? -14.627 144.740 141.298 1.00 45.10  ? 133 LYS A C   1 
ATOM   1027 O  O   . LYS A 1 130 ? -14.966 145.376 140.300 1.00 52.64  ? 133 LYS A O   1 
ATOM   1028 C  CB  . LYS A 1 130 ? -16.359 143.083 142.038 1.00 51.89  ? 133 LYS A CB  1 
ATOM   1029 C  CG  . LYS A 1 130 ? -16.563 143.796 143.369 1.00 53.17  ? 133 LYS A CG  1 
ATOM   1030 C  CD  . LYS A 1 130 ? -17.878 143.350 143.982 1.00 56.36  ? 133 LYS A CD  1 
ATOM   1031 C  CE  . LYS A 1 130 ? -18.281 144.188 145.189 1.00 57.22  ? 133 LYS A CE  1 
ATOM   1032 N  NZ  . LYS A 1 130 ? -19.623 143.744 145.646 1.00 51.12  ? 133 LYS A NZ  1 
ATOM   1033 N  N   . TYR A 1 131 ? -13.956 145.311 142.287 1.00 49.09  ? 134 TYR A N   1 
ATOM   1034 C  CA  . TYR A 1 131 ? -13.606 146.725 142.190 1.00 51.33  ? 134 TYR A CA  1 
ATOM   1035 C  C   . TYR A 1 131 ? -12.508 146.951 141.159 1.00 52.67  ? 134 TYR A C   1 
ATOM   1036 O  O   . TYR A 1 131 ? -12.502 147.966 140.456 1.00 51.14  ? 134 TYR A O   1 
ATOM   1037 C  CB  . TYR A 1 131 ? -13.179 147.257 143.564 1.00 50.03  ? 134 TYR A CB  1 
ATOM   1038 C  CG  . TYR A 1 131 ? -14.187 146.955 144.650 1.00 53.78  ? 134 TYR A CG  1 
ATOM   1039 C  CD1 . TYR A 1 131 ? -15.408 147.607 144.680 1.00 55.85  ? 134 TYR A CD1 1 
ATOM   1040 C  CD2 . TYR A 1 131 ? -13.922 146.009 145.631 1.00 49.69  ? 134 TYR A CD2 1 
ATOM   1041 C  CE1 . TYR A 1 131 ? -16.337 147.330 145.653 1.00 63.63  ? 134 TYR A CE1 1 
ATOM   1042 C  CE2 . TYR A 1 131 ? -14.849 145.722 146.614 1.00 49.29  ? 134 TYR A CE2 1 
ATOM   1043 C  CZ  . TYR A 1 131 ? -16.055 146.390 146.619 1.00 60.60  ? 134 TYR A CZ  1 
ATOM   1044 O  OH  . TYR A 1 131 ? -16.998 146.127 147.583 1.00 64.41  ? 134 TYR A OH  1 
ATOM   1045 N  N   . LEU A 1 132 ? -11.562 146.023 141.064 1.00 54.21  ? 135 LEU A N   1 
ATOM   1046 C  CA  . LEU A 1 132 ? -10.468 146.187 140.119 1.00 51.86  ? 135 LEU A CA  1 
ATOM   1047 C  C   . LEU A 1 132 ? -10.950 145.945 138.696 1.00 52.44  ? 135 LEU A C   1 
ATOM   1048 O  O   . LEU A 1 132 ? -10.663 146.731 137.785 1.00 55.53  ? 135 LEU A O   1 
ATOM   1049 C  CB  . LEU A 1 132 ? -9.335  145.231 140.495 1.00 51.61  ? 135 LEU A CB  1 
ATOM   1050 C  CG  . LEU A 1 132 ? -7.954  145.448 139.902 1.00 51.14  ? 135 LEU A CG  1 
ATOM   1051 C  CD1 . LEU A 1 132 ? -7.571  146.915 139.877 1.00 45.11  ? 135 LEU A CD1 1 
ATOM   1052 C  CD2 . LEU A 1 132 ? -6.988  144.670 140.739 1.00 46.68  ? 135 LEU A CD2 1 
ATOM   1053 N  N   . ALA A 1 133 ? -11.701 144.863 138.494 1.00 50.01  ? 136 ALA A N   1 
ATOM   1054 C  CA  . ALA A 1 133 ? -12.245 144.572 137.178 1.00 47.74  ? 136 ALA A CA  1 
ATOM   1055 C  C   . ALA A 1 133 ? -13.110 145.722 136.680 1.00 56.73  ? 136 ALA A C   1 
ATOM   1056 O  O   . ALA A 1 133 ? -13.021 146.119 135.509 1.00 54.26  ? 136 ALA A O   1 
ATOM   1057 C  CB  . ALA A 1 133 ? -13.047 143.274 137.227 1.00 47.89  ? 136 ALA A CB  1 
ATOM   1058 N  N   . TYR A 1 134 ? -13.934 146.285 137.565 1.00 50.36  ? 137 TYR A N   1 
ATOM   1059 C  CA  . TYR A 1 134 ? -14.839 147.358 137.172 1.00 53.24  ? 137 TYR A CA  1 
ATOM   1060 C  C   . TYR A 1 134 ? -14.085 148.660 136.914 1.00 54.02  ? 137 TYR A C   1 
ATOM   1061 O  O   . TYR A 1 134 ? -14.257 149.291 135.867 1.00 57.50  ? 137 TYR A O   1 
ATOM   1062 C  CB  . TYR A 1 134 ? -15.904 147.553 138.250 1.00 54.59  ? 137 TYR A CB  1 
ATOM   1063 C  CG  . TYR A 1 134 ? -16.782 148.747 138.008 1.00 58.18  ? 137 TYR A CG  1 
ATOM   1064 C  CD1 . TYR A 1 134 ? -17.857 148.669 137.139 1.00 61.64  ? 137 TYR A CD1 1 
ATOM   1065 C  CD2 . TYR A 1 134 ? -16.531 149.960 138.637 1.00 56.03  ? 137 TYR A CD2 1 
ATOM   1066 C  CE1 . TYR A 1 134 ? -18.664 149.760 136.903 1.00 66.45  ? 137 TYR A CE1 1 
ATOM   1067 C  CE2 . TYR A 1 134 ? -17.336 151.062 138.410 1.00 64.81  ? 137 TYR A CE2 1 
ATOM   1068 C  CZ  . TYR A 1 134 ? -18.405 150.954 137.540 1.00 69.92  ? 137 TYR A CZ  1 
ATOM   1069 O  OH  . TYR A 1 134 ? -19.217 152.037 137.300 1.00 70.32  ? 137 TYR A OH  1 
ATOM   1070 N  N   . THR A 1 135 ? -13.247 149.079 137.861 1.00 52.86  ? 138 THR A N   1 
ATOM   1071 C  CA  . THR A 1 135 ? -12.592 150.380 137.764 1.00 50.00  ? 138 THR A CA  1 
ATOM   1072 C  C   . THR A 1 135 ? -11.609 150.452 136.604 1.00 55.47  ? 138 THR A C   1 
ATOM   1073 O  O   . THR A 1 135 ? -11.460 151.515 135.992 1.00 59.41  ? 138 THR A O   1 
ATOM   1074 C  CB  . THR A 1 135 ? -11.863 150.688 139.070 1.00 50.22  ? 138 THR A CB  1 
ATOM   1075 O  OG1 . THR A 1 135 ? -12.799 150.649 140.150 1.00 54.41  ? 138 THR A OG1 1 
ATOM   1076 C  CG2 . THR A 1 135 ? -11.189 152.048 139.023 1.00 46.30  ? 138 THR A CG2 1 
ATOM   1077 N  N   . GLU A 1 136 ? -10.919 149.352 136.296 1.00 59.34  ? 139 GLU A N   1 
ATOM   1078 C  CA  . GLU A 1 136 ? -9.825  149.374 135.333 1.00 52.92  ? 139 GLU A CA  1 
ATOM   1079 C  C   . GLU A 1 136 ? -10.098 148.575 134.067 1.00 53.60  ? 139 GLU A C   1 
ATOM   1080 O  O   . GLU A 1 136 ? -9.201  148.473 133.218 1.00 53.95  ? 139 GLU A O   1 
ATOM   1081 C  CB  . GLU A 1 136 ? -8.536  148.855 135.982 1.00 49.38  ? 139 GLU A CB  1 
ATOM   1082 C  CG  . GLU A 1 136 ? -7.986  149.761 137.050 1.00 51.86  ? 139 GLU A CG  1 
ATOM   1083 C  CD  . GLU A 1 136 ? -7.406  151.039 136.489 1.00 53.64  ? 139 GLU A CD  1 
ATOM   1084 O  OE1 . GLU A 1 136 ? -6.914  151.012 135.346 1.00 56.12  ? 139 GLU A OE1 1 
ATOM   1085 O  OE2 . GLU A 1 136 ? -7.433  152.073 137.191 1.00 54.73  ? 139 GLU A OE2 1 
ATOM   1086 N  N   . GLU A 1 137 ? -11.294 148.000 133.921 1.00 51.21  ? 140 GLU A N   1 
ATOM   1087 C  CA  . GLU A 1 137 ? -11.691 147.294 132.702 1.00 55.37  ? 140 GLU A CA  1 
ATOM   1088 C  C   . GLU A 1 137 ? -10.760 146.110 132.426 1.00 57.95  ? 140 GLU A C   1 
ATOM   1089 O  O   . GLU A 1 137 ? -10.314 145.884 131.294 1.00 54.77  ? 140 GLU A O   1 
ATOM   1090 C  CB  . GLU A 1 137 ? -11.754 148.260 131.509 1.00 51.24  ? 140 GLU A CB  1 
ATOM   1091 C  CG  . GLU A 1 137 ? -12.405 147.709 130.226 1.00 64.22  ? 140 GLU A CG  1 
ATOM   1092 C  CD  . GLU A 1 137 ? -13.874 147.346 130.395 1.00 71.45  ? 140 GLU A CD  1 
ATOM   1093 O  OE1 . GLU A 1 137 ? -14.496 147.828 131.368 1.00 69.50  ? 140 GLU A OE1 1 
ATOM   1094 O  OE2 . GLU A 1 137 ? -14.399 146.574 129.551 1.00 63.07  ? 140 GLU A OE2 1 
ATOM   1095 N  N   . VAL A 1 138 ? -10.453 145.347 133.474 1.00 48.24  ? 141 VAL A N   1 
ATOM   1096 C  CA  . VAL A 1 138 ? -9.685  144.120 133.326 1.00 50.87  ? 141 VAL A CA  1 
ATOM   1097 C  C   . VAL A 1 138 ? -10.563 142.928 133.678 1.00 44.82  ? 141 VAL A C   1 
ATOM   1098 O  O   . VAL A 1 138 ? -11.606 143.054 134.324 1.00 48.06  ? 141 VAL A O   1 
ATOM   1099 C  CB  . VAL A 1 138 ? -8.402  144.123 134.177 1.00 45.34  ? 141 VAL A CB  1 
ATOM   1100 C  CG1 . VAL A 1 138 ? -7.479  145.238 133.719 1.00 45.93  ? 141 VAL A CG1 1 
ATOM   1101 C  CG2 . VAL A 1 138 ? -8.740  144.268 135.641 1.00 49.97  ? 141 VAL A CG2 1 
ATOM   1102 N  N   . VAL A 1 139 ? -10.146 141.762 133.200 1.00 44.00  ? 142 VAL A N   1 
ATOM   1103 C  CA  . VAL A 1 139 ? -10.681 140.482 133.649 1.00 44.25  ? 142 VAL A CA  1 
ATOM   1104 C  C   . VAL A 1 139 ? -9.824  140.019 134.826 1.00 42.87  ? 142 VAL A C   1 
ATOM   1105 O  O   . VAL A 1 139 ? -8.602  139.873 134.696 1.00 43.09  ? 142 VAL A O   1 
ATOM   1106 C  CB  . VAL A 1 139 ? -10.677 139.452 132.509 1.00 39.26  ? 142 VAL A CB  1 
ATOM   1107 C  CG1 . VAL A 1 139 ? -11.046 138.086 133.018 1.00 44.19  ? 142 VAL A CG1 1 
ATOM   1108 C  CG2 . VAL A 1 139 ? -11.652 139.869 131.448 1.00 47.86  ? 142 VAL A CG2 1 
ATOM   1109 N  N   . LEU A 1 140 ? -10.447 139.825 135.983 1.00 45.79  ? 143 LEU A N   1 
ATOM   1110 C  CA  . LEU A 1 140 ? -9.734  139.494 137.219 1.00 40.30  ? 143 LEU A CA  1 
ATOM   1111 C  C   . LEU A 1 140 ? -9.973  138.023 137.543 1.00 42.58  ? 143 LEU A C   1 
ATOM   1112 O  O   . LEU A 1 140 ? -11.100 137.623 137.857 1.00 40.25  ? 143 LEU A O   1 
ATOM   1113 C  CB  . LEU A 1 140 ? -10.191 140.392 138.367 1.00 42.68  ? 143 LEU A CB  1 
ATOM   1114 C  CG  . LEU A 1 140 ? -9.299  140.620 139.598 1.00 42.40  ? 143 LEU A CG  1 
ATOM   1115 C  CD1 . LEU A 1 140 ? -9.102  139.347 140.390 1.00 40.70  ? 143 LEU A CD1 1 
ATOM   1116 C  CD2 . LEU A 1 140 ? -7.963  141.195 139.211 1.00 43.59  ? 143 LEU A CD2 1 
ATOM   1117 N  N   . VAL A 1 141 ? -8.920  137.222 137.467 1.00 36.74  ? 144 VAL A N   1 
ATOM   1118 C  CA  . VAL A 1 141 ? -8.962  135.849 137.951 1.00 37.53  ? 144 VAL A CA  1 
ATOM   1119 C  C   . VAL A 1 141 ? -8.267  135.789 139.306 1.00 38.17  ? 144 VAL A C   1 
ATOM   1120 O  O   . VAL A 1 141 ? -7.285  136.500 139.550 1.00 38.29  ? 144 VAL A O   1 
ATOM   1121 C  CB  . VAL A 1 141 ? -8.306  134.878 136.953 1.00 34.77  ? 144 VAL A CB  1 
ATOM   1122 C  CG1 . VAL A 1 141 ? -8.392  133.444 137.467 1.00 29.22  ? 144 VAL A CG1 1 
ATOM   1123 C  CG2 . VAL A 1 141 ? -8.971  135.003 135.599 1.00 43.42  ? 144 VAL A CG2 1 
ATOM   1124 N  N   . SER A 1 142 ? -8.783  134.957 140.197 1.00 37.20  ? 145 SER A N   1 
ATOM   1125 C  CA  . SER A 1 142 ? -8.023  134.529 141.362 1.00 41.26  ? 145 SER A CA  1 
ATOM   1126 C  C   . SER A 1 142 ? -8.077  133.012 141.378 1.00 41.27  ? 145 SER A C   1 
ATOM   1127 O  O   . SER A 1 142 ? -9.152  132.422 141.227 1.00 41.58  ? 145 SER A O   1 
ATOM   1128 C  CB  . SER A 1 142 ? -8.547  135.136 142.680 1.00 37.12  ? 145 SER A CB  1 
ATOM   1129 O  OG  . SER A 1 142 ? -9.846  134.681 143.008 1.00 41.18  ? 145 SER A OG  1 
ATOM   1130 N  N   . LEU A 1 143 ? -6.910  132.392 141.480 1.00 39.59  ? 146 LEU A N   1 
ATOM   1131 C  CA  . LEU A 1 143 ? -6.793  130.948 141.509 1.00 40.04  ? 146 LEU A CA  1 
ATOM   1132 C  C   . LEU A 1 143 ? -6.662  130.463 142.959 1.00 40.71  ? 146 LEU A C   1 
ATOM   1133 O  O   . LEU A 1 143 ? -6.557  131.246 143.907 1.00 35.28  ? 146 LEU A O   1 
ATOM   1134 C  CB  . LEU A 1 143 ? -5.605  130.516 140.642 1.00 35.01  ? 146 LEU A CB  1 
ATOM   1135 C  CG  . LEU A 1 143 ? -4.207  131.066 140.945 1.00 37.47  ? 146 LEU A CG  1 
ATOM   1136 C  CD1 . LEU A 1 143 ? -3.619  130.539 142.305 1.00 35.09  ? 146 LEU A CD1 1 
ATOM   1137 C  CD2 . LEU A 1 143 ? -3.243  130.745 139.798 1.00 28.27  ? 146 LEU A CD2 1 
ATOM   1138 N  N   . SER A 1 144 ? -6.633  129.148 143.126 1.00 40.17  ? 147 SER A N   1 
ATOM   1139 C  CA  . SER A 1 144 ? -6.345  128.552 144.418 1.00 40.44  ? 147 SER A CA  1 
ATOM   1140 C  C   . SER A 1 144 ? -5.354  127.418 144.214 1.00 40.45  ? 147 SER A C   1 
ATOM   1141 O  O   . SER A 1 144 ? -5.125  126.958 143.089 1.00 39.28  ? 147 SER A O   1 
ATOM   1142 C  CB  . SER A 1 144 ? -7.612  128.036 145.100 1.00 42.55  ? 147 SER A CB  1 
ATOM   1143 O  OG  . SER A 1 144 ? -8.007  126.810 144.514 1.00 48.87  ? 147 SER A OG  1 
ATOM   1144 N  N   . TYR A 1 145 ? -4.763  126.971 145.319 1.00 35.07  ? 148 TYR A N   1 
ATOM   1145 C  CA  . TYR A 1 145 ? -3.731  125.947 145.265 1.00 33.65  ? 148 TYR A CA  1 
ATOM   1146 C  C   . TYR A 1 145 ? -3.591  125.299 146.629 1.00 44.97  ? 148 TYR A C   1 
ATOM   1147 O  O   . TYR A 1 145 ? -3.828  125.936 147.666 1.00 37.53  ? 148 TYR A O   1 
ATOM   1148 C  CB  . TYR A 1 145 ? -2.390  126.525 144.793 1.00 39.33  ? 148 TYR A CB  1 
ATOM   1149 C  CG  . TYR A 1 145 ? -1.764  127.605 145.664 1.00 42.13  ? 148 TYR A CG  1 
ATOM   1150 C  CD1 . TYR A 1 145 ? -2.109  128.945 145.509 1.00 34.68  ? 148 TYR A CD1 1 
ATOM   1151 C  CD2 . TYR A 1 145 ? -0.785  127.283 146.617 1.00 37.95  ? 148 TYR A CD2 1 
ATOM   1152 C  CE1 . TYR A 1 145 ? -1.505  129.937 146.291 1.00 33.42  ? 148 TYR A CE1 1 
ATOM   1153 C  CE2 . TYR A 1 145 ? -0.173  128.269 147.396 1.00 32.12  ? 148 TYR A CE2 1 
ATOM   1154 C  CZ  . TYR A 1 145 ? -0.538  129.588 147.238 1.00 36.52  ? 148 TYR A CZ  1 
ATOM   1155 O  OH  . TYR A 1 145 ? 0.066   130.563 148.026 1.00 32.69  ? 148 TYR A OH  1 
ATOM   1156 N  N   . ARG A 1 146 ? -3.216  124.019 146.612 1.00 39.86  ? 149 ARG A N   1 
ATOM   1157 C  CA  . ARG A 1 146 ? -3.045  123.271 147.850 1.00 37.41  ? 149 ARG A CA  1 
ATOM   1158 C  C   . ARG A 1 146 ? -1.907  123.857 148.680 1.00 42.73  ? 149 ARG A C   1 
ATOM   1159 O  O   . ARG A 1 146 ? -0.807  124.098 148.170 1.00 41.34  ? 149 ARG A O   1 
ATOM   1160 C  CB  . ARG A 1 146 ? -2.766  121.799 147.539 1.00 37.90  ? 149 ARG A CB  1 
ATOM   1161 C  CG  . ARG A 1 146 ? -3.996  120.974 147.197 1.00 39.17  ? 149 ARG A CG  1 
ATOM   1162 C  CD  . ARG A 1 146 ? -3.622  119.613 146.597 1.00 43.52  ? 149 ARG A CD  1 
ATOM   1163 N  NE  . ARG A 1 146 ? -3.051  119.695 145.241 1.00 42.14  ? 149 ARG A NE  1 
ATOM   1164 C  CZ  . ARG A 1 146 ? -2.523  118.653 144.598 1.00 46.35  ? 149 ARG A CZ  1 
ATOM   1165 N  NH1 . ARG A 1 146 ? -2.486  117.470 145.195 1.00 44.68  ? 149 ARG A NH1 1 
ATOM   1166 N  NH2 . ARG A 1 146 ? -2.028  118.784 143.363 1.00 44.82  ? 149 ARG A NH2 1 
ATOM   1167 N  N   . VAL A 1 147 ? -2.168  124.073 149.968 1.00 44.53  ? 150 VAL A N   1 
ATOM   1168 C  CA  . VAL A 1 147 ? -1.161  124.569 150.896 1.00 41.55  ? 150 VAL A CA  1 
ATOM   1169 C  C   . VAL A 1 147 ? -0.836  123.477 151.908 1.00 41.23  ? 150 VAL A C   1 
ATOM   1170 O  O   . VAL A 1 147 ? -1.498  122.443 151.979 1.00 42.01  ? 150 VAL A O   1 
ATOM   1171 C  CB  . VAL A 1 147 ? -1.609  125.858 151.599 1.00 40.63  ? 150 VAL A CB  1 
ATOM   1172 C  CG1 . VAL A 1 147 ? -1.797  126.970 150.574 1.00 36.28  ? 150 VAL A CG1 1 
ATOM   1173 C  CG2 . VAL A 1 147 ? -2.892  125.603 152.392 1.00 38.05  ? 150 VAL A CG2 1 
ATOM   1174 N  N   . GLY A 1 148 ? 0.203   123.723 152.703 1.00 45.08  ? 151 GLY A N   1 
ATOM   1175 C  CA  . GLY A 1 148 ? 0.551   122.804 153.773 1.00 43.55  ? 151 GLY A CA  1 
ATOM   1176 C  C   . GLY A 1 148 ? 1.152   121.529 153.209 1.00 46.12  ? 151 GLY A C   1 
ATOM   1177 O  O   . GLY A 1 148 ? 1.701   121.505 152.109 1.00 47.10  ? 151 GLY A O   1 
ATOM   1178 N  N   . ALA A 1 149 ? 1.028   120.443 153.975 1.00 47.71  ? 152 ALA A N   1 
ATOM   1179 C  CA  . ALA A 1 149 ? 1.486   119.144 153.489 1.00 47.24  ? 152 ALA A CA  1 
ATOM   1180 C  C   . ALA A 1 149 ? 0.767   118.725 152.209 1.00 44.24  ? 152 ALA A C   1 
ATOM   1181 O  O   . ALA A 1 149 ? 1.362   118.054 151.364 1.00 42.03  ? 152 ALA A O   1 
ATOM   1182 C  CB  . ALA A 1 149 ? 1.282   118.075 154.562 1.00 35.01  ? 152 ALA A CB  1 
ATOM   1183 N  N   . PHE A 1 150 ? -0.510  119.103 152.062 1.00 43.18  ? 153 PHE A N   1 
ATOM   1184 C  CA  . PHE A 1 150 ? -1.318  118.650 150.937 1.00 43.76  ? 153 PHE A CA  1 
ATOM   1185 C  C   . PHE A 1 150 ? -0.750  119.127 149.610 1.00 48.80  ? 153 PHE A C   1 
ATOM   1186 O  O   . PHE A 1 150 ? -0.937  118.464 148.583 1.00 43.07  ? 153 PHE A O   1 
ATOM   1187 C  CB  . PHE A 1 150 ? -2.762  119.136 151.084 1.00 39.58  ? 153 PHE A CB  1 
ATOM   1188 C  CG  . PHE A 1 150 ? -3.370  118.816 152.408 1.00 46.19  ? 153 PHE A CG  1 
ATOM   1189 C  CD1 . PHE A 1 150 ? -3.860  117.544 152.672 1.00 50.05  ? 153 PHE A CD1 1 
ATOM   1190 C  CD2 . PHE A 1 150 ? -3.430  119.779 153.411 1.00 47.54  ? 153 PHE A CD2 1 
ATOM   1191 C  CE1 . PHE A 1 150 ? -4.410  117.240 153.919 1.00 48.07  ? 153 PHE A CE1 1 
ATOM   1192 C  CE2 . PHE A 1 150 ? -3.987  119.489 154.645 1.00 47.44  ? 153 PHE A CE2 1 
ATOM   1193 C  CZ  . PHE A 1 150 ? -4.478  118.217 154.899 1.00 47.51  ? 153 PHE A CZ  1 
ATOM   1194 N  N   . GLY A 1 151 ? -0.057  120.264 149.614 1.00 45.43  ? 154 GLY A N   1 
ATOM   1195 C  CA  . GLY A 1 151 ? 0.485   120.825 148.401 1.00 37.48  ? 154 GLY A CA  1 
ATOM   1196 C  C   . GLY A 1 151 ? 1.999   120.790 148.329 1.00 45.25  ? 154 GLY A C   1 
ATOM   1197 O  O   . GLY A 1 151 ? 2.552   120.979 147.239 1.00 43.25  ? 154 GLY A O   1 
ATOM   1198 N  N   . PHE A 1 152 ? 2.698   120.545 149.460 1.00 41.90  ? 155 PHE A N   1 
ATOM   1199 C  CA  . PHE A 1 152 ? 4.154   120.656 149.418 1.00 42.77  ? 155 PHE A CA  1 
ATOM   1200 C  C   . PHE A 1 152 ? 4.902   119.559 150.175 1.00 40.59  ? 155 PHE A C   1 
ATOM   1201 O  O   . PHE A 1 152 ? 6.093   119.726 150.461 1.00 39.60  ? 155 PHE A O   1 
ATOM   1202 C  CB  . PHE A 1 152 ? 4.575   122.037 149.912 1.00 37.70  ? 155 PHE A CB  1 
ATOM   1203 C  CG  . PHE A 1 152 ? 4.069   123.141 149.037 1.00 44.56  ? 155 PHE A CG  1 
ATOM   1204 C  CD1 . PHE A 1 152 ? 4.638   123.365 147.787 1.00 36.76  ? 155 PHE A CD1 1 
ATOM   1205 C  CD2 . PHE A 1 152 ? 2.989   123.910 149.427 1.00 37.19  ? 155 PHE A CD2 1 
ATOM   1206 C  CE1 . PHE A 1 152 ? 4.164   124.357 146.970 1.00 39.83  ? 155 PHE A CE1 1 
ATOM   1207 C  CE2 . PHE A 1 152 ? 2.511   124.905 148.613 1.00 39.57  ? 155 PHE A CE2 1 
ATOM   1208 C  CZ  . PHE A 1 152 ? 3.094   125.127 147.369 1.00 38.58  ? 155 PHE A CZ  1 
ATOM   1209 N  N   . LEU A 1 153 ? 4.265   118.429 150.463 1.00 41.82  ? 156 LEU A N   1 
ATOM   1210 C  CA  . LEU A 1 153 ? 4.988   117.289 151.020 1.00 48.69  ? 156 LEU A CA  1 
ATOM   1211 C  C   . LEU A 1 153 ? 5.930   116.743 149.956 1.00 49.33  ? 156 LEU A C   1 
ATOM   1212 O  O   . LEU A 1 153 ? 5.477   116.269 148.914 1.00 53.23  ? 156 LEU A O   1 
ATOM   1213 C  CB  . LEU A 1 153 ? 4.012   116.206 151.482 1.00 45.38  ? 156 LEU A CB  1 
ATOM   1214 C  CG  . LEU A 1 153 ? 4.604   114.948 152.132 1.00 54.90  ? 156 LEU A CG  1 
ATOM   1215 C  CD1 . LEU A 1 153 ? 4.687   115.063 153.676 1.00 50.43  ? 156 LEU A CD1 1 
ATOM   1216 C  CD2 . LEU A 1 153 ? 3.814   113.719 151.735 1.00 50.80  ? 156 LEU A CD2 1 
ATOM   1217 N  N   . ALA A 1 154 ? 7.233   116.811 150.206 1.00 46.82  ? 157 ALA A N   1 
ATOM   1218 C  CA  . ALA A 1 154 ? 8.245   116.526 149.193 1.00 47.02  ? 157 ALA A CA  1 
ATOM   1219 C  C   . ALA A 1 154 ? 9.019   115.266 149.575 1.00 56.04  ? 157 ALA A C   1 
ATOM   1220 O  O   . ALA A 1 154 ? 9.866   115.296 150.476 1.00 52.44  ? 157 ALA A O   1 
ATOM   1221 C  CB  . ALA A 1 154 ? 9.185   117.719 149.026 1.00 44.37  ? 157 ALA A CB  1 
ATOM   1222 N  N   . LEU A 1 155 ? 8.733   114.164 148.886 1.00 53.63  ? 158 LEU A N   1 
ATOM   1223 C  CA  . LEU A 1 155 ? 9.471   112.907 149.017 1.00 53.46  ? 158 LEU A CA  1 
ATOM   1224 C  C   . LEU A 1 155 ? 10.129  112.661 147.665 1.00 58.72  ? 158 LEU A C   1 
ATOM   1225 O  O   . LEU A 1 155 ? 9.575   111.972 146.805 1.00 55.26  ? 158 LEU A O   1 
ATOM   1226 C  CB  . LEU A 1 155 ? 8.556   111.757 149.416 1.00 51.54  ? 158 LEU A CB  1 
ATOM   1227 C  CG  . LEU A 1 155 ? 8.272   111.662 150.909 1.00 49.39  ? 158 LEU A CG  1 
ATOM   1228 C  CD1 . LEU A 1 155 ? 7.150   110.685 151.182 1.00 44.61  ? 158 LEU A CD1 1 
ATOM   1229 C  CD2 . LEU A 1 155 ? 9.539   111.252 151.624 1.00 47.94  ? 158 LEU A CD2 1 
ATOM   1230 N  N   . HIS A 1 156 ? 11.306  113.252 147.475 1.00 60.82  ? 159 HIS A N   1 
ATOM   1231 C  CA  . HIS A 1 156 ? 11.888  113.298 146.141 1.00 61.90  ? 159 HIS A CA  1 
ATOM   1232 C  C   . HIS A 1 156 ? 12.216  111.896 145.659 1.00 65.85  ? 159 HIS A C   1 
ATOM   1233 O  O   . HIS A 1 156 ? 12.600  111.023 146.441 1.00 68.12  ? 159 HIS A O   1 
ATOM   1234 C  CB  . HIS A 1 156 ? 13.148  114.154 146.120 1.00 61.08  ? 159 HIS A CB  1 
ATOM   1235 C  CG  . HIS A 1 156 ? 13.647  114.435 144.738 1.00 62.55  ? 159 HIS A CG  1 
ATOM   1236 N  ND1 . HIS A 1 156 ? 14.947  114.194 144.349 1.00 64.78  ? 159 HIS A ND1 1 
ATOM   1237 C  CD2 . HIS A 1 156 ? 13.011  114.919 143.645 1.00 59.46  ? 159 HIS A CD2 1 
ATOM   1238 C  CE1 . HIS A 1 156 ? 15.097  114.534 143.081 1.00 60.36  ? 159 HIS A CE1 1 
ATOM   1239 N  NE2 . HIS A 1 156 ? 13.936  114.974 142.630 1.00 65.14  ? 159 HIS A NE2 1 
ATOM   1240 N  N   . GLY A 1 157 ? 12.058  111.687 144.351 1.00 60.71  ? 160 GLY A N   1 
ATOM   1241 C  CA  . GLY A 1 157 ? 12.221  110.385 143.754 1.00 58.66  ? 160 GLY A CA  1 
ATOM   1242 C  C   . GLY A 1 157 ? 10.951  109.569 143.679 1.00 57.96  ? 160 GLY A C   1 
ATOM   1243 O  O   . GLY A 1 157 ? 10.867  108.646 142.865 1.00 69.55  ? 160 GLY A O   1 
ATOM   1244 N  N   . SER A 1 158 ? 9.971   109.871 144.511 1.00 56.18  ? 161 SER A N   1 
ATOM   1245 C  CA  . SER A 1 158 ? 8.672   109.242 144.401 1.00 56.04  ? 161 SER A CA  1 
ATOM   1246 C  C   . SER A 1 158 ? 7.836   109.993 143.378 1.00 60.13  ? 161 SER A C   1 
ATOM   1247 O  O   . SER A 1 158 ? 8.136   111.133 143.009 1.00 61.29  ? 161 SER A O   1 
ATOM   1248 C  CB  . SER A 1 158 ? 7.969   109.229 145.761 1.00 58.98  ? 161 SER A CB  1 
ATOM   1249 O  OG  . SER A 1 158 ? 6.588   108.940 145.627 1.00 66.55  ? 161 SER A OG  1 
ATOM   1250 N  N   . GLN A 1 159 ? 6.786   109.335 142.901 1.00 55.78  ? 162 GLN A N   1 
ATOM   1251 C  CA  . GLN A 1 159 ? 5.845   109.969 141.996 1.00 62.35  ? 162 GLN A CA  1 
ATOM   1252 C  C   . GLN A 1 159 ? 4.488   110.163 142.640 1.00 62.14  ? 162 GLN A C   1 
ATOM   1253 O  O   . GLN A 1 159 ? 3.620   110.817 142.046 1.00 62.22  ? 162 GLN A O   1 
ATOM   1254 C  CB  . GLN A 1 159 ? 5.697   109.147 140.706 1.00 68.71  ? 162 GLN A CB  1 
ATOM   1255 C  CG  . GLN A 1 159 ? 7.021   108.860 139.992 1.00 73.02  ? 162 GLN A CG  1 
ATOM   1256 C  CD  . GLN A 1 159 ? 7.745   110.125 139.542 1.00 75.67  ? 162 GLN A CD  1 
ATOM   1257 O  OE1 . GLN A 1 159 ? 7.119   111.148 139.251 1.00 68.78  ? 162 GLN A OE1 1 
ATOM   1258 N  NE2 . GLN A 1 159 ? 9.075   110.058 139.485 1.00 78.47  ? 162 GLN A NE2 1 
ATOM   1259 N  N   . GLU A 1 160 ? 4.294   109.607 143.836 1.00 63.85  ? 163 GLU A N   1 
ATOM   1260 C  CA  . GLU A 1 160 ? 3.085   109.783 144.624 1.00 65.97  ? 163 GLU A CA  1 
ATOM   1261 C  C   . GLU A 1 160 ? 3.119   111.051 145.462 1.00 61.90  ? 163 GLU A C   1 
ATOM   1262 O  O   . GLU A 1 160 ? 2.060   111.590 145.805 1.00 62.76  ? 163 GLU A O   1 
ATOM   1263 C  CB  . GLU A 1 160 ? 2.875   108.575 145.546 1.00 69.83  ? 163 GLU A CB  1 
ATOM   1264 C  CG  . GLU A 1 160 ? 2.763   107.231 144.831 1.00 72.36  ? 163 GLU A CG  1 
ATOM   1265 C  CD  . GLU A 1 160 ? 1.547   107.132 143.911 1.00 74.28  ? 163 GLU A CD  1 
ATOM   1266 O  OE1 . GLU A 1 160 ? 1.503   106.193 143.086 1.00 86.24  ? 163 GLU A OE1 1 
ATOM   1267 O  OE2 . GLU A 1 160 ? 0.634   107.979 144.009 1.00 68.90  ? 163 GLU A OE2 1 
ATOM   1268 N  N   . ALA A 1 161 ? 4.314   111.525 145.818 1.00 57.06  ? 164 ALA A N   1 
ATOM   1269 C  CA  . ALA A 1 161 ? 4.475   112.785 146.544 1.00 56.90  ? 164 ALA A CA  1 
ATOM   1270 C  C   . ALA A 1 161 ? 5.810   113.392 146.152 1.00 58.10  ? 164 ALA A C   1 
ATOM   1271 O  O   . ALA A 1 161 ? 6.771   113.390 146.935 1.00 57.90  ? 164 ALA A O   1 
ATOM   1272 C  CB  . ALA A 1 161 ? 4.390   112.566 148.054 1.00 52.50  ? 164 ALA A CB  1 
ATOM   1273 N  N   . PRO A 1 162 ? 5.914   113.926 144.927 1.00 51.52  ? 165 PRO A N   1 
ATOM   1274 C  CA  . PRO A 1 162 ? 7.193   114.498 144.474 1.00 56.07  ? 165 PRO A CA  1 
ATOM   1275 C  C   . PRO A 1 162 ? 7.520   115.853 145.081 1.00 56.33  ? 165 PRO A C   1 
ATOM   1276 O  O   . PRO A 1 162 ? 8.683   116.279 145.005 1.00 55.59  ? 165 PRO A O   1 
ATOM   1277 C  CB  . PRO A 1 162 ? 7.000   114.621 142.950 1.00 53.86  ? 165 PRO A CB  1 
ATOM   1278 C  CG  . PRO A 1 162 ? 5.520   114.837 142.788 1.00 46.71  ? 165 PRO A CG  1 
ATOM   1279 C  CD  . PRO A 1 162 ? 4.859   114.033 143.895 1.00 53.71  ? 165 PRO A CD  1 
ATOM   1280 N  N   . GLY A 1 163 ? 6.545   116.543 145.669 1.00 48.94  ? 166 GLY A N   1 
ATOM   1281 C  CA  . GLY A 1 163 ? 6.716   117.927 146.048 1.00 48.31  ? 166 GLY A CA  1 
ATOM   1282 C  C   . GLY A 1 163 ? 6.203   118.873 144.980 1.00 46.89  ? 166 GLY A C   1 
ATOM   1283 O  O   . GLY A 1 163 ? 5.849   118.481 143.867 1.00 52.29  ? 166 GLY A O   1 
ATOM   1284 N  N   . ASN A 1 164 ? 6.129   120.150 145.350 1.00 44.43  ? 167 ASN A N   1 
ATOM   1285 C  CA  . ASN A 1 164 ? 5.752   121.263 144.480 1.00 39.49  ? 167 ASN A CA  1 
ATOM   1286 C  C   . ASN A 1 164 ? 4.353   121.147 143.871 1.00 38.08  ? 167 ASN A C   1 
ATOM   1287 O  O   . ASN A 1 164 ? 4.000   121.965 143.017 1.00 43.08  ? 167 ASN A O   1 
ATOM   1288 C  CB  . ASN A 1 164 ? 6.777   121.455 143.357 1.00 38.89  ? 167 ASN A CB  1 
ATOM   1289 C  CG  . ASN A 1 164 ? 8.079   122.016 143.863 1.00 45.38  ? 167 ASN A CG  1 
ATOM   1290 O  OD1 . ASN A 1 164 ? 8.095   122.776 144.825 1.00 44.60  ? 167 ASN A OD1 1 
ATOM   1291 N  ND2 . ASN A 1 164 ? 9.181   121.638 143.231 1.00 41.15  ? 167 ASN A ND2 1 
ATOM   1292 N  N   . VAL A 1 165 ? 3.526   120.183 144.285 1.00 36.23  ? 168 VAL A N   1 
ATOM   1293 C  CA  . VAL A 1 165 ? 2.260   119.996 143.572 1.00 42.34  ? 168 VAL A CA  1 
ATOM   1294 C  C   . VAL A 1 165 ? 1.351   121.206 143.731 1.00 42.61  ? 168 VAL A C   1 
ATOM   1295 O  O   . VAL A 1 165 ? 0.524   121.486 142.853 1.00 42.17  ? 168 VAL A O   1 
ATOM   1296 C  CB  . VAL A 1 165 ? 1.556   118.688 143.998 1.00 44.26  ? 168 VAL A CB  1 
ATOM   1297 C  CG1 . VAL A 1 165 ? 2.484   117.489 143.754 1.00 49.04  ? 168 VAL A CG1 1 
ATOM   1298 C  CG2 . VAL A 1 165 ? 1.080   118.736 145.437 1.00 42.82  ? 168 VAL A CG2 1 
ATOM   1299 N  N   . GLY A 1 166 ? 1.502   121.958 144.826 1.00 39.30  ? 169 GLY A N   1 
ATOM   1300 C  CA  . GLY A 1 166 ? 0.793   123.219 144.952 1.00 36.13  ? 169 GLY A CA  1 
ATOM   1301 C  C   . GLY A 1 166 ? 1.183   124.245 143.897 1.00 40.35  ? 169 GLY A C   1 
ATOM   1302 O  O   . GLY A 1 166 ? 0.344   125.044 143.471 1.00 36.39  ? 169 GLY A O   1 
ATOM   1303 N  N   . LEU A 1 167 ? 2.460   124.266 143.483 1.00 38.42  ? 170 LEU A N   1 
ATOM   1304 C  CA  . LEU A 1 167 ? 2.853   125.115 142.353 1.00 39.14  ? 170 LEU A CA  1 
ATOM   1305 C  C   . LEU A 1 167 ? 2.295   124.567 141.045 1.00 39.33  ? 170 LEU A C   1 
ATOM   1306 O  O   . LEU A 1 167 ? 1.877   125.335 140.170 1.00 39.27  ? 170 LEU A O   1 
ATOM   1307 C  CB  . LEU A 1 167 ? 4.380   125.246 142.257 1.00 39.77  ? 170 LEU A CB  1 
ATOM   1308 C  CG  . LEU A 1 167 ? 5.122   126.006 143.376 1.00 38.28  ? 170 LEU A CG  1 
ATOM   1309 C  CD1 . LEU A 1 167 ? 6.630   125.764 143.329 1.00 32.42  ? 170 LEU A CD1 1 
ATOM   1310 C  CD2 . LEU A 1 167 ? 4.853   127.488 143.271 1.00 34.31  ? 170 LEU A CD2 1 
ATOM   1311 N  N   . LEU A 1 168 ? 2.269   123.240 140.898 1.00 41.93  ? 171 LEU A N   1 
ATOM   1312 C  CA  . LEU A 1 168 ? 1.600   122.649 139.744 1.00 41.77  ? 171 LEU A CA  1 
ATOM   1313 C  C   . LEU A 1 168 ? 0.115   122.986 139.731 1.00 40.82  ? 171 LEU A C   1 
ATOM   1314 O  O   . LEU A 1 168 ? -0.473  123.121 138.658 1.00 39.48  ? 171 LEU A O   1 
ATOM   1315 C  CB  . LEU A 1 168 ? 1.807   121.134 139.721 1.00 40.28  ? 171 LEU A CB  1 
ATOM   1316 C  CG  . LEU A 1 168 ? 3.264   120.691 139.559 1.00 44.69  ? 171 LEU A CG  1 
ATOM   1317 C  CD1 . LEU A 1 168 ? 3.367   119.187 139.395 1.00 44.26  ? 171 LEU A CD1 1 
ATOM   1318 C  CD2 . LEU A 1 168 ? 3.934   121.404 138.395 1.00 37.82  ? 171 LEU A CD2 1 
ATOM   1319 N  N   . ASP A 1 169 ? -0.503  123.143 140.909 1.00 42.86  ? 172 ASP A N   1 
ATOM   1320 C  CA  . ASP A 1 169 ? -1.881  123.627 140.965 1.00 38.51  ? 172 ASP A CA  1 
ATOM   1321 C  C   . ASP A 1 169 ? -1.999  124.996 140.311 1.00 42.38  ? 172 ASP A C   1 
ATOM   1322 O  O   . ASP A 1 169 ? -2.887  125.233 139.482 1.00 36.53  ? 172 ASP A O   1 
ATOM   1323 C  CB  . ASP A 1 169 ? -2.365  123.686 142.422 1.00 40.29  ? 172 ASP A CB  1 
ATOM   1324 C  CG  . ASP A 1 169 ? -2.592  122.313 143.006 1.00 45.20  ? 172 ASP A CG  1 
ATOM   1325 O  OD1 . ASP A 1 169 ? -2.497  121.340 142.217 1.00 44.24  ? 172 ASP A OD1 1 
ATOM   1326 O  OD2 . ASP A 1 169 ? -2.854  122.197 144.234 1.00 42.32  ? 172 ASP A OD2 1 
ATOM   1327 N  N   . GLN A 1 170 ? -1.109  125.919 140.691 1.00 39.39  ? 173 GLN A N   1 
ATOM   1328 C  CA  . GLN A 1 170 ? -1.133  127.251 140.109 1.00 35.20  ? 173 GLN A CA  1 
ATOM   1329 C  C   . GLN A 1 170 ? -0.898  127.187 138.602 1.00 40.97  ? 173 GLN A C   1 
ATOM   1330 O  O   . GLN A 1 170 ? -1.557  127.893 137.830 1.00 37.56  ? 173 GLN A O   1 
ATOM   1331 C  CB  . GLN A 1 170 ? -0.082  128.126 140.785 1.00 34.92  ? 173 GLN A CB  1 
ATOM   1332 C  CG  . GLN A 1 170 ? -0.190  128.218 142.321 1.00 38.81  ? 173 GLN A CG  1 
ATOM   1333 C  CD  . GLN A 1 170 ? 0.941   129.035 142.925 1.00 40.59  ? 173 GLN A CD  1 
ATOM   1334 O  OE1 . GLN A 1 170 ? 1.702   129.686 142.196 1.00 31.57  ? 173 GLN A OE1 1 
ATOM   1335 N  NE2 . GLN A 1 170 ? 1.065   129.004 144.268 1.00 39.71  ? 173 GLN A NE2 1 
ATOM   1336 N  N   . ARG A 1 171 ? 0.034   126.337 138.167 1.00 37.31  ? 174 ARG A N   1 
ATOM   1337 C  CA  . ARG A 1 171 ? 0.339   126.247 136.749 1.00 41.75  ? 174 ARG A CA  1 
ATOM   1338 C  C   . ARG A 1 171 ? -0.881  125.791 135.957 1.00 39.61  ? 174 ARG A C   1 
ATOM   1339 O  O   . ARG A 1 171 ? -1.217  126.387 134.932 1.00 35.92  ? 174 ARG A O   1 
ATOM   1340 C  CB  . ARG A 1 171 ? 1.524   125.306 136.532 1.00 42.52  ? 174 ARG A CB  1 
ATOM   1341 C  CG  . ARG A 1 171 ? 1.946   125.157 135.072 1.00 41.14  ? 174 ARG A CG  1 
ATOM   1342 C  CD  . ARG A 1 171 ? 3.077   124.141 134.949 1.00 41.13  ? 174 ARG A CD  1 
ATOM   1343 N  NE  . ARG A 1 171 ? 4.357   124.637 135.454 1.00 34.10  ? 174 ARG A NE  1 
ATOM   1344 C  CZ  . ARG A 1 171 ? 5.455   123.892 135.520 1.00 37.84  ? 174 ARG A CZ  1 
ATOM   1345 N  NH1 . ARG A 1 171 ? 5.410   122.621 135.130 1.00 37.51  ? 174 ARG A NH1 1 
ATOM   1346 N  NH2 . ARG A 1 171 ? 6.599   124.409 135.960 1.00 34.88  ? 174 ARG A NH2 1 
ATOM   1347 N  N   . MET A 1 172 ? -1.591  124.777 136.457 1.00 39.47  ? 175 MET A N   1 
ATOM   1348 C  CA  . MET A 1 172 ? -2.805  124.312 135.794 1.00 45.08  ? 175 MET A CA  1 
ATOM   1349 C  C   . MET A 1 172 ? -3.866  125.406 135.707 1.00 42.39  ? 175 MET A C   1 
ATOM   1350 O  O   . MET A 1 172 ? -4.560  125.522 134.690 1.00 46.63  ? 175 MET A O   1 
ATOM   1351 C  CB  . MET A 1 172 ? -3.367  123.092 136.519 1.00 42.50  ? 175 MET A CB  1 
ATOM   1352 C  CG  . MET A 1 172 ? -4.602  122.536 135.833 1.00 45.49  ? 175 MET A CG  1 
ATOM   1353 S  SD  . MET A 1 172 ? -4.815  120.804 136.252 1.00 53.89  ? 175 MET A SD  1 
ATOM   1354 C  CE  . MET A 1 172 ? -3.350  120.119 135.471 1.00 42.35  ? 175 MET A CE  1 
ATOM   1355 N  N   . ALA A 1 173 ? -4.027  126.210 136.760 1.00 39.09  ? 176 ALA A N   1 
ATOM   1356 C  CA  . ALA A 1 173 ? -4.950  127.334 136.648 1.00 43.81  ? 176 ALA A CA  1 
ATOM   1357 C  C   . ALA A 1 173 ? -4.509  128.285 135.546 1.00 39.96  ? 176 ALA A C   1 
ATOM   1358 O  O   . ALA A 1 173 ? -5.343  128.808 134.799 1.00 41.21  ? 176 ALA A O   1 
ATOM   1359 C  CB  . ALA A 1 173 ? -5.070  128.079 137.977 1.00 37.93  ? 176 ALA A CB  1 
ATOM   1360 N  N   . LEU A 1 174 ? -3.198  128.521 135.432 1.00 40.17  ? 177 LEU A N   1 
ATOM   1361 C  CA  . LEU A 1 174 ? -2.690  129.396 134.383 1.00 40.86  ? 177 LEU A CA  1 
ATOM   1362 C  C   . LEU A 1 174 ? -2.921  128.780 133.000 1.00 44.60  ? 177 LEU A C   1 
ATOM   1363 O  O   . LEU A 1 174 ? -3.296  129.480 132.048 1.00 39.51  ? 177 LEU A O   1 
ATOM   1364 C  CB  . LEU A 1 174 ? -1.205  129.687 134.629 1.00 33.16  ? 177 LEU A CB  1 
ATOM   1365 C  CG  . LEU A 1 174 ? -0.868  130.509 135.878 1.00 42.79  ? 177 LEU A CG  1 
ATOM   1366 C  CD1 . LEU A 1 174 ? 0.645   130.807 136.001 1.00 35.79  ? 177 LEU A CD1 1 
ATOM   1367 C  CD2 . LEU A 1 174 ? -1.683  131.784 135.911 1.00 38.83  ? 177 LEU A CD2 1 
ATOM   1368 N  N   . GLN A 1 175 ? -2.705  127.466 132.883 1.00 43.37  ? 178 GLN A N   1 
ATOM   1369 C  CA  . GLN A 1 175 ? -3.027  126.745 131.662 1.00 39.88  ? 178 GLN A CA  1 
ATOM   1370 C  C   . GLN A 1 175 ? -4.506  126.879 131.325 1.00 43.37  ? 178 GLN A C   1 
ATOM   1371 O  O   . GLN A 1 175 ? -4.875  127.027 130.156 1.00 44.45  ? 178 GLN A O   1 
ATOM   1372 C  CB  . GLN A 1 175 ? -2.638  125.275 131.826 1.00 42.09  ? 178 GLN A CB  1 
ATOM   1373 C  CG  . GLN A 1 175 ? -2.788  124.429 130.575 1.00 41.33  ? 178 GLN A CG  1 
ATOM   1374 C  CD  . GLN A 1 175 ? -1.776  124.790 129.489 1.00 49.76  ? 178 GLN A CD  1 
ATOM   1375 O  OE1 . GLN A 1 175 ? -0.570  124.624 129.671 1.00 49.47  ? 178 GLN A OE1 1 
ATOM   1376 N  NE2 . GLN A 1 175 ? -2.268  125.283 128.353 1.00 45.50  ? 178 GLN A NE2 1 
ATOM   1377 N  N   . TRP A 1 176 ? -5.368  126.837 132.339 1.00 39.72  ? 179 TRP A N   1 
ATOM   1378 C  CA  . TRP A 1 176 ? -6.796  126.968 132.091 1.00 37.28  ? 179 TRP A CA  1 
ATOM   1379 C  C   . TRP A 1 176 ? -7.140  128.358 131.560 1.00 40.49  ? 179 TRP A C   1 
ATOM   1380 O  O   . TRP A 1 176 ? -7.957  128.489 130.640 1.00 39.92  ? 179 TRP A O   1 
ATOM   1381 C  CB  . TRP A 1 176 ? -7.576  126.661 133.374 1.00 37.05  ? 179 TRP A CB  1 
ATOM   1382 C  CG  . TRP A 1 176 ? -9.037  126.490 133.142 1.00 40.67  ? 179 TRP A CG  1 
ATOM   1383 C  CD1 . TRP A 1 176 ? -9.705  125.314 132.921 1.00 37.59  ? 179 TRP A CD1 1 
ATOM   1384 C  CD2 . TRP A 1 176 ? -10.020 127.533 133.083 1.00 31.39  ? 179 TRP A CD2 1 
ATOM   1385 N  NE1 . TRP A 1 176 ? -11.042 125.569 132.732 1.00 43.27  ? 179 TRP A NE1 1 
ATOM   1386 C  CE2 . TRP A 1 176 ? -11.258 126.922 132.820 1.00 35.94  ? 179 TRP A CE2 1 
ATOM   1387 C  CE3 . TRP A 1 176 ? -9.967  128.924 133.225 1.00 33.79  ? 179 TRP A CE3 1 
ATOM   1388 C  CZ2 . TRP A 1 176 ? -12.440 127.655 132.703 1.00 39.70  ? 179 TRP A CZ2 1 
ATOM   1389 C  CZ3 . TRP A 1 176 ? -11.135 129.652 133.104 1.00 37.24  ? 179 TRP A CZ3 1 
ATOM   1390 C  CH2 . TRP A 1 176 ? -12.358 129.016 132.842 1.00 39.21  ? 179 TRP A CH2 1 
ATOM   1391 N  N   . VAL A 1 177 ? -6.544  129.406 132.143 1.00 37.43  ? 180 VAL A N   1 
ATOM   1392 C  CA  . VAL A 1 177 ? -6.759  130.775 131.667 1.00 32.90  ? 180 VAL A CA  1 
ATOM   1393 C  C   . VAL A 1 177 ? -6.277  130.918 130.225 1.00 44.58  ? 180 VAL A C   1 
ATOM   1394 O  O   . VAL A 1 177 ? -6.926  131.564 129.387 1.00 34.56  ? 180 VAL A O   1 
ATOM   1395 C  CB  . VAL A 1 177 ? -6.042  131.773 132.598 1.00 38.17  ? 180 VAL A CB  1 
ATOM   1396 C  CG1 . VAL A 1 177 ? -5.990  133.161 131.981 1.00 35.70  ? 180 VAL A CG1 1 
ATOM   1397 C  CG2 . VAL A 1 177 ? -6.699  131.806 134.003 1.00 34.88  ? 180 VAL A CG2 1 
ATOM   1398 N  N   . HIS A 1 178 ? -5.127  130.315 129.915 1.00 44.13  ? 181 HIS A N   1 
ATOM   1399 C  CA  . HIS A 1 178 ? -4.580  130.378 128.566 1.00 43.77  ? 181 HIS A CA  1 
ATOM   1400 C  C   . HIS A 1 178 ? -5.558  129.788 127.559 1.00 44.88  ? 181 HIS A C   1 
ATOM   1401 O  O   . HIS A 1 178 ? -5.782  130.360 126.484 1.00 39.40  ? 181 HIS A O   1 
ATOM   1402 C  CB  . HIS A 1 178 ? -3.243  129.641 128.545 1.00 42.60  ? 181 HIS A CB  1 
ATOM   1403 C  CG  . HIS A 1 178 ? -2.543  129.671 127.229 1.00 44.17  ? 181 HIS A CG  1 
ATOM   1404 N  ND1 . HIS A 1 178 ? -2.603  128.623 126.333 1.00 45.57  ? 181 HIS A ND1 1 
ATOM   1405 C  CD2 . HIS A 1 178 ? -1.732  130.602 126.671 1.00 47.09  ? 181 HIS A CD2 1 
ATOM   1406 C  CE1 . HIS A 1 178 ? -1.871  128.914 125.272 1.00 46.49  ? 181 HIS A CE1 1 
ATOM   1407 N  NE2 . HIS A 1 178 ? -1.337  130.111 125.448 1.00 49.51  ? 181 HIS A NE2 1 
ATOM   1408 N  N   . ASP A 1 179 ? -6.214  128.690 127.936 1.00 44.87  ? 182 ASP A N   1 
ATOM   1409 C  CA  . ASP A 1 179 ? -7.072  127.926 127.047 1.00 43.61  ? 182 ASP A CA  1 
ATOM   1410 C  C   . ASP A 1 179 ? -8.518  128.411 127.004 1.00 49.32  ? 182 ASP A C   1 
ATOM   1411 O  O   . ASP A 1 179 ? -9.197  128.162 126.001 1.00 50.00  ? 182 ASP A O   1 
ATOM   1412 C  CB  . ASP A 1 179 ? -7.047  126.450 127.457 1.00 42.25  ? 182 ASP A CB  1 
ATOM   1413 C  CG  . ASP A 1 179 ? -5.666  125.829 127.313 1.00 45.98  ? 182 ASP A CG  1 
ATOM   1414 O  OD1 . ASP A 1 179 ? -4.806  126.421 126.628 1.00 49.60  ? 182 ASP A OD1 1 
ATOM   1415 O  OD2 . ASP A 1 179 ? -5.438  124.743 127.877 1.00 52.66  ? 182 ASP A OD2 1 
ATOM   1416 N  N   . ASN A 1 180 ? -9.014  129.098 128.046 1.00 40.32  ? 183 ASN A N   1 
ATOM   1417 C  CA  . ASN A 1 180 ? -10.430 129.439 128.120 1.00 38.76  ? 183 ASN A CA  1 
ATOM   1418 C  C   . ASN A 1 180 ? -10.739 130.918 128.289 1.00 39.56  ? 183 ASN A C   1 
ATOM   1419 O  O   . ASN A 1 180 ? -11.900 131.299 128.110 1.00 45.05  ? 183 ASN A O   1 
ATOM   1420 C  CB  . ASN A 1 180 ? -11.114 128.697 129.281 1.00 42.69  ? 183 ASN A CB  1 
ATOM   1421 C  CG  . ASN A 1 180 ? -11.036 127.204 129.142 1.00 46.53  ? 183 ASN A CG  1 
ATOM   1422 O  OD1 . ASN A 1 180 ? -11.913 126.589 128.551 1.00 53.22  ? 183 ASN A OD1 1 
ATOM   1423 N  ND2 . ASN A 1 180 ? -9.983  126.607 129.688 1.00 43.54  ? 183 ASN A ND2 1 
ATOM   1424 N  N   . ILE A 1 181 ? -9.771  131.758 128.662 1.00 36.53  ? 184 ILE A N   1 
ATOM   1425 C  CA  . ILE A 1 181 ? -10.150 133.105 129.077 1.00 41.54  ? 184 ILE A CA  1 
ATOM   1426 C  C   . ILE A 1 181 ? -10.718 133.906 127.905 1.00 46.37  ? 184 ILE A C   1 
ATOM   1427 O  O   . ILE A 1 181 ? -11.473 134.865 128.134 1.00 43.32  ? 184 ILE A O   1 
ATOM   1428 C  CB  . ILE A 1 181 ? -8.961  133.820 129.771 1.00 41.99  ? 184 ILE A CB  1 
ATOM   1429 C  CG1 . ILE A 1 181 ? -9.449  134.896 130.743 1.00 37.58  ? 184 ILE A CG1 1 
ATOM   1430 C  CG2 . ILE A 1 181 ? -8.004  134.428 128.771 1.00 39.88  ? 184 ILE A CG2 1 
ATOM   1431 C  CD1 . ILE A 1 181 ? -10.303 134.359 131.860 1.00 43.70  ? 184 ILE A CD1 1 
ATOM   1432 N  N   . GLN A 1 182 ? -10.402 133.508 126.656 1.00 45.24  ? 185 GLN A N   1 
ATOM   1433 C  CA  . GLN A 1 182 ? -10.969 134.153 125.466 1.00 47.68  ? 185 GLN A CA  1 
ATOM   1434 C  C   . GLN A 1 182 ? -12.494 134.163 125.486 1.00 47.86  ? 185 GLN A C   1 
ATOM   1435 O  O   . GLN A 1 182 ? -13.124 135.119 125.021 1.00 47.13  ? 185 GLN A O   1 
ATOM   1436 C  CB  . GLN A 1 182 ? -10.479 133.456 124.181 1.00 44.39  ? 185 GLN A CB  1 
ATOM   1437 C  CG  . GLN A 1 182 ? -10.364 131.923 124.252 1.00 52.75  ? 185 GLN A CG  1 
ATOM   1438 C  CD  . GLN A 1 182 ? -9.712  131.317 122.984 1.00 57.75  ? 185 GLN A CD  1 
ATOM   1439 O  OE1 . GLN A 1 182 ? -10.096 131.648 121.860 1.00 57.54  ? 185 GLN A OE1 1 
ATOM   1440 N  NE2 . GLN A 1 182 ? -8.727  130.428 123.173 1.00 53.41  ? 185 GLN A NE2 1 
ATOM   1441 N  N   . PHE A 1 183 ? -13.107 133.100 126.002 1.00 46.94  ? 186 PHE A N   1 
ATOM   1442 C  CA  . PHE A 1 183 ? -14.561 133.018 125.997 1.00 47.88  ? 186 PHE A CA  1 
ATOM   1443 C  C   . PHE A 1 183 ? -15.195 133.986 126.979 1.00 49.37  ? 186 PHE A C   1 
ATOM   1444 O  O   . PHE A 1 183 ? -16.360 134.345 126.798 1.00 49.67  ? 186 PHE A O   1 
ATOM   1445 C  CB  . PHE A 1 183 ? -14.979 131.579 126.278 1.00 44.12  ? 186 PHE A CB  1 
ATOM   1446 C  CG  . PHE A 1 183 ? -14.315 130.593 125.357 1.00 50.37  ? 186 PHE A CG  1 
ATOM   1447 C  CD1 . PHE A 1 183 ? -14.446 130.724 123.979 1.00 47.53  ? 186 PHE A CD1 1 
ATOM   1448 C  CD2 . PHE A 1 183 ? -13.535 129.563 125.853 1.00 53.26  ? 186 PHE A CD2 1 
ATOM   1449 C  CE1 . PHE A 1 183 ? -13.819 129.831 123.110 1.00 48.51  ? 186 PHE A CE1 1 
ATOM   1450 C  CE2 . PHE A 1 183 ? -12.911 128.662 124.984 1.00 54.78  ? 186 PHE A CE2 1 
ATOM   1451 C  CZ  . PHE A 1 183 ? -13.056 128.801 123.616 1.00 46.28  ? 186 PHE A CZ  1 
ATOM   1452 N  N   . PHE A 1 184 ? -14.453 134.426 127.998 1.00 50.17  ? 187 PHE A N   1 
ATOM   1453 C  CA  . PHE A 1 184 ? -14.921 135.414 128.964 1.00 44.23  ? 187 PHE A CA  1 
ATOM   1454 C  C   . PHE A 1 184 ? -14.571 136.838 128.547 1.00 46.47  ? 187 PHE A C   1 
ATOM   1455 O  O   . PHE A 1 184 ? -14.784 137.775 129.331 1.00 38.34  ? 187 PHE A O   1 
ATOM   1456 C  CB  . PHE A 1 184 ? -14.340 135.114 130.352 1.00 35.68  ? 187 PHE A CB  1 
ATOM   1457 C  CG  . PHE A 1 184 ? -14.752 133.786 130.906 1.00 37.20  ? 187 PHE A CG  1 
ATOM   1458 C  CD1 . PHE A 1 184 ? -14.082 132.631 130.549 1.00 37.89  ? 187 PHE A CD1 1 
ATOM   1459 C  CD2 . PHE A 1 184 ? -15.809 133.693 131.806 1.00 41.10  ? 187 PHE A CD2 1 
ATOM   1460 C  CE1 . PHE A 1 184 ? -14.470 131.398 131.058 1.00 41.28  ? 187 PHE A CE1 1 
ATOM   1461 C  CE2 . PHE A 1 184 ? -16.207 132.464 132.323 1.00 37.56  ? 187 PHE A CE2 1 
ATOM   1462 C  CZ  . PHE A 1 184 ? -15.536 131.314 131.950 1.00 41.92  ? 187 PHE A CZ  1 
ATOM   1463 N  N   . GLY A 1 185 ? -14.043 137.022 127.332 1.00 45.12  ? 188 GLY A N   1 
ATOM   1464 C  CA  . GLY A 1 185 ? -13.613 138.330 126.874 1.00 41.24  ? 188 GLY A CA  1 
ATOM   1465 C  C   . GLY A 1 185 ? -12.242 138.762 127.345 1.00 46.39  ? 188 GLY A C   1 
ATOM   1466 O  O   . GLY A 1 185 ? -11.899 139.943 127.200 1.00 45.19  ? 188 GLY A O   1 
ATOM   1467 N  N   . GLY A 1 186 ? -11.457 137.850 127.928 1.00 46.89  ? 189 GLY A N   1 
ATOM   1468 C  CA  . GLY A 1 186 ? -10.081 138.142 128.284 1.00 44.00  ? 189 GLY A CA  1 
ATOM   1469 C  C   . GLY A 1 186 ? -9.102  137.783 127.170 1.00 50.82  ? 189 GLY A C   1 
ATOM   1470 O  O   . GLY A 1 186 ? -9.304  136.836 126.410 1.00 44.64  ? 189 GLY A O   1 
ATOM   1471 N  N   . ASP A 1 187 ? -8.026  138.563 127.089 1.00 48.06  ? 190 ASP A N   1 
ATOM   1472 C  CA  . ASP A 1 187 ? -6.968  138.411 126.102 1.00 44.69  ? 190 ASP A CA  1 
ATOM   1473 C  C   . ASP A 1 187 ? -5.894  137.466 126.632 1.00 44.62  ? 190 ASP A C   1 
ATOM   1474 O  O   . ASP A 1 187 ? -5.004  137.904 127.373 1.00 40.82  ? 190 ASP A O   1 
ATOM   1475 C  CB  . ASP A 1 187 ? -6.383  139.791 125.772 1.00 44.99  ? 190 ASP A CB  1 
ATOM   1476 C  CG  . ASP A 1 187 ? -5.169  139.734 124.836 1.00 47.57  ? 190 ASP A CG  1 
ATOM   1477 O  OD1 . ASP A 1 187 ? -4.845  138.654 124.286 1.00 41.93  ? 190 ASP A OD1 1 
ATOM   1478 O  OD2 . ASP A 1 187 ? -4.530  140.797 124.661 1.00 44.68  ? 190 ASP A OD2 1 
ATOM   1479 N  N   . PRO A 1 188 ? -5.903  136.188 126.232 1.00 48.24  ? 191 PRO A N   1 
ATOM   1480 C  CA  . PRO A 1 188 ? -4.885  135.248 126.741 1.00 41.44  ? 191 PRO A CA  1 
ATOM   1481 C  C   . PRO A 1 188 ? -3.452  135.637 126.409 1.00 46.39  ? 191 PRO A C   1 
ATOM   1482 O  O   . PRO A 1 188 ? -2.531  135.081 127.018 1.00 47.97  ? 191 PRO A O   1 
ATOM   1483 C  CB  . PRO A 1 188 ? -5.267  133.921 126.069 1.00 43.03  ? 191 PRO A CB  1 
ATOM   1484 C  CG  . PRO A 1 188 ? -5.997  134.329 124.815 1.00 40.69  ? 191 PRO A CG  1 
ATOM   1485 C  CD  . PRO A 1 188 ? -6.750  135.574 125.189 1.00 44.83  ? 191 PRO A CD  1 
ATOM   1486 N  N   . LYS A 1 189 ? -3.230  136.552 125.453 1.00 45.41  ? 192 LYS A N   1 
ATOM   1487 C  CA  . LYS A 1 189 ? -1.893  137.034 125.127 1.00 45.43  ? 192 LYS A CA  1 
ATOM   1488 C  C   . LYS A 1 189 ? -1.366  138.054 126.130 1.00 45.24  ? 192 LYS A C   1 
ATOM   1489 O  O   . LYS A 1 189 ? -0.173  138.378 126.089 1.00 45.29  ? 192 LYS A O   1 
ATOM   1490 C  CB  . LYS A 1 189 ? -1.866  137.682 123.728 1.00 44.74  ? 192 LYS A CB  1 
ATOM   1491 C  CG  . LYS A 1 189 ? -2.522  136.878 122.599 1.00 52.24  ? 192 LYS A CG  1 
ATOM   1492 C  CD  . LYS A 1 189 ? -2.442  137.616 121.245 1.00 44.81  ? 192 LYS A CD  1 
ATOM   1493 C  CE  . LYS A 1 189 ? -3.261  138.900 121.242 1.00 41.01  ? 192 LYS A CE  1 
ATOM   1494 N  NZ  . LYS A 1 189 ? -4.729  138.642 121.440 1.00 41.12  ? 192 LYS A NZ  1 
ATOM   1495 N  N   . THR A 1 190 ? -2.224  138.596 126.996 1.00 41.84  ? 193 THR A N   1 
ATOM   1496 C  CA  . THR A 1 190 ? -1.853  139.695 127.888 1.00 47.11  ? 193 THR A CA  1 
ATOM   1497 C  C   . THR A 1 190 ? -2.317  139.369 129.315 1.00 47.19  ? 193 THR A C   1 
ATOM   1498 O  O   . THR A 1 190 ? -3.136  140.069 129.915 1.00 44.43  ? 193 THR A O   1 
ATOM   1499 C  CB  . THR A 1 190 ? -2.423  141.018 127.373 1.00 42.27  ? 193 THR A CB  1 
ATOM   1500 O  OG1 . THR A 1 190 ? -2.247  141.075 125.949 1.00 52.58  ? 193 THR A OG1 1 
ATOM   1501 C  CG2 . THR A 1 190 ? -1.674  142.199 127.975 1.00 40.67  ? 193 THR A CG2 1 
ATOM   1502 N  N   . VAL A 1 191 ? -1.770  138.278 129.853 1.00 40.18  ? 194 VAL A N   1 
ATOM   1503 C  CA  . VAL A 1 191 ? -2.080  137.793 131.193 1.00 43.45  ? 194 VAL A CA  1 
ATOM   1504 C  C   . VAL A 1 191 ? -0.961  138.225 132.127 1.00 41.90  ? 194 VAL A C   1 
ATOM   1505 O  O   . VAL A 1 191 ? 0.213   137.913 131.892 1.00 40.98  ? 194 VAL A O   1 
ATOM   1506 C  CB  . VAL A 1 191 ? -2.254  136.265 131.215 1.00 41.93  ? 194 VAL A CB  1 
ATOM   1507 C  CG1 . VAL A 1 191 ? -2.419  135.768 132.640 1.00 36.95  ? 194 VAL A CG1 1 
ATOM   1508 C  CG2 . VAL A 1 191 ? -3.448  135.861 130.379 1.00 36.83  ? 194 VAL A CG2 1 
ATOM   1509 N  N   . THR A 1 192 ? -1.318  138.944 133.181 1.00 38.60  ? 195 THR A N   1 
ATOM   1510 C  CA  . THR A 1 192 ? -0.377  139.326 134.227 1.00 39.56  ? 195 THR A CA  1 
ATOM   1511 C  C   . THR A 1 192 ? -0.692  138.526 135.482 1.00 39.19  ? 195 THR A C   1 
ATOM   1512 O  O   . THR A 1 192 ? -1.821  138.582 135.986 1.00 37.46  ? 195 THR A O   1 
ATOM   1513 C  CB  . THR A 1 192 ? -0.461  140.823 134.515 1.00 36.97  ? 195 THR A CB  1 
ATOM   1514 O  OG1 . THR A 1 192 ? 0.135   141.544 133.441 1.00 38.59  ? 195 THR A OG1 1 
ATOM   1515 C  CG2 . THR A 1 192 ? 0.249   141.168 135.834 1.00 36.62  ? 195 THR A CG2 1 
ATOM   1516 N  N   . ILE A 1 193 ? 0.292   137.774 135.974 1.00 35.75  ? 196 ILE A N   1 
