data_6FQS
# 
_entry.id   6FQS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6FQS         
WWPDB D_1200008799 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        'Similar structure with different ligand, in similar cell' 
_pdbx_database_related.db_id          5CDM 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6FQS 
_pdbx_database_status.recvd_initial_deposition_date   2018-02-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bax, B.D.'   1 0000-0003-1940-3785 
'Germe, T.'   2 ?                   
'Basque, E.'  3 ?                   
'Maxwell, A.' 4 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            46 
_citation.language                  ? 
_citation.page_first                4114 
_citation.page_last                 4128 
_citation.title                     
;A new class of antibacterials, the imidazopyrazinones, reveal structural transitions involved in DNA gyrase poisoning and mechanisms of resistance.
;
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gky181 
_citation.pdbx_database_id_PubMed   29538767 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Germe, T.'       1 
primary 'Voros, J.'       2 
primary 'Jeannot, F.'     3 
primary 'Taillier, T.'    4 
primary 'Stavenger, R.A.' 5 
primary 'Bacque, E.'      6 
primary 'Maxwell, A.'     7 
primary 'Bax, B.D.'       8 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6FQS 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     94.027 
_cell.length_a_esd                 ? 
_cell.length_b                     94.027 
_cell.length_b_esd                 ? 
_cell.length_c                     420.470 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6FQS 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA gyrase subunit B,DNA gyrase subunit B'                                 22605.689 2   5.99.1.3,5.99.1.3 ? ? 
? 
2  polymer     man 'DNA gyrase subunit A'                                                      55537.312 1   5.99.1.3          ? ? 
? 
3  polymer     man 'DNA gyrase subunit A'                                                      55617.293 1   5.99.1.3          ? ? 
? 
4  polymer     syn 
;DNA (5'-D(*GP*AP*GP*AP*GP*TP*AP*T*GP*GP*CP*CP*AP*TP*AP*CP*TP*CP*TP*T)-3')
;
6148.989  2   ?                 ? ? ? 
5  non-polymer syn 'MANGANESE (II) ION'                                                        54.938    2   ?                 ? ? 
? 
6  non-polymer syn 'SODIUM ION'                                                                22.990    1   ?                 ? ? 
? 
7  non-polymer syn GLYCEROL                                                                    92.094    8   ?                 ? ? 
? 
8  non-polymer syn 'SULFATE ION'                                                               96.063    1   ?                 ? ? 
? 
9  non-polymer syn '5-cyclopropyl-8-fluoranyl-7-pyridin-4-yl-imidazo[1,2-a]quinoxalin-4-one'   320.320   2   ?                 ? ? 
? 
10 water       nat water                                                                       18.015    112 ?                 ? ? 
? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTG
IGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEHRA
LLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
;
;MDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTG
IGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEHRA
LLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
;
B,D ? 
2 'polypeptide(L)'        no no  
;AELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPH
GDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLP
ARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSI
QMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNL
YKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRES
DTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFG
DDRRTEIQLG
;
;AELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPH
GDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLP
ARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSI
QMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNL
YKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRES
DTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFG
DDRRTEIQLG
;
A   ? 
3 'polypeptide(L)'        no yes 
;AELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPH
GDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMR(PTR)TEARMTKITLELLRDINKDTIDFIDNYDGNEREP
SVLPARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETG
RGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVI
LNNLYKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIIST
IRESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIR
DRFGDDRRTEIQLG
;
;AELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPH
GDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLP
ARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSI
QMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNL
YKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRES
DTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFG
DDRRTEIQLG
;
C   ? 
4 polydeoxyribonucleotide no no  '(DG)(DA)(DG)(DA)(DG)(DT)(DA)(DT)(DG)(DG)(DC)(DC)(DA)(DT)(DA)(DC)(DT)(DC)(DT)(DT)' 
GAGAGTATGGCCATACTCTT E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   VAL n 
1 4   ALA n 
1 5   SER n 
1 6   LEU n 
1 7   PRO n 
1 8   GLY n 
1 9   LYS n 
1 10  LEU n 
1 11  ALA n 
1 12  ASP n 
1 13  CYS n 
1 14  SER n 
1 15  SER n 
1 16  LYS n 
1 17  SER n 
1 18  PRO n 
1 19  GLU n 
1 20  GLU n 
1 21  CYS n 
1 22  GLU n 
1 23  ILE n 
1 24  PHE n 
1 25  LEU n 
1 26  VAL n 
1 27  GLU n 
1 28  GLY n 
1 29  ASP n 
1 30  SER n 
1 31  ALA n 
1 32  GLY n 
1 33  GLY n 
1 34  SER n 
1 35  THR n 
1 36  LYS n 
1 37  SER n 
1 38  GLY n 
1 39  ARG n 
1 40  ASP n 
1 41  SER n 
1 42  ARG n 
1 43  THR n 
1 44  GLN n 
1 45  ALA n 
1 46  ILE n 
1 47  LEU n 
1 48  PRO n 
1 49  LEU n 
1 50  ARG n 
1 51  GLY n 
1 52  LYS n 
1 53  ILE n 
1 54  LEU n 
1 55  ASN n 
1 56  VAL n 
1 57  GLU n 
1 58  LYS n 
1 59  ALA n 
1 60  ARG n 
1 61  LEU n 
1 62  ASP n 
1 63  ARG n 
1 64  ILE n 
1 65  LEU n 
1 66  ASN n 
1 67  ASN n 
1 68  ASN n 
1 69  GLU n 
1 70  ILE n 
1 71  ARG n 
1 72  GLN n 
1 73  MET n 
1 74  ILE n 
1 75  THR n 
1 76  ALA n 
1 77  PHE n 
1 78  GLY n 
1 79  THR n 
1 80  GLY n 
1 81  ILE n 
1 82  GLY n 
1 83  GLY n 
1 84  ASP n 
1 85  PHE n 
1 86  ASP n 
1 87  LEU n 
1 88  ALA n 
1 89  LYS n 
1 90  ALA n 
1 91  ARG n 
1 92  TYR n 
1 93  HIS n 
1 94  LYS n 
1 95  ILE n 
1 96  VAL n 
1 97  ILE n 
1 98  MET n 
1 99  THR n 
1 100 ASP n 
1 101 ALA n 
1 102 ASP n 
1 103 VAL n 
1 104 ASP n 
1 105 GLY n 
1 106 ALA n 
1 107 HIS n 
1 108 ILE n 
1 109 ARG n 
1 110 THR n 
1 111 LEU n 
1 112 LEU n 
1 113 LEU n 
1 114 THR n 
1 115 PHE n 
1 116 PHE n 
1 117 TYR n 
1 118 ARG n 
1 119 PHE n 
1 120 MET n 
1 121 ARG n 
1 122 PRO n 
1 123 LEU n 
1 124 ILE n 
1 125 GLU n 
1 126 ALA n 
1 127 GLY n 
1 128 TYR n 
1 129 VAL n 
1 130 TYR n 
1 131 ILE n 
1 132 ALA n 
1 133 GLN n 
1 134 PRO n 
1 135 PRO n 
1 136 THR n 
1 137 GLY n 
1 138 TYR n 
1 139 LYS n 
1 140 GLY n 
1 141 LEU n 
1 142 GLY n 
1 143 GLU n 
1 144 MET n 
1 145 ASN n 
1 146 ALA n 
1 147 ASP n 
1 148 GLN n 
1 149 LEU n 
1 150 TRP n 
1 151 GLU n 
1 152 THR n 
1 153 THR n 
1 154 MET n 
1 155 ASN n 
1 156 PRO n 
1 157 GLU n 
1 158 HIS n 
1 159 ARG n 
1 160 ALA n 
1 161 LEU n 
1 162 LEU n 
1 163 GLN n 
1 164 VAL n 
1 165 LYS n 
1 166 LEU n 
1 167 GLU n 
1 168 ASP n 
1 169 ALA n 
1 170 ILE n 
1 171 GLU n 
1 172 ALA n 
1 173 ASP n 
1 174 GLN n 
1 175 THR n 
1 176 PHE n 
1 177 GLU n 
1 178 MET n 
1 179 LEU n 
1 180 MET n 
1 181 GLY n 
1 182 ASP n 
1 183 VAL n 
1 184 VAL n 
1 185 GLU n 
1 186 ASN n 
1 187 ARG n 
1 188 ARG n 
1 189 GLN n 
1 190 PHE n 
1 191 ILE n 
1 192 GLU n 
1 193 ASP n 
1 194 ASN n 
1 195 ALA n 
1 196 VAL n 
1 197 TYR n 
1 198 ALA n 
1 199 ASN n 
1 200 LEU n 
1 201 ASP n 
1 202 PHE n 
2 1   ALA n 
2 2   GLU n 
2 3   LEU n 
2 4   PRO n 
2 5   GLN n 
2 6   SER n 
2 7   ARG n 
2 8   ILE n 
2 9   ASN n 
2 10  GLU n 
2 11  ARG n 
2 12  ASN n 
2 13  ILE n 
2 14  THR n 
2 15  SER n 
2 16  GLU n 
2 17  MET n 
2 18  ARG n 
2 19  GLU n 
2 20  SER n 
2 21  PHE n 
2 22  LEU n 
2 23  ASP n 
2 24  TYR n 
2 25  ALA n 
2 26  MET n 
2 27  SER n 
2 28  VAL n 
2 29  ILE n 
2 30  VAL n 
2 31  ALA n 
2 32  ARG n 
2 33  ALA n 
2 34  LEU n 
2 35  PRO n 
2 36  ASP n 
2 37  VAL n 
2 38  ARG n 
2 39  ASP n 
2 40  GLY n 
2 41  LEU n 
2 42  LYS n 
2 43  PRO n 
2 44  VAL n 
2 45  HIS n 
2 46  ARG n 
2 47  ARG n 
2 48  ILE n 
2 49  LEU n 
2 50  TYR n 
2 51  GLY n 
2 52  LEU n 
2 53  ASN n 
2 54  GLU n 
2 55  GLN n 
2 56  GLY n 
2 57  MET n 
2 58  THR n 
2 59  PRO n 
2 60  ASP n 
2 61  LYS n 
2 62  SER n 
2 63  TYR n 
2 64  LYS n 
2 65  LYS n 
2 66  SER n 
2 67  ALA n 
2 68  ARG n 
2 69  ILE n 
2 70  VAL n 
2 71  GLY n 
2 72  ASP n 
2 73  VAL n 
2 74  MET n 
2 75  GLY n 
2 76  LYS n 
2 77  TYR n 
2 78  HIS n 
2 79  PRO n 
2 80  HIS n 
2 81  GLY n 
2 82  ASP n 
2 83  SER n 
2 84  SER n 
2 85  ILE n 
2 86  TYR n 
2 87  GLU n 
2 88  ALA n 
2 89  MET n 
2 90  VAL n 
2 91  ARG n 
2 92  MET n 
2 93  ALA n 
2 94  GLN n 
2 95  ASP n 
2 96  PHE n 
2 97  SER n 
2 98  TYR n 
2 99  ARG n 
2 100 TYR n 
2 101 PRO n 
2 102 LEU n 
2 103 VAL n 
2 104 ASP n 
2 105 GLY n 
2 106 GLN n 
2 107 GLY n 
2 108 ASN n 
2 109 PHE n 
2 110 GLY n 
2 111 SER n 
2 112 MET n 
2 113 ASP n 
2 114 GLY n 
2 115 ASP n 
2 116 GLY n 
2 117 ALA n 
2 118 ALA n 
2 119 ALA n 
2 120 MET n 
2 121 ARG n 
2 122 TYR n 
2 123 THR n 
2 124 GLU n 
2 125 ALA n 
2 126 ARG n 
2 127 MET n 
2 128 THR n 
2 129 LYS n 
2 130 ILE n 
2 131 THR n 
2 132 LEU n 
2 133 GLU n 
2 134 LEU n 
2 135 LEU n 
2 136 ARG n 
2 137 ASP n 
2 138 ILE n 
2 139 ASN n 
2 140 LYS n 
2 141 ASP n 
2 142 THR n 
2 143 ILE n 
2 144 ASP n 
2 145 PHE n 
2 146 ILE n 
2 147 ASP n 
2 148 ASN n 
2 149 TYR n 
2 150 ASP n 
2 151 GLY n 
2 152 ASN n 
2 153 GLU n 
2 154 ARG n 
2 155 GLU n 
2 156 PRO n 
2 157 SER n 
2 158 VAL n 
2 159 LEU n 
2 160 PRO n 
2 161 ALA n 
2 162 ARG n 
2 163 PHE n 
2 164 PRO n 
2 165 ASN n 
2 166 LEU n 
2 167 LEU n 
2 168 ALA n 
2 169 ASN n 
2 170 GLY n 
2 171 ALA n 
2 172 SER n 
2 173 GLY n 
2 174 ILE n 
2 175 ALA n 
2 176 VAL n 
2 177 GLY n 
2 178 MET n 
2 179 ALA n 
2 180 THR n 
2 181 ASN n 
2 182 ILE n 
2 183 PRO n 
2 184 PRO n 
2 185 HIS n 
2 186 ASN n 
2 187 LEU n 
2 188 THR n 
2 189 GLU n 
2 190 LEU n 
2 191 ILE n 
2 192 ASN n 
2 193 GLY n 
2 194 VAL n 
2 195 LEU n 
2 196 SER n 
2 197 LEU n 
2 198 SER n 
2 199 LYS n 
2 200 ASN n 
2 201 PRO n 
2 202 ASP n 
2 203 ILE n 
2 204 SER n 
2 205 ILE n 
2 206 ALA n 
2 207 GLU n 
2 208 LEU n 
2 209 MET n 
2 210 GLU n 
2 211 ASP n 
2 212 ILE n 
2 213 GLU n 
2 214 GLY n 
2 215 PRO n 
2 216 ASP n 
2 217 PHE n 
2 218 PRO n 
2 219 THR n 
2 220 ALA n 
2 221 GLY n 
2 222 LEU n 
2 223 ILE n 
2 224 LEU n 
2 225 GLY n 
2 226 LYS n 
2 227 SER n 
2 228 GLY n 
2 229 ILE n 
2 230 ARG n 
2 231 ARG n 
2 232 ALA n 
2 233 TYR n 
2 234 GLU n 
2 235 THR n 
2 236 GLY n 
2 237 ARG n 
2 238 GLY n 
2 239 SER n 
2 240 ILE n 
2 241 GLN n 
2 242 MET n 
2 243 ARG n 
2 244 SER n 
2 245 ARG n 
2 246 ALA n 
2 247 VAL n 
2 248 ILE n 
2 249 GLU n 
2 250 GLU n 
2 251 ARG n 
2 252 GLY n 
2 253 GLY n 
2 254 GLY n 
2 255 ARG n 
2 256 GLN n 
2 257 ARG n 
2 258 ILE n 
2 259 VAL n 
2 260 VAL n 
2 261 THR n 
2 262 GLU n 
2 263 ILE n 
2 264 PRO n 
2 265 PHE n 
2 266 GLN n 
2 267 VAL n 
2 268 ASN n 
2 269 LYS n 
2 270 ALA n 
2 271 ARG n 
2 272 MET n 
2 273 ILE n 
2 274 GLU n 
2 275 LYS n 
2 276 ILE n 
2 277 ALA n 
2 278 GLU n 
2 279 LEU n 
2 280 VAL n 
2 281 ARG n 
2 282 ASP n 
2 283 LYS n 
2 284 LYS n 
2 285 ILE n 
2 286 ASP n 
2 287 GLY n 
2 288 ILE n 
2 289 THR n 
2 290 ASP n 
2 291 LEU n 
2 292 ARG n 
2 293 ASP n 
2 294 GLU n 
2 295 THR n 
2 296 SER n 
2 297 LEU n 
2 298 ARG n 
2 299 THR n 
2 300 GLY n 
2 301 VAL n 
2 302 ARG n 
2 303 VAL n 
2 304 VAL n 
2 305 ILE n 
2 306 ASP n 
2 307 VAL n 
2 308 ARG n 
2 309 LYS n 
2 310 ASP n 
2 311 ALA n 
2 312 ASN n 
2 313 ALA n 
2 314 SER n 
2 315 VAL n 
2 316 ILE n 
2 317 LEU n 
2 318 ASN n 
2 319 ASN n 
2 320 LEU n 
2 321 TYR n 
2 322 LYS n 
2 323 GLN n 
2 324 THR n 
2 325 PRO n 
2 326 LEU n 
2 327 GLN n 
2 328 THR n 
2 329 SER n 
2 330 PHE n 
2 331 GLY n 
2 332 VAL n 
2 333 ASN n 
2 334 MET n 
2 335 ILE n 
2 336 ALA n 
2 337 LEU n 
2 338 VAL n 
2 339 ASN n 
2 340 GLY n 
2 341 ARG n 
2 342 PRO n 
2 343 LYS n 
2 344 LEU n 
2 345 ILE n 
2 346 ASN n 
2 347 LEU n 
2 348 LYS n 
2 349 GLU n 
2 350 ALA n 
2 351 LEU n 
2 352 VAL n 
2 353 HIS n 
2 354 TYR n 
2 355 LEU n 
2 356 GLU n 
2 357 HIS n 
2 358 GLN n 
2 359 LYS n 
2 360 THR n 
2 361 VAL n 
2 362 VAL n 
2 363 ARG n 
2 364 ARG n 
2 365 ARG n 
2 366 THR n 
2 367 GLN n 
2 368 TYR n 
2 369 ASN n 
2 370 LEU n 
2 371 ARG n 
2 372 LYS n 
2 373 ALA n 
2 374 LYS n 
2 375 ASP n 
2 376 ARG n 
2 377 ALA n 
2 378 HIS n 
2 379 ILE n 
2 380 LEU n 
2 381 GLU n 
2 382 GLY n 
2 383 LEU n 
2 384 ARG n 
2 385 ILE n 
2 386 ALA n 
2 387 LEU n 
2 388 ASP n 
2 389 HIS n 
2 390 ILE n 
2 391 ASP n 
2 392 GLU n 
2 393 ILE n 
2 394 ILE n 
2 395 SER n 
2 396 THR n 
2 397 ILE n 
2 398 ARG n 
2 399 GLU n 
2 400 SER n 
2 401 ASP n 
2 402 THR n 
2 403 ASP n 
2 404 LYS n 
2 405 VAL n 
2 406 ALA n 
2 407 MET n 
2 408 GLU n 
2 409 SER n 
2 410 LEU n 
2 411 GLN n 
2 412 GLN n 
2 413 ARG n 
2 414 PHE n 
2 415 LYS n 
2 416 LEU n 
2 417 SER n 
2 418 GLU n 
2 419 LYS n 
2 420 GLN n 
2 421 ALA n 
2 422 GLN n 
2 423 ALA n 
2 424 ILE n 
2 425 LEU n 
2 426 ASP n 
2 427 MET n 
2 428 ARG n 
2 429 LEU n 
2 430 ARG n 
2 431 ARG n 
2 432 LEU n 
2 433 THR n 
2 434 GLY n 
2 435 LEU n 
2 436 GLU n 
2 437 ARG n 
2 438 ASP n 
2 439 LYS n 
2 440 ILE n 
2 441 GLU n 
2 442 ALA n 
2 443 GLU n 
2 444 TYR n 
2 445 ASN n 
2 446 GLU n 
2 447 LEU n 
2 448 LEU n 
2 449 ASN n 
2 450 TYR n 
2 451 ILE n 
2 452 SER n 
2 453 GLU n 
2 454 LEU n 
2 455 GLU n 
2 456 THR n 
2 457 ILE n 
2 458 LEU n 
2 459 ALA n 
2 460 ASP n 
2 461 GLU n 
2 462 GLU n 
2 463 VAL n 
2 464 LEU n 
2 465 LEU n 
2 466 GLN n 
2 467 LEU n 
2 468 VAL n 
2 469 ARG n 
2 470 ASP n 
2 471 GLU n 
2 472 LEU n 
2 473 THR n 
2 474 GLU n 
2 475 ILE n 
2 476 ARG n 
2 477 ASP n 
2 478 ARG n 
2 479 PHE n 
2 480 GLY n 
2 481 ASP n 
2 482 ASP n 
2 483 ARG n 
2 484 ARG n 
2 485 THR n 
2 486 GLU n 
2 487 ILE n 
2 488 GLN n 
2 489 LEU n 
2 490 GLY n 
3 1   ALA n 
3 2   GLU n 
3 3   LEU n 
3 4   PRO n 
3 5   GLN n 
3 6   SER n 
3 7   ARG n 
3 8   ILE n 
3 9   ASN n 
3 10  GLU n 
3 11  ARG n 
3 12  ASN n 
3 13  ILE n 
3 14  THR n 
3 15  SER n 
3 16  GLU n 
3 17  MET n 
3 18  ARG n 
3 19  GLU n 
3 20  SER n 
3 21  PHE n 
3 22  LEU n 
3 23  ASP n 
3 24  TYR n 
3 25  ALA n 
3 26  MET n 
3 27  SER n 
3 28  VAL n 
3 29  ILE n 
3 30  VAL n 
3 31  ALA n 
3 32  ARG n 
3 33  ALA n 
3 34  LEU n 
3 35  PRO n 
3 36  ASP n 
3 37  VAL n 
3 38  ARG n 
3 39  ASP n 
3 40  GLY n 
3 41  LEU n 
3 42  LYS n 
3 43  PRO n 
3 44  VAL n 
3 45  HIS n 
3 46  ARG n 
3 47  ARG n 
3 48  ILE n 
3 49  LEU n 
3 50  TYR n 
3 51  GLY n 
3 52  LEU n 
3 53  ASN n 
3 54  GLU n 
3 55  GLN n 
3 56  GLY n 
3 57  MET n 
3 58  THR n 
3 59  PRO n 
3 60  ASP n 
3 61  LYS n 
3 62  SER n 
3 63  TYR n 
3 64  LYS n 
3 65  LYS n 
3 66  SER n 
3 67  ALA n 
3 68  ARG n 
3 69  ILE n 
3 70  VAL n 