ATOM   1517 C  CA  . ILE A 1 193 ? 0.166   137.098 137.259 1.00 38.21  ? 196 ILE A CA  1 
ATOM   1518 C  C   . ILE A 1 193 ? 0.697   138.022 138.343 1.00 37.20  ? 196 ILE A C   1 
ATOM   1519 O  O   . ILE A 1 193 ? 1.741   138.667 138.174 1.00 35.06  ? 196 ILE A O   1 
ATOM   1520 C  CB  . ILE A 1 193 ? 0.901   135.742 137.263 1.00 32.87  ? 196 ILE A CB  1 
ATOM   1521 C  CG1 . ILE A 1 193 ? 2.341   135.866 136.761 1.00 34.52  ? 196 ILE A CG1 1 
ATOM   1522 C  CG2 . ILE A 1 193 ? 0.143   134.734 136.433 1.00 35.07  ? 196 ILE A CG2 1 
ATOM   1523 C  CD1 . ILE A 1 193 ? 3.158   134.588 136.983 1.00 32.35  ? 196 ILE A CD1 1 
ATOM   1524 N  N   . PHE A 1 194 ? -0.033  138.119 139.452 1.00 37.22  ? 197 PHE A N   1 
ATOM   1525 C  CA  . PHE A 1 194 ? 0.450   138.917 140.571 1.00 32.05  ? 197 PHE A CA  1 
ATOM   1526 C  C   . PHE A 1 194 ? 0.017   138.260 141.869 1.00 34.71  ? 197 PHE A C   1 
ATOM   1527 O  O   . PHE A 1 194 ? -0.986  137.545 141.918 1.00 37.91  ? 197 PHE A O   1 
ATOM   1528 C  CB  . PHE A 1 194 ? -0.017  140.387 140.487 1.00 32.95  ? 197 PHE A CB  1 
ATOM   1529 C  CG  . PHE A 1 194 ? -1.516  140.613 140.685 1.00 36.65  ? 197 PHE A CG  1 
ATOM   1530 C  CD1 . PHE A 1 194 ? -2.468  139.821 140.050 1.00 37.70  ? 197 PHE A CD1 1 
ATOM   1531 C  CD2 . PHE A 1 194 ? -1.966  141.665 141.494 1.00 38.02  ? 197 PHE A CD2 1 
ATOM   1532 C  CE1 . PHE A 1 194 ? -3.844  140.053 140.235 1.00 38.91  ? 197 PHE A CE1 1 
ATOM   1533 C  CE2 . PHE A 1 194 ? -3.330  141.906 141.681 1.00 35.55  ? 197 PHE A CE2 1 
ATOM   1534 C  CZ  . PHE A 1 194 ? -4.269  141.096 141.047 1.00 39.63  ? 197 PHE A CZ  1 
ATOM   1535 N  N   . GLY A 1 195 ? 0.796   138.492 142.919 1.00 39.62  ? 198 GLY A N   1 
ATOM   1536 C  CA  . GLY A 1 195 ? 0.518   137.879 144.200 1.00 34.30  ? 198 GLY A CA  1 
ATOM   1537 C  C   . GLY A 1 195 ? 1.375   138.468 145.296 1.00 40.32  ? 198 GLY A C   1 
ATOM   1538 O  O   . GLY A 1 195 ? 2.401   139.111 145.042 1.00 38.18  ? 198 GLY A O   1 
ATOM   1539 N  N   . GLU A 1 196 ? 0.944   138.224 146.529 1.00 40.36  ? 199 GLU A N   1 
ATOM   1540 C  CA  . GLU A 1 196 ? 1.568   138.860 147.674 1.00 38.49  ? 199 GLU A CA  1 
ATOM   1541 C  C   . GLU A 1 196 ? 2.279   137.853 148.561 1.00 36.56  ? 199 GLU A C   1 
ATOM   1542 O  O   . GLU A 1 196 ? 1.724   136.820 148.942 1.00 34.74  ? 199 GLU A O   1 
ATOM   1543 C  CB  . GLU A 1 196 ? 0.534   139.639 148.480 1.00 40.48  ? 199 GLU A CB  1 
ATOM   1544 C  CG  . GLU A 1 196 ? 1.138   140.580 149.496 1.00 39.22  ? 199 GLU A CG  1 
ATOM   1545 C  CD  . GLU A 1 196 ? 1.213   139.978 150.891 1.00 43.29  ? 199 GLU A CD  1 
ATOM   1546 O  OE1 . GLU A 1 196 ? 0.563   138.938 151.154 1.00 41.98  ? 199 GLU A OE1 1 
ATOM   1547 O  OE2 . GLU A 1 196 ? 1.943   140.550 151.724 1.00 41.56  ? 199 GLU A OE2 1 
HETATM 1548 C  C2  . BXT A 1 197 ? 6.871   135.782 154.932 1.00 46.71  ? 200 BXT A C2  1 
HETATM 1549 C  C4  . BXT A 1 197 ? 5.697   136.555 154.488 1.00 51.29  ? 200 BXT A C4  1 
HETATM 1550 C  C5  . BXT A 1 197 ? 4.162   134.972 155.257 1.00 42.28  ? 200 BXT A C5  1 
HETATM 1551 N  N   . BXT A 1 197 ? 3.632   138.280 148.859 1.00 41.39  ? 200 BXT A N   1 
HETATM 1552 C  CA  . BXT A 1 197 ? 4.321   137.347 149.855 1.00 38.34  ? 200 BXT A CA  1 
HETATM 1553 C  C   . BXT A 1 197 ? 4.274   135.985 149.158 1.00 38.93  ? 200 BXT A C   1 
HETATM 1554 O  O   . BXT A 1 197 ? 5.408   135.776 148.453 1.00 46.23  ? 200 BXT A O   1 
HETATM 1555 C  CB  . BXT A 1 197 ? 3.451   137.171 151.125 1.00 39.34  ? 200 BXT A CB  1 
HETATM 1556 O  OG  . BXT A 1 197 ? 4.175   136.958 152.297 1.00 48.66  ? 200 BXT A OG  1 
HETATM 1557 C  C1  . BXT A 1 197 ? 3.991   135.833 153.053 1.00 45.23  ? 200 BXT A C1  1 
HETATM 1558 N  N3  . BXT A 1 197 ? 4.619   135.748 154.212 1.00 51.59  ? 200 BXT A N3  1 
HETATM 1559 O  O2  . BXT A 1 197 ? 3.311   134.984 152.701 1.00 43.90  ? 200 BXT A O2  1 
ATOM   1560 N  N   . ALA A 1 198 ? 3.834   134.933 149.849 1.00 28.52  ? 201 ALA A N   1 
ATOM   1561 C  CA  . ALA A 1 198 ? 4.039   133.578 149.328 1.00 33.46  ? 201 ALA A CA  1 
ATOM   1562 C  C   . ALA A 1 198 ? 3.608   133.549 147.865 1.00 35.99  ? 201 ALA A C   1 
ATOM   1563 O  O   . ALA A 1 198 ? 4.209   132.858 147.050 1.00 36.30  ? 201 ALA A O   1 
ATOM   1564 C  CB  . ALA A 1 198 ? 3.275   132.547 150.102 1.00 32.07  ? 201 ALA A CB  1 
ATOM   1565 N  N   . GLY A 1 199 ? 2.539   134.289 147.559 1.00 34.68  ? 202 GLY A N   1 
ATOM   1566 C  CA  . GLY A 1 199 ? 2.114   134.441 146.180 1.00 37.58  ? 202 GLY A CA  1 
ATOM   1567 C  C   . GLY A 1 199 ? 3.082   135.273 145.367 1.00 41.34  ? 202 GLY A C   1 
ATOM   1568 O  O   . GLY A 1 199 ? 3.220   135.070 144.156 1.00 35.54  ? 202 GLY A O   1 
ATOM   1569 N  N   . GLY A 1 200 ? 3.761   136.223 146.012 1.00 40.11  ? 203 GLY A N   1 
ATOM   1570 C  CA  . GLY A 1 200 ? 4.846   136.919 145.340 1.00 35.98  ? 203 GLY A CA  1 
ATOM   1571 C  C   . GLY A 1 200 ? 6.007   135.992 145.035 1.00 37.58  ? 203 GLY A C   1 
ATOM   1572 O  O   . GLY A 1 200 ? 6.545   135.989 143.924 1.00 39.32  ? 203 GLY A O   1 
ATOM   1573 N  N   . ALA A 1 201 ? 6.407   135.184 146.017 1.00 35.34  ? 204 ALA A N   1 
ATOM   1574 C  CA  . ALA A 1 201 ? 7.426   134.174 145.748 1.00 43.38  ? 204 ALA A CA  1 
ATOM   1575 C  C   . ALA A 1 201 ? 6.964   133.205 144.665 1.00 40.15  ? 204 ALA A C   1 
ATOM   1576 O  O   . ALA A 1 201 ? 7.773   132.749 143.849 1.00 40.01  ? 204 ALA A O   1 
ATOM   1577 C  CB  . ALA A 1 201 ? 7.783   133.413 147.025 1.00 29.80  ? 204 ALA A CB  1 
ATOM   1578 N  N   . SER A 1 202 ? 5.670   132.863 144.663 1.00 35.06  ? 205 SER A N   1 
ATOM   1579 C  CA  . SER A 1 202 ? 5.127   131.972 143.645 1.00 37.29  ? 205 SER A CA  1 
ATOM   1580 C  C   . SER A 1 202 ? 5.283   132.578 142.244 1.00 42.88  ? 205 SER A C   1 
ATOM   1581 O  O   . SER A 1 202 ? 5.716   131.900 141.301 1.00 38.04  ? 205 SER A O   1 
ATOM   1582 C  CB  . SER A 1 202 ? 3.657   131.687 143.950 1.00 36.72  ? 205 SER A CB  1 
ATOM   1583 O  OG  . SER A 1 202 ? 3.496   130.781 145.021 1.00 36.39  ? 205 SER A OG  1 
ATOM   1584 N  N   . VAL A 1 203 ? 4.909   133.855 142.091 1.00 38.13  ? 206 VAL A N   1 
ATOM   1585 C  CA  . VAL A 1 203 ? 5.063   134.538 140.809 1.00 37.14  ? 206 VAL A CA  1 
ATOM   1586 C  C   . VAL A 1 203 ? 6.508   134.455 140.342 1.00 36.98  ? 206 VAL A C   1 
ATOM   1587 O  O   . VAL A 1 203 ? 6.790   134.076 139.203 1.00 39.04  ? 206 VAL A O   1 
ATOM   1588 C  CB  . VAL A 1 203 ? 4.591   135.999 140.921 1.00 37.18  ? 206 VAL A CB  1 
ATOM   1589 C  CG1 . VAL A 1 203 ? 5.195   136.832 139.804 1.00 29.89  ? 206 VAL A CG1 1 
ATOM   1590 C  CG2 . VAL A 1 203 ? 3.059   136.083 140.934 1.00 32.36  ? 206 VAL A CG2 1 
ATOM   1591 N  N   . GLY A 1 204 ? 7.435   134.707 141.218 1.00 37.08  ? 207 GLY A N   1 
ATOM   1592 C  CA  . GLY A 1 204 ? 8.812   134.626 140.882 1.00 33.88  ? 207 GLY A CA  1 
ATOM   1593 C  C   . GLY A 1 204 ? 9.209   133.252 140.458 1.00 41.60  ? 207 GLY A C   1 
ATOM   1594 O  O   . GLY A 1 204 ? 10.033  133.103 139.636 1.00 42.58  ? 207 GLY A O   1 
ATOM   1595 N  N   . MET A 1 205 ? 8.650   132.250 141.079 1.00 38.06  ? 208 MET A N   1 
ATOM   1596 C  CA  . MET A 1 205 ? 8.936   130.884 140.752 1.00 34.28  ? 208 MET A CA  1 
ATOM   1597 C  C   . MET A 1 205 ? 8.464   130.493 139.365 1.00 37.43  ? 208 MET A C   1 
ATOM   1598 O  O   . MET A 1 205 ? 9.077   129.744 138.698 1.00 40.16  ? 208 MET A O   1 
ATOM   1599 C  CB  . MET A 1 205 ? 8.426   129.960 141.833 1.00 30.68  ? 208 MET A CB  1 
ATOM   1600 C  CG  . MET A 1 205 ? 9.059   130.203 143.178 1.00 34.84  ? 208 MET A CG  1 
ATOM   1601 S  SD  . MET A 1 205 ? 8.464   129.227 144.517 1.00 37.89  ? 208 MET A SD  1 
ATOM   1602 C  CE  . MET A 1 205 ? 9.589   129.552 145.785 1.00 34.73  ? 208 MET A CE  1 
ATOM   1603 N  N   . HIS A 1 206 ? 7.332   131.004 138.967 1.00 36.23  ? 209 HIS A N   1 
ATOM   1604 C  CA  . HIS A 1 206 ? 6.793   130.773 137.660 1.00 36.81  ? 209 HIS A CA  1 
ATOM   1605 C  C   . HIS A 1 206 ? 7.674   131.410 136.594 1.00 42.84  ? 209 HIS A C   1 
ATOM   1606 O  O   . HIS A 1 206 ? 7.771   130.893 135.526 1.00 41.09  ? 209 HIS A O   1 
ATOM   1607 C  CB  . HIS A 1 206 ? 5.339   131.152 137.569 1.00 37.45  ? 209 HIS A CB  1 
ATOM   1608 C  CG  . HIS A 1 206 ? 4.427   130.210 138.265 1.00 37.73  ? 209 HIS A CG  1 
ATOM   1609 N  ND1 . HIS A 1 206 ? 4.437   128.867 138.033 1.00 40.11  ? 209 HIS A ND1 1 
ATOM   1610 C  CD2 . HIS A 1 206 ? 3.487   130.417 139.196 1.00 31.28  ? 209 HIS A CD2 1 
ATOM   1611 C  CE1 . HIS A 1 206 ? 3.533   128.285 138.777 1.00 36.08  ? 209 HIS A CE1 1 
ATOM   1612 N  NE2 . HIS A 1 206 ? 2.934   129.207 139.481 1.00 36.42  ? 209 HIS A NE2 1 
ATOM   1613 N  N   . ILE A 1 207 ? 8.277   132.552 136.907 1.00 42.99  ? 210 ILE A N   1 
ATOM   1614 C  CA  . ILE A 1 207 ? 9.236   133.232 136.039 1.00 36.17  ? 210 ILE A CA  1 
ATOM   1615 C  C   . ILE A 1 207 ? 10.473  132.369 135.846 1.00 42.65  ? 210 ILE A C   1 
ATOM   1616 O  O   . ILE A 1 207 ? 11.047  132.316 134.754 1.00 45.90  ? 210 ILE A O   1 
ATOM   1617 C  CB  . ILE A 1 207 ? 9.598   134.607 136.626 1.00 34.87  ? 210 ILE A CB  1 
ATOM   1618 C  CG1 . ILE A 1 207 ? 8.396   135.542 136.567 1.00 35.80  ? 210 ILE A CG1 1 
ATOM   1619 C  CG2 . ILE A 1 207 ? 10.795  135.208 135.921 1.00 37.36  ? 210 ILE A CG2 1 
ATOM   1620 C  CD1 . ILE A 1 207 ? 8.719   136.945 136.989 1.00 41.34  ? 210 ILE A CD1 1 
ATOM   1621 N  N   . LEU A 1 208 ? 10.892  131.663 136.898 1.00 39.21  ? 211 LEU A N   1 
ATOM   1622 C  CA  . LEU A 1 208 ? 12.084  130.832 136.808 1.00 41.65  ? 211 LEU A CA  1 
ATOM   1623 C  C   . LEU A 1 208 ? 11.806  129.493 136.124 1.00 41.10  ? 211 LEU A C   1 
ATOM   1624 O  O   . LEU A 1 208 ? 12.618  129.034 135.316 1.00 41.47  ? 211 LEU A O   1 
ATOM   1625 C  CB  . LEU A 1 208 ? 12.667  130.606 138.207 1.00 38.16  ? 211 LEU A CB  1 
ATOM   1626 C  CG  . LEU A 1 208 ? 13.272  131.817 138.910 1.00 38.72  ? 211 LEU A CG  1 
ATOM   1627 C  CD1 . LEU A 1 208 ? 13.287  131.553 140.390 1.00 42.96  ? 211 LEU A CD1 1 
ATOM   1628 C  CD2 . LEU A 1 208 ? 14.675  132.093 138.431 1.00 37.52  ? 211 LEU A CD2 1 
ATOM   1629 N  N   . SER A 1 209 ? 10.675  128.857 136.428 1.00 41.39  ? 212 SER A N   1 
ATOM   1630 C  CA  . SER A 1 209 ? 10.420  127.475 135.997 1.00 40.35  ? 212 SER A CA  1 
ATOM   1631 C  C   . SER A 1 209 ? 10.143  127.381 134.498 1.00 39.41  ? 212 SER A C   1 
ATOM   1632 O  O   . SER A 1 209 ? 9.142   127.938 134.037 1.00 40.24  ? 212 SER A O   1 
ATOM   1633 C  CB  . SER A 1 209 ? 9.231   126.917 136.761 1.00 33.93  ? 212 SER A CB  1 
ATOM   1634 O  OG  . SER A 1 209 ? 9.003   125.559 136.430 1.00 41.08  ? 212 SER A OG  1 
ATOM   1635 N  N   . PRO A 1 210 ? 10.950  126.646 133.719 1.00 42.53  ? 213 PRO A N   1 
ATOM   1636 C  CA  . PRO A 1 210 ? 10.719  126.601 132.252 1.00 44.71  ? 213 PRO A CA  1 
ATOM   1637 C  C   . PRO A 1 210 ? 9.314   126.175 131.878 1.00 42.32  ? 213 PRO A C   1 
ATOM   1638 O  O   . PRO A 1 210 ? 8.711   126.775 130.981 1.00 43.70  ? 213 PRO A O   1 
ATOM   1639 C  CB  . PRO A 1 210 ? 11.764  125.591 131.751 1.00 40.96  ? 213 PRO A CB  1 
ATOM   1640 C  CG  . PRO A 1 210 ? 12.783  125.507 132.860 1.00 45.87  ? 213 PRO A CG  1 
ATOM   1641 C  CD  . PRO A 1 210 ? 12.043  125.758 134.139 1.00 40.66  ? 213 PRO A CD  1 
ATOM   1642 N  N   . GLY A 1 211 ? 8.756   125.188 132.584 1.00 44.29  ? 214 GLY A N   1 
ATOM   1643 C  CA  . GLY A 1 211 ? 7.417   124.686 132.347 1.00 38.66  ? 214 GLY A CA  1 
ATOM   1644 C  C   . GLY A 1 211 ? 6.291   125.646 132.665 1.00 43.18  ? 214 GLY A C   1 
ATOM   1645 O  O   . GLY A 1 211 ? 5.138   125.317 132.380 1.00 47.04  ? 214 GLY A O   1 
ATOM   1646 N  N   . SER A 1 212 ? 6.583   126.823 133.232 1.00 39.75  ? 215 SER A N   1 
ATOM   1647 C  CA  . SER A 1 212 ? 5.572   127.834 133.520 1.00 37.21  ? 215 SER A CA  1 
ATOM   1648 C  C   . SER A 1 212 ? 5.682   129.086 132.658 1.00 40.62  ? 215 SER A C   1 
ATOM   1649 O  O   . SER A 1 212 ? 4.694   129.815 132.535 1.00 39.05  ? 215 SER A O   1 
ATOM   1650 C  CB  . SER A 1 212 ? 5.647   128.272 135.002 1.00 42.03  ? 215 SER A CB  1 
ATOM   1651 O  OG  . SER A 1 212 ? 5.258   127.254 135.922 1.00 34.93  ? 215 SER A OG  1 
ATOM   1652 N  N   . ARG A 1 213 ? 6.848   129.359 132.064 1.00 41.97  ? 216 ARG A N   1 
ATOM   1653 C  CA  . ARG A 1 213 ? 7.095   130.685 131.499 1.00 42.05  ? 216 ARG A CA  1 
ATOM   1654 C  C   . ARG A 1 213 ? 6.134   131.041 130.372 1.00 45.38  ? 216 ARG A C   1 
ATOM   1655 O  O   . ARG A 1 213 ? 5.844   132.228 130.171 1.00 47.43  ? 216 ARG A O   1 
ATOM   1656 C  CB  . ARG A 1 213 ? 8.520   130.784 130.975 1.00 39.98  ? 216 ARG A CB  1 
ATOM   1657 C  CG  . ARG A 1 213 ? 9.537   130.323 131.942 1.00 42.98  ? 216 ARG A CG  1 
ATOM   1658 C  CD  . ARG A 1 213 ? 10.887  130.267 131.281 1.00 43.62  ? 216 ARG A CD  1 
ATOM   1659 N  NE  . ARG A 1 213 ? 11.894  129.866 132.246 1.00 43.46  ? 216 ARG A NE  1 
ATOM   1660 C  CZ  . ARG A 1 213 ? 13.186  129.808 131.983 1.00 45.06  ? 216 ARG A CZ  1 
ATOM   1661 N  NH1 . ARG A 1 213 ? 13.623  130.130 130.774 1.00 42.90  ? 216 ARG A NH1 1 
ATOM   1662 N  NH2 . ARG A 1 213 ? 14.037  129.445 132.935 1.00 41.14  ? 216 ARG A NH2 1 
ATOM   1663 N  N   . ASP A 1 214 ? 5.654   130.059 129.605 1.00 35.34  ? 217 ASP A N   1 
ATOM   1664 C  CA  . ASP A 1 214 ? 4.857   130.401 128.428 1.00 42.49  ? 217 ASP A CA  1 
ATOM   1665 C  C   . ASP A 1 214 ? 3.384   130.635 128.754 1.00 43.94  ? 217 ASP A C   1 
ATOM   1666 O  O   . ASP A 1 214 ? 2.597   130.904 127.836 1.00 44.35  ? 217 ASP A O   1 
ATOM   1667 C  CB  . ASP A 1 214 ? 4.980   129.317 127.330 1.00 41.17  ? 217 ASP A CB  1 
ATOM   1668 C  CG  . ASP A 1 214 ? 6.442   128.984 126.963 1.00 45.31  ? 217 ASP A CG  1 
ATOM   1669 O  OD1 . ASP A 1 214 ? 7.365   129.820 127.180 1.00 41.17  ? 217 ASP A OD1 1 
ATOM   1670 O  OD2 . ASP A 1 214 ? 6.664   127.863 126.457 1.00 42.71  ? 217 ASP A OD2 1 
ATOM   1671 N  N   . LEU A 1 215 ? 2.992   130.561 130.028 1.00 39.07  ? 218 LEU A N   1 
ATOM   1672 C  CA  . LEU A 1 215 ? 1.591   130.669 130.408 1.00 38.01  ? 218 LEU A CA  1 
ATOM   1673 C  C   . LEU A 1 215 ? 1.189   132.067 130.856 1.00 41.95  ? 218 LEU A C   1 
ATOM   1674 O  O   . LEU A 1 215 ? 0.058   132.243 131.320 1.00 45.46  ? 218 LEU A O   1 
ATOM   1675 C  CB  . LEU A 1 215 ? 1.262   129.664 131.510 1.00 40.84  ? 218 LEU A CB  1 
ATOM   1676 C  CG  . LEU A 1 215 ? 1.448   128.222 131.035 1.00 46.55  ? 218 LEU A CG  1 
ATOM   1677 C  CD1 . LEU A 1 215 ? 1.077   127.251 132.124 1.00 38.27  ? 218 LEU A CD1 1 
ATOM   1678 C  CD2 . LEU A 1 215 ? 0.621   127.974 129.789 1.00 39.30  ? 218 LEU A CD2 1 
ATOM   1679 N  N   . PHE A 1 216 ? 2.068   133.063 130.731 1.00 33.91  ? 219 PHE A N   1 
ATOM   1680 C  CA  . PHE A 1 216 ? 1.701   134.415 131.137 1.00 37.26  ? 219 PHE A CA  1 
ATOM   1681 C  C   . PHE A 1 216 ? 2.630   135.402 130.449 1.00 37.23  ? 219 PHE A C   1 
ATOM   1682 O  O   . PHE A 1 216 ? 3.727   135.051 130.012 1.00 36.95  ? 219 PHE A O   1 
ATOM   1683 C  CB  . PHE A 1 216 ? 1.752   134.591 132.675 1.00 36.86  ? 219 PHE A CB  1 
ATOM   1684 C  CG  . PHE A 1 216 ? 3.119   134.350 133.266 1.00 33.85  ? 219 PHE A CG  1 
ATOM   1685 C  CD1 . PHE A 1 216 ? 3.546   133.056 133.560 1.00 28.89  ? 219 PHE A CD1 1 
ATOM   1686 C  CD2 . PHE A 1 216 ? 3.985   135.414 133.507 1.00 33.50  ? 219 PHE A CD2 1 
ATOM   1687 C  CE1 . PHE A 1 216 ? 4.811   132.823 134.062 1.00 28.83  ? 219 PHE A CE1 1 
ATOM   1688 C  CE2 . PHE A 1 216 ? 5.254   135.192 134.039 1.00 31.51  ? 219 PHE A CE2 1 
ATOM   1689 C  CZ  . PHE A 1 216 ? 5.670   133.895 134.311 1.00 31.16  ? 219 PHE A CZ  1 
ATOM   1690 N  N   . ARG A 1 217 ? 2.184   136.657 130.396 1.00 40.67  ? 220 ARG A N   1 
ATOM   1691 C  CA  . ARG A 1 217 ? 2.889   137.721 129.694 1.00 35.64  ? 220 ARG A CA  1 
ATOM   1692 C  C   . ARG A 1 217 ? 3.885   138.456 130.582 1.00 39.99  ? 220 ARG A C   1 
ATOM   1693 O  O   . ARG A 1 217 ? 5.028   138.680 130.175 1.00 40.76  ? 220 ARG A O   1 
ATOM   1694 C  CB  . ARG A 1 217 ? 1.881   138.716 129.112 1.00 43.46  ? 220 ARG A CB  1 
ATOM   1695 C  CG  . ARG A 1 217 ? 2.516   139.876 128.374 1.00 42.74  ? 220 ARG A CG  1 
ATOM   1696 C  CD  . ARG A 1 217 ? 3.223   139.361 127.140 1.00 43.55  ? 220 ARG A CD  1 
ATOM   1697 N  NE  . ARG A 1 217 ? 3.717   140.426 126.274 1.00 50.60  ? 220 ARG A NE  1 
ATOM   1698 C  CZ  . ARG A 1 217 ? 3.056   140.911 125.221 1.00 56.44  ? 220 ARG A CZ  1 
ATOM   1699 N  NH1 . ARG A 1 217 ? 1.848   140.450 124.896 1.00 48.37  ? 220 ARG A NH1 1 
ATOM   1700 N  NH2 . ARG A 1 217 ? 3.610   141.864 124.487 1.00 58.80  ? 220 ARG A NH2 1 
ATOM   1701 N  N   . ARG A 1 218 ? 3.464   138.854 131.784 1.00 41.93  ? 221 ARG A N   1 
ATOM   1702 C  CA  . ARG A 1 218 ? 4.312   139.631 132.678 1.00 39.00  ? 221 ARG A CA  1 
ATOM   1703 C  C   . ARG A 1 218 ? 3.835   139.409 134.114 1.00 40.90  ? 221 ARG A C   1 
ATOM   1704 O  O   . ARG A 1 218 ? 2.890   138.654 134.369 1.00 39.91  ? 221 ARG A O   1 
ATOM   1705 C  CB  . ARG A 1 218 ? 4.324   141.109 132.268 1.00 40.87  ? 221 ARG A CB  1 
ATOM   1706 C  CG  . ARG A 1 218 ? 2.969   141.690 131.965 1.00 43.34  ? 221 ARG A CG  1 
ATOM   1707 C  CD  . ARG A 1 218 ? 3.058   143.179 131.622 1.00 40.68  ? 221 ARG A CD  1 
ATOM   1708 N  NE  . ARG A 1 218 ? 3.709   143.422 130.340 1.00 49.07  ? 221 ARG A NE  1 
ATOM   1709 C  CZ  . ARG A 1 218 ? 3.078   143.542 129.171 1.00 46.56  ? 221 ARG A CZ  1 
ATOM   1710 N  NH1 . ARG A 1 218 ? 1.754   143.445 129.092 1.00 42.73  ? 221 ARG A NH1 1 
ATOM   1711 N  NH2 . ARG A 1 218 ? 3.781   143.762 128.074 1.00 43.11  ? 221 ARG A NH2 1 
ATOM   1712 N  N   . ALA A 1 219 ? 4.505   140.063 135.063 1.00 33.89  ? 222 ALA A N   1 
ATOM   1713 C  CA  . ALA A 1 219 ? 4.401   139.602 136.439 1.00 35.81  ? 222 ALA A CA  1 
ATOM   1714 C  C   . ALA A 1 219 ? 4.561   140.746 137.434 1.00 37.21  ? 222 ALA A C   1 
ATOM   1715 O  O   . ALA A 1 219 ? 5.323   141.691 137.206 1.00 38.13  ? 222 ALA A O   1 
ATOM   1716 C  CB  . ALA A 1 219 ? 5.446   138.514 136.704 1.00 30.67  ? 222 ALA A CB  1 
ATOM   1717 N  N   . ILE A 1 220 ? 3.856   140.624 138.562 1.00 37.49  ? 223 ILE A N   1 
ATOM   1718 C  CA  . ILE A 1 220 ? 3.933   141.574 139.670 1.00 36.61  ? 223 ILE A CA  1 
ATOM   1719 C  C   . ILE A 1 220 ? 4.165   140.801 140.965 1.00 40.08  ? 223 ILE A C   1 
ATOM   1720 O  O   . ILE A 1 220 ? 3.441   139.839 141.256 1.00 37.00  ? 223 ILE A O   1 
ATOM   1721 C  CB  . ILE A 1 220 ? 2.653   142.424 139.783 1.00 39.13  ? 223 ILE A CB  1 
ATOM   1722 C  CG1 . ILE A 1 220 ? 2.484   143.333 138.574 1.00 35.06  ? 223 ILE A CG1 1 
ATOM   1723 C  CG2 . ILE A 1 220 ? 2.650   143.246 141.072 1.00 31.69  ? 223 ILE A CG2 1 
ATOM   1724 C  CD1 . ILE A 1 220 ? 1.185   144.108 138.625 1.00 35.24  ? 223 ILE A CD1 1 
ATOM   1725 N  N   . LEU A 1 221 ? 5.156   141.234 141.748 1.00 39.59  ? 224 LEU A N   1 
ATOM   1726 C  CA  . LEU A 1 221 ? 5.526   140.588 143.009 1.00 40.38  ? 224 LEU A CA  1 
ATOM   1727 C  C   . LEU A 1 221 ? 5.359   141.587 144.145 1.00 35.24  ? 224 LEU A C   1 
ATOM   1728 O  O   . LEU A 1 221 ? 5.962   142.660 144.112 1.00 40.36  ? 224 LEU A O   1 
ATOM   1729 C  CB  . LEU A 1 221 ? 6.975   140.086 142.968 1.00 35.90  ? 224 LEU A CB  1 
ATOM   1730 C  CG  . LEU A 1 221 ? 7.319   138.935 142.020 1.00 39.71  ? 224 LEU A CG  1 
ATOM   1731 C  CD1 . LEU A 1 221 ? 7.545   139.410 140.570 1.00 39.67  ? 224 LEU A CD1 1 
ATOM   1732 C  CD2 . LEU A 1 221 ? 8.522   138.160 142.519 1.00 37.42  ? 224 LEU A CD2 1 
ATOM   1733 N  N   . GLN A 1 222 ? 4.567   141.242 145.157 1.00 35.44  ? 225 GLN A N   1 
ATOM   1734 C  CA  . GLN A 1 222 ? 4.393   142.120 146.321 1.00 38.16  ? 225 GLN A CA  1 
ATOM   1735 C  C   . GLN A 1 222 ? 4.917   141.443 147.582 1.00 35.62  ? 225 GLN A C   1 
ATOM   1736 O  O   . GLN A 1 222 ? 4.376   140.417 148.007 1.00 38.61  ? 225 GLN A O   1 
ATOM   1737 C  CB  . GLN A 1 222 ? 2.926   142.510 146.495 1.00 36.79  ? 225 GLN A CB  1 
ATOM   1738 C  CG  . GLN A 1 222 ? 2.357   143.217 145.286 1.00 38.35  ? 225 GLN A CG  1 
ATOM   1739 C  CD  . GLN A 1 222 ? 0.851   143.287 145.296 1.00 42.11  ? 225 GLN A CD  1 
ATOM   1740 O  OE1 . GLN A 1 222 ? 0.225   143.360 144.236 1.00 37.06  ? 225 GLN A OE1 1 
ATOM   1741 N  NE2 . GLN A 1 222 ? 0.249   143.261 146.495 1.00 35.97  ? 225 GLN A NE2 1 
ATOM   1742 N  N   . SER A 1 223 ? 5.964   142.017 148.180 1.00 34.87  ? 226 SER A N   1 
ATOM   1743 C  CA  . SER A 1 223 ? 6.479   141.561 149.485 1.00 42.13  ? 226 SER A CA  1 
ATOM   1744 C  C   . SER A 1 223 ? 6.855   140.087 149.457 1.00 41.45  ? 226 SER A C   1 
ATOM   1745 O  O   . SER A 1 223 ? 6.612   139.362 150.420 1.00 36.92  ? 226 SER A O   1 
ATOM   1746 C  CB  . SER A 1 223 ? 5.480   141.790 150.632 1.00 32.83  ? 226 SER A CB  1 
ATOM   1747 O  OG  . SER A 1 223 ? 5.228   143.158 150.878 1.00 38.85  ? 226 SER A OG  1 
ATOM   1748 N  N   . GLY A 1 224 ? 7.420   139.631 148.345 1.00 38.15  ? 227 GLY A N   1 
ATOM   1749 C  CA  . GLY A 1 224 ? 7.829   138.242 148.248 1.00 34.80  ? 227 GLY A CA  1 
ATOM   1750 C  C   . GLY A 1 224 ? 8.632   137.998 146.991 1.00 40.89  ? 227 GLY A C   1 
ATOM   1751 O  O   . GLY A 1 224 ? 8.394   138.649 145.971 1.00 36.96  ? 227 GLY A O   1 
ATOM   1752 N  N   . SER A 1 225 ? 9.597   137.087 147.052 1.00 39.44  ? 228 SER A N   1 
ATOM   1753 C  CA  . SER A 1 225 ? 10.416  136.766 145.895 1.00 40.32  ? 228 SER A CA  1 
ATOM   1754 C  C   . SER A 1 225 ? 10.904  135.334 146.082 1.00 44.35  ? 228 SER A C   1 
ATOM   1755 O  O   . SER A 1 225 ? 10.983  134.865 147.221 1.00 43.26  ? 228 SER A O   1 
ATOM   1756 C  CB  . SER A 1 225 ? 11.596  137.741 145.732 1.00 36.71  ? 228 SER A CB  1 
ATOM   1757 O  OG  . SER A 1 225 ? 12.502  137.639 146.802 1.00 40.59  ? 228 SER A OG  1 
ATOM   1758 N  N   . PRO A 1 226 ? 11.216  134.625 144.989 1.00 37.59  ? 229 PRO A N   1 
ATOM   1759 C  CA  . PRO A 1 226 ? 11.435  133.169 145.101 1.00 40.36  ? 229 PRO A CA  1 
ATOM   1760 C  C   . PRO A 1 226 ? 12.639  132.776 145.937 1.00 40.04  ? 229 PRO A C   1 
ATOM   1761 O  O   . PRO A 1 226 ? 12.665  131.650 146.448 1.00 36.93  ? 229 PRO A O   1 
ATOM   1762 C  CB  . PRO A 1 226 ? 11.605  132.726 143.629 1.00 39.82  ? 229 PRO A CB  1 
ATOM   1763 C  CG  . PRO A 1 226 ? 12.022  133.928 142.919 1.00 32.91  ? 229 PRO A CG  1 
ATOM   1764 C  CD  . PRO A 1 226 ? 11.330  135.081 143.599 1.00 37.09  ? 229 PRO A CD  1 
ATOM   1765 N  N   . ASN A 1 227 ? 13.637  133.651 146.083 1.00 38.31  ? 230 ASN A N   1 
ATOM   1766 C  CA  . ASN A 1 227 ? 14.833  133.364 146.865 1.00 38.77  ? 230 ASN A CA  1 
ATOM   1767 C  C   . ASN A 1 227 ? 14.673  133.676 148.367 1.00 45.29  ? 230 ASN A C   1 
ATOM   1768 O  O   . ASN A 1 227 ? 15.672  133.696 149.086 1.00 39.04  ? 230 ASN A O   1 
ATOM   1769 C  CB  . ASN A 1 227 ? 16.015  134.148 146.296 1.00 32.44  ? 230 ASN A CB  1 
ATOM   1770 C  CG  . ASN A 1 227 ? 15.708  135.627 146.142 1.00 39.66  ? 230 ASN A CG  1 
ATOM   1771 O  OD1 . ASN A 1 227 ? 14.621  136.006 145.698 1.00 42.12  ? 230 ASN A OD1 1 
ATOM   1772 N  ND2 . ASN A 1 227 ? 16.657  136.472 146.522 1.00 35.87  ? 230 ASN A ND2 1 
ATOM   1773 N  N   . CYS A 1 228 ? 13.457  133.936 148.845 1.00 41.01  ? 231 CYS A N   1 
ATOM   1774 C  CA  . CYS A 1 228 ? 13.264  134.246 150.255 1.00 39.16  ? 231 CYS A CA  1 
ATOM   1775 C  C   . CYS A 1 228 ? 13.607  133.028 151.108 1.00 43.89  ? 231 CYS A C   1 
ATOM   1776 O  O   . CYS A 1 228 ? 13.244  131.898 150.754 1.00 42.74  ? 231 CYS A O   1 
ATOM   1777 C  CB  . CYS A 1 228 ? 11.818  134.673 150.534 1.00 40.95  ? 231 CYS A CB  1 
ATOM   1778 S  SG  . CYS A 1 228 ? 11.403  136.395 150.115 1.00 40.03  ? 231 CYS A SG  1 
ATOM   1779 N  N   . PRO A 1 229 ? 14.291  133.224 152.237 1.00 39.89  ? 232 PRO A N   1 
ATOM   1780 C  CA  . PRO A 1 229 ? 14.747  132.068 153.034 1.00 37.86  ? 232 PRO A CA  1 
ATOM   1781 C  C   . PRO A 1 229 ? 13.629  131.128 153.473 1.00 42.62  ? 232 PRO A C   1 
ATOM   1782 O  O   . PRO A 1 229 ? 13.879  129.925 153.640 1.00 38.14  ? 232 PRO A O   1 
ATOM   1783 C  CB  . PRO A 1 229 ? 15.452  132.723 154.238 1.00 36.20  ? 232 PRO A CB  1 
ATOM   1784 C  CG  . PRO A 1 229 ? 15.029  134.177 154.227 1.00 41.12  ? 232 PRO A CG  1 
ATOM   1785 C  CD  . PRO A 1 229 ? 14.779  134.504 152.770 1.00 38.99  ? 232 PRO A CD  1 
ATOM   1786 N  N   . TRP A 1 230 ? 12.405  131.632 153.655 1.00 35.34  ? 233 TRP A N   1 
ATOM   1787 C  CA  . TRP A 1 230 ? 11.267  130.818 154.068 1.00 37.77  ? 233 TRP A CA  1 
ATOM   1788 C  C   . TRP A 1 230 ? 10.532  130.154 152.906 1.00 41.67  ? 233 TRP A C   1 
ATOM   1789 O  O   . TRP A 1 230 ? 9.640   129.328 153.147 1.00 41.86  ? 233 TRP A O   1 
ATOM   1790 C  CB  . TRP A 1 230 ? 10.273  131.683 154.859 1.00 40.23  ? 233 TRP A CB  1 
ATOM   1791 C  CG  . TRP A 1 230 ? 9.986   132.969 154.162 1.00 41.01  ? 233 TRP A CG  1 
ATOM   1792 C  CD1 . TRP A 1 230 ? 10.648  134.153 154.317 1.00 39.01  ? 233 TRP A CD1 1 
ATOM   1793 C  CD2 . TRP A 1 230 ? 8.996   133.191 153.145 1.00 39.61  ? 233 TRP A CD2 1 
ATOM   1794 N  NE1 . TRP A 1 230 ? 10.118  135.102 153.474 1.00 41.24  ? 233 TRP A NE1 1 
ATOM   1795 C  CE2 . TRP A 1 230 ? 9.099   134.538 152.749 1.00 38.97  ? 233 TRP A CE2 1 
ATOM   1796 C  CE3 . TRP A 1 230 ? 8.014   132.387 152.557 1.00 34.05  ? 233 TRP A CE3 1 
ATOM   1797 C  CZ2 . TRP A 1 230 ? 8.261   135.101 151.785 1.00 37.92  ? 233 TRP A CZ2 1 
ATOM   1798 C  CZ3 . TRP A 1 230 ? 7.180   132.948 151.605 1.00 43.31  ? 233 TRP A CZ3 1 
ATOM   1799 C  CH2 . TRP A 1 230 ? 7.312   134.291 151.223 1.00 41.34  ? 233 TRP A CH2 1 
ATOM   1800 N  N   . ALA A 1 231 ? 10.889  130.475 151.662 1.00 39.75  ? 234 ALA A N   1 
ATOM   1801 C  CA  . ALA A 1 231 ? 10.067  130.114 150.511 1.00 40.58  ? 234 ALA A CA  1 
ATOM   1802 C  C   . ALA A 1 231 ? 10.459  128.794 149.847 1.00 38.42  ? 234 ALA A C   1 
ATOM   1803 O  O   . ALA A 1 231 ? 9.674   128.279 149.051 1.00 43.09  ? 234 ALA A O   1 
ATOM   1804 C  CB  . ALA A 1 231 ? 10.089  131.246 149.478 1.00 33.41  ? 234 ALA A CB  1 
ATOM   1805 N  N   . SER A 1 232 ? 11.618  128.216 150.160 1.00 41.51  ? 235 SER A N   1 
ATOM   1806 C  CA  . SER A 1 232 ? 11.971  126.916 149.604 1.00 41.98  ? 235 SER A CA  1 
ATOM   1807 C  C   . SER A 1 232 ? 12.900  126.160 150.545 1.00 46.21  ? 235 SER A C   1 
ATOM   1808 O  O   . SER A 1 232 ? 13.619  126.755 151.354 1.00 43.57  ? 235 SER A O   1 
ATOM   1809 C  CB  . SER A 1 232 ? 12.644  127.043 148.238 1.00 35.29  ? 235 SER A CB  1 
ATOM   1810 O  OG  . SER A 1 232 ? 13.794  127.861 148.308 1.00 38.16  ? 235 SER A OG  1 
ATOM   1811 N  N   . VAL A 1 233 ? 12.897  124.828 150.395 1.00 42.39  ? 236 VAL A N   1 
ATOM   1812 C  CA  . VAL A 1 233 ? 13.847  123.935 151.045 1.00 42.57  ? 236 VAL A CA  1 
ATOM   1813 C  C   . VAL A 1 233 ? 14.528  123.045 150.005 1.00 43.94  ? 236 VAL A C   1 
ATOM   1814 O  O   . VAL A 1 233 ? 14.020  122.824 148.907 1.00 46.28  ? 236 VAL A O   1 
ATOM   1815 C  CB  . VAL A 1 233 ? 13.180  123.053 152.113 1.00 41.81  ? 236 VAL A CB  1 
ATOM   1816 C  CG1 . VAL A 1 233 ? 12.650  123.907 153.281 1.00 41.78  ? 236 VAL A CG1 1 
ATOM   1817 C  CG2 . VAL A 1 233 ? 12.085  122.211 151.475 1.00 37.80  ? 236 VAL A CG2 1 
ATOM   1818 N  N   . SER A 1 234 ? 15.689  122.515 150.386 1.00 47.96  ? 237 SER A N   1 
ATOM   1819 C  CA  . SER A 1 234 ? 16.383  121.485 149.632 1.00 45.90  ? 237 SER A CA  1 
ATOM   1820 C  C   . SER A 1 234 ? 15.592  120.177 149.614 1.00 46.90  ? 237 SER A C   1 
ATOM   1821 O  O   . SER A 1 234 ? 14.690  119.941 150.425 1.00 48.09  ? 237 SER A O   1 
ATOM   1822 C  CB  . SER A 1 234 ? 17.758  121.212 150.234 1.00 43.88  ? 237 SER A CB  1 
ATOM   1823 O  OG  . SER A 1 234 ? 17.653  120.248 151.276 1.00 51.46  ? 237 SER A OG  1 
ATOM   1824 N  N   . VAL A 1 235 ? 15.972  119.303 148.681 1.00 46.36  ? 238 VAL A N   1 
ATOM   1825 C  CA  . VAL A 1 235 ? 15.319  118.000 148.565 1.00 48.76  ? 238 VAL A CA  1 
ATOM   1826 C  C   . VAL A 1 235 ? 15.562  117.164 149.817 1.00 46.09  ? 238 VAL A C   1 
ATOM   1827 O  O   . VAL A 1 235 ? 14.685  116.415 150.268 1.00 49.41  ? 238 VAL A O   1 
ATOM   1828 C  CB  . VAL A 1 235 ? 15.803  117.293 147.282 1.00 44.59  ? 238 VAL A CB  1 
ATOM   1829 C  CG1 . VAL A 1 235 ? 15.954  115.800 147.478 1.00 42.91  ? 238 VAL A CG1 1 
ATOM   1830 C  CG2 . VAL A 1 235 ? 14.831  117.564 146.173 1.00 50.55  ? 238 VAL A CG2 1 
ATOM   1831 N  N   . ALA A 1 236 ? 16.751  117.285 150.405 1.00 46.47  ? 239 ALA A N   1 
ATOM   1832 C  CA  . ALA A 1 236 ? 17.071  116.508 151.598 1.00 50.99  ? 239 ALA A CA  1 
ATOM   1833 C  C   . ALA A 1 236 ? 16.249  116.969 152.798 1.00 46.46  ? 239 ALA A C   1 
ATOM   1834 O  O   . ALA A 1 236 ? 15.772  116.143 153.586 1.00 44.41  ? 239 ALA A O   1 
ATOM   1835 C  CB  . ALA A 1 236 ? 18.567  116.612 151.894 1.00 45.45  ? 239 ALA A CB  1 
ATOM   1836 N  N   . GLU A 1 237 ? 16.059  118.284 152.939 1.00 48.12  ? 240 GLU A N   1 
ATOM   1837 C  CA  . GLU A 1 237 ? 15.274  118.812 154.051 1.00 46.09  ? 240 GLU A CA  1 
ATOM   1838 C  C   . GLU A 1 237 ? 13.786  118.518 153.878 1.00 46.55  ? 240 GLU A C   1 
ATOM   1839 O  O   . GLU A 1 237 ? 13.089  118.229 154.857 1.00 48.97  ? 240 GLU A O   1 
ATOM   1840 C  CB  . GLU A 1 237 ? 15.529  120.312 154.199 1.00 41.95  ? 240 GLU A CB  1 
ATOM   1841 C  CG  . GLU A 1 237 ? 14.648  121.012 155.223 1.00 52.29  ? 240 GLU A CG  1 
ATOM   1842 C  CD  . GLU A 1 237 ? 14.889  120.559 156.676 1.00 57.50  ? 240 GLU A CD  1 
ATOM   1843 O  OE1 . GLU A 1 237 ? 16.007  120.098 156.999 1.00 59.54  ? 240 GLU A OE1 1 
ATOM   1844 O  OE2 . GLU A 1 237 ? 13.948  120.670 157.495 1.00 52.75  ? 240 GLU A OE2 1 
ATOM   1845 N  N   . GLY A 1 238 ? 13.277  118.572 152.645 1.00 49.75  ? 241 GLY A N   1 
ATOM   1846 C  CA  . GLY A 1 238 ? 11.879  118.227 152.435 1.00 43.25  ? 241 GLY A CA  1 
ATOM   1847 C  C   . GLY A 1 238 ? 11.595  116.776 152.767 1.00 49.91  ? 241 GLY A C   1 
ATOM   1848 O  O   . GLY A 1 238 ? 10.553  116.446 153.345 1.00 52.87  ? 241 GLY A O   1 
ATOM   1849 N  N   . ARG A 1 239 ? 12.520  115.887 152.408 1.00 48.08  ? 242 ARG A N   1 
ATOM   1850 C  CA  . ARG A 1 239 ? 12.356  114.483 152.751 1.00 49.45  ? 242 ARG A CA  1 
ATOM   1851 C  C   . ARG A 1 239 ? 12.442  114.285 154.262 1.00 52.08  ? 242 ARG A C   1 
ATOM   1852 O  O   . ARG A 1 239 ? 11.660  113.519 154.842 1.00 51.54  ? 242 ARG A O   1 
ATOM   1853 C  CB  . ARG A 1 239 ? 13.405  113.657 152.006 1.00 53.64  ? 242 ARG A CB  1 
ATOM   1854 C  CG  . ARG A 1 239 ? 13.527  112.224 152.465 1.00 54.67  ? 242 ARG A CG  1 
ATOM   1855 C  CD  . ARG A 1 239 ? 14.481  111.435 151.580 1.00 55.24  ? 242 ARG A CD  1 
ATOM   1856 N  NE  . ARG A 1 239 ? 13.886  111.151 150.281 1.00 52.78  ? 242 ARG A NE  1 
ATOM   1857 C  CZ  . ARG A 1 239 ? 12.936  110.239 150.086 1.00 58.72  ? 242 ARG A CZ  1 
ATOM   1858 N  NH1 . ARG A 1 239 ? 12.476  109.525 151.110 1.00 54.26  ? 242 ARG A NH1 1 
ATOM   1859 N  NH2 . ARG A 1 239 ? 12.444  110.040 148.870 1.00 55.05  ? 242 ARG A NH2 1 
ATOM   1860 N  N   . ARG A 1 240 ? 13.357  115.004 154.922 1.00 49.62  ? 243 ARG A N   1 
ATOM   1861 C  CA  . ARG A 1 240 ? 13.457  114.906 156.377 1.00 52.15  ? 243 ARG A CA  1 
ATOM   1862 C  C   . ARG A 1 240 ? 12.160  115.330 157.058 1.00 51.88  ? 243 ARG A C   1 
ATOM   1863 O  O   . ARG A 1 240 ? 11.682  114.655 157.975 1.00 52.48  ? 243 ARG A O   1 
ATOM   1864 C  CB  . ARG A 1 240 ? 14.620  115.748 156.895 1.00 46.84  ? 243 ARG A CB  1 
ATOM   1865 C  CG  . ARG A 1 240 ? 14.869  115.504 158.366 1.00 50.61  ? 243 ARG A CG  1 
ATOM   1866 C  CD  . ARG A 1 240 ? 15.719  116.592 159.016 1.00 57.43  ? 243 ARG A CD  1 
ATOM   1867 N  NE  . ARG A 1 240 ? 14.995  117.847 159.223 1.00 56.59  ? 243 ARG A NE  1 
ATOM   1868 C  CZ  . ARG A 1 240 ? 14.010  118.021 160.107 1.00 55.58  ? 243 ARG A CZ  1 
ATOM   1869 N  NH1 . ARG A 1 240 ? 13.594  117.017 160.880 1.00 54.87  ? 243 ARG A NH1 1 
ATOM   1870 N  NH2 . ARG A 1 240 ? 13.432  119.211 160.210 1.00 57.39  ? 243 ARG A NH2 1 
ATOM   1871 N  N   . ARG A 1 241 ? 11.566  116.437 156.612 1.00 52.14  ? 244 ARG A N   1 
ATOM   1872 C  CA  . ARG A 1 241 ? 10.320  116.887 157.219 1.00 49.77  ? 244 ARG A CA  1 
ATOM   1873 C  C   . ARG A 1 241 ? 9.162   115.942 156.914 1.00 51.90  ? 244 ARG A C   1 
ATOM   1874 O  O   . ARG A 1 241 ? 8.272   115.768 157.755 1.00 52.27  ? 244 ARG A O   1 
ATOM   1875 C  CB  . ARG A 1 241 ? 10.001  118.307 156.755 1.00 46.02  ? 244 ARG A CB  1 
ATOM   1876 C  CG  . ARG A 1 241 ? 11.034  119.342 157.205 1.00 43.91  ? 244 ARG A CG  1 
ATOM   1877 C  CD  . ARG A 1 241 ? 10.600  120.741 156.827 1.00 38.76  ? 244 ARG A CD  1 
ATOM   1878 N  NE  . ARG A 1 241 ? 11.681  121.701 156.969 1.00 39.52  ? 244 ARG A NE  1 
ATOM   1879 C  CZ  . ARG A 1 241 ? 11.565  123.002 156.725 1.00 40.82  ? 244 ARG A CZ  1 
ATOM   1880 N  NH1 . ARG A 1 241 ? 10.404  123.509 156.329 1.00 34.31  ? 244 ARG A NH1 1 
ATOM   1881 N  NH2 . ARG A 1 241 ? 12.611  123.799 156.889 1.00 38.69  ? 244 ARG A NH2 1 
ATOM   1882 N  N   . ALA A 1 242 ? 9.157   115.312 155.735 1.00 49.96  ? 245 ALA A N   1 
ATOM   1883 C  CA  . ALA A 1 242 ? 8.077   114.383 155.416 1.00 51.25  ? 245 ALA A CA  1 
ATOM   1884 C  C   . ALA A 1 242 ? 8.137   113.143 156.304 1.00 50.46  ? 245 ALA A C   1 
ATOM   1885 O  O   . ALA A 1 242 ? 7.102   112.659 156.774 1.00 45.90  ? 245 ALA A O   1 
ATOM   1886 C  CB  . ALA A 1 242 ? 8.132   113.996 153.933 1.00 44.44  ? 245 ALA A CB  1 
ATOM   1887 N  N   . VAL A 1 243 ? 9.337   112.598 156.511 1.00 51.51  ? 246 VAL A N   1 
ATOM   1888 C  CA  . VAL A 1 243 ? 9.514   111.486 157.441 1.00 54.53  ? 246 VAL A CA  1 
ATOM   1889 C  C   . VAL A 1 243 ? 9.105   111.909 158.849 1.00 58.06  ? 246 VAL A C   1 
ATOM   1890 O  O   . VAL A 1 243 ? 8.358   111.206 159.545 1.00 52.74  ? 246 VAL A O   1 
ATOM   1891 C  CB  . VAL A 1 243 ? 10.974  110.995 157.402 1.00 54.43  ? 246 VAL A CB  1 
ATOM   1892 C  CG1 . VAL A 1 243 ? 11.272  110.095 158.585 1.00 53.66  ? 246 VAL A CG1 1 
ATOM   1893 C  CG2 . VAL A 1 243 ? 11.255  110.281 156.099 1.00 46.66  ? 246 VAL A CG2 1 
ATOM   1894 N  N   . GLU A 1 244 ? 9.582   113.080 159.279 1.00 56.04  ? 247 GLU A N   1 
ATOM   1895 C  CA  . GLU A 1 244 ? 9.243   113.591 160.599 1.00 53.32  ? 247 GLU A CA  1 
ATOM   1896 C  C   . GLU A 1 244 ? 7.740   113.771 160.761 1.00 52.34  ? 247 GLU A C   1 
ATOM   1897 O  O   . GLU A 1 244 ? 7.216   113.630 161.869 1.00 56.12  ? 247 GLU A O   1 
ATOM   1898 C  CB  . GLU A 1 244 ? 9.990   114.901 160.843 1.00 54.22  ? 247 GLU A CB  1 
ATOM   1899 C  CG  . GLU A 1 244 ? 9.992   115.369 162.279 1.00 62.79  ? 247 GLU A CG  1 
ATOM   1900 C  CD  . GLU A 1 244 ? 10.532  114.324 163.261 1.00 75.63  ? 247 GLU A CD  1 
ATOM   1901 O  OE1 . GLU A 1 244 ? 10.060  114.315 164.422 1.00 69.57  ? 247 GLU A OE1 1 
ATOM   1902 O  OE2 . GLU A 1 244 ? 11.422  113.523 162.881 1.00 72.98  ? 247 GLU A OE2 1 
ATOM   1903 N  N   . LEU A 1 245 ? 7.023   114.062 159.676 1.00 50.01  ? 248 LEU A N   1 
ATOM   1904 C  CA  . LEU A 1 245 ? 5.568   114.093 159.773 1.00 51.27  ? 248 LEU A CA  1 
ATOM   1905 C  C   . LEU A 1 245 ? 5.021   112.705 160.071 1.00 53.27  ? 248 LEU A C   1 
ATOM   1906 O  O   . LEU A 1 245 ? 4.124   112.552 160.909 1.00 54.90  ? 248 LEU A O   1 
ATOM   1907 C  CB  . LEU A 1 245 ? 4.948   114.659 158.484 1.00 48.65  ? 248 LEU A CB  1 
ATOM   1908 C  CG  . LEU A 1 245 ? 3.418   114.828 158.479 1.00 45.27  ? 248 LEU A CG  1 
ATOM   1909 C  CD1 . LEU A 1 245 ? 2.949   115.857 159.499 1.00 46.36  ? 248 LEU A CD1 1 
ATOM   1910 C  CD2 . LEU A 1 245 ? 2.898   115.204 157.114 1.00 42.55  ? 248 LEU A CD2 1 
ATOM   1911 N  N   . GLY A 1 246 ? 5.557   111.679 159.400 1.00 55.32  ? 249 GLY A N   1 
ATOM   1912 C  CA  . GLY A 1 246 ? 5.084   110.323 159.631 1.00 57.65  ? 249 GLY A CA  1 
ATOM   1913 C  C   . GLY A 1 246 ? 5.401   109.828 161.030 1.00 54.00  ? 249 GLY A C   1 
ATOM   1914 O  O   . GLY A 1 246 ? 4.607   109.110 161.639 1.00 56.08  ? 249 GLY A O   1 
ATOM   1915 N  N   . ARG A 1 247 ? 6.565   110.206 161.557 1.00 52.30  ? 250 ARG A N   1 
ATOM   1916 C  CA  . ARG A 1 247 ? 6.905   109.839 162.927 1.00 61.54  ? 250 ARG A CA  1 
ATOM   1917 C  C   . ARG A 1 247 ? 5.902   110.420 163.916 1.00 57.29  ? 250 ARG A C   1 
ATOM   1918 O  O   . ARG A 1 247 ? 5.490   109.742 164.860 1.00 61.69  ? 250 ARG A O   1 
ATOM   1919 C  CB  . ARG A 1 247 ? 8.319   110.309 163.248 1.00 58.98  ? 250 ARG A CB  1 
ATOM   1920 C  CG  . ARG A 1 247 ? 8.905   109.713 164.496 1.00 66.48  ? 250 ARG A CG  1 
ATOM   1921 C  CD  . ARG A 1 247 ? 10.401  109.950 164.486 1.00 73.08  ? 250 ARG A CD  1 
ATOM   1922 N  NE  . ARG A 1 247 ? 10.995  109.473 163.237 1.00 82.04  ? 250 ARG A NE  1 
ATOM   1923 C  CZ  . ARG A 1 247 ? 12.109  109.963 162.700 1.00 83.37  ? 250 ARG A CZ  1 
ATOM   1924 N  NH1 . ARG A 1 247 ? 12.757  110.956 163.299 1.00 86.64  ? 250 ARG A NH1 1 
ATOM   1925 N  NH2 . ARG A 1 247 ? 12.571  109.469 161.561 1.00 69.17  ? 250 ARG A NH2 1 
ATOM   1926 N  N   . ASN A 1 248 ? 5.476   111.665 163.696 1.00 58.24  ? 251 ASN A N   1 
ATOM   1927 C  CA  . ASN A 1 248 ? 4.464   112.279 164.546 1.00 52.79  ? 251 ASN A CA  1 
ATOM   1928 C  C   . ASN A 1 248 ? 3.125   111.562 164.473 1.00 56.81  ? 251 ASN A C   1 
ATOM   1929 O  O   . ASN A 1 248 ? 2.290   111.750 165.363 1.00 64.62  ? 251 ASN A O   1 
ATOM   1930 C  CB  . ASN A 1 248 ? 4.260   113.744 164.156 1.00 49.07  ? 251 ASN A CB  1 
ATOM   1931 C  CG  . ASN A 1 248 ? 5.267   114.675 164.805 1.00 53.62  ? 251 ASN A CG  1 
ATOM   1932 O  OD1 . ASN A 1 248 ? 4.919   115.438 165.704 1.00 57.58  ? 251 ASN A OD1 1 
ATOM   1933 N  ND2 . ASN A 1 248 ? 6.514   114.627 164.350 1.00 49.81  ? 251 ASN A ND2 1 
ATOM   1934 N  N   . LEU A 1 249 ? 2.893   110.742 163.449 1.00 55.18  ? 252 LEU A N   1 
ATOM   1935 C  CA  . LEU A 1 249 ? 1.567   110.185 163.205 1.00 59.38  ? 252 LEU A CA  1 
ATOM   1936 C  C   . LEU A 1 249 ? 1.548   108.659 163.191 1.00 65.66  ? 252 LEU A C   1 
ATOM   1937 O  O   . LEU A 1 249 ? 0.615   108.065 162.633 1.00 67.25  ? 252 LEU A O   1 
ATOM   1938 C  CB  . LEU A 1 249 ? 1.006   110.721 161.890 1.00 59.45  ? 252 LEU A CB  1 
ATOM   1939 C  CG  . LEU A 1 249 ? 0.746   112.219 161.849 1.00 56.23  ? 252 LEU A CG  1 
ATOM   1940 C  CD1 . LEU A 1 249 ? 0.358   112.620 160.451 1.00 50.63  ? 252 LEU A CD1 1 
ATOM   1941 C  CD2 . LEU A 1 249 ? -0.348  112.569 162.822 1.00 54.63  ? 252 LEU A CD2 1 
ATOM   1942 N  N   . ASN A 1 250 ? 2.546   108.014 163.797 1.00 67.31  ? 253 ASN A N   1 
ATOM   1943 C  CA  . ASN A 1 250 ? 2.617   106.553 163.892 1.00 70.76  ? 253 ASN A CA  1 
ATOM   1944 C  C   . ASN A 1 250 ? 2.472   105.912 162.508 1.00 68.95  ? 253 ASN A C   1 
ATOM   1945 O  O   . ASN A 1 250 ? 1.539   105.159 162.218 1.00 72.57  ? 253 ASN A O   1 
ATOM   1946 C  CB  . ASN A 1 250 ? 1.561   106.003 164.859 1.00 68.54  ? 253 ASN A CB  1 
ATOM   1947 C  CG  . ASN A 1 250 ? 1.217   106.973 165.987 1.00 75.00  ? 253 ASN A CG  1 
ATOM   1948 O  OD1 . ASN A 1 250 ? 0.078   107.444 166.080 1.00 71.87  ? 253 ASN A OD1 1 
ATOM   1949 N  ND2 . ASN A 1 250 ? 2.191   107.257 166.859 1.00 62.66  ? 253 ASN A ND2 1 
ATOM   1950 N  N   . CYS A 1 251 ? 3.410   106.243 161.641 1.00 61.61  ? 254 CYS A N   1 
ATOM   1951 C  CA  . CYS A 1 251 ? 3.416   105.731 160.281 1.00 61.50  ? 254 CYS A CA  1 
ATOM   1952 C  C   . CYS A 1 251 ? 4.609   104.805 160.104 1.00 65.12  ? 254 CYS A C   1 
ATOM   1953 O  O   . CYS A 1 251 ? 5.695   105.073 160.634 1.00 58.20  ? 254 CYS A O   1 
ATOM   1954 C  CB  . CYS A 1 251 ? 3.481   106.871 159.257 1.00 57.77  ? 254 CYS A CB  1 
ATOM   1955 S  SG  . CYS A 1 251 ? 1.945   107.808 159.072 0.95 61.82  ? 254 CYS A SG  1 
ATOM   1956 N  N   . ASN A 1 252 ? 4.404   103.709 159.373 1.00 66.78  ? 255 ASN A N   1 
ATOM   1957 C  CA  . ASN A 1 252 ? 5.541   102.883 159.000 1.00 61.01  ? 255 ASN A CA  1 
ATOM   1958 C  C   . ASN A 1 252 ? 6.477   103.701 158.125 1.00 58.76  ? 255 ASN A C   1 
ATOM   1959 O  O   . ASN A 1 252 ? 6.052   104.297 157.134 1.00 63.30  ? 255 ASN A O   1 
ATOM   1960 C  CB  . ASN A 1 252 ? 5.089   101.620 158.277 1.00 65.53  ? 255 ASN A CB  1 
ATOM   1961 C  CG  . ASN A 1 252 ? 6.260   100.797 157.791 1.00 74.56  ? 255 ASN A CG  1 
ATOM   1962 O  OD1 . ASN A 1 252 ? 6.358   100.464 156.617 1.00 80.11  ? 255 ASN A OD1 1 
ATOM   1963 N  ND2 . ASN A 1 252 ? 7.180   100.500 158.691 1.00 80.82  ? 255 ASN A ND2 1 
ATOM   1964 N  N   . LEU A 1 253 ? 7.746   103.767 158.522 1.00 62.07  ? 256 LEU A N   1 
ATOM   1965 C  CA  . LEU A 1 253 ? 8.731   104.619 157.868 1.00 65.09  ? 256 LEU A CA  1 
ATOM   1966 C  C   . LEU A 1 253 ? 9.716   103.823 157.021 1.00 71.30  ? 256 LEU A C   1 
ATOM   1967 O  O   . LEU A 1 253 ? 10.804  104.322 156.712 1.00 71.32  ? 256 LEU A O   1 
ATOM   1968 C  CB  . LEU A 1 253 ? 9.495   105.449 158.904 1.00 58.83  ? 256 LEU A CB  1 
ATOM   1969 C  CG  . LEU A 1 253 ? 8.705   106.227 159.955 1.00 59.61  ? 256 LEU A CG  1 
ATOM   1970 C  CD1 . LEU A 1 253 ? 9.666   106.980 160.859 1.00 62.24  ? 256 LEU A CD1 1 
ATOM   1971 C  CD2 . LEU A 1 253 ? 7.700   107.178 159.309 1.00 59.06  ? 256 LEU A CD2 1 
ATOM   1972 N  N   . ASN A 1 254 ? 9.364   102.592 156.643 1.00 72.61  ? 257 ASN A N   1 
ATOM   1973 C  CA  . ASN A 1 254 ? 10.313  101.752 155.919 1.00 73.03  ? 257 ASN A CA  1 
ATOM   1974 C  C   . ASN A 1 254 ? 10.490  102.233 154.484 1.00 74.73  ? 257 ASN A C   1 
ATOM   1975 O  O   . ASN A 1 254 ? 11.619  102.424 154.021 1.00 77.63  ? 257 ASN A O   1 
ATOM   1976 C  CB  . ASN A 1 254 ? 9.865   100.288 155.957 1.00 77.05  ? 257 ASN A CB  1 
ATOM   1977 C  CG  . ASN A 1 254 ? 9.767   99.741  157.383 1.00 90.15  ? 257 ASN A CG  1 
ATOM   1978 O  OD1 . ASN A 1 254 ? 8.900   98.915  157.684 1.00 87.57  ? 257 ASN A OD1 1 
ATOM   1979 N  ND2 . ASN A 1 254 ? 10.649  100.212 158.270 1.00 77.45  ? 257 ASN A ND2 1 
ATOM   1980 N  N   . SER A 1 255 ? 9.388   102.454 153.769 1.00 74.69  ? 258 SER A N   1 
ATOM   1981 C  CA  . SER A 1 255 ? 9.448   102.872 152.376 1.00 74.52  ? 258 SER A CA  1 
ATOM   1982 C  C   . SER A 1 255 ? 8.625   104.137 152.163 1.00 70.37  ? 258 SER A C   1 
ATOM   1983 O  O   . SER A 1 255 ? 7.708   104.444 152.931 1.00 66.94  ? 258 SER A O   1 
ATOM   1984 C  CB  . SER A 1 255 ? 8.942   101.765 151.441 1.00 70.51  ? 258 SER A CB  1 
ATOM   1985 O  OG  . SER A 1 255 ? 7.582   101.473 151.705 1.00 72.35  ? 258 SER A OG  1 
ATOM   1986 N  N   . ASP A 1 256 ? 8.978   104.873 151.100 1.00 67.57  ? 259 ASP A N   1 
ATOM   1987 C  CA  . ASP A 1 256 ? 8.141   105.980 150.646 1.00 55.75  ? 259 ASP A CA  1 
ATOM   1988 C  C   . ASP A 1 256 ? 6.710   105.519 150.421 1.00 62.40  ? 259 ASP A C   1 
ATOM   1989 O  O   . ASP A 1 256 ? 5.759   106.209 150.800 1.00 63.57  ? 259 ASP A O   1 
ATOM   1990 C  CB  . ASP A 1 256 ? 8.700   106.582 149.355 1.00 59.60  ? 259 ASP A CB  1 
ATOM   1991 C  CG  . ASP A 1 256 ? 9.961   107.403 149.574 1.00 61.16  ? 259 ASP A CG  1 
ATOM   1992 O  OD1 . ASP A 1 256 ? 10.338  107.636 150.741 1.00 56.93  ? 259 ASP A OD1 1 
ATOM   1993 O  OD2 . ASP A 1 256 ? 10.580  107.820 148.569 1.00 64.23  ? 259 ASP A OD2 1 
ATOM   1994 N  N   . GLU A 1 257 ? 6.538   104.347 149.809 1.00 66.12  ? 260 GLU A N   1 
ATOM   1995 C  CA  . GLU A 1 257 ? 5.198   103.841 149.530 1.00 65.32  ? 260 GLU A CA  1 
ATOM   1996 C  C   . GLU A 1 257 ? 4.401   103.661 150.813 1.00 67.55  ? 260 GLU A C   1 
ATOM   1997 O  O   . GLU A 1 257 ? 3.196   103.939 150.855 1.00 66.95  ? 260 GLU A O   1 
ATOM   1998 C  CB  . GLU A 1 257 ? 5.281   102.517 148.767 1.00 68.09  ? 260 GLU A CB  1 
ATOM   1999 C  CG  . GLU A 1 257 ? 5.709   102.634 147.309 1.00 79.25  ? 260 GLU A CG  1 
ATOM   2000 C  CD  . GLU A 1 257 ? 7.173   103.030 147.132 1.00 88.53  ? 260 GLU A CD  1 
ATOM   2001 O  OE1 . GLU A 1 257 ? 7.970   102.835 148.083 1.00 78.89  ? 260 GLU A OE1 1 
ATOM   2002 O  OE2 . GLU A 1 257 ? 7.523   103.539 146.035 1.00 89.78  ? 260 GLU A OE2 1 
ATOM   2003 N  N   . GLU A 1 258 ? 5.053   103.203 151.876 1.00 69.45  ? 261 GLU A N   1 
ATOM   2004 C  CA  . GLU A 1 258 ? 4.310   102.950 153.103 1.00 68.21  ? 261 GLU A CA  1 
ATOM   2005 C  C   . GLU A 1 258 ? 4.122   104.223 153.918 1.00 61.88  ? 261 GLU A C   1 
ATOM   2006 O  O   . GLU A 1 258 ? 3.036   104.449 154.467 1.00 57.72  ? 261 GLU A O   1 
ATOM   2007 C  CB  . GLU A 1 258 ? 5.003   101.858 153.910 1.00 75.11  ? 261 GLU A CB  1 
ATOM   2008 C  CG  . GLU A 1 258 ? 4.640   100.459 153.422 1.00 77.66  ? 261 GLU A CG  1 