3 71  GLY n 
3 72  ASP n 
3 73  VAL n 
3 74  MET n 
3 75  GLY n 
3 76  LYS n 
3 77  TYR n 
3 78  HIS n 
3 79  PRO n 
3 80  HIS n 
3 81  GLY n 
3 82  ASP n 
3 83  SER n 
3 84  SER n 
3 85  ILE n 
3 86  TYR n 
3 87  GLU n 
3 88  ALA n 
3 89  MET n 
3 90  VAL n 
3 91  ARG n 
3 92  MET n 
3 93  ALA n 
3 94  GLN n 
3 95  ASP n 
3 96  PHE n 
3 97  SER n 
3 98  TYR n 
3 99  ARG n 
3 100 TYR n 
3 101 PRO n 
3 102 LEU n 
3 103 VAL n 
3 104 ASP n 
3 105 GLY n 
3 106 GLN n 
3 107 GLY n 
3 108 ASN n 
3 109 PHE n 
3 110 GLY n 
3 111 SER n 
3 112 MET n 
3 113 ASP n 
3 114 GLY n 
3 115 ASP n 
3 116 GLY n 
3 117 ALA n 
3 118 ALA n 
3 119 ALA n 
3 120 MET n 
3 121 ARG n 
3 122 PTR n 
3 123 THR n 
3 124 GLU n 
3 125 ALA n 
3 126 ARG n 
3 127 MET n 
3 128 THR n 
3 129 LYS n 
3 130 ILE n 
3 131 THR n 
3 132 LEU n 
3 133 GLU n 
3 134 LEU n 
3 135 LEU n 
3 136 ARG n 
3 137 ASP n 
3 138 ILE n 
3 139 ASN n 
3 140 LYS n 
3 141 ASP n 
3 142 THR n 
3 143 ILE n 
3 144 ASP n 
3 145 PHE n 
3 146 ILE n 
3 147 ASP n 
3 148 ASN n 
3 149 TYR n 
3 150 ASP n 
3 151 GLY n 
3 152 ASN n 
3 153 GLU n 
3 154 ARG n 
3 155 GLU n 
3 156 PRO n 
3 157 SER n 
3 158 VAL n 
3 159 LEU n 
3 160 PRO n 
3 161 ALA n 
3 162 ARG n 
3 163 PHE n 
3 164 PRO n 
3 165 ASN n 
3 166 LEU n 
3 167 LEU n 
3 168 ALA n 
3 169 ASN n 
3 170 GLY n 
3 171 ALA n 
3 172 SER n 
3 173 GLY n 
3 174 ILE n 
3 175 ALA n 
3 176 VAL n 
3 177 GLY n 
3 178 MET n 
3 179 ALA n 
3 180 THR n 
3 181 ASN n 
3 182 ILE n 
3 183 PRO n 
3 184 PRO n 
3 185 HIS n 
3 186 ASN n 
3 187 LEU n 
3 188 THR n 
3 189 GLU n 
3 190 LEU n 
3 191 ILE n 
3 192 ASN n 
3 193 GLY n 
3 194 VAL n 
3 195 LEU n 
3 196 SER n 
3 197 LEU n 
3 198 SER n 
3 199 LYS n 
3 200 ASN n 
3 201 PRO n 
3 202 ASP n 
3 203 ILE n 
3 204 SER n 
3 205 ILE n 
3 206 ALA n 
3 207 GLU n 
3 208 LEU n 
3 209 MET n 
3 210 GLU n 
3 211 ASP n 
3 212 ILE n 
3 213 GLU n 
3 214 GLY n 
3 215 PRO n 
3 216 ASP n 
3 217 PHE n 
3 218 PRO n 
3 219 THR n 
3 220 ALA n 
3 221 GLY n 
3 222 LEU n 
3 223 ILE n 
3 224 LEU n 
3 225 GLY n 
3 226 LYS n 
3 227 SER n 
3 228 GLY n 
3 229 ILE n 
3 230 ARG n 
3 231 ARG n 
3 232 ALA n 
3 233 TYR n 
3 234 GLU n 
3 235 THR n 
3 236 GLY n 
3 237 ARG n 
3 238 GLY n 
3 239 SER n 
3 240 ILE n 
3 241 GLN n 
3 242 MET n 
3 243 ARG n 
3 244 SER n 
3 245 ARG n 
3 246 ALA n 
3 247 VAL n 
3 248 ILE n 
3 249 GLU n 
3 250 GLU n 
3 251 ARG n 
3 252 GLY n 
3 253 GLY n 
3 254 GLY n 
3 255 ARG n 
3 256 GLN n 
3 257 ARG n 
3 258 ILE n 
3 259 VAL n 
3 260 VAL n 
3 261 THR n 
3 262 GLU n 
3 263 ILE n 
3 264 PRO n 
3 265 PHE n 
3 266 GLN n 
3 267 VAL n 
3 268 ASN n 
3 269 LYS n 
3 270 ALA n 
3 271 ARG n 
3 272 MET n 
3 273 ILE n 
3 274 GLU n 
3 275 LYS n 
3 276 ILE n 
3 277 ALA n 
3 278 GLU n 
3 279 LEU n 
3 280 VAL n 
3 281 ARG n 
3 282 ASP n 
3 283 LYS n 
3 284 LYS n 
3 285 ILE n 
3 286 ASP n 
3 287 GLY n 
3 288 ILE n 
3 289 THR n 
3 290 ASP n 
3 291 LEU n 
3 292 ARG n 
3 293 ASP n 
3 294 GLU n 
3 295 THR n 
3 296 SER n 
3 297 LEU n 
3 298 ARG n 
3 299 THR n 
3 300 GLY n 
3 301 VAL n 
3 302 ARG n 
3 303 VAL n 
3 304 VAL n 
3 305 ILE n 
3 306 ASP n 
3 307 VAL n 
3 308 ARG n 
3 309 LYS n 
3 310 ASP n 
3 311 ALA n 
3 312 ASN n 
3 313 ALA n 
3 314 SER n 
3 315 VAL n 
3 316 ILE n 
3 317 LEU n 
3 318 ASN n 
3 319 ASN n 
3 320 LEU n 
3 321 TYR n 
3 322 LYS n 
3 323 GLN n 
3 324 THR n 
3 325 PRO n 
3 326 LEU n 
3 327 GLN n 
3 328 THR n 
3 329 SER n 
3 330 PHE n 
3 331 GLY n 
3 332 VAL n 
3 333 ASN n 
3 334 MET n 
3 335 ILE n 
3 336 ALA n 
3 337 LEU n 
3 338 VAL n 
3 339 ASN n 
3 340 GLY n 
3 341 ARG n 
3 342 PRO n 
3 343 LYS n 
3 344 LEU n 
3 345 ILE n 
3 346 ASN n 
3 347 LEU n 
3 348 LYS n 
3 349 GLU n 
3 350 ALA n 
3 351 LEU n 
3 352 VAL n 
3 353 HIS n 
3 354 TYR n 
3 355 LEU n 
3 356 GLU n 
3 357 HIS n 
3 358 GLN n 
3 359 LYS n 
3 360 THR n 
3 361 VAL n 
3 362 VAL n 
3 363 ARG n 
3 364 ARG n 
3 365 ARG n 
3 366 THR n 
3 367 GLN n 
3 368 TYR n 
3 369 ASN n 
3 370 LEU n 
3 371 ARG n 
3 372 LYS n 
3 373 ALA n 
3 374 LYS n 
3 375 ASP n 
3 376 ARG n 
3 377 ALA n 
3 378 HIS n 
3 379 ILE n 
3 380 LEU n 
3 381 GLU n 
3 382 GLY n 
3 383 LEU n 
3 384 ARG n 
3 385 ILE n 
3 386 ALA n 
3 387 LEU n 
3 388 ASP n 
3 389 HIS n 
3 390 ILE n 
3 391 ASP n 
3 392 GLU n 
3 393 ILE n 
3 394 ILE n 
3 395 SER n 
3 396 THR n 
3 397 ILE n 
3 398 ARG n 
3 399 GLU n 
3 400 SER n 
3 401 ASP n 
3 402 THR n 
3 403 ASP n 
3 404 LYS n 
3 405 VAL n 
3 406 ALA n 
3 407 MET n 
3 408 GLU n 
3 409 SER n 
3 410 LEU n 
3 411 GLN n 
3 412 GLN n 
3 413 ARG n 
3 414 PHE n 
3 415 LYS n 
3 416 LEU n 
3 417 SER n 
3 418 GLU n 
3 419 LYS n 
3 420 GLN n 
3 421 ALA n 
3 422 GLN n 
3 423 ALA n 
3 424 ILE n 
3 425 LEU n 
3 426 ASP n 
3 427 MET n 
3 428 ARG n 
3 429 LEU n 
3 430 ARG n 
3 431 ARG n 
3 432 LEU n 
3 433 THR n 
3 434 GLY n 
3 435 LEU n 
3 436 GLU n 
3 437 ARG n 
3 438 ASP n 
3 439 LYS n 
3 440 ILE n 
3 441 GLU n 
3 442 ALA n 
3 443 GLU n 
3 444 TYR n 
3 445 ASN n 
3 446 GLU n 
3 447 LEU n 
3 448 LEU n 
3 449 ASN n 
3 450 TYR n 
3 451 ILE n 
3 452 SER n 
3 453 GLU n 
3 454 LEU n 
3 455 GLU n 
3 456 THR n 
3 457 ILE n 
3 458 LEU n 
3 459 ALA n 
3 460 ASP n 
3 461 GLU n 
3 462 GLU n 
3 463 VAL n 
3 464 LEU n 
3 465 LEU n 
3 466 GLN n 
3 467 LEU n 
3 468 VAL n 
3 469 ARG n 
3 470 ASP n 
3 471 GLU n 
3 472 LEU n 
3 473 THR n 
3 474 GLU n 
3 475 ILE n 
3 476 ARG n 
3 477 ASP n 
3 478 ARG n 
3 479 PHE n 
3 480 GLY n 
3 481 ASP n 
3 482 ASP n 
3 483 ARG n 
3 484 ARG n 
3 485 THR n 
3 486 GLU n 
3 487 ILE n 
3 488 GLN n 
3 489 LEU n 
3 490 GLY n 
4 1   DG  n 
4 2   DA  n 
4 3   DG  n 
4 4   DA  n 
4 5   DG  n 
4 6   DT  n 
4 7   DA  n 
4 8   DT  n 
4 9   DG  n 
4 10  DG  n 
4 11  DC  n 
4 12  DC  n 
4 13  DA  n 
4 14  DT  n 
4 15  DA  n 
4 16  DC  n 
4 17  DT  n 
4 18  DC  n 
4 19  DT  n 
4 20  DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   135 ? ? 'gyrB, SA0005' ? N315 ? ? ? ? 'Staphylococcus aureus (strain N315)' 158879 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 138 202 ? ? 'gyrB, SA0005' ? N315 ? ? ? ? 'Staphylococcus aureus (strain N315)' 158879 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   490 ? ? 'gyrA, SA0006' ? N315 ? ? ? ? 'Staphylococcus aureus'               158879 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1   490 ? ? 'gyrA, SA0006' ? N315 ? ? ? ? 'Staphylococcus aureus'               158879 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              4 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       20 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP GYRB_STAAN P66937 ? 1 
;LDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTG
IGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPP
;
409 
2 UNP GYRB_STAAN P66937 ? 1 YKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF 580 
3 UNP GYRA_STAAN Q99XG5 ? 2 
;AELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPH
GDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLP
ARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSI
QMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNL
YKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRES
DTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFG
DDRRTEIQLG
;
2   
4 UNP GYRA_STAAN Q99XG5 ? 3 
;AELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPH
GDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLP
ARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSI
QMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNL
YKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRES
DTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFG
DDRRTEIQLG
;
2   
5 PDB 6FQS       6FQS   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6FQS B 1   ? 135 ? P66937 409 ? 543 ? 409 543 
2 2 6FQS B 138 ? 202 ? P66937 580 ? 644 ? 580 644 
3 3 6FQS A 1   ? 490 ? Q99XG5 2   ? 491 ? 2   491 
4 1 6FQS D 1   ? 135 ? P66937 409 ? 543 ? 409 543 
5 2 6FQS D 138 ? 202 ? P66937 580 ? 644 ? 580 644 
6 4 6FQS C 1   ? 490 ? Q99XG5 2   ? 491 ? 2   491 
7 5 6FQS E 1   ? 20  ? 6FQS   -8  ? 12  ? -8  12  
8 5 6FQS F 1   ? 20  ? 6FQS   -8  ? 12  ? -8  12  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6FQS MET B 1   ? UNP P66937 LEU 409 conflict 409 1 
1 6FQS THR B 136 ? UNP P66937 ?   ?   linker   544 2 
1 6FQS GLY B 137 ? UNP P66937 ?   ?   linker   579 3 
4 6FQS MET D 1   ? UNP P66937 LEU 409 conflict 409 4 
4 6FQS THR D 136 ? UNP P66937 ?   ?   linker   544 5 
4 6FQS GLY D 137 ? UNP P66937 ?   ?   linker   545 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                   ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                  ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                           ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                  ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                      ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                       ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                      ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                              ? 'C10 H15 N2 O8 P' 322.208 
E3E non-polymer         . '5-cyclopropyl-8-fluoranyl-7-pyridin-4-yl-imidazo[1,2-a]quinoxalin-4-one' ? 'C18 H13 F N4 O'  320.320 
GLN 'L-peptide linking' y GLUTAMINE                                                                 ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                           ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                   ? 'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                                                                  
'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                 ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                     ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                   ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                    ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                                                      ? 'Mn 2'            54.938  
NA  non-polymer         . 'SODIUM ION'                                                              ? 'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                                             ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                   ? 'C5 H9 N O2'      115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE                                                         PHOSPHONOTYROSINE 
'C9 H12 N O6 P'   261.168 
SER 'L-peptide linking' y SERINE                                                                    ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                                                             ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                                                                 ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                  ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                    ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6FQS 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.18 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.34 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          MICROBATCH 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.2 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '8% PEG 5000 MME, 90 mM bis-tris pH 6.2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-02-23 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97600 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97600 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6FQS 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.11 
_reflns.d_resolution_low                 48 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       37639 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  10.5 
_reflns.pdbx_Rmerge_I_obs                0.194 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.995 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.11 
_reflns_shell.d_res_low                   3.22 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3666 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.572 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.532 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6FQS 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.110 
_refine.ls_d_res_low                             47.014 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     37524 
_refine.ls_number_reflns_R_free                  1843 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.92 
_refine.ls_percent_reflns_R_free                 4.91 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1803 
_refine.ls_R_factor_R_free                       0.2100 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1788 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      5CDM 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.30 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.10 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.98 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.40 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10526 
_refine_hist.pdbx_number_atoms_nucleic_acid   809 
_refine_hist.pdbx_number_atoms_ligand         104 
_refine_hist.number_atoms_solvent             112 
_refine_hist.number_atoms_total               11551 
_refine_hist.d_res_high                       3.110 
_refine_hist.d_res_low                        47.014 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  ? 12047 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.311  ? 16481 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 20.332 ? 7378  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.065  ? 1838  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 2017  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.1100 3.1941  . . 149 2716 99.00  . . . 0.3342 . 0.2883 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1941 3.2881  . . 153 2709 100.00 . . . 0.3448 . 0.2620 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2881 3.3942  . . 132 2784 100.00 . . . 0.2700 . 0.2428 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3942 3.5154  . . 120 2743 100.00 . . . 0.2333 . 0.2371 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5154 3.6561  . . 163 2734 100.00 . . . 0.2434 . 0.1949 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6561 3.8225  . . 140 2731 100.00 . . . 0.2133 . 0.1758 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8225 4.0239  . . 156 2737 100.00 . . . 0.2103 . 0.1638 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0239 4.2758  . . 162 2759 100.00 . . . 0.1868 . 0.1637 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2758 4.6057  . . 132 2730 100.00 . . . 0.1712 . 0.1389 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6057 5.0687  . . 139 2750 100.00 . . . 0.1868 . 0.1409 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0687 5.8010  . . 135 2748 100.00 . . . 0.1995 . 0.1737 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.8010 7.3042  . . 127 2790 100.00 . . . 0.2174 . 0.1977 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.3042 47.0188 . . 135 2750 100.00 . . . 0.1832 . 0.1679 . . . . . . . . . . 