ATOM   2009 C  CD  . GLU A 1 258 ? 5.399   99.377  154.151 1.00 88.38  ? 261 GLU A CD  1 
ATOM   2010 O  OE1 . GLU A 1 258 ? 6.647   99.357  154.047 1.00 86.44  ? 261 GLU A OE1 1 
ATOM   2011 O  OE2 . GLU A 1 258 ? 4.749   98.566  154.849 1.00 89.96  ? 261 GLU A OE2 1 
ATOM   2012 N  N   . LEU A 1 259 ? 5.155   105.069 153.985 1.00 57.76  ? 262 LEU A N   1 
ATOM   2013 C  CA  . LEU A 1 259 ? 4.996   106.405 154.552 1.00 55.51  ? 262 LEU A CA  1 
ATOM   2014 C  C   . LEU A 1 259 ? 3.808   107.136 153.928 1.00 59.83  ? 262 LEU A C   1 
ATOM   2015 O  O   . LEU A 1 259 ? 2.959   107.687 154.641 1.00 57.77  ? 262 LEU A O   1 
ATOM   2016 C  CB  . LEU A 1 259 ? 6.290   107.201 154.369 1.00 51.32  ? 262 LEU A CB  1 
ATOM   2017 C  CG  . LEU A 1 259 ? 6.292   108.691 154.726 1.00 54.42  ? 262 LEU A CG  1 
ATOM   2018 C  CD1 . LEU A 1 259 ? 5.690   108.951 156.111 1.00 54.88  ? 262 LEU A CD1 1 
ATOM   2019 C  CD2 . LEU A 1 259 ? 7.710   109.253 154.639 1.00 49.23  ? 262 LEU A CD2 1 
ATOM   2020 N  N   . ILE A 1 260 ? 3.708   107.107 152.591 1.00 60.27  ? 263 ILE A N   1 
ATOM   2021 C  CA  . ILE A 1 260 ? 2.673   107.863 151.890 1.00 50.28  ? 263 ILE A CA  1 
ATOM   2022 C  C   . ILE A 1 260 ? 1.300   107.225 152.082 1.00 57.72  ? 263 ILE A C   1 
ATOM   2023 O  O   . ILE A 1 260 ? 0.291   107.930 152.226 1.00 56.46  ? 263 ILE A O   1 
ATOM   2024 C  CB  . ILE A 1 260 ? 3.042   108.001 150.399 1.00 60.10  ? 263 ILE A CB  1 
ATOM   2025 C  CG1 . ILE A 1 260 ? 4.290   108.867 150.258 1.00 55.91  ? 263 ILE A CG1 1 
ATOM   2026 C  CG2 . ILE A 1 260 ? 1.882   108.589 149.590 1.00 51.56  ? 263 ILE A CG2 1 
ATOM   2027 C  CD1 . ILE A 1 260 ? 4.952   108.769 148.924 1.00 50.45  ? 263 ILE A CD1 1 
ATOM   2028 N  N   . HIS A 1 261 ? 1.231   105.888 152.091 1.00 60.21  ? 264 HIS A N   1 
ATOM   2029 C  CA  . HIS A 1 261 ? -0.056  105.228 152.308 1.00 65.00  ? 264 HIS A CA  1 
ATOM   2030 C  C   . HIS A 1 261 ? -0.636  105.585 153.672 1.00 64.56  ? 264 HIS A C   1 
ATOM   2031 O  O   . HIS A 1 261 ? -1.852  105.784 153.807 1.00 63.34  ? 264 HIS A O   1 
ATOM   2032 C  CB  . HIS A 1 261 ? 0.081   103.710 152.175 1.00 66.54  ? 264 HIS A CB  1 
ATOM   2033 C  CG  . HIS A 1 261 ? -1.180  102.970 152.506 1.00 76.19  ? 264 HIS A CG  1 
ATOM   2034 N  ND1 . HIS A 1 261 ? -2.350  103.140 151.795 1.00 80.30  ? 264 HIS A ND1 1 
ATOM   2035 C  CD2 . HIS A 1 261 ? -1.464  102.081 153.489 1.00 73.27  ? 264 HIS A CD2 1 
ATOM   2036 C  CE1 . HIS A 1 261 ? -3.296  102.378 152.319 1.00 81.52  ? 264 HIS A CE1 1 
ATOM   2037 N  NE2 . HIS A 1 261 ? -2.785  101.728 153.350 1.00 76.56  ? 264 HIS A NE2 1 
ATOM   2038 N  N   . CYS A 1 262 ? 0.220   105.671 154.694 1.00 61.99  ? 265 CYS A N   1 
ATOM   2039 C  CA  . CYS A 1 262 ? -0.241  106.054 156.025 1.00 62.44  ? 265 CYS A CA  1 
ATOM   2040 C  C   . CYS A 1 262 ? -0.706  107.507 156.042 1.00 60.08  ? 265 CYS A C   1 
ATOM   2041 O  O   . CYS A 1 262 ? -1.801  107.813 156.532 1.00 57.92  ? 265 CYS A O   1 
ATOM   2042 C  CB  . CYS A 1 262 ? 0.874   105.813 157.045 1.00 55.50  ? 265 CYS A CB  1 
ATOM   2043 S  SG  . CYS A 1 262 ? 0.527   106.394 158.725 0.63 65.35  ? 265 CYS A SG  1 
ATOM   2044 N  N   . LEU A 1 263 ? 0.109   108.415 155.485 1.00 54.61  ? 266 LEU A N   1 
ATOM   2045 C  CA  . LEU A 1 263 ? -0.281  109.821 155.406 1.00 48.31  ? 266 LEU A CA  1 
ATOM   2046 C  C   . LEU A 1 263 ? -1.589  109.997 154.645 1.00 53.68  ? 266 LEU A C   1 
ATOM   2047 O  O   . LEU A 1 263 ? -2.410  110.845 155.011 1.00 51.66  ? 266 LEU A O   1 
ATOM   2048 C  CB  . LEU A 1 263 ? 0.830   110.648 154.762 1.00 41.99  ? 266 LEU A CB  1 
ATOM   2049 C  CG  . LEU A 1 263 ? 2.161   110.685 155.515 1.00 49.64  ? 266 LEU A CG  1 
ATOM   2050 C  CD1 . LEU A 1 263 ? 3.190   111.469 154.739 1.00 47.34  ? 266 LEU A CD1 1 
ATOM   2051 C  CD2 . LEU A 1 263 ? 1.977   111.280 156.910 1.00 49.79  ? 266 LEU A CD2 1 
ATOM   2052 N  N   . ARG A 1 264 ? -1.806  109.203 153.582 1.00 57.55  ? 267 ARG A N   1 
ATOM   2053 C  CA  . ARG A 1 264 ? -3.079  109.269 152.864 1.00 55.26  ? 267 ARG A CA  1 
ATOM   2054 C  C   . ARG A 1 264 ? -4.231  108.744 153.711 1.00 57.54  ? 267 ARG A C   1 
ATOM   2055 O  O   . ARG A 1 264 ? -5.376  109.177 153.542 1.00 56.94  ? 267 ARG A O   1 
ATOM   2056 C  CB  . ARG A 1 264 ? -3.002  108.482 151.559 1.00 56.83  ? 267 ARG A CB  1 
ATOM   2057 C  CG  . ARG A 1 264 ? -2.088  109.081 150.518 1.00 57.25  ? 267 ARG A CG  1 
ATOM   2058 C  CD  . ARG A 1 264 ? -2.573  108.757 149.118 1.00 58.93  ? 267 ARG A CD  1 
ATOM   2059 N  NE  . ARG A 1 264 ? -1.771  109.456 148.115 1.00 63.23  ? 267 ARG A NE  1 
ATOM   2060 C  CZ  . ARG A 1 264 ? -0.949  108.860 147.257 1.00 63.92  ? 267 ARG A CZ  1 
ATOM   2061 N  NH1 . ARG A 1 264 ? -0.828  107.537 147.254 1.00 67.31  ? 267 ARG A NH1 1 
ATOM   2062 N  NH2 . ARG A 1 264 ? -0.250  109.591 146.398 1.00 59.35  ? 267 ARG A NH2 1 
ATOM   2063 N  N   . GLU A 1 265 ? -3.949  107.815 154.621 1.00 60.71  ? 268 GLU A N   1 
ATOM   2064 C  CA  . GLU A 1 265 ? -4.984  107.238 155.472 1.00 67.39  ? 268 GLU A CA  1 
ATOM   2065 C  C   . GLU A 1 265 ? -5.527  108.244 156.487 1.00 63.10  ? 268 GLU A C   1 
ATOM   2066 O  O   . GLU A 1 265 ? -6.664  108.091 156.950 1.00 61.96  ? 268 GLU A O   1 
ATOM   2067 C  CB  . GLU A 1 265 ? -4.402  105.995 156.155 1.00 70.83  ? 268 GLU A CB  1 
ATOM   2068 C  CG  . GLU A 1 265 ? -5.268  105.273 157.165 1.00 88.97  ? 268 GLU A CG  1 
ATOM   2069 C  CD  . GLU A 1 265 ? -4.415  104.553 158.215 1.00 99.16  ? 268 GLU A CD  1 
ATOM   2070 O  OE1 . GLU A 1 265 ? -4.501  104.909 159.424 1.00 88.80  ? 268 GLU A OE1 1 
ATOM   2071 O  OE2 . GLU A 1 265 ? -3.636  103.652 157.816 1.00 99.35  ? 268 GLU A OE2 1 
ATOM   2072 N  N   . LYS A 1 266 ? -4.759  109.244 156.833 1.00 56.83  ? 269 LYS A N   1 
ATOM   2073 C  CA  . LYS A 1 266 ? -5.192  110.210 157.824 1.00 59.78  ? 269 LYS A CA  1 
ATOM   2074 C  C   . LYS A 1 266 ? -6.238  111.216 157.479 1.00 56.16  ? 269 LYS A C   1 
ATOM   2075 O  O   . LYS A 1 266 ? -6.386  111.574 156.365 1.00 64.89  ? 269 LYS A O   1 
ATOM   2076 C  CB  . LYS A 1 266 ? -4.011  111.014 158.301 1.00 50.99  ? 269 LYS A CB  1 
ATOM   2077 C  CG  . LYS A 1 266 ? -2.832  110.216 158.731 1.00 57.03  ? 269 LYS A CG  1 
ATOM   2078 C  CD  . LYS A 1 266 ? -3.121  109.480 160.003 1.00 55.58  ? 269 LYS A CD  1 
ATOM   2079 C  CE  . LYS A 1 266 ? -2.023  108.490 160.252 1.00 55.77  ? 269 LYS A CE  1 
ATOM   2080 N  NZ  . LYS A 1 266 ? -2.383  107.604 161.367 1.00 76.88  ? 269 LYS A NZ  1 
ATOM   2081 N  N   . LYS A 1 267 ? -6.946  111.707 158.468 1.00 55.10  ? 270 LYS A N   1 
ATOM   2082 C  CA  . LYS A 1 267 ? -7.895  112.781 158.211 1.00 57.17  ? 270 LYS A CA  1 
ATOM   2083 C  C   . LYS A 1 267 ? -7.146  114.109 158.063 1.00 55.55  ? 270 LYS A C   1 
ATOM   2084 O  O   . LYS A 1 267 ? -6.074  114.291 158.649 1.00 51.39  ? 270 LYS A O   1 
ATOM   2085 C  CB  . LYS A 1 267 ? -8.917  112.882 159.341 1.00 56.69  ? 270 LYS A CB  1 
ATOM   2086 C  CG  . LYS A 1 267 ? -9.958  111.768 159.383 1.00 61.96  ? 270 LYS A CG  1 
ATOM   2087 C  CD  . LYS A 1 267 ? -11.184 112.112 158.550 1.00 61.92  ? 270 LYS A CD  1 
ATOM   2088 N  N   . PRO A 1 268 ? -7.682  115.045 157.269 1.00 54.00  ? 271 PRO A N   1 
ATOM   2089 C  CA  . PRO A 1 268 ? -6.945  116.302 157.023 1.00 54.16  ? 271 PRO A CA  1 
ATOM   2090 C  C   . PRO A 1 268 ? -6.491  117.014 158.291 1.00 51.57  ? 271 PRO A C   1 
ATOM   2091 O  O   . PRO A 1 268 ? -5.341  117.464 158.367 1.00 54.08  ? 271 PRO A O   1 
ATOM   2092 C  CB  . PRO A 1 268 ? -7.950  117.149 156.221 1.00 48.43  ? 271 PRO A CB  1 
ATOM   2093 C  CG  . PRO A 1 268 ? -8.919  116.182 155.645 1.00 49.46  ? 271 PRO A CG  1 
ATOM   2094 C  CD  . PRO A 1 268 ? -8.950  114.970 156.515 1.00 52.63  ? 271 PRO A CD  1 
ATOM   2095 N  N   . GLN A 1 269 ? -7.359  117.123 159.299 1.00 53.03  ? 272 GLN A N   1 
ATOM   2096 C  CA  . GLN A 1 269 ? -6.979  117.856 160.506 1.00 53.48  ? 272 GLN A CA  1 
ATOM   2097 C  C   . GLN A 1 269 ? -5.864  117.172 161.296 1.00 48.30  ? 272 GLN A C   1 
ATOM   2098 O  O   . GLN A 1 269 ? -5.166  117.845 162.067 1.00 48.19  ? 272 GLN A O   1 
ATOM   2099 C  CB  . GLN A 1 269 ? -8.199  118.072 161.404 1.00 47.04  ? 272 GLN A CB  1 
ATOM   2100 C  CG  . GLN A 1 269 ? -7.955  119.056 162.528 1.00 37.10  ? 272 GLN A CG  1 
ATOM   2101 C  CD  . GLN A 1 269 ? -7.488  120.413 162.037 1.00 48.87  ? 272 GLN A CD  1 
ATOM   2102 O  OE1 . GLN A 1 269 ? -7.896  120.886 160.967 1.00 54.34  ? 272 GLN A OE1 1 
ATOM   2103 N  NE2 . GLN A 1 269 ? -6.620  121.047 162.813 1.00 46.39  ? 272 GLN A NE2 1 
ATOM   2104 N  N   . GLU A 1 270 ? -5.672  115.861 161.124 1.00 46.52  ? 273 GLU A N   1 
ATOM   2105 C  CA  . GLU A 1 270 ? -4.563  115.192 161.800 1.00 44.51  ? 273 GLU A CA  1 
ATOM   2106 C  C   . GLU A 1 270 ? -3.224  115.657 161.246 1.00 51.67  ? 273 GLU A C   1 
ATOM   2107 O  O   . GLU A 1 270 ? -2.271  115.868 162.007 1.00 48.03  ? 273 GLU A O   1 
ATOM   2108 C  CB  . GLU A 1 270 ? -4.698  113.673 161.678 1.00 47.32  ? 273 GLU A CB  1 
ATOM   2109 C  CG  . GLU A 1 270 ? -6.040  113.140 162.181 1.00 53.49  ? 273 GLU A CG  1 
ATOM   2110 C  CD  . GLU A 1 270 ? -6.182  111.642 162.021 1.00 60.31  ? 273 GLU A CD  1 
ATOM   2111 O  OE1 . GLU A 1 270 ? -5.286  110.905 162.481 1.00 74.40  ? 273 GLU A OE1 1 
ATOM   2112 O  OE2 . GLU A 1 270 ? -7.191  111.199 161.429 1.00 67.96  ? 273 GLU A OE2 1 
ATOM   2113 N  N   . LEU A 1 271 ? -3.130  115.828 159.922 1.00 49.46  ? 274 LEU A N   1 
ATOM   2114 C  CA  . LEU A 1 271 ? -1.907  116.364 159.335 1.00 50.37  ? 274 LEU A CA  1 
ATOM   2115 C  C   . LEU A 1 271 ? -1.635  117.776 159.848 1.00 45.62  ? 274 LEU A C   1 
ATOM   2116 O  O   . LEU A 1 271 ? -0.513  118.096 160.267 1.00 40.14  ? 274 LEU A O   1 
ATOM   2117 C  CB  . LEU A 1 271 ? -2.002  116.346 157.801 1.00 46.81  ? 274 LEU A CB  1 
ATOM   2118 C  CG  . LEU A 1 271 ? -2.025  114.969 157.132 1.00 52.31  ? 274 LEU A CG  1 
ATOM   2119 C  CD1 . LEU A 1 271 ? -2.060  115.100 155.623 1.00 54.09  ? 274 LEU A CD1 1 
ATOM   2120 C  CD2 . LEU A 1 271 ? -0.816  114.164 157.549 1.00 53.18  ? 274 LEU A CD2 1 
ATOM   2121 N  N   . ILE A 1 272 ? -2.665  118.628 159.834 1.00 41.44  ? 275 ILE A N   1 
ATOM   2122 C  CA  . ILE A 1 272 ? -2.510  120.020 160.250 1.00 49.09  ? 275 ILE A CA  1 
ATOM   2123 C  C   . ILE A 1 272 ? -2.058  120.106 161.709 1.00 47.31  ? 275 ILE A C   1 
ATOM   2124 O  O   . ILE A 1 272 ? -1.099  120.820 162.029 1.00 45.76  ? 275 ILE A O   1 
ATOM   2125 C  CB  . ILE A 1 272 ? -3.821  120.790 160.006 1.00 50.13  ? 275 ILE A CB  1 
ATOM   2126 C  CG1 . ILE A 1 272 ? -4.100  120.851 158.499 1.00 44.76  ? 275 ILE A CG1 1 
ATOM   2127 C  CG2 . ILE A 1 272 ? -3.771  122.179 160.649 1.00 41.56  ? 275 ILE A CG2 1 
ATOM   2128 C  CD1 . ILE A 1 272 ? -5.546  121.105 158.138 1.00 42.95  ? 275 ILE A CD1 1 
ATOM   2129 N  N   . ASP A 1 273 ? -2.713  119.347 162.607 1.00 46.43  ? 276 ASP A N   1 
ATOM   2130 C  CA  . ASP A 1 273 ? -2.432  119.454 164.047 1.00 44.36  ? 276 ASP A CA  1 
ATOM   2131 C  C   . ASP A 1 273 ? -0.959  119.276 164.376 1.00 47.82  ? 276 ASP A C   1 
ATOM   2132 O  O   . ASP A 1 273 ? -0.478  119.830 165.371 1.00 42.92  ? 276 ASP A O   1 
ATOM   2133 C  CB  . ASP A 1 273 ? -3.225  118.418 164.849 1.00 40.80  ? 276 ASP A CB  1 
ATOM   2134 C  CG  . ASP A 1 273 ? -4.692  118.778 164.996 1.00 49.66  ? 276 ASP A CG  1 
ATOM   2135 O  OD1 . ASP A 1 273 ? -5.021  119.982 164.914 1.00 51.45  ? 276 ASP A OD1 1 
ATOM   2136 O  OD2 . ASP A 1 273 ? -5.516  117.853 165.197 1.00 49.76  ? 276 ASP A OD2 1 
ATOM   2137 N  N   . VAL A 1 274 ? -0.224  118.506 163.573 1.00 42.48  ? 277 VAL A N   1 
ATOM   2138 C  CA  . VAL A 1 274 ? 1.162   118.182 163.896 1.00 49.04  ? 277 VAL A CA  1 
ATOM   2139 C  C   . VAL A 1 274 ? 2.168   118.857 162.974 1.00 46.33  ? 277 VAL A C   1 
ATOM   2140 O  O   . VAL A 1 274 ? 3.380   118.672 163.174 1.00 45.95  ? 277 VAL A O   1 
ATOM   2141 C  CB  . VAL A 1 274 ? 1.400   116.656 163.914 1.00 54.67  ? 277 VAL A CB  1 
ATOM   2142 C  CG1 . VAL A 1 274 ? 0.744   116.024 165.140 1.00 47.86  ? 277 VAL A CG1 1 
ATOM   2143 C  CG2 . VAL A 1 274 ? 0.889   116.002 162.631 1.00 47.73  ? 277 VAL A CG2 1 
ATOM   2144 N  N   . GLU A 1 275 ? 1.720   119.668 162.003 1.00 45.35  ? 278 GLU A N   1 
ATOM   2145 C  CA  . GLU A 1 275 ? 2.614   120.071 160.917 1.00 40.13  ? 278 GLU A CA  1 
ATOM   2146 C  C   . GLU A 1 275 ? 3.725   121.004 161.390 1.00 46.91  ? 278 GLU A C   1 
ATOM   2147 O  O   . GLU A 1 275 ? 4.813   121.009 160.800 1.00 39.02  ? 278 GLU A O   1 
ATOM   2148 C  CB  . GLU A 1 275 ? 1.815   120.705 159.767 1.00 49.28  ? 278 GLU A CB  1 
ATOM   2149 C  CG  . GLU A 1 275 ? 1.463   122.199 159.887 1.00 53.00  ? 278 GLU A CG  1 
ATOM   2150 C  CD  . GLU A 1 275 ? 0.920   122.783 158.561 1.00 53.83  ? 278 GLU A CD  1 
ATOM   2151 O  OE1 . GLU A 1 275 ? -0.217  122.442 158.163 1.00 51.22  ? 278 GLU A OE1 1 
ATOM   2152 O  OE2 . GLU A 1 275 ? 1.637   123.575 157.907 1.00 50.61  ? 278 GLU A OE2 1 
ATOM   2153 N  N   . TRP A 1 276 ? 3.505   121.770 162.467 1.00 49.05  ? 279 TRP A N   1 
ATOM   2154 C  CA  . TRP A 1 276 ? 4.591   122.614 162.962 1.00 45.72  ? 279 TRP A CA  1 
ATOM   2155 C  C   . TRP A 1 276 ? 5.668   121.825 163.700 1.00 43.60  ? 279 TRP A C   1 
ATOM   2156 O  O   . TRP A 1 276 ? 6.719   122.395 164.003 1.00 43.12  ? 279 TRP A O   1 
ATOM   2157 C  CB  . TRP A 1 276 ? 4.048   123.731 163.862 1.00 43.94  ? 279 TRP A CB  1 
ATOM   2158 C  CG  . TRP A 1 276 ? 2.984   124.538 163.192 1.00 43.48  ? 279 TRP A CG  1 
ATOM   2159 C  CD1 . TRP A 1 276 ? 1.633   124.432 163.378 1.00 42.01  ? 279 TRP A CD1 1 
ATOM   2160 C  CD2 . TRP A 1 276 ? 3.177   125.557 162.191 1.00 44.57  ? 279 TRP A CD2 1 
ATOM   2161 N  NE1 . TRP A 1 276 ? 0.975   125.329 162.559 1.00 46.26  ? 279 TRP A NE1 1 
ATOM   2162 C  CE2 . TRP A 1 276 ? 1.898   126.027 161.821 1.00 43.33  ? 279 TRP A CE2 1 
ATOM   2163 C  CE3 . TRP A 1 276 ? 4.306   126.117 161.580 1.00 39.56  ? 279 TRP A CE3 1 
ATOM   2164 C  CZ2 . TRP A 1 276 ? 1.713   127.030 160.858 1.00 44.34  ? 279 TRP A CZ2 1 
ATOM   2165 C  CZ3 . TRP A 1 276 ? 4.122   127.115 160.626 1.00 49.52  ? 279 TRP A CZ3 1 
ATOM   2166 C  CH2 . TRP A 1 276 ? 2.831   127.561 160.272 1.00 43.36  ? 279 TRP A CH2 1 
ATOM   2167 N  N   . ASN A 1 277 ? 5.456   120.530 163.963 1.00 42.23  ? 280 ASN A N   1 
ATOM   2168 C  CA  . ASN A 1 277 ? 6.422   119.743 164.728 1.00 43.32  ? 280 ASN A CA  1 
ATOM   2169 C  C   . ASN A 1 277 ? 7.597   119.254 163.903 1.00 50.98  ? 280 ASN A C   1 
ATOM   2170 O  O   . ASN A 1 277 ? 8.596   118.813 164.484 1.00 51.19  ? 280 ASN A O   1 
ATOM   2171 C  CB  . ASN A 1 277 ? 5.747   118.529 165.358 1.00 48.86  ? 280 ASN A CB  1 
ATOM   2172 C  CG  . ASN A 1 277 ? 4.618   118.914 166.280 1.00 50.48  ? 280 ASN A CG  1 
ATOM   2173 O  OD1 . ASN A 1 277 ? 4.545   120.057 166.737 1.00 47.85  ? 280 ASN A OD1 1 
ATOM   2174 N  ND2 . ASN A 1 277 ? 3.722   117.969 166.550 1.00 43.64  ? 280 ASN A ND2 1 
ATOM   2175 N  N   . VAL A 1 278 ? 7.496   119.298 162.570 1.00 48.81  ? 281 VAL A N   1 
ATOM   2176 C  CA  . VAL A 1 278 ? 8.568   118.794 161.720 1.00 47.00  ? 281 VAL A CA  1 
ATOM   2177 C  C   . VAL A 1 278 ? 9.643   119.834 161.490 1.00 51.29  ? 281 VAL A C   1 
ATOM   2178 O  O   . VAL A 1 278 ? 10.646  119.537 160.826 1.00 51.97  ? 281 VAL A O   1 
ATOM   2179 C  CB  . VAL A 1 278 ? 7.983   118.311 160.381 1.00 49.28  ? 281 VAL A CB  1 
ATOM   2180 C  CG1 . VAL A 1 278 ? 6.806   117.383 160.648 1.00 49.26  ? 281 VAL A CG1 1 
ATOM   2181 C  CG2 . VAL A 1 278 ? 7.562   119.506 159.516 1.00 44.11  ? 281 VAL A CG2 1 
ATOM   2182 N  N   . LEU A 1 279 ? 9.469   121.038 162.028 1.00 46.31  ? 282 LEU A N   1 
ATOM   2183 C  CA  . LEU A 1 279 ? 10.413  122.109 161.778 1.00 50.81  ? 282 LEU A CA  1 
ATOM   2184 C  C   . LEU A 1 279 ? 11.718  121.849 162.519 1.00 57.08  ? 282 LEU A C   1 
ATOM   2185 O  O   . LEU A 1 279 ? 11.738  121.146 163.534 1.00 60.01  ? 282 LEU A O   1 
ATOM   2186 C  CB  . LEU A 1 279 ? 9.829   123.451 162.209 1.00 50.00  ? 282 LEU A CB  1 
ATOM   2187 C  CG  . LEU A 1 279 ? 8.888   124.091 161.189 1.00 47.78  ? 282 LEU A CG  1 
ATOM   2188 C  CD1 . LEU A 1 279 ? 8.318   125.384 161.735 1.00 44.56  ? 282 LEU A CD1 1 
ATOM   2189 C  CD2 . LEU A 1 279 ? 9.635   124.319 159.871 1.00 46.71  ? 282 LEU A CD2 1 
ATOM   2190 N  N   . PRO A 1 280 ? 12.824  122.392 162.025 1.00 59.56  ? 283 PRO A N   1 
ATOM   2191 C  CA  . PRO A 1 280 ? 14.081  122.297 162.767 1.00 62.56  ? 283 PRO A CA  1 
ATOM   2192 C  C   . PRO A 1 280 ? 14.019  123.139 164.030 1.00 72.28  ? 283 PRO A C   1 
ATOM   2193 O  O   . PRO A 1 280 ? 13.105  123.939 164.245 1.00 68.00  ? 283 PRO A O   1 
ATOM   2194 C  CB  . PRO A 1 280 ? 15.128  122.839 161.792 1.00 64.82  ? 283 PRO A CB  1 
ATOM   2195 C  CG  . PRO A 1 280 ? 14.457  122.870 160.471 1.00 62.66  ? 283 PRO A CG  1 
ATOM   2196 C  CD  . PRO A 1 280 ? 13.005  123.063 160.732 1.00 58.76  ? 283 PRO A CD  1 
ATOM   2197 N  N   . PHE A 1 281 ? 15.080  123.096 164.743 1.00 77.88  ? 284 PHE A N   1 
ATOM   2198 C  CA  . PHE A 1 281 ? 15.282  123.798 165.981 1.00 81.62  ? 284 PHE A CA  1 
ATOM   2199 C  C   . PHE A 1 281 ? 14.988  125.289 165.790 1.00 81.23  ? 284 PHE A C   1 
ATOM   2200 O  O   . PHE A 1 281 ? 14.293  125.885 166.594 1.00 69.56  ? 284 PHE A O   1 
ATOM   2201 C  CB  . PHE A 1 281 ? 16.783  123.642 166.374 1.00 85.27  ? 284 PHE A CB  1 
ATOM   2202 C  CG  . PHE A 1 281 ? 17.675  123.133 165.239 1.00 95.77  ? 284 PHE A CG  1 
ATOM   2203 C  CD1 . PHE A 1 281 ? 17.492  121.837 164.775 1.00 96.64  ? 284 PHE A CD1 1 
ATOM   2204 C  CD2 . PHE A 1 281 ? 18.517  123.971 164.537 1.00 94.27  ? 284 PHE A CD2 1 
ATOM   2205 C  CE1 . PHE A 1 281 ? 18.203  121.362 163.699 1.00 99.03  ? 284 PHE A CE1 1 
ATOM   2206 C  CE2 . PHE A 1 281 ? 19.234  123.493 163.464 1.00 98.27  ? 284 PHE A CE2 1 
ATOM   2207 C  CZ  . PHE A 1 281 ? 19.079  122.193 163.041 1.00 94.52  ? 284 PHE A CZ  1 
ATOM   2208 N  N   . ASP A 1 282 ? 15.484  125.891 164.721 1.00 75.53  ? 285 ASP A N   1 
ATOM   2209 C  CA  . ASP A 1 282 ? 15.231  127.293 164.486 1.00 75.36  ? 285 ASP A CA  1 
ATOM   2210 C  C   . ASP A 1 282 ? 14.042  127.321 163.575 1.00 79.72  ? 285 ASP A C   1 
ATOM   2211 O  O   . ASP A 1 282 ? 14.141  127.038 162.404 1.00 75.74  ? 285 ASP A O   1 
ATOM   2212 C  CB  . ASP A 1 282 ? 16.419  127.893 163.798 1.00 81.91  ? 285 ASP A CB  1 
ATOM   2213 C  CG  . ASP A 1 282 ? 16.835  127.105 162.613 1.00 86.49  ? 285 ASP A CG  1 
ATOM   2214 O  OD1 . ASP A 1 282 ? 16.771  125.888 162.686 1.00 86.85  ? 285 ASP A OD1 1 
ATOM   2215 O  OD2 . ASP A 1 282 ? 17.215  127.694 161.608 1.00 74.58  ? 285 ASP A OD2 1 
ATOM   2216 N  N   . SER A 1 283 ? 12.902  127.635 164.139 1.00 72.15  ? 286 SER A N   1 
ATOM   2217 C  CA  . SER A 1 283 ? 11.694  127.584 163.402 1.00 68.36  ? 286 SER A CA  1 
ATOM   2218 C  C   . SER A 1 283 ? 10.788  128.739 163.460 1.00 58.73  ? 286 SER A C   1 
ATOM   2219 O  O   . SER A 1 283 ? 9.712   128.669 162.958 1.00 57.90  ? 286 SER A O   1 
ATOM   2220 C  CB  . SER A 1 283 ? 10.917  126.434 164.026 1.00 65.34  ? 286 SER A CB  1 
ATOM   2221 O  OG  . SER A 1 283 ? 10.925  126.506 165.427 1.00 56.63  ? 286 SER A OG  1 
ATOM   2222 N  N   . ILE A 1 284 ? 11.188  129.793 164.102 1.00 57.74  ? 287 ILE A N   1 
ATOM   2223 C  CA  . ILE A 1 284 ? 10.217  130.843 164.361 1.00 58.43  ? 287 ILE A CA  1 
ATOM   2224 C  C   . ILE A 1 284 ? 9.907   131.624 163.085 1.00 52.00  ? 287 ILE A C   1 
ATOM   2225 O  O   . ILE A 1 284 ? 8.799   132.148 162.923 1.00 52.38  ? 287 ILE A O   1 
ATOM   2226 C  CB  . ILE A 1 284 ? 10.733  131.709 165.531 1.00 59.13  ? 287 ILE A CB  1 
ATOM   2227 C  CG1 . ILE A 1 284 ? 10.054  133.078 165.577 1.00 55.53  ? 287 ILE A CG1 1 
ATOM   2228 C  CG2 . ILE A 1 284 ? 12.267  131.816 165.494 1.00 59.46  ? 287 ILE A CG2 1 
ATOM   2229 C  CD1 . ILE A 1 284 ? 10.731  134.043 166.516 1.00 58.49  ? 287 ILE A CD1 1 
ATOM   2230 N  N   . PHE A 1 285 ? 10.833  131.657 162.133 1.00 50.51  ? 288 PHE A N   1 
ATOM   2231 C  CA  . PHE A 1 285 ? 10.610  132.334 160.864 1.00 49.89  ? 288 PHE A CA  1 
ATOM   2232 C  C   . PHE A 1 285 ? 10.495  131.352 159.695 1.00 47.31  ? 288 PHE A C   1 
ATOM   2233 O  O   . PHE A 1 285 ? 10.821  131.697 158.557 1.00 48.40  ? 288 PHE A O   1 
ATOM   2234 C  CB  . PHE A 1 285 ? 11.731  133.343 160.615 1.00 53.23  ? 288 PHE A CB  1 
ATOM   2235 C  CG  . PHE A 1 285 ? 11.941  134.309 161.755 1.00 53.58  ? 288 PHE A CG  1 
ATOM   2236 C  CD1 . PHE A 1 285 ? 10.860  134.829 162.456 1.00 56.33  ? 288 PHE A CD1 1 
ATOM   2237 C  CD2 . PHE A 1 285 ? 13.216  134.689 162.135 1.00 60.18  ? 288 PHE A CD2 1 
ATOM   2238 C  CE1 . PHE A 1 285 ? 11.050  135.719 163.504 1.00 54.91  ? 288 PHE A CE1 1 
ATOM   2239 C  CE2 . PHE A 1 285 ? 13.415  135.577 163.190 1.00 55.81  ? 288 PHE A CE2 1 
ATOM   2240 C  CZ  . PHE A 1 285 ? 12.332  136.091 163.870 1.00 53.16  ? 288 PHE A CZ  1 
ATOM   2241 N  N   . ARG A 1 286 ? 10.032  130.130 159.953 1.00 45.56  ? 289 ARG A N   1 
ATOM   2242 C  CA  . ARG A 1 286 ? 9.975   129.098 158.926 1.00 47.29  ? 289 ARG A CA  1 
ATOM   2243 C  C   . ARG A 1 286 ? 8.583   128.492 158.873 1.00 44.65  ? 289 ARG A C   1 
ATOM   2244 O  O   . ARG A 1 286 ? 7.804   128.584 159.821 1.00 46.10  ? 289 ARG A O   1 
ATOM   2245 C  CB  . ARG A 1 286 ? 11.000  127.967 159.153 1.00 44.53  ? 289 ARG A CB  1 
ATOM   2246 C  CG  . ARG A 1 286 ? 12.428  128.428 159.387 1.00 54.05  ? 289 ARG A CG  1 
ATOM   2247 C  CD  . ARG A 1 286 ? 13.441  127.324 159.083 1.00 61.12  ? 289 ARG A CD  1 
ATOM   2248 N  NE  . ARG A 1 286 ? 14.234  127.699 157.910 1.00 79.75  ? 289 ARG A NE  1 
ATOM   2249 C  CZ  . ARG A 1 286 ? 15.560  127.776 157.889 1.00 78.74  ? 289 ARG A CZ  1 
ATOM   2250 N  NH1 . ARG A 1 286 ? 16.258  127.463 158.974 1.00 61.24  ? 289 ARG A NH1 1 
ATOM   2251 N  NH2 . ARG A 1 286 ? 16.185  128.152 156.773 1.00 73.86  ? 289 ARG A NH2 1 
ATOM   2252 N  N   . PHE A 1 287 ? 8.293   127.861 157.737 1.00 47.18  ? 290 PHE A N   1 
ATOM   2253 C  CA  . PHE A 1 287 ? 7.038   127.169 157.485 1.00 46.18  ? 290 PHE A CA  1 
ATOM   2254 C  C   . PHE A 1 287 ? 7.359   125.758 157.013 1.00 44.06  ? 290 PHE A C   1 
ATOM   2255 O  O   . PHE A 1 287 ? 8.371   125.522 156.345 1.00 48.06  ? 290 PHE A O   1 
ATOM   2256 C  CB  . PHE A 1 287 ? 6.188   127.947 156.461 1.00 42.72  ? 290 PHE A CB  1 
ATOM   2257 C  CG  . PHE A 1 287 ? 6.221   129.440 156.680 1.00 44.52  ? 290 PHE A CG  1 
ATOM   2258 C  CD1 . PHE A 1 287 ? 5.669   130.000 157.836 1.00 43.80  ? 290 PHE A CD1 1 
ATOM   2259 C  CD2 . PHE A 1 287 ? 6.836   130.280 155.764 1.00 41.50  ? 290 PHE A CD2 1 
ATOM   2260 C  CE1 . PHE A 1 287 ? 5.713   131.368 158.063 1.00 38.29  ? 290 PHE A CE1 1 
ATOM   2261 C  CE2 . PHE A 1 287 ? 6.882   131.656 155.980 1.00 44.27  ? 290 PHE A CE2 1 
ATOM   2262 C  CZ  . PHE A 1 287 ? 6.325   132.197 157.141 1.00 45.57  ? 290 PHE A CZ  1 
ATOM   2263 N  N   . SER A 1 288 ? 6.497   124.813 157.378 1.00 42.76  ? 291 SER A N   1 
ATOM   2264 C  CA  . SER A 1 288 ? 6.882   123.406 157.313 1.00 42.67  ? 291 SER A CA  1 
ATOM   2265 C  C   . SER A 1 288 ? 7.015   122.909 155.872 1.00 47.27  ? 291 SER A C   1 
ATOM   2266 O  O   . SER A 1 288 ? 8.074   122.408 155.476 1.00 41.24  ? 291 SER A O   1 
ATOM   2267 C  CB  . SER A 1 288 ? 5.882   122.563 158.098 1.00 39.53  ? 291 SER A CB  1 
ATOM   2268 O  OG  . SER A 1 288 ? 6.081   122.756 159.484 1.00 53.80  ? 291 SER A OG  1 
ATOM   2269 N  N   . PHE A 1 289 ? 5.948   123.012 155.074 1.00 42.42  ? 292 PHE A N   1 
ATOM   2270 C  CA  . PHE A 1 289 ? 5.931   122.444 153.728 1.00 39.24  ? 292 PHE A CA  1 
ATOM   2271 C  C   . PHE A 1 289 ? 5.875   123.564 152.702 1.00 40.28  ? 292 PHE A C   1 
ATOM   2272 O  O   . PHE A 1 289 ? 4.831   124.201 152.515 1.00 41.33  ? 292 PHE A O   1 
ATOM   2273 C  CB  . PHE A 1 289 ? 4.779   121.459 153.591 1.00 38.38  ? 292 PHE A CB  1 
ATOM   2274 C  CG  . PHE A 1 289 ? 4.873   120.351 154.588 1.00 48.88  ? 292 PHE A CG  1 
ATOM   2275 C  CD1 . PHE A 1 289 ? 5.796   119.324 154.410 1.00 44.92  ? 292 PHE A CD1 1 
ATOM   2276 C  CD2 . PHE A 1 289 ? 4.114   120.380 155.760 1.00 49.23  ? 292 PHE A CD2 1 
ATOM   2277 C  CE1 . PHE A 1 289 ? 5.924   118.313 155.368 1.00 46.30  ? 292 PHE A CE1 1 
ATOM   2278 C  CE2 . PHE A 1 289 ? 4.237   119.369 156.718 1.00 44.17  ? 292 PHE A CE2 1 
ATOM   2279 C  CZ  . PHE A 1 289 ? 5.138   118.336 156.519 1.00 43.19  ? 292 PHE A CZ  1 
ATOM   2280 N  N   . VAL A 1 290 ? 7.011   123.791 152.048 1.00 35.26  ? 293 VAL A N   1 
ATOM   2281 C  CA  . VAL A 1 290 ? 7.219   124.874 151.092 1.00 42.40  ? 293 VAL A CA  1 
ATOM   2282 C  C   . VAL A 1 290 ? 7.774   124.287 149.791 1.00 45.31  ? 293 VAL A C   1 
ATOM   2283 O  O   . VAL A 1 290 ? 8.127   123.098 149.752 1.00 44.39  ? 293 VAL A O   1 
ATOM   2284 C  CB  . VAL A 1 290 ? 8.160   125.940 151.683 1.00 37.51  ? 293 VAL A CB  1 
ATOM   2285 C  CG1 . VAL A 1 290 ? 7.545   126.559 152.926 1.00 44.59  ? 293 VAL A CG1 1 
ATOM   2286 C  CG2 . VAL A 1 290 ? 9.498   125.332 151.999 1.00 38.36  ? 293 VAL A CG2 1 
ATOM   2287 N  N   . PRO A 1 291 ? 7.875   125.058 148.708 1.00 41.05  ? 294 PRO A N   1 
ATOM   2288 C  CA  . PRO A 1 291 ? 8.452   124.507 147.474 1.00 41.52  ? 294 PRO A CA  1 
ATOM   2289 C  C   . PRO A 1 291 ? 9.847   123.933 147.686 1.00 44.89  ? 294 PRO A C   1 
ATOM   2290 O  O   . PRO A 1 291 ? 10.602  124.374 148.552 1.00 44.57  ? 294 PRO A O   1 
ATOM   2291 C  CB  . PRO A 1 291 ? 8.485   125.716 146.533 1.00 35.46  ? 294 PRO A CB  1 
ATOM   2292 C  CG  . PRO A 1 291 ? 7.324   126.516 146.942 1.00 41.83  ? 294 PRO A CG  1 
ATOM   2293 C  CD  . PRO A 1 291 ? 7.259   126.378 148.471 1.00 39.82  ? 294 PRO A CD  1 
ATOM   2294 N  N   . VAL A 1 292 ? 10.187  122.939 146.864 1.00 47.13  ? 295 VAL A N   1 
ATOM   2295 C  CA  . VAL A 1 292 ? 11.421  122.169 146.991 1.00 44.10  ? 295 VAL A CA  1 
ATOM   2296 C  C   . VAL A 1 292 ? 12.251  122.340 145.720 1.00 50.09  ? 295 VAL A C   1 
ATOM   2297 O  O   . VAL A 1 292 ? 11.722  122.254 144.603 1.00 44.26  ? 295 VAL A O   1 
ATOM   2298 C  CB  . VAL A 1 292 ? 11.125  120.681 147.264 1.00 43.56  ? 295 VAL A CB  1 
ATOM   2299 C  CG1 . VAL A 1 292 ? 10.237  120.084 146.169 1.00 43.31  ? 295 VAL A CG1 1 
ATOM   2300 C  CG2 . VAL A 1 292 ? 12.406  119.905 147.382 1.00 46.47  ? 295 VAL A CG2 1 
ATOM   2301 N  N   . ILE A 1 293 ? 13.549  122.584 145.890 1.00 44.74  ? 296 ILE A N   1 
ATOM   2302 C  CA  . ILE A 1 293 ? 14.446  122.744 144.750 1.00 50.71  ? 296 ILE A CA  1 
ATOM   2303 C  C   . ILE A 1 293 ? 14.779  121.365 144.190 1.00 50.61  ? 296 ILE A C   1 
ATOM   2304 O  O   . ILE A 1 293 ? 15.752  120.730 144.614 1.00 50.95  ? 296 ILE A O   1 
ATOM   2305 C  CB  . ILE A 1 293 ? 15.713  123.511 145.161 1.00 46.76  ? 296 ILE A CB  1 
ATOM   2306 C  CG1 . ILE A 1 293 ? 15.325  124.784 145.914 1.00 40.49  ? 296 ILE A CG1 1 
ATOM   2307 C  CG2 . ILE A 1 293 ? 16.571  123.808 143.945 1.00 44.48  ? 296 ILE A CG2 1 
ATOM   2308 C  CD1 . ILE A 1 293 ? 14.356  125.666 145.157 1.00 40.38  ? 296 ILE A CD1 1 
ATOM   2309 N  N   . ASP A 1 294 ? 13.973  120.890 143.239 1.00 44.00  ? 297 ASP A N   1 
ATOM   2310 C  CA  . ASP A 1 294 ? 13.886  119.468 142.940 1.00 46.15  ? 297 ASP A CA  1 
ATOM   2311 C  C   . ASP A 1 294 ? 14.576  119.057 141.645 1.00 53.55  ? 297 ASP A C   1 
ATOM   2312 O  O   . ASP A 1 294 ? 14.553  117.871 141.298 1.00 58.37  ? 297 ASP A O   1 
ATOM   2313 C  CB  . ASP A 1 294 ? 12.409  119.032 142.896 1.00 46.62  ? 297 ASP A CB  1 
ATOM   2314 C  CG  . ASP A 1 294 ? 11.633  119.669 141.743 1.00 53.54  ? 297 ASP A CG  1 
ATOM   2315 O  OD1 . ASP A 1 294 ? 12.146  120.624 141.105 1.00 45.76  ? 297 ASP A OD1 1 
ATOM   2316 O  OD2 . ASP A 1 294 ? 10.499  119.204 141.477 1.00 58.72  ? 297 ASP A OD2 1 
ATOM   2317 N  N   . GLY A 1 295 ? 15.182  119.987 140.917 1.00 52.92  ? 298 GLY A N   1 
ATOM   2318 C  CA  . GLY A 1 295 ? 15.767  119.645 139.645 1.00 54.49  ? 298 GLY A CA  1 
ATOM   2319 C  C   . GLY A 1 295 ? 14.777  119.458 138.519 1.00 56.21  ? 298 GLY A C   1 
ATOM   2320 O  O   . GLY A 1 295 ? 15.200  119.243 137.381 1.00 55.20  ? 298 GLY A O   1 
ATOM   2321 N  N   . GLU A 1 296 ? 13.474  119.524 138.795 1.00 58.20  ? 299 GLU A N   1 
ATOM   2322 C  CA  . GLU A 1 296 ? 12.453  119.379 137.765 1.00 51.16  ? 299 GLU A CA  1 
ATOM   2323 C  C   . GLU A 1 296 ? 11.749  120.711 137.534 1.00 51.23  ? 299 GLU A C   1 
ATOM   2324 O  O   . GLU A 1 296 ? 11.977  121.383 136.524 1.00 56.02  ? 299 GLU A O   1 
ATOM   2325 C  CB  . GLU A 1 296 ? 11.441  118.301 138.171 1.00 56.72  ? 299 GLU A CB  1 
ATOM   2326 C  CG  . GLU A 1 296 ? 12.062  117.043 138.794 1.00 60.94  ? 299 GLU A CG  1 
ATOM   2327 N  N   . PHE A 1 297 ? 10.875  121.086 138.470 1.00 54.21  ? 300 PHE A N   1 
ATOM   2328 C  CA  . PHE A 1 297 ? 10.274  122.416 138.472 1.00 42.28  ? 300 PHE A CA  1 
ATOM   2329 C  C   . PHE A 1 297 ? 11.345  123.502 138.464 1.00 41.34  ? 300 PHE A C   1 
ATOM   2330 O  O   . PHE A 1 297 ? 11.242  124.494 137.729 1.00 42.70  ? 300 PHE A O   1 
ATOM   2331 C  CB  . PHE A 1 297 ? 9.359   122.558 139.694 1.00 44.10  ? 300 PHE A CB  1 
ATOM   2332 C  CG  . PHE A 1 297 ? 8.347   123.655 139.570 1.00 42.88  ? 300 PHE A CG  1 
ATOM   2333 C  CD1 . PHE A 1 297 ? 8.707   124.976 139.810 1.00 36.83  ? 300 PHE A CD1 1 
ATOM   2334 C  CD2 . PHE A 1 297 ? 7.031   123.362 139.211 1.00 36.49  ? 300 PHE A CD2 1 
ATOM   2335 C  CE1 . PHE A 1 297 ? 7.782   125.983 139.697 1.00 35.18  ? 300 PHE A CE1 1 
ATOM   2336 C  CE2 . PHE A 1 297 ? 6.104   124.361 139.076 1.00 31.97  ? 300 PHE A CE2 1 
ATOM   2337 C  CZ  . PHE A 1 297 ? 6.478   125.681 139.322 1.00 38.05  ? 300 PHE A CZ  1 
ATOM   2338 N  N   . PHE A 1 298 ? 12.382  123.331 139.271 1.00 46.77  ? 301 PHE A N   1 
ATOM   2339 C  CA  . PHE A 1 298 ? 13.538  124.216 139.223 1.00 51.11  ? 301 PHE A CA  1 
ATOM   2340 C  C   . PHE A 1 298 ? 14.717  123.426 138.685 1.00 52.31  ? 301 PHE A C   1 
ATOM   2341 O  O   . PHE A 1 298 ? 15.235  122.553 139.398 1.00 52.62  ? 301 PHE A O   1 
ATOM   2342 C  CB  . PHE A 1 298 ? 13.862  124.775 140.606 1.00 44.65  ? 301 PHE A CB  1 
ATOM   2343 C  CG  . PHE A 1 298 ? 12.705  125.435 141.276 1.00 46.60  ? 301 PHE A CG  1 
ATOM   2344 C  CD1 . PHE A 1 298 ? 12.396  126.761 141.009 1.00 46.12  ? 301 PHE A CD1 1 
ATOM   2345 C  CD2 . PHE A 1 298 ? 11.916  124.732 142.171 1.00 44.81  ? 301 PHE A CD2 1 
ATOM   2346 C  CE1 . PHE A 1 298 ? 11.320  127.379 141.637 1.00 42.44  ? 301 PHE A CE1 1 
ATOM   2347 C  CE2 . PHE A 1 298 ? 10.840  125.342 142.798 1.00 45.28  ? 301 PHE A CE2 1 
ATOM   2348 C  CZ  . PHE A 1 298 ? 10.545  126.672 142.529 1.00 43.79  ? 301 PHE A CZ  1 
ATOM   2349 N  N   . PRO A 1 299 ? 15.169  123.677 137.451 1.00 48.85  ? 302 PRO A N   1 
ATOM   2350 C  CA  . PRO A 1 299 ? 16.265  122.852 136.895 1.00 55.05  ? 302 PRO A CA  1 
ATOM   2351 C  C   . PRO A 1 299 ? 17.506  122.829 137.777 1.00 52.99  ? 302 PRO A C   1 
ATOM   2352 O  O   . PRO A 1 299 ? 18.035  121.747 138.065 1.00 48.08  ? 302 PRO A O   1 
ATOM   2353 C  CB  . PRO A 1 299 ? 16.546  123.501 135.524 1.00 39.67  ? 302 PRO A CB  1 
ATOM   2354 C  CG  . PRO A 1 299 ? 15.344  124.343 135.219 1.00 47.01  ? 302 PRO A CG  1 
ATOM   2355 C  CD  . PRO A 1 299 ? 14.748  124.755 136.538 1.00 48.22  ? 302 PRO A CD  1 
ATOM   2356 N  N   . THR A 1 300 ? 17.993  123.999 138.202 1.00 46.66  ? 303 THR A N   1 
ATOM   2357 C  CA  . THR A 1 300 ? 19.117  124.067 139.130 1.00 53.00  ? 303 THR A CA  1 
ATOM   2358 C  C   . THR A 1 300 ? 18.789  124.930 140.346 1.00 53.83  ? 303 THR A C   1 
ATOM   2359 O  O   . THR A 1 300 ? 17.618  125.222 140.616 1.00 54.33  ? 303 THR A O   1 
ATOM   2360 C  CB  . THR A 1 300 ? 20.357  124.605 138.428 1.00 51.29  ? 303 THR A CB  1 
ATOM   2361 O  OG1 . THR A 1 300 ? 20.093  125.923 137.931 1.00 57.12  ? 303 THR A OG1 1 
ATOM   2362 C  CG2 . THR A 1 300 ? 20.721  123.713 137.276 1.00 55.71  ? 303 THR A CG2 1 
ATOM   2363 N  N   . SER A 1 301 ? 19.819  125.330 141.091 1.00 57.52  ? 304 SER A N   1 
ATOM   2364 C  CA  . SER A 1 301 ? 19.625  126.173 142.264 1.00 46.51  ? 304 SER A CA  1 
ATOM   2365 C  C   . SER A 1 301 ? 19.097  127.536 141.837 1.00 48.10  ? 304 SER A C   1 
ATOM   2366 O  O   . SER A 1 301 ? 19.395  128.018 140.745 1.00 50.22  ? 304 SER A O   1 
ATOM   2367 C  CB  . SER A 1 301 ? 20.942  126.341 143.018 1.00 43.57  ? 304 SER A CB  1 
ATOM   2368 O  OG  . SER A 1 301 ? 21.772  127.298 142.370 1.00 48.72  ? 304 SER A OG  1 
ATOM   2369 N  N   . LEU A 1 302 ? 18.282  128.149 142.699 1.00 48.81  ? 305 LEU A N   1 
ATOM   2370 C  CA  . LEU A 1 302 ? 17.682  129.435 142.348 1.00 45.29  ? 305 LEU A CA  1 
ATOM   2371 C  C   . LEU A 1 302 ? 18.751  130.470 142.033 1.00 47.78  ? 305 LEU A C   1 
ATOM   2372 O  O   . LEU A 1 302 ? 18.628  131.237 141.068 1.00 47.91  ? 305 LEU A O   1 
ATOM   2373 C  CB  . LEU A 1 302 ? 16.791  129.930 143.486 1.00 43.76  ? 305 LEU A CB  1 
ATOM   2374 C  CG  . LEU A 1 302 ? 15.564  129.100 143.840 1.00 40.67  ? 305 LEU A CG  1 
ATOM   2375 C  CD1 . LEU A 1 302 ? 14.710  129.859 144.837 1.00 40.39  ? 305 LEU A CD1 1 
ATOM   2376 C  CD2 . LEU A 1 302 ? 14.772  128.760 142.577 1.00 44.07  ? 305 LEU A CD2 1 
ATOM   2377 N  N   . GLU A 1 303 ? 19.823  130.484 142.823 1.00 47.48  ? 306 GLU A N   1 
ATOM   2378 C  CA  . GLU A 1 303 ? 20.867  131.483 142.636 1.00 50.57  ? 306 GLU A CA  1 
ATOM   2379 C  C   . GLU A 1 303 ? 21.597  131.300 141.305 1.00 49.71  ? 306 GLU A C   1 
ATOM   2380 O  O   . GLU A 1 303 ? 21.928  132.288 140.634 1.00 51.08  ? 306 GLU A O   1 
ATOM   2381 C  CB  . GLU A 1 303 ? 21.845  131.437 143.812 1.00 40.44  ? 306 GLU A CB  1 
ATOM   2382 C  CG  . GLU A 1 303 ? 22.962  132.455 143.736 1.00 41.74  ? 306 GLU A CG  1 
ATOM   2383 C  CD  . GLU A 1 303 ? 22.463  133.896 143.697 1.00 50.75  ? 306 GLU A CD  1 
ATOM   2384 O  OE1 . GLU A 1 303 ? 21.255  134.137 143.916 1.00 47.35  ? 306 GLU A OE1 1 
ATOM   2385 O  OE2 . GLU A 1 303 ? 23.289  134.800 143.439 1.00 55.79  ? 306 GLU A OE2 1 
ATOM   2386 N  N   . SER A 1 304 ? 21.873  130.052 140.909 1.00 45.94  ? 307 SER A N   1 
ATOM   2387 C  CA  . SER A 1 304 ? 22.537  129.843 139.624 1.00 49.00  ? 307 SER A CA  1 
ATOM   2388 C  C   . SER A 1 304 ? 21.617  130.216 138.465 1.00 46.73  ? 307 SER A C   1 
ATOM   2389 O  O   . SER A 1 304 ? 22.072  130.809 137.480 1.00 46.78  ? 307 SER A O   1 
ATOM   2390 C  CB  . SER A 1 304 ? 23.037  128.400 139.497 1.00 50.93  ? 307 SER A CB  1 
ATOM   2391 O  OG  . SER A 1 304 ? 21.993  127.449 139.609 1.00 55.93  ? 307 SER A OG  1 
ATOM   2392 N  N   . MET A 1 305 ? 20.315  129.917 138.579 1.00 42.50  ? 308 MET A N   1 
ATOM   2393 C  CA  . MET A 1 305 ? 19.358  130.366 137.565 1.00 47.12  ? 308 MET A CA  1 
ATOM   2394 C  C   . MET A 1 305 ? 19.335  131.887 137.456 1.00 44.80  ? 308 MET A C   1 
ATOM   2395 O  O   . MET A 1 305 ? 19.272  132.440 136.351 1.00 45.35  ? 308 MET A O   1 
ATOM   2396 C  CB  . MET A 1 305 ? 17.957  129.841 137.884 1.00 40.74  ? 308 MET A CB  1 
ATOM   2397 C  CG  . MET A 1 305 ? 17.869  128.331 137.956 1.00 39.66  ? 308 MET A CG  1 
ATOM   2398 S  SD  . MET A 1 305 ? 16.172  127.762 138.128 1.00 41.61  ? 308 MET A SD  1 
ATOM   2399 C  CE  . MET A 1 305 ? 15.497  128.194 136.500 1.00 41.83  ? 308 MET A CE  1 
ATOM   2400 N  N   . LEU A 1 306 ? 19.376  132.577 138.596 1.00 46.11  ? 309 LEU A N   1 
ATOM   2401 C  CA  . LEU A 1 306 ? 19.367  134.037 138.589 1.00 50.01  ? 309 LEU A CA  1 
ATOM   2402 C  C   . LEU A 1 306 ? 20.654  134.593 138.001 1.00 47.12  ? 309 LEU A C   1 
ATOM   2403 O  O   . LEU A 1 306 ? 20.632  135.598 137.279 1.00 49.14  ? 309 LEU A O   1 
ATOM   2404 C  CB  . LEU A 1 306 ? 19.153  134.569 140.011 1.00 48.69  ? 309 LEU A CB  1 
ATOM   2405 C  CG  . LEU A 1 306 ? 17.731  134.452 140.551 1.00 46.01  ? 309 LEU A CG  1 
ATOM   2406 C  CD1 . LEU A 1 306 ? 17.648  135.025 141.959 1.00 42.82  ? 309 LEU A CD1 1 
ATOM   2407 C  CD2 . LEU A 1 306 ? 16.786  135.182 139.617 1.00 41.33  ? 309 LEU A CD2 1 
ATOM   2408 N  N   . ASN A 1 307 ? 21.787  133.954 138.300 1.00 47.49  ? 310 ASN A N   1 
ATOM   2409 C  CA  . ASN A 1 307 ? 23.061  134.423 137.767 1.00 55.93  ? 310 ASN A CA  1 
ATOM   2410 C  C   . ASN A 1 307 ? 23.153  134.241 136.260 1.00 51.47  ? 310 ASN A C   1 
ATOM   2411 O  O   . ASN A 1 307 ? 23.626  135.138 135.556 1.00 55.43  ? 310 ASN A O   1 
ATOM   2412 C  CB  . ASN A 1 307 ? 24.212  133.703 138.451 1.00 56.48  ? 310 ASN A CB  1 
ATOM   2413 C  CG  . ASN A 1 307 ? 24.667  134.426 139.662 1.00 60.78  ? 310 ASN A CG  1 
ATOM   2414 O  OD1 . ASN A 1 307 ? 24.842  135.644 139.630 1.00 70.01  ? 310 ASN A OD1 1 
ATOM   2415 N  ND2 . ASN A 1 307 ? 24.828  133.703 140.761 1.00 69.34  ? 310 ASN A ND2 1 
ATOM   2416 N  N   . SER A 1 308 ? 22.716  133.094 135.745 1.00 48.30  ? 311 SER A N   1 
ATOM   2417 C  CA  . SER A 1 308 ? 22.944  132.766 134.344 1.00 48.29  ? 311 SER A CA  1 
ATOM   2418 C  C   . SER A 1 308 ? 21.868  133.308 133.412 1.00 47.59  ? 311 SER A C   1 
ATOM   2419 O  O   . SER A 1 308 ? 21.962  133.093 132.203 1.00 51.40  ? 311 SER A O   1 
ATOM   2420 C  CB  . SER A 1 308 ? 23.077  131.247 134.169 1.00 44.74  ? 311 SER A CB  1 
ATOM   2421 O  OG  . SER A 1 308 ? 21.931  130.549 134.624 1.00 46.60  ? 311 SER A OG  1 
ATOM   2422 N  N   . GLY A 1 309 ? 20.872  134.028 133.929 1.00 53.39  ? 312 GLY A N   1 
ATOM   2423 C  CA  . GLY A 1 309 ? 19.775  134.495 133.099 1.00 42.24  ? 312 GLY A CA  1 
ATOM   2424 C  C   . GLY A 1 309 ? 18.743  133.439 132.763 1.00 46.66  ? 312 GLY A C   1 
ATOM   2425 O  O   . GLY A 1 309 ? 17.933  133.640 131.852 1.00 45.97  ? 312 GLY A O   1 
ATOM   2426 N  N   . ASN A 1 310 ? 18.738  132.313 133.478 1.00 43.31  ? 313 ASN A N   1 
ATOM   2427 C  CA  . ASN A 1 310 ? 17.847  131.197 133.181 1.00 40.76  ? 313 ASN A CA  1 
ATOM   2428 C  C   . ASN A 1 310 ? 16.464  131.484 133.768 1.00 45.93  ? 313 ASN A C   1 
ATOM   2429 O  O   . ASN A 1 310 ? 16.083  130.970 134.822 1.00 48.06  ? 313 ASN A O   1 
ATOM   2430 C  CB  . ASN A 1 310 ? 18.444  129.912 133.733 1.00 38.45  ? 313 ASN A CB  1 
ATOM   2431 C  CG  . ASN A 1 310 ? 17.719  128.683 133.255 1.00 47.26  ? 313 ASN A CG  1 
ATOM   2432 O  OD1 . ASN A 1 310 ? 16.813  128.764 132.423 1.00 45.83  ? 313 ASN A OD1 1 
ATOM   2433 N  ND2 . ASN A 1 310 ? 18.124  127.528 133.760 1.00 48.42  ? 313 ASN A ND2 1 
ATOM   2434 N  N   . PHE A 1 311 ? 15.698  132.327 133.069 1.00 43.54  ? 314 PHE A N   1 
ATOM   2435 C  CA  . PHE A 1 311 ? 14.352  132.709 133.505 1.00 43.51  ? 314 PHE A CA  1 
ATOM   2436 C  C   . PHE A 1 311 ? 13.664  133.532 132.413 1.00 48.30  ? 314 PHE A C   1 
ATOM   2437 O  O   . PHE A 1 311 ? 14.325  134.166 131.584 1.00 48.56  ? 314 PHE A O   1 
ATOM   2438 C  CB  . PHE A 1 311 ? 14.378  133.490 134.839 1.00 39.91  ? 314 PHE A CB  1 
ATOM   2439 C  CG  . PHE A 1 311 ? 15.308  134.687 134.849 1.00 39.94  ? 314 PHE A CG  1 
ATOM   2440 C  CD1 . PHE A 1 311 ? 14.946  135.878 134.224 1.00 35.62  ? 314 PHE A CD1 1 
ATOM   2441 C  CD2 . PHE A 1 311 ? 16.536  134.626 135.510 1.00 40.46  ? 314 PHE A CD2 1 
ATOM   2442 C  CE1 . PHE A 1 311 ? 15.802  136.980 134.229 1.00 40.49  ? 314 PHE A CE1 1 
ATOM   2443 C  CE2 . PHE A 1 311 ? 17.398  135.730 135.533 1.00 41.91  ? 314 PHE A CE2 1 
ATOM   2444 C  CZ  . PHE A 1 311 ? 17.028  136.913 134.892 1.00 40.53  ? 314 PHE A CZ  1 
ATOM   2445 N  N   . LYS A 1 312 ? 12.328  133.515 132.427 1.00 44.40  ? 315 LYS A N   1 
ATOM   2446 C  CA  . LYS A 1 312 ? 11.548  134.289 131.466 1.00 43.08  ? 315 LYS A CA  1 
ATOM   2447 C  C   . LYS A 1 312 ? 11.902  135.771 131.535 1.00 44.06  ? 315 LYS A C   1 
ATOM   2448 O  O   . LYS A 1 312 ? 11.903  136.376 132.610 1.00 42.32  ? 315 LYS A O   1 
ATOM   2449 C  CB  . LYS A 1 312 ? 10.056  134.097 131.729 1.00 38.11  ? 315 LYS A CB  1 
ATOM   2450 C  CG  . LYS A 1 312 ? 9.154   135.016 130.907 1.00 38.67  ? 315 LYS A CG  1 
ATOM   2451 C  CD  . LYS A 1 312 ? 7.717   134.854 131.368 1.00 39.44  ? 315 LYS A CD  1 
ATOM   2452 C  CE  . LYS A 1 312 ? 6.732   135.543 130.470 1.00 40.90  ? 315 LYS A CE  1 
ATOM   2453 N  NZ  . LYS A 1 312 ? 6.561   134.820 129.162 1.00 35.74  ? 315 LYS A NZ  1 
ATOM   2454 N  N   . LYS A 1 313 ? 12.188  136.364 130.379 1.00 45.91  ? 316 LYS A N   1 
ATOM   2455 C  CA  . LYS A 1 313 ? 12.644  137.750 130.309 1.00 42.97  ? 316 LYS A CA  1 
ATOM   2456 C  C   . LYS A 1 313 ? 11.474  138.600 129.832 1.00 40.96  ? 316 LYS A C   1 
ATOM   2457 O  O   . LYS A 1 313 ? 11.118  138.579 128.657 1.00 49.97  ? 316 LYS A O   1 
ATOM   2458 C  CB  . LYS A 1 313 ? 13.868  137.860 129.401 1.00 47.84  ? 316 LYS A CB  1 
ATOM   2459 C  CG  . LYS A 1 313 ? 15.072  137.091 129.973 1.00 47.01  ? 316 LYS A CG  1 
ATOM   2460 C  CD  . LYS A 1 313 ? 16.131  136.791 128.928 1.00 55.72  ? 316 LYS A CD  1 
ATOM   2461 C  CE  . LYS A 1 313 ? 17.167  135.780 129.452 1.00 60.22  ? 316 LYS A CE  1 
ATOM   2462 N  NZ  . LYS A 1 313 ? 16.710  134.343 129.414 1.00 59.27  ? 316 LYS A NZ  1 
ATOM   2463 N  N   . THR A 1 314 ? 10.871  139.339 130.754 1.00 44.35  ? 317 THR A N   1 
ATOM   2464 C  CA  . THR A 1 314 ? 9.704   140.161 130.454 1.00 37.38  ? 317 THR A CA  1 
ATOM   2465 C  C   . THR A 1 314 ? 9.794   141.415 131.327 1.00 38.86  ? 317 THR A C   1 
ATOM   2466 O  O   . THR A 1 314 ? 10.868  141.743 131.842 1.00 36.40  ? 317 THR A O   1 
ATOM   2467 C  CB  . THR A 1 314 ? 8.422   139.334 130.650 1.00 34.18  ? 317 THR A CB  1 
ATOM   2468 O  OG1 . THR A 1 314 ? 7.286   140.111 130.264 1.00 44.58  ? 317 THR A OG1 1 
ATOM   2469 C  CG2 . THR A 1 314 ? 8.259   138.892 132.122 1.00 44.87  ? 317 THR A CG2 1 
ATOM   2470 N  N   . GLN A 1 315 ? 8.687   142.148 131.461 1.00 37.45  ? 318 GLN A N   1 
ATOM   2471 C  CA  . GLN A 1 315 ? 8.616   143.257 132.410 1.00 40.28  ? 318 GLN A CA  1 
ATOM   2472 C  C   . GLN A 1 315 ? 8.135   142.739 133.760 1.00 41.26  ? 318 GLN A C   1 
ATOM   2473 O  O   . GLN A 1 315 ? 7.298   141.829 133.826 1.00 39.77  ? 318 GLN A O   1 
ATOM   2474 C  CB  . GLN A 1 315 ? 7.674   144.365 131.929 1.00 39.96  ? 318 GLN A CB  1 
ATOM   2475 C  CG  . GLN A 1 315 ? 7.944   144.896 130.522 1.00 46.02  ? 318 GLN A CG  1 
ATOM   2476 C  CD  . GLN A 1 315 ? 7.422   143.966 129.448 1.00 45.53  ? 318 GLN A CD  1 
ATOM   2477 O  OE1 . GLN A 1 315 ? 6.282   143.500 129.513 1.00 43.39  ? 318 GLN A OE1 1 
ATOM   2478 N  NE2 . GLN A 1 315 ? 8.262   143.672 128.461 1.00 50.50  ? 318 GLN A NE2 1 
ATOM   2479 N  N   . ILE A 1 316 ? 8.676   143.315 134.837 1.00 43.39  ? 319 ILE A N   1 
ATOM   2480 C  CA  . ILE A 1 316 ? 8.233   143.008 136.196 1.00 43.87  ? 319 ILE A CA  1 
ATOM   2481 C  C   . ILE A 1 316 ? 8.012   144.292 136.983 1.00 45.25  ? 319 ILE A C   1 
ATOM   2482 O  O   . ILE A 1 316 ? 8.742   145.282 136.836 1.00 40.81  ? 319 ILE A O   1 
ATOM   2483 C  CB  . ILE A 1 316 ? 9.211   142.100 136.972 1.00 42.85  ? 319 ILE A CB  1 
ATOM   2484 C  CG1 . ILE A 1 316 ? 10.601  142.736 137.048 1.00 40.03  ? 319 ILE A CG1 1 
ATOM   2485 C  CG2 . ILE A 1 316 ? 9.202   140.677 136.407 1.00 39.10  ? 319 ILE A CG2 1 
ATOM   2486 C  CD1 . ILE A 1 316 ? 11.434  142.202 138.200 1.00 45.56  ? 319 ILE A CD1 1 
ATOM   2487 N  N   . LEU A 1 317 ? 7.007   144.246 137.857 1.00 43.15  ? 320 LEU A N   1 
ATOM   2488 C  CA  . LEU A 1 317 ? 6.679   145.334 138.768 1.00 43.92  ? 320 LEU A CA  1 
ATOM   2489 C  C   . LEU A 1 317 ? 6.577   144.766 140.184 1.00 42.68  ? 320 LEU A C   1 
ATOM   2490 O  O   . LEU A 1 317 ? 5.741   143.893 140.447 1.00 42.58  ? 320 LEU A O   1 
ATOM   2491 C  CB  . LEU A 1 317 ? 5.374   146.006 138.328 1.00 37.74  ? 320 LEU A CB  1 
ATOM   2492 C  CG  . LEU A 1 317 ? 4.904   147.246 139.092 1.00 47.03  ? 320 LEU A CG  1 
ATOM   2493 C  CD1 . LEU A 1 317 ? 3.996   148.052 138.182 1.00 41.19  ? 320 LEU A CD1 1 
ATOM   2494 C  CD2 . LEU A 1 317 ? 4.179   146.897 140.408 1.00 39.10  ? 320 LEU A CD2 1 
ATOM   2495 N  N   . LEU A 1 318 ? 7.413   145.253 141.096 1.00 40.84  ? 321 LEU A N   1 
ATOM   2496 C  CA  . LEU A 1 318 ? 7.487   144.635 142.414 1.00 39.99  ? 321 LEU A CA  1 
ATOM   2497 C  C   . LEU A 1 318 ? 7.899   145.652 143.472 1.00 44.79  ? 321 LEU A C   1 
ATOM   2498 O  O   . LEU A 1 318 ? 8.340   146.765 143.159 1.00 41.93  ? 321 LEU A O   1 
ATOM   2499 C  CB  . LEU A 1 318 ? 8.437   143.430 142.420 1.00 35.91  ? 321 LEU A CB  1 