# 
_struct.entry_id                     6FQS 
_struct.title                        '3.11A complex of S.Aureus gyrase with imidazopyrazinone T3 and DNA' 
_struct.pdbx_descriptor              'DNA gyrase subunit B,DNA gyrase subunit B, DNA gyrase subunit A/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6FQS 
_struct_keywords.text            'TYPE IIA TOPOISOMERASE, ANTIBACTERIAL, INHIBITOR, ISOMERASE' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 1  ? 
D N N 3  ? 
E N N 4  ? 
F N N 4  ? 
G N N 5  ? 
H N N 6  ? 
I N N 7  ? 
J N N 7  ? 
K N N 7  ? 
L N N 7  ? 
M N N 5  ? 
N N N 8  ? 
O N N 7  ? 
P N N 7  ? 
Q N N 7  ? 
R N N 7  ? 
S N N 9  ? 
T N N 9  ? 
U N N 10 ? 
V N N 10 ? 
W N N 10 ? 
X N N 10 ? 
Y N N 10 ? 
Z N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 28  ? ARG A 39  ? GLY B 436 ARG B 447 1 ? 12 
HELX_P HELX_P2  AA2 ASN A 55  ? ALA A 59  ? ASN B 463 ALA B 467 5 ? 5  
HELX_P HELX_P3  AA3 ARG A 60  ? ASN A 67  ? ARG B 468 ASN B 475 1 ? 8  
HELX_P HELX_P4  AA4 ASN A 67  ? GLY A 78  ? ASN B 475 GLY B 486 1 ? 12 
HELX_P HELX_P5  AA5 ILE A 81  ? PHE A 85  ? ILE B 489 PHE B 493 5 ? 5  
HELX_P HELX_P6  AA6 ASP A 86  ? ALA A 90  ? ASP B 494 ALA B 498 5 ? 5  
HELX_P HELX_P7  AA7 ASP A 102 ? MET A 120 ? ASP B 510 MET B 528 1 ? 19 
HELX_P HELX_P8  AA8 MET A 120 ? GLY A 127 ? MET B 528 GLY B 535 1 ? 8  
HELX_P HELX_P9  AA9 ASN A 145 ? MET A 154 ? ASN B 587 MET B 596 1 ? 10 
HELX_P HELX_P10 AB1 ASP A 168 ? GLY A 181 ? ASP B 610 GLY B 623 1 ? 14 
HELX_P HELX_P11 AB2 VAL A 183 ? ALA A 195 ? VAL B 625 ALA B 637 1 ? 13 
HELX_P HELX_P12 AB3 ILE B 13  ? ARG B 32  ? ILE A 14  ARG A 33  1 ? 20 
HELX_P HELX_P13 AB4 LYS B 42  ? GLY B 56  ? LYS A 43  GLY A 57  1 ? 15 
HELX_P HELX_P14 AB5 SER B 66  ? TYR B 77  ? SER A 67  TYR A 78  1 ? 12 
HELX_P HELX_P15 AB6 GLY B 81  ? MET B 92  ? GLY A 82  MET A 93  1 ? 12 
HELX_P HELX_P16 AB7 ALA B 119 ? TYR B 122 ? ALA A 120 TYR A 123 5 ? 4  
HELX_P HELX_P17 AB8 THR B 128 ? GLU B 133 ? THR A 129 GLU A 134 1 ? 6  
HELX_P HELX_P18 AB9 PRO B 164 ? GLY B 170 ? PRO A 165 GLY A 171 1 ? 7  
HELX_P HELX_P19 AC1 ASN B 186 ? ASN B 200 ? ASN A 187 ASN A 201 1 ? 15 
HELX_P HELX_P20 AC2 SER B 204 ? ILE B 212 ? SER A 205 ILE A 213 1 ? 9  
HELX_P HELX_P21 AC3 LYS B 226 ? GLY B 236 ? LYS A 227 GLY A 237 1 ? 11 
HELX_P HELX_P22 AC4 ASN B 268 ? ASP B 282 ? ASN A 269 ASP A 283 1 ? 15 
HELX_P HELX_P23 AC5 ASN B 312 ? THR B 324 ? ASN A 313 THR A 325 1 ? 13 
HELX_P HELX_P24 AC6 ASN B 346 ? HIS B 389 ? ASN A 347 HIS A 390 1 ? 44 
HELX_P HELX_P25 AC7 HIS B 389 ? SER B 400 ? HIS A 390 SER A 401 1 ? 12 
HELX_P HELX_P26 AC8 THR B 402 ? LYS B 415 ? THR A 403 LYS A 416 1 ? 14 
HELX_P HELX_P27 AC9 SER B 417 ? MET B 427 ? SER A 418 MET A 428 1 ? 11 
HELX_P HELX_P28 AD1 ARG B 428 ? LEU B 432 ? ARG A 429 LEU A 433 5 ? 5  
HELX_P HELX_P29 AD2 THR B 433 ? ASP B 460 ? THR A 434 ASP A 461 1 ? 28 
HELX_P HELX_P30 AD3 ASP B 460 ? GLY B 480 ? ASP A 461 GLY A 481 1 ? 21 
HELX_P HELX_P31 AD4 SER C 17  ? CYS C 21  ? SER D 425 CYS D 429 5 ? 5  
HELX_P HELX_P32 AD5 GLY C 28  ? ARG C 39  ? GLY D 436 ARG D 447 1 ? 12 
HELX_P HELX_P33 AD6 ASP C 62  ? ASN C 67  ? ASP D 470 ASN D 475 1 ? 6  
HELX_P HELX_P34 AD7 ASN C 68  ? GLY C 78  ? ASN D 476 GLY D 486 1 ? 11 
HELX_P HELX_P35 AD8 ILE C 81  ? PHE C 85  ? ILE D 489 PHE D 493 5 ? 5  
HELX_P HELX_P36 AD9 ASP C 102 ? MET C 120 ? ASP D 510 MET D 528 1 ? 19 
HELX_P HELX_P37 AE1 MET C 120 ? GLY C 127 ? MET D 528 GLY D 535 1 ? 8  
HELX_P HELX_P38 AE2 ASN C 145 ? MET C 154 ? ASN D 587 MET D 596 1 ? 10 
HELX_P HELX_P39 AE3 ASP C 168 ? GLY C 181 ? ASP D 610 GLY D 623 1 ? 14 
HELX_P HELX_P40 AE4 VAL C 183 ? ALA C 195 ? VAL D 625 ALA D 637 1 ? 13 
HELX_P HELX_P41 AE5 ILE D 13  ? ARG D 32  ? ILE C 14  ARG C 33  1 ? 20 
HELX_P HELX_P42 AE6 LYS D 42  ? GLY D 56  ? LYS C 43  GLY C 57  1 ? 15 
HELX_P HELX_P43 AE7 SER D 66  ? TYR D 77  ? SER C 67  TYR C 78  1 ? 12 
HELX_P HELX_P44 AE8 GLY D 81  ? ALA D 93  ? GLY C 82  ALA C 94  1 ? 13 
HELX_P HELX_P45 AE9 ALA D 119 ? PTR D 122 ? ALA C 120 PTR C 123 5 ? 4  
HELX_P HELX_P46 AF1 THR D 128 ? ARG D 136 ? THR C 129 ARG C 137 1 ? 9  
HELX_P HELX_P47 AF2 PRO D 164 ? GLY D 170 ? PRO C 165 GLY C 171 1 ? 7  
HELX_P HELX_P48 AF3 ASN D 186 ? LYS D 199 ? ASN C 187 LYS C 200 1 ? 14 
HELX_P HELX_P49 AF4 SER D 204 ? MET D 209 ? SER C 205 MET C 210 1 ? 6  
HELX_P HELX_P50 AF5 LYS D 226 ? GLY D 236 ? LYS C 227 GLY C 237 1 ? 11 
HELX_P HELX_P51 AF6 ASN D 268 ? ASP D 282 ? ASN C 269 ASP C 283 1 ? 15 
HELX_P HELX_P52 AF7 ASN D 312 ? THR D 324 ? ASN C 313 THR C 325 1 ? 13 
HELX_P HELX_P53 AF8 ASN D 346 ? HIS D 389 ? ASN C 347 HIS C 390 1 ? 44 
HELX_P HELX_P54 AF9 HIS D 389 ? SER D 400 ? HIS C 390 SER C 401 1 ? 12 
HELX_P HELX_P55 AG1 THR D 402 ? LYS D 415 ? THR C 403 LYS C 416 1 ? 14 
HELX_P HELX_P56 AG2 SER D 417 ? MET D 427 ? SER C 418 MET C 428 1 ? 11 
HELX_P HELX_P57 AG3 ARG D 428 ? LEU D 432 ? ARG C 429 LEU C 433 5 ? 5  
HELX_P HELX_P58 AG4 THR D 433 ? ALA D 459 ? THR C 434 ALA C 460 1 ? 27 
HELX_P HELX_P59 AG5 ASP D 460 ? GLY D 480 ? ASP C 461 GLY C 481 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A ASP 100 OD2 ? ? ? 1_555 G MN  .   MN    ? ? B ASP 508 B MN  701 1_555 ? ? ? ? ? ? ?            2.193 ? 
metalc2  metalc ?    ? A ASP 102 OD2 ? ? ? 1_555 G MN  .   MN    ? ? B ASP 510 B MN  701 1_555 ? ? ? ? ? ? ?            2.148 ? 
covale1  covale one  ? B TYR 122 OH  A ? ? 1_555 F DG  9   P     A ? A TYR 123 F DG  1   1_555 ? ? ? ? ? ? ?            1.570 ? 
metalc3  metalc ?    ? B TYR 321 O   ? ? ? 1_555 H NA  .   NA    ? ? A TYR 322 A NA  501 1_555 ? ? ? ? ? ? ?            2.467 ? 
metalc4  metalc ?    ? B THR 324 O   ? ? ? 1_555 H NA  .   NA    ? ? A THR 325 A NA  501 1_555 ? ? ? ? ? ? ?            2.157 ? 
metalc5  metalc ?    ? B GLN 327 O   ? ? ? 1_555 H NA  .   NA    ? ? A GLN 328 A NA  501 1_555 ? ? ? ? ? ? ?            2.121 ? 
metalc6  metalc ?    ? C ASP 100 OD2 ? ? ? 1_555 M MN  .   MN    ? ? D ASP 508 D MN  701 1_555 ? ? ? ? ? ? ?            2.171 ? 
metalc7  metalc ?    ? C ASP 102 OD2 ? ? ? 1_555 M MN  .   MN    ? ? D ASP 510 D MN  701 1_555 ? ? ? ? ? ? ?            2.173 ? 
covale2  covale both ? D ARG 121 C   ? ? ? 1_555 D PTR 122 N     ? ? C ARG 122 C PTR 123 1_555 ? ? ? ? ? ? ?            1.330 ? 
covale3  covale both ? D PTR 122 C   ? ? ? 1_555 D THR 123 N     ? ? C PTR 123 C THR 124 1_555 ? ? ? ? ? ? ?            1.330 ? 
covale4  covale none ? D PTR 122 O3P ? ? ? 1_555 E DG  9   "C5'" ? ? C PTR 123 E DG  1   1_555 ? ? ? ? ? ? ?            1.409 ? 
metalc8  metalc ?    ? G MN  .   MN  ? ? ? 1_555 U HOH .   O     ? ? B MN  701 B HOH 804 1_555 ? ? ? ? ? ? ?            2.151 ? 
metalc9  metalc ?    ? G MN  .   MN  ? ? ? 1_555 U HOH .   O     ? ? B MN  701 B HOH 807 1_555 ? ? ? ? ? ? ?            2.149 ? 
metalc10 metalc ?    ? G MN  .   MN  ? ? ? 1_555 U HOH .   O     ? ? B MN  701 B HOH 802 1_555 ? ? ? ? ? ? ?            2.153 ? 
metalc11 metalc ?    ? G MN  .   MN  ? ? ? 1_555 U HOH .   O     ? ? B MN  701 B HOH 805 1_555 ? ? ? ? ? ? ?            2.074 ? 
metalc12 metalc ?    ? H NA  .   NA  ? ? ? 1_555 V HOH .   O     ? ? A NA  501 A HOH 614 1_555 ? ? ? ? ? ? ?            2.259 ? 
metalc13 metalc ?    ? H NA  .   NA  ? ? ? 1_555 V HOH .   O     ? ? A NA  501 A HOH 626 1_555 ? ? ? ? ? ? ?            2.082 ? 
metalc14 metalc ?    ? M MN  .   MN  ? ? ? 1_555 W HOH .   O     ? ? D MN  701 D HOH 803 1_555 ? ? ? ? ? ? ?            2.098 ? 
metalc15 metalc ?    ? M MN  .   MN  ? ? ? 1_555 W HOH .   O     ? ? D MN  701 D HOH 801 1_555 ? ? ? ? ? ? ?            2.204 ? 
metalc16 metalc ?    ? M MN  .   MN  ? ? ? 1_555 W HOH .   O     ? ? D MN  701 D HOH 802 1_555 ? ? ? ? ? ? ?            2.120 ? 
metalc17 metalc ?    ? M MN  .   MN  ? ? ? 1_555 Z HOH .   O     ? ? D MN  701 F HOH 104 1_555 ? ? ? ? ? ? ?            2.183 ? 
hydrog1  hydrog ?    ? E DA  2   N1  ? ? ? 1_555 F DT  19  N3    ? ? E DA  -7  F DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? E DA  2   N6  ? ? ? 1_555 F DT  19  O4    ? ? E DA  -7  F DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? E DG  3   N1  ? ? ? 1_555 F DC  18  N3    ? ? E DG  -6  F DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? E DG  3   N2  ? ? ? 1_555 F DC  18  O2    ? ? E DG  -6  F DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? E DG  3   O6  ? ? ? 1_555 F DC  18  N4    ? ? E DG  -6  F DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? E DA  4   N1  ? ? ? 1_555 F DT  17  N3    ? ? E DA  -5  F DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? E DA  4   N6  ? ? ? 1_555 F DT  17  O4    ? ? E DA  -5  F DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? E DG  5   N1  ? ? ? 1_555 F DC  16  N3    ? ? E DG  -4  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? E DG  5   N2  ? ? ? 1_555 F DC  16  O2    ? ? E DG  -4  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? E DG  5   O6  ? ? ? 1_555 F DC  16  N4    ? ? E DG  -4  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? E DT  6   N3  ? ? ? 1_555 F DA  15  N1    ? ? E DT  -3  F DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? E DT  6   O4  ? ? ? 1_555 F DA  15  N6    ? ? E DT  -3  F DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? E DA  7   N1  ? ? ? 1_555 F DT  14  N3    ? ? E DA  -2  F DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? E DA  7   N6  ? ? ? 1_555 F DT  14  O4    ? ? E DA  -2  F DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? E DT  8   N3  ? ? ? 1_555 F DA  13  N1    ? ? E DT  -1  F DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? E DT  8   O4  ? ? ? 1_555 F DA  13  N6    ? ? E DT  -1  F DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? E DG  9   N1  ? ? ? 1_555 F DC  12  N3    ? ? E DG  1   F DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? E DG  9   N2  ? ? ? 1_555 F DC  12  O2    ? ? E DG  1   F DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? E DG  9   O6  ? ? ? 1_555 F DC  12  N4    ? ? E DG  1   F DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? E DG  10  N1  ? ? ? 1_555 F DC  11  N3    ? ? E DG  2   F DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? E DG  10  N2  ? ? ? 1_555 F DC  11  O2    ? ? E DG  2   F DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? E DG  10  O6  ? ? ? 1_555 F DC  11  N4    ? ? E DG  2   F DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? E DC  11  O2  A ? ? 1_555 F DG  10  N2    ? ? E DC  3   F DG  2   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog24 hydrog ?    ? E DC  11  O2  B ? ? 1_555 F DG  10  N2    ? ? E DC  3   F DG  2   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog25 hydrog ?    ? E DC  12  N3  A ? ? 1_555 F DG  9   N1    A ? E DC  4   F DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? E DC  12  N3  B ? ? 1_555 F DG  9   N1    B ? E DC  4   F DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? E DC  12  N4  A ? ? 1_555 F DG  9   O6    A ? E DC  4   F DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? E DC  12  N4  B ? ? 1_555 F DG  9   O6    B ? E DC  4   F DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? E DC  12  O2  A ? ? 1_555 F DG  9   N2    A ? E DC  4   F DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? E DC  12  O2  B ? ? 1_555 F DG  9   N2    B ? E DC  4   F DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? E DA  13  N1  B ? ? 1_555 F DT  8   N3    B ? E DA  5   F DT  -1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? E DA  13  N6  B ? ? 1_555 F DT  8   O4    B ? E DA  5   F DT  -1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? E DT  14  N3  ? ? ? 1_555 F DA  7   N1    ? ? E DT  6   F DA  -2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? E DT  14  O4  ? ? ? 1_555 F DA  7   N6    ? ? E DT  6   F DA  -2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? E DA  15  N1  ? ? ? 1_555 F DT  6   N3    ? ? E DA  7   F DT  -3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? E DA  15  N6  ? ? ? 1_555 F DT  6   O4    ? ? E DA  7   F DT  -3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? E DC  16  N3  ? ? ? 1_555 F DG  5   N1    ? ? E DC  8   F DG  -4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? E DC  16  N4  ? ? ? 1_555 F DG  5   O6    ? ? E DC  8   F DG  -4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? E DC  16  O2  ? ? ? 1_555 F DG  5   N2    ? ? E DC  8   F DG  -4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? E DT  17  N3  ? ? ? 1_555 F DA  4   N1    ? ? E DT  9   F DA  -5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? E DT  17  O4  ? ? ? 1_555 F DA  4   N6    ? ? E DT  9   F DA  -5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? E DC  18  N3  ? ? ? 1_555 F DG  3   N1    ? ? E DC  10  F DG  -6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? E DC  18  N4  ? ? ? 1_555 F DG  3   O6    ? ? E DC  10  F DG  -6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? E DC  18  O2  ? ? ? 1_555 F DG  3   N2    ? ? E DC  10  F DG  -6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? E DT  19  N3  ? ? ? 1_555 F DA  2   N1    ? ? E DT  11  F DA  -7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? E DT  19  O4  ? ? ? 1_555 F DA  2   N6    ? ? E DT  11  F DA  -7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 6 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? parallel      
AA8 3 4 ? parallel      
AA8 4 5 ? anti-parallel 
AA8 5 6 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A 44  ? LEU A 49  ? GLN B 452 LEU B 457 
AA1 2 GLU A 22  ? GLU A 27  ? GLU B 430 GLU B 435 
AA1 3 LYS A 94  ? MET A 98  ? LYS B 502 MET B 506 
AA1 4 VAL A 129 ? ILE A 131 ? VAL B 537 ILE B 539 
AA1 5 LEU A 162 ? LYS A 165 ? LEU B 604 LYS B 607 
AA1 6 GLU B 10  ? ASN B 12  ? GLU A 11  ASN A 13  
AA2 1 LYS B 64  ? LYS B 65  ? LYS A 65  LYS A 66  
AA2 2 GLU B 124 ? MET B 127 ? GLU A 125 MET A 128 
AA2 3 VAL B 103 ? GLN B 106 ? VAL A 104 GLN A 107 
AA3 1 PHE B 145 ? ASP B 147 ? PHE A 146 ASP A 148 
AA3 2 ARG B 154 ? PRO B 156 ? ARG A 155 PRO A 157 
AA4 1 ALA B 171 ? ILE B 174 ? ALA A 172 ILE A 175 
AA4 2 ALA B 179 ? ILE B 182 ? ALA A 180 ILE A 183 
AA5 1 GLN B 327 ? ASN B 333 ? GLN A 328 ASN A 334 
AA5 2 ARG B 237 ? ARG B 243 ? ARG A 238 ARG A 244 
AA5 3 LEU B 222 ? LEU B 224 ? LEU A 223 LEU A 225 
AA5 4 GLU B 486 ? GLN B 488 ? GLU A 487 GLN A 489 
AA6 1 ARG B 245 ? GLY B 252 ? ARG A 246 GLY A 253 
AA6 2 ARG B 255 ? GLU B 262 ? ARG A 256 GLU A 263 
AA6 3 VAL B 303 ? VAL B 307 ? VAL A 304 VAL A 308 
AA6 4 ILE B 288 ? ASP B 293 ? ILE A 289 ASP A 294 
AA7 1 ILE B 335 ? VAL B 338 ? ILE A 336 VAL A 339 
AA7 2 ARG B 341 ? LEU B 344 ? ARG A 342 LEU A 345 
AA8 1 GLN C 44  ? LEU C 49  ? GLN D 452 LEU D 457 
AA8 2 GLU C 22  ? GLU C 27  ? GLU D 430 GLU D 435 
AA8 3 ILE C 95  ? MET C 98  ? ILE D 503 MET D 506 
AA8 4 VAL C 129 ? ILE C 131 ? VAL D 537 ILE D 539 
AA8 5 LEU C 162 ? LYS C 165 ? LEU D 604 LYS D 607 
AA8 6 GLU D 10  ? ASN D 12  ? GLU C 11  ASN C 13  
AA9 1 LYS D 64  ? LYS D 65  ? LYS C 65  LYS C 66  
AA9 2 GLU D 124 ? MET D 127 ? GLU C 125 MET C 128 
AA9 3 VAL D 103 ? GLN D 106 ? VAL C 104 GLN C 107 
AB1 1 PHE D 145 ? ASP D 147 ? PHE C 146 ASP C 148 
AB1 2 ARG D 154 ? PRO D 156 ? ARG C 155 PRO C 157 
AB2 1 ALA D 171 ? ILE D 174 ? ALA C 172 ILE C 175 
AB2 2 ALA D 179 ? ILE D 182 ? ALA C 180 ILE C 183 
AB3 1 GLN D 327 ? ASN D 333 ? GLN C 328 ASN C 334 
AB3 2 ARG D 237 ? ARG D 243 ? ARG C 238 ARG C 244 
AB3 3 LEU D 222 ? LEU D 224 ? LEU C 223 LEU C 225 
AB3 4 GLU D 486 ? GLN D 488 ? GLU C 487 GLN C 489 
AB4 1 ARG D 245 ? GLU D 250 ? ARG C 246 GLU C 251 
AB4 2 GLN D 256 ? GLU D 262 ? GLN C 257 GLU C 263 
AB4 3 VAL D 303 ? VAL D 307 ? VAL C 304 VAL C 308 
AB4 4 ILE D 288 ? ASP D 293 ? ILE C 289 ASP C 294 
AB5 1 ILE D 335 ? VAL D 338 ? ILE C 336 VAL C 339 
AB5 2 ARG D 341 ? LEU D 344 ? ARG C 342 LEU C 345 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LEU A 47  ? O LEU B 455 N PHE A 24  ? N PHE B 432 
AA1 2 3 N LEU A 25  ? N LEU B 433 O MET A 98  ? O MET B 506 
AA1 3 4 N ILE A 95  ? N ILE B 503 O TYR A 130 ? O TYR B 538 
AA1 4 5 N ILE A 131 ? N ILE B 539 O LEU A 162 ? O LEU B 604 
AA1 5 6 N GLN A 163 ? N GLN B 605 O ARG B 11  ? O ARG A 12  
AA2 1 2 N LYS B 64  ? N LYS A 65  O ALA B 125 ? O ALA A 126 
AA2 2 3 O ARG B 126 ? O ARG A 127 N ASP B 104 ? N ASP A 105 
AA3 1 2 N ILE B 146 ? N ILE A 147 O GLU B 155 ? O GLU A 156 
AA4 1 2 N ALA B 171 ? N ALA A 172 O ILE B 182 ? O ILE A 183 
AA5 1 2 O PHE B 330 ? O PHE A 331 N ILE B 240 ? N ILE A 241 
AA5 2 3 O ARG B 243 ? O ARG A 244 N LEU B 222 ? N LEU A 223 
AA5 3 4 N ILE B 223 ? N ILE A 224 O GLU B 486 ? O GLU A 487 
AA6 1 2 N VAL B 247 ? N VAL A 248 O VAL B 259 ? O VAL A 260 
AA6 2 3 N VAL B 260 ? N VAL A 261 O VAL B 303 ? O VAL A 304 
AA6 3 4 O ASP B 306 ? O ASP A 307 N THR B 289 ? N THR A 290 
AA7 1 2 N VAL B 338 ? N VAL A 339 O ARG B 341 ? O ARG A 342 
AA8 1 2 O LEU C 47  ? O LEU D 455 N PHE C 24  ? N PHE D 432 
AA8 2 3 N LEU C 25  ? N LEU D 433 O VAL C 96  ? O VAL D 504 
AA8 3 4 N ILE C 95  ? N ILE D 503 O TYR C 130 ? O TYR D 538 
AA8 4 5 N VAL C 129 ? N VAL D 537 O VAL C 164 ? O VAL D 606 
AA8 5 6 N GLN C 163 ? N GLN D 605 O ARG D 11  ? O ARG C 12  
AA9 1 2 N LYS D 64  ? N LYS C 65  O ALA D 125 ? O ALA C 126 
AA9 2 3 O GLU D 124 ? O GLU C 125 N GLN D 106 ? N GLN C 107 
AB1 1 2 N ILE D 146 ? N ILE C 147 O GLU D 155 ? O GLU C 156 
AB2 1 2 N ALA D 171 ? N ALA C 172 O ILE D 182 ? O ILE C 183 
AB3 1 2 O VAL D 332 ? O VAL C 333 N GLY D 238 ? N GLY C 239 
AB3 2 3 O ARG D 243 ? O ARG C 244 N LEU D 222 ? N LEU C 223 
AB3 3 4 N ILE D 223 ? N ILE C 224 O GLU D 486 ? O GLU C 487 
AB4 1 2 N VAL D 247 ? N VAL C 248 O VAL D 259 ? O VAL C 260 
AB4 2 3 N VAL D 260 ? N VAL C 261 O VAL D 303 ? O VAL C 304 
AB4 3 4 O ASP D 306 ? O ASP C 307 N THR D 289 ? N THR C 290 
AB5 1 2 N VAL D 338 ? N VAL C 339 O ARG D 341 ? O ARG C 342 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MN  701 ? 6 'binding site for residue MN B 701'  
AC2 Software A NA  501 ? 5 'binding site for residue NA A 501'  
AC3 Software A GOL 502 ? 3 'binding site for residue GOL A 502' 
AC4 Software A GOL 503 ? 2 'binding site for residue GOL A 503' 
AC5 Software A GOL 504 ? 3 'binding site for residue GOL A 504' 
AC6 Software A GOL 505 ? 3 'binding site for residue GOL A 505' 
AC7 Software D MN  701 ? 6 'binding site for residue MN D 701'  
AC8 Software C SO4 501 ? 3 'binding site for residue SO4 C 501' 
AC9 Software C GOL 502 ? 4 'binding site for residue GOL C 502' 
AD1 Software C GOL 503 ? 5 'binding site for residue GOL C 503' 
AD2 Software C GOL 504 ? 3 'binding site for residue GOL C 504' 
AD3 Software E GOL 101 ? 3 'binding site for residue GOL E 101' 
AD4 Software E E3E 102 ? 7 'binding site for residue E3E E 102' 
AD5 Software E E3E 103 ? 6 'binding site for residue E3E E 103' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 100 ? ASP B 508 . ? 1_555 ? 