ATOM   2500 C  CG  . LEU A 1 318 ? 9.788   143.369 141.717 1.00 41.49  ? 321 LEU A CG  1 
ATOM   2501 C  CD1 . LEU A 1 318 ? 10.479  144.710 141.573 1.00 47.51  ? 321 LEU A CD1 1 
ATOM   2502 C  CD2 . LEU A 1 318 ? 10.677  142.366 142.424 1.00 34.92  ? 321 LEU A CD2 1 
ATOM   2503 N  N   . GLY A 1 319 ? 7.745   145.255 144.738 1.00 36.70  ? 322 GLY A N   1 
ATOM   2504 C  CA  . GLY A 1 319 ? 8.041   146.159 145.839 1.00 36.93  ? 322 GLY A CA  1 
ATOM   2505 C  C   . GLY A 1 319 ? 7.775   145.524 147.188 1.00 42.55  ? 322 GLY A C   1 
ATOM   2506 O  O   . GLY A 1 319 ? 7.406   144.349 147.296 1.00 42.81  ? 322 GLY A O   1 
ATOM   2507 N  N   . VAL A 1 320 ? 7.972   146.333 148.232 1.00 43.32  ? 323 VAL A N   1 
ATOM   2508 C  CA  . VAL A 1 320 ? 7.830   145.907 149.622 1.00 43.50  ? 323 VAL A CA  1 
ATOM   2509 C  C   . VAL A 1 320 ? 7.071   146.977 150.395 1.00 40.43  ? 323 VAL A C   1 
ATOM   2510 O  O   . VAL A 1 320 ? 6.897   148.107 149.934 1.00 43.16  ? 323 VAL A O   1 
ATOM   2511 C  CB  . VAL A 1 320 ? 9.192   145.652 150.305 1.00 41.99  ? 323 VAL A CB  1 
ATOM   2512 C  CG1 . VAL A 1 320 ? 9.936   144.513 149.618 1.00 38.26  ? 323 VAL A CG1 1 
ATOM   2513 C  CG2 . VAL A 1 320 ? 10.019  146.934 150.311 1.00 35.97  ? 323 VAL A CG2 1 
ATOM   2514 N  N   . ASN A 1 321 ? 6.630   146.601 151.594 1.00 45.36  ? 324 ASN A N   1 
ATOM   2515 C  CA  . ASN A 1 321 ? 6.097   147.526 152.588 1.00 41.03  ? 324 ASN A CA  1 
ATOM   2516 C  C   . ASN A 1 321 ? 7.173   147.871 153.607 1.00 40.39  ? 324 ASN A C   1 
ATOM   2517 O  O   . ASN A 1 321 ? 8.118   147.112 153.836 1.00 42.54  ? 324 ASN A O   1 
ATOM   2518 C  CB  . ASN A 1 321 ? 4.880   146.935 153.306 1.00 44.28  ? 324 ASN A CB  1 
ATOM   2519 C  CG  . ASN A 1 321 ? 3.716   146.660 152.367 1.00 46.11  ? 324 ASN A CG  1 
ATOM   2520 O  OD1 . ASN A 1 321 ? 3.818   146.842 151.150 1.00 47.85  ? 324 ASN A OD1 1 
ATOM   2521 N  ND2 . ASN A 1 321 ? 2.602   146.212 152.929 1.00 44.26  ? 324 ASN A ND2 1 
ATOM   2522 N  N   . LYS A 1 322 ? 7.001   149.028 154.246 1.00 47.71  ? 325 LYS A N   1 
ATOM   2523 C  CA  . LYS A 1 322 ? 8.051   149.549 155.116 1.00 40.22  ? 325 LYS A CA  1 
ATOM   2524 C  C   . LYS A 1 322 ? 8.412   148.573 156.239 1.00 44.20  ? 325 LYS A C   1 
ATOM   2525 O  O   . LYS A 1 322 ? 9.590   148.448 156.597 1.00 43.95  ? 325 LYS A O   1 
ATOM   2526 C  CB  . LYS A 1 322 ? 7.627   150.904 155.680 1.00 45.02  ? 325 LYS A CB  1 
ATOM   2527 C  CG  . LYS A 1 322 ? 8.622   151.508 156.673 1.00 47.96  ? 325 LYS A CG  1 
ATOM   2528 C  CD  . LYS A 1 322 ? 8.179   152.882 157.134 1.00 45.15  ? 325 LYS A CD  1 
ATOM   2529 C  CE  . LYS A 1 322 ? 9.207   153.486 158.055 1.00 51.93  ? 325 LYS A CE  1 
ATOM   2530 N  NZ  . LYS A 1 322 ? 9.453   152.602 159.237 1.00 60.18  ? 325 LYS A NZ  1 
ATOM   2531 N  N   . ASP A 1 323 ? 7.428   147.851 156.801 1.00 39.07  ? 326 ASP A N   1 
ATOM   2532 C  CA  . ASP A 1 323 ? 7.673   147.055 158.018 1.00 49.00  ? 326 ASP A CA  1 
ATOM   2533 C  C   . ASP A 1 323 ? 7.264   145.601 157.786 1.00 46.10  ? 326 ASP A C   1 
ATOM   2534 O  O   . ASP A 1 323 ? 6.170   145.176 158.165 1.00 50.42  ? 326 ASP A O   1 
ATOM   2535 C  CB  . ASP A 1 323 ? 6.951   147.688 159.235 1.00 39.78  ? 326 ASP A CB  1 
ATOM   2536 C  CG  . ASP A 1 323 ? 7.369   149.144 159.457 1.00 45.38  ? 326 ASP A CG  1 
ATOM   2537 O  OD1 . ASP A 1 323 ? 8.565   149.381 159.739 1.00 44.22  ? 326 ASP A OD1 1 
ATOM   2538 O  OD2 . ASP A 1 323 ? 6.519   150.054 159.298 1.00 42.31  ? 326 ASP A OD2 1 
ATOM   2539 N  N   . GLU A 1 324 ? 8.180   144.830 157.201 1.00 45.91  ? 327 GLU A N   1 
ATOM   2540 C  CA  . GLU A 1 324 ? 7.912   143.461 156.775 1.00 44.73  ? 327 GLU A CA  1 
ATOM   2541 C  C   . GLU A 1 324 ? 8.119   142.432 157.875 1.00 48.23  ? 327 GLU A C   1 
ATOM   2542 O  O   . GLU A 1 324 ? 7.684   141.291 157.715 1.00 51.44  ? 327 GLU A O   1 
ATOM   2543 C  CB  . GLU A 1 324 ? 8.798   143.092 155.570 1.00 45.29  ? 327 GLU A CB  1 
ATOM   2544 C  CG  . GLU A 1 324 ? 8.497   143.874 154.297 1.00 37.47  ? 327 GLU A CG  1 
ATOM   2545 C  CD  . GLU A 1 324 ? 7.227   143.399 153.569 1.00 44.72  ? 327 GLU A CD  1 
ATOM   2546 O  OE1 . GLU A 1 324 ? 6.782   144.095 152.624 1.00 44.39  ? 327 GLU A OE1 1 
ATOM   2547 O  OE2 . GLU A 1 324 ? 6.665   142.338 153.930 1.00 46.49  ? 327 GLU A OE2 1 
ATOM   2548 N  N   . GLY A 1 325 ? 8.754   142.791 158.984 1.00 46.20  ? 328 GLY A N   1 
ATOM   2549 C  CA  . GLY A 1 325 ? 9.024   141.819 160.023 1.00 48.23  ? 328 GLY A CA  1 
ATOM   2550 C  C   . GLY A 1 325 ? 8.013   141.719 161.148 1.00 43.11  ? 328 GLY A C   1 
ATOM   2551 O  O   . GLY A 1 325 ? 8.140   140.818 161.983 1.00 42.36  ? 328 GLY A O   1 
ATOM   2552 N  N   . SER A 1 326 ? 6.991   142.584 161.167 1.00 40.50  ? 329 SER A N   1 
ATOM   2553 C  CA  . SER A 1 326 ? 6.184   142.796 162.367 1.00 38.80  ? 329 SER A CA  1 
ATOM   2554 C  C   . SER A 1 326 ? 5.388   141.553 162.756 1.00 44.58  ? 329 SER A C   1 
ATOM   2555 O  O   . SER A 1 326 ? 5.290   141.219 163.947 1.00 37.58  ? 329 SER A O   1 
ATOM   2556 C  CB  . SER A 1 326 ? 5.251   143.984 162.151 1.00 40.23  ? 329 SER A CB  1 
ATOM   2557 O  OG  . SER A 1 326 ? 6.002   145.171 161.973 1.00 42.73  ? 329 SER A OG  1 
ATOM   2558 N  N   . PHE A 1 327 ? 4.805   140.860 161.780 1.00 36.06  ? 330 PHE A N   1 
ATOM   2559 C  CA  . PHE A 1 327 ? 3.995   139.699 162.121 1.00 38.44  ? 330 PHE A CA  1 
ATOM   2560 C  C   . PHE A 1 327 ? 4.864   138.559 162.642 1.00 38.62  ? 330 PHE A C   1 
ATOM   2561 O  O   . PHE A 1 327 ? 4.464   137.847 163.570 1.00 40.38  ? 330 PHE A O   1 
ATOM   2562 C  CB  . PHE A 1 327 ? 3.162   139.262 160.908 1.00 39.11  ? 330 PHE A CB  1 
ATOM   2563 C  CG  . PHE A 1 327 ? 1.845   139.989 160.776 1.00 40.81  ? 330 PHE A CG  1 
ATOM   2564 C  CD1 . PHE A 1 327 ? 0.960   140.053 161.844 1.00 45.40  ? 330 PHE A CD1 1 
ATOM   2565 C  CD2 . PHE A 1 327 ? 1.490   140.599 159.586 1.00 45.72  ? 330 PHE A CD2 1 
ATOM   2566 C  CE1 . PHE A 1 327 ? -0.249  140.724 161.729 1.00 46.47  ? 330 PHE A CE1 1 
ATOM   2567 C  CE2 . PHE A 1 327 ? 0.279   141.259 159.452 1.00 40.50  ? 330 PHE A CE2 1 
ATOM   2568 C  CZ  . PHE A 1 327 ? -0.591  141.329 160.521 1.00 48.31  ? 330 PHE A CZ  1 
ATOM   2569 N  N   . PHE A 1 328 ? 6.057   138.377 162.064 1.00 31.64  ? 331 PHE A N   1 
ATOM   2570 C  CA  . PHE A 1 328 ? 6.992   137.368 162.559 1.00 38.66  ? 331 PHE A CA  1 
ATOM   2571 C  C   . PHE A 1 328 ? 7.261   137.558 164.052 1.00 44.82  ? 331 PHE A C   1 
ATOM   2572 O  O   . PHE A 1 328 ? 7.277   136.595 164.829 1.00 40.34  ? 331 PHE A O   1 
ATOM   2573 C  CB  . PHE A 1 328 ? 8.321   137.450 161.801 1.00 41.95  ? 331 PHE A CB  1 
ATOM   2574 C  CG  . PHE A 1 328 ? 8.363   136.708 160.477 1.00 43.78  ? 331 PHE A CG  1 
ATOM   2575 C  CD1 . PHE A 1 328 ? 8.257   135.324 160.425 1.00 42.10  ? 331 PHE A CD1 1 
ATOM   2576 C  CD2 . PHE A 1 328 ? 8.589   137.401 159.293 1.00 40.12  ? 331 PHE A CD2 1 
ATOM   2577 C  CE1 . PHE A 1 328 ? 8.351   134.648 159.205 1.00 49.83  ? 331 PHE A CE1 1 
ATOM   2578 C  CE2 . PHE A 1 328 ? 8.681   136.735 158.075 1.00 41.05  ? 331 PHE A CE2 1 
ATOM   2579 C  CZ  . PHE A 1 328 ? 8.561   135.359 158.030 1.00 42.04  ? 331 PHE A CZ  1 
ATOM   2580 N  N   . LEU A 1 329 ? 7.502   138.806 164.461 1.00 40.46  ? 332 LEU A N   1 
ATOM   2581 C  CA  . LEU A 1 329 ? 7.891   139.077 165.839 1.00 44.04  ? 332 LEU A CA  1 
ATOM   2582 C  C   . LEU A 1 329 ? 6.697   138.942 166.774 1.00 42.39  ? 332 LEU A C   1 
ATOM   2583 O  O   . LEU A 1 329 ? 6.784   138.273 167.813 1.00 41.16  ? 332 LEU A O   1 
ATOM   2584 C  CB  . LEU A 1 329 ? 8.516   140.468 165.937 1.00 37.40  ? 332 LEU A CB  1 
ATOM   2585 C  CG  . LEU A 1 329 ? 9.877   140.582 165.265 1.00 39.72  ? 332 LEU A CG  1 
ATOM   2586 C  CD1 . LEU A 1 329 ? 10.306  142.026 165.174 1.00 41.94  ? 332 LEU A CD1 1 
ATOM   2587 C  CD2 . LEU A 1 329 ? 10.909  139.759 166.010 1.00 32.52  ? 332 LEU A CD2 1 
ATOM   2588 N  N   . LEU A 1 330 ? 5.570   139.559 166.404 1.00 39.85  ? 333 LEU A N   1 
ATOM   2589 C  CA  . LEU A 1 330 ? 4.349   139.442 167.189 1.00 40.76  ? 333 LEU A CA  1 
ATOM   2590 C  C   . LEU A 1 330 ? 3.980   137.986 167.449 1.00 43.03  ? 333 LEU A C   1 
ATOM   2591 O  O   . LEU A 1 330 ? 3.640   137.617 168.577 1.00 38.26  ? 333 LEU A O   1 
ATOM   2592 C  CB  . LEU A 1 330 ? 3.200   140.161 166.486 1.00 32.81  ? 333 LEU A CB  1 
ATOM   2593 C  CG  . LEU A 1 330 ? 1.837   139.880 167.122 1.00 39.58  ? 333 LEU A CG  1 
ATOM   2594 C  CD1 . LEU A 1 330 ? 1.798   140.419 168.567 1.00 39.70  ? 333 LEU A CD1 1 
ATOM   2595 C  CD2 . LEU A 1 330 ? 0.691   140.443 166.299 1.00 34.66  ? 333 LEU A CD2 1 
ATOM   2596 N  N   . TYR A 1 331 ? 4.032   137.136 166.416 1.00 40.12  ? 334 TYR A N   1 
ATOM   2597 C  CA  . TYR A 1 331 ? 3.520   135.781 166.608 1.00 41.99  ? 334 TYR A CA  1 
ATOM   2598 C  C   . TYR A 1 331 ? 4.554   134.850 167.226 1.00 46.52  ? 334 TYR A C   1 
ATOM   2599 O  O   . TYR A 1 331 ? 4.181   133.888 167.914 1.00 47.20  ? 334 TYR A O   1 
ATOM   2600 C  CB  . TYR A 1 331 ? 3.002   135.202 165.289 1.00 41.08  ? 334 TYR A CB  1 
ATOM   2601 C  CG  . TYR A 1 331 ? 1.570   135.595 164.987 1.00 40.39  ? 334 TYR A CG  1 
ATOM   2602 C  CD1 . TYR A 1 331 ? 1.264   136.879 164.546 1.00 41.11  ? 334 TYR A CD1 1 
ATOM   2603 C  CD2 . TYR A 1 331 ? 0.526   134.691 165.148 1.00 34.82  ? 334 TYR A CD2 1 
ATOM   2604 C  CE1 . TYR A 1 331 ? -0.034  137.254 164.278 1.00 36.90  ? 334 TYR A CE1 1 
ATOM   2605 C  CE2 . TYR A 1 331 ? -0.783  135.058 164.869 1.00 35.57  ? 334 TYR A CE2 1 
ATOM   2606 C  CZ  . TYR A 1 331 ? -1.048  136.343 164.433 1.00 39.25  ? 334 TYR A CZ  1 
ATOM   2607 O  OH  . TYR A 1 331 ? -2.330  136.733 164.151 1.00 40.42  ? 334 TYR A OH  1 
ATOM   2608 N  N   . GLY A 1 332 ? 5.840   135.136 167.045 1.00 41.11  ? 335 GLY A N   1 
ATOM   2609 C  CA  . GLY A 1 332 ? 6.862   134.193 167.454 1.00 46.93  ? 335 GLY A CA  1 
ATOM   2610 C  C   . GLY A 1 332 ? 7.963   134.645 168.401 1.00 50.70  ? 335 GLY A C   1 
ATOM   2611 O  O   . GLY A 1 332 ? 8.641   133.793 168.982 1.00 53.52  ? 335 GLY A O   1 
ATOM   2612 N  N   . ALA A 1 333 ? 8.184   135.950 168.566 1.00 45.02  ? 336 ALA A N   1 
ATOM   2613 C  CA  . ALA A 1 333 ? 9.302   136.406 169.381 1.00 49.08  ? 336 ALA A CA  1 
ATOM   2614 C  C   . ALA A 1 333 ? 8.824   136.808 170.775 1.00 52.88  ? 336 ALA A C   1 
ATOM   2615 O  O   . ALA A 1 333 ? 7.959   137.695 170.902 1.00 51.39  ? 336 ALA A O   1 
ATOM   2616 C  CB  . ALA A 1 333 ? 10.014  137.569 168.703 1.00 42.24  ? 336 ALA A CB  1 
ATOM   2617 N  N   . PRO A 1 334 ? 9.330   136.185 171.837 1.00 50.12  ? 337 PRO A N   1 
ATOM   2618 C  CA  . PRO A 1 334 ? 8.898   136.572 173.188 1.00 54.72  ? 337 PRO A CA  1 
ATOM   2619 C  C   . PRO A 1 334 ? 9.237   138.030 173.501 1.00 53.58  ? 337 PRO A C   1 
ATOM   2620 O  O   . PRO A 1 334 ? 10.331  138.524 173.202 1.00 47.77  ? 337 PRO A O   1 
ATOM   2621 C  CB  . PRO A 1 334 ? 9.647   135.591 174.108 1.00 48.18  ? 337 PRO A CB  1 
ATOM   2622 C  CG  . PRO A 1 334 ? 10.654  134.889 173.244 1.00 60.17  ? 337 PRO A CG  1 
ATOM   2623 C  CD  . PRO A 1 334 ? 10.147  134.960 171.833 1.00 53.08  ? 337 PRO A CD  1 
ATOM   2624 N  N   . GLY A 1 335 ? 8.264   138.725 174.091 1.00 43.61  ? 338 GLY A N   1 
ATOM   2625 C  CA  . GLY A 1 335 ? 8.387   140.135 174.376 1.00 40.78  ? 338 GLY A CA  1 
ATOM   2626 C  C   . GLY A 1 335 ? 7.525   141.031 173.524 1.00 50.54  ? 338 GLY A C   1 
ATOM   2627 O  O   . GLY A 1 335 ? 7.438   142.227 173.817 1.00 53.88  ? 338 GLY A O   1 
ATOM   2628 N  N   . PHE A 1 336 ? 6.894   140.506 172.478 1.00 48.10  ? 339 PHE A N   1 
ATOM   2629 C  CA  . PHE A 1 336 ? 6.004   141.272 171.624 1.00 42.89  ? 339 PHE A CA  1 
ATOM   2630 C  C   . PHE A 1 336 ? 4.573   140.841 171.883 1.00 40.23  ? 339 PHE A C   1 
ATOM   2631 O  O   . PHE A 1 336 ? 4.285   139.642 171.940 1.00 48.30  ? 339 PHE A O   1 
ATOM   2632 C  CB  . PHE A 1 336 ? 6.339   141.060 170.136 1.00 43.40  ? 339 PHE A CB  1 
ATOM   2633 C  CG  . PHE A 1 336 ? 7.674   141.597 169.737 1.00 39.74  ? 339 PHE A CG  1 
ATOM   2634 C  CD1 . PHE A 1 336 ? 8.828   140.873 169.986 1.00 35.36  ? 339 PHE A CD1 1 
ATOM   2635 C  CD2 . PHE A 1 336 ? 7.777   142.831 169.102 1.00 42.20  ? 339 PHE A CD2 1 
ATOM   2636 C  CE1 . PHE A 1 336 ? 10.070  141.369 169.614 1.00 38.71  ? 339 PHE A CE1 1 
ATOM   2637 C  CE2 . PHE A 1 336 ? 9.022   143.336 168.726 1.00 38.18  ? 339 PHE A CE2 1 
ATOM   2638 C  CZ  . PHE A 1 336 ? 10.169  142.602 168.984 1.00 39.52  ? 339 PHE A CZ  1 
ATOM   2639 N  N   . SER A 1 337 ? 3.671   141.811 171.998 1.00 36.45  ? 340 SER A N   1 
ATOM   2640 C  CA  . SER A 1 337 ? 2.264   141.506 172.223 1.00 35.84  ? 340 SER A CA  1 
ATOM   2641 C  C   . SER A 1 337 ? 1.410   142.457 171.404 1.00 39.88  ? 340 SER A C   1 
ATOM   2642 O  O   . SER A 1 337 ? 1.828   143.570 171.071 1.00 41.32  ? 340 SER A O   1 
ATOM   2643 C  CB  . SER A 1 337 ? 1.865   141.604 173.715 1.00 44.07  ? 340 SER A CB  1 
ATOM   2644 O  OG  . SER A 1 337 ? 2.967   141.922 174.558 1.00 45.70  ? 340 SER A OG  1 
ATOM   2645 N  N   . LYS A 1 338 ? 0.198   142.011 171.087 1.00 38.77  ? 341 LYS A N   1 
ATOM   2646 C  CA  . LYS A 1 338 ? -0.673  142.850 170.281 1.00 44.82  ? 341 LYS A CA  1 
ATOM   2647 C  C   . LYS A 1 338 ? -1.037  144.133 171.013 1.00 44.83  ? 341 LYS A C   1 
ATOM   2648 O  O   . LYS A 1 338 ? -1.179  145.191 170.384 1.00 42.10  ? 341 LYS A O   1 
ATOM   2649 C  CB  . LYS A 1 338 ? -1.933  142.071 169.885 1.00 45.66  ? 341 LYS A CB  1 
ATOM   2650 C  CG  . LYS A 1 338 ? -2.862  142.839 168.957 1.00 40.53  ? 341 LYS A CG  1 
ATOM   2651 C  CD  . LYS A 1 338 ? -3.933  141.943 168.357 1.00 42.18  ? 341 LYS A CD  1 
ATOM   2652 C  CE  . LYS A 1 338 ? -5.109  141.750 169.281 1.00 38.17  ? 341 LYS A CE  1 
ATOM   2653 N  NZ  . LYS A 1 338 ? -5.504  143.043 169.892 1.00 46.63  ? 341 LYS A NZ  1 
ATOM   2654 N  N   . ASP A 1 339 ? -1.149  144.071 172.343 1.00 45.23  ? 342 ASP A N   1 
ATOM   2655 C  CA  . ASP A 1 339 ? -1.762  145.139 173.116 1.00 38.98  ? 342 ASP A CA  1 
ATOM   2656 C  C   . ASP A 1 339 ? -0.775  145.975 173.919 1.00 44.56  ? 342 ASP A C   1 
ATOM   2657 O  O   . ASP A 1 339 ? -1.197  146.930 174.577 1.00 46.80  ? 342 ASP A O   1 
ATOM   2658 C  CB  . ASP A 1 339 ? -2.831  144.547 174.027 1.00 37.42  ? 342 ASP A CB  1 
ATOM   2659 C  CG  . ASP A 1 339 ? -3.962  143.924 173.244 1.00 44.04  ? 342 ASP A CG  1 
ATOM   2660 O  OD1 . ASP A 1 339 ? -4.017  144.145 172.002 1.00 44.90  ? 342 ASP A OD1 1 
ATOM   2661 O  OD2 . ASP A 1 339 ? -4.789  143.210 173.853 1.00 42.03  ? 342 ASP A OD2 1 
ATOM   2662 N  N   . SER A 1 340 ? 0.515   145.663 173.882 1.00 46.17  ? 343 SER A N   1 
ATOM   2663 C  CA  . SER A 1 340 ? 1.526   146.562 174.417 1.00 40.96  ? 343 SER A CA  1 
ATOM   2664 C  C   . SER A 1 340 ? 2.251   147.266 173.277 1.00 48.67  ? 343 SER A C   1 
ATOM   2665 O  O   . SER A 1 340 ? 2.132   146.903 172.104 1.00 47.64  ? 343 SER A O   1 
ATOM   2666 C  CB  . SER A 1 340 ? 2.532   145.809 175.295 1.00 40.65  ? 343 SER A CB  1 
ATOM   2667 O  OG  . SER A 1 340 ? 3.308   144.896 174.532 1.00 50.77  ? 343 SER A OG  1 
ATOM   2668 N  N   . GLU A 1 341 ? 3.021   148.291 173.640 1.00 54.68  ? 344 GLU A N   1 
ATOM   2669 C  CA  . GLU A 1 341 ? 3.933   148.915 172.692 1.00 52.80  ? 344 GLU A CA  1 
ATOM   2670 C  C   . GLU A 1 341 ? 5.135   148.031 172.377 1.00 50.06  ? 344 GLU A C   1 
ATOM   2671 O  O   . GLU A 1 341 ? 5.915   148.366 171.479 1.00 52.80  ? 344 GLU A O   1 
ATOM   2672 C  CB  . GLU A 1 341 ? 4.404   150.268 173.232 1.00 52.83  ? 344 GLU A CB  1 
ATOM   2673 C  CG  . GLU A 1 341 ? 3.453   151.424 172.949 1.00 55.83  ? 344 GLU A CG  1 
ATOM   2674 C  CD  . GLU A 1 341 ? 3.985   152.764 173.460 1.00 77.36  ? 344 GLU A CD  1 
ATOM   2675 O  OE1 . GLU A 1 341 ? 5.220   152.920 173.600 1.00 75.01  ? 344 GLU A OE1 1 
ATOM   2676 O  OE2 . GLU A 1 341 ? 3.166   153.669 173.729 1.00 84.20  ? 344 GLU A OE2 1 
ATOM   2677 N  N   . SER A 1 342 ? 5.307   146.931 173.103 1.00 45.07  ? 345 SER A N   1 
ATOM   2678 C  CA  . SER A 1 342 ? 6.344   145.944 172.819 1.00 49.44  ? 345 SER A CA  1 
ATOM   2679 C  C   . SER A 1 342 ? 7.737   146.575 172.802 1.00 54.09  ? 345 SER A C   1 
ATOM   2680 O  O   . SER A 1 342 ? 8.516   146.396 171.862 1.00 51.11  ? 345 SER A O   1 
ATOM   2681 C  CB  . SER A 1 342 ? 6.049   145.211 171.508 1.00 45.49  ? 345 SER A CB  1 
ATOM   2682 O  OG  . SER A 1 342 ? 4.901   144.388 171.653 1.00 49.69  ? 345 SER A OG  1 
ATOM   2683 N  N   . LYS A 1 343 ? 8.056   147.316 173.864 1.00 54.44  ? 346 LYS A N   1 
ATOM   2684 C  CA  . LYS A 1 343 ? 9.404   147.833 174.028 1.00 45.68  ? 346 LYS A CA  1 
ATOM   2685 C  C   . LYS A 1 343 ? 10.323  146.709 174.478 1.00 46.07  ? 346 LYS A C   1 
ATOM   2686 O  O   . LYS A 1 343 ? 9.924   145.828 175.241 1.00 52.01  ? 346 LYS A O   1 
ATOM   2687 C  CB  . LYS A 1 343 ? 9.423   148.984 175.018 1.00 48.66  ? 346 LYS A CB  1 
ATOM   2688 C  CG  . LYS A 1 343 ? 8.720   150.238 174.513 1.00 54.44  ? 346 LYS A CG  1 
ATOM   2689 C  CD  . LYS A 1 343 ? 8.671   151.262 175.647 1.00 63.85  ? 346 LYS A CD  1 
ATOM   2690 C  CE  . LYS A 1 343 ? 7.768   152.444 175.346 1.00 70.69  ? 346 LYS A CE  1 
ATOM   2691 N  NZ  . LYS A 1 343 ? 7.347   153.115 176.614 1.00 76.21  ? 346 LYS A NZ  1 
ATOM   2692 N  N   . ILE A 1 344 ? 11.552  146.729 173.976 1.00 49.48  ? 347 ILE A N   1 
ATOM   2693 C  CA  . ILE A 1 344 ? 12.444  145.577 174.008 1.00 48.30  ? 347 ILE A CA  1 
ATOM   2694 C  C   . ILE A 1 344 ? 13.686  145.962 174.796 1.00 53.54  ? 347 ILE A C   1 
ATOM   2695 O  O   . ILE A 1 344 ? 14.306  146.998 174.521 1.00 54.71  ? 347 ILE A O   1 
ATOM   2696 C  CB  . ILE A 1 344 ? 12.801  145.119 172.573 1.00 59.61  ? 347 ILE A CB  1 
ATOM   2697 C  CG1 . ILE A 1 344 ? 11.541  144.693 171.820 1.00 52.45  ? 347 ILE A CG1 1 
ATOM   2698 C  CG2 . ILE A 1 344 ? 13.801  143.978 172.563 1.00 60.44  ? 347 ILE A CG2 1 
ATOM   2699 C  CD1 . ILE A 1 344 ? 10.691  143.708 172.588 1.00 45.50  ? 347 ILE A CD1 1 
ATOM   2700 N  N   . SER A 1 345 ? 14.032  145.147 175.788 1.00 57.84  ? 348 SER A N   1 
ATOM   2701 C  CA  . SER A 1 345 ? 15.254  145.374 176.541 1.00 60.73  ? 348 SER A CA  1 
ATOM   2702 C  C   . SER A 1 345 ? 16.472  145.110 175.663 1.00 68.19  ? 348 SER A C   1 
ATOM   2703 O  O   . SER A 1 345 ? 16.384  144.458 174.618 1.00 65.19  ? 348 SER A O   1 
ATOM   2704 C  CB  . SER A 1 345 ? 15.307  144.463 177.763 1.00 59.45  ? 348 SER A CB  1 
ATOM   2705 O  OG  . SER A 1 345 ? 15.314  143.101 177.369 1.00 63.81  ? 348 SER A OG  1 
ATOM   2706 N  N   . ARG A 1 346 ? 17.624  145.515 176.151 1.00 70.50  ? 349 ARG A N   1 
ATOM   2707 C  CA  . ARG A 1 346 ? 18.871  145.251 175.502 1.00 69.55  ? 349 ARG A CA  1 
ATOM   2708 C  C   . ARG A 1 346 ? 19.033  143.751 175.503 1.00 72.52  ? 349 ARG A C   1 
ATOM   2709 O  O   . ARG A 1 346 ? 19.566  143.209 174.587 1.00 76.63  ? 349 ARG A O   1 
ATOM   2710 C  CB  . ARG A 1 346 ? 20.009  145.921 176.233 1.00 78.43  ? 349 ARG A CB  1 
ATOM   2711 C  CG  . ARG A 1 346 ? 21.374  145.860 175.576 1.00 83.13  ? 349 ARG A CG  1 
ATOM   2712 C  CD  . ARG A 1 346 ? 22.310  146.764 176.359 1.00 94.43  ? 349 ARG A CD  1 
ATOM   2713 N  NE  . ARG A 1 346 ? 23.696  146.304 176.507 1.00 106.59 ? 349 ARG A NE  1 
ATOM   2714 C  CZ  . ARG A 1 346 ? 24.638  146.421 175.573 1.00 106.98 ? 349 ARG A CZ  1 
ATOM   2715 N  NH1 . ARG A 1 346 ? 25.864  145.983 175.802 1.00 99.65  ? 349 ARG A NH1 1 
ATOM   2716 N  NH2 . ARG A 1 346 ? 24.353  146.965 174.402 1.00 106.01 ? 349 ARG A NH2 1 
ATOM   2717 N  N   . GLU A 1 347 ? 18.589  143.089 176.553 1.00 74.41  ? 350 GLU A N   1 
ATOM   2718 C  CA  . GLU A 1 347 ? 18.674  141.635 176.650 1.00 71.08  ? 350 GLU A CA  1 
ATOM   2719 C  C   . GLU A 1 347 ? 17.804  140.955 175.606 1.00 68.75  ? 350 GLU A C   1 
ATOM   2720 O  O   . GLU A 1 347 ? 18.252  140.025 174.926 1.00 73.11  ? 350 GLU A O   1 
ATOM   2721 C  CB  . GLU A 1 347 ? 18.247  141.177 178.036 1.00 77.27  ? 350 GLU A CB  1 
ATOM   2722 C  CG  . GLU A 1 347 ? 19.320  141.204 179.077 1.00 81.42  ? 350 GLU A CG  1 
ATOM   2723 C  CD  . GLU A 1 347 ? 18.880  140.448 180.303 1.00 88.87  ? 350 GLU A CD  1 
ATOM   2724 O  OE1 . GLU A 1 347 ? 19.730  140.161 181.178 1.00 93.93  ? 350 GLU A OE1 1 
ATOM   2725 O  OE2 . GLU A 1 347 ? 17.668  140.137 180.377 1.00 84.77  ? 350 GLU A OE2 1 
ATOM   2726 N  N   . ASP A 1 348 ? 16.576  141.412 175.499 1.00 71.58  ? 351 ASP A N   1 
ATOM   2727 C  CA  . ASP A 1 348 ? 15.631  140.860 174.553 1.00 73.13  ? 351 ASP A CA  1 
ATOM   2728 C  C   . ASP A 1 348 ? 16.082  141.079 173.126 1.00 73.09  ? 351 ASP A C   1 
ATOM   2729 O  O   . ASP A 1 348 ? 15.808  140.286 172.263 1.00 70.11  ? 351 ASP A O   1 
ATOM   2730 C  CB  . ASP A 1 348 ? 14.219  141.361 174.816 1.00 77.83  ? 351 ASP A CB  1 
ATOM   2731 C  CG  . ASP A 1 348 ? 13.375  140.347 175.552 1.00 87.59  ? 351 ASP A CG  1 
ATOM   2732 O  OD1 . ASP A 1 348 ? 13.835  139.211 175.723 1.00 90.22  ? 351 ASP A OD1 1 
ATOM   2733 O  OD2 . ASP A 1 348 ? 12.252  140.657 175.955 1.00 74.83  ? 351 ASP A OD2 1 
ATOM   2734 N  N   . PHE A 1 349 ? 16.756  142.182 172.884 1.00 66.22  ? 352 PHE A N   1 
ATOM   2735 C  CA  . PHE A 1 349 ? 17.287  142.475 171.561 1.00 62.15  ? 352 PHE A CA  1 
ATOM   2736 C  C   . PHE A 1 349 ? 18.292  141.410 171.135 1.00 59.84  ? 352 PHE A C   1 
ATOM   2737 O  O   . PHE A 1 349 ? 18.182  140.837 170.047 1.00 59.33  ? 352 PHE A O   1 
ATOM   2738 C  CB  . PHE A 1 349 ? 17.916  143.867 171.556 1.00 64.75  ? 352 PHE A CB  1 
ATOM   2739 C  CG  . PHE A 1 349 ? 18.474  144.277 170.219 1.00 59.61  ? 352 PHE A CG  1 
ATOM   2740 C  CD1 . PHE A 1 349 ? 17.652  144.839 169.255 1.00 49.09  ? 352 PHE A CD1 1 
ATOM   2741 C  CD2 . PHE A 1 349 ? 19.823  144.104 169.934 1.00 53.63  ? 352 PHE A CD2 1 
ATOM   2742 C  CE1 . PHE A 1 349 ? 18.162  145.218 168.029 1.00 52.77  ? 352 PHE A CE1 1 
ATOM   2743 C  CE2 . PHE A 1 349 ? 20.339  144.475 168.716 1.00 53.55  ? 352 PHE A CE2 1 
ATOM   2744 C  CZ  . PHE A 1 349 ? 19.507  145.037 167.757 1.00 55.07  ? 352 PHE A CZ  1 
ATOM   2745 N  N   A MET A 1 350 ? 19.268  141.110 171.995 0.39 64.24  ? 353 MET A N   1 
ATOM   2746 N  N   B MET A 1 350 ? 19.281  141.134 171.991 0.61 64.26  ? 353 MET A N   1 
ATOM   2747 C  CA  A MET A 1 350 ? 20.263  140.103 171.639 0.39 65.38  ? 353 MET A CA  1 
ATOM   2748 C  CA  B MET A 1 350 ? 20.262  140.096 171.693 0.61 65.51  ? 353 MET A CA  1 
ATOM   2749 C  C   A MET A 1 350 ? 19.632  138.729 171.425 0.39 65.78  ? 353 MET A C   1 
ATOM   2750 C  C   B MET A 1 350 ? 19.586  138.768 171.377 0.61 65.97  ? 353 MET A C   1 
ATOM   2751 O  O   A MET A 1 350 ? 20.133  137.940 170.616 0.39 64.72  ? 353 MET A O   1 
ATOM   2752 O  O   B MET A 1 350 ? 20.001  138.052 170.458 0.61 64.75  ? 353 MET A O   1 
ATOM   2753 C  CB  A MET A 1 350 ? 21.354  140.036 172.708 0.39 63.51  ? 353 MET A CB  1 
ATOM   2754 C  CB  B MET A 1 350 ? 21.224  139.931 172.870 0.61 63.38  ? 353 MET A CB  1 
ATOM   2755 C  CG  A MET A 1 350 ? 22.364  141.179 172.642 0.39 63.91  ? 353 MET A CG  1 
ATOM   2756 C  CG  B MET A 1 350 ? 21.945  141.198 173.290 0.61 64.40  ? 353 MET A CG  1 
ATOM   2757 S  SD  A MET A 1 350 ? 23.123  141.385 171.011 0.39 63.53  ? 353 MET A SD  1 
ATOM   2758 S  SD  B MET A 1 350 ? 23.040  140.896 174.696 0.61 77.16  ? 353 MET A SD  1 
ATOM   2759 C  CE  A MET A 1 350 ? 23.755  139.735 170.681 0.39 59.06  ? 353 MET A CE  1 
ATOM   2760 C  CE  B MET A 1 350 ? 21.956  139.982 175.798 0.61 61.91  ? 353 MET A CE  1 
ATOM   2761 N  N   . SER A 1 351 ? 18.543  138.437 172.119 1.00 66.15  ? 354 SER A N   1 
ATOM   2762 C  CA  . SER A 1 351 ? 17.882  137.181 171.786 1.00 63.40  ? 354 SER A CA  1 
ATOM   2763 C  C   . SER A 1 351 ? 17.245  137.159 170.455 1.00 60.69  ? 354 SER A C   1 
ATOM   2764 O  O   . SER A 1 351 ? 17.205  136.151 169.826 1.00 64.33  ? 354 SER A O   1 
ATOM   2765 C  CB  . SER A 1 351 ? 16.843  136.806 172.804 1.00 63.41  ? 354 SER A CB  1 
ATOM   2766 O  OG  . SER A 1 351 ? 17.341  137.061 174.074 1.00 71.94  ? 354 SER A OG  1 
ATOM   2767 N  N   . GLY A 1 352 ? 16.678  138.271 170.057 1.00 65.84  ? 355 GLY A N   1 
ATOM   2768 C  CA  . GLY A 1 352 ? 16.033  138.362 168.774 1.00 58.61  ? 355 GLY A CA  1 
ATOM   2769 C  C   . GLY A 1 352 ? 17.037  138.189 167.682 1.00 62.64  ? 355 GLY A C   1 
ATOM   2770 O  O   . GLY A 1 352 ? 16.777  137.640 166.653 1.00 65.68  ? 355 GLY A O   1 
ATOM   2771 N  N   . VAL A 1 353 ? 18.197  138.740 167.915 1.00 62.63  ? 356 VAL A N   1 
ATOM   2772 C  CA  . VAL A 1 353 ? 19.263  138.659 166.983 1.00 63.98  ? 356 VAL A CA  1 
ATOM   2773 C  C   . VAL A 1 353 ? 19.704  137.240 166.857 1.00 67.46  ? 356 VAL A C   1 
ATOM   2774 O  O   . VAL A 1 353 ? 19.943  136.769 165.783 1.00 67.53  ? 356 VAL A O   1 
ATOM   2775 C  CB  . VAL A 1 353 ? 20.414  139.534 167.444 1.00 61.07  ? 356 VAL A CB  1 
ATOM   2776 C  CG1 . VAL A 1 353 ? 21.643  139.314 166.607 1.00 47.57  ? 356 VAL A CG1 1 
ATOM   2777 C  CG2 . VAL A 1 353 ? 19.989  140.971 167.409 1.00 48.71  ? 356 VAL A CG2 1 
ATOM   2778 N  N   . LYS A 1 354 ? 19.809  136.559 167.972 1.00 63.38  ? 357 LYS A N   1 
ATOM   2779 C  CA  . LYS A 1 354 ? 20.201  135.183 167.944 1.00 64.46  ? 357 LYS A CA  1 
ATOM   2780 C  C   . LYS A 1 354 ? 19.180  134.397 167.187 1.00 72.79  ? 357 LYS A C   1 
ATOM   2781 O  O   . LYS A 1 354 ? 19.522  133.571 166.404 1.00 78.49  ? 357 LYS A O   1 
ATOM   2782 C  CB  . LYS A 1 354 ? 20.263  134.642 169.337 1.00 66.52  ? 357 LYS A CB  1 
ATOM   2783 C  CG  . LYS A 1 354 ? 21.603  134.120 169.715 1.00 70.80  ? 357 LYS A CG  1 
ATOM   2784 C  CD  . LYS A 1 354 ? 21.471  132.819 170.452 1.00 69.51  ? 357 LYS A CD  1 
ATOM   2785 C  CE  . LYS A 1 354 ? 22.050  131.689 169.637 1.00 79.46  ? 357 LYS A CE  1 
ATOM   2786 N  NZ  . LYS A 1 354 ? 23.518  131.625 169.756 1.00 76.31  ? 357 LYS A NZ  1 
ATOM   2787 N  N   . LEU A 1 355 ? 17.917  134.632 167.459 1.00 67.27  ? 358 LEU A N   1 
ATOM   2788 C  CA  . LEU A 1 355 ? 16.869  133.909 166.801 1.00 66.93  ? 358 LEU A CA  1 
ATOM   2789 C  C   . LEU A 1 355 ? 16.866  134.153 165.349 1.00 70.95  ? 358 LEU A C   1 
ATOM   2790 O  O   . LEU A 1 355 ? 16.616  133.278 164.576 1.00 77.91  ? 358 LEU A O   1 
ATOM   2791 C  CB  . LEU A 1 355 ? 15.528  134.363 167.311 1.00 64.85  ? 358 LEU A CB  1 
ATOM   2792 C  CG  . LEU A 1 355 ? 15.090  133.796 168.630 1.00 59.70  ? 358 LEU A CG  1 
ATOM   2793 C  CD1 . LEU A 1 355 ? 13.803  134.446 169.017 1.00 49.77  ? 358 LEU A CD1 1 
ATOM   2794 C  CD2 . LEU A 1 355 ? 14.922  132.313 168.516 1.00 50.94  ? 358 LEU A CD2 1 
ATOM   2795 N  N   . SER A 1 356 ? 17.161  135.372 164.956 1.00 71.51  ? 359 SER A N   1 
ATOM   2796 C  CA  . SER A 1 356 ? 17.157  135.776 163.558 1.00 70.77  ? 359 SER A CA  1 
ATOM   2797 C  C   . SER A 1 356 ? 18.151  135.081 162.700 1.00 73.27  ? 359 SER A C   1 
ATOM   2798 O  O   . SER A 1 356 ? 17.916  134.818 161.559 1.00 72.78  ? 359 SER A O   1 
ATOM   2799 C  CB  . SER A 1 356 ? 17.300  137.263 163.431 1.00 71.82  ? 359 SER A CB  1 
ATOM   2800 O  OG  . SER A 1 356 ? 16.138  137.857 163.904 1.00 70.29  ? 359 SER A OG  1 
ATOM   2801 N  N   . VAL A 1 357 ? 19.299  134.821 163.254 1.00 81.74  ? 360 VAL A N   1 
ATOM   2802 C  CA  . VAL A 1 357 ? 20.341  134.106 162.530 1.00 77.66  ? 360 VAL A CA  1 
ATOM   2803 C  C   . VAL A 1 357 ? 20.857  133.046 163.476 1.00 82.57  ? 360 VAL A C   1 
ATOM   2804 O  O   . VAL A 1 357 ? 21.877  133.210 164.095 1.00 80.13  ? 360 VAL A O   1 
ATOM   2805 C  CB  . VAL A 1 357 ? 21.440  135.025 162.059 1.00 72.82  ? 360 VAL A CB  1 
ATOM   2806 C  CG1 . VAL A 1 357 ? 20.848  136.021 161.123 1.00 67.17  ? 360 VAL A CG1 1 
ATOM   2807 C  CG2 . VAL A 1 357 ? 22.055  135.754 163.211 1.00 70.74  ? 360 VAL A CG2 1 
ATOM   2808 N  N   . PRO A 1 358 ? 20.133  131.949 163.608 1.00 87.99  ? 361 PRO A N   1 
ATOM   2809 C  CA  . PRO A 1 358 ? 20.513  130.958 164.617 1.00 83.92  ? 361 PRO A CA  1 
ATOM   2810 C  C   . PRO A 1 358 ? 21.744  130.158 164.311 1.00 89.68  ? 361 PRO A C   1 
ATOM   2811 O  O   . PRO A 1 358 ? 22.281  129.526 165.188 1.00 85.22  ? 361 PRO A O   1 
ATOM   2812 C  CB  . PRO A 1 358 ? 19.290  130.055 164.740 1.00 77.58  ? 361 PRO A CB  1 
ATOM   2813 C  CG  . PRO A 1 358 ? 18.257  130.590 163.849 1.00 82.73  ? 361 PRO A CG  1 
ATOM   2814 C  CD  . PRO A 1 358 ? 18.977  131.347 162.815 1.00 84.65  ? 361 PRO A CD  1 
ATOM   2815 N  N   . HIS A 1 359 ? 22.167  130.161 163.069 1.00 90.22  ? 362 HIS A N   1 
ATOM   2816 C  CA  . HIS A 1 359 ? 23.357  129.416 162.685 1.00 87.11  ? 362 HIS A CA  1 
ATOM   2817 C  C   . HIS A 1 359 ? 24.606  130.281 162.632 1.00 92.32  ? 362 HIS A C   1 
ATOM   2818 O  O   . HIS A 1 359 ? 25.706  129.744 162.464 1.00 96.52  ? 362 HIS A O   1 
ATOM   2819 C  CB  . HIS A 1 359 ? 23.143  128.746 161.326 1.00 90.23  ? 362 HIS A CB  1 
ATOM   2820 C  CG  . HIS A 1 359 ? 22.063  127.711 161.333 1.00 92.05  ? 362 HIS A CG  1 
ATOM   2821 N  ND1 . HIS A 1 359 ? 20.788  127.962 160.873 1.00 94.66  ? 362 HIS A ND1 1 
ATOM   2822 C  CD2 . HIS A 1 359 ? 22.064  126.426 161.762 1.00 91.08  ? 362 HIS A CD2 1 
ATOM   2823 C  CE1 . HIS A 1 359 ? 20.051  126.874 161.012 1.00 94.99  ? 362 HIS A CE1 1 
ATOM   2824 N  NE2 . HIS A 1 359 ? 20.801  125.928 161.551 1.00 98.28  ? 362 HIS A NE2 1 
ATOM   2825 N  N   . ALA A 1 360 ? 24.467  131.596 162.762 1.00 87.27  ? 363 ALA A N   1 
ATOM   2826 C  CA  . ALA A 1 360 ? 25.634  132.459 162.808 1.00 79.17  ? 363 ALA A CA  1 
ATOM   2827 C  C   . ALA A 1 360 ? 26.499  132.112 164.009 1.00 79.47  ? 363 ALA A C   1 
ATOM   2828 O  O   . ALA A 1 360 ? 25.998  131.817 165.099 1.00 81.99  ? 363 ALA A O   1 
ATOM   2829 C  CB  . ALA A 1 360 ? 25.205  133.922 162.874 1.00 75.50  ? 363 ALA A CB  1 
ATOM   2830 N  N   . ASN A 1 361 ? 27.808  132.136 163.805 1.00 79.52  ? 364 ASN A N   1 
ATOM   2831 C  CA  . ASN A 1 361 ? 28.739  131.969 164.911 1.00 80.48  ? 364 ASN A CA  1 
ATOM   2832 C  C   . ASN A 1 361 ? 28.736  133.249 165.745 1.00 78.96  ? 364 ASN A C   1 
ATOM   2833 O  O   . ASN A 1 361 ? 27.947  134.174 165.520 1.00 74.08  ? 364 ASN A O   1 
ATOM   2834 C  CB  . ASN A 1 361 ? 30.124  131.611 164.386 1.00 79.68  ? 364 ASN A CB  1 
ATOM   2835 C  CG  . ASN A 1 361 ? 30.569  132.521 163.262 1.00 84.49  ? 364 ASN A CG  1 
ATOM   2836 O  OD1 . ASN A 1 361 ? 31.258  133.510 163.493 1.00 83.68  ? 364 ASN A OD1 1 
ATOM   2837 N  ND2 . ASN A 1 361 ? 30.166  132.198 162.035 1.00 88.12  ? 364 ASN A ND2 1 
ATOM   2838 N  N   . ASP A 1 362 ? 29.625  133.314 166.736 1.00 76.68  ? 365 ASP A N   1 
ATOM   2839 C  CA  . ASP A 1 362 ? 29.676  134.504 167.575 1.00 78.42  ? 365 ASP A CA  1 
ATOM   2840 C  C   . ASP A 1 362 ? 30.001  135.743 166.750 1.00 76.19  ? 365 ASP A C   1 
ATOM   2841 O  O   . ASP A 1 362 ? 29.452  136.824 166.999 1.00 72.92  ? 365 ASP A O   1 
ATOM   2842 C  CB  . ASP A 1 362 ? 30.698  134.317 168.692 1.00 75.40  ? 365 ASP A CB  1 
ATOM   2843 C  CG  . ASP A 1 362 ? 30.186  134.811 170.027 1.00 92.24  ? 365 ASP A CG  1 
ATOM   2844 O  OD1 . ASP A 1 362 ? 30.066  136.047 170.203 1.00 93.60  ? 365 ASP A OD1 1 
ATOM   2845 O  OD2 . ASP A 1 362 ? 29.881  133.962 170.893 1.00 101.78 ? 365 ASP A OD2 1 
ATOM   2846 N  N   . LEU A 1 363 ? 30.870  135.597 165.745 1.00 76.50  ? 366 LEU A N   1 
ATOM   2847 C  CA  . LEU A 1 363 ? 31.265  136.735 164.919 1.00 69.38  ? 366 LEU A CA  1 
ATOM   2848 C  C   . LEU A 1 363 ? 30.098  137.248 164.087 1.00 68.64  ? 366 LEU A C   1 
ATOM   2849 O  O   . LEU A 1 363 ? 29.918  138.464 163.949 1.00 66.77  ? 366 LEU A O   1 
ATOM   2850 C  CB  . LEU A 1 363 ? 32.434  136.343 164.018 1.00 66.35  ? 366 LEU A CB  1 
ATOM   2851 C  CG  . LEU A 1 363 ? 33.173  137.444 163.264 1.00 69.89  ? 366 LEU A CG  1 
ATOM   2852 C  CD1 . LEU A 1 363 ? 33.802  138.417 164.235 1.00 65.45  ? 366 LEU A CD1 1 
ATOM   2853 C  CD2 . LEU A 1 363 ? 34.233  136.833 162.368 1.00 71.26  ? 366 LEU A CD2 1 
ATOM   2854 N  N   . GLY A 1 364 ? 29.302  136.340 163.518 1.00 69.67  ? 367 GLY A N   1 
ATOM   2855 C  CA  . GLY A 1 364 ? 28.126  136.768 162.777 1.00 63.19  ? 367 GLY A CA  1 
ATOM   2856 C  C   . GLY A 1 364 ? 27.112  137.481 163.652 1.00 64.79  ? 367 GLY A C   1 
ATOM   2857 O  O   . GLY A 1 364 ? 26.527  138.488 163.245 1.00 63.36  ? 367 GLY A O   1 
ATOM   2858 N  N   . LEU A 1 365 ? 26.893  136.970 164.869 1.00 68.95  ? 368 LEU A N   1 
ATOM   2859 C  CA  . LEU A 1 365 ? 25.975  137.620 165.801 1.00 60.56  ? 368 LEU A CA  1 
ATOM   2860 C  C   . LEU A 1 365 ? 26.436  139.032 166.134 1.00 59.89  ? 368 LEU A C   1 
ATOM   2861 O  O   . LEU A 1 365 ? 25.624  139.963 166.199 1.00 54.17  ? 368 LEU A O   1 
ATOM   2862 C  CB  . LEU A 1 365 ? 25.845  136.784 167.073 1.00 62.74  ? 368 LEU A CB  1 
ATOM   2863 C  CG  . LEU A 1 365 ? 25.008  135.507 166.952 1.00 67.96  ? 368 LEU A CG  1 
ATOM   2864 C  CD1 . LEU A 1 365 ? 25.059  134.665 168.227 1.00 64.90  ? 368 LEU A CD1 1 
ATOM   2865 C  CD2 . LEU A 1 365 ? 23.581  135.871 166.602 1.00 67.42  ? 368 LEU A CD2 1 
ATOM   2866 N  N   . ASP A 1 366 ? 27.740  139.208 166.354 1.00 64.54  ? 369 ASP A N   1 
ATOM   2867 C  CA  . ASP A 1 366 ? 28.275  140.539 166.607 1.00 58.38  ? 369 ASP A CA  1 
ATOM   2868 C  C   . ASP A 1 366 ? 28.067  141.449 165.408 1.00 60.12  ? 369 ASP A C   1 
ATOM   2869 O  O   . ASP A 1 366 ? 27.784  142.642 165.569 1.00 58.82  ? 369 ASP A O   1 
ATOM   2870 C  CB  . ASP A 1 366 ? 29.762  140.455 166.952 1.00 64.51  ? 369 ASP A CB  1 
ATOM   2871 C  CG  . ASP A 1 366 ? 30.020  139.810 168.298 1.00 71.91  ? 369 ASP A CG  1 
ATOM   2872 O  OD1 . ASP A 1 366 ? 29.230  140.047 169.242 1.00 74.12  ? 369 ASP A OD1 1 
ATOM   2873 O  OD2 . ASP A 1 366 ? 31.020  139.066 168.411 1.00 77.92  ? 369 ASP A OD2 1 
ATOM   2874 N  N   . ALA A 1 367 ? 28.204  140.904 164.194 1.00 57.71  ? 370 ALA A N   1 
ATOM   2875 C  CA  . ALA A 1 367 ? 28.080  141.725 162.996 1.00 52.63  ? 370 ALA A CA  1 
ATOM   2876 C  C   . ALA A 1 367 ? 26.675  142.289 162.869 1.00 54.09  ? 370 ALA A C   1 
ATOM   2877 O  O   . ALA A 1 367 ? 26.496  143.484 162.606 1.00 55.42  ? 370 ALA A O   1 
ATOM   2878 C  CB  . ALA A 1 367 ? 28.450  140.913 161.753 1.00 54.75  ? 370 ALA A CB  1 
ATOM   2879 N  N   . VAL A 1 368 ? 25.662  141.437 163.049 1.00 50.44  ? 371 VAL A N   1 
ATOM   2880 C  CA  . VAL A 1 368 ? 24.281  141.906 162.982 1.00 53.81  ? 371 VAL A CA  1 
ATOM   2881 C  C   . VAL A 1 368 ? 24.015  142.933 164.078 1.00 54.03  ? 371 VAL A C   1 
ATOM   2882 O  O   . VAL A 1 368 ? 23.395  143.977 163.831 1.00 47.56  ? 371 VAL A O   1 
ATOM   2883 C  CB  . VAL A 1 368 ? 23.306  140.715 163.067 1.00 54.16  ? 371 VAL A CB  1 
ATOM   2884 C  CG1 . VAL A 1 368 ? 21.867  141.199 162.978 1.00 42.54  ? 371 VAL A CG1 1 
ATOM   2885 C  CG2 . VAL A 1 368 ? 23.605  139.703 161.969 1.00 53.47  ? 371 VAL A CG2 1 
ATOM   2886 N  N   . THR A 1 369 ? 24.500  142.668 165.299 1.00 44.96  ? 372 THR A N   1 
ATOM   2887 C  CA  . THR A 1 369 ? 24.285  143.605 166.400 1.00 48.35  ? 372 THR A CA  1 
ATOM   2888 C  C   . THR A 1 369 ? 24.919  144.960 166.105 1.00 48.45  ? 372 THR A C   1 
ATOM   2889 O  O   . THR A 1 369 ? 24.277  146.002 166.267 1.00 49.99  ? 372 THR A O   1 
ATOM   2890 C  CB  . THR A 1 369 ? 24.833  143.026 167.708 1.00 54.67  ? 372 THR A CB  1 
ATOM   2891 O  OG1 . THR A 1 369 ? 24.122  141.828 168.037 1.00 54.96  ? 372 THR A OG1 1 
ATOM   2892 C  CG2 . THR A 1 369 ? 24.656  144.015 168.847 1.00 49.99  ? 372 THR A CG2 1 
ATOM   2893 N  N   . LEU A 1 370 ? 26.178  144.964 165.659 1.00 54.61  ? 373 LEU A N   1 
ATOM   2894 C  CA  . LEU A 1 370 ? 26.844  146.219 165.306 1.00 57.98  ? 373 LEU A CA  1 
ATOM   2895 C  C   . LEU A 1 370 ? 26.078  146.962 164.226 1.00 56.31  ? 373 LEU A C   1 
ATOM   2896 O  O   . LEU A 1 370 ? 26.002  148.197 164.241 1.00 59.29  ? 373 LEU A O   1 
ATOM   2897 C  CB  . LEU A 1 370 ? 28.281  145.952 164.835 1.00 54.69  ? 373 LEU A CB  1 
ATOM   2898 C  CG  . LEU A 1 370 ? 28.992  147.078 164.063 1.00 57.13  ? 373 LEU A CG  1 
ATOM   2899 C  CD1 . LEU A 1 370 ? 29.608  148.121 165.001 1.00 56.55  ? 373 LEU A CD1 1 
ATOM   2900 C  CD2 . LEU A 1 370 ? 30.036  146.538 163.064 1.00 50.83  ? 373 LEU A CD2 1 
ATOM   2901 N  N   . GLN A 1 371 ? 25.498  146.225 163.281 1.00 53.79  ? 374 GLN A N   1 
ATOM   2902 C  CA  . GLN A 1 371 ? 24.841  146.862 162.148 1.00 51.23  ? 374 GLN A CA  1 
ATOM   2903 C  C   . GLN A 1 371 ? 23.537  147.540 162.550 1.00 51.42  ? 374 GLN A C   1 
ATOM   2904 O  O   . GLN A 1 371 ? 23.172  148.569 161.969 1.00 48.43  ? 374 GLN A O   1 
ATOM   2905 C  CB  . GLN A 1 371 ? 24.583  145.820 161.055 1.00 49.95  ? 374 GLN A CB  1 
ATOM   2906 C  CG  . GLN A 1 371 ? 24.407  146.399 159.691 1.00 49.47  ? 374 GLN A CG  1 
ATOM   2907 C  CD  . GLN A 1 371 ? 25.678  147.039 159.172 1.00 58.75  ? 374 GLN A CD  1 
ATOM   2908 O  OE1 . GLN A 1 371 ? 26.785  146.795 159.689 1.00 52.76  ? 374 GLN A OE1 1 
ATOM   2909 N  NE2 . GLN A 1 371 ? 25.530  147.864 158.136 1.00 61.17  ? 374 GLN A NE2 1 
ATOM   2910 N  N   . TYR A 1 372 ? 22.821  146.985 163.532 1.00 49.46  ? 375 TYR A N   1 
ATOM   2911 C  CA  . TYR A 1 372 ? 21.470  147.436 163.836 1.00 50.59  ? 375 TYR A CA  1 
ATOM   2912 C  C   . TYR A 1 372 ? 21.312  148.088 165.201 1.00 51.58  ? 375 TYR A C   1 
ATOM   2913 O  O   . TYR A 1 372 ? 20.207  148.539 165.519 1.00 54.93  ? 375 TYR A O   1 
ATOM   2914 C  CB  . TYR A 1 372 ? 20.482  146.266 163.714 1.00 45.98  ? 375 TYR A CB  1 
ATOM   2915 C  CG  . TYR A 1 372 ? 20.136  145.934 162.280 1.00 48.89  ? 375 TYR A CG  1 
ATOM   2916 C  CD1 . TYR A 1 372 ? 20.969  145.129 161.511 1.00 48.02  ? 375 TYR A CD1 1 
ATOM   2917 C  CD2 . TYR A 1 372 ? 18.985  146.439 161.693 1.00 45.12  ? 375 TYR A CD2 1 
ATOM   2918 C  CE1 . TYR A 1 372 ? 20.657  144.826 160.205 1.00 47.83  ? 375 TYR A CE1 1 
ATOM   2919 C  CE2 . TYR A 1 372 ? 18.667  146.150 160.405 1.00 45.55  ? 375 TYR A CE2 1 
ATOM   2920 C  CZ  . TYR A 1 372 ? 19.505  145.340 159.658 1.00 48.20  ? 375 TYR A CZ  1 
ATOM   2921 O  OH  . TYR A 1 372 ? 19.190  145.059 158.358 1.00 45.84  ? 375 TYR A OH  1 
ATOM   2922 N  N   . THR A 1 373 ? 22.365  148.168 166.012 1.00 48.63  ? 376 THR A N   1 
ATOM   2923 C  CA  . THR A 1 373 ? 22.260  148.842 167.301 1.00 52.41  ? 376 THR A CA  1 
ATOM   2924 C  C   . THR A 1 373 ? 22.353  150.351 167.125 1.00 57.27  ? 376 THR A C   1 
ATOM   2925 O  O   . THR A 1 373 ? 23.165  150.847 166.340 1.00 59.55  ? 376 THR A O   1 
ATOM   2926 C  CB  . THR A 1 373 ? 23.369  148.383 168.250 1.00 50.17  ? 376 THR A CB  1 
ATOM   2927 O  OG1 . THR A 1 373 ? 23.242  146.981 168.498 1.00 54.14  ? 376 THR A OG1 1 
ATOM   2928 C  CG2 . THR A 1 373 ? 23.284  149.124 169.572 1.00 58.60  ? 376 THR A CG2 1 
ATOM   2929 N  N   . ASP A 1 374 ? 21.515  151.085 167.858 1.00 58.41  ? 377 ASP A N   1 
ATOM   2930 C  CA  . ASP A 1 374 ? 21.774  152.501 168.111 1.00 67.26  ? 377 ASP A CA  1 
ATOM   2931 C  C   . ASP A 1 374 ? 22.778  152.598 169.256 1.00 69.75  ? 377 ASP A C   1 
ATOM   2932 O  O   . ASP A 1 374 ? 22.423  152.385 170.419 1.00 65.37  ? 377 ASP A O   1 
ATOM   2933 C  CB  . ASP A 1 374 ? 20.483  153.243 168.450 1.00 73.87  ? 377 ASP A CB  1 
ATOM   2934 C  CG  . ASP A 1 374 ? 20.707  154.737 168.705 1.00 79.82  ? 377 ASP A CG  1 
ATOM   2935 O  OD1 . ASP A 1 374 ? 21.859  155.218 168.575 1.00 77.51  ? 377 ASP A OD1 1 
ATOM   2936 O  OD2 . ASP A 1 374 ? 19.723  155.436 169.033 1.00 81.59  ? 377 ASP A OD2 1 
ATOM   2937 N  N   . TRP A 1 375 ? 24.033  152.919 168.939 1.00 66.90  ? 378 TRP A N   1 
ATOM   2938 C  CA  . TRP A 1 375 ? 25.056  152.978 169.975 1.00 69.89  ? 378 TRP A CA  1 
ATOM   2939 C  C   . TRP A 1 375 ? 25.030  154.281 170.765 1.00 74.14  ? 378 TRP A C   1 
ATOM   2940 O  O   . TRP A 1 375 ? 25.649  154.342 171.834 1.00 74.65  ? 378 TRP A O   1 
ATOM   2941 C  CB  . TRP A 1 375 ? 26.442  152.766 169.366 1.00 64.19  ? 378 TRP A CB  1 
ATOM   2942 C  CG  . TRP A 1 375 ? 26.604  151.436 168.703 1.00 64.53  ? 378 TRP A CG  1 
ATOM   2943 C  CD1 . TRP A 1 375 ? 26.499  151.164 167.360 1.00 68.48  ? 378 TRP A CD1 1 
ATOM   2944 C  CD2 . TRP A 1 375 ? 26.879  150.186 169.342 1.00 61.25  ? 378 TRP A CD2 1 
ATOM   2945 N  NE1 . TRP A 1 375 ? 26.705  149.826 167.128 1.00 63.31  ? 378 TRP A NE1 1 
ATOM   2946 C  CE2 . TRP A 1 375 ? 26.939  149.201 168.328 1.00 64.32  ? 378 TRP A CE2 1 
ATOM   2947 C  CE3 . TRP A 1 375 ? 27.080  149.800 170.671 1.00 61.47  ? 378 TRP A CE3 1 
ATOM   2948 C  CZ2 . TRP A 1 375 ? 27.193  147.856 168.608 1.00 60.92  ? 378 TRP A CZ2 1 
ATOM   2949 C  CZ3 . TRP A 1 375 ? 27.336  148.468 170.946 1.00 57.99  ? 378 TRP A CZ3 1 
ATOM   2950 C  CH2 . TRP A 1 375 ? 27.390  147.511 169.918 1.00 65.57  ? 378 TRP A CH2 1 
ATOM   2951 N  N   . MET A 1 376 ? 24.322  155.309 170.279 1.00 78.45  ? 379 MET A N   1 
ATOM   2952 C  CA  . MET A 1 376 ? 24.158  156.537 171.054 1.00 79.10  ? 379 MET A CA  1 
ATOM   2953 C  C   . MET A 1 376 ? 23.300  156.322 172.300 1.00 80.88  ? 379 MET A C   1 
ATOM   2954 O  O   . MET A 1 376 ? 23.489  157.027 173.297 1.00 90.52  ? 379 MET A O   1 
ATOM   2955 C  CB  . MET A 1 376 ? 23.571  157.640 170.175 1.00 84.90  ? 379 MET A CB  1 
ATOM   2956 C  CG  . MET A 1 376 ? 24.514  158.089 169.058 1.00 89.98  ? 379 MET A CG  1 
ATOM   2957 S  SD  . MET A 1 376 ? 25.121  159.786 169.238 1.00 101.90 ? 379 MET A SD  1 
ATOM   2958 C  CE  . MET A 1 376 ? 24.921  160.052 171.008 1.00 78.25  ? 379 MET A CE  1 
ATOM   2959 N  N   . ASP A 1 377 ? 22.355  155.376 172.273 1.00 78.33  ? 380 ASP A N   1 
ATOM   2960 C  CA  . ASP A 1 377 ? 21.828  154.807 173.514 1.00 81.30  ? 380 ASP A CA  1 
ATOM   2961 C  C   . ASP A 1 377 ? 21.340  153.381 173.293 1.00 83.92  ? 380 ASP A C   1 
ATOM   2962 O  O   . ASP A 1 377 ? 20.385  153.156 172.541 1.00 76.42  ? 380 ASP A O   1 
ATOM   2963 C  CB  . ASP A 1 377 ? 20.704  155.648 174.107 1.00 88.01  ? 380 ASP A CB  1 
ATOM   2964 C  CG  . ASP A 1 377 ? 20.290  155.146 175.482 1.00 84.44  ? 380 ASP A CG  1 
ATOM   2965 O  OD1 . ASP A 1 377 ? 20.957  155.529 176.469 1.00 89.36  ? 380 ASP A OD1 1 
ATOM   2966 O  OD2 . ASP A 1 377 ? 19.346  154.326 175.573 1.00 75.83  ? 380 ASP A OD2 1 
ATOM   2967 N  N   . ASP A 1 378 ? 21.957  152.433 174.013 1.00 94.88  ? 381 ASP A N   1 
ATOM   2968 C  CA  . ASP A 1 378 ? 21.639  151.011 173.861 1.00 90.72  ? 381 ASP A CA  1 
ATOM   2969 C  C   . ASP A 1 378 ? 20.252  150.665 174.409 1.00 85.38  ? 381 ASP A C   1 
ATOM   2970 O  O   . ASP A 1 378 ? 19.538  149.843 173.823 1.00 75.96  ? 381 ASP A O   1 
ATOM   2971 C  CB  . ASP A 1 378 ? 22.698  150.157 174.572 1.00 93.37  ? 381 ASP A CB  1 
ATOM   2972 C  CG  . ASP A 1 378 ? 24.050  150.182 173.878 1.00 94.11  ? 381 ASP A CG  1 
ATOM   2973 O  OD1 . ASP A 1 378 ? 24.264  151.045 172.999 1.00 89.41  ? 381 ASP A OD1 1 
ATOM   2974 O  OD2 . ASP A 1 378 ? 24.900  149.324 174.211 1.00 98.34  ? 381 ASP A OD2 1 
ATOM   2975 N  N   . ASN A 1 379 ? 19.870  151.241 175.546 1.00 87.41  ? 382 ASN A N   1 
ATOM   2976 C  CA  . ASN A 1 379 ? 18.670  150.796 176.260 1.00 82.51  ? 382 ASN A CA  1 
ATOM   2977 C  C   . ASN A 1 379 ? 17.487  151.724 176.027 1.00 76.58  ? 382 ASN A C   1 
ATOM   2978 O  O   . ASN A 1 379 ? 16.850  152.209 176.961 1.00 78.64  ? 382 ASN A O   1 
ATOM   2979 C  CB  . ASN A 1 379 ? 18.967  150.643 177.745 1.00 81.07  ? 382 ASN A CB  1 
ATOM   2980 C  CG  . ASN A 1 379 ? 19.514  149.266 178.086 1.00 90.49  ? 382 ASN A CG  1 
ATOM   2981 O  OD1 . ASN A 1 379 ? 18.762  148.286 178.177 1.00 89.10  ? 382 ASN A OD1 1 
ATOM   2982 N  ND2 . ASN A 1 379 ? 20.830  149.181 178.270 1.00 90.01  ? 382 ASN A ND2 1 
ATOM   2983 N  N   . ASN A 1 380 ? 17.194  151.970 174.755 1.00 65.95  ? 383 ASN A N   1 
ATOM   2984 C  CA  . ASN A 1 380 ? 15.952  152.597 174.322 1.00 59.68  ? 383 ASN A CA  1 
ATOM   2985 C  C   . ASN A 1 380 ? 15.039  151.472 173.832 1.00 60.63  ? 383 ASN A C   1 
ATOM   2986 O  O   . ASN A 1 380 ? 15.352  150.796 172.847 1.00 59.83  ? 383 ASN A O   1 
ATOM   2987 C  CB  . ASN A 1 380 ? 16.238  153.629 173.232 1.00 64.75  ? 383 ASN A CB  1 
ATOM   2988 C  CG  . ASN A 1 380 ? 14.994  154.360 172.755 1.00 61.33  ? 383 ASN A CG  1 
ATOM   2989 O  OD1 . ASN A 1 380 ? 13.917  153.779 172.628 1.00 60.37  ? 383 ASN A OD1 1 
ATOM   2990 N  ND2 . ASN A 1 380 ? 15.150  155.642 172.456 1.00 67.99  ? 383 ASN A ND2 1 