2  AC1 6 ASP A 102 ? ASP B 510 . ? 1_555 ? 
3  AC1 6 HOH U .   ? HOH B 802 . ? 1_555 ? 
4  AC1 6 HOH U .   ? HOH B 804 . ? 1_555 ? 
5  AC1 6 HOH U .   ? HOH B 805 . ? 1_555 ? 
6  AC1 6 HOH U .   ? HOH B 807 . ? 1_555 ? 
7  AC2 5 TYR B 321 ? TYR A 322 . ? 1_555 ? 
8  AC2 5 THR B 324 ? THR A 325 . ? 1_555 ? 
9  AC2 5 GLN B 327 ? GLN A 328 . ? 1_555 ? 
10 AC2 5 HOH V .   ? HOH A 614 . ? 1_555 ? 
11 AC2 5 HOH V .   ? HOH A 626 . ? 1_555 ? 
12 AC3 3 SER B 111 ? SER A 112 . ? 1_555 ? 
13 AC3 3 MET B 112 ? MET A 113 . ? 1_555 ? 
14 AC3 3 GLN B 266 ? GLN A 267 . ? 1_555 ? 
15 AC4 2 ASP B 137 ? ASP A 138 . ? 1_555 ? 
16 AC4 2 ASN B 139 ? ASN A 140 . ? 1_555 ? 
17 AC5 3 GLY B 254 ? GLY A 255 . ? 1_555 ? 
18 AC5 3 GLN B 256 ? GLN A 257 . ? 1_555 ? 
19 AC5 3 ASN D 318 ? ASN C 319 . ? 5_554 ? 
20 AC6 3 ARG B 237 ? ARG A 238 . ? 1_555 ? 
21 AC6 3 ILE B 335 ? ILE A 336 . ? 1_555 ? 
22 AC6 3 ARG A 188 ? ARG B 630 . ? 1_555 ? 
23 AC7 6 ASP C 100 ? ASP D 508 . ? 1_555 ? 
24 AC7 6 ASP C 102 ? ASP D 510 . ? 1_555 ? 
25 AC7 6 HOH W .   ? HOH D 801 . ? 1_555 ? 
26 AC7 6 HOH W .   ? HOH D 802 . ? 1_555 ? 
27 AC7 6 HOH W .   ? HOH D 803 . ? 1_555 ? 
28 AC7 6 HOH Z .   ? HOH F 104 . ? 1_555 ? 
29 AC8 3 ARG B 428 ? ARG A 429 . ? 1_555 ? 
30 AC8 3 ARG D 428 ? ARG C 429 . ? 1_555 ? 
31 AC8 3 ARG D 431 ? ARG C 432 . ? 1_555 ? 
32 AC9 4 ARG D 46  ? ARG C 47  . ? 1_555 ? 
33 AC9 4 ARG D 47  ? ARG C 48  . ? 1_555 ? 
34 AC9 4 GLU D 155 ? GLU C 156 . ? 1_555 ? 
35 AC9 4 PRO D 156 ? PRO C 157 . ? 1_555 ? 
36 AD1 5 SER B 314 ? SER A 315 . ? 6_555 ? 
37 AD1 5 LEU B 317 ? LEU A 318 . ? 6_555 ? 
38 AD1 5 ASN B 318 ? ASN A 319 . ? 6_555 ? 
39 AD1 5 GLU D 250 ? GLU C 251 . ? 1_555 ? 
40 AD1 5 GLN D 256 ? GLN C 257 . ? 1_555 ? 
41 AD2 3 THR D 289 ? THR C 290 . ? 1_555 ? 
42 AD2 3 ARG D 308 ? ARG C 309 . ? 1_555 ? 
43 AD2 3 LYS D 309 ? LYS C 310 . ? 1_555 ? 
44 AD3 3 DA  E 4   ? DA  E -5  . ? 1_555 ? 
45 AD3 3 DG  E 5   ? DG  E -4  . ? 1_555 ? 
46 AD3 3 DG  E 3   ? DG  E -6  . ? 1_555 ? 
47 AD4 7 SER B 83  ? SER A 84  . ? 1_555 ? 
48 AD4 7 ARG A 50  ? ARG B 458 . ? 1_555 ? 
49 AD4 7 ARG D 121 ? ARG C 122 . ? 1_555 ? 
50 AD4 7 DT  E 8   ? DT  E -1  . ? 1_555 ? 
51 AD4 7 DG  E 9   ? DG  E 1   . ? 1_555 ? 
52 AD4 7 DC  F 12  ? DC  F 4   . ? 1_555 ? 
53 AD4 7 DA  F 13  ? DA  F 5   . ? 1_555 ? 
54 AD5 6 SER D 83  ? SER C 84  . ? 1_555 ? 
55 AD5 6 ARG C 50  ? ARG D 458 . ? 1_555 ? 
56 AD5 6 DC  E 12  ? DC  E 4   . ? 1_555 ? 
57 AD5 6 DA  E 13  ? DA  E 5   . ? 1_555 ? 
58 AD5 6 DT  F 8   ? DT  F -1  . ? 1_555 ? 
59 AD5 6 DG  F 9   ? DG  F 1   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6FQS 
_atom_sites.fract_transf_matrix[1][1]   0.010635 
_atom_sites.fract_transf_matrix[1][2]   0.006140 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012281 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002378 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
MN 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A 1  9   ? 4.605   58.958  56.047 1.00 138.15 ? 417 LYS B N     1 
ATOM   2     C  CA    . LYS A 1  9   ? 4.433   57.596  56.532 1.00 146.31 ? 417 LYS B CA    1 
ATOM   3     C  C     . LYS A 1  9   ? 4.693   57.519  58.037 1.00 175.96 ? 417 LYS B C     1 
ATOM   4     O  O     . LYS A 1  9   ? 4.444   56.487  58.658 1.00 194.48 ? 417 LYS B O     1 
ATOM   5     C  CB    . LYS A 1  9   ? 5.350   56.645  55.767 1.00 131.10 ? 417 LYS B CB    1 
ATOM   6     N  N     . LEU A 1  10  ? 5.194   58.614  58.613 1.00 186.39 ? 418 LEU B N     1 
ATOM   7     C  CA    . LEU A 1  10  ? 5.380   58.686  60.059 1.00 191.96 ? 418 LEU B CA    1 
ATOM   8     C  C     . LEU A 1  10  ? 4.046   58.578  60.779 1.00 198.00 ? 418 LEU B C     1 
ATOM   9     O  O     . LEU A 1  10  ? 3.050   59.189  60.384 1.00 207.48 ? 418 LEU B O     1 
ATOM   10    C  CB    . LEU A 1  10  ? 6.064   59.997  60.449 1.00 186.70 ? 418 LEU B CB    1 
ATOM   11    C  CG    . LEU A 1  10  ? 6.063   60.345  61.943 1.00 182.74 ? 418 LEU B CG    1 
ATOM   12    C  CD1   . LEU A 1  10  ? 7.039   59.472  62.724 1.00 180.99 ? 418 LEU B CD1   1 
ATOM   13    C  CD2   . LEU A 1  10  ? 6.368   61.814  62.139 1.00 181.06 ? 418 LEU B CD2   1 
ATOM   14    N  N     . ALA A 1  11  ? 4.036   57.799  61.853 1.00 194.64 ? 419 ALA B N     1 
ATOM   15    C  CA    . ALA A 1  11  ? 2.874   57.646  62.713 1.00 192.33 ? 419 ALA B CA    1 
ATOM   16    C  C     . ALA A 1  11  ? 3.257   58.190  64.075 1.00 195.55 ? 419 ALA B C     1 
ATOM   17    O  O     . ALA A 1  11  ? 4.324   57.850  64.574 1.00 212.94 ? 419 ALA B O     1 
ATOM   18    C  CB    . ALA A 1  11  ? 2.471   56.172  62.817 1.00 192.24 ? 419 ALA B CB    1 
ATOM   19    N  N     . ASP A 1  12  ? 2.430   59.042  64.679 1.00 189.46 ? 420 ASP B N     1 
ATOM   20    C  CA    . ASP A 1  12  ? 2.816   59.623  65.961 1.00 186.34 ? 420 ASP B CA    1 
ATOM   21    C  C     . ASP A 1  12  ? 1.757   59.429  67.039 1.00 190.43 ? 420 ASP B C     1 
ATOM   22    O  O     . ASP A 1  12  ? 0.553   59.439  66.775 1.00 196.95 ? 420 ASP B O     1 
ATOM   23    C  CB    . ASP A 1  12  ? 3.147   61.114  65.834 1.00 180.24 ? 420 ASP B CB    1 
ATOM   24    C  CG    . ASP A 1  12  ? 4.338   61.509  66.683 1.00 170.53 ? 420 ASP B CG    1 
ATOM   25    O  OD1   . ASP A 1  12  ? 5.329   60.754  66.686 1.00 173.55 ? 420 ASP B OD1   1 
ATOM   26    O  OD2   . ASP A 1  12  ? 4.280   62.554  67.364 1.00 163.68 ? 420 ASP B OD2   1 
ATOM   27    N  N     . CYS A 1  13  ? 2.254   59.284  68.270 1.00 195.67 ? 421 CYS B N     1 
ATOM   28    C  CA    . CYS A 1  13  ? 1.464   59.041  69.471 1.00 193.10 ? 421 CYS B CA    1 
ATOM   29    C  C     . CYS A 1  13  ? 0.619   60.255  69.868 1.00 199.04 ? 421 CYS B C     1 
ATOM   30    O  O     . CYS A 1  13  ? 0.930   61.405  69.548 1.00 203.18 ? 421 CYS B O     1 
ATOM   31    C  CB    . CYS A 1  13  ? 2.398   58.671  70.625 1.00 182.84 ? 421 CYS B CB    1 
ATOM   32    S  SG    . CYS A 1  13  ? 4.003   59.489  70.516 1.00 170.88 ? 421 CYS B SG    1 
ATOM   33    N  N     . SER A 1  14  ? -0.447  59.964  70.632 1.00 195.87 ? 422 SER B N     1 
ATOM   34    C  CA    . SER A 1  14  ? -1.347  60.991  71.158 1.00 193.68 ? 422 SER B CA    1 
ATOM   35    C  C     . SER A 1  14  ? -0.641  61.943  72.114 1.00 212.91 ? 422 SER B C     1 
ATOM   36    O  O     . SER A 1  14  ? -1.030  63.112  72.234 1.00 225.35 ? 422 SER B O     1 
ATOM   37    C  CB    . SER A 1  14  ? -2.524  60.327  71.882 1.00 172.67 ? 422 SER B CB    1 
ATOM   38    O  OG    . SER A 1  14  ? -2.723  58.998  71.428 1.00 151.31 ? 422 SER B OG    1 
ATOM   39    N  N     . SER A 1  15  ? 0.367   61.450  72.824 1.00 224.67 ? 423 SER B N     1 
ATOM   40    C  CA    . SER A 1  15  ? 1.099   62.212  73.823 1.00 212.89 ? 423 SER B CA    1 
ATOM   41    C  C     . SER A 1  15  ? 2.115   63.134  73.161 1.00 212.86 ? 423 SER B C     1 
ATOM   42    O  O     . SER A 1  15  ? 2.729   62.780  72.153 1.00 218.83 ? 423 SER B O     1 
ATOM   43    C  CB    . SER A 1  15  ? 1.784   61.230  74.780 1.00 197.70 ? 423 SER B CB    1 
ATOM   44    O  OG    . SER A 1  15  ? 2.846   61.805  75.516 1.00 190.49 ? 423 SER B OG    1 
ATOM   45    N  N     . LYS A 1  16  ? 2.263   64.341  73.710 1.00 203.83 ? 424 LYS B N     1 
ATOM   46    C  CA    . LYS A 1  16  ? 3.310   65.261  73.292 1.00 185.79 ? 424 LYS B CA    1 
ATOM   47    C  C     . LYS A 1  16  ? 4.465   65.297  74.277 1.00 188.02 ? 424 LYS B C     1 
ATOM   48    O  O     . LYS A 1  16  ? 5.419   66.049  74.065 1.00 186.81 ? 424 LYS B O     1 
ATOM   49    C  CB    . LYS A 1  16  ? 2.742   66.670  73.087 1.00 178.86 ? 424 LYS B CB    1 
ATOM   50    N  N     . SER A 1  17  ? 4.411   64.474  75.334 1.00 186.57 ? 425 SER B N     1 
ATOM   51    C  CA    . SER A 1  17  ? 5.425   64.359  76.373 1.00 185.48 ? 425 SER B CA    1 
ATOM   52    C  C     . SER A 1  17  ? 6.553   63.411  75.966 1.00 182.46 ? 425 SER B C     1 
ATOM   53    O  O     . SER A 1  17  ? 6.433   62.179  76.089 1.00 182.93 ? 425 SER B O     1 
ATOM   54    C  CB    . SER A 1  17  ? 4.775   63.909  77.679 1.00 189.88 ? 425 SER B CB    1 
ATOM   55    O  OG    . SER A 1  17  ? 5.732   63.794  78.711 1.00 196.04 ? 425 SER B OG    1 
ATOM   56    N  N     . PRO A 1  18  ? 7.689   63.981  75.552 1.00 184.65 ? 426 PRO B N     1 
ATOM   57    C  CA    . PRO A 1  18  ? 8.822   63.189  75.024 1.00 187.37 ? 426 PRO B CA    1 
ATOM   58    C  C     . PRO A 1  18  ? 9.405   62.164  75.984 1.00 194.84 ? 426 PRO B C     1 
ATOM   59    O  O     . PRO A 1  18  ? 10.248  61.359  75.562 1.00 203.46 ? 426 PRO B O     1 
ATOM   60    C  CB    . PRO A 1  18  ? 9.864   64.271  74.706 1.00 175.87 ? 426 PRO B CB    1 
ATOM   61    C  CG    . PRO A 1  18  ? 9.061   65.552  74.572 1.00 177.23 ? 426 PRO B CG    1 
ATOM   62    C  CD    . PRO A 1  18  ? 7.974   65.420  75.581 1.00 177.85 ? 426 PRO B CD    1 
ATOM   63    N  N     . GLU A 1  19  ? 8.999   62.193  77.252 1.00 191.32 ? 427 GLU B N     1 
ATOM   64    C  CA    . GLU A 1  19  ? 9.540   61.336  78.300 1.00 184.66 ? 427 GLU B CA    1 
ATOM   65    C  C     . GLU A 1  19  ? 8.987   59.923  78.230 1.00 179.65 ? 427 GLU B C     1 
ATOM   66    O  O     . GLU A 1  19  ? 9.688   58.967  78.587 1.00 176.00 ? 427 GLU B O     1 
ATOM   67    C  CB    . GLU A 1  19  ? 9.222   61.955  79.664 1.00 190.87 ? 427 GLU B CB    1 
ATOM   68    C  CG    . GLU A 1  19  ? 7.748   61.816  80.081 1.00 192.76 ? 427 GLU B CG    1 
ATOM   69    C  CD    . GLU A 1  19  ? 7.351   62.712  81.242 1.00 190.68 ? 427 GLU B CD    1 
ATOM   70    O  OE1   . GLU A 1  19  ? 8.236   63.125  82.020 1.00 188.59 ? 427 GLU B OE1   1 
ATOM   71    O  OE2   . GLU A 1  19  ? 6.142   63.004  81.370 1.00 186.48 ? 427 GLU B OE2   1 
ATOM   72    N  N     . GLU A 1  20  ? 7.741   59.781  77.794 1.00 180.80 ? 428 GLU B N     1 
ATOM   73    C  CA    . GLU A 1  20  ? 7.049   58.508  77.708 1.00 185.44 ? 428 GLU B CA    1 
ATOM   74    C  C     . GLU A 1  20  ? 6.864   58.058  76.269 1.00 183.55 ? 428 GLU B C     1 
ATOM   75    O  O     . GLU A 1  20  ? 6.231   57.029  76.034 1.00 185.94 ? 428 GLU B O     1 
ATOM   76    C  CB    . GLU A 1  20  ? 5.686   58.600  78.418 1.00 192.21 ? 428 GLU B CB    1 
ATOM   77    C  CG    . GLU A 1  20  ? 4.757   59.661  77.811 1.00 197.68 ? 428 GLU B CG    1 
ATOM   78    C  CD    . GLU A 1  20  ? 3.436   59.854  78.556 1.00 203.81 ? 428 GLU B CD    1 
ATOM   79    O  OE1   . GLU A 1  20  ? 3.377   59.642  79.786 1.00 201.75 ? 428 GLU B OE1   1 
ATOM   80    O  OE2   . GLU A 1  20  ? 2.448   60.237  77.893 1.00 207.76 ? 428 GLU B OE2   1 
ATOM   81    N  N     . CYS A 1  21  ? 7.428   58.774  75.298 1.00 180.43 ? 429 CYS B N     1 
ATOM   82    C  CA    . CYS A 1  21  ? 7.241   58.463  73.889 1.00 178.82 ? 429 CYS B CA    1 
ATOM   83    C  C     . CYS A 1  21  ? 8.458   57.749  73.312 1.00 181.69 ? 429 CYS B C     1 
ATOM   84    O  O     . CYS A 1  21  ? 9.599   58.023  73.692 1.00 174.61 ? 429 CYS B O     1 
ATOM   85    C  CB    . CYS A 1  21  ? 6.932   59.731  73.098 1.00 177.60 ? 429 CYS B CB    1 
ATOM   86    S  SG    . CYS A 1  21  ? 5.285   60.378  73.472 1.00 174.31 ? 429 CYS B SG    1 
ATOM   87    N  N     . GLU A 1  22  ? 8.189   56.816  72.394 1.00 183.17 ? 430 GLU B N     1 
ATOM   88    C  CA    . GLU A 1  22  ? 9.178   55.964  71.753 1.00 169.15 ? 430 GLU B CA    1 
ATOM   89    C  C     . GLU A 1  22  ? 8.919   55.974  70.252 1.00 158.40 ? 430 GLU B C     1 
ATOM   90    O  O     . GLU A 1  22  ? 7.761   55.927  69.826 1.00 156.39 ? 430 GLU B O     1 
ATOM   91    C  CB    . GLU A 1  22  ? 9.078   54.511  72.279 1.00 169.51 ? 430 GLU B CB    1 
ATOM   92    C  CG    . GLU A 1  22  ? 8.674   54.368  73.739 1.00 172.25 ? 430 GLU B CG    1 
ATOM   93    C  CD    . GLU A 1  22  ? 8.433   52.922  74.135 1.00 175.14 ? 430 GLU B CD    1 
ATOM   94    O  OE1   . GLU A 1  22  ? 8.836   52.535  75.253 1.00 183.58 ? 430 GLU B OE1   1 
ATOM   95    O  OE2   . GLU A 1  22  ? 7.844   52.170  73.331 1.00 173.21 ? 430 GLU B OE2   1 
ATOM   96    N  N     . ILE A 1  23  ? 9.982   56.025  69.438 1.00 146.62 ? 431 ILE B N     1 
ATOM   97    C  CA    . ILE A 1  23  ? 9.847   55.929  67.983 1.00 128.67 ? 431 ILE B CA    1 
ATOM   98    C  C     . ILE A 1  23  ? 10.596  54.703  67.482 1.00 132.17 ? 431 ILE B C     1 
ATOM   99    O  O     . ILE A 1  23  ? 11.759  54.477  67.842 1.00 122.52 ? 431 ILE B O     1 
ATOM   100   C  CB    . ILE A 1  23  ? 10.326  57.195  67.236 1.00 115.84 ? 431 ILE B CB    1 
ATOM   101   C  CG1   . ILE A 1  23  ? 10.100  57.011  65.726 1.00 113.98 ? 431 ILE B CG1   1 
ATOM   102   C  CG2   . ILE A 1  23  ? 11.791  57.515  67.547 1.00 110.72 ? 431 ILE B CG2   1 
ATOM   103   C  CD1   . ILE A 1  23  ? 10.058  58.300  64.889 1.00 111.76 ? 431 ILE B CD1   1 
ATOM   104   N  N     . PHE A 1  24  ? 9.928   53.932  66.628 1.00 133.99 ? 432 PHE B N     1 
ATOM   105   C  CA    . PHE A 1  24  ? 10.473  52.701  66.097 1.00 135.35 ? 432 PHE B CA    1 
ATOM   106   C  C     . PHE A 1  24  ? 10.935  52.898  64.667 1.00 130.88 ? 432 PHE B C     1 
ATOM   107   O  O     . PHE A 1  24  ? 10.184  53.400  63.823 1.00 137.52 ? 432 PHE B O     1 
ATOM   108   C  CB    . PHE A 1  24  ? 9.448   51.580  66.146 1.00 145.06 ? 432 PHE B CB    1 
ATOM   109   C  CG    . PHE A 1  24  ? 9.205   51.061  67.499 1.00 153.28 ? 432 PHE B CG    1 
ATOM   110   C  CD1   . PHE A 1  24  ? 10.155  50.277  68.110 1.00 150.55 ? 432 PHE B CD1   1 
ATOM   111   C  CD2   . PHE A 1  24  ? 8.036   51.358  68.168 1.00 159.37 ? 432 PHE B CD2   1 
ATOM   112   C  CE1   . PHE A 1  24  ? 9.948   49.784  69.368 1.00 155.23 ? 432 PHE B CE1   1 
ATOM   113   C  CE2   . PHE A 1  24  ? 7.818   50.866  69.429 1.00 165.75 ? 432 PHE B CE2   1 
ATOM   114   C  CZ    . PHE A 1  24  ? 8.776   50.077  70.031 1.00 158.14 ? 432 PHE B CZ    1 
ATOM   115   N  N     . LEU A 1  25  ? 12.152  52.474  64.400 1.00 129.41 ? 433 LEU B N     1 
ATOM   116   C  CA    . LEU A 1  25  ? 12.710  52.501  63.061 1.00 123.86 ? 433 LEU B CA    1 
ATOM   117   C  C     . LEU A 1  25  ? 12.617  51.090  62.516 1.00 126.42 ? 433 LEU B C     1 
ATOM   118   O  O     . LEU A 1  25  ? 13.272  50.180  63.031 1.00 118.63 ? 433 LEU B O     1 
ATOM   119   C  CB    . LEU A 1  25  ? 14.149  52.992  63.077 1.00 121.43 ? 433 LEU B CB    1 
ATOM   120   C  CG    . LEU A 1  25  ? 14.327  54.396  63.638 1.00 116.96 ? 433 LEU B CG    1 
ATOM   121   C  CD1   . LEU A 1  25  ? 15.712  54.881  63.311 1.00 117.99 ? 433 LEU B CD1   1 
ATOM   122   C  CD2   . LEU A 1  25  ? 13.284  55.319  63.056 1.00 115.06 ? 433 LEU B CD2   1 
ATOM   123   N  N     . VAL A 1  26  ? 11.808  50.905  61.493 1.00 129.25 ? 434 VAL B N     1 
ATOM   124   C  CA    . VAL A 1  26  ? 11.550  49.571  60.978 1.00 131.10 ? 434 VAL B CA    1 
ATOM   125   C  C     . VAL A 1  26  ? 12.088  49.476  59.568 1.00 145.38 ? 434 VAL B C     1 
ATOM   126   O  O     . VAL A 1  26  ? 11.993  50.420  58.778 1.00 162.13 ? 434 VAL B O     1 
ATOM   127   C  CB    . VAL A 1  26  ? 10.053  49.225  61.007 1.00 126.39 ? 434 VAL B CB    1 
ATOM   128   C  CG1   . VAL A 1  26  ? 9.885   47.738  60.988 1.00 139.24 ? 434 VAL B CG1   1 
ATOM   129   C  CG2   . VAL A 1  26  ? 9.425   49.846  62.215 1.00 122.84 ? 434 VAL B CG2   1 
ATOM   130   N  N     . GLU A 1  27  ? 12.617  48.317  59.257 1.00 136.18 ? 435 GLU B N     1 
ATOM   131   C  CA    . GLU A 1  27  ? 13.026  48.006  57.901 1.00 133.49 ? 435 GLU B CA    1 
ATOM   132   C  C     . GLU A 1  27  ? 11.830  47.356  57.210 1.00 123.95 ? 435 GLU B C     1 
ATOM   133   O  O     . GLU A 1  27  ? 11.408  46.248  57.576 1.00 126.45 ? 435 GLU B O     1 
ATOM   134   C  CB    . GLU A 1  27  ? 14.282  47.138  57.908 1.00 126.30 ? 435 GLU B CB    1 
ATOM   135   C  CG    . GLU A 1  27  ? 14.167  45.915  57.074 1.00 115.50 ? 435 GLU B CG    1 
ATOM   136   C  CD    . GLU A 1  27  ? 15.472  45.237  56.902 1.00 123.31 ? 435 GLU B CD    1 
ATOM   137   O  OE1   . GLU A 1  27  ? 16.185  45.067  57.903 1.00 118.32 ? 435 GLU B OE1   1 
ATOM   138   O  OE2   . GLU A 1  27  ? 15.798  44.898  55.759 1.00 133.39 ? 435 GLU B OE2   1 
ATOM   139   N  N     A GLY A 1  28  ? 11.256  48.074  56.251 0.50 112.65 ? 436 GLY B N     1 
ATOM   140   N  N     B GLY A 1  28  ? 11.282  48.062  56.205 0.50 112.61 ? 436 GLY B N     1 
ATOM   141   C  CA    A GLY A 1  28  ? 10.085  47.547  55.581 0.50 106.16 ? 436 GLY B CA    1 
ATOM   142   C  CA    B GLY A 1  28  ? 10.158  47.635  55.415 0.50 106.45 ? 436 GLY B CA    1 
ATOM   143   C  C     A GLY A 1  28  ? 8.892   48.387  55.963 0.50 91.33  ? 436 GLY B C     1 
ATOM   144   C  C     B GLY A 1  28  ? 8.903   48.466  55.473 0.50 92.32  ? 436 GLY B C     1 
ATOM   145   O  O     A GLY A 1  28  ? 8.472   48.393  57.128 0.50 98.66  ? 436 GLY B O     1 
ATOM   146   O  O     B GLY A 1  28  ? 8.603   49.100  56.535 0.50 94.40  ? 436 GLY B O     1 
ATOM   147   N  N     A ASP A 1  29  ? 8.367   49.153  55.009 0.50 86.56  ? 437 ASP B N     1 
ATOM   148   N  N     B ASP A 1  29  ? 8.124   48.586  54.436 0.50 85.70  ? 437 ASP B N     1 
ATOM   149   C  CA    A ASP A 1  29  ? 7.252   50.029  55.353 0.50 84.34  ? 437 ASP B CA    1 
ATOM   150   C  CA    B ASP A 1  29  ? 6.875   49.347  54.613 0.50 90.37  ? 437 ASP B CA    1 
ATOM   151   C  C     A ASP A 1  29  ? 6.081   49.238  55.891 0.50 90.61  ? 437 ASP B C     1 
ATOM   152   C  C     B ASP A 1  29  ? 5.702   48.413  54.819 0.50 96.43  ? 437 ASP B C     1 
ATOM   153   O  O     A ASP A 1  29  ? 5.461   49.631  56.881 0.50 94.54  ? 437 ASP B O     1 
ATOM   154   O  O     B ASP A 1  29  ? 5.497   47.535  53.978 0.50 91.08  ? 437 ASP B O     1 
ATOM   155   C  CB    A ASP A 1  29  ? 6.801   50.869  54.163 0.50 92.83  ? 437 ASP B CB    1 
ATOM   156   C  CB    B ASP A 1  29  ? 6.448   50.256  53.509 0.50 90.75  ? 437 ASP B CB    1 
ATOM   157   C  CG    A ASP A 1  29  ? 7.847   50.978  53.111 0.50 96.22  ? 437 ASP B CG    1 
ATOM   158   C  CG    B ASP A 1  29  ? 7.253   51.375  53.332 0.50 96.55  ? 437 ASP B CG    1 
ATOM   159   O  OD1   A ASP A 1  29  ? 8.986   50.528  53.373 0.50 105.51 ? 437 ASP B OD1   1 
ATOM   160   O  OD1   B ASP A 1  29  ? 7.968   51.670  54.291 0.50 101.66 ? 437 ASP B OD1   1 
ATOM   161   O  OD2   A ASP A 1  29  ? 7.529   51.518  52.030 0.50 107.84 ? 437 ASP B OD2   1 
ATOM   162   O  OD2   B ASP A 1  29  ? 7.105   51.947  52.246 0.50 106.14 ? 437 ASP B OD2   1 
ATOM   163   N  N     A SER A 1  30  ? 5.744   48.138  55.258 0.50 94.68  ? 438 SER B N     1 
ATOM   164   N  N     B SER A 1  30  ? 4.938   48.665  55.874 0.50 96.79  ? 438 SER B N     1 
ATOM   165   C  CA    A SER A 1  30  ? 4.605   47.417  55.791 0.50 105.66 ? 438 SER B CA    1 
ATOM   166   C  CA    B SER A 1  30  ? 3.773   47.924  56.200 0.50 113.31 ? 438 SER B CA    1 
ATOM   167   C  C     A SER A 1  30  ? 5.027   46.326  56.752 0.50 106.32 ? 438 SER B C     1 
ATOM   168   C  C     B SER A 1  30  ? 4.286   46.809  57.041 0.50 123.09 ? 438 SER B C     1 
ATOM   169   O  O     A SER A 1  30  ? 4.164   45.649  57.321 0.50 126.86 ? 438 SER B O     1 
ATOM   170   O  O     B SER A 1  30  ? 3.526   46.091  57.615 0.50 123.86 ? 438 SER B O     1 
ATOM   171   C  CB    A SER A 1  30  ? 3.713   46.909  54.690 0.50 108.16 ? 438 SER B CB    1 
ATOM   172   C  CB    B SER A 1  30  ? 3.006   47.496  54.989 0.50 103.12 ? 438 SER B CB    1 
ATOM   173   O  OG    A SER A 1  30  ? 2.400   47.392  54.907 0.50 97.76  ? 438 SER B OG    1 
ATOM   174   O  OG    B SER A 1  30  ? 2.536   48.625  54.309 0.50 84.63  ? 438 SER B OG    1 
ATOM   175   N  N     A ALA A 1  31  ? 6.327   46.169  56.972 0.50 123.20 ? 439 ALA B N     1 
ATOM   176   N  N     B ALA A 1  31  ? 5.621   46.759  57.217 0.50 123.20 ? 439 ALA B N     1 
ATOM   177   C  CA    A ALA A 1  31  ? 6.789   45.540  58.203 0.50 128.29 ? 439 ALA B CA    1 
ATOM   178   C  CA    B ALA A 1  31  ? 6.278   45.838  58.131 0.50 128.29 ? 439 ALA B CA    1 
ATOM   179   C  C     A ALA A 1  31  ? 6.368   46.362  59.437 0.50 132.29 ? 439 ALA B C     1 
ATOM   180   C  C     B ALA A 1  31  ? 6.369   46.425  59.495 0.50 132.29 ? 439 ALA B C     1 
ATOM   181   O  O     A ALA A 1  31  ? 5.783   45.817  60.384 0.50 139.85 ? 439 ALA B O     1 
ATOM   182   O  O     B ALA A 1  31  ? 6.110   45.775  60.533 0.50 139.85 ? 439 ALA B O     1 
ATOM   183   C  CB    A ALA A 1  31  ? 8.297   45.342  58.161 0.50 124.99 ? 439 ALA B CB    1 
ATOM   184   C  CB    B ALA A 1  31  ? 7.671   45.493  57.599 0.50 123.27 ? 439 ALA B CB    1 
ATOM   185   N  N     . GLY A 1  32  ? 6.668   47.693  59.457 1.00 145.47 ? 440 GLY B N     1 
ATOM   186   C  CA    . GLY A 1  32  ? 6.114   48.657  60.362 1.00 140.64 ? 440 GLY B CA    1 
ATOM   187   C  C     . GLY A 1  32  ? 4.689   49.037  60.064 1.00 139.84 ? 440 GLY B C     1 
ATOM   188   O  O     . GLY A 1  32  ? 4.019   49.589  60.926 1.00 148.31 ? 440 GLY B O     1 
ATOM   189   N  N     . GLY A 1  33  ? 4.175   48.788  58.880 1.00 128.17 ? 441 GLY B N     1 
ATOM   190   C  CA    . GLY A 1  33  ? 2.785   49.132  58.645 1.00 128.90 ? 441 GLY B CA    1 
ATOM   191   C  C     . GLY A 1  33  ? 1.849   48.218  59.400 1.00 133.29 ? 441 GLY B C     1 
ATOM   192   O  O     . GLY A 1  33  ? 0.812   48.671  59.879 1.00 128.73 ? 441 GLY B O     1 
ATOM   193   N  N     . SER A 1  34  ? 2.234   46.944  59.580 1.00 138.66 ? 442 SER B N     1 
ATOM   194   C  CA    . SER A 1  34  ? 1.514   46.031  60.471 1.00 141.05 ? 442 SER B CA    1 
ATOM   195   C  C     . SER A 1  34  ? 1.443   46.637  61.866 1.00 137.41 ? 442 SER B C     1 
ATOM   196   O  O     . SER A 1  34  ? 0.360   47.004  62.340 1.00 133.61 ? 442 SER B O     1 
ATOM   197   C  CB    . SER A 1  34  ? 2.199   44.654  60.524 1.00 142.11 ? 442 SER B CB    1 
ATOM   198   O  OG    . SER A 1  34  ? 3.534   44.730  60.050 1.00 139.69 ? 442 SER B OG    1 
ATOM   199   N  N     . THR A 1  35  ? 2.610   46.767  62.496 1.00 137.61 ? 443 THR B N     1 
ATOM   200   C  CA    . THR A 1  35  ? 2.794   47.289  63.847 1.00 146.38 ? 443 THR B CA    1 
ATOM   201   C  C     . THR A 1  35  ? 1.766   48.330  64.259 1.00 152.62 ? 443 THR B C     1 
ATOM   202   O  O     . THR A 1  35  ? 1.308   48.332  65.405 1.00 160.62 ? 443 THR B O     1 
ATOM   203   C  CB    . THR A 1  35  ? 4.178   47.924  63.976 1.00 139.73 ? 443 THR B CB    1 
ATOM   204   O  OG1   . THR A 1  35  ? 4.162   49.225  63.375 1.00 135.96 ? 443 THR B OG1   1 
ATOM   205   C  CG2   . THR A 1  35  ? 5.215   47.055  63.314 1.00 137.97 ? 443 THR B CG2   1 
ATOM   206   N  N     . LYS A 1  36  ? 1.426   49.236  63.338 1.00 137.90 ? 444 LYS B N     1 
ATOM   207   C  CA    . LYS A 1  36  ? 0.540   50.345  63.678 1.00 116.82 ? 444 LYS B CA    1 
ATOM   208   C  C     . LYS A 1  36  ? -0.794  49.848  64.216 1.00 109.13 ? 444 LYS B C     1 
ATOM   209   O  O     . LYS A 1  36  ? -1.296  50.357  65.224 1.00 121.77 ? 444 LYS B O     1 
ATOM   210   C  CB    . LYS A 1  36  ? 0.330   51.246  62.458 1.00 123.83 ? 444 LYS B CB    1 
ATOM   211   N  N     . SER A 1  37  ? -1.398  48.865  63.549 1.00 191.62 ? 445 SER B N     1 