ATOM   2991 N  N   . GLY A 1 381 ? 13.924  151.256 174.534 1.00 60.37  ? 384 GLY A N   1 
ATOM   2992 C  CA  . GLY A 1 381 ? 13.059  150.134 174.206 1.00 48.52  ? 384 GLY A CA  1 
ATOM   2993 C  C   . GLY A 1 381 ? 12.446  150.248 172.823 1.00 56.59  ? 384 GLY A C   1 
ATOM   2994 O  O   . GLY A 1 381 ? 12.289  149.248 172.119 1.00 49.41  ? 384 GLY A O   1 
ATOM   2995 N  N   . ILE A 1 382 ? 12.097  151.469 172.413 1.00 53.91  ? 385 ILE A N   1 
ATOM   2996 C  CA  . ILE A 1 382 ? 11.506  151.668 171.095 1.00 47.96  ? 385 ILE A CA  1 
ATOM   2997 C  C   . ILE A 1 382 ? 12.543  151.446 169.998 1.00 53.71  ? 385 ILE A C   1 
ATOM   2998 O  O   . ILE A 1 382 ? 12.259  150.802 168.978 1.00 51.51  ? 385 ILE A O   1 
ATOM   2999 C  CB  . ILE A 1 382 ? 10.876  153.067 171.011 1.00 45.92  ? 385 ILE A CB  1 
ATOM   3000 C  CG1 . ILE A 1 382 ? 9.634   153.132 171.894 1.00 48.30  ? 385 ILE A CG1 1 
ATOM   3001 C  CG2 . ILE A 1 382 ? 10.546  153.442 169.556 1.00 41.00  ? 385 ILE A CG2 1 
ATOM   3002 C  CD1 . ILE A 1 382 ? 9.064   154.529 172.005 1.00 53.10  ? 385 ILE A CD1 1 
ATOM   3003 N  N   . LYS A 1 383 ? 13.756  151.981 170.183 1.00 52.70  ? 386 LYS A N   1 
ATOM   3004 C  CA  . LYS A 1 383 ? 14.844  151.720 169.243 1.00 54.18  ? 386 LYS A CA  1 
ATOM   3005 C  C   . LYS A 1 383 ? 15.128  150.224 169.127 1.00 49.02  ? 386 LYS A C   1 
ATOM   3006 O  O   . LYS A 1 383 ? 15.197  149.684 168.017 1.00 55.28  ? 386 LYS A O   1 
ATOM   3007 C  CB  . LYS A 1 383 ? 16.108  152.475 169.660 1.00 58.31  ? 386 LYS A CB  1 
ATOM   3008 C  CG  . LYS A 1 383 ? 16.025  153.994 169.577 1.00 60.70  ? 386 LYS A CG  1 
ATOM   3009 C  CD  . LYS A 1 383 ? 15.806  154.481 168.163 1.00 73.13  ? 386 LYS A CD  1 
ATOM   3010 C  CE  . LYS A 1 383 ? 16.540  155.794 167.924 1.00 83.33  ? 386 LYS A CE  1 
ATOM   3011 N  NZ  . LYS A 1 383 ? 16.639  156.600 169.177 1.00 75.83  ? 386 LYS A NZ  1 
ATOM   3012 N  N   . ASN A 1 384 ? 15.295  149.536 170.262 1.00 46.25  ? 387 ASN A N   1 
ATOM   3013 C  CA  . ASN A 1 384 ? 15.516  148.091 170.221 1.00 50.60  ? 387 ASN A CA  1 
ATOM   3014 C  C   . ASN A 1 384 ? 14.393  147.375 169.463 1.00 53.11  ? 387 ASN A C   1 
ATOM   3015 O  O   . ASN A 1 384 ? 14.650  146.430 168.706 1.00 46.43  ? 387 ASN A O   1 
ATOM   3016 C  CB  . ASN A 1 384 ? 15.639  147.518 171.638 1.00 49.20  ? 387 ASN A CB  1 
ATOM   3017 C  CG  . ASN A 1 384 ? 16.930  147.940 172.361 1.00 57.72  ? 387 ASN A CG  1 
ATOM   3018 O  OD1 . ASN A 1 384 ? 17.952  148.221 171.741 1.00 59.21  ? 387 ASN A OD1 1 
ATOM   3019 N  ND2 . ASN A 1 384 ? 16.874  147.964 173.689 1.00 53.54  ? 387 ASN A ND2 1 
ATOM   3020 N  N   . ARG A 1 385 ? 13.140  147.796 169.673 1.00 47.30  ? 388 ARG A N   1 
ATOM   3021 C  CA  . ARG A 1 385 ? 12.019  147.174 168.980 1.00 43.19  ? 388 ARG A CA  1 
ATOM   3022 C  C   . ARG A 1 385 ? 12.131  147.397 167.484 1.00 48.61  ? 388 ARG A C   1 
ATOM   3023 O  O   . ARG A 1 385 ? 12.052  146.454 166.692 1.00 44.10  ? 388 ARG A O   1 
ATOM   3024 C  CB  . ARG A 1 385 ? 10.699  147.744 169.480 1.00 41.20  ? 388 ARG A CB  1 
ATOM   3025 C  CG  . ARG A 1 385 ? 9.483   147.022 168.955 1.00 37.56  ? 388 ARG A CG  1 
ATOM   3026 C  CD  . ARG A 1 385 ? 8.243   147.869 169.137 1.00 39.02  ? 388 ARG A CD  1 
ATOM   3027 N  NE  . ARG A 1 385 ? 8.366   149.123 168.411 1.00 40.94  ? 388 ARG A NE  1 
ATOM   3028 C  CZ  . ARG A 1 385 ? 7.830   150.277 168.793 1.00 50.87  ? 388 ARG A CZ  1 
ATOM   3029 N  NH1 . ARG A 1 385 ? 7.139   150.362 169.933 1.00 50.63  ? 388 ARG A NH1 1 
ATOM   3030 N  NH2 . ARG A 1 385 ? 8.007   151.357 168.044 1.00 43.19  ? 388 ARG A NH2 1 
ATOM   3031 N  N   . ASP A 1 386 ? 12.311  148.655 167.086 1.00 45.34  ? 389 ASP A N   1 
ATOM   3032 C  CA  . ASP A 1 386 ? 12.382  148.996 165.677 1.00 44.99  ? 389 ASP A CA  1 
ATOM   3033 C  C   . ASP A 1 386 ? 13.576  148.316 165.011 1.00 51.00  ? 389 ASP A C   1 
ATOM   3034 O  O   . ASP A 1 386 ? 13.477  147.857 163.864 1.00 45.71  ? 389 ASP A O   1 
ATOM   3035 C  CB  . ASP A 1 386 ? 12.435  150.520 165.529 1.00 42.23  ? 389 ASP A CB  1 
ATOM   3036 C  CG  . ASP A 1 386 ? 11.105  151.194 165.880 1.00 47.52  ? 389 ASP A CG  1 
ATOM   3037 O  OD1 . ASP A 1 386 ? 10.085  150.482 166.008 1.00 45.73  ? 389 ASP A OD1 1 
ATOM   3038 O  OD2 . ASP A 1 386 ? 11.074  152.437 166.026 1.00 53.17  ? 389 ASP A OD2 1 
ATOM   3039 N  N   . GLY A 1 387 ? 14.697  148.205 165.730 1.00 45.34  ? 390 GLY A N   1 
ATOM   3040 C  CA  . GLY A 1 387 ? 15.870  147.559 165.162 1.00 44.95  ? 390 GLY A CA  1 
ATOM   3041 C  C   . GLY A 1 387 ? 15.640  146.087 164.881 1.00 48.09  ? 390 GLY A C   1 
ATOM   3042 O  O   . GLY A 1 387 ? 15.985  145.583 163.810 1.00 49.47  ? 390 GLY A O   1 
ATOM   3043 N  N   . LEU A 1 388 ? 15.048  145.379 165.841 1.00 46.15  ? 391 LEU A N   1 
ATOM   3044 C  CA  . LEU A 1 388 ? 14.718  143.974 165.623 1.00 47.91  ? 391 LEU A CA  1 
ATOM   3045 C  C   . LEU A 1 388 ? 13.714  143.808 164.488 1.00 48.76  ? 391 LEU A C   1 
ATOM   3046 O  O   . LEU A 1 388 ? 13.815  142.866 163.694 1.00 44.10  ? 391 LEU A O   1 
ATOM   3047 C  CB  . LEU A 1 388 ? 14.166  143.365 166.905 1.00 38.22  ? 391 LEU A CB  1 
ATOM   3048 C  CG  . LEU A 1 388 ? 14.958  142.163 167.392 1.00 53.23  ? 391 LEU A CG  1 
ATOM   3049 C  CD1 . LEU A 1 388 ? 14.230  141.504 168.549 1.00 52.63  ? 391 LEU A CD1 1 
ATOM   3050 C  CD2 . LEU A 1 388 ? 15.177  141.177 166.250 1.00 46.49  ? 391 LEU A CD2 1 
ATOM   3051 N  N   . ASP A 1 389 ? 12.721  144.699 164.420 1.00 40.65  ? 392 ASP A N   1 
ATOM   3052 C  CA  . ASP A 1 389 ? 11.750  144.660 163.342 1.00 39.84  ? 392 ASP A CA  1 
ATOM   3053 C  C   . ASP A 1 389 ? 12.445  144.821 161.991 1.00 47.81  ? 392 ASP A C   1 
ATOM   3054 O  O   . ASP A 1 389 ? 12.133  144.114 161.028 1.00 47.25  ? 392 ASP A O   1 
ATOM   3055 C  CB  . ASP A 1 389 ? 10.713  145.758 163.574 1.00 42.30  ? 392 ASP A CB  1 
ATOM   3056 C  CG  . ASP A 1 389 ? 9.352   145.411 163.013 1.00 54.01  ? 392 ASP A CG  1 
ATOM   3057 O  OD1 . ASP A 1 389 ? 9.189   144.259 162.565 1.00 55.62  ? 392 ASP A OD1 1 
ATOM   3058 O  OD2 . ASP A 1 389 ? 8.444   146.284 163.017 1.00 52.17  ? 392 ASP A OD2 1 
ATOM   3059 N  N   . ASP A 1 390 ? 13.421  145.726 161.923 1.00 47.42  ? 393 ASP A N   1 
ATOM   3060 C  CA  . ASP A 1 390 ? 14.176  145.943 160.702 1.00 47.84  ? 393 ASP A CA  1 
ATOM   3061 C  C   . ASP A 1 390 ? 15.022  144.731 160.348 1.00 47.65  ? 393 ASP A C   1 
ATOM   3062 O  O   . ASP A 1 390 ? 15.077  144.332 159.179 1.00 45.60  ? 393 ASP A O   1 
ATOM   3063 C  CB  . ASP A 1 390 ? 15.045  147.184 160.859 1.00 48.96  ? 393 ASP A CB  1 
ATOM   3064 C  CG  . ASP A 1 390 ? 14.294  148.441 160.526 1.00 51.64  ? 393 ASP A CG  1 
ATOM   3065 O  OD1 . ASP A 1 390 ? 13.127  148.324 160.091 1.00 54.02  ? 393 ASP A OD1 1 
ATOM   3066 O  OD2 . ASP A 1 390 ? 14.867  149.537 160.683 1.00 58.24  ? 393 ASP A OD2 1 
ATOM   3067 N  N   . ILE A 1 391 ? 15.684  144.130 161.341 1.00 43.96  ? 394 ILE A N   1 
ATOM   3068 C  CA  . ILE A 1 391 ? 16.444  142.905 161.096 1.00 43.45  ? 394 ILE A CA  1 
ATOM   3069 C  C   . ILE A 1 391 ? 15.565  141.869 160.407 1.00 43.29  ? 394 ILE A C   1 
ATOM   3070 O  O   . ILE A 1 391 ? 15.896  141.362 159.330 1.00 40.66  ? 394 ILE A O   1 
ATOM   3071 C  CB  . ILE A 1 391 ? 17.027  142.353 162.409 1.00 43.59  ? 394 ILE A CB  1 
ATOM   3072 C  CG1 . ILE A 1 391 ? 18.098  143.297 162.974 1.00 47.91  ? 394 ILE A CG1 1 
ATOM   3073 C  CG2 . ILE A 1 391 ? 17.582  140.949 162.204 1.00 40.79  ? 394 ILE A CG2 1 
ATOM   3074 C  CD1 . ILE A 1 391 ? 18.644  142.876 164.348 1.00 39.15  ? 394 ILE A CD1 1 
ATOM   3075 N  N   . VAL A 1 392 ? 14.414  141.564 161.009 1.00 42.90  ? 395 VAL A N   1 
ATOM   3076 C  CA  . VAL A 1 392 ? 13.596  140.458 160.523 1.00 43.21  ? 395 VAL A CA  1 
ATOM   3077 C  C   . VAL A 1 392 ? 13.058  140.752 159.124 1.00 42.55  ? 395 VAL A C   1 
ATOM   3078 O  O   . VAL A 1 392 ? 13.058  139.882 158.252 1.00 36.66  ? 395 VAL A O   1 
ATOM   3079 C  CB  . VAL A 1 392 ? 12.473  140.165 161.526 1.00 37.24  ? 395 VAL A CB  1 
ATOM   3080 C  CG1 . VAL A 1 392 ? 11.565  139.053 161.011 1.00 38.16  ? 395 VAL A CG1 1 
ATOM   3081 C  CG2 . VAL A 1 392 ? 13.081  139.791 162.868 1.00 40.39  ? 395 VAL A CG2 1 
ATOM   3082 N  N   . GLY A 1 393 ? 12.607  141.984 158.890 1.00 41.33  ? 396 GLY A N   1 
ATOM   3083 C  CA  . GLY A 1 393 ? 12.068  142.330 157.597 1.00 40.63  ? 396 GLY A CA  1 
ATOM   3084 C  C   . GLY A 1 393 ? 13.139  142.377 156.531 1.00 44.69  ? 396 GLY A C   1 
ATOM   3085 O  O   . GLY A 1 393 ? 12.919  141.929 155.405 1.00 44.50  ? 396 GLY A O   1 
ATOM   3086 N  N   . ASP A 1 394 ? 14.309  142.925 156.870 1.00 44.67  ? 397 ASP A N   1 
ATOM   3087 C  CA  . ASP A 1 394 ? 15.403  142.997 155.911 1.00 43.70  ? 397 ASP A CA  1 
ATOM   3088 C  C   . ASP A 1 394 ? 15.851  141.607 155.494 1.00 43.38  ? 397 ASP A C   1 
ATOM   3089 O  O   . ASP A 1 394 ? 16.017  141.319 154.303 1.00 46.18  ? 397 ASP A O   1 
ATOM   3090 C  CB  . ASP A 1 394 ? 16.578  143.768 156.502 1.00 38.98  ? 397 ASP A CB  1 
ATOM   3091 C  CG  . ASP A 1 394 ? 16.318  145.244 156.572 1.00 43.51  ? 397 ASP A CG  1 
ATOM   3092 O  OD1 . ASP A 1 394 ? 15.286  145.680 156.027 1.00 43.83  ? 397 ASP A OD1 1 
ATOM   3093 O  OD2 . ASP A 1 394 ? 17.139  145.968 157.181 1.00 46.10  ? 397 ASP A OD2 1 
ATOM   3094 N  N   . HIS A 1 395 ? 16.036  140.733 156.463 1.00 39.10  ? 398 HIS A N   1 
ATOM   3095 C  CA  . HIS A 1 395 ? 16.597  139.428 156.185 1.00 44.37  ? 398 HIS A CA  1 
ATOM   3096 C  C   . HIS A 1 395 ? 15.601  138.483 155.521 1.00 48.38  ? 398 HIS A C   1 
ATOM   3097 O  O   . HIS A 1 395 ? 16.016  137.601 154.766 1.00 53.94  ? 398 HIS A O   1 
ATOM   3098 C  CB  . HIS A 1 395 ? 17.105  138.825 157.481 1.00 41.31  ? 398 HIS A CB  1 
ATOM   3099 C  CG  . HIS A 1 395 ? 17.687  137.464 157.326 1.00 50.88  ? 398 HIS A CG  1 
ATOM   3100 N  ND1 . HIS A 1 395 ? 17.256  136.386 158.067 1.00 57.72  ? 398 HIS A ND1 1 
ATOM   3101 C  CD2 . HIS A 1 395 ? 18.672  137.002 156.522 1.00 54.64  ? 398 HIS A CD2 1 
ATOM   3102 C  CE1 . HIS A 1 395 ? 17.953  135.317 157.729 1.00 62.84  ? 398 HIS A CE1 1 
ATOM   3103 N  NE2 . HIS A 1 395 ? 18.821  135.664 156.795 1.00 63.59  ? 398 HIS A NE2 1 
ATOM   3104 N  N   . ASN A 1 396 ? 14.300  138.618 155.784 1.00 44.41  ? 399 ASN A N   1 
ATOM   3105 C  CA  . ASN A 1 396 ? 13.370  137.609 155.292 1.00 43.30  ? 399 ASN A CA  1 
ATOM   3106 C  C   . ASN A 1 396 ? 12.577  138.043 154.065 1.00 42.81  ? 399 ASN A C   1 
ATOM   3107 O  O   . ASN A 1 396 ? 11.963  137.186 153.418 1.00 37.61  ? 399 ASN A O   1 
ATOM   3108 C  CB  . ASN A 1 396 ? 12.390  137.192 156.397 1.00 38.08  ? 399 ASN A CB  1 
ATOM   3109 C  CG  . ASN A 1 396 ? 13.077  136.455 157.548 1.00 45.82  ? 399 ASN A CG  1 
ATOM   3110 O  OD1 . ASN A 1 396 ? 13.213  135.225 157.543 1.00 44.47  ? 399 ASN A OD1 1 
ATOM   3111 N  ND2 . ASN A 1 396 ? 13.518  137.208 158.535 1.00 47.09  ? 399 ASN A ND2 1 
ATOM   3112 N  N   . VAL A 1 397 ? 12.560  139.337 153.728 1.00 39.37  ? 400 VAL A N   1 
ATOM   3113 C  CA  . VAL A 1 397 ? 11.679  139.826 152.676 1.00 33.21  ? 400 VAL A CA  1 
ATOM   3114 C  C   . VAL A 1 397 ? 12.381  140.875 151.828 1.00 48.57  ? 400 VAL A C   1 
ATOM   3115 O  O   . VAL A 1 397 ? 12.522  140.702 150.608 1.00 45.18  ? 400 VAL A O   1 
ATOM   3116 C  CB  . VAL A 1 397 ? 10.363  140.394 153.240 1.00 41.04  ? 400 VAL A CB  1 
ATOM   3117 C  CG1 . VAL A 1 397 ? 9.508   140.961 152.123 1.00 35.97  ? 400 VAL A CG1 1 
ATOM   3118 C  CG2 . VAL A 1 397 ? 9.579   139.334 154.026 1.00 38.52  ? 400 VAL A CG2 1 
ATOM   3119 N  N   . ILE A 1 398 ? 12.818  141.974 152.451 1.00 44.30  ? 401 ILE A N   1 
ATOM   3120 C  CA  . ILE A 1 398 ? 13.267  143.128 151.666 1.00 45.58  ? 401 ILE A CA  1 
ATOM   3121 C  C   . ILE A 1 398 ? 14.567  142.816 150.922 1.00 48.36  ? 401 ILE A C   1 
ATOM   3122 O  O   . ILE A 1 398 ? 14.693  143.074 149.718 1.00 48.68  ? 401 ILE A O   1 
ATOM   3123 C  CB  . ILE A 1 398 ? 13.421  144.371 152.557 1.00 50.13  ? 401 ILE A CB  1 
ATOM   3124 C  CG1 . ILE A 1 398 ? 12.096  144.705 153.259 1.00 44.47  ? 401 ILE A CG1 1 
ATOM   3125 C  CG2 . ILE A 1 398 ? 13.944  145.556 151.729 1.00 40.14  ? 401 ILE A CG2 1 
ATOM   3126 C  CD1 . ILE A 1 398 ? 12.129  145.999 154.057 1.00 33.40  ? 401 ILE A CD1 1 
ATOM   3127 N  N   . CYS A 1 399 ? 15.547  142.268 151.616 1.00 48.16  ? 402 CYS A N   1 
ATOM   3128 C  CA  . CYS A 1 399 ? 16.845  142.080 150.982 1.00 45.72  ? 402 CYS A CA  1 
ATOM   3129 C  C   . CYS A 1 399 ? 16.861  140.881 150.035 1.00 50.27  ? 402 CYS A C   1 
ATOM   3130 O  O   . CYS A 1 399 ? 17.581  140.925 149.027 1.00 47.17  ? 402 CYS A O   1 
ATOM   3131 C  CB  . CYS A 1 399 ? 17.943  141.961 152.045 1.00 49.70  ? 402 CYS A CB  1 
ATOM   3132 S  SG  . CYS A 1 399 ? 18.284  143.540 152.902 1.00 55.68  ? 402 CYS A SG  1 
ATOM   3133 N  N   . PRO A 1 400 ? 16.120  139.795 150.308 1.00 48.55  ? 403 PRO A N   1 
ATOM   3134 C  CA  . PRO A 1 400 ? 15.896  138.803 149.233 1.00 37.43  ? 403 PRO A CA  1 
ATOM   3135 C  C   . PRO A 1 400 ? 15.293  139.415 147.977 1.00 47.17  ? 403 PRO A C   1 
ATOM   3136 O  O   . PRO A 1 400 ? 15.767  139.150 146.853 1.00 43.93  ? 403 PRO A O   1 
ATOM   3137 C  CB  . PRO A 1 400 ? 14.955  137.786 149.882 1.00 44.14  ? 403 PRO A CB  1 
ATOM   3138 C  CG  . PRO A 1 400 ? 15.305  137.856 151.375 1.00 47.01  ? 403 PRO A CG  1 
ATOM   3139 C  CD  . PRO A 1 400 ? 15.700  139.289 151.635 1.00 45.50  ? 403 PRO A CD  1 
ATOM   3140 N  N   . LEU A 1 401 ? 14.253  140.234 148.137 1.00 42.29  ? 404 LEU A N   1 
ATOM   3141 C  CA  . LEU A 1 401 ? 13.617  140.857 146.982 1.00 42.04  ? 404 LEU A CA  1 
ATOM   3142 C  C   . LEU A 1 401 ? 14.587  141.772 146.242 1.00 47.32  ? 404 LEU A C   1 
ATOM   3143 O  O   . LEU A 1 401 ? 14.686  141.720 145.009 1.00 44.64  ? 404 LEU A O   1 
ATOM   3144 C  CB  . LEU A 1 401 ? 12.373  141.621 147.419 1.00 38.82  ? 404 LEU A CB  1 
ATOM   3145 C  CG  . LEU A 1 401 ? 11.584  142.244 146.275 1.00 44.14  ? 404 LEU A CG  1 
ATOM   3146 C  CD1 . LEU A 1 401 ? 10.090  142.010 146.493 1.00 39.68  ? 404 LEU A CD1 1 
ATOM   3147 C  CD2 . LEU A 1 401 ? 11.898  143.721 146.118 1.00 36.91  ? 404 LEU A CD2 1 
ATOM   3148 N  N   . MET A 1 402 ? 15.356  142.558 146.961 1.00 46.18  ? 405 MET A N   1 
ATOM   3149 C  CA  . MET A 1 402 ? 16.325  143.425 146.336 1.00 44.83  ? 405 MET A CA  1 
ATOM   3150 C  C   . MET A 1 402 ? 17.350  142.624 145.573 1.00 44.94  ? 405 MET A C   1 
ATOM   3151 O  O   . MET A 1 402 ? 17.761  143.019 144.531 1.00 45.83  ? 405 MET A O   1 
ATOM   3152 C  CB  . MET A 1 402 ? 16.998  144.310 147.342 1.00 40.06  ? 405 MET A CB  1 
ATOM   3153 C  CG  . MET A 1 402 ? 16.126  145.390 147.859 1.00 40.68  ? 405 MET A CG  1 
ATOM   3154 S  SD  . MET A 1 402 ? 15.233  146.192 146.591 1.00 48.90  ? 405 MET A SD  1 
ATOM   3155 C  CE  . MET A 1 402 ? 16.523  146.921 145.679 1.00 47.73  ? 405 MET A CE  1 
ATOM   3156 N  N   . HIS A 1 403 ? 17.775  141.510 146.114 1.00 42.66  ? 406 HIS A N   1 
ATOM   3157 C  CA  . HIS A 1 403 ? 18.669  140.625 145.379 1.00 40.93  ? 406 HIS A CA  1 
ATOM   3158 C  C   . HIS A 1 403 ? 18.006  140.134 144.097 1.00 47.09  ? 406 HIS A C   1 
ATOM   3159 O  O   . HIS A 1 403 ? 18.628  140.119 143.029 1.00 42.70  ? 406 HIS A O   1 
ATOM   3160 C  CB  . HIS A 1 403 ? 19.058  139.447 146.263 1.00 40.68  ? 406 HIS A CB  1 
ATOM   3161 C  CG  . HIS A 1 403 ? 20.085  138.541 145.661 1.00 48.72  ? 406 HIS A CG  1 
ATOM   3162 N  ND1 . HIS A 1 403 ? 21.364  138.960 145.363 1.00 50.44  ? 406 HIS A ND1 1 
ATOM   3163 C  CD2 . HIS A 1 403 ? 20.031  137.227 145.330 1.00 41.22  ? 406 HIS A CD2 1 
ATOM   3164 C  CE1 . HIS A 1 403 ? 22.053  137.944 144.873 1.00 51.05  ? 406 HIS A CE1 1 
ATOM   3165 N  NE2 . HIS A 1 403 ? 21.268  136.881 144.846 1.00 47.33  ? 406 HIS A NE2 1 
ATOM   3166 N  N   . PHE A 1 404 ? 16.733  139.748 144.187 1.00 46.78  ? 407 PHE A N   1 
ATOM   3167 C  CA  . PHE A 1 404 ? 16.008  139.297 143.013 1.00 43.40  ? 407 PHE A CA  1 
ATOM   3168 C  C   . PHE A 1 404 ? 15.874  140.420 141.996 1.00 45.01  ? 407 PHE A C   1 
ATOM   3169 O  O   . PHE A 1 404 ? 16.048  140.197 140.795 1.00 50.30  ? 407 PHE A O   1 
ATOM   3170 C  CB  . PHE A 1 404 ? 14.635  138.760 143.426 1.00 42.66  ? 407 PHE A CB  1 
ATOM   3171 C  CG  . PHE A 1 404 ? 13.749  138.430 142.268 1.00 43.10  ? 407 PHE A CG  1 
ATOM   3172 C  CD1 . PHE A 1 404 ? 13.866  137.203 141.615 1.00 47.42  ? 407 PHE A CD1 1 
ATOM   3173 C  CD2 . PHE A 1 404 ? 12.816  139.349 141.808 1.00 40.60  ? 407 PHE A CD2 1 
ATOM   3174 C  CE1 . PHE A 1 404 ? 13.053  136.886 140.536 1.00 39.04  ? 407 PHE A CE1 1 
ATOM   3175 C  CE2 . PHE A 1 404 ? 11.997  139.041 140.722 1.00 44.68  ? 407 PHE A CE2 1 
ATOM   3176 C  CZ  . PHE A 1 404 ? 12.121  137.807 140.084 1.00 37.21  ? 407 PHE A CZ  1 
ATOM   3177 N  N   . VAL A 1 405 ? 15.595  141.639 142.460 1.00 45.48  ? 408 VAL A N   1 
ATOM   3178 C  CA  . VAL A 1 405 ? 15.441  142.790 141.569 1.00 44.70  ? 408 VAL A CA  1 
ATOM   3179 C  C   . VAL A 1 405 ? 16.724  143.043 140.791 1.00 51.31  ? 408 VAL A C   1 
ATOM   3180 O  O   . VAL A 1 405 ? 16.708  143.352 139.590 1.00 48.07  ? 408 VAL A O   1 
ATOM   3181 C  CB  . VAL A 1 405 ? 15.045  144.039 142.380 1.00 48.57  ? 408 VAL A CB  1 
ATOM   3182 C  CG1 . VAL A 1 405 ? 15.110  145.287 141.515 1.00 55.21  ? 408 VAL A CG1 1 
ATOM   3183 C  CG2 . VAL A 1 405 ? 13.672  143.886 142.958 1.00 54.05  ? 408 VAL A CG2 1 
ATOM   3184 N  N   . ASN A 1 406 ? 17.869  142.941 141.476 1.00 48.52  ? 409 ASN A N   1 
ATOM   3185 C  CA  . ASN A 1 406 ? 19.135  143.294 140.837 1.00 50.00  ? 409 ASN A CA  1 
ATOM   3186 C  C   . ASN A 1 406 ? 19.531  142.257 139.796 1.00 51.41  ? 409 ASN A C   1 
ATOM   3187 O  O   . ASN A 1 406 ? 19.892  142.607 138.665 1.00 52.56  ? 409 ASN A O   1 
ATOM   3188 C  CB  . ASN A 1 406 ? 20.237  143.450 141.886 1.00 55.31  ? 409 ASN A CB  1 
ATOM   3189 C  CG  . ASN A 1 406 ? 20.100  144.736 142.697 1.00 63.42  ? 409 ASN A CG  1 
ATOM   3190 O  OD1 . ASN A 1 406 ? 19.748  145.793 142.160 1.00 64.51  ? 409 ASN A OD1 1 
ATOM   3191 N  ND2 . ASN A 1 406 ? 20.381  144.649 143.997 1.00 57.24  ? 409 ASN A ND2 1 
ATOM   3192 N  N   . LYS A 1 407 ? 19.471  140.975 140.167 1.00 43.82  ? 410 LYS A N   1 
ATOM   3193 C  CA  . LYS A 1 407 ? 19.782  139.910 139.228 1.00 47.11  ? 410 LYS A CA  1 
ATOM   3194 C  C   . LYS A 1 407 ? 18.832  139.927 138.030 1.00 48.99  ? 410 LYS A C   1 
ATOM   3195 O  O   . LYS A 1 407 ? 19.275  139.817 136.880 1.00 49.43  ? 410 LYS A O   1 
ATOM   3196 C  CB  . LYS A 1 407 ? 19.739  138.568 139.950 1.00 45.52  ? 410 LYS A CB  1 
ATOM   3197 C  CG  . LYS A 1 407 ? 20.847  138.390 140.972 1.00 47.10  ? 410 LYS A CG  1 
ATOM   3198 C  CD  . LYS A 1 407 ? 22.215  138.391 140.326 1.00 50.75  ? 410 LYS A CD  1 
ATOM   3199 C  CE  . LYS A 1 407 ? 23.300  138.167 141.354 1.00 54.02  ? 410 LYS A CE  1 
ATOM   3200 N  NZ  . LYS A 1 407 ? 24.651  138.140 140.734 1.00 56.76  ? 410 LYS A NZ  1 
ATOM   3201 N  N   . TYR A 1 408 ? 17.526  140.101 138.277 1.00 43.85  ? 411 TYR A N   1 
ATOM   3202 C  CA  . TYR A 1 408 ? 16.558  140.065 137.192 1.00 44.38  ? 411 TYR A CA  1 
ATOM   3203 C  C   . TYR A 1 408 ? 16.778  141.210 136.206 1.00 50.91  ? 411 TYR A C   1 
ATOM   3204 O  O   . TYR A 1 408 ? 16.696  141.010 134.984 1.00 47.28  ? 411 TYR A O   1 
ATOM   3205 C  CB  . TYR A 1 408 ? 15.125  140.106 137.730 1.00 45.23  ? 411 TYR A CB  1 
ATOM   3206 C  CG  . TYR A 1 408 ? 14.133  139.858 136.612 1.00 40.42  ? 411 TYR A CG  1 
ATOM   3207 C  CD1 . TYR A 1 408 ? 13.689  140.898 135.796 1.00 39.54  ? 411 TYR A CD1 1 
ATOM   3208 C  CD2 . TYR A 1 408 ? 13.676  138.573 136.345 1.00 38.40  ? 411 TYR A CD2 1 
ATOM   3209 C  CE1 . TYR A 1 408 ? 12.808  140.655 134.736 1.00 43.92  ? 411 TYR A CE1 1 
ATOM   3210 C  CE2 . TYR A 1 408 ? 12.791  138.321 135.297 1.00 45.83  ? 411 TYR A CE2 1 
ATOM   3211 C  CZ  . TYR A 1 408 ? 12.372  139.363 134.493 1.00 39.52  ? 411 TYR A CZ  1 
ATOM   3212 O  OH  . TYR A 1 408 ? 11.503  139.104 133.468 1.00 40.70  ? 411 TYR A OH  1 
ATOM   3213 N  N   . THR A 1 409 ? 17.051  142.416 136.718 1.00 46.68  ? 412 THR A N   1 
ATOM   3214 C  CA  . THR A 1 409 ? 17.142  143.598 135.864 1.00 51.70  ? 412 THR A CA  1 
ATOM   3215 C  C   . THR A 1 409 ? 18.262  143.481 134.828 1.00 51.78  ? 412 THR A C   1 
ATOM   3216 O  O   . THR A 1 409 ? 18.148  144.038 133.727 1.00 46.14  ? 412 THR A O   1 
ATOM   3217 C  CB  . THR A 1 409 ? 17.318  144.833 136.746 1.00 46.41  ? 412 THR A CB  1 
ATOM   3218 O  OG1 . THR A 1 409 ? 16.108  145.046 137.473 1.00 52.81  ? 412 THR A OG1 1 
ATOM   3219 C  CG2 . THR A 1 409 ? 17.619  146.077 135.932 1.00 49.37  ? 412 THR A CG2 1 
ATOM   3220 N  N   . LYS A 1 410 ? 19.323  142.731 135.144 1.00 48.87  ? 413 LYS A N   1 
ATOM   3221 C  CA  . LYS A 1 410 ? 20.412  142.527 134.196 1.00 53.10  ? 413 LYS A CA  1 
ATOM   3222 C  C   . LYS A 1 410 ? 19.942  141.893 132.887 1.00 51.38  ? 413 LYS A C   1 
ATOM   3223 O  O   . LYS A 1 410 ? 20.557  142.121 131.842 1.00 50.65  ? 413 LYS A O   1 
ATOM   3224 C  CB  . LYS A 1 410 ? 21.505  141.666 134.829 1.00 52.69  ? 413 LYS A CB  1 
ATOM   3225 C  CG  . LYS A 1 410 ? 22.475  142.455 135.682 1.00 63.65  ? 413 LYS A CG  1 
ATOM   3226 C  CD  . LYS A 1 410 ? 23.615  141.572 136.176 1.00 83.22  ? 413 LYS A CD  1 
ATOM   3227 C  CE  . LYS A 1 410 ? 23.120  140.512 137.162 1.00 74.69  ? 413 LYS A CE  1 
ATOM   3228 N  NZ  . LYS A 1 410 ? 24.227  139.662 137.714 1.00 81.95  ? 413 LYS A NZ  1 
ATOM   3229 N  N   . PHE A 1 411 ? 18.863  141.106 132.916 1.00 47.86  ? 414 PHE A N   1 
ATOM   3230 C  CA  . PHE A 1 411 ? 18.410  140.364 131.747 1.00 41.65  ? 414 PHE A CA  1 
ATOM   3231 C  C   . PHE A 1 411 ? 17.014  140.717 131.271 1.00 47.55  ? 414 PHE A C   1 
ATOM   3232 O  O   . PHE A 1 411 ? 16.706  140.474 130.100 1.00 52.22  ? 414 PHE A O   1 
ATOM   3233 C  CB  . PHE A 1 411 ? 18.432  138.856 132.019 1.00 39.77  ? 414 PHE A CB  1 
ATOM   3234 C  CG  . PHE A 1 411 ? 19.805  138.287 132.147 1.00 47.16  ? 414 PHE A CG  1 
ATOM   3235 C  CD1 . PHE A 1 411 ? 20.533  137.938 131.016 1.00 48.67  ? 414 PHE A CD1 1 
ATOM   3236 C  CD2 . PHE A 1 411 ? 20.370  138.084 133.395 1.00 47.20  ? 414 PHE A CD2 1 
ATOM   3237 C  CE1 . PHE A 1 411 ? 21.798  137.403 131.136 1.00 48.77  ? 414 PHE A CE1 1 
ATOM   3238 C  CE2 . PHE A 1 411 ? 21.636  137.550 133.527 1.00 44.96  ? 414 PHE A CE2 1 
ATOM   3239 C  CZ  . PHE A 1 411 ? 22.352  137.210 132.400 1.00 54.51  ? 414 PHE A CZ  1 
ATOM   3240 N  N   . GLY A 1 412 ? 16.158  141.250 132.132 1.00 47.38  ? 415 GLY A N   1 
ATOM   3241 C  CA  . GLY A 1 412 ? 14.774  141.445 131.783 1.00 42.40  ? 415 GLY A CA  1 
ATOM   3242 C  C   . GLY A 1 412 ? 14.566  142.653 130.905 1.00 40.54  ? 415 GLY A C   1 
ATOM   3243 O  O   . GLY A 1 412 ? 15.488  143.393 130.573 1.00 38.19  ? 415 GLY A O   1 
ATOM   3244 N  N   . ASN A 1 413 ? 13.296  142.875 130.574 1.00 39.97  ? 416 ASN A N   1 
ATOM   3245 C  CA  . ASN A 1 413 ? 12.866  143.892 129.630 1.00 42.05  ? 416 ASN A CA  1 
ATOM   3246 C  C   . ASN A 1 413 ? 12.154  145.068 130.304 1.00 48.10  ? 416 ASN A C   1 
ATOM   3247 O  O   . ASN A 1 413 ? 11.375  145.776 129.652 1.00 45.25  ? 416 ASN A O   1 
ATOM   3248 C  CB  . ASN A 1 413 ? 11.971  143.240 128.571 1.00 45.45  ? 416 ASN A CB  1 
ATOM   3249 C  CG  . ASN A 1 413 ? 11.704  144.152 127.418 1.00 43.94  ? 416 ASN A CG  1 
ATOM   3250 O  OD1 . ASN A 1 413 ? 10.556  144.362 127.037 1.00 51.50  ? 416 ASN A OD1 1 
ATOM   3251 N  ND2 . ASN A 1 413 ? 12.760  144.729 126.866 1.00 48.14  ? 416 ASN A ND2 1 
ATOM   3252 N  N   . GLY A 1 414 ? 12.413  145.297 131.596 1.00 50.40  ? 417 GLY A N   1 
ATOM   3253 C  CA  . GLY A 1 414 ? 11.845  146.429 132.308 1.00 44.05  ? 417 GLY A CA  1 
ATOM   3254 C  C   . GLY A 1 414 ? 11.447  146.114 133.738 1.00 49.79  ? 417 GLY A C   1 
ATOM   3255 O  O   . GLY A 1 414 ? 10.590  145.260 133.970 1.00 48.19  ? 417 GLY A O   1 
ATOM   3256 N  N   . THR A 1 415 ? 12.056  146.799 134.702 1.00 47.76  ? 418 THR A N   1 
ATOM   3257 C  CA  . THR A 1 415 ? 11.751  146.635 136.116 1.00 47.29  ? 418 THR A CA  1 
ATOM   3258 C  C   . THR A 1 415 ? 11.167  147.921 136.682 1.00 51.28  ? 418 THR A C   1 
ATOM   3259 O  O   . THR A 1 415 ? 11.698  149.012 136.435 1.00 48.00  ? 418 THR A O   1 
ATOM   3260 C  CB  . THR A 1 415 ? 13.000  146.276 136.920 1.00 48.54  ? 418 THR A CB  1 
ATOM   3261 O  OG1 . THR A 1 415 ? 13.643  145.127 136.349 1.00 45.43  ? 418 THR A OG1 1 
ATOM   3262 C  CG2 . THR A 1 415 ? 12.619  145.986 138.368 1.00 47.97  ? 418 THR A CG2 1 
ATOM   3263 N  N   . TYR A 1 416 ? 10.092  147.789 137.464 1.00 43.10  ? 419 TYR A N   1 
ATOM   3264 C  CA  . TYR A 1 416 ? 9.513   148.907 138.208 1.00 46.03  ? 419 TYR A CA  1 
ATOM   3265 C  C   . TYR A 1 416 ? 9.408   148.543 139.686 1.00 46.13  ? 419 TYR A C   1 
ATOM   3266 O  O   . TYR A 1 416 ? 8.743   147.563 140.042 1.00 43.26  ? 419 TYR A O   1 
ATOM   3267 C  CB  . TYR A 1 416 ? 8.146   149.292 137.642 1.00 43.89  ? 419 TYR A CB  1 
ATOM   3268 C  CG  . TYR A 1 416 ? 8.220   149.871 136.251 1.00 50.41  ? 419 TYR A CG  1 
ATOM   3269 C  CD1 . TYR A 1 416 ? 8.460   151.223 136.056 1.00 52.02  ? 419 TYR A CD1 1 
ATOM   3270 C  CD2 . TYR A 1 416 ? 8.056   149.065 135.125 1.00 53.78  ? 419 TYR A CD2 1 
ATOM   3271 C  CE1 . TYR A 1 416 ? 8.529   151.766 134.772 1.00 54.92  ? 419 TYR A CE1 1 
ATOM   3272 C  CE2 . TYR A 1 416 ? 8.126   149.596 133.836 1.00 45.08  ? 419 TYR A CE2 1 
ATOM   3273 C  CZ  . TYR A 1 416 ? 8.356   150.950 133.666 1.00 51.36  ? 419 TYR A CZ  1 
ATOM   3274 O  OH  . TYR A 1 416 ? 8.439   151.490 132.390 1.00 51.98  ? 419 TYR A OH  1 
ATOM   3275 N  N   . LEU A 1 417 ? 10.054  149.339 140.541 1.00 48.74  ? 420 LEU A N   1 
ATOM   3276 C  CA  . LEU A 1 417 ? 10.194  149.060 141.967 1.00 46.07  ? 420 LEU A CA  1 
ATOM   3277 C  C   . LEU A 1 417 ? 9.446   150.096 142.798 1.00 46.82  ? 420 LEU A C   1 
ATOM   3278 O  O   . LEU A 1 417 ? 9.495   151.295 142.501 1.00 47.32  ? 420 LEU A O   1 
ATOM   3279 C  CB  . LEU A 1 417 ? 11.667  149.046 142.375 1.00 42.95  ? 420 LEU A CB  1 
ATOM   3280 C  CG  . LEU A 1 417 ? 11.946  148.680 143.832 1.00 43.76  ? 420 LEU A CG  1 
ATOM   3281 C  CD1 . LEU A 1 417 ? 11.359  147.304 144.165 1.00 37.72  ? 420 LEU A CD1 1 
ATOM   3282 C  CD2 . LEU A 1 417 ? 13.437  148.701 144.082 1.00 41.51  ? 420 LEU A CD2 1 
ATOM   3283 N  N   . TYR A 1 418 ? 8.757   149.640 143.847 1.00 40.24  ? 421 TYR A N   1 
ATOM   3284 C  CA  . TYR A 1 418 ? 7.993   150.544 144.698 1.00 42.48  ? 421 TYR A CA  1 
ATOM   3285 C  C   . TYR A 1 418 ? 8.283   150.260 146.169 1.00 46.00  ? 421 TYR A C   1 
ATOM   3286 O  O   . TYR A 1 418 ? 8.626   149.134 146.545 1.00 43.20  ? 421 TYR A O   1 
ATOM   3287 C  CB  . TYR A 1 418 ? 6.463   150.443 144.430 1.00 41.31  ? 421 TYR A CB  1 
ATOM   3288 C  CG  . TYR A 1 418 ? 5.816   149.165 144.941 1.00 43.15  ? 421 TYR A CG  1 
ATOM   3289 C  CD1 . TYR A 1 418 ? 5.579   148.961 146.309 1.00 41.54  ? 421 TYR A CD1 1 
ATOM   3290 C  CD2 . TYR A 1 418 ? 5.434   148.164 144.061 1.00 39.63  ? 421 TYR A CD2 1 
ATOM   3291 C  CE1 . TYR A 1 418 ? 5.000   147.784 146.769 1.00 45.06  ? 421 TYR A CE1 1 
ATOM   3292 C  CE2 . TYR A 1 418 ? 4.849   146.997 144.508 1.00 39.82  ? 421 TYR A CE2 1 
ATOM   3293 C  CZ  . TYR A 1 418 ? 4.636   146.807 145.858 1.00 41.03  ? 421 TYR A CZ  1 
ATOM   3294 O  OH  . TYR A 1 418 ? 4.057   145.638 146.293 1.00 38.20  ? 421 TYR A OH  1 
ATOM   3295 N  N   . PHE A 1 419 ? 8.103   151.289 147.003 1.00 44.09  ? 422 PHE A N   1 
ATOM   3296 C  CA  . PHE A 1 419 ? 8.246   151.182 148.457 1.00 45.16  ? 422 PHE A CA  1 
ATOM   3297 C  C   . PHE A 1 419 ? 6.960   151.709 149.074 1.00 43.21  ? 422 PHE A C   1 
ATOM   3298 O  O   . PHE A 1 419 ? 6.720   152.917 149.066 1.00 50.20  ? 422 PHE A O   1 
ATOM   3299 C  CB  . PHE A 1 419 ? 9.459   151.966 148.963 1.00 43.38  ? 422 PHE A CB  1 
ATOM   3300 C  CG  . PHE A 1 419 ? 9.760   151.758 150.429 1.00 44.13  ? 422 PHE A CG  1 
ATOM   3301 C  CD1 . PHE A 1 419 ? 10.332  150.572 150.874 1.00 42.74  ? 422 PHE A CD1 1 
ATOM   3302 C  CD2 . PHE A 1 419 ? 9.490   152.756 151.360 1.00 49.13  ? 422 PHE A CD2 1 
ATOM   3303 C  CE1 . PHE A 1 419 ? 10.622  150.379 152.214 1.00 44.87  ? 422 PHE A CE1 1 
ATOM   3304 C  CE2 . PHE A 1 419 ? 9.778   152.572 152.711 1.00 48.07  ? 422 PHE A CE2 1 
ATOM   3305 C  CZ  . PHE A 1 419 ? 10.348  151.380 153.140 1.00 43.31  ? 422 PHE A CZ  1 
ATOM   3306 N  N   . PHE A 1 420 ? 6.120   150.815 149.575 1.00 36.12  ? 423 PHE A N   1 
ATOM   3307 C  CA  . PHE A 1 420 ? 4.805   151.197 150.077 1.00 43.28  ? 423 PHE A CA  1 
ATOM   3308 C  C   . PHE A 1 420 ? 4.915   151.499 151.578 1.00 47.19  ? 423 PHE A C   1 
ATOM   3309 O  O   . PHE A 1 420 ? 5.180   150.599 152.382 1.00 45.11  ? 423 PHE A O   1 
ATOM   3310 C  CB  . PHE A 1 420 ? 3.808   150.081 149.783 1.00 40.34  ? 423 PHE A CB  1 
ATOM   3311 C  CG  . PHE A 1 420 ? 2.435   150.331 150.326 1.00 42.75  ? 423 PHE A CG  1 
ATOM   3312 C  CD1 . PHE A 1 420 ? 2.122   150.007 151.645 1.00 44.39  ? 423 PHE A CD1 1 
ATOM   3313 C  CD2 . PHE A 1 420 ? 1.455   150.882 149.525 1.00 37.12  ? 423 PHE A CD2 1 
ATOM   3314 C  CE1 . PHE A 1 420 ? 0.847   150.236 152.150 1.00 43.66  ? 423 PHE A CE1 1 
ATOM   3315 C  CE2 . PHE A 1 420 ? 0.179   151.115 150.017 1.00 45.30  ? 423 PHE A CE2 1 
ATOM   3316 C  CZ  . PHE A 1 420 ? -0.129  150.793 151.337 1.00 44.69  ? 423 PHE A CZ  1 
ATOM   3317 N  N   . ASN A 1 421 ? 4.718   152.762 151.961 1.00 45.93  ? 424 ASN A N   1 
ATOM   3318 C  CA  . ASN A 1 421 ? 4.939   153.180 153.347 1.00 47.90  ? 424 ASN A CA  1 
ATOM   3319 C  C   . ASN A 1 421 ? 3.811   154.091 153.827 1.00 47.21  ? 424 ASN A C   1 
ATOM   3320 O  O   . ASN A 1 421 ? 4.035   155.141 154.428 1.00 51.91  ? 424 ASN A O   1 
ATOM   3321 C  CB  . ASN A 1 421 ? 6.308   153.851 153.520 1.00 44.15  ? 424 ASN A CB  1 
ATOM   3322 C  CG  . ASN A 1 421 ? 6.447   155.156 152.732 1.00 54.98  ? 424 ASN A CG  1 
ATOM   3323 O  OD1 . ASN A 1 421 ? 5.526   155.591 152.033 1.00 54.85  ? 424 ASN A OD1 1 
ATOM   3324 N  ND2 . ASN A 1 421 ? 7.610   155.787 152.851 1.00 55.38  ? 424 ASN A ND2 1 
ATOM   3325 N  N   . HIS A 1 422 ? 2.569   153.695 153.583 1.00 47.00  ? 425 HIS A N   1 
ATOM   3326 C  CA  . HIS A 1 422 ? 1.426   154.388 154.159 1.00 48.37  ? 425 HIS A CA  1 
ATOM   3327 C  C   . HIS A 1 422 ? 0.648   153.419 155.032 1.00 52.44  ? 425 HIS A C   1 
ATOM   3328 O  O   . HIS A 1 422 ? 0.148   152.401 154.538 1.00 50.53  ? 425 HIS A O   1 
ATOM   3329 C  CB  . HIS A 1 422 ? 0.503   154.968 153.095 1.00 46.76  ? 425 HIS A CB  1 
ATOM   3330 C  CG  . HIS A 1 422 ? -0.757  155.540 153.665 1.00 51.34  ? 425 HIS A CG  1 
ATOM   3331 N  ND1 . HIS A 1 422 ? -0.795  156.761 154.305 1.00 49.62  ? 425 HIS A ND1 1 
ATOM   3332 C  CD2 . HIS A 1 422 ? -2.016  155.043 153.725 1.00 51.20  ? 425 HIS A CD2 1 
ATOM   3333 C  CE1 . HIS A 1 422 ? -2.030  157.001 154.712 1.00 50.54  ? 425 HIS A CE1 1 
ATOM   3334 N  NE2 . HIS A 1 422 ? -2.789  155.974 154.377 1.00 47.43  ? 425 HIS A NE2 1 
ATOM   3335 N  N   . ARG A 1 423 ? 0.531   153.743 156.322 1.00 49.82  ? 426 ARG A N   1 
ATOM   3336 C  CA  . ARG A 1 423 ? -0.283  152.945 157.233 1.00 49.48  ? 426 ARG A CA  1 
ATOM   3337 C  C   . ARG A 1 423 ? -1.759  153.323 157.092 1.00 49.17  ? 426 ARG A C   1 
ATOM   3338 O  O   . ARG A 1 423 ? -2.126  154.491 157.260 1.00 50.38  ? 426 ARG A O   1 
ATOM   3339 C  CB  . ARG A 1 423 ? 0.180   153.134 158.672 1.00 48.89  ? 426 ARG A CB  1 
ATOM   3340 C  CG  . ARG A 1 423 ? -0.636  152.319 159.645 1.00 53.73  ? 426 ARG A CG  1 
ATOM   3341 C  CD  . ARG A 1 423 ? -0.072  152.365 161.034 1.00 49.84  ? 426 ARG A CD  1 
ATOM   3342 N  NE  . ARG A 1 423 ? -1.100  152.008 162.000 1.00 53.76  ? 426 ARG A NE  1 
ATOM   3343 C  CZ  . ARG A 1 423 ? -1.119  150.873 162.684 1.00 53.89  ? 426 ARG A CZ  1 
ATOM   3344 N  NH1 . ARG A 1 423 ? -0.149  149.983 162.522 1.00 49.61  ? 426 ARG A NH1 1 
ATOM   3345 N  NH2 . ARG A 1 423 ? -2.106  150.639 163.541 1.00 52.98  ? 426 ARG A NH2 1 
ATOM   3346 N  N   . ALA A 1 424 ? -2.602  152.335 156.795 1.00 44.83  ? 427 ALA A N   1 
ATOM   3347 C  CA  . ALA A 1 424 ? -4.028  152.592 156.648 1.00 40.95  ? 427 ALA A CA  1 
ATOM   3348 C  C   . ALA A 1 424 ? -4.600  153.246 157.905 1.00 54.63  ? 427 ALA A C   1 
ATOM   3349 O  O   . ALA A 1 424 ? -4.273  152.873 159.041 1.00 50.83  ? 427 ALA A O   1 
ATOM   3350 C  CB  . ALA A 1 424 ? -4.775  151.295 156.340 1.00 38.49  ? 427 ALA A CB  1 
ATOM   3351 N  N   . SER A 1 425 ? -5.469  154.233 157.687 1.00 49.11  ? 428 SER A N   1 
ATOM   3352 C  CA  . SER A 1 425 ? -6.048  154.974 158.794 1.00 48.40  ? 428 SER A CA  1 
ATOM   3353 C  C   . SER A 1 425 ? -6.889  154.078 159.697 1.00 54.09  ? 428 SER A C   1 
ATOM   3354 O  O   . SER A 1 425 ? -6.965  154.319 160.906 1.00 55.56  ? 428 SER A O   1 
ATOM   3355 C  CB  . SER A 1 425 ? -6.892  156.120 158.248 1.00 53.03  ? 428 SER A CB  1 
ATOM   3356 O  OG  . SER A 1 425 ? -8.052  155.612 157.615 1.00 52.12  ? 428 SER A OG  1 
ATOM   3357 N  N   . ASN A 1 426 ? -7.512  153.037 159.141 1.00 51.13  ? 429 ASN A N   1 
ATOM   3358 C  CA  . ASN A 1 426 ? -8.423  152.165 159.875 1.00 45.13  ? 429 ASN A CA  1 
ATOM   3359 C  C   . ASN A 1 426 ? -7.773  150.855 160.315 1.00 43.48  ? 429 ASN A C   1 
ATOM   3360 O  O   . ASN A 1 426 ? -8.483  149.872 160.553 1.00 42.77  ? 429 ASN A O   1 
ATOM   3361 C  CB  . ASN A 1 426 ? -9.652  151.852 159.018 1.00 38.48  ? 429 ASN A CB  1 
ATOM   3362 C  CG  . ASN A 1 426 ? -9.267  151.318 157.639 1.00 52.19  ? 429 ASN A CG  1 
ATOM   3363 O  OD1 . ASN A 1 426 ? -8.076  151.123 157.342 1.00 42.92  ? 429 ASN A OD1 1 
ATOM   3364 N  ND2 . ASN A 1 426 ? -10.269 151.081 156.791 1.00 50.77  ? 429 ASN A ND2 1 
ATOM   3365 N  N   . LEU A 1 427 ? -6.447  150.801 160.389 1.00 42.75  ? 430 LEU A N   1 
ATOM   3366 C  CA  . LEU A 1 427 ? -5.779  149.552 160.731 1.00 39.93  ? 430 LEU A CA  1 
ATOM   3367 C  C   . LEU A 1 427 ? -6.023  149.216 162.203 1.00 46.18  ? 430 LEU A C   1 
ATOM   3368 O  O   . LEU A 1 427 ? -5.780  150.050 163.081 1.00 36.97  ? 430 LEU A O   1 
ATOM   3369 C  CB  . LEU A 1 427 ? -4.282  149.668 160.452 1.00 40.12  ? 430 LEU A CB  1 
ATOM   3370 C  CG  . LEU A 1 427 ? -3.650  148.658 159.499 1.00 46.72  ? 430 LEU A CG  1 
ATOM   3371 C  CD1 . LEU A 1 427 ? -2.167  148.971 159.335 1.00 51.18  ? 430 LEU A CD1 1 
ATOM   3372 C  CD2 . LEU A 1 427 ? -3.859  147.240 159.990 1.00 43.45  ? 430 LEU A CD2 1 
ATOM   3373 N  N   . VAL A 1 428 ? -6.499  147.992 162.462 1.00 38.13  ? 431 VAL A N   1 
ATOM   3374 C  CA  . VAL A 1 428 ? -6.810  147.551 163.815 1.00 44.59  ? 431 VAL A CA  1 
ATOM   3375 C  C   . VAL A 1 428 ? -5.608  146.956 164.546 1.00 51.48  ? 431 VAL A C   1 
ATOM   3376 O  O   . VAL A 1 428 ? -5.645  146.839 165.781 1.00 42.08  ? 431 VAL A O   1 
ATOM   3377 C  CB  . VAL A 1 428 ? -7.950  146.513 163.822 1.00 48.09  ? 431 VAL A CB  1 
ATOM   3378 C  CG1 . VAL A 1 428 ? -9.250  147.131 163.333 1.00 40.06  ? 431 VAL A CG1 1 
ATOM   3379 C  CG2 . VAL A 1 428 ? -7.569  145.280 163.000 1.00 34.87  ? 431 VAL A CG2 1 
ATOM   3380 N  N   . TRP A 1 429 ? -4.564  146.548 163.821 1.00 48.26  ? 432 TRP A N   1 
ATOM   3381 C  CA  . TRP A 1 429 ? -3.347  146.070 164.455 1.00 42.72  ? 432 TRP A CA  1 
ATOM   3382 C  C   . TRP A 1 429 ? -2.630  147.230 165.150 1.00 42.63  ? 432 TRP A C   1 
ATOM   3383 O  O   . TRP A 1 429 ? -2.761  148.383 164.731 1.00 43.42  ? 432 TRP A O   1 
ATOM   3384 C  CB  . TRP A 1 429 ? -2.430  145.427 163.414 1.00 39.25  ? 432 TRP A CB  1 
ATOM   3385 C  CG  . TRP A 1 429 ? -2.928  144.113 162.871 1.00 42.46  ? 432 TRP A CG  1 
ATOM   3386 C  CD1 . TRP A 1 429 ? -3.522  143.893 161.653 1.00 43.85  ? 432 TRP A CD1 1 
ATOM   3387 C  CD2 . TRP A 1 429 ? -2.866  142.833 163.524 1.00 43.02  ? 432 TRP A CD2 1 
ATOM   3388 N  NE1 . TRP A 1 429 ? -3.834  142.558 161.516 1.00 43.38  ? 432 TRP A NE1 1 
ATOM   3389 C  CE2 . TRP A 1 429 ? -3.443  141.890 162.650 1.00 43.14  ? 432 TRP A CE2 1 
ATOM   3390 C  CE3 . TRP A 1 429 ? -2.385  142.397 164.769 1.00 48.69  ? 432 TRP A CE3 1 
ATOM   3391 C  CZ2 . TRP A 1 429 ? -3.546  140.540 162.978 1.00 41.08  ? 432 TRP A CZ2 1 
ATOM   3392 C  CZ3 . TRP A 1 429 ? -2.493  141.055 165.092 1.00 41.17  ? 432 TRP A CZ3 1 
ATOM   3393 C  CH2 . TRP A 1 429 ? -3.067  140.143 164.200 1.00 43.20  ? 432 TRP A CH2 1 
ATOM   3394 N  N   . PRO A 1 430 ? -1.866  146.953 166.213 1.00 42.61  ? 433 PRO A N   1 
ATOM   3395 C  CA  . PRO A 1 430 ? -1.237  148.039 166.980 1.00 43.73  ? 433 PRO A CA  1 
ATOM   3396 C  C   . PRO A 1 430 ? -0.335  148.924 166.133 1.00 45.45  ? 433 PRO A C   1 
ATOM   3397 O  O   . PRO A 1 430 ? 0.108   148.564 165.042 1.00 47.19  ? 433 PRO A O   1 
ATOM   3398 C  CB  . PRO A 1 430 ? -0.417  147.301 168.042 1.00 35.12  ? 433 PRO A CB  1 
ATOM   3399 C  CG  . PRO A 1 430 ? -0.227  145.919 167.478 1.00 39.70  ? 433 PRO A CG  1 
ATOM   3400 C  CD  . PRO A 1 430 ? -1.518  145.634 166.765 1.00 38.59  ? 433 PRO A CD  1 
ATOM   3401 N  N   . GLU A 1 431 ? -0.036  150.088 166.702 1.00 52.24  ? 434 GLU A N   1 
ATOM   3402 C  CA  . GLU A 1 431 ? 0.750   151.115 166.035 1.00 47.73  ? 434 GLU A CA  1 
ATOM   3403 C  C   . GLU A 1 431 ? 2.205   150.692 165.867 1.00 47.37  ? 434 GLU A C   1 
ATOM   3404 O  O   . GLU A 1 431 ? 2.835   151.026 164.855 1.00 50.85  ? 434 GLU A O   1 
ATOM   3405 C  CB  . GLU A 1 431 ? 0.654   152.417 166.843 1.00 47.24  ? 434 GLU A CB  1 
ATOM   3406 C  CG  . GLU A 1 431 ? 0.971   153.670 166.091 1.00 57.34  ? 434 GLU A CG  1 
ATOM   3407 C  CD  . GLU A 1 431 ? -0.074  153.973 165.026 1.00 74.54  ? 434 GLU A CD  1 
ATOM   3408 O  OE1 . GLU A 1 431 ? -1.287  153.910 165.346 1.00 77.47  ? 434 GLU A OE1 1 
ATOM   3409 O  OE2 . GLU A 1 431 ? 0.316   154.258 163.869 1.00 65.62  ? 434 GLU A OE2 1 
ATOM   3410 N  N   . TRP A 1 432 ? 2.768   149.963 166.840 1.00 41.50  ? 435 TRP A N   1 
ATOM   3411 C  CA  . TRP A 1 432 ? 4.191   149.628 166.743 1.00 46.39  ? 435 TRP A CA  1 
ATOM   3412 C  C   . TRP A 1 432 ? 4.505   148.746 165.535 1.00 43.75  ? 435 TRP A C   1 
ATOM   3413 O  O   . TRP A 1 432 ? 5.663   148.689 165.102 1.00 37.95  ? 435 TRP A O   1 
ATOM   3414 C  CB  . TRP A 1 432 ? 4.698   148.944 168.016 1.00 36.39  ? 435 TRP A CB  1 
ATOM   3415 C  CG  . TRP A 1 432 ? 4.114   147.584 168.299 1.00 46.80  ? 435 TRP A CG  1 
ATOM   3416 C  CD1 . TRP A 1 432 ? 3.024   147.305 169.085 1.00 47.79  ? 435 TRP A CD1 1 
ATOM   3417 C  CD2 . TRP A 1 432 ? 4.602   146.313 167.832 1.00 46.20  ? 435 TRP A CD2 1 
ATOM   3418 N  NE1 . TRP A 1 432 ? 2.801   145.942 169.126 1.00 46.92  ? 435 TRP A NE1 1 
ATOM   3419 C  CE2 . TRP A 1 432 ? 3.752   145.314 168.365 1.00 46.80  ? 435 TRP A CE2 1 
ATOM   3420 C  CE3 . TRP A 1 432 ? 5.667   145.923 167.011 1.00 46.75  ? 435 TRP A CE3 1 
ATOM   3421 C  CZ2 . TRP A 1 432 ? 3.935   143.954 168.098 1.00 48.26  ? 435 TRP A CZ2 1 
ATOM   3422 C  CZ3 . TRP A 1 432 ? 5.848   144.570 166.747 1.00 43.24  ? 435 TRP A CZ3 1 
ATOM   3423 C  CH2 . TRP A 1 432 ? 4.984   143.604 167.283 1.00 44.98  ? 435 TRP A CH2 1 
ATOM   3424 N  N   . MET A 1 433 ? 3.507   148.053 164.993 1.00 47.15  ? 436 MET A N   1 
ATOM   3425 C  CA  . MET A 1 433 ? 3.734   147.174 163.853 1.00 48.87  ? 436 MET A CA  1 
ATOM   3426 C  C   . MET A 1 433 ? 3.920   147.942 162.551 1.00 45.46  ? 436 MET A C   1 
ATOM   3427 O  O   . MET A 1 433 ? 4.492   147.391 161.607 1.00 48.28  ? 436 MET A O   1 
ATOM   3428 C  CB  . MET A 1 433 ? 2.586   146.171 163.736 1.00 42.03  ? 436 MET A CB  1 
ATOM   3429 C  CG  . MET A 1 433 ? 2.533   145.213 164.908 1.00 39.76  ? 436 MET A CG  1 
ATOM   3430 S  SD  . MET A 1 433 ? 1.190   144.030 164.818 1.00 43.74  ? 436 MET A SD  1 
ATOM   3431 C  CE  . MET A 1 433 ? 1.928   142.720 163.844 1.00 46.35  ? 436 MET A CE  1 
ATOM   3432 N  N   . GLY A 1 434 ? 3.461   149.191 162.486 1.00 47.07  ? 437 GLY A N   1 
ATOM   3433 C  CA  . GLY A 1 434 ? 3.834   150.083 161.408 1.00 43.14  ? 437 GLY A CA  1 
ATOM   3434 C  C   . GLY A 1 434 ? 3.064   149.844 160.126 1.00 46.58  ? 437 GLY A C   1 
ATOM   3435 O  O   . GLY A 1 434 ? 1.859   149.566 160.166 1.00 46.96  ? 437 GLY A O   1 
ATOM   3436 N  N   . VAL A 1 435 ? 3.753   149.954 158.988 1.00 47.14  ? 438 VAL A N   1 
ATOM   3437 C  CA  . VAL A 1 435 ? 3.149   149.738 157.665 1.00 41.46  ? 438 VAL A CA  1 
ATOM   3438 C  C   . VAL A 1 435 ? 3.260   148.239 157.405 1.00 46.06  ? 438 VAL A C   1 
ATOM   3439 O  O   . VAL A 1 435 ? 4.245   147.739 156.846 1.00 44.41  ? 438 VAL A O   1 
ATOM   3440 C  CB  . VAL A 1 435 ? 3.824   150.573 156.582 1.00 43.29  ? 438 VAL A CB  1 
ATOM   3441 C  CG1 . VAL A 1 435 ? 3.119   150.366 155.244 1.00 42.79  ? 438 VAL A CG1 1 
ATOM   3442 C  CG2 . VAL A 1 435 ? 3.830   152.050 156.967 1.00 43.18  ? 438 VAL A CG2 1 
ATOM   3443 N  N   . ILE A 1 436 ? 2.240   147.511 157.822 1.00 44.16  ? 439 ILE A N   1 
ATOM   3444 C  CA  . ILE A 1 436 ? 2.405   146.081 158.025 1.00 46.11  ? 439 ILE A CA  1 
ATOM   3445 C  C   . ILE A 1 436 ? 2.380   145.356 156.694 1.00 44.72  ? 439 ILE A C   1 
ATOM   3446 O  O   . ILE A 1 436 ? 1.614   145.689 155.781 1.00 46.65  ? 439 ILE A O   1 
ATOM   3447 C  CB  . ILE A 1 436 ? 1.330   145.513 158.961 1.00 42.07  ? 439 ILE A CB  1 
ATOM   3448 C  CG1 . ILE A 1 436 ? 1.127   146.402 160.176 1.00 53.15  ? 439 ILE A CG1 1 
ATOM   3449 C  CG2 . ILE A 1 436 ? 1.786   144.192 159.459 1.00 44.01  ? 439 ILE A CG2 1 
ATOM   3450 C  CD1 . ILE A 1 436 ? 0.175   145.786 161.160 1.00 51.88  ? 439 ILE A CD1 1 
ATOM   3451 N  N   . HIS A 1 437 ? 3.221   144.344 156.605 1.00 43.12  ? 440 HIS A N   1 
ATOM   3452 C  CA  . HIS A 1 437 ? 3.131   143.372 155.540 1.00 49.57  ? 440 HIS A CA  1 
ATOM   3453 C  C   . HIS A 1 437 ? 1.684   142.926 155.336 1.00 46.55  ? 440 HIS A C   1 
ATOM   3454 O  O   . HIS A 1 437 ? 0.966   142.639 156.300 1.00 45.49  ? 440 HIS A O   1 
ATOM   3455 C  CB  . HIS A 1 437 ? 4.039   142.198 155.903 1.00 55.65  ? 440 HIS A CB  1 
ATOM   3456 C  CG  . HIS A 1 437 ? 3.638   140.916 155.271 1.00 47.82  ? 440 HIS A CG  1 
ATOM   3457 N  ND1 . HIS A 1 437 ? 2.869   139.978 155.925 1.00 50.37  ? 440 HIS A ND1 1 
ATOM   3458 C  CD2 . HIS A 1 437 ? 3.887   140.418 154.041 1.00 47.02  ? 440 HIS A CD2 1 
ATOM   3459 C  CE1 . HIS A 1 437 ? 2.653   138.955 155.120 1.00 53.91  ? 440 HIS A CE1 1 
ATOM   3460 N  NE2 . HIS A 1 437 ? 3.250   139.203 153.968 1.00 56.16  ? 440 HIS A NE2 1 
ATOM   3461 N  N   . GLY A 1 438 ? 1.244   142.921 154.074 1.00 40.35  ? 441 GLY A N   1 
ATOM   3462 C  CA  . GLY A 1 438 ? -0.095  142.501 153.721 1.00 38.68  ? 441 GLY A CA  1 
ATOM   3463 C  C   . GLY A 1 438 ? -1.133  143.604 153.657 1.00 44.34  ? 441 GLY A C   1 
ATOM   3464 O  O   . GLY A 1 438 ? -2.233  143.377 153.115 1.00 37.84  ? 441 GLY A O   1 
ATOM   3465 N  N   . TYR A 1 439 ? -0.831  144.796 154.170 1.00 38.85  ? 442 TYR A N   1 
ATOM   3466 C  CA  . TYR A 1 439 ? -1.852  145.830 154.270 1.00 43.31  ? 442 TYR A CA  1 
ATOM   3467 C  C   . TYR A 1 439 ? -1.760  146.858 153.151 1.00 47.08  ? 442 TYR A C   1 
ATOM   3468 O  O   . TYR A 1 439 ? -2.363  147.930 153.250 1.00 49.97  ? 442 TYR A O   1 
ATOM   3469 C  CB  . TYR A 1 439 ? -1.831  146.459 155.674 1.00 39.84  ? 442 TYR A CB  1 
ATOM   3470 C  CG  . TYR A 1 439 ? -2.637  145.547 156.562 1.00 39.10  ? 442 TYR A CG  1 
ATOM   3471 C  CD1 . TYR A 1 439 ? -4.011  145.709 156.675 1.00 40.16  ? 442 TYR A CD1 1 
ATOM   3472 C  CD2 . TYR A 1 439 ? -2.054  144.438 157.168 1.00 39.78  ? 442 TYR A CD2 1 
ATOM   3473 C  CE1 . TYR A 1 439 ? -4.771  144.841 157.413 1.00 39.91  ? 442 TYR A CE1 1 
ATOM   3474 C  CE2 . TYR A 1 439 ? -2.812  143.560 157.923 1.00 38.41  ? 442 TYR A CE2 1 
ATOM   3475 C  CZ  . TYR A 1 439 ? -4.170  143.767 158.035 1.00 40.71  ? 442 TYR A CZ  1 
ATOM   3476 O  OH  . TYR A 1 439 ? -4.944  142.900 158.752 1.00 38.80  ? 442 TYR A OH  1 
ATOM   3477 N  N   . GLU A 1 440 ? -1.040  146.529 152.072 1.00 44.88  ? 443 GLU A N   1 
ATOM   3478 C  CA  . GLU A 1 440 ? -1.206  147.197 150.791 1.00 45.90  ? 443 GLU A CA  1 
ATOM   3479 C  C   . GLU A 1 440 ? -2.233  146.499 149.913 1.00 45.51  ? 443 GLU A C   1 
ATOM   3480 O  O   . GLU A 1 440 ? -2.764  147.121 148.989 1.00 45.26  ? 443 GLU A O   1 
ATOM   3481 C  CB  . GLU A 1 440 ? 0.133   147.263 150.041 1.00 44.16  ? 443 GLU A CB  1 