ATOM   212   C  CA    . SER A 1  37  ? -2.609  48.264  64.093 1.00 175.23 ? 445 SER B CA    1 
ATOM   213   C  C     . SER A 1  37  ? -2.336  47.662  65.465 1.00 169.96 ? 445 SER B C     1 
ATOM   214   O  O     . SER A 1  37  ? -3.173  47.750  66.373 1.00 171.25 ? 445 SER B O     1 
ATOM   215   C  CB    . SER A 1  37  ? -3.150  47.203  63.138 1.00 170.42 ? 445 SER B CB    1 
ATOM   216   O  OG    . SER A 1  37  ? -2.142  46.272  62.818 1.00 169.37 ? 445 SER B OG    1 
ATOM   217   N  N     . GLY A 1  38  ? -1.140  47.103  65.651 1.00 167.04 ? 446 GLY B N     1 
ATOM   218   C  CA    . GLY A 1  38  ? -0.757  46.435  66.879 1.00 168.21 ? 446 GLY B CA    1 
ATOM   219   C  C     . GLY A 1  38  ? -0.171  47.336  67.947 1.00 161.87 ? 446 GLY B C     1 
ATOM   220   O  O     . GLY A 1  38  ? -0.449  47.138  69.136 1.00 165.32 ? 446 GLY B O     1 
ATOM   221   N  N     . ARG A 1  39  ? 0.647   48.308  67.537 1.00 153.04 ? 447 ARG B N     1 
ATOM   222   C  CA    . ARG A 1  39  ? 1.357   49.185  68.463 1.00 155.93 ? 447 ARG B CA    1 
ATOM   223   C  C     . ARG A 1  39  ? 0.387   49.981  69.332 1.00 163.92 ? 447 ARG B C     1 
ATOM   224   O  O     . ARG A 1  39  ? -0.700  50.379  68.900 1.00 163.70 ? 447 ARG B O     1 
ATOM   225   C  CB    . ARG A 1  39  ? 2.243   50.169  67.694 1.00 151.81 ? 447 ARG B CB    1 
ATOM   226   C  CG    . ARG A 1  39  ? 1.380   51.296  67.152 1.00 146.51 ? 447 ARG B CG    1 
ATOM   227   C  CD    . ARG A 1  39  ? 2.028   52.117  66.105 1.00 143.07 ? 447 ARG B CD    1 
ATOM   228   N  NE    . ARG A 1  39  ? 1.120   53.171  65.661 1.00 144.73 ? 447 ARG B NE    1 
ATOM   229   C  CZ    . ARG A 1  39  ? 1.102   54.389  66.187 1.00 146.30 ? 447 ARG B CZ    1 
ATOM   230   N  NH1   . ARG A 1  39  ? 0.270   55.325  65.764 1.00 141.53 ? 447 ARG B NH1   1 
ATOM   231   N  NH2   . ARG A 1  39  ? 1.933   54.666  67.151 1.00 148.28 ? 447 ARG B NH2   1 
ATOM   232   N  N     . ASP A 1  40  ? 0.804   50.237  70.567 1.00 170.21 ? 448 ASP B N     1 
ATOM   233   C  CA    . ASP A 1  40  ? 0.066   51.172  71.400 1.00 168.73 ? 448 ASP B CA    1 
ATOM   234   C  C     . ASP A 1  40  ? 0.231   52.562  70.802 1.00 160.51 ? 448 ASP B C     1 
ATOM   235   O  O     . ASP A 1  40  ? 1.354   53.084  70.712 1.00 159.03 ? 448 ASP B O     1 
ATOM   236   C  CB    . ASP A 1  40  ? 0.549   51.139  72.843 1.00 168.77 ? 448 ASP B CB    1 
ATOM   237   C  CG    . ASP A 1  40  ? -0.545  51.530  73.833 1.00 167.46 ? 448 ASP B CG    1 
ATOM   238   O  OD1   . ASP A 1  40  ? -1.674  51.869  73.397 1.00 168.76 ? 448 ASP B OD1   1 
ATOM   239   O  OD2   . ASP A 1  40  ? -0.264  51.497  75.052 1.00 166.13 ? 448 ASP B OD2   1 
ATOM   240   N  N     . SER A 1  41  ? -0.865  53.116  70.297 1.00 160.75 ? 449 SER B N     1 
ATOM   241   C  CA    . SER A 1  41  ? -0.816  54.423  69.654 1.00 144.33 ? 449 SER B CA    1 
ATOM   242   C  C     . SER A 1  41  ? -0.728  55.554  70.664 1.00 143.45 ? 449 SER B C     1 
ATOM   243   O  O     . SER A 1  41  ? -0.674  56.732  70.272 1.00 138.71 ? 449 SER B O     1 
ATOM   244   C  CB    . SER A 1  41  ? -2.044  54.616  68.767 1.00 131.46 ? 449 SER B CB    1 
ATOM   245   O  OG    . SER A 1  41  ? -2.100  55.947  68.291 1.00 130.30 ? 449 SER B OG    1 
ATOM   246   N  N     . ARG A 1  42  ? -0.754  55.220  71.952 1.00 141.35 ? 450 ARG B N     1 
ATOM   247   C  CA    . ARG A 1  42  ? -0.691  56.262  72.960 1.00 135.01 ? 450 ARG B CA    1 
ATOM   248   C  C     . ARG A 1  42  ? 0.735   56.758  73.130 1.00 141.59 ? 450 ARG B C     1 
ATOM   249   O  O     . ARG A 1  42  ? 0.972   57.971  73.183 1.00 131.53 ? 450 ARG B O     1 
ATOM   250   C  CB    . ARG A 1  42  ? -1.268  55.741  74.278 1.00 121.01 ? 450 ARG B CB    1 
ATOM   251   N  N     . THR A 1  43  ? 1.698   55.841  73.184 1.00 144.15 ? 451 THR B N     1 
ATOM   252   C  CA    . THR A 1  43  ? 3.088   56.223  73.381 1.00 144.06 ? 451 THR B CA    1 
ATOM   253   C  C     . THR A 1  43  ? 4.021   55.801  72.251 1.00 151.69 ? 451 THR B C     1 
ATOM   254   O  O     . THR A 1  43  ? 5.233   55.932  72.421 1.00 155.03 ? 451 THR B O     1 
ATOM   255   C  CB    . THR A 1  43  ? 3.610   55.665  74.714 1.00 138.46 ? 451 THR B CB    1 
ATOM   256   O  OG1   . THR A 1  43  ? 2.996   54.397  74.980 1.00 136.29 ? 451 THR B OG1   1 
ATOM   257   C  CG2   . THR A 1  43  ? 3.298   56.627  75.833 1.00 135.84 ? 451 THR B CG2   1 
ATOM   258   N  N     . GLN A 1  44  ? 3.540   55.323  71.105 1.00 148.93 ? 452 GLN B N     1 
ATOM   259   C  CA    . GLN A 1  44  ? 4.483   54.764  70.139 1.00 142.43 ? 452 GLN B CA    1 
ATOM   260   C  C     . GLN A 1  44  ? 4.330   55.330  68.736 1.00 132.99 ? 452 GLN B C     1 
ATOM   261   O  O     . GLN A 1  44  ? 3.238   55.314  68.190 1.00 139.90 ? 452 GLN B O     1 
ATOM   262   C  CB    . GLN A 1  44  ? 4.359   53.239  70.104 1.00 144.95 ? 452 GLN B CB    1 
ATOM   263   C  CG    . GLN A 1  44  ? 4.934   52.608  71.348 1.00 145.76 ? 452 GLN B CG    1 
ATOM   264   C  CD    . GLN A 1  44  ? 4.604   51.141  71.440 1.00 153.16 ? 452 GLN B CD    1 
ATOM   265   O  OE1   . GLN A 1  44  ? 3.537   50.706  70.996 1.00 153.58 ? 452 GLN B OE1   1 
ATOM   266   N  NE2   . GLN A 1  44  ? 5.523   50.360  72.003 1.00 158.14 ? 452 GLN B NE2   1 
ATOM   267   N  N     . ALA A 1  45  ? 5.438   55.762  68.134 1.00 124.47 ? 453 ALA B N     1 
ATOM   268   C  CA    . ALA A 1  45  ? 5.495   56.234  66.758 1.00 125.23 ? 453 ALA B CA    1 
ATOM   269   C  C     . ALA A 1  45  ? 6.235   55.237  65.867 1.00 120.51 ? 453 ALA B C     1 
ATOM   270   O  O     . ALA A 1  45  ? 7.056   54.463  66.353 1.00 121.75 ? 453 ALA B O     1 
ATOM   271   C  CB    . ALA A 1  45  ? 6.199   57.593  66.702 1.00 131.80 ? 453 ALA B CB    1 
ATOM   272   N  N     . ILE A 1  46  ? 5.992   55.286  64.546 1.00 117.92 ? 454 ILE B N     1 
ATOM   273   C  CA    . ILE A 1  46  ? 6.642   54.360  63.610 1.00 108.45 ? 454 ILE B CA    1 
ATOM   274   C  C     . ILE A 1  46  ? 7.235   55.107  62.410 1.00 104.15 ? 454 ILE B C     1 
ATOM   275   O  O     . ILE A 1  46  ? 6.504   55.784  61.673 1.00 107.39 ? 454 ILE B O     1 
ATOM   276   C  CB    . ILE A 1  46  ? 5.677   53.266  63.116 1.00 107.65 ? 454 ILE B CB    1 
ATOM   277   C  CG1   . ILE A 1  46  ? 5.161   52.452  64.307 1.00 117.10 ? 454 ILE B CG1   1 
ATOM   278   C  CG2   . ILE A 1  46  ? 6.412   52.347  62.144 1.00 113.50 ? 454 ILE B CG2   1 
ATOM   279   C  CD1   . ILE A 1  46  ? 6.260   51.812  65.118 1.00 127.97 ? 454 ILE B CD1   1 
ATOM   280   N  N     . LEU A 1  47  ? 8.546   54.909  62.162 1.00 101.29 ? 455 LEU B N     1 
ATOM   281   C  CA    . LEU A 1  47  ? 9.247   55.463  61.000 1.00 100.41 ? 455 LEU B CA    1 
ATOM   282   C  C     . LEU A 1  47  ? 9.809   54.348  60.130 1.00 99.27  ? 455 LEU B C     1 
ATOM   283   O  O     . LEU A 1  47  ? 10.921  53.849  60.376 1.00 103.06 ? 455 LEU B O     1 
ATOM   284   C  CB    . LEU A 1  47  ? 10.356  56.441  61.414 1.00 101.04 ? 455 LEU B CB    1 
ATOM   285   C  CG    . LEU A 1  47  ? 11.079  57.155  60.254 1.00 109.20 ? 455 LEU B CG    1 
ATOM   286   C  CD1   . LEU A 1  47  ? 10.170  57.950  59.270 1.00 113.96 ? 455 LEU B CD1   1 
ATOM   287   C  CD2   . LEU A 1  47  ? 12.152  58.078  60.807 1.00 104.48 ? 455 LEU B CD2   1 
ATOM   288   N  N     . PRO A 1  48  ? 9.094   53.968  59.075 1.00 98.80  ? 456 PRO B N     1 
ATOM   289   C  CA    . PRO A 1  48  ? 9.567   52.924  58.171 1.00 103.94 ? 456 PRO B CA    1 
ATOM   290   C  C     . PRO A 1  48  ? 10.682  53.433  57.287 1.00 101.86 ? 456 PRO B C     1 
ATOM   291   O  O     . PRO A 1  48  ? 10.648  54.552  56.772 1.00 96.72  ? 456 PRO B O     1 
ATOM   292   C  CB    . PRO A 1  48  ? 8.318   52.610  57.351 1.00 112.76 ? 456 PRO B CB    1 
ATOM   293   C  CG    . PRO A 1  48  ? 7.721   53.985  57.190 1.00 108.44 ? 456 PRO B CG    1 
ATOM   294   C  CD    . PRO A 1  48  ? 7.881   54.611  58.567 1.00 100.85 ? 456 PRO B CD    1 
ATOM   295   N  N     . LEU A 1  49  ? 11.659  52.571  57.080 1.00 113.54 ? 457 LEU B N     1 
ATOM   296   C  CA    . LEU A 1  49  ? 12.771  52.846  56.186 1.00 112.66 ? 457 LEU B CA    1 
ATOM   297   C  C     . LEU A 1  49  ? 12.538  52.144  54.864 1.00 112.81 ? 457 LEU B C     1 
ATOM   298   O  O     . LEU A 1  49  ? 12.291  50.934  54.839 1.00 121.06 ? 457 LEU B O     1 
ATOM   299   C  CB    . LEU A 1  49  ? 14.081  52.366  56.790 1.00 107.13 ? 457 LEU B CB    1 
ATOM   300   C  CG    . LEU A 1  49  ? 14.469  53.163  58.017 1.00 110.88 ? 457 LEU B CG    1 
ATOM   301   C  CD1   . LEU A 1  49  ? 15.821  52.687  58.463 1.00 114.66 ? 457 LEU B CD1   1 
ATOM   302   C  CD2   . LEU A 1  49  ? 14.484  54.635  57.647 1.00 107.27 ? 457 LEU B CD2   1 
ATOM   303   N  N     . ARG A 1  50  ? 12.670  52.879  53.767 1.00 102.11 ? 458 ARG B N     1 
ATOM   304   C  CA    . ARG A 1  50  ? 12.360  52.281  52.472 1.00 110.05 ? 458 ARG B CA    1 
ATOM   305   C  C     . ARG A 1  50  ? 13.426  51.279  52.042 1.00 113.41 ? 458 ARG B C     1 
ATOM   306   O  O     . ARG A 1  50  ? 13.097  50.156  51.629 1.00 119.97 ? 458 ARG B O     1 
ATOM   307   C  CB    . ARG A 1  50  ? 12.156  53.378  51.435 1.00 107.79 ? 458 ARG B CB    1 
ATOM   308   C  CG    . ARG A 1  50  ? 11.071  54.330  51.860 1.00 110.84 ? 458 ARG B CG    1 
ATOM   309   C  CD    . ARG A 1  50  ? 9.712   53.810  51.436 1.00 117.98 ? 458 ARG B CD    1 
ATOM   310   N  NE    . ARG A 1  50  ? 9.594   53.774  49.979 1.00 114.73 ? 458 ARG B NE    1 
ATOM   311   N  N     . GLY A 1  51  ? 14.686  51.642  52.105 1.00 91.22  ? 459 GLY B N     1 
ATOM   312   C  CA    . GLY A 1  51  ? 15.737  50.754  51.647 1.00 77.70  ? 459 GLY B CA    1 
ATOM   313   C  C     . GLY A 1  51  ? 17.006  50.980  52.381 1.00 77.13  ? 459 GLY B C     1 
ATOM   314   O  O     . GLY A 1  51  ? 16.999  51.493  53.509 1.00 94.57  ? 459 GLY B O     1 
ATOM   315   N  N     . LYS A 1  52  ? 18.112  50.593  51.767 1.00 80.30  ? 460 LYS B N     1 
ATOM   316   C  CA    . LYS A 1  52  ? 19.413  50.877  52.357 1.00 80.45  ? 460 LYS B CA    1 
ATOM   317   C  C     . LYS A 1  52  ? 19.577  52.380  52.554 1.00 86.14  ? 460 LYS B C     1 
ATOM   318   O  O     . LYS A 1  52  ? 19.249  53.182  51.672 1.00 94.12  ? 460 LYS B O     1 
ATOM   319   C  CB    . LYS A 1  52  ? 20.540  50.333  51.485 1.00 74.16  ? 460 LYS B CB    1 
ATOM   320   C  CG    . LYS A 1  52  ? 20.504  48.843  51.294 1.00 81.83  ? 460 LYS B CG    1 
ATOM   321   C  CD    . LYS A 1  52  ? 20.721  48.126  52.617 1.00 89.04  ? 460 LYS B CD    1 
ATOM   322   C  CE    . LYS A 1  52  ? 20.904  46.628  52.401 1.00 73.24  ? 460 LYS B CE    1 
ATOM   323   N  NZ    . LYS A 1  52  ? 22.087  46.360  51.529 1.00 70.03  ? 460 LYS B NZ    1 
ATOM   324   N  N     . ILE A 1  53  ? 20.090  52.756  53.717 1.00 77.93  ? 461 ILE B N     1 
ATOM   325   C  CA    . ILE A 1  53  ? 20.157  54.153  54.127 1.00 81.67  ? 461 ILE B CA    1 
ATOM   326   C  C     . ILE A 1  53  ? 21.478  54.732  53.674 1.00 86.43  ? 461 ILE B C     1 
ATOM   327   O  O     . ILE A 1  53  ? 22.522  54.124  53.909 1.00 100.12 ? 461 ILE B O     1 
ATOM   328   C  CB    . ILE A 1  53  ? 20.015  54.274  55.644 1.00 87.41  ? 461 ILE B CB    1 
ATOM   329   C  CG1   . ILE A 1  53  ? 18.613  53.836  56.041 1.00 87.46  ? 461 ILE B CG1   1 
ATOM   330   C  CG2   . ILE A 1  53  ? 20.328  55.685  56.077 1.00 90.63  ? 461 ILE B CG2   1 
ATOM   331   C  CD1   . ILE A 1  53  ? 17.573  54.422  55.114 1.00 93.59  ? 461 ILE B CD1   1 
ATOM   332   N  N     . LEU A 1  54  ? 21.451  55.931  53.089 1.00 77.19  ? 462 LEU B N     1 