ATOM   3482 C  CG  . GLU A 1 440 ? 0.405   146.069 149.118 1.00 39.78  ? 443 GLU A CG  1 
ATOM   3483 C  CD  . GLU A 1 440 ? 0.705   144.764 149.857 1.00 48.83  ? 443 GLU A CD  1 
ATOM   3484 O  OE1 . GLU A 1 440 ? 0.525   144.692 151.098 1.00 48.49  ? 443 GLU A OE1 1 
ATOM   3485 O  OE2 . GLU A 1 440 ? 1.130   143.798 149.184 1.00 45.21  ? 443 GLU A OE2 1 
ATOM   3486 N  N   . ILE A 1 441 ? -2.537  145.229 150.194 1.00 44.41  ? 444 ILE A N   1 
ATOM   3487 C  CA  . ILE A 1 441 ? -3.438  144.473 149.329 1.00 42.91  ? 444 ILE A CA  1 
ATOM   3488 C  C   . ILE A 1 441 ? -4.783  145.173 149.208 1.00 41.30  ? 444 ILE A C   1 
ATOM   3489 O  O   . ILE A 1 441 ? -5.352  145.273 148.112 1.00 43.33  ? 444 ILE A O   1 
ATOM   3490 C  CB  . ILE A 1 441 ? -3.596  143.033 149.847 1.00 40.80  ? 444 ILE A CB  1 
ATOM   3491 C  CG1 . ILE A 1 441 ? -2.246  142.308 149.857 1.00 40.51  ? 444 ILE A CG1 1 
ATOM   3492 C  CG2 . ILE A 1 441 ? -4.621  142.281 149.008 1.00 39.81  ? 444 ILE A CG2 1 
ATOM   3493 C  CD1 . ILE A 1 441 ? -2.327  140.922 150.451 1.00 38.91  ? 444 ILE A CD1 1 
ATOM   3494 N  N   . GLU A 1 442 ? -5.315  145.672 150.322 1.00 40.49  ? 445 GLU A N   1 
ATOM   3495 C  CA  . GLU A 1 442 ? -6.615  146.334 150.265 1.00 45.27  ? 445 GLU A CA  1 
ATOM   3496 C  C   . GLU A 1 442 ? -6.601  147.525 149.314 1.00 43.53  ? 445 GLU A C   1 
ATOM   3497 O  O   . GLU A 1 442 ? -7.612  147.805 148.658 1.00 40.69  ? 445 GLU A O   1 
ATOM   3498 C  CB  . GLU A 1 442 ? -7.045  146.771 151.662 1.00 42.72  ? 445 GLU A CB  1 
ATOM   3499 C  CG  . GLU A 1 442 ? -6.036  147.611 152.392 1.00 41.88  ? 445 GLU A CG  1 
ATOM   3500 C  CD  . GLU A 1 442 ? -6.211  147.507 153.899 1.00 51.01  ? 445 GLU A CD  1 
ATOM   3501 O  OE1 . GLU A 1 442 ? -6.577  146.404 154.380 1.00 48.84  ? 445 GLU A OE1 1 
ATOM   3502 O  OE2 . GLU A 1 442 ? -6.000  148.527 154.591 1.00 43.94  ? 445 GLU A OE2 1 
ATOM   3503 N  N   . PHE A 1 443 ? -5.469  148.226 149.216 1.00 39.25  ? 446 PHE A N   1 
ATOM   3504 C  CA  . PHE A 1 443 ? -5.356  149.311 148.248 1.00 43.25  ? 446 PHE A CA  1 
ATOM   3505 C  C   . PHE A 1 443 ? -5.309  148.780 146.813 1.00 46.75  ? 446 PHE A C   1 
ATOM   3506 O  O   . PHE A 1 443 ? -5.915  149.371 145.911 1.00 40.03  ? 446 PHE A O   1 
ATOM   3507 C  CB  . PHE A 1 443 ? -4.126  150.161 148.559 1.00 39.58  ? 446 PHE A CB  1 
ATOM   3508 C  CG  . PHE A 1 443 ? -4.277  150.982 149.799 1.00 46.35  ? 446 PHE A CG  1 
ATOM   3509 C  CD1 . PHE A 1 443 ? -4.031  150.429 151.051 1.00 45.91  ? 446 PHE A CD1 1 
ATOM   3510 C  CD2 . PHE A 1 443 ? -4.709  152.295 149.726 1.00 46.55  ? 446 PHE A CD2 1 
ATOM   3511 C  CE1 . PHE A 1 443 ? -4.204  151.177 152.207 1.00 47.28  ? 446 PHE A CE1 1 
ATOM   3512 C  CE2 . PHE A 1 443 ? -4.872  153.056 150.887 1.00 52.48  ? 446 PHE A CE2 1 
ATOM   3513 C  CZ  . PHE A 1 443 ? -4.621  152.494 152.126 1.00 46.08  ? 446 PHE A CZ  1 
ATOM   3514 N  N   . VAL A 1 444 ? -4.618  147.657 146.586 1.00 42.40  ? 447 VAL A N   1 
ATOM   3515 C  CA  . VAL A 1 444 ? -4.509  147.115 145.234 1.00 42.09  ? 447 VAL A CA  1 
ATOM   3516 C  C   . VAL A 1 444 ? -5.870  146.647 144.729 1.00 42.27  ? 447 VAL A C   1 
ATOM   3517 O  O   . VAL A 1 444 ? -6.140  146.698 143.526 1.00 42.22  ? 447 VAL A O   1 
ATOM   3518 C  CB  . VAL A 1 444 ? -3.451  145.988 145.194 1.00 42.73  ? 447 VAL A CB  1 
ATOM   3519 C  CG1 . VAL A 1 444 ? -3.478  145.243 143.870 1.00 38.92  ? 447 VAL A CG1 1 
ATOM   3520 C  CG2 . VAL A 1 444 ? -2.042  146.547 145.459 1.00 32.42  ? 447 VAL A CG2 1 
ATOM   3521 N  N   . PHE A 1 445 ? -6.767  146.222 145.618 1.00 40.68  ? 448 PHE A N   1 
ATOM   3522 C  CA  . PHE A 1 445 ? -8.076  145.740 145.181 1.00 40.70  ? 448 PHE A CA  1 
ATOM   3523 C  C   . PHE A 1 445 ? -9.171  146.801 145.282 1.00 41.81  ? 448 PHE A C   1 
ATOM   3524 O  O   . PHE A 1 445 ? -10.347 146.475 145.097 1.00 44.01  ? 448 PHE A O   1 
ATOM   3525 C  CB  . PHE A 1 445 ? -8.480  144.488 145.967 1.00 39.22  ? 448 PHE A CB  1 
ATOM   3526 C  CG  . PHE A 1 445 ? -7.837  143.217 145.470 1.00 39.52  ? 448 PHE A CG  1 
ATOM   3527 C  CD1 . PHE A 1 445 ? -6.486  142.983 145.666 1.00 40.95  ? 448 PHE A CD1 1 
ATOM   3528 C  CD2 . PHE A 1 445 ? -8.583  142.255 144.812 1.00 49.30  ? 448 PHE A CD2 1 
ATOM   3529 C  CE1 . PHE A 1 445 ? -5.887  141.826 145.210 1.00 39.12  ? 448 PHE A CE1 1 
ATOM   3530 C  CE2 . PHE A 1 445 ? -7.985  141.090 144.343 1.00 47.89  ? 448 PHE A CE2 1 
ATOM   3531 C  CZ  . PHE A 1 445 ? -6.632  140.879 144.545 1.00 42.58  ? 448 PHE A CZ  1 
ATOM   3532 N  N   . GLY A 1 446 ? -8.811  148.028 145.572 1.00 44.32  ? 449 GLY A N   1 
ATOM   3533 C  CA  . GLY A 1 446 ? -9.754  149.111 145.726 1.00 51.20  ? 449 GLY A CA  1 
ATOM   3534 C  C   . GLY A 1 446 ? -10.775 149.111 146.840 1.00 52.41  ? 449 GLY A C   1 
ATOM   3535 O  O   . GLY A 1 446 ? -11.849 149.607 146.682 1.00 50.28  ? 449 GLY A O   1 
ATOM   3536 N  N   . LEU A 1 447 ? -10.431 148.551 147.972 1.00 47.64  ? 450 LEU A N   1 
ATOM   3537 C  CA  . LEU A 1 447 ? -11.338 148.516 149.091 1.00 50.63  ? 450 LEU A CA  1 
ATOM   3538 C  C   . LEU A 1 447 ? -11.656 149.911 149.592 1.00 49.13  ? 450 LEU A C   1 
ATOM   3539 O  O   . LEU A 1 447 ? -12.747 150.179 149.972 1.00 49.90  ? 450 LEU A O   1 
ATOM   3540 C  CB  . LEU A 1 447 ? -10.848 147.578 150.166 1.00 49.56  ? 450 LEU A CB  1 
ATOM   3541 C  CG  . LEU A 1 447 ? -11.543 146.237 150.081 1.00 48.07  ? 450 LEU A CG  1 
ATOM   3542 C  CD1 . LEU A 1 447 ? -11.142 145.541 148.819 1.00 45.67  ? 450 LEU A CD1 1 
ATOM   3543 C  CD2 . LEU A 1 447 ? -11.147 145.402 151.256 1.00 48.06  ? 450 LEU A CD2 1 
ATOM   3544 N  N   . PRO A 1 448 ? -10.621 150.822 149.542 1.00 44.13  ? 451 PRO A N   1 
ATOM   3545 C  CA  . PRO A 1 448 ? -10.945 152.166 149.994 1.00 47.04  ? 451 PRO A CA  1 
ATOM   3546 C  C   . PRO A 1 448 ? -12.041 152.855 149.214 1.00 53.36  ? 451 PRO A C   1 
ATOM   3547 O  O   . PRO A 1 448 ? -12.537 153.825 149.672 1.00 56.87  ? 451 PRO A O   1 
ATOM   3548 C  CB  . PRO A 1 448 ? -9.668  152.912 149.778 1.00 51.77  ? 451 PRO A CB  1 
ATOM   3549 C  CG  . PRO A 1 448 ? -8.660  151.947 150.088 1.00 44.01  ? 451 PRO A CG  1 
ATOM   3550 C  CD  . PRO A 1 448 ? -9.115  150.793 149.329 1.00 49.39  ? 451 PRO A CD  1 
ATOM   3551 N  N   . LEU A 1 449 ? -12.377 152.403 148.036 1.00 56.47  ? 452 LEU A N   1 
ATOM   3552 C  CA  . LEU A 1 449 ? -13.425 153.023 147.258 1.00 59.56  ? 452 LEU A CA  1 
ATOM   3553 C  C   . LEU A 1 449 ? -14.797 152.823 147.844 1.00 59.84  ? 452 LEU A C   1 
ATOM   3554 O  O   . LEU A 1 449 ? -15.737 153.429 147.434 1.00 59.31  ? 452 LEU A O   1 
ATOM   3555 C  CB  . LEU A 1 449 ? -13.428 152.468 145.857 1.00 59.65  ? 452 LEU A CB  1 
ATOM   3556 C  CG  . LEU A 1 449 ? -12.469 153.077 144.871 1.00 56.33  ? 452 LEU A CG  1 
ATOM   3557 C  CD1 . LEU A 1 449 ? -11.090 152.923 145.405 1.00 52.13  ? 452 LEU A CD1 1 
ATOM   3558 C  CD2 . LEU A 1 449 ? -12.608 152.367 143.559 1.00 56.96  ? 452 LEU A CD2 1 
ATOM   3559 N  N   . VAL A 1 450 ? -14.901 151.927 148.790 1.00 52.85  ? 453 VAL A N   1 
ATOM   3560 C  CA  . VAL A 1 450 ? -16.152 151.608 149.440 1.00 61.22  ? 453 VAL A CA  1 
ATOM   3561 C  C   . VAL A 1 450 ? -16.240 152.450 150.686 1.00 62.43  ? 453 VAL A C   1 
ATOM   3562 O  O   . VAL A 1 450 ? -15.436 152.318 151.559 1.00 60.23  ? 453 VAL A O   1 
ATOM   3563 C  CB  . VAL A 1 450 ? -16.090 150.170 149.850 1.00 57.65  ? 453 VAL A CB  1 
ATOM   3564 C  CG1 . VAL A 1 450 ? -17.363 149.731 150.474 1.00 59.53  ? 453 VAL A CG1 1 
ATOM   3565 C  CG2 . VAL A 1 450 ? -15.744 149.335 148.662 1.00 55.81  ? 453 VAL A CG2 1 
ATOM   3566 N  N   . LYS A 1 451 ? -17.233 153.312 150.773 1.00 60.56  ? 454 LYS A N   1 
ATOM   3567 C  CA  . LYS A 1 451 ? -17.348 154.245 151.876 1.00 63.13  ? 454 LYS A CA  1 
ATOM   3568 C  C   . LYS A 1 451 ? -17.481 153.661 153.255 1.00 61.29  ? 454 LYS A C   1 
ATOM   3569 O  O   . LYS A 1 451 ? -16.868 154.131 154.162 1.00 53.13  ? 454 LYS A O   1 
ATOM   3570 C  CB  . LYS A 1 451 ? -18.529 155.165 151.608 1.00 70.84  ? 454 LYS A CB  1 
ATOM   3571 C  CG  . LYS A 1 451 ? -18.550 156.464 152.385 1.00 73.60  ? 454 LYS A CG  1 
ATOM   3572 N  N   . GLU A 1 452 ? -18.283 152.635 153.392 1.00 61.92  ? 455 GLU A N   1 
ATOM   3573 C  CA  . GLU A 1 452 ? -18.492 151.992 154.656 1.00 63.07  ? 455 GLU A CA  1 
ATOM   3574 C  C   . GLU A 1 452 ? -17.215 151.510 155.286 1.00 70.24  ? 455 GLU A C   1 
ATOM   3575 O  O   . GLU A 1 452 ? -17.155 151.353 156.475 1.00 70.40  ? 455 GLU A O   1 
ATOM   3576 C  CB  . GLU A 1 452 ? -19.445 150.809 154.521 1.00 61.70  ? 455 GLU A CB  1 
ATOM   3577 C  CG  . GLU A 1 452 ? -20.705 151.070 153.728 1.00 72.36  ? 455 GLU A CG  1 
ATOM   3578 C  CD  . GLU A 1 452 ? -20.418 151.395 152.283 1.00 81.73  ? 455 GLU A CD  1 
ATOM   3579 O  OE1 . GLU A 1 452 ? -19.569 152.270 152.073 1.00 82.22  ? 455 GLU A OE1 1 
ATOM   3580 O  OE2 . GLU A 1 452 ? -20.995 150.777 151.383 1.00 71.05  ? 455 GLU A OE2 1 
ATOM   3581 N  N   . LEU A 1 453 ? -16.203 151.256 154.490 1.00 68.19  ? 456 LEU A N   1 
ATOM   3582 C  CA  . LEU A 1 453 ? -14.949 150.754 155.000 1.00 61.31  ? 456 LEU A CA  1 
ATOM   3583 C  C   . LEU A 1 453 ? -14.147 151.732 155.836 1.00 58.68  ? 456 LEU A C   1 
ATOM   3584 O  O   . LEU A 1 453 ? -13.180 151.374 156.445 1.00 57.48  ? 456 LEU A O   1 
ATOM   3585 C  CB  . LEU A 1 453 ? -14.163 150.075 153.907 1.00 65.44  ? 456 LEU A CB  1 
ATOM   3586 C  CG  . LEU A 1 453 ? -14.899 148.861 153.384 1.00 61.75  ? 456 LEU A CG  1 
ATOM   3587 C  CD1 . LEU A 1 453 ? -14.081 148.085 152.404 1.00 53.19  ? 456 LEU A CD1 1 
ATOM   3588 C  CD2 . LEU A 1 453 ? -15.294 147.963 154.511 1.00 54.69  ? 456 LEU A CD2 1 
ATOM   3589 N  N   . ASN A 1 454 ? -14.544 152.981 155.825 1.00 53.67  ? 457 ASN A N   1 
ATOM   3590 C  CA  . ASN A 1 454 ? -13.962 153.982 156.714 1.00 61.08  ? 457 ASN A CA  1 
ATOM   3591 C  C   . ASN A 1 454 ? -12.527 154.355 156.330 1.00 57.16  ? 457 ASN A C   1 
ATOM   3592 O  O   . ASN A 1 454 ? -11.701 154.632 157.207 1.00 54.67  ? 457 ASN A O   1 
ATOM   3593 C  CB  . ASN A 1 454 ? -14.009 153.523 158.188 1.00 63.72  ? 457 ASN A CB  1 
ATOM   3594 C  CG  . ASN A 1 454 ? -15.441 153.360 158.738 1.00 72.76  ? 457 ASN A CG  1 
ATOM   3595 O  OD1 . ASN A 1 454 ? -16.408 153.850 158.148 1.00 72.77  ? 457 ASN A OD1 1 
ATOM   3596 N  ND2 . ASN A 1 454 ? -15.564 152.667 159.890 1.00 81.84  ? 457 ASN A ND2 1 
ATOM   3597 N  N   . TYR A 1 455 ? -12.203 154.381 155.036 1.00 52.72  ? 458 TYR A N   1 
ATOM   3598 C  CA  . TYR A 1 455 ? -10.924 154.928 154.596 1.00 46.96  ? 458 TYR A CA  1 
ATOM   3599 C  C   . TYR A 1 455 ? -11.071 156.425 154.374 1.00 51.16  ? 458 TYR A C   1 
ATOM   3600 O  O   . TYR A 1 455 ? -12.171 156.918 154.107 1.00 52.39  ? 458 TYR A O   1 
ATOM   3601 C  CB  . TYR A 1 455 ? -10.434 154.268 153.302 1.00 49.79  ? 458 TYR A CB  1 
ATOM   3602 C  CG  . TYR A 1 455 ? -10.042 152.821 153.437 1.00 44.52  ? 458 TYR A CG  1 
ATOM   3603 C  CD1 . TYR A 1 455 ? -10.980 151.811 153.263 1.00 45.15  ? 458 TYR A CD1 1 
ATOM   3604 C  CD2 . TYR A 1 455 ? -8.731  152.461 153.735 1.00 43.30  ? 458 TYR A CD2 1 
ATOM   3605 C  CE1 . TYR A 1 455 ? -10.626 150.480 153.374 1.00 46.22  ? 458 TYR A CE1 1 
ATOM   3606 C  CE2 . TYR A 1 455 ? -8.366  151.129 153.865 1.00 42.55  ? 458 TYR A CE2 1 
ATOM   3607 C  CZ  . TYR A 1 455 ? -9.320  150.142 153.684 1.00 45.60  ? 458 TYR A CZ  1 
ATOM   3608 O  OH  . TYR A 1 455 ? -8.972  148.813 153.806 1.00 44.44  ? 458 TYR A OH  1 
ATOM   3609 N  N   . THR A 1 456 ? -9.956  157.150 154.483 1.00 45.46  ? 459 THR A N   1 
ATOM   3610 C  CA  . THR A 1 456 ? -9.999  158.571 154.166 1.00 45.27  ? 459 THR A CA  1 
ATOM   3611 C  C   . THR A 1 456 ? -10.078 158.778 152.651 1.00 60.30  ? 459 THR A C   1 
ATOM   3612 O  O   . THR A 1 456 ? -9.849  157.864 151.850 1.00 54.39  ? 459 THR A O   1 
ATOM   3613 C  CB  . THR A 1 456 ? -8.782  159.302 154.728 1.00 53.56  ? 459 THR A CB  1 
ATOM   3614 O  OG1 . THR A 1 456 ? -7.608  158.925 153.996 1.00 52.21  ? 459 THR A OG1 1 
ATOM   3615 C  CG2 . THR A 1 456 ? -8.595  158.982 156.226 1.00 45.91  ? 459 THR A CG2 1 
ATOM   3616 N  N   . ALA A 1 457 ? -10.404 160.014 152.262 1.00 59.00  ? 460 ALA A N   1 
ATOM   3617 C  CA  . ALA A 1 457 ? -10.510 160.334 150.846 1.00 53.39  ? 460 ALA A CA  1 
ATOM   3618 C  C   . ALA A 1 457 ? -9.152  160.281 150.158 1.00 59.00  ? 460 ALA A C   1 
ATOM   3619 O  O   . ALA A 1 457 ? -9.066  159.875 148.990 1.00 57.78  ? 460 ALA A O   1 
ATOM   3620 C  CB  . ALA A 1 457 ? -11.154 161.705 150.666 1.00 48.62  ? 460 ALA A CB  1 
ATOM   3621 N  N   . GLU A 1 458 ? -8.084  160.673 150.860 1.00 58.16  ? 461 GLU A N   1 
ATOM   3622 C  CA  . GLU A 1 458 ? -6.745  160.528 150.296 1.00 63.36  ? 461 GLU A CA  1 
ATOM   3623 C  C   . GLU A 1 458 ? -6.367  159.058 150.143 1.00 61.98  ? 461 GLU A C   1 
ATOM   3624 O  O   . GLU A 1 458 ? -5.576  158.707 149.257 1.00 58.69  ? 461 GLU A O   1 
ATOM   3625 C  CB  . GLU A 1 458 ? -5.710  161.258 151.160 1.00 59.80  ? 461 GLU A CB  1 
ATOM   3626 C  CG  . GLU A 1 458 ? -6.157  162.620 151.659 1.00 62.92  ? 461 GLU A CG  1 
ATOM   3627 C  CD  . GLU A 1 458 ? -6.705  162.563 153.082 1.00 83.27  ? 461 GLU A CD  1 
ATOM   3628 O  OE1 . GLU A 1 458 ? -5.883  162.548 154.029 1.00 92.36  ? 461 GLU A OE1 1 
ATOM   3629 O  OE2 . GLU A 1 458 ? -7.950  162.516 153.257 1.00 77.50  ? 461 GLU A OE2 1 
ATOM   3630 N  N   . GLU A 1 459 ? -6.923  158.187 150.990 1.00 54.02  ? 462 GLU A N   1 
ATOM   3631 C  CA  . GLU A 1 459 ? -6.712  156.760 150.797 1.00 56.80  ? 462 GLU A CA  1 
ATOM   3632 C  C   . GLU A 1 459 ? -7.509  156.234 149.614 1.00 51.50  ? 462 GLU A C   1 
ATOM   3633 O  O   . GLU A 1 459 ? -7.100  155.254 148.982 1.00 53.80  ? 462 GLU A O   1 
ATOM   3634 C  CB  . GLU A 1 459 ? -7.052  156.003 152.077 1.00 41.60  ? 462 GLU A CB  1 
ATOM   3635 C  CG  . GLU A 1 459 ? -5.967  156.222 153.100 1.00 51.95  ? 462 GLU A CG  1 
ATOM   3636 C  CD  . GLU A 1 459 ? -6.308  155.718 154.486 1.00 53.51  ? 462 GLU A CD  1 
ATOM   3637 O  OE1 . GLU A 1 459 ? -7.513  155.550 154.809 1.00 46.76  ? 462 GLU A OE1 1 
ATOM   3638 O  OE2 . GLU A 1 459 ? -5.342  155.501 155.244 1.00 46.00  ? 462 GLU A OE2 1 
ATOM   3639 N  N   . GLU A 1 460 ? -8.635  156.867 149.290 1.00 49.42  ? 463 GLU A N   1 
ATOM   3640 C  CA  . GLU A 1 460 ? -9.325  156.504 148.061 1.00 55.04  ? 463 GLU A CA  1 
ATOM   3641 C  C   . GLU A 1 460 ? -8.509  156.917 146.842 1.00 50.40  ? 463 GLU A C   1 
ATOM   3642 O  O   . GLU A 1 460 ? -8.462  156.190 145.848 1.00 52.33  ? 463 GLU A O   1 
ATOM   3643 C  CB  . GLU A 1 460 ? -10.710 157.133 148.016 1.00 48.95  ? 463 GLU A CB  1 
ATOM   3644 C  CG  . GLU A 1 460 ? -11.535 156.605 146.861 1.00 56.85  ? 463 GLU A CG  1 
ATOM   3645 C  CD  . GLU A 1 460 ? -12.857 157.320 146.715 1.00 68.34  ? 463 GLU A CD  1 
ATOM   3646 O  OE1 . GLU A 1 460 ? -13.512 157.155 145.656 1.00 70.94  ? 463 GLU A OE1 1 
ATOM   3647 O  OE2 . GLU A 1 460 ? -13.235 158.056 147.659 1.00 66.13  ? 463 GLU A OE2 1 
ATOM   3648 N  N   . ALA A 1 461 ? -7.840  158.068 146.912 1.00 51.79  ? 464 ALA A N   1 
ATOM   3649 C  CA  . ALA A 1 461 ? -7.027  158.512 145.788 1.00 49.43  ? 464 ALA A CA  1 
ATOM   3650 C  C   . ALA A 1 461 ? -5.847  157.577 145.556 1.00 54.66  ? 464 ALA A C   1 
ATOM   3651 O  O   . ALA A 1 461 ? -5.533  157.232 144.405 1.00 51.97  ? 464 ALA A O   1 
ATOM   3652 C  CB  . ALA A 1 461 ? -6.538  159.939 146.025 1.00 48.67  ? 464 ALA A CB  1 
ATOM   3653 N  N   . LEU A 1 462 ? -5.204  157.151 146.622 1.00 49.33  ? 465 LEU A N   1 
ATOM   3654 C  CA  . LEU A 1 462 ? -4.062  156.270 146.543 1.00 49.74  ? 465 LEU A CA  1 
ATOM   3655 C  C   . LEU A 1 462 ? -4.398  154.935 145.962 1.00 49.66  ? 465 LEU A C   1 
ATOM   3656 O  O   . LEU A 1 462 ? -3.666  154.388 145.204 1.00 48.31  ? 465 LEU A O   1 
ATOM   3657 C  CB  . LEU A 1 462 ? -3.435  156.101 147.907 1.00 52.28  ? 465 LEU A CB  1 
ATOM   3658 C  CG  . LEU A 1 462 ? -2.267  155.160 148.005 1.00 54.16  ? 465 LEU A CG  1 
ATOM   3659 C  CD1 . LEU A 1 462 ? -1.159  155.617 147.108 1.00 47.06  ? 465 LEU A CD1 1 
ATOM   3660 C  CD2 . LEU A 1 462 ? -1.773  155.120 149.408 1.00 44.67  ? 465 LEU A CD2 1 
ATOM   3661 N  N   . SER A 1 463 ? -5.528  154.412 146.349 1.00 48.53  ? 466 SER A N   1 
ATOM   3662 C  CA  . SER A 1 463 ? -5.987  153.171 145.853 1.00 43.32  ? 466 SER A CA  1 
ATOM   3663 C  C   . SER A 1 463 ? -6.256  153.318 144.385 1.00 51.60  ? 466 SER A C   1 
ATOM   3664 O  O   . SER A 1 463 ? -6.000  152.425 143.635 1.00 52.10  ? 466 SER A O   1 
ATOM   3665 C  CB  . SER A 1 463 ? -7.224  152.761 146.580 1.00 45.62  ? 466 SER A CB  1 
ATOM   3666 O  OG  . SER A 1 463 ? -7.611  151.499 146.184 1.00 43.67  ? 466 SER A OG  1 
ATOM   3667 N  N   . ARG A 1 464 ? -6.815  154.442 143.986 1.00 49.73  ? 467 ARG A N   1 
ATOM   3668 C  CA  . ARG A 1 464 ? -7.106  154.666 142.593 1.00 53.96  ? 467 ARG A CA  1 
ATOM   3669 C  C   . ARG A 1 464 ? -5.830  154.717 141.798 1.00 50.09  ? 467 ARG A C   1 
ATOM   3670 O  O   . ARG A 1 464 ? -5.749  154.151 140.765 1.00 51.91  ? 467 ARG A O   1 
ATOM   3671 C  CB  . ARG A 1 464 ? -7.957  155.902 142.405 1.00 48.77  ? 467 ARG A CB  1 
ATOM   3672 C  CG  . ARG A 1 464 ? -9.427  155.601 142.416 1.00 50.12  ? 467 ARG A CG  1 
ATOM   3673 C  CD  . ARG A 1 464 ? -10.270 156.847 142.487 1.00 51.76  ? 467 ARG A CD  1 
ATOM   3674 N  NE  . ARG A 1 464 ? -11.648 156.578 142.852 1.00 58.77  ? 467 ARG A NE  1 
ATOM   3675 C  CZ  . ARG A 1 464 ? -12.491 155.922 142.092 1.00 60.84  ? 467 ARG A CZ  1 
ATOM   3676 N  NH1 . ARG A 1 464 ? -12.080 155.467 140.948 1.00 62.61  ? 467 ARG A NH1 1 
ATOM   3677 N  NH2 . ARG A 1 464 ? -13.723 155.704 142.470 1.00 66.46  ? 467 ARG A NH2 1 
ATOM   3678 N  N   . ARG A 1 465 ? -4.833  155.396 142.311 1.00 47.72  ? 468 ARG A N   1 
ATOM   3679 C  CA  . ARG A 1 465 ? -3.513  155.436 141.691 1.00 46.58  ? 468 ARG A CA  1 
ATOM   3680 C  C   . ARG A 1 465 ? -2.935  154.039 141.546 1.00 49.98  ? 468 ARG A C   1 
ATOM   3681 O  O   . ARG A 1 465 ? -2.485  153.648 140.465 1.00 52.54  ? 468 ARG A O   1 
ATOM   3682 C  CB  . ARG A 1 465 ? -2.563  156.296 142.523 1.00 53.37  ? 468 ARG A CB  1 
ATOM   3683 C  CG  . ARG A 1 465 ? -2.503  157.750 142.141 1.00 57.21  ? 468 ARG A CG  1 
ATOM   3684 C  CD  . ARG A 1 465 ? -1.620  158.521 143.114 1.00 58.57  ? 468 ARG A CD  1 
ATOM   3685 N  NE  . ARG A 1 465 ? -0.214  158.123 143.058 1.00 66.45  ? 468 ARG A NE  1 
ATOM   3686 C  CZ  . ARG A 1 465 ? 0.625   158.194 144.091 1.00 76.40  ? 468 ARG A CZ  1 
ATOM   3687 N  NH1 . ARG A 1 465 ? 1.897   157.816 143.950 1.00 72.06  ? 468 ARG A NH1 1 
ATOM   3688 N  NH2 . ARG A 1 465 ? 0.188   158.628 145.274 1.00 67.15  ? 468 ARG A NH2 1 
ATOM   3689 N  N   . ILE A 1 466 ? -2.935  153.273 142.636 1.00 55.14  ? 469 ILE A N   1 
ATOM   3690 C  CA  . ILE A 1 466 ? -2.256  151.982 142.635 1.00 48.52  ? 469 ILE A CA  1 
ATOM   3691 C  C   . ILE A 1 466 ? -2.939  151.020 141.677 1.00 47.61  ? 469 ILE A C   1 
ATOM   3692 O  O   . ILE A 1 466 ? -2.276  150.330 140.893 1.00 44.00  ? 469 ILE A O   1 
ATOM   3693 C  CB  . ILE A 1 466 ? -2.200  151.416 144.060 1.00 43.14  ? 469 ILE A CB  1 
ATOM   3694 C  CG1 . ILE A 1 466 ? -1.102  152.123 144.851 1.00 46.67  ? 469 ILE A CG1 1 
ATOM   3695 C  CG2 . ILE A 1 466 ? -2.008  149.918 144.025 1.00 33.22  ? 469 ILE A CG2 1 
ATOM   3696 C  CD1 . ILE A 1 466 ? -1.279  152.009 146.381 1.00 45.30  ? 469 ILE A CD1 1 
ATOM   3697 N  N   . MET A 1 467 ? -4.276  150.953 141.733 1.00 46.38  ? 470 MET A N   1 
ATOM   3698 C  CA  . MET A 1 467 ? -5.015  150.145 140.772 1.00 42.76  ? 470 MET A CA  1 
ATOM   3699 C  C   . MET A 1 467 ? -4.658  150.542 139.347 1.00 48.07  ? 470 MET A C   1 
ATOM   3700 O  O   . MET A 1 467 ? -4.503  149.682 138.477 1.00 44.29  ? 470 MET A O   1 
ATOM   3701 C  CB  . MET A 1 467 ? -6.523  150.274 140.995 1.00 45.12  ? 470 MET A CB  1 
ATOM   3702 C  CG  . MET A 1 467 ? -7.042  149.529 142.222 1.00 44.53  ? 470 MET A CG  1 
ATOM   3703 S  SD  . MET A 1 467 ? -8.849  149.426 142.240 1.00 52.40  ? 470 MET A SD  1 
ATOM   3704 C  CE  . MET A 1 467 ? -9.245  151.151 142.509 1.00 47.16  ? 470 MET A CE  1 
ATOM   3705 N  N   . HIS A 1 468 ? -4.485  151.841 139.096 1.00 46.68  ? 471 HIS A N   1 
ATOM   3706 C  CA  . HIS A 1 468 ? -4.197  152.263 137.735 1.00 49.95  ? 471 HIS A CA  1 
ATOM   3707 C  C   . HIS A 1 468 ? -2.762  151.927 137.346 1.00 49.81  ? 471 HIS A C   1 
ATOM   3708 O  O   . HIS A 1 468 ? -2.521  151.422 136.247 1.00 46.44  ? 471 HIS A O   1 
ATOM   3709 C  CB  . HIS A 1 468 ? -4.483  153.753 137.558 1.00 48.32  ? 471 HIS A CB  1 
ATOM   3710 C  CG  . HIS A 1 468 ? -4.554  154.174 136.127 1.00 53.50  ? 471 HIS A CG  1 
ATOM   3711 N  ND1 . HIS A 1 468 ? -5.392  153.563 135.215 1.00 59.57  ? 471 HIS A ND1 1 
ATOM   3712 C  CD2 . HIS A 1 468 ? -3.871  155.119 135.437 1.00 56.14  ? 471 HIS A CD2 1 
ATOM   3713 C  CE1 . HIS A 1 468 ? -5.237  154.126 134.032 1.00 44.23  ? 471 HIS A CE1 1 
ATOM   3714 N  NE2 . HIS A 1 468 ? -4.318  155.071 134.137 1.00 56.05  ? 471 HIS A NE2 1 
ATOM   3715 N  N   . TYR A 1 469 ? -1.798  152.190 138.231 1.00 48.29  ? 472 TYR A N   1 
ATOM   3716 C  CA  . TYR A 1 469 ? -0.443  151.688 138.014 1.00 43.91  ? 472 TYR A CA  1 
ATOM   3717 C  C   . TYR A 1 469 ? -0.457  150.205 137.665 1.00 48.12  ? 472 TYR A C   1 
ATOM   3718 O  O   . TYR A 1 469 ? 0.120   149.784 136.657 1.00 48.56  ? 472 TYR A O   1 
ATOM   3719 C  CB  . TYR A 1 469 ? 0.403   151.893 139.265 1.00 48.11  ? 472 TYR A CB  1 
ATOM   3720 C  CG  . TYR A 1 469 ? 0.893   153.291 139.506 1.00 52.76  ? 472 TYR A CG  1 
ATOM   3721 C  CD1 . TYR A 1 469 ? 1.187   154.141 138.453 1.00 49.49  ? 472 TYR A CD1 1 
ATOM   3722 C  CD2 . TYR A 1 469 ? 1.082   153.755 140.803 1.00 50.08  ? 472 TYR A CD2 1 
ATOM   3723 C  CE1 . TYR A 1 469 ? 1.652   155.419 138.689 1.00 54.48  ? 472 TYR A CE1 1 
ATOM   3724 C  CE2 . TYR A 1 469 ? 1.548   155.021 141.045 1.00 51.58  ? 472 TYR A CE2 1 
ATOM   3725 C  CZ  . TYR A 1 469 ? 1.829   155.847 139.991 1.00 58.11  ? 472 TYR A CZ  1 
ATOM   3726 O  OH  . TYR A 1 469 ? 2.286   157.109 140.245 1.00 73.20  ? 472 TYR A OH  1 
ATOM   3727 N  N   . TRP A 1 470 ? -1.105  149.395 138.508 1.00 47.01  ? 473 TRP A N   1 
ATOM   3728 C  CA  . TRP A 1 470 ? -1.071  147.946 138.342 1.00 44.62  ? 473 TRP A CA  1 
ATOM   3729 C  C   . TRP A 1 470 ? -1.655  147.536 137.001 1.00 46.17  ? 473 TRP A C   1 
ATOM   3730 O  O   . TRP A 1 470 ? -1.055  146.751 136.260 1.00 43.91  ? 473 TRP A O   1 
ATOM   3731 C  CB  . TRP A 1 470 ? -1.848  147.268 139.472 1.00 36.45  ? 473 TRP A CB  1 
ATOM   3732 C  CG  . TRP A 1 470 ? -1.035  146.723 140.628 1.00 42.55  ? 473 TRP A CG  1 
ATOM   3733 C  CD1 . TRP A 1 470 ? -1.106  145.455 141.145 1.00 42.74  ? 473 TRP A CD1 1 
ATOM   3734 C  CD2 . TRP A 1 470 ? -0.075  147.427 141.437 1.00 39.94  ? 473 TRP A CD2 1 
ATOM   3735 N  NE1 . TRP A 1 470 ? -0.243  145.323 142.207 1.00 37.87  ? 473 TRP A NE1 1 
ATOM   3736 C  CE2 . TRP A 1 470 ? 0.401   146.513 142.411 1.00 39.28  ? 473 TRP A CE2 1 
ATOM   3737 C  CE3 . TRP A 1 470 ? 0.434   148.731 141.432 1.00 42.22  ? 473 TRP A CE3 1 
ATOM   3738 C  CZ2 . TRP A 1 470 ? 1.366   146.864 143.368 1.00 38.87  ? 473 TRP A CZ2 1 
ATOM   3739 C  CZ3 . TRP A 1 470 ? 1.401   149.078 142.385 1.00 40.31  ? 473 TRP A CZ3 1 
ATOM   3740 C  CH2 . TRP A 1 470 ? 1.849   148.146 143.342 1.00 40.07  ? 473 TRP A CH2 1 
ATOM   3741 N  N   . ALA A 1 471 ? -2.844  148.053 136.683 1.00 49.79  ? 474 ALA A N   1 
ATOM   3742 C  CA  . ALA A 1 471 ? -3.576  147.601 135.509 1.00 46.02  ? 474 ALA A CA  1 
ATOM   3743 C  C   . ALA A 1 471 ? -2.973  148.153 134.223 1.00 44.66  ? 474 ALA A C   1 
ATOM   3744 O  O   . ALA A 1 471 ? -2.986  147.471 133.200 1.00 43.35  ? 474 ALA A O   1 
ATOM   3745 C  CB  . ALA A 1 471 ? -5.047  148.001 135.630 1.00 44.71  ? 474 ALA A CB  1 
ATOM   3746 N  N   . THR A 1 472 ? -2.455  149.382 134.261 1.00 45.41  ? 475 THR A N   1 
ATOM   3747 C  CA  . THR A 1 472 ? -1.718  149.929 133.132 1.00 44.15  ? 475 THR A CA  1 
ATOM   3748 C  C   . THR A 1 472 ? -0.446  149.136 132.872 1.00 47.95  ? 475 THR A C   1 
ATOM   3749 O  O   . THR A 1 472 ? -0.095  148.867 131.714 1.00 48.71  ? 475 THR A O   1 
ATOM   3750 C  CB  . THR A 1 472 ? -1.385  151.396 133.391 1.00 45.69  ? 475 THR A CB  1 
ATOM   3751 O  OG1 . THR A 1 472 ? -2.590  152.098 133.712 1.00 40.89  ? 475 THR A OG1 1 
ATOM   3752 C  CG2 . THR A 1 472 ? -0.723  152.030 132.159 1.00 45.65  ? 475 THR A CG2 1 
ATOM   3753 N  N   . PHE A 1 473 ? 0.268   148.760 133.936 1.00 43.80  ? 476 PHE A N   1 
ATOM   3754 C  CA  . PHE A 1 473 ? 1.414   147.877 133.756 1.00 45.80  ? 476 PHE A CA  1 
ATOM   3755 C  C   . PHE A 1 473 ? 0.986   146.551 133.147 1.00 45.98  ? 476 PHE A C   1 
ATOM   3756 O  O   . PHE A 1 473 ? 1.660   146.019 132.256 1.00 45.02  ? 476 PHE A O   1 
ATOM   3757 C  CB  . PHE A 1 473 ? 2.129   147.631 135.079 1.00 43.09  ? 476 PHE A CB  1 
ATOM   3758 C  CG  . PHE A 1 473 ? 3.221   146.602 134.979 1.00 41.12  ? 476 PHE A CG  1 
ATOM   3759 C  CD1 . PHE A 1 473 ? 4.488   146.961 134.546 1.00 38.59  ? 476 PHE A CD1 1 
ATOM   3760 C  CD2 . PHE A 1 473 ? 2.977   145.274 135.296 1.00 36.03  ? 476 PHE A CD2 1 
ATOM   3761 C  CE1 . PHE A 1 473 ? 5.487   146.023 134.453 1.00 37.51  ? 476 PHE A CE1 1 
ATOM   3762 C  CE2 . PHE A 1 473 ? 3.976   144.329 135.193 1.00 37.57  ? 476 PHE A CE2 1 
ATOM   3763 C  CZ  . PHE A 1 473 ? 5.232   144.703 134.782 1.00 38.08  ? 476 PHE A CZ  1 
ATOM   3764 N  N   . ALA A 1 474 ? -0.134  146.000 133.617 1.00 44.78  ? 477 ALA A N   1 
ATOM   3765 C  CA  . ALA A 1 474 ? -0.594  144.732 133.073 1.00 42.97  ? 477 ALA A CA  1 
ATOM   3766 C  C   . ALA A 1 474 ? -0.928  144.859 131.587 1.00 47.81  ? 477 ALA A C   1 
ATOM   3767 O  O   . ALA A 1 474 ? -0.627  143.954 130.804 1.00 43.86  ? 477 ALA A O   1 
ATOM   3768 C  CB  . ALA A 1 474 ? -1.792  144.228 133.870 1.00 36.40  ? 477 ALA A CB  1 
ATOM   3769 N  N   . LYS A 1 475 ? -1.522  145.988 131.175 1.00 43.83  ? 478 LYS A N   1 
ATOM   3770 C  CA  . LYS A 1 475 ? -1.961  146.121 129.788 1.00 49.22  ? 478 LYS A CA  1 
ATOM   3771 C  C   . LYS A 1 475 ? -0.782  146.356 128.848 1.00 51.31  ? 478 LYS A C   1 
ATOM   3772 O  O   . LYS A 1 475 ? -0.743  145.802 127.744 1.00 46.22  ? 478 LYS A O   1 
ATOM   3773 C  CB  . LYS A 1 475 ? -2.980  147.259 129.638 1.00 51.55  ? 478 LYS A CB  1 
ATOM   3774 C  CG  . LYS A 1 475 ? -4.265  147.122 130.472 1.00 62.91  ? 478 LYS A CG  1 
ATOM   3775 C  CD  . LYS A 1 475 ? -5.496  147.763 129.788 1.00 74.11  ? 478 LYS A CD  1 
ATOM   3776 C  CE  . LYS A 1 475 ? -6.735  147.808 130.712 1.00 51.20  ? 478 LYS A CE  1 
ATOM   3777 N  NZ  . LYS A 1 475 ? -6.552  148.753 131.879 1.00 61.58  ? 478 LYS A NZ  1 
ATOM   3778 N  N   . THR A 1 476 ? 0.195   147.161 129.273 1.00 48.79  ? 479 THR A N   1 
ATOM   3779 C  CA  . THR A 1 476 ? 1.215   147.680 128.376 1.00 46.49  ? 479 THR A CA  1 
ATOM   3780 C  C   . THR A 1 476 ? 2.642   147.337 128.777 1.00 49.69  ? 479 THR A C   1 
ATOM   3781 O  O   . THR A 1 476 ? 3.542   147.449 127.929 1.00 40.44  ? 479 THR A O   1 
ATOM   3782 C  CB  . THR A 1 476 ? 1.106   149.210 128.279 1.00 46.81  ? 479 THR A CB  1 
ATOM   3783 O  OG1 . THR A 1 476 ? 1.575   149.799 129.501 1.00 47.90  ? 479 THR A OG1 1 
ATOM   3784 C  CG2 . THR A 1 476 ? -0.338  149.630 128.051 1.00 45.57  ? 479 THR A CG2 1 
ATOM   3785 N  N   . GLY A 1 477 ? 2.881   146.939 130.031 1.00 46.34  ? 480 GLY A N   1 
ATOM   3786 C  CA  . GLY A 1 477 ? 4.227   146.720 130.538 1.00 38.82  ? 480 GLY A CA  1 
ATOM   3787 C  C   . GLY A 1 477 ? 4.909   147.956 131.077 1.00 40.69  ? 480 GLY A C   1 
ATOM   3788 O  O   . GLY A 1 477 ? 6.122   147.923 131.313 1.00 38.52  ? 480 GLY A O   1 
ATOM   3789 N  N   . ASN A 1 478 ? 4.173   149.050 131.250 1.00 45.18  ? 481 ASN A N   1 
ATOM   3790 C  CA  . ASN A 1 478 ? 4.642   150.295 131.841 1.00 47.69  ? 481 ASN A CA  1 
ATOM   3791 C  C   . ASN A 1 478 ? 3.529   150.846 132.732 1.00 46.51  ? 481 ASN A C   1 
ATOM   3792 O  O   . ASN A 1 478 ? 2.407   151.044 132.251 1.00 44.70  ? 481 ASN A O   1 
ATOM   3793 C  CB  . ASN A 1 478 ? 5.024   151.282 130.737 1.00 48.10  ? 481 ASN A CB  1 
ATOM   3794 C  CG  . ASN A 1 478 ? 5.589   152.587 131.269 1.00 52.80  ? 481 ASN A CG  1 
ATOM   3795 O  OD1 . ASN A 1 478 ? 5.263   153.030 132.370 1.00 52.42  ? 481 ASN A OD1 1 
ATOM   3796 N  ND2 . ASN A 1 478 ? 6.426   153.228 130.467 1.00 53.59  ? 481 ASN A ND2 1 
ATOM   3797 N  N   . PRO A 1 479 ? 3.786   151.093 134.030 1.00 50.68  ? 482 PRO A N   1 
ATOM   3798 C  CA  . PRO A 1 479 ? 2.718   151.617 134.905 1.00 47.77  ? 482 PRO A CA  1 
ATOM   3799 C  C   . PRO A 1 479 ? 2.262   153.028 134.557 1.00 52.55  ? 482 PRO A C   1 
ATOM   3800 O  O   . PRO A 1 479 ? 1.185   153.433 135.009 1.00 54.86  ? 482 PRO A O   1 
ATOM   3801 C  CB  . PRO A 1 479 ? 3.360   151.581 136.297 1.00 48.07  ? 482 PRO A CB  1 
ATOM   3802 C  CG  . PRO A 1 479 ? 4.813   151.770 136.020 1.00 48.89  ? 482 PRO A CG  1 
ATOM   3803 C  CD  . PRO A 1 479 ? 5.068   150.987 134.750 1.00 41.63  ? 482 PRO A CD  1 
ATOM   3804 N  N   . ASN A 1 480 ? 3.038   153.783 133.780 1.00 56.90  ? 483 ASN A N   1 
ATOM   3805 C  CA  . ASN A 1 480 ? 2.717   155.161 133.432 1.00 59.99  ? 483 ASN A CA  1 
ATOM   3806 C  C   . ASN A 1 480 ? 1.858   155.232 132.172 1.00 59.43  ? 483 ASN A C   1 
ATOM   3807 O  O   . ASN A 1 480 ? 2.015   154.431 131.246 1.00 60.89  ? 483 ASN A O   1 
ATOM   3808 C  CB  . ASN A 1 480 ? 4.002   155.966 133.228 1.00 59.19  ? 483 ASN A CB  1 
ATOM   3809 C  CG  . ASN A 1 480 ? 4.952   155.851 134.404 1.00 60.81  ? 483 ASN A CG  1 
ATOM   3810 O  OD1 . ASN A 1 480 ? 4.673   156.357 135.496 1.00 60.33  ? 483 ASN A OD1 1 
ATOM   3811 N  ND2 . ASN A 1 480 ? 6.084   155.182 134.192 1.00 53.65  ? 483 ASN A ND2 1 
ATOM   3812 N  N   . GLU A 1 481 ? 0.942   156.206 132.154 1.00 71.12  ? 484 GLU A N   1 
ATOM   3813 C  CA  . GLU A 1 481 ? 0.102   156.464 130.987 1.00 76.64  ? 484 GLU A CA  1 
ATOM   3814 C  C   . GLU A 1 481 ? 0.918   157.082 129.851 1.00 79.05  ? 484 GLU A C   1 
ATOM   3815 O  O   . GLU A 1 481 ? 1.835   157.874 130.090 1.00 82.03  ? 484 GLU A O   1 
ATOM   3816 C  CB  . GLU A 1 481 ? -1.038  157.421 131.335 1.00 80.52  ? 484 GLU A CB  1 
ATOM   3817 C  CG  . GLU A 1 481 ? -2.197  156.824 132.105 1.00 78.79  ? 484 GLU A CG  1 
ATOM   3818 C  CD  . GLU A 1 481 ? -3.316  156.385 131.194 1.00 79.30  ? 484 GLU A CD  1 
ATOM   3819 O  OE1 . GLU A 1 481 ? -3.022  155.992 130.045 1.00 77.39  ? 484 GLU A OE1 1 
ATOM   3820 O  OE2 . GLU A 1 481 ? -4.488  156.444 131.621 1.00 82.41  ? 484 GLU A OE2 1 
ATOM   3821 N  N   . PRO A 1 482 ? 0.585   156.761 128.605 0.81 83.27  ? 485 PRO A N   1 
ATOM   3822 C  CA  . PRO A 1 482 ? 1.242   157.428 127.471 0.81 87.75  ? 485 PRO A CA  1 
ATOM   3823 C  C   . PRO A 1 482 ? 1.051   158.938 127.538 0.81 92.07  ? 485 PRO A C   1 
ATOM   3824 O  O   . PRO A 1 482 ? -0.077  159.441 127.498 0.81 91.17  ? 485 PRO A O   1 
ATOM   3825 C  CB  . PRO A 1 482 ? 0.547   156.815 126.250 0.81 80.80  ? 485 PRO A CB  1 
ATOM   3826 C  CG  . PRO A 1 482 ? -0.745  156.263 126.771 0.81 82.18  ? 485 PRO A CG  1 
ATOM   3827 C  CD  . PRO A 1 482 ? -0.439  155.798 128.164 0.81 81.84  ? 485 PRO A CD  1 
ATOM   3828 N  N   . HIS A 1 483 ? 2.176   159.650 127.652 0.84 90.82  ? 486 HIS A N   1 
ATOM   3829 C  CA  . HIS A 1 483 ? 2.251   161.118 127.695 0.84 94.18  ? 486 HIS A CA  1 
ATOM   3830 C  C   . HIS A 1 483 ? 1.076   161.747 128.447 0.84 96.93  ? 486 HIS A C   1 
ATOM   3831 O  O   . HIS A 1 483 ? 0.390   162.647 127.957 0.84 97.05  ? 486 HIS A O   1 
ATOM   3832 C  CB  . HIS A 1 483 ? 2.397   161.713 126.282 0.84 97.20  ? 486 HIS A CB  1 
ATOM   3833 C  CG  . HIS A 1 483 ? 1.454   161.147 125.260 0.84 99.92  ? 486 HIS A CG  1 
ATOM   3834 N  ND1 . HIS A 1 483 ? 0.106   161.442 125.238 0.84 99.94  ? 486 HIS A ND1 1 
ATOM   3835 C  CD2 . HIS A 1 483 ? 1.673   160.321 124.207 0.84 91.03  ? 486 HIS A CD2 1 
ATOM   3836 C  CE1 . HIS A 1 483 ? -0.466  160.811 124.227 0.84 92.95  ? 486 HIS A CE1 1 
ATOM   3837 N  NE2 . HIS A 1 483 ? 0.462   160.122 123.587 0.84 89.97  ? 486 HIS A NE2 1 
ATOM   3838 N  N   . SER A 1 484 ? 0.848   161.265 129.665 1.00 94.59  ? 487 SER A N   1 
ATOM   3839 C  CA  . SER A 1 484 ? -0.035  161.954 130.591 1.00 96.47  ? 487 SER A CA  1 
ATOM   3840 C  C   . SER A 1 484 ? 0.794   162.995 131.345 1.00 108.62 ? 487 SER A C   1 
ATOM   3841 O  O   . SER A 1 484 ? 1.941   163.278 130.986 1.00 106.10 ? 487 SER A O   1 
ATOM   3842 C  CB  . SER A 1 484 ? -0.727  160.963 131.525 1.00 99.80  ? 487 SER A CB  1 
ATOM   3843 O  OG  . SER A 1 484 ? 0.172   160.462 132.500 1.00 99.09  ? 487 SER A OG  1 
ATOM   3844 N  N   . GLN A 1 485 ? 0.235   163.566 132.414 1.00 111.38 ? 488 GLN A N   1 
ATOM   3845 C  CA  . GLN A 1 485 ? 0.822   164.750 133.029 1.00 110.92 ? 488 GLN A CA  1 
ATOM   3846 C  C   . GLN A 1 485 ? 1.230   164.582 134.492 1.00 109.97 ? 488 GLN A C   1 
ATOM   3847 O  O   . GLN A 1 485 ? 1.802   165.519 135.063 1.00 108.01 ? 488 GLN A O   1 
ATOM   3848 C  CB  . GLN A 1 485 ? -0.151  165.933 132.900 1.00 113.70 ? 488 GLN A CB  1 
ATOM   3849 C  CG  . GLN A 1 485 ? -0.863  165.988 131.546 1.00 117.54 ? 488 GLN A CG  1 
ATOM   3850 C  CD  . GLN A 1 485 ? -0.682  167.313 130.822 1.00 119.58 ? 488 GLN A CD  1 
ATOM   3851 O  OE1 . GLN A 1 485 ? -1.234  168.337 131.229 1.00 116.59 ? 488 GLN A OE1 1 
ATOM   3852 N  NE2 . GLN A 1 485 ? 0.089   167.295 129.735 1.00 114.83 ? 488 GLN A NE2 1 
ATOM   3853 N  N   . GLU A 1 486 ? 0.972   163.430 135.114 1.00 107.04 ? 489 GLU A N   1 
ATOM   3854 C  CA  . GLU A 1 486 ? 1.352   163.230 136.507 1.00 102.35 ? 489 GLU A CA  1 
ATOM   3855 C  C   . GLU A 1 486 ? 2.828   162.855 136.615 1.00 95.83  ? 489 GLU A C   1 
ATOM   3856 O  O   . GLU A 1 486 ? 3.543   162.719 135.619 1.00 94.55  ? 489 GLU A O   1 
ATOM   3857 C  CB  . GLU A 1 486 ? 0.487   162.156 137.161 1.00 101.78 ? 489 GLU A CB  1 
ATOM   3858 C  CG  . GLU A 1 486 ? -0.944  162.567 137.416 1.00 105.31 ? 489 GLU A CG  1 
ATOM   3859 C  CD  . GLU A 1 486 ? -1.819  162.410 136.191 1.00 112.63 ? 489 GLU A CD  1 
ATOM   3860 O  OE1 . GLU A 1 486 ? -1.281  162.118 135.099 1.00 111.39 ? 489 GLU A OE1 1 
ATOM   3861 O  OE2 . GLU A 1 486 ? -3.050  162.574 136.322 1.00 119.42 ? 489 GLU A OE2 1 
ATOM   3862 N  N   . SER A 1 487 ? 3.291   162.685 137.851 1.00 95.38  ? 490 SER A N   1 
ATOM   3863 C  CA  . SER A 1 487 ? 4.655   162.232 138.076 1.00 93.21  ? 490 SER A CA  1 
ATOM   3864 C  C   . SER A 1 487 ? 4.831   160.830 137.507 1.00 86.81  ? 490 SER A C   1 
ATOM   3865 O  O   . SER A 1 487 ? 4.012   159.937 137.752 1.00 81.86  ? 490 SER A O   1 
ATOM   3866 C  CB  . SER A 1 487 ? 4.982   162.253 139.570 1.00 79.34  ? 490 SER A CB  1 
ATOM   3867 N  N   . LYS A 1 488 ? 5.889   160.647 136.724 1.00 78.57  ? 491 LYS A N   1 
ATOM   3868 C  CA  . LYS A 1 488 ? 6.171   159.360 136.110 1.00 74.04  ? 491 LYS A CA  1 
ATOM   3869 C  C   . LYS A 1 488 ? 6.977   158.489 137.069 1.00 70.50  ? 491 LYS A C   1 
ATOM   3870 O  O   . LYS A 1 488 ? 7.881   158.969 137.759 1.00 73.11  ? 491 LYS A O   1 
ATOM   3871 C  CB  . LYS A 1 488 ? 6.933   159.538 134.791 1.00 72.72  ? 491 LYS A CB  1 
ATOM   3872 C  CG  . LYS A 1 488 ? 6.303   160.530 133.796 1.00 81.10  ? 491 LYS A CG  1 
ATOM   3873 C  CD  . LYS A 1 488 ? 5.044   159.989 133.118 1.00 78.25  ? 491 LYS A CD  1 
ATOM   3874 N  N   . TRP A 1 489 ? 6.633   157.208 137.115 1.00 65.47  ? 492 TRP A N   1 
ATOM   3875 C  CA  . TRP A 1 489 ? 7.360   156.189 137.862 1.00 56.94  ? 492 TRP A CA  1 
ATOM   3876 C  C   . TRP A 1 489 ? 8.538   155.710 137.011 1.00 55.16  ? 492 TRP A C   1 
ATOM   3877 O  O   . TRP A 1 489 ? 8.341   155.014 136.005 1.00 59.93  ? 492 TRP A O   1 
ATOM   3878 C  CB  . TRP A 1 489 ? 6.382   155.067 138.225 1.00 53.83  ? 492 TRP A CB  1 
ATOM   3879 C  CG  . TRP A 1 489 ? 6.893   153.885 139.001 1.00 44.96  ? 492 TRP A CG  1 
ATOM   3880 C  CD1 . TRP A 1 489 ? 8.189   153.563 139.282 1.00 47.45  ? 492 TRP A CD1 1 
ATOM   3881 C  CD2 . TRP A 1 489 ? 6.086   152.855 139.592 1.00 42.08  ? 492 TRP A CD2 1 
ATOM   3882 N  NE1 . TRP A 1 489 ? 8.240   152.396 140.011 1.00 42.45  ? 492 TRP A NE1 1 
ATOM   3883 C  CE2 . TRP A 1 489 ? 6.961   151.943 140.213 1.00 41.83  ? 492 TRP A CE2 1 
ATOM   3884 C  CE3 . TRP A 1 489 ? 4.703   152.625 139.665 1.00 42.37  ? 492 TRP A CE3 1 
ATOM   3885 C  CZ2 . TRP A 1 489 ? 6.499   150.812 140.891 1.00 44.65  ? 492 TRP A CZ2 1 
ATOM   3886 C  CZ3 . TRP A 1 489 ? 4.247   151.502 140.320 1.00 38.73  ? 492 TRP A CZ3 1 
ATOM   3887 C  CH2 . TRP A 1 489 ? 5.142   150.609 140.932 1.00 42.09  ? 492 TRP A CH2 1 
ATOM   3888 N  N   . PRO A 1 490 ? 9.769   156.073 137.362 1.00 53.52  ? 493 PRO A N   1 
ATOM   3889 C  CA  . PRO A 1 490 ? 10.901  155.761 136.485 1.00 51.06  ? 493 PRO A CA  1 
ATOM   3890 C  C   . PRO A 1 490 ? 11.258  154.285 136.495 1.00 58.80  ? 493 PRO A C   1 
ATOM   3891 O  O   . PRO A 1 490 ? 11.071  153.577 137.490 1.00 54.55  ? 493 PRO A O   1 
ATOM   3892 C  CB  . PRO A 1 490 ? 12.042  156.600 137.072 1.00 57.48  ? 493 PRO A CB  1 
ATOM   3893 C  CG  . PRO A 1 490 ? 11.705  156.707 138.524 1.00 55.13  ? 493 PRO A CG  1 
ATOM   3894 C  CD  . PRO A 1 490 ? 10.193  156.797 138.576 1.00 57.74  ? 493 PRO A CD  1 
ATOM   3895 N  N   . LEU A 1 491 ? 11.799  153.837 135.363 1.00 47.02  ? 494 LEU A N   1 
ATOM   3896 C  CA  . LEU A 1 491 ? 12.359  152.497 135.250 1.00 51.65  ? 494 LEU A CA  1 
ATOM   3897 C  C   . LEU A 1 491 ? 13.466  152.283 136.279 1.00 53.98  ? 494 LEU A C   1 
ATOM   3898 O  O   . LEU A 1 491 ? 14.273  153.178 136.543 1.00 54.77  ? 494 LEU A O   1 
ATOM   3899 C  CB  . LEU A 1 491 ? 12.916  152.293 133.838 1.00 52.12  ? 494 LEU A CB  1 
ATOM   3900 C  CG  . LEU A 1 491 ? 12.861  150.964 133.084 1.00 57.87  ? 494 LEU A CG  1 
ATOM   3901 C  CD1 . LEU A 1 491 ? 11.430  150.564 132.826 1.00 50.67  ? 494 LEU A CD1 1 
ATOM   3902 C  CD2 . LEU A 1 491 ? 13.630  151.067 131.741 1.00 55.88  ? 494 LEU A CD2 1 
ATOM   3903 N  N   . PHE A 1 492 ? 13.506  151.082 136.855 1.00 51.65  ? 495 PHE A N   1 
ATOM   3904 C  CA  . PHE A 1 492 ? 14.616  150.680 137.711 1.00 54.32  ? 495 PHE A CA  1 
ATOM   3905 C  C   . PHE A 1 492 ? 15.759  150.159 136.837 1.00 54.11  ? 495 PHE A C   1 
ATOM   3906 O  O   . PHE A 1 492 ? 15.614  149.135 136.163 1.00 51.86  ? 495 PHE A O   1 
ATOM   3907 C  CB  . PHE A 1 492 ? 14.162  149.617 138.715 1.00 47.68  ? 495 PHE A CB  1 
ATOM   3908 C  CG  . PHE A 1 492 ? 15.270  149.073 139.581 1.00 45.22  ? 495 PHE A CG  1 
ATOM   3909 C  CD1 . PHE A 1 492 ? 16.095  148.057 139.124 1.00 41.95  ? 495 PHE A CD1 1 
ATOM   3910 C  CD2 . PHE A 1 492 ? 15.466  149.560 140.867 1.00 50.86  ? 495 PHE A CD2 1 
ATOM   3911 C  CE1 . PHE A 1 492 ? 17.114  147.559 139.899 1.00 50.25  ? 495 PHE A CE1 1 
ATOM   3912 C  CE2 . PHE A 1 492 ? 16.480  149.057 141.663 1.00 47.61  ? 495 PHE A CE2 1 
ATOM   3913 C  CZ  . PHE A 1 492 ? 17.309  148.055 141.182 1.00 52.15  ? 495 PHE A CZ  1 
ATOM   3914 N  N   . THR A 1 493 ? 16.899  150.845 136.867 1.00 55.61  ? 496 THR A N   1 
ATOM   3915 C  CA  . THR A 1 493 ? 18.063  150.465 136.082 1.00 57.96  ? 496 THR A CA  1 
ATOM   3916 C  C   . THR A 1 493 ? 19.173  149.977 136.996 1.00 53.59  ? 496 THR A C   1 
ATOM   3917 O  O   . THR A 1 493 ? 19.179  150.239 138.197 1.00 61.16  ? 496 THR A O   1 
ATOM   3918 C  CB  . THR A 1 493 ? 18.577  151.637 135.240 1.00 61.53  ? 496 THR A CB  1 
ATOM   3919 O  OG1 . THR A 1 493 ? 19.223  152.589 136.100 1.00 64.49  ? 496 THR A OG1 1 
ATOM   3920 C  CG2 . THR A 1 493 ? 17.424  152.305 134.482 1.00 45.93  ? 496 THR A CG2 1 
ATOM   3921 N  N   . THR A 1 494 ? 20.125  149.261 136.403 1.00 58.93  ? 497 THR A N   1 
ATOM   3922 C  CA  . THR A 1 494 ? 21.245  148.735 137.176 1.00 55.83  ? 497 THR A CA  1 
ATOM   3923 C  C   . THR A 1 494 ? 22.125  149.858 137.717 1.00 67.36  ? 497 THR A C   1 
ATOM   3924 O  O   . THR A 1 494 ? 22.660  149.757 138.828 1.00 73.33  ? 497 THR A O   1 
ATOM   3925 C  CB  . THR A 1 494 ? 22.066  147.774 136.315 1.00 56.10  ? 497 THR A CB  1 
ATOM   3926 O  OG1 . THR A 1 494 ? 21.256  146.655 135.939 1.00 64.33  ? 497 THR A OG1 1 
ATOM   3927 C  CG2 . THR A 1 494 ? 23.269  147.270 137.075 1.00 61.51  ? 497 THR A CG2 1 
ATOM   3928 N  N   . LYS A 1 495 ? 22.274  150.947 136.964 1.00 68.71  ? 498 LYS A N   1 
ATOM   3929 C  CA  . LYS A 1 495 ? 23.212  151.973 137.402 1.00 74.73  ? 498 LYS A CA  1 
ATOM   3930 C  C   . LYS A 1 495 ? 22.573  152.998 138.336 1.00 71.74  ? 498 LYS A C   1 
ATOM   3931 O  O   . LYS A 1 495 ? 23.238  153.481 139.256 1.00 80.80  ? 498 LYS A O   1 
ATOM   3932 C  CB  . LYS A 1 495 ? 23.846  152.669 136.191 1.00 74.20  ? 498 LYS A CB  1 
ATOM   3933 C  CG  . LYS A 1 495 ? 22.902  153.511 135.362 1.00 77.00  ? 498 LYS A CG  1 
ATOM   3934 C  CD  . LYS A 1 495 ? 23.672  154.583 134.603 1.00 87.43  ? 498 LYS A CD  1 
ATOM   3935 C  CE  . LYS A 1 495 ? 24.575  155.391 135.536 1.00 84.73  ? 498 LYS A CE  1 
ATOM   3936 N  NZ  . LYS A 1 495 ? 25.245  156.527 134.832 1.00 91.31  ? 498 LYS A NZ  1 
ATOM   3937 N  N   . GLU A 1 496 ? 21.294  153.329 138.142 1.00 71.33  ? 499 GLU A N   1 
ATOM   3938 C  CA  . GLU A 1 496 ? 20.633  154.360 138.940 1.00 76.45  ? 499 GLU A CA  1 
ATOM   3939 C  C   . GLU A 1 496 ? 19.696  153.813 140.016 1.00 68.84  ? 499 GLU A C   1 
ATOM   3940 O  O   . GLU A 1 496 ? 19.575  154.432 141.077 1.00 68.11  ? 499 GLU A O   1 
ATOM   3941 C  CB  . GLU A 1 496 ? 19.860  155.321 138.027 1.00 71.96  ? 499 GLU A CB  1 
ATOM   3942 C  CG  . GLU A 1 496 ? 20.758  156.325 137.307 1.00 80.79  ? 499 GLU A CG  1 
ATOM   3943 C  CD  . GLU A 1 496 ? 21.771  156.969 138.251 1.00 90.55  ? 499 GLU A CD  1 
ATOM   3944 O  OE1 . GLU A 1 496 ? 22.922  156.480 138.323 1.00 90.05  ? 499 GLU A OE1 1 
ATOM   3945 O  OE2 . GLU A 1 496 ? 21.414  157.954 138.939 1.00 92.18  ? 499 GLU A OE2 1 
ATOM   3946 N  N   . GLN A 1 497 ? 19.020  152.688 139.758 1.00 66.44  ? 500 GLN A N   1 
ATOM   3947 C  CA  . GLN A 1 497 ? 18.257  151.945 140.769 1.00 58.78  ? 500 GLN A CA  1 
ATOM   3948 C  C   . GLN A 1 497 ? 17.149  152.785 141.398 1.00 58.87  ? 500 GLN A C   1 
ATOM   3949 O  O   . GLN A 1 497 ? 16.916  152.732 142.608 1.00 60.67  ? 500 GLN A O   1 
ATOM   3950 C  CB  . GLN A 1 497 ? 19.182  151.382 141.846 1.00 57.65  ? 500 GLN A CB  1 
ATOM   3951 C  CG  . GLN A 1 497 ? 20.216  150.452 141.284 1.00 61.89  ? 500 GLN A CG  1 
ATOM   3952 C  CD  . GLN A 1 497 ? 21.109  149.888 142.347 1.00 64.58  ? 500 GLN A CD  1 
ATOM   3953 O  OE1 . GLN A 1 497 ? 20.662  149.584 143.453 1.00 66.76  ? 500 GLN A OE1 1 
ATOM   3954 N  NE2 . GLN A 1 497 ? 22.387  149.740 142.023 1.00 77.02  ? 500 GLN A NE2 1 
ATOM   3955 N  N   . LYS A 1 498 ? 16.451  153.555 140.574 1.00 52.67  ? 501 LYS A N   1 
ATOM   3956 C  CA  . LYS A 1 498 ? 15.374  154.383 141.087 1.00 58.23  ? 501 LYS A CA  1 
ATOM   3957 C  C   . LYS A 1 498 ? 14.164  153.535 141.483 1.00 59.82  ? 501 LYS A C   1 
ATOM   3958 O  O   . LYS A 1 498 ? 13.890  152.483 140.897 1.00 58.27  ? 501 LYS A O   1 
ATOM   3959 C  CB  . LYS A 1 498 ? 14.970  155.429 140.047 1.00 59.14  ? 501 LYS A CB  1 
ATOM   3960 C  CG  . LYS A 1 498 ? 16.075  156.427 139.684 1.00 63.86  ? 501 LYS A CG  1 
ATOM   3961 C  CD  . LYS A 1 498 ? 15.577  157.448 138.646 1.00 65.68  ? 501 LYS A CD  1 
ATOM   3962 C  CE  . LYS A 1 498 ? 16.694  158.364 138.145 1.00 66.21  ? 501 LYS A CE  1 
ATOM   3963 N  NZ  . LYS A 1 498 ? 16.192  159.330 137.112 1.00 68.54  ? 501 LYS A NZ  1 
ATOM   3964 N  N   . PHE A 1 499 ? 13.447  154.005 142.508 1.00 58.87  ? 502 PHE A N   1 
ATOM   3965 C  CA  . PHE A 1 499 ? 12.150  153.468 142.901 1.00 49.82  ? 502 PHE A CA  1 
ATOM   3966 C  C   . PHE A 1 499 ? 11.271  154.624 143.362 1.00 51.23  ? 502 PHE A C   1 
ATOM   3967 O  O   . PHE A 1 499 ? 11.740  155.753 143.521 1.00 54.56  ? 502 PHE A O   1 
ATOM   3968 C  CB  . PHE A 1 499 ? 12.290  152.417 143.996 1.00 48.03  ? 502 PHE A CB  1 
ATOM   3969 C  CG  . PHE A 1 499 ? 12.802  152.961 145.309 1.00 53.02  ? 502 PHE A CG  1 
ATOM   3970 C  CD1 . PHE A 1 499 ? 14.162  153.013 145.570 1.00 55.85  ? 502 PHE A CD1 1 
ATOM   3971 C  CD2 . PHE A 1 499 ? 11.918  153.398 146.295 1.00 53.28  ? 502 PHE A CD2 1 
ATOM   3972 C  CE1 . PHE A 1 499 ? 14.638  153.492 146.783 1.00 57.29  ? 502 PHE A CE1 1 
ATOM   3973 C  CE2 . PHE A 1 499 ? 12.389  153.885 147.504 1.00 53.00  ? 502 PHE A CE2 1 
ATOM   3974 C  CZ  . PHE A 1 499 ? 13.750  153.926 147.750 1.00 54.22  ? 502 PHE A CZ  1 
ATOM   3975 N  N   . ILE A 1 500 ? 9.982   154.351 143.567 1.00 46.65  ? 503 ILE A N   1 
ATOM   3976 C  CA  . ILE A 1 500 ? 9.079   155.366 144.095 1.00 49.86  ? 503 ILE A CA  1 
ATOM   3977 C  C   . ILE A 1 500 ? 8.544   154.948 145.463 1.00 56.05  ? 503 ILE A C   1 
ATOM   3978 O  O   . ILE A 1 500 ? 8.498   153.765 145.816 1.00 50.35  ? 503 ILE A O   1 
ATOM   3979 C  CB  . ILE A 1 500 ? 7.901   155.676 143.158 1.00 47.27  ? 503 ILE A CB  1 
ATOM   3980 C  CG1 . ILE A 1 500 ? 7.088   154.416 142.884 1.00 47.19  ? 503 ILE A CG1 1 
ATOM   3981 C  CG2 . ILE A 1 500 ? 8.382   156.363 141.895 1.00 55.20  ? 503 ILE A CG2 1 
ATOM   3982 C  CD1 . ILE A 1 500 ? 5.699   154.719 142.379 1.00 46.20  ? 503 ILE A CD1 1 
ATOM   3983 N  N   . ASP A 1 501 ? 8.148   155.963 146.240 1.00 60.05  ? 504 ASP A N   1 
ATOM   3984 C  CA  . ASP A 1 501 ? 7.284   155.775 147.399 1.00 56.39  ? 504 ASP A CA  1 
ATOM   3985 C  C   . ASP A 1 501 ? 5.833   155.710 146.947 1.00 53.70  ? 504 ASP A C   1 
ATOM   3986 O  O   . ASP A 1 501 ? 5.410   156.457 146.059 1.00 59.99  ? 504 ASP A O   1 
ATOM   3987 C  CB  . ASP A 1 501 ? 7.432   156.930 148.394 1.00 57.36  ? 504 ASP A CB  1 
ATOM   3988 C  CG  . ASP A 1 501 ? 8.707   156.857 149.215 1.00 65.96  ? 504 ASP A CG  1 
ATOM   3989 O  OD1 . ASP A 1 501 ? 9.392   155.808 149.202 1.00 61.99  ? 504 ASP A OD1 1 
ATOM   3990 O  OD2 . ASP A 1 501 ? 9.018   157.864 149.892 1.00 77.58  ? 504 ASP A OD2 1 
ATOM   3991 N  N   . LEU A 1 502 ? 5.069   154.814 147.555 1.00 49.46  ? 505 LEU A N   1 
ATOM   3992 C  CA  . LEU A 1 502 ? 3.619   154.795 147.405 1.00 51.63  ? 505 LEU A CA  1 
ATOM   3993 C  C   . LEU A 1 502 ? 3.015   155.168 148.747 1.00 51.12  ? 505 LEU A C   1 
ATOM   3994 O  O   . LEU A 1 502 ? 3.179   154.437 149.731 1.00 56.06  ? 505 LEU A O   1 
ATOM   3995 C  CB  . LEU A 1 502 ? 3.108   153.430 146.940 1.00 47.03  ? 505 LEU A CB  1 
ATOM   3996 C  CG  . LEU A 1 502 ? 3.361   153.038 145.483 1.00 47.98  ? 505 LEU A CG  1 
ATOM   3997 C  CD1 . LEU A 1 502 ? 2.972   151.587 145.267 1.00 50.60  ? 505 LEU A CD1 1 
ATOM   3998 C  CD2 . LEU A 1 502 ? 2.579   153.936 144.536 1.00 50.56  ? 505 LEU A CD2 1 
ATOM   3999 N  N   . ASN A 1 503 ? 2.351   156.314 148.793 1.00 54.65  ? 506 ASN A N   1 
ATOM   4000 C  CA  . ASN A 1 503 ? 1.675   156.772 150.000 1.00 62.61  ? 506 ASN A CA  1 
ATOM   4001 C  C   . ASN A 1 503 ? 0.705   157.872 149.587 1.00 61.32  ? 506 ASN A C   1 
ATOM   4002 O  O   . ASN A 1 503 ? 0.488   158.110 148.393 1.00 60.16  ? 506 ASN A O   1 
ATOM   4003 C  CB  . ASN A 1 503 ? 2.688   157.227 151.060 1.00 55.81  ? 506 ASN A CB  1 
ATOM   4004 C  CG  . ASN A 1 503 ? 3.677   158.242 150.525 1.00 59.80  ? 506 ASN A CG  1 
ATOM   4005 O  OD1 . ASN A 1 503 ? 3.302   159.178 149.822 1.00 65.96  ? 506 ASN A OD1 1 
ATOM   4006 N  ND2 . ASN A 1 503 ? 4.950   158.055 150.847 1.00 54.47  ? 506 ASN A ND2 1 
ATOM   4007 N  N   . THR A 1 504 ? 0.118   158.541 150.579 1.00 60.98  ? 507 THR A N   1 
ATOM   4008 C  CA  . THR A 1 504 ? -0.863  159.588 150.320 1.00 60.20  ? 507 THR A CA  1 
ATOM   4009 C  C   . THR A 1 504 ? -0.228  160.931 149.984 1.00 62.98  ? 507 THR A C   1 
ATOM   4010 O  O   . THR A 1 504 ? -0.932  161.829 149.512 1.00 65.44  ? 507 THR A O   1 
ATOM   4011 C  CB  . THR A 1 504 ? -1.793  159.728 151.523 1.00 63.28  ? 507 THR A CB  1 
ATOM   4012 O  OG1 . THR A 1 504 ? -1.017  159.758 152.735 1.00 59.69  ? 507 THR A OG1 1 
ATOM   4013 C  CG2 . THR A 1 504 ? -2.767  158.555 151.558 1.00 56.19  ? 507 THR A CG2 1 
ATOM   4014 N  N   A GLU A 1 505 ? 1.074   161.090 150.218 0.42 65.25  ? 508 GLU A N   1 
ATOM   4015 N  N   B GLU A 1 505 ? 1.070   161.086 150.199 0.58 65.32  ? 508 GLU A N   1 
ATOM   4016 C  CA  A GLU A 1 505 ? 1.790   162.285 149.812 0.42 69.04  ? 508 GLU A CA  1 
ATOM   4017 C  CA  B GLU A 1 505 ? 1.764   162.303 149.819 0.58 68.94  ? 508 GLU A CA  1 
ATOM   4018 C  C   A GLU A 1 505 ? 1.996   162.271 148.299 0.42 73.30  ? 508 GLU A C   1 
ATOM   4019 C  C   B GLU A 1 505 ? 2.100   162.254 148.330 0.58 73.33  ? 508 GLU A C   1 
ATOM   4020 O  O   A GLU A 1 505 ? 1.806   161.243 147.645 0.42 73.04  ? 508 GLU A O   1 
ATOM   4021 O  O   B GLU A 1 505 ? 2.094   161.179 147.721 0.58 73.19  ? 508 GLU A O   1 
ATOM   4022 C  CB  A GLU A 1 505 ? 3.137   162.366 150.532 0.42 71.48  ? 508 GLU A CB  1 
ATOM   4023 C  CB  B GLU A 1 505 ? 3.032   162.466 150.656 0.58 71.55  ? 508 GLU A CB  1 
ATOM   4024 C  CG  A GLU A 1 505 ? 3.071   162.184 152.042 0.42 70.72  ? 508 GLU A CG  1 
ATOM   4025 C  CG  B GLU A 1 505 ? 2.993   161.771 152.024 0.58 70.74  ? 508 GLU A CG  1 
ATOM   4026 C  CD  A GLU A 1 505 ? 4.448   162.144 152.675 0.42 70.75  ? 508 GLU A CD  1 
ATOM   4027 C  CD  B GLU A 1 505 ? 1.753   162.109 152.831 0.58 69.56  ? 508 GLU A CD  1 
ATOM   4028 O  OE1 A GLU A 1 505 ? 5.404   162.643 152.040 0.42 69.01  ? 508 GLU A OE1 1 
ATOM   4029 O  OE1 B GLU A 1 505 ? 1.620   163.271 153.271 0.58 73.21  ? 508 GLU A OE1 1 
ATOM   4030 O  OE2 A GLU A 1 505 ? 4.576   161.607 153.799 0.42 68.65  ? 508 GLU A OE2 1 
ATOM   4031 O  OE2 B GLU A 1 505 ? 0.904   161.209 153.004 0.58 66.07  ? 508 GLU A OE2 1 
ATOM   4032 N  N   . PRO A 1 506 ? 2.373   163.408 147.709 1.00 82.26  ? 509 PRO A N   1 
ATOM   4033 C  CA  . PRO A 1 506 ? 2.768   163.399 146.293 1.00 75.39  ? 509 PRO A CA  1 
ATOM   4034 C  C   . PRO A 1 506 ? 3.987   162.515 146.076 1.00 77.00  ? 509 PRO A C   1 
ATOM   4035 O  O   . PRO A 1 506 ? 4.859   162.404 146.938 1.00 80.97  ? 509 PRO A O   1 
ATOM   4036 C  CB  . PRO A 1 506 ? 3.091   164.869 146.003 1.00 74.14  ? 509 PRO A CB  1 
ATOM   4037 C  CG  . PRO A 1 506 ? 2.315   165.632 147.007 1.00 77.46  ? 509 PRO A CG  1 
ATOM   4038 C  CD  . PRO A 1 506 ? 2.289   164.781 148.241 1.00 78.31  ? 509 PRO A CD  1 
ATOM   4039 N  N   . MET A 1 507 ? 4.039   161.873 144.914 1.00 76.20  ? 510 MET A N   1 
ATOM   4040 C  CA  . MET A 1 507 ? 5.072   160.875 144.685 1.00 74.14  ? 510 MET A CA  1 
ATOM   4041 C  C   . MET A 1 507 ? 6.435   161.534 144.532 1.00 73.39  ? 510 MET A C   1 
ATOM   4042 O  O   . MET A 1 507 ? 6.582   162.524 143.811 1.00 79.26  ? 510 MET A O   1 
ATOM   4043 C  CB  . MET A 1 507 ? 4.747   160.042 143.449 1.00 79.90  ? 510 MET A CB  1 
ATOM   4044 C  CG  . MET A 1 507 ? 5.866   159.094 143.043 1.00 76.17  ? 510 MET A CG  1 
ATOM   4045 S  SD  . MET A 1 507 ? 6.308   159.296 141.309 1.00 89.73  ? 510 MET A SD  1 
ATOM   4046 C  CE  . MET A 1 507 ? 4.790   158.792 140.524 1.00 76.46  ? 510 MET A CE  1 
ATOM   4047 N  N   . LYS A 1 508 ? 7.427   160.996 145.231 1.00 77.75  ? 511 LYS A N   1 
ATOM   4048 C  CA  . LYS A 1 508 ? 8.820   161.345 145.018 1.00 80.24  ? 511 LYS A CA  1 
ATOM   4049 C  C   . LYS A 1 508 ? 9.598   160.086 144.659 1.00 74.43  ? 511 LYS A C   1 
ATOM   4050 O  O   . LYS A 1 508 ? 9.188   158.964 144.971 1.00 66.62  ? 511 LYS A O   1 
ATOM   4051 C  CB  . LYS A 1 508 ? 9.458   162.016 146.248 1.00 79.58  ? 511 LYS A CB  1 
ATOM   4052 C  CG  . LYS A 1 508 ? 8.646   161.947 147.529 1.00 83.32  ? 511 LYS A CG  1 
ATOM   4053 C  CD  . LYS A 1 508 ? 7.777   163.191 147.691 1.00 90.14  ? 511 LYS A CD  1 
ATOM   4054 C  CE  . LYS A 1 508 ? 7.173   163.274 149.096 1.00 90.08  ? 511 LYS A CE  1 
ATOM   4055 N  NZ  . LYS A 1 508 ? 5.884   164.031 149.118 1.00 84.73  ? 511 LYS A NZ  1 
ATOM   4056 N  N   . VAL A 1 509 ? 10.731  160.292 143.996 1.00 67.16  ? 512 VAL A N   1 
ATOM   4057 C  CA  . VAL A 1 509 ? 11.589  159.213 143.531 1.00 62.00  ? 512 VAL A CA  1 
ATOM   4058 C  C   . VAL A 1 509 ? 12.821  159.176 144.417 1.00 59.66  ? 512 VAL A C   1 
ATOM   4059 O  O   . VAL A 1 509 ? 13.346  160.225 144.806 1.00 65.24  ? 512 VAL A O   1 
ATOM   4060 C  CB  . VAL A 1 509 ? 11.984  159.398 142.050 1.00 66.45  ? 512 VAL A CB  1 
ATOM   4061 C  CG1 . VAL A 1 509 ? 12.915  158.277 141.600 1.00 57.15  ? 512 VAL A CG1 1 
ATOM   4062 C  CG2 . VAL A 1 509 ? 10.739  159.485 141.163 1.00 55.79  ? 512 VAL A CG2 1 
ATOM   4063 N  N   . HIS A 1 510 ? 13.272  157.969 144.742 1.00 53.83  ? 513 HIS A N   1 
ATOM   4064 C  CA  . HIS A 1 510 ? 14.484  157.753 145.511 1.00 58.12  ? 513 HIS A CA  1 
ATOM   4065 C  C   . HIS A 1 510 ? 15.347  156.754 144.763 1.00 55.44  ? 513 HIS A C   1 
ATOM   4066 O  O   . HIS A 1 510 ? 14.965  156.239 143.714 1.00 54.48  ? 513 HIS A O   1 
ATOM   4067 C  CB  . HIS A 1 510 ? 14.169  157.253 146.931 1.00 64.37  ? 513 HIS A CB  1 
ATOM   4068 C  CG  . HIS A 1 510 ? 13.157  158.090 147.650 1.00 65.87  ? 513 HIS A CG  1 
ATOM   4069 N  ND1 . HIS A 1 510 ? 13.506  159.172 148.428 1.00 65.39  ? 513 HIS A ND1 1 
ATOM   4070 C  CD2 . HIS A 1 510 ? 11.805  158.019 147.686 1.00 63.25  ? 513 HIS A CD2 1 
ATOM   4071 C  CE1 . HIS A 1 510 ? 12.412  159.725 148.921 1.00 72.33  ? 513 HIS A CE1 1 
ATOM   4072 N  NE2 . HIS A 1 510 ? 11.367  159.047 148.483 1.00 69.45  ? 513 HIS A NE2 1 
ATOM   4073 N  N   . GLN A 1 511 ? 16.510  156.455 145.320 1.00 61.75  ? 514 GLN A N   1 
ATOM   4074 C  CA  . GLN A 1 511 ? 17.409  155.483 144.726 1.00 63.70  ? 514 GLN A CA  1 
ATOM   4075 C  C   . GLN A 1 511 ? 17.924  154.543 145.800 1.00 58.19  ? 514 GLN A C   1 
ATOM   4076 O  O   . GLN A 1 511 ? 18.055  154.922 146.965 1.00 61.07  ? 514 GLN A O   1 
ATOM   4077 C  CB  . GLN A 1 511 ? 18.597  156.159 144.041 1.00 63.62  ? 514 GLN A CB  1 
ATOM   4078 C  CG  . GLN A 1 511 ? 18.220  157.285 143.108 1.00 72.54  ? 514 GLN A CG  1 
ATOM   4079 C  CD  . GLN A 1 511 ? 19.437  157.933 142.482 1.00 85.36  ? 514 GLN A CD  1 
ATOM   4080 O  OE1 . GLN A 1 511 ? 20.566  157.754 142.961 1.00 80.39  ? 514 GLN A OE1 1 
ATOM   4081 N  NE2 . GLN A 1 511 ? 19.219  158.687 141.402 1.00 75.54  ? 514 GLN A NE2 1 
ATOM   4082 N  N   . ARG A 1 512 ? 18.201  153.305 145.390 1.00 58.64  ? 515 ARG A N   1 
ATOM   4083 C  CA  . ARG A 1 512 ? 18.992  152.356 146.171 1.00 58.45  ? 515 ARG A CA  1 
ATOM   4084 C  C   . ARG A 1 512 ? 18.293  151.998 147.488 1.00 60.55  ? 515 ARG A C   1 
ATOM   4085 O  O   . ARG A 1 512 ? 18.762  152.301 148.594 1.00 57.17  ? 515 ARG A O   1 
ATOM   4086 C  CB  . ARG A 1 512 ? 20.401  152.919 146.399 1.00 63.67  ? 515 ARG A CB  1 
ATOM   4087 C  CG  . ARG A 1 512 ? 21.199  153.007 145.113 1.00 66.97  ? 515 ARG A CG  1 
ATOM   4088 C  CD  . ARG A 1 512 ? 22.532  153.721 145.274 1.00 74.28  ? 515 ARG A CD  1 
ATOM   4089 N  NE  . ARG A 1 512 ? 23.294  153.632 144.032 1.00 72.74  ? 515 ARG A NE  1 
ATOM   4090 C  CZ  . ARG A 1 512 ? 23.176  154.488 143.022 1.00 83.85  ? 515 ARG A CZ  1 
ATOM   4091 N  NH1 . ARG A 1 512 ? 22.338  155.517 143.110 1.00 84.08  ? 515 ARG A NH1 1 
ATOM   4092 N  NH2 . ARG A 1 512 ? 23.893  154.315 141.920 1.00 80.75  ? 515 ARG A NH2 1 
ATOM   4093 N  N   . LEU A 1 513 ? 17.157  151.312 147.327 1.00 53.39  ? 516 LEU A N   1 
ATOM   4094 C  CA  . LEU A 1 513 ? 16.313  150.888 148.438 1.00 52.02  ? 516 LEU A CA  1 
ATOM   4095 C  C   . LEU A 1 513 ? 17.109  150.077 149.455 1.00 52.35  ? 516 LEU A C   1 
ATOM   4096 O  O   . LEU A 1 513 ? 17.529  148.954 149.163 1.00 51.23  ? 516 LEU A O   1 
ATOM   4097 C  CB  . LEU A 1 513 ? 15.117  150.082 147.914 1.00 53.34  ? 516 LEU A CB  1 
ATOM   4098 C  CG  . LEU A 1 513 ? 13.834  149.999 148.757 1.00 50.00  ? 516 LEU A CG  1 
ATOM   4099 C  CD1 . LEU A 1 513 ? 12.643  149.628 147.897 1.00 49.09  ? 516 LEU A CD1 1 
ATOM   4100 C  CD2 . LEU A 1 513 ? 13.963  148.996 149.881 1.00 49.25  ? 516 LEU A CD2 1 
ATOM   4101 N  N   . ARG A 1 514 ? 17.320  150.656 150.644 1.00 50.68  ? 517 ARG A N   1 
ATOM   4102 C  CA  . ARG A 1 514 ? 17.990  150.006 151.778 1.00 48.88  ? 517 ARG A CA  1 
ATOM   4103 C  C   . ARG A 1 514 ? 19.275  149.294 151.357 1.00 50.53  ? 517 ARG A C   1 
ATOM   4104 O  O   . ARG A 1 514 ? 19.556  148.161 151.762 1.00 49.97  ? 517 ARG A O   1 
ATOM   4105 C  CB  . ARG A 1 514 ? 17.030  149.059 152.507 1.00 50.28  ? 517 ARG A CB  1 
ATOM   4106 C  CG  . ARG A 1 514 ? 15.998  149.824 153.355 1.00 56.33  ? 517 ARG A CG  1 
ATOM   4107 C  CD  . ARG A 1 514 ? 15.137  148.947 154.237 1.00 47.35  ? 517 ARG A CD  1 
ATOM   4108 N  NE  . ARG A 1 514 ? 15.869  148.409 155.384 1.00 54.45  ? 517 ARG A NE  1 
ATOM   4109 C  CZ  . ARG A 1 514 ? 16.093  149.073 156.517 1.00 55.06  ? 517 ARG A CZ  1 
ATOM   4110 N  NH1 . ARG A 1 514 ? 15.655  150.314 156.660 1.00 53.47  ? 517 ARG A NH1 1 
ATOM   4111 N  NH2 . ARG A 1 514 ? 16.759  148.499 157.510 1.00 51.65  ? 517 ARG A NH2 1 
ATOM   4112 N  N   . VAL A 1 515 ? 20.090  150.002 150.569 1.00 49.57  ? 518 VAL A N   1 
ATOM   4113 C  CA  . VAL A 1 515 ? 21.267  149.385 149.968 1.00 50.38  ? 518 VAL A CA  1 
ATOM   4114 C  C   . VAL A 1 515 ? 22.328  149.069 151.021 1.00 50.01  ? 518 VAL A C   1 
ATOM   4115 O  O   . VAL A 1 515 ? 22.976  148.016 150.959 1.00 47.63  ? 518 VAL A O   1 
ATOM   4116 C  CB  . VAL A 1 515 ? 21.808  150.279 148.836 1.00 59.15  ? 518 VAL A CB  1 
ATOM   4117 C  CG1 . VAL A 1 515 ? 21.908  151.720 149.307 1.00 63.54  ? 518 VAL A CG1 1 
ATOM   4118 C  CG2 . VAL A 1 515 ? 23.150  149.750 148.329 1.00 47.92  ? 518 VAL A CG2 1 
ATOM   4119 N  N   . GLN A 1 516 ? 22.490  149.909 152.021 1.00 56.61  ? 519 GLN A N   1 
ATOM   4120 C  CA  . GLN A 1 516 ? 23.471  149.584 153.024 1.00 53.57  ? 519 GLN A CA  1 
ATOM   4121 C  C   . GLN A 1 516 ? 23.151  148.294 153.724 1.00 53.02  ? 519 GLN A C   1 
ATOM   4122 O  O   . GLN A 1 516 ? 23.993  147.458 153.879 1.00 49.91  ? 519 GLN A O   1 
ATOM   4123 C  CB  . GLN A 1 516 ? 23.535  150.680 154.068 1.00 63.09  ? 519 GLN A CB  1 
ATOM   4124 C  CG  . GLN A 1 516 ? 24.949  151.022 154.481 1.00 68.29  ? 519 GLN A CG  1 
ATOM   4125 C  CD  . GLN A 1 516 ? 25.245  150.900 155.958 1.00 75.11  ? 519 GLN A CD  1 
ATOM   4126 O  OE1 . GLN A 1 516 ? 26.194  150.243 156.343 1.00 68.96  ? 519 GLN A OE1 1 
ATOM   4127 N  NE2 . GLN A 1 516 ? 24.474  151.581 156.779 1.00 70.27  ? 519 GLN A NE2 1 
ATOM   4128 N  N   . MET A 1 517 ? 21.917  148.133 154.137 1.00 44.60  ? 520 MET A N   1 
ATOM   4129 C  CA  . MET A 1 517 ? 21.508  146.925 154.795 1.00 45.30  ? 520 MET A CA  1 
ATOM   4130 C  C   . MET A 1 517 ? 21.504  145.713 153.898 1.00 51.53  ? 520 MET A C   1 
ATOM   4131 O  O   . MET A 1 517 ? 21.859  144.654 154.300 1.00 47.98  ? 520 MET A O   1 
ATOM   4132 C  CB  . MET A 1 517 ? 20.173  147.126 155.461 1.00 50.69  ? 520 MET A CB  1 
ATOM   4133 C  CG  . MET A 1 517 ? 20.187  148.189 156.524 1.00 59.23  ? 520 MET A CG  1 
ATOM   4134 S  SD  . MET A 1 517 ? 21.549  147.987 157.648 1.00 68.35  ? 520 MET A SD  1 
ATOM   4135 C  CE  . MET A 1 517 ? 21.443  149.492 158.561 1.00 73.91  ? 520 MET A CE  1 
ATOM   4136 N  N   . CYS A 1 518 ? 21.060  145.891 152.677 1.00 47.88  ? 521 CYS A N   1 
ATOM   4137 C  CA  . CYS A 1 518 ? 21.040  144.812 151.729 1.00 51.40  ? 521 CYS A CA  1 
ATOM   4138 C  C   . CYS A 1 518 ? 22.450  144.370 151.336 1.00 52.09  ? 521 CYS A C   1 
ATOM   4139 O  O   . CYS A 1 518 ? 22.690  143.205 151.214 1.00 46.48  ? 521 CYS A O   1 
ATOM   4140 C  CB  . CYS A 1 518 ? 19.901  144.941 150.727 1.00 43.58  ? 521 CYS A CB  1 
ATOM   4141 S  SG  . CYS A 1 518 ? 18.358  144.659 151.653 1.00 62.90  ? 521 CYS A SG  1 
ATOM   4142 N  N   . VAL A 1 519 ? 23.388  145.307 151.196 1.00 46.78  ? 522 VAL A N   1 
ATOM   4143 C  CA  . VAL A 1 519 ? 24.798  144.943 151.046 1.00 45.84  ? 522 VAL A CA  1 
ATOM   4144 C  C   . VAL A 1 519 ? 25.278  144.130 152.244 1.00 48.66  ? 522 VAL A C   1 
ATOM   4145 O  O   . VAL A 1 519 ? 26.076  143.197 152.094 1.00 50.71  ? 522 VAL A O   1 
ATOM   4146 C  CB  . VAL A 1 519 ? 25.674  146.191 150.830 1.00 51.76  ? 522 VAL A CB  1 
ATOM   4147 C  CG1 . VAL A 1 519 ? 27.142  145.819 150.938 1.00 49.80  ? 522 VAL A CG1 1 
ATOM   4148 C  CG2 . VAL A 1 519 ? 25.411  146.791 149.467 1.00 52.60  ? 522 VAL A CG2 1 
ATOM   4149 N  N   . PHE A 1 520 ? 24.807  144.461 153.454 1.00 49.00  ? 523 PHE A N   1 
ATOM   4150 C  CA  . PHE A 1 520 ? 25.193  143.670 154.621 1.00 45.82  ? 523 PHE A CA  1 
ATOM   4151 C  C   . PHE A 1 520 ? 24.658  142.246 154.526 1.00 47.28  ? 523 PHE A C   1 
ATOM   4152 O  O   . PHE A 1 520 ? 25.405  141.279 154.715 1.00 48.04  ? 523 PHE A O   1 
ATOM   4153 C  CB  . PHE A 1 520 ? 24.706  144.326 155.922 1.00 49.36  ? 523 PHE A CB  1 
ATOM   4154 C  CG  . PHE A 1 520 ? 24.884  143.446 157.146 1.00 45.18  ? 523 PHE A CG  1 
ATOM   4155 C  CD1 . PHE A 1 520 ? 26.119  143.327 157.759 1.00 45.41  ? 523 PHE A CD1 1 
ATOM   4156 C  CD2 . PHE A 1 520 ? 23.826  142.715 157.657 1.00 43.75  ? 523 PHE A CD2 1 
ATOM   4157 C  CE1 . PHE A 1 520 ? 26.290  142.513 158.871 1.00 47.48  ? 523 PHE A CE1 1 
ATOM   4158 C  CE2 . PHE A 1 520 ? 23.997  141.901 158.758 1.00 47.76  ? 523 PHE A CE2 1 
ATOM   4159 C  CZ  . PHE A 1 520 ? 25.233  141.800 159.367 1.00 47.72  ? 523 PHE A CZ  1 
ATOM   4160 N  N   . TRP A 1 521 ? 23.352  142.099 154.267 1.00 49.50  ? 524 TRP A N   1 
ATOM   4161 C  CA  . TRP A 1 521 ? 22.731  140.771 154.243 1.00 51.57  ? 524 TRP A CA  1 
ATOM   4162 C  C   . TRP A 1 521 ? 23.106  139.985 152.993 1.00 55.46  ? 524 TRP A C   1 
ATOM   4163 O  O   . TRP A 1 521 ? 23.331  138.772 153.072 1.00 55.63  ? 524 TRP A O   1 
ATOM   4164 C  CB  . TRP A 1 521 ? 21.209  140.882 154.326 1.00 50.44  ? 524 TRP A CB  1 
ATOM   4165 C  CG  . TRP A 1 521 ? 20.728  141.304 155.646 1.00 48.82  ? 524 TRP A CG  1 
ATOM   4166 C  CD1 . TRP A 1 521 ? 20.225  142.520 155.977 1.00 44.54  ? 524 TRP A CD1 1 
ATOM   4167 C  CD2 . TRP A 1 521 ? 20.725  140.520 156.843 1.00 48.17  ? 524 TRP A CD2 1 
ATOM   4168 N  NE1 . TRP A 1 521 ? 19.904  142.544 157.304 1.00 53.64  ? 524 TRP A NE1 1 
ATOM   4169 C  CE2 . TRP A 1 521 ? 20.203  141.328 157.862 1.00 47.83  ? 524 TRP A CE2 1 
ATOM   4170 C  CE3 . TRP A 1 521 ? 21.113  139.215 157.149 1.00 46.88  ? 524 TRP A CE3 1 
ATOM   4171 C  CZ2 . TRP A 1 521 ? 20.055  140.878 159.169 1.00 41.92  ? 524 TRP A CZ2 1 
ATOM   4172 C  CZ3 . TRP A 1 521 ? 20.968  138.770 158.445 1.00 52.57  ? 524 TRP A CZ3 1 
ATOM   4173 C  CH2 . TRP A 1 521 ? 20.443  139.598 159.440 1.00 45.99  ? 524 TRP A CH2 1 
ATOM   4174 N  N   . ASN A 1 522 ? 23.154  140.647 151.829 1.00 45.64  ? 525 ASN A N   1 
ATOM   4175 C  CA  . ASN A 1 522 ? 23.342  139.915 150.574 1.00 56.47  ? 525 ASN A CA  1 
ATOM   4176 C  C   . ASN A 1 522 ? 24.812  139.622 150.279 1.00 60.16  ? 525 ASN A C   1 
ATOM   4177 O  O   . ASN A 1 522 ? 25.139  138.524 149.822 1.00 63.19  ? 525 ASN A O   1 
ATOM   4178 C  CB  . ASN A 1 522 ? 22.708  140.676 149.408 1.00 45.08  ? 525 ASN A CB  1 
ATOM   4179 C  CG  . ASN A 1 522 ? 21.195  140.633 149.454 1.00 48.14  ? 525 ASN A CG  1 
ATOM   4180 O  OD1 . ASN A 1 522 ? 20.619  139.699 150.008 1.00 53.84  ? 525 ASN A OD1 1 
ATOM   4181 N  ND2 . ASN A 1 522 ? 20.544  141.642 148.888 1.00 45.76  ? 525 ASN A ND2 1 
ATOM   4182 N  N   . GLN A 1 523 ? 25.713  140.568 150.537 1.00 66.07  ? 526 GLN A N   1 
ATOM   4183 C  CA  . GLN A 1 523 ? 27.136  140.345 150.296 1.00 58.64  ? 526 GLN A CA  1 
ATOM   4184 C  C   . GLN A 1 523 ? 27.933  140.041 151.559 1.00 63.71  ? 526 GLN A C   1 
ATOM   4185 O  O   . GLN A 1 523 ? 28.598  139.002 151.627 1.00 69.42  ? 526 GLN A O   1 
ATOM   4186 C  CB  . GLN A 1 523 ? 27.744  141.552 149.584 1.00 53.08  ? 526 GLN A CB  1 
ATOM   4187 C  CG  . GLN A 1 523 ? 27.421  141.588 148.126 1.00 61.83  ? 526 GLN A CG  1 
ATOM   4188 C  CD  . GLN A 1 523 ? 26.558  142.769 147.763 1.00 74.02  ? 526 GLN A CD  1 
ATOM   4189 O  OE1 . GLN A 1 523 ? 27.059  143.798 147.298 1.00 80.39  ? 526 GLN A OE1 1 
ATOM   4190 N  NE2 . GLN A 1 523 ? 25.250  142.635 147.969 1.00 73.25  ? 526 GLN A NE2 1 
ATOM   4191 N  N   . PHE A 1 524 ? 27.884  140.911 152.572 1.00 60.11  ? 527 PHE A N   1 
ATOM   4192 C  CA  . PHE A 1 524 ? 28.894  140.841 153.628 1.00 55.09  ? 527 PHE A CA  1 
ATOM   4193 C  C   . PHE A 1 524 ? 28.700  139.636 154.547 1.00 59.89  ? 527 PHE A C   1 
ATOM   4194 O  O   . PHE A 1 524 ? 29.631  138.846 154.753 1.00 60.46  ? 527 PHE A O   1 
ATOM   4195 C  CB  . PHE A 1 524 ? 28.921  142.125 154.457 1.00 52.71  ? 527 PHE A CB  1 
ATOM   4196 C  CG  . PHE A 1 524 ? 29.978  142.097 155.512 1.00 53.76  ? 527 PHE A CG  1 
ATOM   4197 C  CD1 . PHE A 1 524 ? 31.319  142.121 155.156 1.00 50.59  ? 527 PHE A CD1 1 
ATOM   4198 C  CD2 . PHE A 1 524 ? 29.643  141.984 156.850 1.00 52.46  ? 527 PHE A CD2 1 
ATOM   4199 C  CE1 . PHE A 1 524 ? 32.305  142.062 156.118 1.00 58.73  ? 527 PHE A CE1 1 
ATOM   4200 C  CE2 . PHE A 1 524 ? 30.625  141.927 157.817 1.00 54.90  ? 527 PHE A CE2 1 
ATOM   4201 C  CZ  . PHE A 1 524 ? 31.960  141.967 157.448 1.00 55.57  ? 527 PHE A CZ  1 
ATOM   4202 N  N   . LEU A 1 525 ? 27.524  139.510 155.162 1.00 57.14  ? 528 LEU A N   1 
ATOM   4203 C  CA  . LEU A 1 525 ? 27.344  138.439 156.143 1.00 64.21  ? 528 LEU A CA  1 
ATOM   4204 C  C   . LEU A 1 525 ? 27.564  137.045 155.550 1.00 64.70  ? 528 LEU A C   1 
ATOM   4205 O  O   . LEU A 1 525 ? 28.158  136.201 156.246 1.00 65.06  ? 528 LEU A O   1 
ATOM   4206 C  CB  . LEU A 1 525 ? 25.964  138.557 156.813 1.00 49.97  ? 528 LEU A CB  1 
ATOM   4207 C  CG  . LEU A 1 525 ? 25.743  137.640 158.017 1.00 51.90  ? 528 LEU A CG  1 
ATOM   4208 C  CD1 . LEU A 1 525 ? 26.814  137.859 159.079 1.00 57.38  ? 528 LEU A CD1 1 
ATOM   4209 C  CD2 . LEU A 1 525 ? 24.353  137.822 158.618 1.00 56.32  ? 528 LEU A CD2 1 
ATOM   4210 N  N   . PRO A 1 526 ? 27.141  136.739 154.311 1.00 60.53  ? 529 PRO A N   1 
ATOM   4211 C  CA  . PRO A 1 526 ? 27.550  135.461 153.694 1.00 63.20  ? 529 PRO A CA  1 
ATOM   4212 C  C   . PRO A 1 526 ? 29.056  135.230 153.665 1.00 66.64  ? 529 PRO A C   1 
ATOM   4213 O  O   . PRO A 1 526 ? 29.526  134.160 154.075 1.00 69.85  ? 529 PRO A O   1 
ATOM   4214 C  CB  . PRO A 1 526 ? 26.972  135.570 152.277 1.00 65.98  ? 529 PRO A CB  1 
ATOM   4215 C  CG  . PRO A 1 526 ? 25.804  136.455 152.416 1.00 64.37  ? 529 PRO A CG  1 
ATOM   4216 C  CD  . PRO A 1 526 ? 26.142  137.445 153.488 1.00 61.69  ? 529 PRO A CD  1 
ATOM   4217 N  N   . LYS A 1 527 ? 29.829  136.205 153.179 1.00 65.14  ? 530 LYS A N   1 
ATOM   4218 C  CA  . LYS A 1 527 ? 31.279  136.046 153.149 1.00 63.83  ? 530 LYS A CA  1 
ATOM   4219 C  C   . LYS A 1 527 ? 31.835  135.774 154.542 1.00 68.32  ? 530 LYS A C   1 
ATOM   4220 O  O   . LYS A 1 527 ? 32.780  134.991 154.702 1.00 71.65  ? 530 LYS A O   1 
ATOM   4221 C  CB  . LYS A 1 527 ? 31.923  137.292 152.537 1.00 67.51  ? 530 LYS A CB  1 
ATOM   4222 C  CG  . LYS A 1 527 ? 33.360  137.103 152.065 1.00 71.66  ? 530 LYS A CG  1 
ATOM   4223 C  CD  . LYS A 1 527 ? 33.900  138.350 151.363 1.00 66.40  ? 530 LYS A CD  1 
ATOM   4224 N  N   . LEU A 1 528 ? 31.246  136.393 155.570 1.00 70.99  ? 531 LEU A N   1 
ATOM   4225 C  CA  . LEU A 1 528 ? 31.769  136.236 156.924 1.00 67.49  ? 531 LEU A CA  1 
ATOM   4226 C  C   . LEU A 1 528 ? 31.484  134.842 157.470 1.00 70.22  ? 531 LEU A C   1 
ATOM   4227 O  O   . LEU A 1 528 ? 32.304  134.275 158.202 1.00 72.02  ? 531 LEU A O   1 
ATOM   4228 C  CB  . LEU A 1 528 ? 31.182  137.316 157.834 1.00 65.72  ? 531 LEU A CB  1 
ATOM   4229 C  CG  . LEU A 1 528 ? 31.564  137.345 159.317 1.00 68.43  ? 531 LEU A CG  1 
ATOM   4230 C  CD1 . LEU A 1 528 ? 31.577  138.774 159.822 1.00 65.39  ? 531 LEU A CD1 1 
ATOM   4231 C  CD2 . LEU A 1 528 ? 30.600  136.523 160.144 1.00 67.99  ? 531 LEU A CD2 1 
ATOM   4232 N  N   . LEU A 1 529 ? 30.332  134.272 157.125 1.00 71.65  ? 532 LEU A N   1 
ATOM   4233 C  CA  . LEU A 1 529 ? 30.007  132.936 157.611 1.00 75.47  ? 532 LEU A CA  1 
ATOM   4234 C  C   . LEU A 1 529 ? 30.773  131.852 156.852 1.00 83.10  ? 532 LEU A C   1 
ATOM   4235 O  O   . LEU A 1 529 ? 31.164  130.839 157.444 1.00 87.10  ? 532 LEU A O   1 
ATOM   4236 C  CB  . LEU A 1 529 ? 28.497  132.711 157.522 1.00 75.89  ? 532 LEU A CB  1 
ATOM   4237 C  CG  . LEU A 1 529 ? 27.664  133.652 158.402 1.00 74.02  ? 532 LEU A CG  1 
ATOM   4238 C  CD1 . LEU A 1 529 ? 26.180  133.499 158.121 1.00 69.85  ? 532 LEU A CD1 1 
ATOM   4239 C  CD2 . LEU A 1 529 ? 27.958  133.419 159.876 1.00 69.48  ? 532 LEU A CD2 1 
ATOM   4240 N  N   . ASN A 1 530 ? 31.013  132.049 155.548 1.00 80.01  ? 533 ASN A N   1 
ATOM   4241 C  CA  . ASN A 1 530 ? 31.807  131.116 154.747 1.00 86.32  ? 533 ASN A CA  1 
ATOM   4242 C  C   . ASN A 1 530 ? 33.288  131.121 155.121 1.00 90.69  ? 533 ASN A C   1 
ATOM   4243 O  O   . ASN A 1 530 ? 34.049  130.317 154.569 1.00 97.64  ? 533 ASN A O   1 
ATOM   4244 C  CB  . ASN A 1 530 ? 31.654  131.439 153.252 1.00 84.62  ? 533 ASN A CB  1 
ATOM   4245 C  CG  . ASN A 1 530 ? 32.099  130.289 152.347 1.00 101.16 ? 533 ASN A CG  1 
ATOM   4246 O  OD1 . ASN A 1 530 ? 32.162  129.134 152.781 1.00 103.05 ? 533 ASN A OD1 1 
ATOM   4247 N  ND2 . ASN A 1 530 ? 32.407  130.602 151.082 1.00 95.34  ? 533 ASN A ND2 1 
ATOM   4248 N  N   . ALA A 1 531 ? 33.717  131.989 156.039 1.00 85.63  ? 534 ALA A N   1 
ATOM   4249 C  CA  . ALA A 1 531 ? 35.126  132.146 156.356 1.00 83.83  ? 534 ALA A CA  1 
ATOM   4250 C  C   . ALA A 1 531 ? 35.491  131.773 157.784 1.00 89.48  ? 534 ALA A C   1 
ATOM   4251 O  O   . ALA A 1 531 ? 36.688  131.697 158.093 1.00 98.39  ? 534 ALA A O   1 
ATOM   4252 C  CB  . ALA A 1 531 ? 35.572  133.592 156.092 1.00 78.79  ? 534 ALA A CB  1 
ATOM   4253 N  N   . THR A 1 532 ? 34.517  131.539 158.659 1.00 90.95  ? 535 THR A N   1 
ATOM   4254 C  CA  . THR A 1 532 ? 34.816  131.211 160.055 1.00 96.49  ? 535 THR A CA  1 
ATOM   4255 C  C   . THR A 1 532 ? 34.898  129.700 160.274 1.00 98.59  ? 535 THR A C   1 
ATOM   4256 O  O   . THR A 1 532 ? 33.907  128.983 160.128 1.00 97.56  ? 535 THR A O   1 
ATOM   4257 C  CB  . THR A 1 532 ? 33.765  131.804 161.016 1.00 92.97  ? 535 THR A CB  1 
ATOM   4258 O  OG1 . THR A 1 532 ? 33.635  133.212 160.779 1.00 85.62  ? 535 THR A OG1 1 
ATOM   4259 C  CG2 . THR A 1 532 ? 34.178  131.575 162.467 1.00 93.55  ? 535 THR A CG2 1 
HETATM 4260 C  C1  . NAG B 2 .   ? -26.513 127.937 142.746 1.00 85.31  ? 601 NAG A C1  1 
HETATM 4261 C  C2  . NAG B 2 .   ? -28.028 128.051 142.493 1.00 84.98  ? 601 NAG A C2  1 
HETATM 4262 C  C3  . NAG B 2 .   ? -28.666 128.978 143.532 1.00 87.65  ? 601 NAG A C3  1 
HETATM 4263 C  C4  . NAG B 2 .   ? -28.363 128.486 144.943 1.00 93.61  ? 601 NAG A C4  1 
HETATM 4264 C  C5  . NAG B 2 .   ? -26.851 128.416 145.143 1.00 86.62  ? 601 NAG A C5  1 
HETATM 4265 C  C6  . NAG B 2 .   ? -26.441 127.904 146.510 1.00 77.13  ? 601 NAG A C6  1 
HETATM 4266 C  C7  . NAG B 2 .   ? -28.805 127.739 140.171 1.00 89.36  ? 601 NAG A C7  1 
HETATM 4267 C  C8  . NAG B 2 .   ? -29.048 128.411 138.852 1.00 79.06  ? 601 NAG A C8  1 
HETATM 4268 N  N2  . NAG B 2 .   ? -28.316 128.519 141.145 1.00 85.68  ? 601 NAG A N2  1 
HETATM 4269 O  O3  . NAG B 2 .   ? -30.071 129.049 143.319 1.00 94.64  ? 601 NAG A O3  1 
HETATM 4270 O  O4  . NAG B 2 .   ? -28.952 129.342 145.918 1.00 99.41  ? 601 NAG A O4  1 
HETATM 4271 O  O5  . NAG B 2 .   ? -26.270 127.541 144.158 1.00 90.25  ? 601 NAG A O5  1 
HETATM 4272 O  O6  . NAG B 2 .   ? -26.609 126.500 146.656 1.00 77.82  ? 601 NAG A O6  1 
HETATM 4273 O  O7  . NAG B 2 .   ? -29.031 126.543 140.341 1.00 88.35  ? 601 NAG A O7  1 
HETATM 4274 C  C1  . NAG C 2 .   ? 12.606  145.634 125.751 1.00 55.32  ? 602 NAG A C1  1 
HETATM 4275 C  C2  . NAG C 2 .   ? 13.669  146.738 125.801 1.00 58.13  ? 602 NAG A C2  1 
HETATM 4276 C  C3  . NAG C 2 .   ? 13.601  147.595 124.544 1.00 54.57  ? 602 NAG A C3  1 
HETATM 4277 C  C4  . NAG C 2 .   ? 13.786  146.716 123.317 1.00 59.05  ? 602 NAG A C4  1 
HETATM 4278 C  C5  . NAG C 2 .   ? 12.707  145.640 123.303 1.00 60.69  ? 602 NAG A C5  1 
HETATM 4279 C  C6  . NAG C 2 .   ? 12.895  144.644 122.183 1.00 51.29  ? 602 NAG A C6  1 
HETATM 4280 C  C7  . NAG C 2 .   ? 14.261  147.367 128.099 1.00 55.68  ? 602 NAG A C7  1 
HETATM 4281 C  C8  . NAG C 2 .   ? 13.991  148.309 129.234 1.00 59.17  ? 602 NAG A C8  1 
HETATM 4282 N  N2  . NAG C 2 .   ? 13.533  147.561 126.993 1.00 50.12  ? 602 NAG A N2  1 
HETATM 4283 O  O3  . NAG C 2 .   ? 14.617  148.588 124.601 1.00 55.57  ? 602 NAG A O3  1 
HETATM 4284 O  O4  . NAG C 2 .   ? 13.740  147.486 122.119 1.00 69.14  ? 602 NAG A O4  1 
HETATM 4285 O  O5  . NAG C 2 .   ? 12.739  144.883 124.528 1.00 55.64  ? 602 NAG A O5  1 
HETATM 4286 O  O6  . NAG C 2 .   ? 11.821  143.715 122.145 1.00 64.02  ? 602 NAG A O6  1 
HETATM 4287 O  O7  . NAG C 2 .   ? 15.090  146.459 128.187 1.00 55.74  ? 602 NAG A O7  1 
HETATM 4288 C  C1  . NAG D 2 .   ? -16.791 152.392 160.621 1.00 80.57  ? 603 NAG A C1  1 
HETATM 4289 C  C2  . NAG D 2 .   ? -16.856 150.928 161.093 1.00 85.19  ? 603 NAG A C2  1 
HETATM 4290 C  C3  . NAG D 2 .   ? -18.068 150.709 162.005 1.00 90.82  ? 603 NAG A C3  1 
HETATM 4291 C  C4  . NAG D 2 .   ? -18.040 151.694 163.165 1.00 87.88  ? 603 NAG A C4  1 
HETATM 4292 C  C5  . NAG D 2 .   ? -18.007 153.115 162.615 1.00 93.27  ? 603 NAG A C5  1 
HETATM 4293 C  C6  . NAG D 2 .   ? -17.917 154.170 163.695 1.00 94.99  ? 603 NAG A C6  1 
HETATM 4294 C  C7  . NAG D 2 .   ? -15.906 149.150 159.686 1.00 83.99  ? 603 NAG A C7  1 
HETATM 4295 C  C8  . NAG D 2 .   ? -16.109 148.283 158.477 1.00 75.21  ? 603 NAG A C8  1 
HETATM 4296 N  N2  . NAG D 2 .   ? -16.892 150.013 159.963 1.00 83.95  ? 603 NAG A N2  1 
HETATM 4297 O  O3  . NAG D 2 .   ? -18.083 149.372 162.496 1.00 82.88  ? 603 NAG A O3  1 
HETATM 4298 O  O4  . NAG D 2 .   ? -19.184 151.525 163.996 1.00 89.86  ? 603 NAG A O4  1 
HETATM 4299 O  O5  . NAG D 2 .   ? -16.857 153.281 161.769 1.00 91.15  ? 603 NAG A O5  1 
HETATM 4300 O  O6  . NAG D 2 .   ? -18.535 155.383 163.284 1.00 97.95  ? 603 NAG A O6  1 
HETATM 4301 O  O7  . NAG D 2 .   ? -14.894 149.074 160.379 1.00 88.59  ? 603 NAG A O7  1 
HETATM 4302 C  C02 . DQ5 E 3 .   ? 1.742   126.640 166.177 1.00 48.19  ? 604 DQ5 A C02 1 
HETATM 4303 C  C03 . DQ5 E 3 .   ? 0.598   126.856 167.197 1.00 45.54  ? 604 DQ5 A C03 1 
HETATM 4304 C  C04 . DQ5 E 3 .   ? 0.224   128.368 167.273 1.00 51.05  ? 604 DQ5 A C04 1 
HETATM 4305 C  C05 . DQ5 E 3 .   ? 0.898   129.076 168.472 1.00 47.20  ? 604 DQ5 A C05 1 
HETATM 4306 C  C06 . DQ5 E 3 .   ? 2.419   129.247 168.269 1.00 44.61  ? 604 DQ5 A C06 1 
HETATM 4307 C  C07 . DQ5 E 3 .   ? 3.290   128.560 169.101 1.00 39.14  ? 604 DQ5 A C07 1 
HETATM 4308 C  C08 . DQ5 E 3 .   ? 4.651   128.704 168.961 1.00 43.90  ? 604 DQ5 A C08 1 
HETATM 4309 C  C09 . DQ5 E 3 .   ? 5.139   129.519 167.980 1.00 47.74  ? 604 DQ5 A C09 1 
HETATM 4310 C  C11 . DQ5 E 3 .   ? 4.278   130.194 167.150 1.00 50.71  ? 604 DQ5 A C11 1 
HETATM 4311 C  C12 . DQ5 E 3 .   ? 4.995   131.037 166.113 1.00 45.74  ? 604 DQ5 A C12 1 
HETATM 4312 C  C16 . DQ5 E 3 .   ? 2.932   128.209 164.429 1.00 47.93  ? 604 DQ5 A C16 1 
HETATM 4313 C  C17 . DQ5 E 3 .   ? 4.319   127.767 164.657 1.00 46.61  ? 604 DQ5 A C17 1 
HETATM 4314 C  C18 . DQ5 E 3 .   ? 4.709   126.650 165.613 1.00 42.88  ? 604 DQ5 A C18 1 
HETATM 4315 C  C19 . DQ5 E 3 .   ? 6.142   126.136 165.474 1.00 44.39  ? 604 DQ5 A C19 1 
HETATM 4316 C  C20 . DQ5 E 3 .   ? 7.161   127.212 165.187 1.00 45.18  ? 604 DQ5 A C20 1 
HETATM 4317 C  C21 . DQ5 E 3 .   ? 6.790   128.103 164.029 1.00 43.65  ? 604 DQ5 A C21 1 
HETATM 4318 C  C22 . DQ5 E 3 .   ? 5.317   128.419 163.938 1.00 42.96  ? 604 DQ5 A C22 1 
HETATM 4319 C  C24 . DQ5 E 3 .   ? 3.748   129.877 162.810 1.00 43.72  ? 604 DQ5 A C24 1 
HETATM 4320 C  C25 . DQ5 E 3 .   ? 3.521   130.923 161.905 1.00 44.09  ? 604 DQ5 A C25 1 
HETATM 4321 C  C26 . DQ5 E 3 .   ? 2.224   131.364 161.657 1.00 42.14  ? 604 DQ5 A C26 1 
HETATM 4322 C  C27 . DQ5 E 3 .   ? 1.169   130.762 162.317 1.00 47.30  ? 604 DQ5 A C27 1 
HETATM 4323 C  C28 . DQ5 E 3 .   ? 1.406   129.722 163.230 1.00 46.91  ? 604 DQ5 A C28 1 
HETATM 4324 C  C29 . DQ5 E 3 .   ? 2.697   129.270 163.481 1.00 41.79  ? 604 DQ5 A C29 1 
HETATM 4325 N  N01 . DQ5 E 3 .   ? 1.745   127.637 165.102 1.00 46.32  ? 604 DQ5 A N01 1 
HETATM 4326 N  N13 . DQ5 E 3 .   ? 4.417   131.999 165.449 1.00 49.74  ? 604 DQ5 A N13 1 
HETATM 4327 N  N15 . DQ5 E 3 .   ? 2.920   130.074 167.279 1.00 52.41  ? 604 DQ5 A N15 1 
HETATM 4328 N  N23 . DQ5 E 3 .   ? 5.049   129.447 163.032 1.00 47.04  ? 604 DQ5 A N23 1 
HETATM 4329 O  O10 . DQ5 E 3 .   ? 6.521   129.725 167.726 1.00 55.71  ? 604 DQ5 A O10 1 
HETATM 4330 O  O14 . DQ5 E 3 .   ? 5.174   132.581 164.458 1.00 63.31  ? 604 DQ5 A O14 1 
HETATM 4331 C  C2  . 1PG F 4 .   ? -0.864  136.775 153.285 1.00 48.43  ? 605 1PG A C2  1 
HETATM 4332 O  O1  . 1PG F 4 .   ? 0.443   136.588 153.798 1.00 60.74  ? 605 1PG A O1  1 
HETATM 4333 O  O2  . 1PG F 4 .   ? -0.627  138.377 155.145 1.00 59.07  ? 605 1PG A O2  1 
HETATM 4334 C  C3  . 1PG F 4 .   ? -1.353  138.134 153.910 1.00 56.74  ? 605 1PG A C3  1 
HETATM 4335 C  C4  . 1PG F 4 .   ? -1.239  137.801 156.260 1.00 48.13  ? 605 1PG A C4  1 
HETATM 4336 C  C5  . 1PG F 4 .   ? -1.105  138.858 157.379 1.00 48.72  ? 605 1PG A C5  1 
HETATM 4337 O  O3  . 1PG F 4 .   ? -1.543  138.244 158.630 1.00 51.38  ? 605 1PG A O3  1 
HETATM 4338 C  C6  . 1PG F 4 .   ? -0.967  136.974 158.896 1.00 49.32  ? 605 1PG A C6  1 
HETATM 4339 C  C7  . 1PG F 4 .   ? -0.883  136.784 160.456 1.00 41.40  ? 605 1PG A C7  1 
HETATM 4340 O  O4  . 1PG F 4 .   ? 0.050   135.729 160.675 1.00 44.64  ? 605 1PG A O4  1 
HETATM 4341 C  C8  . 1PG F 4 .   ? 1.362   136.202 160.907 1.00 44.18  ? 605 1PG A C8  1 
HETATM 4342 C  C9  . 1PG F 4 .   ? 2.313   134.990 161.064 1.00 38.02  ? 605 1PG A C9  1 
HETATM 4343 O  O5  . 1PG F 4 .   ? 3.596   135.423 160.550 1.00 42.70  ? 605 1PG A O5  1 
HETATM 4344 C  C10 . 1PG F 4 .   ? 3.742   135.232 159.119 1.00 48.19  ? 605 1PG A C10 1 
HETATM 4345 C  C11 . 1PG F 4 .   ? 5.069   135.983 158.641 1.00 46.34  ? 605 1PG A C11 1 
HETATM 4346 O  O6  . 1PG F 4 .   ? 4.714   137.325 158.293 1.00 39.42  ? 605 1PG A O6  1 
HETATM 4347 CL CL  . CL  G 5 .   ? 22.458  141.917 145.455 1.00 68.80  ? 606 CL  A CL  1 
HETATM 4348 CL CL  . CL  H 5 .   ? 21.323  131.601 160.509 1.00 96.47  ? 607 CL  A CL  1 
HETATM 4349 CL CL  . CL  I 5 .   ? 16.539  130.962 129.190 1.00 73.85  ? 608 CL  A CL  1 
HETATM 4350 CL CL  . CL  J 5 .   ? -19.941 147.869 146.334 1.00 75.25  ? 609 CL  A CL  1 
HETATM 4351 CL CL  . CL  K 5 .   ? -15.853 125.470 123.089 1.00 82.80  ? 610 CL  A CL  1 
HETATM 4352 C  C1  . EDO L 6 .   ? 17.850  149.440 131.777 1.00 70.03  ? 611 EDO A C1  1 
HETATM 4353 O  O1  . EDO L 6 .   ? 16.476  149.030 131.838 1.00 67.91  ? 611 EDO A O1  1 
HETATM 4354 C  C2  . EDO L 6 .   ? 18.789  148.266 132.052 1.00 71.39  ? 611 EDO A C2  1 
HETATM 4355 O  O2  . EDO L 6 .   ? 19.282  148.308 133.405 1.00 62.24  ? 611 EDO A O2  1 
HETATM 4356 C  C1  . EDO M 6 .   ? 4.736   137.593 174.680 1.00 62.65  ? 612 EDO A C1  1 
HETATM 4357 O  O1  . EDO M 6 .   ? 6.158   137.441 174.546 1.00 58.81  ? 612 EDO A O1  1 
HETATM 4358 C  C2  . EDO M 6 .   ? 4.024   136.870 173.541 1.00 51.68  ? 612 EDO A C2  1 
HETATM 4359 O  O2  . EDO M 6 .   ? 2.921   137.680 173.100 1.00 61.69  ? 612 EDO A O2  1 
HETATM 4360 C  C1  . EDO N 6 .   ? -23.567 119.691 137.078 1.00 76.79  ? 613 EDO A C1  1 
HETATM 4361 O  O1  . EDO N 6 .   ? -23.987 120.805 136.282 1.00 72.90  ? 613 EDO A O1  1 
HETATM 4362 C  C2  . EDO N 6 .   ? -22.384 119.019 136.389 1.00 72.54  ? 613 EDO A C2  1 
HETATM 4363 O  O2  . EDO N 6 .   ? -21.673 118.228 137.345 1.00 78.86  ? 613 EDO A O2  1 
HETATM 4364 O  O   . HOH O 7 .   ? -1.555  107.757 143.592 1.00 65.15  ? 701 HOH A O   1 
HETATM 4365 O  O   . HOH O 7 .   ? -19.639 141.074 131.435 1.00 45.38  ? 702 HOH A O   1 
HETATM 4366 O  O   . HOH O 7 .   ? -8.237  114.765 134.143 1.00 57.07  ? 703 HOH A O   1 
HETATM 4367 O  O   . HOH O 7 .   ? 2.108   133.106 168.721 1.00 45.86  ? 704 HOH A O   1 
HETATM 4368 O  O   . HOH O 7 .   ? -21.158 121.061 129.938 1.00 67.52  ? 705 HOH A O   1 
HETATM 4369 O  O   . HOH O 7 .   ? -12.890 144.112 124.432 1.00 48.58  ? 706 HOH A O   1 
HETATM 4370 O  O   . HOH O 7 .   ? 3.637   124.902 158.386 1.00 48.75  ? 707 HOH A O   1 
HETATM 4371 O  O   . HOH O 7 .   ? 2.669   142.889 151.449 1.00 43.50  ? 708 HOH A O   1 
HETATM 4372 O  O   . HOH O 7 .   ? 16.528  153.493 137.507 1.00 58.14  ? 709 HOH A O   1 
HETATM 4373 O  O   . HOH O 7 .   ? -14.613 115.754 138.136 1.00 73.52  ? 710 HOH A O   1 
HETATM 4374 O  O   . HOH O 7 .   ? 21.358  137.936 136.836 1.00 49.64  ? 711 HOH A O   1 
HETATM 4375 O  O   . HOH O 7 .   ? -2.435  132.142 131.493 1.00 42.26  ? 712 HOH A O   1 
HETATM 4376 O  O   . HOH O 7 .   ? -2.773  116.788 148.253 1.00 43.77  ? 713 HOH A O   1 
HETATM 4377 O  O   . HOH O 7 .   ? -0.612  120.600 156.479 1.00 44.68  ? 714 HOH A O   1 
HETATM 4378 O  O   . HOH O 7 .   ? 4.943   140.702 175.565 1.00 61.05  ? 715 HOH A O   1 
HETATM 4379 O  O   . HOH O 7 .   ? 1.583   121.299 165.451 1.00 47.51  ? 716 HOH A O   1 
HETATM 4380 O  O   . HOH O 7 .   ? -11.749 129.880 159.188 1.00 53.41  ? 717 HOH A O   1 
HETATM 4381 O  O   . HOH O 7 .   ? -10.811 127.162 146.505 1.00 45.05  ? 718 HOH A O   1 
HETATM 4382 O  O   . HOH O 7 .   ? -10.481 136.587 144.771 1.00 49.90  ? 719 HOH A O   1 
HETATM 4383 O  O   . HOH O 7 .   ? 13.886  130.517 148.393 1.00 43.65  ? 720 HOH A O   1 
HETATM 4384 O  O   . HOH O 7 .   ? 2.843   158.301 146.305 1.00 66.39  ? 721 HOH A O   1 
HETATM 4385 O  O   . HOH O 7 .   ? 8.224   117.516 153.010 1.00 43.28  ? 722 HOH A O   1 
HETATM 4386 O  O   . HOH O 7 .   ? -20.327 128.100 142.622 1.00 56.72  ? 723 HOH A O   1 
HETATM 4387 O  O   . HOH O 7 .   ? -6.260  116.494 140.489 1.00 45.44  ? 724 HOH A O   1 
HETATM 4388 O  O   . HOH O 7 .   ? -21.480 116.432 133.948 1.00 78.37  ? 725 HOH A O   1 
HETATM 4389 O  O   . HOH O 7 .   ? -9.927  116.909 158.981 1.00 47.61  ? 726 HOH A O   1 
HETATM 4390 O  O   . HOH O 7 .   ? 1.177   152.894 129.325 1.00 59.90  ? 727 HOH A O   1 
HETATM 4391 O  O   . HOH O 7 .   ? -9.646  120.273 158.806 1.00 47.97  ? 728 HOH A O   1 
HETATM 4392 O  O   . HOH O 7 .   ? -6.637  119.618 148.667 1.00 40.52  ? 729 HOH A O   1 
HETATM 4393 O  O   . HOH O 7 .   ? 12.186  126.243 156.093 1.00 40.12  ? 730 HOH A O   1 
HETATM 4394 O  O   . HOH O 7 .   ? 8.409   120.762 151.054 1.00 33.95  ? 731 HOH A O   1 
HETATM 4395 O  O   . HOH O 7 .   ? 12.106  115.610 149.174 1.00 47.03  ? 732 HOH A O   1 
HETATM 4396 O  O   . HOH O 7 .   ? -5.353  133.416 144.723 1.00 35.13  ? 733 HOH A O   1 
HETATM 4397 O  O   . HOH O 7 .   ? -11.070 144.571 143.449 1.00 42.57  ? 734 HOH A O   1 
HETATM 4398 O  O   . HOH O 7 .   ? -1.013  141.366 130.978 1.00 44.28  ? 735 HOH A O   1 
HETATM 4399 O  O   . HOH O 7 .   ? -7.020  131.353 154.332 1.00 34.47  ? 736 HOH A O   1 
HETATM 4400 O  O   . HOH O 7 .   ? -10.849 120.458 143.628 1.00 48.57  ? 737 HOH A O   1 
HETATM 4401 O  O   . HOH O 7 .   ? 19.334  161.158 140.502 1.00 75.03  ? 738 HOH A O   1 
HETATM 4402 O  O   . HOH O 7 .   ? 4.163   126.336 154.449 1.00 35.18  ? 739 HOH A O   1 
HETATM 4403 O  O   . HOH O 7 .   ? 5.450   136.878 170.687 1.00 43.00  ? 740 HOH A O   1 
HETATM 4404 O  O   . HOH O 7 .   ? 12.969  132.536 157.248 1.00 48.26  ? 741 HOH A O   1 
HETATM 4405 O  O   . HOH O 7 .   ? -1.230  131.471 164.802 1.00 46.10  ? 742 HOH A O   1 
HETATM 4406 O  O   . HOH O 7 .   ? -9.389  138.397 170.439 1.00 54.57  ? 743 HOH A O   1 
HETATM 4407 O  O   . HOH O 7 .   ? -2.350  133.363 156.341 1.00 45.45  ? 744 HOH A O   1 
HETATM 4408 O  O   . HOH O 7 .   ? 9.275   143.047 122.509 1.00 64.46  ? 745 HOH A O   1 
HETATM 4409 O  O   . HOH O 7 .   ? -10.820 120.935 132.241 1.00 60.05  ? 746 HOH A O   1 
HETATM 4410 O  O   . HOH O 7 .   ? -3.919  134.547 151.487 1.00 40.24  ? 747 HOH A O   1 
HETATM 4411 O  O   . HOH O 7 .   ? 5.385   127.421 129.870 1.00 45.45  ? 748 HOH A O   1 
HETATM 4412 O  O   . HOH O 7 .   ? -18.532 127.148 149.780 1.00 57.59  ? 749 HOH A O   1 
HETATM 4413 O  O   . HOH O 7 .   ? -5.741  110.618 151.330 1.00 45.78  ? 750 HOH A O   1 
HETATM 4414 O  O   . HOH O 7 .   ? 6.057   139.809 159.219 1.00 39.92  ? 751 HOH A O   1 
HETATM 4415 O  O   . HOH O 7 .   ? 14.004  127.062 153.974 1.00 39.56  ? 752 HOH A O   1 
HETATM 4416 O  O   . HOH O 7 .   ? -1.780  124.285 157.004 1.00 41.23  ? 753 HOH A O   1 
HETATM 4417 O  O   . HOH O 7 .   ? 15.260  124.133 157.029 1.00 58.59  ? 754 HOH A O   1 
HETATM 4418 O  O   . HOH O 7 .   ? 17.602  120.416 146.875 1.00 50.36  ? 755 HOH A O   1 
HETATM 4419 O  O   . HOH O 7 .   ? -10.583 129.093 144.785 1.00 53.04  ? 756 HOH A O   1 
HETATM 4420 O  O   . HOH O 7 .   ? -4.130  122.396 151.470 1.00 39.65  ? 757 HOH A O   1 
HETATM 4421 O  O   . HOH O 7 .   ? 5.901   152.681 170.466 1.00 49.99  ? 758 HOH A O   1 
HETATM 4422 O  O   . HOH O 7 .   ? 22.890  143.891 147.705 1.00 48.80  ? 759 HOH A O   1 
HETATM 4423 O  O   . HOH O 7 .   ? 3.542   124.038 155.708 1.00 42.57  ? 760 HOH A O   1 
HETATM 4424 O  O   . HOH O 7 .   ? -16.125 118.544 142.927 1.00 54.32  ? 761 HOH A O   1 
HETATM 4425 O  O   . HOH O 7 .   ? 12.118  149.184 156.030 1.00 44.08  ? 762 HOH A O   1 
HETATM 4426 O  O   . HOH O 7 .   ? -1.641  132.310 159.835 1.00 47.29  ? 763 HOH A O   1 
HETATM 4427 O  O   . HOH O 7 .   ? -8.242  153.330 139.438 1.00 48.20  ? 764 HOH A O   1 
HETATM 4428 O  O   . HOH O 7 .   ? -3.707  129.790 166.309 1.00 45.26  ? 765 HOH A O   1 
HETATM 4429 O  O   . HOH O 7 .   ? 6.201   140.921 127.233 1.00 51.69  ? 766 HOH A O   1 
HETATM 4430 O  O   . HOH O 7 .   ? -3.358  153.885 161.385 1.00 54.86  ? 767 HOH A O   1 
HETATM 4431 O  O   . HOH O 7 .   ? -14.134 127.586 157.568 1.00 52.62  ? 768 HOH A O   1 
HETATM 4432 O  O   . HOH O 7 .   ? 12.342  137.686 171.564 1.00 59.61  ? 769 HOH A O   1 
HETATM 4433 O  O   . HOH O 7 .   ? -11.802 121.092 141.143 1.00 43.12  ? 770 HOH A O   1 
HETATM 4434 O  O   . HOH O 7 .   ? -0.517  136.181 128.493 1.00 40.75  ? 771 HOH A O   1 
HETATM 4435 O  O   . HOH O 7 .   ? -5.264  117.037 148.781 1.00 43.40  ? 772 HOH A O   1 
HETATM 4436 O  O   . HOH O 7 .   ? -7.466  127.585 149.691 1.00 47.01  ? 773 HOH A O   1 
HETATM 4437 O  O   . HOH O 7 .   ? 7.827   121.522 135.841 1.00 50.23  ? 774 HOH A O   1 
HETATM 4438 O  O   . HOH O 7 .   ? 22.071  136.747 154.443 1.00 54.62  ? 775 HOH A O   1 
HETATM 4439 O  O   . HOH O 7 .   ? 3.351   153.198 163.243 1.00 57.77  ? 776 HOH A O   1 
HETATM 4440 O  O   . HOH O 7 .   ? 9.973   127.710 155.560 1.00 44.45  ? 777 HOH A O   1 
HETATM 4441 O  O   . HOH O 7 .   ? -10.214 123.865 129.568 1.00 50.49  ? 778 HOH A O   1 
HETATM 4442 O  O   . HOH O 7 .   ? -6.847  148.534 157.213 1.00 41.64  ? 779 HOH A O   1 
HETATM 4443 O  O   . HOH O 7 .   ? 6.600   106.196 145.897 1.00 65.27  ? 780 HOH A O   1 
HETATM 4444 O  O   . HOH O 7 .   ? -1.537  137.389 149.863 1.00 40.36  ? 781 HOH A O   1 
HETATM 4445 O  O   . HOH O 7 .   ? 17.160  155.163 149.567 1.00 55.40  ? 782 HOH A O   1 
HETATM 4446 O  O   . HOH O 7 .   ? 6.807   153.790 168.586 1.00 61.31  ? 783 HOH A O   1 
HETATM 4447 O  O   . HOH O 7 .   ? -0.041  121.645 136.346 1.00 42.54  ? 784 HOH A O   1 
HETATM 4448 O  O   . HOH O 7 .   ? -3.173  125.766 124.476 1.00 50.33  ? 785 HOH A O   1 
HETATM 4449 O  O   . HOH O 7 .   ? 15.526  135.299 160.223 1.00 57.54  ? 786 HOH A O   1 
HETATM 4450 O  O   . HOH O 7 .   ? 6.936   130.717 161.382 1.00 48.05  ? 787 HOH A O   1 
HETATM 4451 O  O   . HOH O 7 .   ? 1.656   136.555 125.051 1.00 47.67  ? 788 HOH A O   1 
HETATM 4452 O  O   . HOH O 7 .   ? -3.437  160.247 148.347 1.00 51.17  ? 789 HOH A O   1 
HETATM 4453 O  O   . HOH O 7 .   ? 10.104  113.094 142.768 1.00 59.33  ? 790 HOH A O   1 
HETATM 4454 O  O   . HOH O 7 .   ? 0.419   130.509 150.984 1.00 33.97  ? 791 HOH A O   1 
HETATM 4455 O  O   . HOH O 7 .   ? 4.022   145.046 149.024 1.00 34.75  ? 792 HOH A O   1 
HETATM 4456 O  O   . HOH O 7 .   ? -2.068  132.843 128.622 1.00 45.45  ? 793 HOH A O   1 
HETATM 4457 O  O   . HOH O 7 .   ? -1.258  141.788 173.956 1.00 41.30  ? 794 HOH A O   1 
HETATM 4458 O  O   . HOH O 7 .   ? -11.765 135.663 156.389 1.00 40.95  ? 795 HOH A O   1 
HETATM 4459 O  O   . HOH O 7 .   ? -6.470  121.041 151.001 1.00 41.99  ? 796 HOH A O   1 
HETATM 4460 O  O   . HOH O 7 .   ? 11.178  151.782 139.638 1.00 48.61  ? 797 HOH A O   1 
HETATM 4461 O  O   . HOH O 7 .   ? -4.303  135.405 160.471 1.00 48.74  ? 798 HOH A O   1 
HETATM 4462 O  O   . HOH O 7 .   ? -7.758  121.821 133.480 1.00 49.86  ? 799 HOH A O   1 
HETATM 4463 O  O   . HOH O 7 .   ? -4.845  144.546 152.853 1.00 43.25  ? 800 HOH A O   1 
HETATM 4464 O  O   . HOH O 7 .   ? 1.801   150.506 169.424 1.00 44.85  ? 801 HOH A O   1 
HETATM 4465 O  O   . HOH O 7 .   ? -10.793 146.712 154.228 1.00 55.49  ? 802 HOH A O   1 
HETATM 4466 O  O   . HOH O 7 .   ? 0.712   132.945 127.361 1.00 43.64  ? 803 HOH A O   1 
HETATM 4467 O  O   . HOH O 7 .   ? -2.557  130.217 168.831 1.00 49.12  ? 804 HOH A O   1 
HETATM 4468 O  O   . HOH O 7 .   ? 1.935   137.256 157.808 1.00 43.12  ? 805 HOH A O   1 
HETATM 4469 O  O   . HOH O 7 .   ? -9.971  112.439 142.490 1.00 61.40  ? 806 HOH A O   1 
HETATM 4470 O  O   . HOH O 7 .   ? 16.583  127.613 147.839 1.00 43.57  ? 807 HOH A O   1 
HETATM 4471 O  O   . HOH O 7 .   ? 16.694  123.432 152.878 1.00 46.33  ? 808 HOH A O   1 
HETATM 4472 O  O   . HOH O 7 .   ? 12.139  134.693 128.071 1.00 42.87  ? 809 HOH A O   1 
HETATM 4473 O  O   . HOH O 7 .   ? -8.604  124.594 167.186 1.00 64.64  ? 810 HOH A O   1 
HETATM 4474 O  O   . HOH O 7 .   ? 15.912  145.694 133.098 1.00 50.69  ? 811 HOH A O   1 
HETATM 4475 O  O   . HOH O 7 .   ? -3.663  146.589 170.269 1.00 45.06  ? 812 HOH A O   1 
HETATM 4476 O  O   . HOH O 7 .   ? -2.519  122.309 155.094 1.00 42.83  ? 813 HOH A O   1 
HETATM 4477 O  O   . HOH O 7 .   ? 6.623   152.668 160.455 1.00 57.50  ? 814 HOH A O   1 
HETATM 4478 O  O   . HOH O 7 .   ? 0.695   131.755 166.637 1.00 51.79  ? 815 HOH A O   1 
HETATM 4479 O  O   . HOH O 7 .   ? 11.627  155.549 133.070 1.00 46.86  ? 816 HOH A O   1 
HETATM 4480 O  O   . HOH O 7 .   ? -7.788  112.342 150.806 1.00 59.15  ? 817 HOH A O   1 
HETATM 4481 O  O   . HOH O 7 .   ? 1.785   158.609 153.841 1.00 63.03  ? 818 HOH A O   1 
HETATM 4482 O  O   . HOH O 7 .   ? -4.834  145.375 168.116 1.00 43.53  ? 819 HOH A O   1 
HETATM 4483 O  O   . HOH O 7 .   ? -9.973  132.253 164.896 1.00 63.27  ? 820 HOH A O   1 
HETATM 4484 O  O   . HOH O 7 .   ? 1.282   137.499 170.231 1.00 48.01  ? 821 HOH A O   1 
HETATM 4485 O  O   . HOH O 7 .   ? 7.290   120.876 148.090 1.00 41.87  ? 822 HOH A O   1 
HETATM 4486 O  O   . HOH O 7 .   ? -7.256  123.822 160.940 1.00 44.63  ? 823 HOH A O   1 
HETATM 4487 O  O   . HOH O 7 .   ? 12.863  112.946 160.015 1.00 64.32  ? 824 HOH A O   1 
HETATM 4488 O  O   . HOH O 7 .   ? -1.404  123.258 163.610 1.00 45.51  ? 825 HOH A O   1 
HETATM 4489 O  O   . HOH O 7 .   ? 9.595   123.177 134.534 1.00 52.96  ? 826 HOH A O   1 
HETATM 4490 O  O   . HOH O 7 .   ? -4.975  131.320 158.276 1.00 56.05  ? 827 HOH A O   1 
HETATM 4491 O  O   . HOH O 7 .   ? -12.384 137.874 154.485 1.00 45.81  ? 828 HOH A O   1 
HETATM 4492 O  O   . HOH O 7 .   ? 18.376  145.363 178.994 1.00 69.37  ? 829 HOH A O   1 
HETATM 4493 O  O   . HOH O 7 .   ? 14.068  143.959 133.676 1.00 42.15  ? 830 HOH A O   1 
HETATM 4494 O  O   . HOH O 7 .   ? 12.927  147.002 157.206 1.00 49.87  ? 831 HOH A O   1 
HETATM 4495 O  O   . HOH O 7 .   ? 24.907  154.045 166.353 1.00 61.70  ? 832 HOH A O   1 
HETATM 4496 O  O   . HOH O 7 .   ? 19.841  129.117 145.441 1.00 40.75  ? 833 HOH A O   1 
HETATM 4497 O  O   . HOH O 7 .   ? -20.001 138.859 131.000 1.00 46.94  ? 834 HOH A O   1 
HETATM 4498 O  O   . HOH O 7 .   ? 20.927  152.224 153.002 1.00 57.44  ? 835 HOH A O   1 
HETATM 4499 O  O   . HOH O 7 .   ? -7.341  134.706 165.570 1.00 45.75  ? 836 HOH A O   1 
HETATM 4500 O  O   . HOH O 7 .   ? -4.291  134.434 154.519 1.00 41.36  ? 837 HOH A O   1 
HETATM 4501 O  O   . HOH O 7 .   ? -22.281 124.241 141.195 1.00 68.22  ? 838 HOH A O   1 
HETATM 4502 O  O   . HOH O 7 .   ? -14.154 153.408 140.327 1.00 51.38  ? 839 HOH A O   1 
HETATM 4503 O  O   . HOH O 7 .   ? -10.692 139.815 154.180 1.00 43.20  ? 840 HOH A O   1 
HETATM 4504 O  O   . HOH O 7 .   ? -8.374  145.594 156.634 1.00 59.18  ? 841 HOH A O   1 
HETATM 4505 O  O   . HOH O 7 .   ? -16.036 155.384 145.185 1.00 58.93  ? 842 HOH A O   1 
HETATM 4506 O  O   . HOH O 7 .   ? 13.582  130.472 162.250 1.00 57.98  ? 843 HOH A O   1 
HETATM 4507 O  O   . HOH O 7 .   ? -14.256 119.692 140.971 1.00 58.88  ? 844 HOH A O   1 
HETATM 4508 O  O   . HOH O 7 .   ? -4.748  159.726 154.503 1.00 61.87  ? 845 HOH A O   1 
HETATM 4509 O  O   . HOH O 7 .   ? 7.083   156.152 130.923 1.00 51.89  ? 846 HOH A O   1 
HETATM 4510 O  O   . HOH O 7 .   ? -5.943  133.461 172.713 1.00 41.64  ? 847 HOH A O   1 
HETATM 4511 O  O   . HOH O 7 .   ? -23.047 122.815 139.176 1.00 58.16  ? 848 HOH A O   1 
HETATM 4512 O  O   . HOH O 7 .   ? 18.455  127.111 145.568 1.00 42.51  ? 849 HOH A O   1 
HETATM 4513 O  O   . HOH O 7 .   ? -15.198 142.379 149.518 1.00 55.21  ? 850 HOH A O   1 
HETATM 4514 O  O   . HOH O 7 .   ? 10.459  146.840 160.257 1.00 58.65  ? 851 HOH A O   1 
HETATM 4515 O  O   . HOH O 7 .   ? 12.221  118.129 163.694 1.00 56.56  ? 852 HOH A O   1 
HETATM 4516 O  O   . HOH O 7 .   ? 7.075   160.229 149.916 1.00 73.38  ? 853 HOH A O   1 
HETATM 4517 O  O   . HOH O 7 .   ? 19.261  118.239 148.910 1.00 48.24  ? 854 HOH A O   1 
HETATM 4518 O  O   . HOH O 7 .   ? 17.192  150.137 144.482 1.00 54.56  ? 855 HOH A O   1 
HETATM 4519 O  O   . HOH O 7 .   ? 19.576  150.078 154.715 1.00 53.62  ? 856 HOH A O   1 
HETATM 4520 O  O   . HOH O 7 .   ? 20.920  127.538 135.415 1.00 55.31  ? 857 HOH A O   1 
HETATM 4521 O  O   . HOH O 7 .   ? 1.778   156.488 157.075 1.00 49.44  ? 858 HOH A O   1 
HETATM 4522 O  O   . HOH O 7 .   ? -11.224 117.044 153.151 1.00 50.23  ? 859 HOH A O   1 
HETATM 4523 O  O   . HOH O 7 .   ? 4.907   157.316 129.933 1.00 69.25  ? 860 HOH A O   1 
HETATM 4524 O  O   . HOH O 7 .   ? -9.534  129.154 148.318 1.00 42.23  ? 861 HOH A O   1 
HETATM 4525 O  O   . HOH O 7 .   ? -5.947  125.319 163.305 1.00 49.44  ? 862 HOH A O   1 
HETATM 4526 O  O   . HOH O 7 .   ? -1.292  155.891 161.729 1.00 61.66  ? 863 HOH A O   1 
HETATM 4527 O  O   . HOH O 7 .   ? -1.956  151.240 168.900 1.00 49.89  ? 864 HOH A O   1 
HETATM 4528 O  O   . HOH O 7 .   ? 16.086  153.467 151.328 1.00 57.82  ? 865 HOH A O   1 
HETATM 4529 O  O   . HOH O 7 .   ? -18.141 139.358 144.214 1.00 48.31  ? 866 HOH A O   1 
HETATM 4530 O  O   . HOH O 7 .   ? -8.448  141.986 170.360 1.00 50.07  ? 867 HOH A O   1 
HETATM 4531 O  O   . HOH O 7 .   ? 1.472   144.249 125.967 1.00 50.75  ? 868 HOH A O   1 
HETATM 4532 O  O   . HOH O 7 .   ? 28.449  144.508 168.060 1.00 59.23  ? 869 HOH A O   1 
HETATM 4533 O  O   . HOH O 7 .   ? 17.953  150.055 160.093 1.00 67.44  ? 870 HOH A O   1 
HETATM 4534 O  O   . HOH O 7 .   ? -0.361  125.996 125.894 1.00 49.56  ? 871 HOH A O   1 
HETATM 4535 O  O   . HOH O 7 .   ? -12.350 148.343 157.048 1.00 60.78  ? 872 HOH A O   1 
HETATM 4536 O  O   . HOH O 7 .   ? 0.352   134.771 156.440 1.00 52.17  ? 873 HOH A O   1 
HETATM 4537 O  O   . HOH O 7 .   ? -11.819 132.491 161.841 1.00 55.02  ? 874 HOH A O   1 
HETATM 4538 O  O   . HOH O 7 .   ? -5.258  139.307 118.339 1.00 47.97  ? 875 HOH A O   1 
HETATM 4539 O  O   . HOH O 7 .   ? -20.226 140.578 145.610 1.00 56.17  ? 876 HOH A O   1 
HETATM 4540 O  O   . HOH O 7 .   ? 9.942   163.055 142.535 1.00 74.55  ? 877 HOH A O   1 
HETATM 4541 O  O   . HOH O 7 .   ? -10.911 127.813 164.559 1.00 52.45  ? 878 HOH A O   1 
HETATM 4542 O  O   . HOH O 7 .   ? 8.782   150.374 162.829 1.00 54.33  ? 879 HOH A O   1 
HETATM 4543 O  O   . HOH O 7 .   ? 2.003   135.416 127.257 1.00 36.01  ? 880 HOH A O   1 
HETATM 4544 O  O   . HOH O 7 .   ? -28.811 143.149 132.185 1.00 77.84  ? 881 HOH A O   1 
HETATM 4545 O  O   . HOH O 7 .   ? 15.358  155.842 134.937 1.00 63.14  ? 882 HOH A O   1 
HETATM 4546 O  O   . HOH O 7 .   ? 16.124  128.907 151.218 1.00 49.50  ? 883 HOH A O   1 
HETATM 4547 O  O   . HOH O 7 .   ? 15.399  130.366 165.587 1.00 65.73  ? 884 HOH A O   1 
HETATM 4548 O  O   . HOH O 7 .   ? -20.624 133.630 147.661 1.00 54.21  ? 885 HOH A O   1 
HETATM 4549 O  O   . HOH O 7 .   ? 3.962   158.561 155.084 1.00 69.94  ? 886 HOH A O   1 
HETATM 4550 O  O   . HOH O 7 .   ? 19.535  132.883 158.643 1.00 77.76  ? 887 HOH A O   1 
HETATM 4551 O  O   . HOH O 7 .   ? -2.969  105.469 148.960 1.00 63.95  ? 888 HOH A O   1 
HETATM 4552 O  O   . HOH O 7 .   ? 20.022  133.691 128.785 1.00 57.39  ? 889 HOH A O   1 
HETATM 4553 O  O   . HOH O 7 .   ? 16.030  125.396 154.723 1.00 60.87  ? 890 HOH A O   1 
HETATM 4554 O  O   . HOH O 7 .   ? -5.576  106.233 149.151 1.00 62.68  ? 891 HOH A O   1 
HETATM 4555 O  O   . HOH O 7 .   ? -9.517  110.937 155.061 1.00 55.38  ? 892 HOH A O   1 
HETATM 4556 O  O   . HOH O 7 .   ? -18.193 119.885 143.139 1.00 61.21  ? 893 HOH A O   1 
HETATM 4557 O  O   . HOH O 7 .   ? 10.053  155.094 155.285 1.00 54.69  ? 894 HOH A O   1 
HETATM 4558 O  O   . HOH O 7 .   ? -12.518 113.695 142.724 1.00 65.94  ? 895 HOH A O   1 
HETATM 4559 O  O   . HOH O 7 .   ? 16.832  130.328 148.613 1.00 54.22  ? 896 HOH A O   1 
HETATM 4560 O  O   . HOH O 7 .   ? 17.184  126.300 151.392 1.00 61.54  ? 897 HOH A O   1 
HETATM 4561 O  O   . HOH O 7 .   ? 17.645  125.207 148.966 1.00 52.51  ? 898 HOH A O   1 
HETATM 4562 O  O   . HOH O 7 .   ? -7.976  134.585 121.649 1.00 48.62  ? 899 HOH A O   1 
HETATM 4563 O  O   . HOH O 7 .   ? -0.791  122.097 133.927 1.00 46.25  ? 900 HOH A O   1 
HETATM 4564 O  O   . HOH O 7 .   ? 22.595  128.334 145.943 1.00 57.54  ? 901 HOH A O   1 
HETATM 4565 O  O   . HOH O 7 .   ? -9.679  124.908 162.708 1.00 62.29  ? 902 HOH A O   1 
HETATM 4566 O  O   . HOH O 7 .   ? 3.728   153.536 160.401 1.00 59.14  ? 903 HOH A O   1 
HETATM 4567 O  O   . HOH O 7 .   ? -7.607  107.086 150.360 1.00 67.52  ? 904 HOH A O   1 
HETATM 4568 O  O   . HOH O 7 .   ? -16.676 128.946 157.881 1.00 55.06  ? 905 HOH A O   1 
HETATM 4569 O  O   . HOH O 7 .   ? 6.822   152.198 163.633 1.00 54.76  ? 906 HOH A O   1 
HETATM 4570 O  O   . HOH O 7 .   ? -3.622  133.780 158.868 1.00 47.44  ? 907 HOH A O   1 
HETATM 4571 O  O   . HOH O 7 .   ? -11.247 142.688 154.813 1.00 54.68  ? 908 HOH A O   1 
HETATM 4572 O  O   . HOH O 7 .   ? 10.297  153.092 128.672 1.00 58.51  ? 909 HOH A O   1 
HETATM 4573 O  O   . HOH O 7 .   ? -22.470 124.167 143.400 1.00 73.71  ? 910 HOH A O   1 
HETATM 4574 O  O   . HOH O 7 .   ? 23.854  141.928 143.174 1.00 63.28  ? 911 HOH A O   1 
HETATM 4575 O  O   . HOH O 7 .   ? -21.781 122.005 141.431 1.00 66.46  ? 912 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   4   4   SER SER A . n 
A 1 2   GLU 2   5   5   GLU GLU A . n 
A 1 3   LEU 3   6   6   LEU LEU A . n 
A 1 4   LEU 4   7   7   LEU LEU A . n 
A 1 5   VAL 5   8   8   VAL VAL A . n 
A 1 6   ASN 6   9   9   ASN ASN A . n 
A 1 7   THR 7   10  10  THR THR A . n 
A 1 8   LYS 8   11  11  LYS LYS A . n 
A 1 9   SER 9   12  12  SER SER A . n 
A 1 10  GLY 10  13  13  GLY GLY A . n 
A 1 11  LYS 11  14  14  LYS LYS A . n 
A 1 12  VAL 12  15  15  VAL VAL A . n 
A 1 13  MET 13  16  16  MET MET A . n 
A 1 14  GLY 14  17  17  GLY GLY A . n 
A 1 15  THR 15  18  18  THR THR A . n 
A 1 16  ARG 16  19  19  ARG ARG A . n 
A 1 17  VAL 17  20  20  VAL VAL A . n 
A 1 18  PRO 18  21  21  PRO PRO A . n 
A 1 19  VAL 19  22  22  VAL VAL A . n 
A 1 20  LEU 20  23  23  LEU LEU A . n 
A 1 21  SER 21  24  24  SER SER A . n 
A 1 22  SER 22  25  25  SER SER A . n 
A 1 23  HIS 23  26  26  HIS HIS A . n 
A 1 24  ILE 24  27  27  ILE ILE A . n 
A 1 25  SER 25  28  28  SER SER A . n 
A 1 26  ALA 26  29  29  ALA ALA A . n 
A 1 27  PHE 27  30  30  PHE PHE A . n 
A 1 28  LEU 28  31  31  LEU LEU A . n 
A 1 29  GLY 29  32  32  GLY GLY A . n 
A 1 30  ILE 30  33  33  ILE ILE A . n 
A 1 31  PRO 31  34  34  PRO PRO A . n 
A 1 32  PHE 32  35  35  PHE PHE A . n 
A 1 33  ALA 33  36  36  ALA ALA A . n 
A 1 34  GLU 34  37  37  GLU GLU A . n 
A 1 35  PRO 35  38  38  PRO PRO A . n 
A 1 36  PRO 36  39  39  PRO PRO A . n 
A 1 37  VAL 37  40  40  VAL VAL A . n 
A 1 38  GLY 38  41  41  GLY GLY A . n 
A 1 39  ASN 39  42  42  ASN ASN A . n 
A 1 40  MET 40  43  43  MET MET A . n 
A 1 41  ARG 41  44  44  ARG ARG A . n 
A 1 42  PHE 42  45  45  PHE PHE A . n 
A 1 43  ARG 43  46  46  ARG ARG A . n 
A 1 44  ARG 44  47  47  ARG ARG A . n 
A 1 45  PRO 45  48  48  PRO PRO A . n 
A 1 46  GLU 46  49  49  GLU GLU A . n 
A 1 47  PRO 47  50  50  PRO PRO A . n 
A 1 48  LYS 48  51  51  LYS LYS A . n 
A 1 49  LYS 49  52  52  LYS LYS A . n 
A 1 50  PRO 50  53  53  PRO PRO A . n 
A 1 51  TRP 51  54  54  TRP TRP A . n 
A 1 52  SER 52  55  55  SER SER A . n 
A 1 53  GLY 53  56  56  GLY GLY A . n 
A 1 54  VAL 54  57  57  VAL VAL A . n 
A 1 55  TRP 55  58  58  TRP TRP A . n 
A 1 56  ASN 56  59  59  ASN ASN A . n 
A 1 57  ALA 57  60  60  ALA ALA A . n 
A 1 58  SER 58  61  61  SER SER A . n 
A 1 59  THR 59  62  62  THR THR A . n 
A 1 60  TYR 60  63  63  TYR TYR A . n 
A 1 61  PRO 61  64  64  PRO PRO A . n 
A 1 62  ASN 62  65  65  ASN ASN A . n 
A 1 63  ASN 63  66  66  ASN ASN A . n 
A 1 64  CYS 64  67  67  CYS CYS A . n 
A 1 65  GLN 65  68  68  GLN GLN A . n 
A 1 66  GLN 66  69  69  GLN GLN A . n 
A 1 67  TYR 67  70  70  TYR TYR A . n 
A 1 68  VAL 68  71  71  VAL VAL A . n 
A 1 69  ASP 69  72  72  ASP ASP A . n 
A 1 70  GLU 70  73  73  GLU GLU A . n 
A 1 71  GLN 71  74  74  GLN GLN A . n 
A 1 72  PHE 72  75  75  PHE PHE A . n 
A 1 73  PRO 73  76  76  PRO PRO A . n 
A 1 74  GLY 74  77  77  GLY GLY A . n 
A 1 75  PHE 75  78  78  PHE PHE A . n 
A 1 76  SER 76  79  79  SER SER A . n 
A 1 77  GLY 77  80  80  GLY GLY A . n 
A 1 78  SER 78  81  81  SER SER A . n 
A 1 79  GLU 79  82  82  GLU GLU A . n 
A 1 80  MET 80  83  83  MET MET A . n 
A 1 81  TRP 81  84  84  TRP TRP A . n 
A 1 82  ASN 82  85  85  ASN ASN A . n 
A 1 83  PRO 83  86  86  PRO PRO A . n 
A 1 84  ASN 84  87  87  ASN ASN A . n 
A 1 85  ARG 85  88  88  ARG ARG A . n 
A 1 86  GLU 86  89  89  GLU GLU A . n 
A 1 87  MET 87  90  90  MET MET A . n 
A 1 88  SER 88  91  91  SER SER A . n 
A 1 89  GLU 89  92  92  GLU GLU A . n 
A 1 90  ASP 90  93  93  ASP ASP A . n 
A 1 91  CYS 91  94  94  CYS CYS A . n 
A 1 92  LEU 92  95  95  LEU LEU A . n 
A 1 93  TYR 93  96  96  TYR TYR A . n 
A 1 94  LEU 94  97  97  LEU LEU A . n 
A 1 95  ASN 95  98  98  ASN ASN A . n 
A 1 96  ILE 96  99  99  ILE ILE A . n 
A 1 97  TRP 97  100 100 TRP TRP A . n 
A 1 98  VAL 98  101 101 VAL VAL A . n 
A 1 99  PRO 99  102 102 PRO PRO A . n 
A 1 100 SER 100 103 103 SER SER A . n 
A 1 101 PRO 101 104 104 PRO PRO A . n 
A 1 102 ARG 102 105 105 ARG ARG A . n 
A 1 103 PRO 103 106 106 PRO PRO A . n 
A 1 104 LYS 104 107 107 LYS LYS A . n 
A 1 105 SER 105 108 108 SER SER A . n 
A 1 106 THR 106 109 109 THR THR A . n 
A 1 107 THR 107 110 110 THR THR A . n 
A 1 108 VAL 108 111 111 VAL VAL A . n 
A 1 109 MET 109 112 112 MET MET A . n 
A 1 110 VAL 110 113 113 VAL VAL A . n 
A 1 111 TRP 111 114 114 TRP TRP A . n 
A 1 112 ILE 112 115 115 ILE ILE A . n 
A 1 113 TYR 113 116 116 TYR TYR A . n 
A 1 114 GLY 114 117 117 GLY GLY A . n 
A 1 115 GLY 115 118 118 GLY GLY A . n 
A 1 116 GLY 116 119 119 GLY GLY A . n 
A 1 117 PHE 117 120 120 PHE PHE A . n 
A 1 118 TYR 118 121 121 TYR TYR A . n 
A 1 119 SER 119 122 122 SER SER A . n 
A 1 120 GLY 120 123 123 GLY GLY A . n 
A 1 121 SER 121 124 124 SER SER A . n 
A 1 122 SER 122 125 125 SER SER A . n 
A 1 123 THR 123 126 126 THR THR A . n 
A 1 124 LEU 124 127 127 LEU LEU A . n 
A 1 125 ASP 125 128 128 ASP ASP A . n 
A 1 126 VAL 126 129 129 VAL VAL A . n 
A 1 127 TYR 127 130 130 TYR TYR A . n 
A 1 128 ASN 128 131 131 ASN ASN A . n 
A 1 129 GLY 129 132 132 GLY GLY A . n 
A 1 130 LYS 130 133 133 LYS LYS A . n 
A 1 131 TYR 131 134 134 TYR TYR A . n 
A 1 132 LEU 132 135 135 LEU LEU A . n 
A 1 133 ALA 133 136 136 ALA ALA A . n 
A 1 134 TYR 134 137 137 TYR TYR A . n 
A 1 135 THR 135 138 138 THR THR A . n 
A 1 136 GLU 136 139 139 GLU GLU A . n 
A 1 137 GLU 137 140 140 GLU GLU A . n 
A 1 138 VAL 138 141 141 VAL VAL A . n 
A 1 139 VAL 139 142 142 VAL VAL A . n 
A 1 140 LEU 140 143 143 LEU LEU A . n 
A 1 141 VAL 141 144 144 VAL VAL A . n 
A 1 142 SER 142 145 145 SER SER A . n 
A 1 143 LEU 143 146 146 LEU LEU A . n 
A 1 144 SER 144 147 147 SER SER A . n 
A 1 145 TYR 145 148 148 TYR TYR A . n 
A 1 146 ARG 146 149 149 ARG ARG A . n 
A 1 147 VAL 147 150 150 VAL VAL A . n 
A 1 148 GLY 148 151 151 GLY GLY A . n 
A 1 149 ALA 149 152 152 ALA ALA A . n 
A 1 150 PHE 150 153 153 PHE PHE A . n 
A 1 151 GLY 151 154 154 GLY GLY A . n 
A 1 152 PHE 152 155 155 PHE PHE A . n 
A 1 153 LEU 153 156 156 LEU LEU A . n 
A 1 154 ALA 154 157 157 ALA ALA A . n 
A 1 155 LEU 155 158 158 LEU LEU A . n 
A 1 156 HIS 156 159 159 HIS HIS A . n 
A 1 157 GLY 157 160 160 GLY GLY A . n 
A 1 158 SER 158 161 161 SER SER A . n 
A 1 159 GLN 159 162 162 GLN GLN A . n 
A 1 160 GLU 160 163 163 GLU GLU A . n 
A 1 161 ALA 161 164 164 ALA ALA A . n 
A 1 162 PRO 162 165 165 PRO PRO A . n 
A 1 163 GLY 163 166 166 GLY GLY A . n 
A 1 164 ASN 164 167 167 ASN ASN A . n 
A 1 165 VAL 165 168 168 VAL VAL A . n 
A 1 166 GLY 166 169 169 GLY GLY A . n 
A 1 167 LEU 167 170 170 LEU LEU A . n 
A 1 168 LEU 168 171 171 LEU LEU A . n 
A 1 169 ASP 169 172 172 ASP ASP A . n 
A 1 170 GLN 170 173 173 GLN GLN A . n 
A 1 171 ARG 171 174 174 ARG ARG A . n 
A 1 172 MET 172 175 175 MET MET A . n 
A 1 173 ALA 173 176 176 ALA ALA A . n 
A 1 174 LEU 174 177 177 LEU LEU A . n 
A 1 175 GLN 175 178 178 GLN GLN A . n 
A 1 176 TRP 176 179 179 TRP TRP A . n 
A 1 177 VAL 177 180 180 VAL VAL A . n 
A 1 178 HIS 178 181 181 HIS HIS A . n 
A 1 179 ASP 179 182 182 ASP ASP A . n 
A 1 180 ASN 180 183 183 ASN ASN A . n 
A 1 181 ILE 181 184 184 ILE ILE A . n 
A 1 182 GLN 182 185 185 GLN GLN A . n 
A 1 183 PHE 183 186 186 PHE PHE A . n 
A 1 184 PHE 184 187 187 PHE PHE A . n 
A 1 185 GLY 185 188 188 GLY GLY A . n 
A 1 186 GLY 186 189 189 GLY GLY A . n 
A 1 187 ASP 187 190 190 ASP ASP A . n 
A 1 188 PRO 188 191 191 PRO PRO A . n 
A 1 189 LYS 189 192 192 LYS LYS A . n 
A 1 190 THR 190 193 193 THR THR A . n 
A 1 191 VAL 191 194 194 VAL VAL A . n 
A 1 192 THR 192 195 195 THR THR A . n 
A 1 193 ILE 193 196 196 ILE ILE A . n 
A 1 194 PHE 194 197 197 PHE PHE A . n 
A 1 195 GLY 195 198 198 GLY GLY A . n 
A 1 196 GLU 196 199 199 GLU GLU A . n 
A 1 197 BXT 197 200 200 BXT BXT A . n 
A 1 198 ALA 198 201 201 ALA ALA A . n 
A 1 199 GLY 199 202 202 GLY GLY A . n 
A 1 200 GLY 200 203 203 GLY GLY A . n 
A 1 201 ALA 201 204 204 ALA ALA A . n 
A 1 202 SER 202 205 205 SER SER A . n 
A 1 203 VAL 203 206 206 VAL VAL A . n 
A 1 204 GLY 204 207 207 GLY GLY A . n 
A 1 205 MET 205 208 208 MET MET A . n 
A 1 206 HIS 206 209 209 HIS HIS A . n 
A 1 207 ILE 207 210 210 ILE ILE A . n 
A 1 208 LEU 208 211 211 LEU LEU A . n 
A 1 209 SER 209 212 212 SER SER A . n 
A 1 210 PRO 210 213 213 PRO PRO A . n 
A 1 211 GLY 211 214 214 GLY GLY A . n 
A 1 212 SER 212 215 215 SER SER A . n 
A 1 213 ARG 213 216 216 ARG ARG A . n 
A 1 214 ASP 214 217 217 ASP ASP A . n 
A 1 215 LEU 215 218 218 LEU LEU A . n 
A 1 216 PHE 216 219 219 PHE PHE A . n 
A 1 217 ARG 217 220 220 ARG ARG A . n 
A 1 218 ARG 218 221 221 ARG ARG A . n 
A 1 219 ALA 219 222 222 ALA ALA A . n 
A 1 220 ILE 220 223 223 ILE ILE A . n 
A 1 221 LEU 221 224 224 LEU LEU A . n 
A 1 222 GLN 222 225 225 GLN GLN A . n 
A 1 223 SER 223 226 226 SER SER A . n 
A 1 224 GLY 224 227 227 GLY GLY A . n 
A 1 225 SER 225 228 228 SER SER A . n 
A 1 226 PRO 226 229 229 PRO PRO A . n 
A 1 227 ASN 227 230 230 ASN ASN A . n 
A 1 228 CYS 228 231 231 CYS CYS A . n 
A 1 229 PRO 229 232 232 PRO PRO A . n 
A 1 230 TRP 230 233 233 TRP TRP A . n 
A 1 231 ALA 231 234 234 ALA ALA A . n 
A 1 232 SER 232 235 235 SER SER A . n 
A 1 233 VAL 233 236 236 VAL VAL A . n 
A 1 234 SER 234 237 237 SER SER A . n 
A 1 235 VAL 235 238 238 VAL VAL A . n 
A 1 236 ALA 236 239 239 ALA ALA A . n 
A 1 237 GLU 237 240 240 GLU GLU A . n 
A 1 238 GLY 238 241 241 GLY GLY A . n 
A 1 239 ARG 239 242 242 ARG ARG A . n 
A 1 240 ARG 240 243 243 ARG ARG A . n 
A 1 241 ARG 241 244 244 ARG ARG A . n 
A 1 242 ALA 242 245 245 ALA ALA A . n 
A 1 243 VAL 243 246 246 VAL VAL A . n 
A 1 244 GLU 244 247 247 GLU GLU A . n 
A 1 245 LEU 245 248 248 LEU LEU A . n 
A 1 246 GLY 246 249 249 GLY GLY A . n 
A 1 247 ARG 247 250 250 ARG ARG A . n 
A 1 248 ASN 248 251 251 ASN ASN A . n 
A 1 249 LEU 249 252 252 LEU LEU A . n 
A 1 250 ASN 250 253 253 ASN ASN A . n 
A 1 251 CYS 251 254 254 CYS CYS A . n 
A 1 252 ASN 252 255 255 ASN ASN A . n 
A 1 253 LEU 253 256 256 LEU LEU A . n 
A 1 254 ASN 254 257 257 ASN ASN A . n 
A 1 255 SER 255 258 258 SER SER A . n 
A 1 256 ASP 256 259 259 ASP ASP A . n 
A 1 257 GLU 257 260 260 GLU GLU A . n 
A 1 258 GLU 258 261 261 GLU GLU A . n 
A 1 259 LEU 259 262 262 LEU LEU A . n 
A 1 260 ILE 260 263 263 ILE ILE A . n 
A 1 261 HIS 261 264 264 HIS HIS A . n 
A 1 262 CYS 262 265 265 CYS CYS A . n 
A 1 263 LEU 263 266 266 LEU LEU A . n 
A 1 264 ARG 264 267 267 ARG ARG A . n 
A 1 265 GLU 265 268 268 GLU GLU A . n 
A 1 266 LYS 266 269 269 LYS LYS A . n 
A 1 267 LYS 267 270 270 LYS LYS A . n 
A 1 268 PRO 268 271 271 PRO PRO A . n 
A 1 269 GLN 269 272 272 GLN GLN A . n 
A 1 270 GLU 270 273 273 GLU GLU A . n 
A 1 271 LEU 271 274 274 LEU LEU A . n 
A 1 272 ILE 272 275 275 ILE ILE A . n 
A 1 273 ASP 273 276 276 ASP ASP A . n 
A 1 274 VAL 274 277 277 VAL VAL A . n 
A 1 275 GLU 275 278 278 GLU GLU A . n 
A 1 276 TRP 276 279 279 TRP TRP A . n 
A 1 277 ASN 277 280 280 ASN ASN A . n 
A 1 278 VAL 278 281 281 VAL VAL A . n 
A 1 279 LEU 279 282 282 LEU LEU A . n 
A 1 280 PRO 280 283 283 PRO PRO A . n 
A 1 281 PHE 281 284 284 PHE PHE A . n 
A 1 282 ASP 282 285 285 ASP ASP A . n 
A 1 283 SER 283 286 286 SER SER A . n 
A 1 284 ILE 284 287 287 ILE ILE A . n 
A 1 285 PHE 285 288 288 PHE PHE A . n 
A 1 286 ARG 286 289 289 ARG ARG A . n 
A 1 287 PHE 287 290 290 PHE PHE A . n 
A 1 288 SER 288 291 291 SER SER A . n 
A 1 289 PHE 289 292 292 PHE PHE A . n 
A 1 290 VAL 290 293 293 VAL VAL A . n 
A 1 291 PRO 291 294 294 PRO PRO A . n 
A 1 292 VAL 292 295 295 VAL VAL A . n 
A 1 293 ILE 293 296 296 ILE ILE A . n 
A 1 294 ASP 294 297 297 ASP ASP A . n 
A 1 295 GLY 295 298 298 GLY GLY A . n 
A 1 296 GLU 296 299 299 GLU GLU A . n 
A 1 297 PHE 297 300 300 PHE PHE A . n 
A 1 298 PHE 298 301 301 PHE PHE A . n 
A 1 299 PRO 299 302 302 PRO PRO A . n 
A 1 300 THR 300 303 303 THR THR A . n 
A 1 301 SER 301 304 304 SER SER A . n 
A 1 302 LEU 302 305 305 LEU LEU A . n 
A 1 303 GLU 303 306 306 GLU GLU A . n 
A 1 304 SER 304 307 307 SER SER A . n 
A 1 305 MET 305 308 308 MET MET A . n 
A 1 306 LEU 306 309 309 LEU LEU A . n 
A 1 307 ASN 307 310 310 ASN ASN A . n 
A 1 308 SER 308 311 311 SER SER A . n 
A 1 309 GLY 309 312 312 GLY GLY A . n 
A 1 310 ASN 310 313 313 ASN ASN A . n 
A 1 311 PHE 311 314 314 PHE PHE A . n 
A 1 312 LYS 312 315 315 LYS LYS A . n 
A 1 313 LYS 313 316 316 LYS LYS A . n 
A 1 314 THR 314 317 317 THR THR A . n 
A 1 315 GLN 315 318 318 GLN GLN A . n 
A 1 316 ILE 316 319 319 ILE ILE A . n 
A 1 317 LEU 317 320 320 LEU LEU A . n 
A 1 318 LEU 318 321 321 LEU LEU A . n 
A 1 319 GLY 319 322 322 GLY GLY A . n 
A 1 320 VAL 320 323 323 VAL VAL A . n 
A 1 321 ASN 321 324 324 ASN ASN A . n 
A 1 322 LYS 322 325 325 LYS LYS A . n 
A 1 323 ASP 323 326 326 ASP ASP A . n 
A 1 324 GLU 324 327 327 GLU GLU A . n 
A 1 325 GLY 325 328 328 GLY GLY A . n 
A 1 326 SER 326 329 329 SER SER A . n 
A 1 327 PHE 327 330 330 PHE PHE A . n 
A 1 328 PHE 328 331 331 PHE PHE A . n 
A 1 329 LEU 329 332 332 LEU LEU A . n 
A 1 330 LEU 330 333 333 LEU LEU A . n 
A 1 331 TYR 331 334 334 TYR TYR A . n 
A 1 332 GLY 332 335 335 GLY GLY A . n 
A 1 333 ALA 333 336 336 ALA ALA A . n 
A 1 334 PRO 334 337 337 PRO PRO A . n 
A 1 335 GLY 335 338 338 GLY GLY A . n 
A 1 336 PHE 336 339 339 PHE PHE A . n 
A 1 337 SER 337 340 340 SER SER A . n 
A 1 338 LYS 338 341 341 LYS LYS A . n 
A 1 339 ASP 339 342 342 ASP ASP A . n 
A 1 340 SER 340 343 343 SER SER A . n 
A 1 341 GLU 341 344 344 GLU GLU A . n 
A 1 342 SER 342 345 345 SER SER A . n 
A 1 343 LYS 343 346 346 LYS LYS A . n 
A 1 344 ILE 344 347 347 ILE ILE A . n 
A 1 345 SER 345 348 348 SER SER A . n 
A 1 346 ARG 346 349 349 ARG ARG A . n 
A 1 347 GLU 347 350 350 GLU GLU A . n 
A 1 348 ASP 348 351 351 ASP ASP A . n 
A 1 349 PHE 349 352 352 PHE PHE A . n 
A 1 350 MET 350 353 353 MET MET A . n 
A 1 351 SER 351 354 354 SER SER A . n 
A 1 352 GLY 352 355 355 GLY GLY A . n 
A 1 353 VAL 353 356 356 VAL VAL A . n 
A 1 354 LYS 354 357 357 LYS LYS A . n 
A 1 355 LEU 355 358 358 LEU LEU A . n 
A 1 356 SER 356 359 359 SER SER A . n 
A 1 357 VAL 357 360 360 VAL VAL A . n 
A 1 358 PRO 358 361 361 PRO PRO A . n 
A 1 359 HIS 359 362 362 HIS HIS A . n 
A 1 360 ALA 360 363 363 ALA ALA A . n 
A 1 361 ASN 361 364 364 ASN ASN A . n 
A 1 362 ASP 362 365 365 ASP ASP A . n 
A 1 363 LEU 363 366 366 LEU LEU A . n 
A 1 364 GLY 364 367 367 GLY GLY A . n 
A 1 365 LEU 365 368 368 LEU LEU A . n 
A 1 366 ASP 366 369 369 ASP ASP A . n 
A 1 367 ALA 367 370 370 ALA ALA A . n 
A 1 368 VAL 368 371 371 VAL VAL A . n 
A 1 369 THR 369 372 372 THR THR A . n 
A 1 370 LEU 370 373 373 LEU LEU A . n 
A 1 371 GLN 371 374 374 GLN GLN A . n 
A 1 372 TYR 372 375 375 TYR TYR A . n 
A 1 373 THR 373 376 376 THR THR A . n 
A 1 374 ASP 374 377 377 ASP ASP A . n 
A 1 375 TRP 375 378 378 TRP TRP A . n 
A 1 376 MET 376 379 379 MET MET A . n 
A 1 377 ASP 377 380 380 ASP ASP A . n 
A 1 378 ASP 378 381 381 ASP ASP A . n 
A 1 379 ASN 379 382 382 ASN ASN A . n 
A 1 380 ASN 380 383 383 ASN ASN A . n 
A 1 381 GLY 381 384 384 GLY GLY A . n 
A 1 382 ILE 382 385 385 ILE ILE A . n 
A 1 383 LYS 383 386 386 LYS LYS A . n 
A 1 384 ASN 384 387 387 ASN ASN A . n 
A 1 385 ARG 385 388 388 ARG ARG A . n 
A 1 386 ASP 386 389 389 ASP ASP A . n 
A 1 387 GLY 387 390 390 GLY GLY A . n 
A 1 388 LEU 388 391 391 LEU LEU A . n 
A 1 389 ASP 389 392 392 ASP ASP A . n 
A 1 390 ASP 390 393 393 ASP ASP A . n 
A 1 391 ILE 391 394 394 ILE ILE A . n 
A 1 392 VAL 392 395 395 VAL VAL A . n 
A 1 393 GLY 393 396 396 GLY GLY A . n 
A 1 394 ASP 394 397 397 ASP ASP A . n 
A 1 395 HIS 395 398 398 HIS HIS A . n 
A 1 396 ASN 396 399 399 ASN ASN A . n 
A 1 397 VAL 397 400 400 VAL VAL A . n 
A 1 398 ILE 398 401 401 ILE ILE A . n 
A 1 399 CYS 399 402 402 CYS CYS A . n 
A 1 400 PRO 400 403 403 PRO PRO A . n 
A 1 401 LEU 401 404 404 LEU LEU A . n 
A 1 402 MET 402 405 405 MET MET A . n 
A 1 403 HIS 403 406 406 HIS HIS A . n 
A 1 404 PHE 404 407 407 PHE PHE A . n 
A 1 405 VAL 405 408 408 VAL VAL A . n 
A 1 406 ASN 406 409 409 ASN ASN A . n 
A 1 407 LYS 407 410 410 LYS LYS A . n 
A 1 408 TYR 408 411 411 TYR TYR A . n 
A 1 409 THR 409 412 412 THR THR A . n 
A 1 410 LYS 410 413 413 LYS LYS A . n 
A 1 411 PHE 411 414 414 PHE PHE A . n 
A 1 412 GLY 412 415 415 GLY GLY A . n 
A 1 413 ASN 413 416 416 ASN ASN A . n 
A 1 414 GLY 414 417 417 GLY GLY A . n 
A 1 415 THR 415 418 418 THR THR A . n 
A 1 416 TYR 416 419 419 TYR TYR A . n 
A 1 417 LEU 417 420 420 LEU LEU A . n 
A 1 418 TYR 418 421 421 TYR TYR A . n 
A 1 419 PHE 419 422 422 PHE PHE A . n 
A 1 420 PHE 420 423 423 PHE PHE A . n 
A 1 421 ASN 421 424 424 ASN ASN A . n 
A 1 422 HIS 422 425 425 HIS HIS A . n 
A 1 423 ARG 423 426 426 ARG ARG A . n 
A 1 424 ALA 424 427 427 ALA ALA A . n 
A 1 425 SER 425 428 428 SER SER A . n 
A 1 426 ASN 426 429 429 ASN ASN A . n 
A 1 427 LEU 427 430 430 LEU LEU A . n 
A 1 428 VAL 428 431 431 VAL VAL A . n 
A 1 429 TRP 429 432 432 TRP TRP A . n 
A 1 430 PRO 430 433 433 PRO PRO A . n 
A 1 431 GLU 431 434 434 GLU GLU A . n 
A 1 432 TRP 432 435 435 TRP TRP A . n 
A 1 433 MET 433 436 436 MET MET A . n 
A 1 434 GLY 434 437 437 GLY GLY A . n 
A 1 435 VAL 435 438 438 VAL VAL A . n 
A 1 436 ILE 436 439 439 ILE ILE A . n 
A 1 437 HIS 437 440 440 HIS HIS A . n 
A 1 438 GLY 438 441 441 GLY GLY A . n 
A 1 439 TYR 439 442 442 TYR TYR A . n 
A 1 440 GLU 440 443 443 GLU GLU A . n 
A 1 441 ILE 441 444 444 ILE ILE A . n 
A 1 442 GLU 442 445 445 GLU GLU A . n 
A 1 443 PHE 443 446 446 PHE PHE A . n 
A 1 444 VAL 444 447 447 VAL VAL A . n 
A 1 445 PHE 445 448 448 PHE PHE A . n 
A 1 446 GLY 446 449 449 GLY GLY A . n 
A 1 447 LEU 447 450 450 LEU LEU A . n 
A 1 448 PRO 448 451 451 PRO PRO A . n 
A 1 449 LEU 449 452 452 LEU LEU A . n 
A 1 450 VAL 450 453 453 VAL VAL A . n 
A 1 451 LYS 451 454 454 LYS LYS A . n 
A 1 452 GLU 452 455 455 GLU GLU A . n 
A 1 453 LEU 453 456 456 LEU LEU A . n 
A 1 454 ASN 454 457 457 ASN ASN A . n 
A 1 455 TYR 455 458 458 TYR TYR A . n 
A 1 456 THR 456 459 459 THR THR A . n 
A 1 457 ALA 457 460 460 ALA ALA A . n 
A 1 458 GLU 458 461 461 GLU GLU A . n 
A 1 459 GLU 459 462 462 GLU GLU A . n 
A 1 460 GLU 460 463 463 GLU GLU A . n 
A 1 461 ALA 461 464 464 ALA ALA A . n 
A 1 462 LEU 462 465 465 LEU LEU A . n 
A 1 463 SER 463 466 466 SER SER A . n 
A 1 464 ARG 464 467 467 ARG ARG A . n 
A 1 465 ARG 465 468 468 ARG ARG A . n 
A 1 466 ILE 466 469 469 ILE ILE A . n 
A 1 467 MET 467 470 470 MET MET A . n 
A 1 468 HIS 468 471 471 HIS HIS A . n 
A 1 469 TYR 469 472 472 TYR TYR A . n 
A 1 470 TRP 470 473 473 TRP TRP A . n 
A 1 471 ALA 471 474 474 ALA ALA A . n 
A 1 472 THR 472 475 475 THR THR A . n 
A 1 473 PHE 473 476 476 PHE PHE A . n 
A 1 474 ALA 474 477 477 ALA ALA A . n 
A 1 475 LYS 475 478 478 LYS LYS A . n 
A 1 476 THR 476 479 479 THR THR A . n 
A 1 477 GLY 477 480 480 GLY GLY A . n 
A 1 478 ASN 478 481 481 ASN ASN A . n 
A 1 479 PRO 479 482 482 PRO PRO A . n 
A 1 480 ASN 480 483 483 ASN ASN A . n 
A 1 481 GLU 481 484 484 GLU GLU A . n 
A 1 482 PRO 482 485 485 PRO PRO A . n 
A 1 483 HIS 483 486 486 HIS HIS A . n 
A 1 484 SER 484 487 487 SER SER A . n 
A 1 485 GLN 485 488 488 GLN GLN A . n 
A 1 486 GLU 486 489 489 GLU GLU A . n 
A 1 487 SER 487 490 490 SER SER A . n 
A 1 488 LYS 488 491 491 LYS LYS A . n 
A 1 489 TRP 489 492 492 TRP TRP A . n 
A 1 490 PRO 490 493 493 PRO PRO A . n 
A 1 491 LEU 491 494 494 LEU LEU A . n 
A 1 492 PHE 492 495 495 PHE PHE A . n 
A 1 493 THR 493 496 496 THR THR A . n 
A 1 494 THR 494 497 497 THR THR A . n 
A 1 495 LYS 495 498 498 LYS LYS A . n 
A 1 496 GLU 496 499 499 GLU GLU A . n 
A 1 497 GLN 497 500 500 GLN GLN A . n 
A 1 498 LYS 498 501 501 LYS LYS A . n 
A 1 499 PHE 499 502 502 PHE PHE A . n 
A 1 500 ILE 500 503 503 ILE ILE A . n 
A 1 501 ASP 501 504 504 ASP ASP A . n 
A 1 502 LEU 502 505 505 LEU LEU A . n 
A 1 503 ASN 503 506 506 ASN ASN A . n 
A 1 504 THR 504 507 507 THR THR A . n 
A 1 505 GLU 505 508 508 GLU GLU A . n 
A 1 506 PRO 506 509 509 PRO PRO A . n 
A 1 507 MET 507 510 510 MET MET A . n 
A 1 508 LYS 508 511 511 LYS LYS A . n 
A 1 509 VAL 509 512 512 VAL VAL A . n 
A 1 510 HIS 510 513 513 HIS HIS A . n 
A 1 511 GLN 511 514 514 GLN GLN A . n 
A 1 512 ARG 512 515 515 ARG ARG A . n 
A 1 513 LEU 513 516 516 LEU LEU A . n 
A 1 514 ARG 514 517 517 ARG ARG A . n 
A 1 515 VAL 515 518 518 VAL VAL A . n 
A 1 516 GLN 516 519 519 GLN GLN A . n 
A 1 517 MET 517 520 520 MET MET A . n 
A 1 518 CYS 518 521 521 CYS CYS A . n 
A 1 519 VAL 519 522 522 VAL VAL A . n 
A 1 520 PHE 520 523 523 PHE PHE A . n 
A 1 521 TRP 521 524 524 TRP TRP A . n 
A 1 522 ASN 522 525 525 ASN ASN A . n 
A 1 523 GLN 523 526 526 GLN GLN A . n 
A 1 524 PHE 524 527 527 PHE PHE A . n 
A 1 525 LEU 525 528 528 LEU LEU A . n 
A 1 526 PRO 526 529 529 PRO PRO A . n 
A 1 527 LYS 527 530 530 LYS LYS A . n 
A 1 528 LEU 528 531 531 LEU LEU A . n 
A 1 529 LEU 529 532 532 LEU LEU A . n 
A 1 530 ASN 530 533 533 ASN ASN A . n 
A 1 531 ALA 531 534 534 ALA ALA A . n 
A 1 532 THR 532 535 535 THR THR A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   601 560 NAG NAG A . 
C 2 NAG 1   602 561 NAG NAG A . 
D 2 NAG 1   603 562 NAG NAG A . 
E 3 DQ5 1   604 550 DQ5 KM4 A . 
F 4 1PG 1   605 1   1PG PG5 A . 
G 5 CL  1   606 1   CL  CL  A . 
H 5 CL  1   607 2   CL  CL  A . 
I 5 CL  1   608 4   CL  CL  A . 
J 5 CL  1   609 5   CL  CL  A . 
K 5 CL  1   610 6   CL  CL  A . 
L 6 EDO 1   611 1   EDO EDO A . 
M 6 EDO 1   612 2   EDO EDO A . 
N 6 EDO 1   613 3   EDO EDO A . 
O 7 HOH 1   701 210 HOH HOH A . 
O 7 HOH 2   702 31  HOH HOH A . 
O 7 HOH 3   703 129 HOH HOH A . 
O 7 HOH 4   704 88  HOH HOH A . 
O 7 HOH 5   705 106 HOH HOH A . 
O 7 HOH 6   706 147 HOH HOH A . 
O 7 HOH 7   707 167 HOH HOH A . 
O 7 HOH 8   708 87  HOH HOH A . 
O 7 HOH 9   709 194 HOH HOH A . 
O 7 HOH 10  710 182 HOH HOH A . 
O 7 HOH 11  711 150 HOH HOH A . 
O 7 HOH 12  712 62  HOH HOH A . 
O 7 HOH 13  713 13  HOH HOH A . 
O 7 HOH 14  714 18  HOH HOH A . 
O 7 HOH 15  715 200 HOH HOH A . 
O 7 HOH 16  716 48  HOH HOH A . 
O 7 HOH 17  717 69  HOH HOH A . 
O 7 HOH 18  718 32  HOH HOH A . 
O 7 HOH 19  719 145 HOH HOH A . 
O 7 HOH 20  720 7   HOH HOH A . 
O 7 HOH 21  721 203 HOH HOH A . 
O 7 HOH 22  722 16  HOH HOH A . 
O 7 HOH 23  723 139 HOH HOH A . 
O 7 HOH 24  724 66  HOH HOH A . 
O 7 HOH 25  725 211 HOH HOH A . 
O 7 HOH 26  726 91  HOH HOH A . 
O 7 HOH 27  727 57  HOH HOH A . 
O 7 HOH 28  728 55  HOH HOH A . 
O 7 HOH 29  729 141 HOH HOH A . 
O 7 HOH 30  730 41  HOH HOH A . 
O 7 HOH 31  731 30  HOH HOH A . 
O 7 HOH 32  732 14  HOH HOH A . 
O 7 HOH 33  733 12  HOH HOH A . 
O 7 HOH 34  734 1   HOH HOH A . 
O 7 HOH 35  735 146 HOH HOH A . 
O 7 HOH 36  736 5   HOH HOH A . 
O 7 HOH 37  737 17  HOH HOH A . 
O 7 HOH 38  738 195 HOH HOH A . 
O 7 HOH 39  739 4   HOH HOH A . 
O 7 HOH 40  740 20  HOH HOH A . 
O 7 HOH 41  741 189 HOH HOH A . 
O 7 HOH 42  742 34  HOH HOH A . 
O 7 HOH 43  743 110 HOH HOH A . 
O 7 HOH 44  744 138 HOH HOH A . 
O 7 HOH 45  745 172 HOH HOH A . 
O 7 HOH 46  746 192 HOH HOH A . 
O 7 HOH 47  747 10  HOH HOH A . 
O 7 HOH 48  748 116 HOH HOH A . 
O 7 HOH 49  749 179 HOH HOH A . 
O 7 HOH 50  750 79  HOH HOH A . 
O 7 HOH 51  751 42  HOH HOH A . 
O 7 HOH 52  752 37  HOH HOH A . 
O 7 HOH 53  753 6   HOH HOH A . 
O 7 HOH 54  754 155 HOH HOH A . 
O 7 HOH 55  755 24  HOH HOH A . 
O 7 HOH 56  756 180 HOH HOH A . 
O 7 HOH 57  757 11  HOH HOH A . 
O 7 HOH 58  758 60  HOH HOH A . 
O 7 HOH 59  759 90  HOH HOH A . 
O 7 HOH 60  760 104 HOH HOH A . 
O 7 HOH 61  761 86  HOH HOH A . 
O 7 HOH 62  762 82  HOH HOH A . 
O 7 HOH 63  763 105 HOH HOH A . 
O 7 HOH 64  764 33  HOH HOH A . 
O 7 HOH 65  765 28  HOH HOH A . 
O 7 HOH 66  766 143 HOH HOH A . 
O 7 HOH 67  767 100 HOH HOH A . 
O 7 HOH 68  768 103 HOH HOH A . 
O 7 HOH 69  769 209 HOH HOH A . 
O 7 HOH 70  770 43  HOH HOH A . 
O 7 HOH 71  771 26  HOH HOH A . 
O 7 HOH 72  772 142 HOH HOH A . 
O 7 HOH 73  773 140 HOH HOH A . 
O 7 HOH 74  774 65  HOH HOH A . 
O 7 HOH 75  775 70  HOH HOH A . 
O 7 HOH 76  776 83  HOH HOH A . 
O 7 HOH 77  777 53  HOH HOH A . 
O 7 HOH 78  778 71  HOH HOH A . 
O 7 HOH 79  779 21  HOH HOH A . 
O 7 HOH 80  780 72  HOH HOH A . 
O 7 HOH 81  781 25  HOH HOH A . 
O 7 HOH 82  782 68  HOH HOH A . 
O 7 HOH 83  783 134 HOH HOH A . 
O 7 HOH 84  784 59  HOH HOH A . 
O 7 HOH 85  785 74  HOH HOH A . 
O 7 HOH 86  786 190 HOH HOH A . 
O 7 HOH 87  787 144 HOH HOH A . 
O 7 HOH 88  788 187 HOH HOH A . 
O 7 HOH 89  789 35  HOH HOH A . 
O 7 HOH 90  790 51  HOH HOH A . 
O 7 HOH 91  791 3   HOH HOH A . 
O 7 HOH 92  792 2   HOH HOH A . 
O 7 HOH 93  793 114 HOH HOH A . 
O 7 HOH 94  794 22  HOH HOH A . 
O 7 HOH 95  795 47  HOH HOH A . 
O 7 HOH 96  796 44  HOH HOH A . 
O 7 HOH 97  797 171 HOH HOH A . 
O 7 HOH 98  798 154 HOH HOH A . 
O 7 HOH 99  799 73  HOH HOH A . 
O 7 HOH 100 800 9   HOH HOH A . 
O 7 HOH 101 801 49  HOH HOH A . 
O 7 HOH 102 802 159 HOH HOH A . 
O 7 HOH 103 803 29  HOH HOH A . 
O 7 HOH 104 804 148 HOH HOH A . 
O 7 HOH 105 805 137 HOH HOH A . 
O 7 HOH 106 806 75  HOH HOH A . 
O 7 HOH 107 807 38  HOH HOH A . 
O 7 HOH 108 808 77  HOH HOH A . 
O 7 HOH 109 809 46  HOH HOH A . 
O 7 HOH 110 810 166 HOH HOH A . 
O 7 HOH 111 811 92  HOH HOH A . 
O 7 HOH 112 812 58  HOH HOH A . 
O 7 HOH 113 813 8   HOH HOH A . 
O 7 HOH 114 814 45  HOH HOH A . 
O 7 HOH 115 815 188 HOH HOH A . 
O 7 HOH 116 816 80  HOH HOH A . 
O 7 HOH 117 817 84  HOH HOH A . 
O 7 HOH 118 818 174 HOH HOH A . 
O 7 HOH 119 819 61  HOH HOH A . 
O 7 HOH 120 820 162 HOH HOH A . 
O 7 HOH 121 821 199 HOH HOH A . 
O 7 HOH 122 822 23  HOH HOH A . 
O 7 HOH 123 823 15  HOH HOH A . 
O 7 HOH 124 824 131 HOH HOH A . 
O 7 HOH 125 825 127 HOH HOH A . 
O 7 HOH 126 826 107 HOH HOH A . 
O 7 HOH 127 827 178 HOH HOH A . 
O 7 HOH 128 828 89  HOH HOH A . 
O 7 HOH 129 829 95  HOH HOH A . 
O 7 HOH 130 830 27  HOH HOH A . 
O 7 HOH 131 831 157 HOH HOH A . 
O 7 HOH 132 832 64  HOH HOH A . 
O 7 HOH 133 833 40  HOH HOH A . 
O 7 HOH 134 834 81  HOH HOH A . 
O 7 HOH 135 835 208 HOH HOH A . 
O 7 HOH 136 836 125 HOH HOH A . 
O 7 HOH 137 837 19  HOH HOH A . 
O 7 HOH 138 838 183 HOH HOH A . 
O 7 HOH 139 839 109 HOH HOH A . 
O 7 HOH 140 840 36  HOH HOH A . 
O 7 HOH 141 841 160 HOH HOH A . 
O 7 HOH 142 842 85  HOH HOH A . 
O 7 HOH 143 843 168 HOH HOH A . 
O 7 HOH 144 844 181 HOH HOH A . 
O 7 HOH 145 845 94  HOH HOH A . 
O 7 HOH 146 846 204 HOH HOH A . 
O 7 HOH 147 847 186 HOH HOH A . 
O 7 HOH 148 848 212 HOH HOH A . 
O 7 HOH 149 849 52  HOH HOH A . 
O 7 HOH 150 850 128 HOH HOH A . 
O 7 HOH 151 851 198 HOH HOH A . 
O 7 HOH 152 852 108 HOH HOH A . 
O 7 HOH 153 853 206 HOH HOH A . 
O 7 HOH 154 854 50  HOH HOH A . 
O 7 HOH 155 855 193 HOH HOH A . 
O 7 HOH 156 856 170 HOH HOH A . 
O 7 HOH 157 857 115 HOH HOH A . 
O 7 HOH 158 858 173 HOH HOH A . 
O 7 HOH 159 859 96  HOH HOH A . 
O 7 HOH 160 860 205 HOH HOH A . 
O 7 HOH 161 861 56  HOH HOH A . 
O 7 HOH 162 862 165 HOH HOH A . 
O 7 HOH 163 863 117 HOH HOH A . 
O 7 HOH 164 864 101 HOH HOH A . 
O 7 HOH 165 865 111 HOH HOH A . 
O 7 HOH 166 866 124 HOH HOH A . 
O 7 HOH 167 867 201 HOH HOH A . 
O 7 HOH 168 868 54  HOH HOH A . 
O 7 HOH 169 869 118 HOH HOH A . 
O 7 HOH 170 870 76  HOH HOH A . 
O 7 HOH 171 871 93  HOH HOH A . 
O 7 HOH 172 872 158 HOH HOH A . 
O 7 HOH 173 873 161 HOH HOH A . 
O 7 HOH 174 874 112 HOH HOH A . 
O 7 HOH 175 875 126 HOH HOH A . 
O 7 HOH 176 876 123 HOH HOH A . 
O 7 HOH 177 877 214 HOH HOH A . 
O 7 HOH 178 878 164 HOH HOH A . 
O 7 HOH 179 879 197 HOH HOH A . 
O 7 HOH 180 880 39  HOH HOH A . 
O 7 HOH 181 881 98  HOH HOH A . 
O 7 HOH 182 882 102 HOH HOH A . 
O 7 HOH 183 883 119 HOH HOH A . 
O 7 HOH 184 884 169 HOH HOH A . 
O 7 HOH 185 885 63  HOH HOH A . 
O 7 HOH 186 886 175 HOH HOH A . 
O 7 HOH 187 887 191 HOH HOH A . 
O 7 HOH 188 888 135 HOH HOH A . 
O 7 HOH 189 889 149 HOH HOH A . 
O 7 HOH 190 890 156 HOH HOH A . 
O 7 HOH 191 891 132 HOH HOH A . 
O 7 HOH 192 892 202 HOH HOH A . 
O 7 HOH 193 893 99  HOH HOH A . 
O 7 HOH 194 894 207 HOH HOH A . 
O 7 HOH 195 895 152 HOH HOH A . 
O 7 HOH 196 896 153 HOH HOH A . 
O 7 HOH 197 897 122 HOH HOH A . 
O 7 HOH 198 898 113 HOH HOH A . 
O 7 HOH 199 899 97  HOH HOH A . 
O 7 HOH 200 900 67  HOH HOH A . 
O 7 HOH 201 901 133 HOH HOH A . 
O 7 HOH 202 902 163 HOH HOH A . 
O 7 HOH 203 903 78  HOH HOH A . 
O 7 HOH 204 904 130 HOH HOH A . 
O 7 HOH 205 905 213 HOH HOH A . 
O 7 HOH 206 906 196 HOH HOH A . 
O 7 HOH 207 907 177 HOH HOH A . 
O 7 HOH 208 908 176 HOH HOH A . 
O 7 HOH 209 909 121 HOH HOH A . 
O 7 HOH 210 910 185 HOH HOH A . 
O 7 HOH 211 911 151 HOH HOH A . 
O 7 HOH 212 912 184 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    BXT 
_pdbx_struct_mod_residue.label_seq_id     197 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     BXT 
_pdbx_struct_mod_residue.auth_seq_id      200 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   SER 
_pdbx_struct_mod_residue.details          'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6680  ? 
1 MORE         -58   ? 
1 'SSA (A^2)'  39310 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z              1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 6_767 -x+2,-x+y+1,-z+7/3 -0.5000000000 -0.8660254038 0.0000000000 171.0150000000 -0.8660254038 
0.5000000000 0.0000000000 98.7355562855 0.0000000000 0.0000000000 -1.0000000000 319.6200000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-08-29 
2 'Structure model' 1 1 2018-09-26 
3 'Structure model' 1 2 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 3 'Structure model' 'Data collection'      
4 3 'Structure model' 'Derived calculations' 
5 3 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                  
2 2 'Structure model' citation_author           
3 3 'Structure model' chem_comp                 
4 3 'Structure model' entity                    
5 3 'Structure model' pdbx_chem_comp_identifier 
6 3 'Structure model' pdbx_entity_nonpoly       
7 3 'Structure model' struct_conn               
8 3 'Structure model' struct_site               
9 3 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.journal_volume'          
2  2 'Structure model' '_citation.page_first'              
3  2 'Structure model' '_citation.page_last'               
4  2 'Structure model' '_citation.title'                   
5  2 'Structure model' '_citation_author.identifier_ORCID' 
6  2 'Structure model' '_citation_author.name'             
7  3 'Structure model' '_chem_comp.name'                   
8  3 'Structure model' '_chem_comp.type'                   
9  3 'Structure model' '_entity.pdbx_description'          
10 3 'Structure model' '_pdbx_entity_nonpoly.name'         
11 3 'Structure model' '_struct_conn.pdbx_role'            
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .           2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .           3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .           4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   SG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   CYS 
_pdbx_validate_close_contact.auth_seq_id_1    402 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   SG 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   CYS 
_pdbx_validate_close_contact.auth_seq_id_2    521 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.68 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_1              521 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_2              521 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_3              521 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.04 
_pdbx_validate_rmsd_angle.angle_target_value         111.50 
_pdbx_validate_rmsd_angle.angle_deviation            11.54 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.20 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 11  ? ? -59.13  -5.80   
2  1 VAL A 22  ? ? -161.50 112.53  
3  1 SER A 25  ? ? -153.97 -159.90 
4  1 PHE A 45  ? ? 90.46   -17.83  
5  1 SER A 108 ? ? -162.11 92.93   
6  1 ASN A 167 ? ? 59.84   8.65    
7  1 BXT A 200 ? ? 58.48   -130.88 
8  1 GLU A 299 ? ? -110.63 -75.10  
9  1 THR A 303 ? ? -127.05 -164.27 
10 1 ASN A 382 ? ? -101.70 52.86   
11 1 VAL A 400 ? ? -140.61 -59.56  
12 1 ASN A 457 ? ? 71.05   34.92   
13 1 HIS A 486 ? ? 36.18   52.12   
14 1 ARG A 515 ? ? 63.85   66.63   
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             BXT 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              200 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   26.69 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 89  ? CD  ? A GLU 86  CD  
2  1 Y 1 A GLU 89  ? OE1 ? A GLU 86  OE1 
3  1 Y 1 A GLU 89  ? OE2 ? A GLU 86  OE2 
4  1 Y 1 A LYS 270 ? CE  ? A LYS 267 CE  
5  1 Y 1 A LYS 270 ? NZ  ? A LYS 267 NZ  
6  1 Y 1 A GLU 299 ? CD  ? A GLU 296 CD  
7  1 Y 1 A GLU 299 ? OE1 ? A GLU 296 OE1 
8  1 Y 1 A GLU 299 ? OE2 ? A GLU 296 OE2 
9  1 Y 1 A LYS 454 ? CD  ? A LYS 451 CD  
10 1 Y 1 A LYS 454 ? CE  ? A LYS 451 CE  
11 1 Y 1 A LYS 454 ? NZ  ? A LYS 451 NZ  
12 1 Y 1 A SER 490 ? OG  ? A SER 487 OG  
13 1 Y 1 A LYS 491 ? CE  ? A LYS 488 CE  
14 1 Y 1 A LYS 491 ? NZ  ? A LYS 488 NZ  
15 1 Y 1 A LYS 530 ? CE  ? A LYS 527 CE  
16 1 Y 1 A LYS 530 ? NZ  ? A LYS 527 NZ  
17 1 N 1 A 1PG 605 ? C1  ? F 1PG 1   C1  
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'French Ministry of Armed Forces (DGA and SSA)' France ?         1 
'ANR ASTRID program'                            France ReCNSAChE 2 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose                                                     NAG 
3 '2-[(~{E})-hydroxyiminomethyl]-6-[4-(1,2,3,4-tetrahydroacridin-9-ylamino)butyl]pyridin-3-ol' DQ5 
4 '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL'                              1PG 
5 'CHLORIDE ION'                                                                               CL  
6 1,2-ETHANEDIOL                                                                               EDO 
7 water                                                                                        HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   SAXS 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_space_group.name_H-M_alt     'P 31 2 1' 
_space_group.name_Hall        
;P 31 2"
;
_space_group.IT_number        152 
_space_group.crystal_system   trigonal 
_space_group.id               1 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z          
2 -y,x-y,z+1/3   
3 -x+y,-x,z+2/3  
4 x-y,-y,-z+2/3  
5 -x,-x+y,-z+1/3 
6 y,x,-z         
#