ATOM   333   C  CA    . LEU A 1  54  ? 22.693  56.628  52.749 1.00 72.58  ? 462 LEU B CA    1 
ATOM   334   C  C     . LEU A 1  54  ? 23.755  56.396  53.826 1.00 73.82  ? 462 LEU B C     1 
ATOM   335   O  O     . LEU A 1  54  ? 23.474  56.501  55.024 1.00 84.98  ? 462 LEU B O     1 
ATOM   336   C  CB    . LEU A 1  54  ? 22.430  58.125  52.584 1.00 70.12  ? 462 LEU B CB    1 
ATOM   337   C  CG    . LEU A 1  54  ? 23.642  58.922  52.100 1.00 69.02  ? 462 LEU B CG    1 
ATOM   338   C  CD1   . LEU A 1  54  ? 23.942  58.737  50.614 1.00 72.86  ? 462 LEU B CD1   1 
ATOM   339   C  CD2   . LEU A 1  54  ? 23.389  60.364  52.384 1.00 78.55  ? 462 LEU B CD2   1 
ATOM   340   N  N     . ASN A 1  55  ? 24.955  55.984  53.395 1.00 75.60  ? 463 ASN B N     1 
ATOM   341   C  CA    . ASN A 1  55  ? 26.119  55.824  54.282 1.00 77.44  ? 463 ASN B CA    1 
ATOM   342   C  C     . ASN A 1  55  ? 26.754  57.196  54.474 1.00 79.08  ? 463 ASN B C     1 
ATOM   343   O  O     . ASN A 1  55  ? 27.519  57.655  53.629 1.00 79.93  ? 463 ASN B O     1 
ATOM   344   C  CB    . ASN A 1  55  ? 27.132  54.836  53.696 1.00 64.53  ? 463 ASN B CB    1 
ATOM   345   C  CG    . ASN A 1  55  ? 28.435  54.709  54.535 1.00 66.59  ? 463 ASN B CG    1 
ATOM   346   O  OD1   . ASN A 1  55  ? 28.630  55.412  55.528 1.00 75.04  ? 463 ASN B OD1   1 
ATOM   347   N  ND2   . ASN A 1  55  ? 29.320  53.806  54.128 1.00 65.70  ? 463 ASN B ND2   1 
ATOM   348   N  N     . VAL A 1  56  ? 26.477  57.846  55.610 1.00 74.99  ? 464 VAL B N     1 
ATOM   349   C  CA    . VAL A 1  56  ? 26.898  59.239  55.734 1.00 65.65  ? 464 VAL B CA    1 
ATOM   350   C  C     . VAL A 1  56  ? 28.411  59.375  55.860 1.00 67.81  ? 464 VAL B C     1 
ATOM   351   O  O     . VAL A 1  56  ? 28.956  60.444  55.566 1.00 79.80  ? 464 VAL B O     1 
ATOM   352   C  CB    . VAL A 1  56  ? 26.202  59.978  56.897 1.00 65.31  ? 464 VAL B CB    1 
ATOM   353   C  CG1   . VAL A 1  56  ? 24.708  60.022  56.695 1.00 74.37  ? 464 VAL B CG1   1 
ATOM   354   C  CG2   . VAL A 1  56  ? 26.558  59.359  58.225 1.00 67.18  ? 464 VAL B CG2   1 
ATOM   355   N  N     . GLU A 1  57  ? 29.108  58.329  56.289 1.00 69.70  ? 465 GLU B N     1 
ATOM   356   C  CA    . GLU A 1  57  ? 30.562  58.406  56.406 1.00 70.61  ? 465 GLU B CA    1 
ATOM   357   C  C     . GLU A 1  57  ? 31.228  58.629  55.056 1.00 66.44  ? 465 GLU B C     1 
ATOM   358   O  O     . GLU A 1  57  ? 32.343  59.168  54.990 1.00 66.45  ? 465 GLU B O     1 
ATOM   359   C  CB    . GLU A 1  57  ? 31.092  57.128  57.055 1.00 77.30  ? 465 GLU B CB    1 
ATOM   360   C  CG    . GLU A 1  57  ? 32.579  57.123  57.365 1.00 75.69  ? 465 GLU B CG    1 
ATOM   361   C  CD    . GLU A 1  57  ? 32.878  57.746  58.701 1.00 76.86  ? 465 GLU B CD    1 
ATOM   362   O  OE1   . GLU A 1  57  ? 34.069  57.974  58.998 1.00 80.18  ? 465 GLU B OE1   1 
ATOM   363   O  OE2   . GLU A 1  57  ? 31.923  58.013  59.455 1.00 82.62  ? 465 GLU B OE2   1 
ATOM   364   N  N     . LYS A 1  58  ? 30.566  58.218  53.969 1.00 63.12  ? 466 LYS B N     1 
ATOM   365   C  CA    . LYS A 1  58  ? 31.092  58.314  52.609 1.00 62.27  ? 466 LYS B CA    1 
ATOM   366   C  C     . LYS A 1  58  ? 30.532  59.491  51.823 1.00 65.63  ? 466 LYS B C     1 
ATOM   367   O  O     . LYS A 1  58  ? 30.953  59.710  50.686 1.00 83.98  ? 466 LYS B O     1 
ATOM   368   C  CB    . LYS A 1  58  ? 30.778  57.034  51.823 1.00 68.34  ? 466 LYS B CB    1 
ATOM   369   C  CG    . LYS A 1  58  ? 31.639  55.813  52.121 1.00 62.40  ? 466 LYS B CG    1 
ATOM   370   C  CD    . LYS A 1  58  ? 31.218  54.682  51.190 1.00 60.65  ? 466 LYS B CD    1 
ATOM   371   C  CE    . LYS A 1  58  ? 31.895  53.358  51.525 1.00 74.59  ? 466 LYS B CE    1 
ATOM   372   N  NZ    . LYS A 1  58  ? 31.167  52.180  50.964 1.00 67.73  ? 466 LYS B NZ    1 
ATOM   373   N  N     . ALA A 1  59  ? 29.580  60.227  52.375 1.00 63.69  ? 467 ALA B N     1 
ATOM   374   C  CA    . ALA A 1  59  ? 28.857  61.251  51.647 1.00 65.34  ? 467 ALA B CA    1 
ATOM   375   C  C     . ALA A 1  59  ? 29.183  62.629  52.192 1.00 64.44  ? 467 ALA B C     1 
ATOM   376   O  O     . ALA A 1  59  ? 29.383  62.796  53.393 1.00 80.69  ? 467 ALA B O     1 
ATOM   377   C  CB    . ALA A 1  59  ? 27.349  60.990  51.706 1.00 71.35  ? 467 ALA B CB    1 
ATOM   378   N  N     . ARG A 1  60  ? 29.196  63.610  51.297 1.00 62.69  ? 468 ARG B N     1 
ATOM   379   C  CA    . ARG A 1  60  ? 29.370  65.001  51.697 1.00 59.72  ? 468 ARG B CA    1 
ATOM   380   C  C     . ARG A 1  60  ? 28.034  65.605  52.164 1.00 76.31  ? 468 ARG B C     1 
ATOM   381   O  O     . ARG A 1  60  ? 26.949  65.103  51.839 1.00 80.61  ? 468 ARG B O     1 
ATOM   382   C  CB    . ARG A 1  60  ? 29.976  65.801  50.555 1.00 54.61  ? 468 ARG B CB    1 
ATOM   383   C  CG    . ARG A 1  60  ? 31.475  65.507  50.369 1.00 55.21  ? 468 ARG B CG    1 
ATOM   384   C  CD    . ARG A 1  60  ? 32.000  66.141  49.097 1.00 53.93  ? 468 ARG B CD    1 
ATOM   385   N  NE    . ARG A 1  60  ? 33.377  65.810  48.731 1.00 53.13  ? 468 ARG B NE    1 
ATOM   386   C  CZ    . ARG A 1  60  ? 34.493  66.292  49.288 1.00 57.44  ? 468 ARG B CZ    1 
ATOM   387   N  NH1   . ARG A 1  60  ? 35.671  65.910  48.799 1.00 68.40  ? 468 ARG B NH1   1 
ATOM   388   N  NH2   . ARG A 1  60  ? 34.462  67.118  50.331 1.00 69.27  ? 468 ARG B NH2   1 
ATOM   389   N  N     . LEU A 1  61  ? 28.131  66.706  52.929 1.00 78.54  ? 469 LEU B N     1 
ATOM   390   C  CA    . LEU A 1  61  ? 26.957  67.275  53.609 1.00 67.81  ? 469 LEU B CA    1 
ATOM   391   C  C     . LEU A 1  61  ? 25.806  67.628  52.661 1.00 67.30  ? 469 LEU B C     1 
ATOM   392   O  O     . LEU A 1  61  ? 24.634  67.397  52.991 1.00 72.07  ? 469 LEU B O     1 
ATOM   393   C  CB    . LEU A 1  61  ? 27.370  68.513  54.414 1.00 64.22  ? 469 LEU B CB    1 
ATOM   394   C  CG    . LEU A 1  61  ? 26.304  69.003  55.395 1.00 60.63  ? 469 LEU B CG    1 
ATOM   395   C  CD1   . LEU A 1  61  ? 26.355  68.104  56.627 1.00 59.73  ? 469 LEU B CD1   1 
ATOM   396   C  CD2   . LEU A 1  61  ? 26.519  70.481  55.738 1.00 61.74  ? 469 LEU B CD2   1 
ATOM   397   N  N     . ASP A 1  62  ? 26.102  68.229  51.502 1.00 64.89  ? 470 ASP B N     1 
ATOM   398   C  CA    . ASP A 1  62  ? 24.993  68.629  50.635 1.00 65.25  ? 470 ASP B CA    1 
ATOM   399   C  C     . ASP A 1  62  ? 24.156  67.411  50.262 1.00 64.56  ? 470 ASP B C     1 
ATOM   400   O  O     . ASP A 1  62  ? 22.924  67.432  50.372 1.00 63.74  ? 470 ASP B O     1 
ATOM   401   C  CB    . ASP A 1  62  ? 25.475  69.423  49.406 1.00 79.41  ? 470 ASP B CB    1 
ATOM   402   C  CG    . ASP A 1  62  ? 26.086  68.557  48.290 1.00 83.76  ? 470 ASP B CG    1 
ATOM   403   O  OD1   . ASP A 1  62  ? 26.772  67.545  48.586 1.00 96.43  ? 470 ASP B OD1   1 
ATOM   404   O  OD2   . ASP A 1  62  ? 25.911  68.942  47.108 1.00 78.89  ? 470 ASP B OD2   1 
ATOM   405   N  N     . ARG A 1  63  ? 24.823  66.302  49.954 1.00 67.58  ? 471 ARG B N     1 
ATOM   406   C  CA    . ARG A 1  63  ? 24.123  65.063  49.624 1.00 82.12  ? 471 ARG B CA    1 
ATOM   407   C  C     . ARG A 1  63  ? 23.356  64.488  50.818 1.00 73.31  ? 471 ARG B C     1 
ATOM   408   O  O     . ARG A 1  63  ? 22.213  64.028  50.668 1.00 65.07  ? 471 ARG B O     1 
ATOM   409   C  CB    . ARG A 1  63  ? 25.129  64.041  49.069 1.00 82.35  ? 471 ARG B CB    1 
ATOM   410   C  CG    . ARG A 1  63  ? 24.529  62.695  48.670 1.00 74.98  ? 471 ARG B CG    1 
ATOM   411   C  CD    . ARG A 1  63  ? 25.229  62.068  47.467 1.00 91.28  ? 471 ARG B CD    1 
ATOM   412   N  NE    . ARG A 1  63  ? 24.462  60.919  46.994 1.00 88.84  ? 471 ARG B NE    1 
ATOM   413   C  CZ    . ARG A 1  63  ? 24.801  59.652  47.209 1.00 85.03  ? 471 ARG B CZ    1 
ATOM   414   N  NH1   . ARG A 1  63  ? 25.911  59.364  47.875 1.00 90.62  ? 471 ARG B NH1   1 
ATOM   415   N  NH2   . ARG A 1  63  ? 24.037  58.670  46.753 1.00 81.66  ? 471 ARG B NH2   1 
ATOM   416   N  N     . ILE A 1  64  ? 23.959  64.507  52.011 1.00 65.05  ? 472 ILE B N     1 
ATOM   417   C  CA    . ILE A 1  64  ? 23.267  64.030  53.217 1.00 65.51  ? 472 ILE B CA    1 
ATOM   418   C  C     . ILE A 1  64  ? 21.993  64.829  53.447 1.00 75.41  ? 472 ILE B C     1 
ATOM   419   O  O     . ILE A 1  64  ? 20.902  64.268  53.602 1.00 73.79  ? 472 ILE B O     1 
ATOM   420   C  CB    . ILE A 1  64  ? 24.197  64.102  54.446 1.00 63.80  ? 472 ILE B CB    1 
ATOM   421   C  CG1   . ILE A 1  64  ? 25.385  63.159  54.299 1.00 61.70  ? 472 ILE B CG1   1 
ATOM   422   C  CG2   . ILE A 1  64  ? 23.415  63.797  55.743 1.00 63.12  ? 472 ILE B CG2   1 
ATOM   423   C  CD1   . ILE A 1  64  ? 26.410  63.310  55.382 1.00 60.27  ? 472 ILE B CD1   1 
ATOM   424   N  N     . LEU A 1  65  ? 22.119  66.159  53.498 1.00 90.47  ? 473 LEU B N     1 
ATOM   425   C  CA    . LEU A 1  65  ? 20.950  67.007  53.739 1.00 84.92  ? 473 LEU B CA    1 
ATOM   426   C  C     . LEU A 1  65  ? 19.887  66.807  52.676 1.00 88.21  ? 473 LEU B C     1 
ATOM   427   O  O     . LEU A 1  65  ? 18.691  66.764  52.982 1.00 83.78  ? 473 LEU B O     1 
ATOM   428   C  CB    . LEU A 1  65  ? 21.369  68.475  53.786 1.00 73.92  ? 473 LEU B CB    1 
ATOM   429   C  CG    . LEU A 1  65  ? 22.389  68.745  54.873 1.00 73.00  ? 473 LEU B CG    1 
ATOM   430   C  CD1   . LEU A 1  65  ? 22.668  70.216  54.904 1.00 74.95  ? 473 LEU B CD1   1 
ATOM   431   C  CD2   . LEU A 1  65  ? 21.827  68.245  56.189 1.00 71.46  ? 473 LEU B CD2   1 
ATOM   432   N  N     . ASN A 1  66  ? 20.308  66.693  51.418 1.00 90.75  ? 474 ASN B N     1 
ATOM   433   C  CA    . ASN A 1  66  ? 19.366  66.561  50.314 1.00 91.93  ? 474 ASN B CA    1 
ATOM   434   C  C     . ASN A 1  66  ? 18.603  65.249  50.366 1.00 88.01  ? 474 ASN B C     1 
ATOM   435   O  O     . ASN A 1  66  ? 17.451  65.189  49.915 1.00 98.49  ? 474 ASN B O     1 
ATOM   436   C  CB    . ASN A 1  66  ? 20.099  66.687  48.981 1.00 101.71 ? 474 ASN B CB    1 
ATOM   437   C  CG    . ASN A 1  66  ? 20.190  68.109  48.513 1.00 112.57 ? 474 ASN B CG    1 
ATOM   438   O  OD1   . ASN A 1  66  ? 19.695  69.023  49.170 1.00 110.31 ? 474 ASN B OD1   1 
ATOM   439   N  ND2   . ASN A 1  66  ? 20.830  68.312  47.366 1.00 117.27 ? 474 ASN B ND2   1 
ATOM   440   N  N     . ASN A 1  67  ? 19.216  64.196  50.891 1.00 80.57  ? 475 ASN B N     1 
ATOM   441   C  CA    . ASN A 1  67  ? 18.583  62.882  50.909 1.00 79.56  ? 475 ASN B CA    1 
ATOM   442   C  C     . ASN A 1  67  ? 17.263  62.880  51.675 1.00 81.48  ? 475 ASN B C     1 
ATOM   443   O  O     . ASN A 1  67  ? 17.210  63.274  52.842 1.00 80.24  ? 475 ASN B O     1 
ATOM   444   C  CB    . ASN A 1  67  ? 19.536  61.860  51.521 1.00 74.37  ? 475 ASN B CB    1 
ATOM   445   C  CG    . ASN A 1  67  ? 18.852  60.564  51.841 1.00 73.01  ? 475 ASN B CG    1 
ATOM   446   O  OD1   . ASN A 1  67  ? 17.999  60.489  52.734 1.00 77.22  ? 475 ASN B OD1   1 
ATOM   447   N  ND2   . ASN A 1  67  ? 19.230  59.519  51.123 1.00 76.99  ? 475 ASN B ND2   1 
ATOM   448   N  N     . ASN A 1  68  ? 16.215  62.344  51.038 1.00 91.04  ? 476 ASN B N     1 
ATOM   449   C  CA    . ASN A 1  68  ? 14.873  62.335  51.627 1.00 94.86  ? 476 ASN B CA    1 
ATOM   450   C  C     . ASN A 1  68  ? 14.807  61.511  52.897 1.00 91.34  ? 476 ASN B C     1 
ATOM   451   O  O     . ASN A 1  68  ? 14.134  61.894  53.860 1.00 94.22  ? 476 ASN B O     1 
ATOM   452   C  CB    . ASN A 1  68  ? 13.861  61.761  50.639 1.00 99.10  ? 476 ASN B CB    1 
ATOM   453   C  CG    . ASN A 1  68  ? 13.351  62.774  49.696 1.00 108.86 ? 476 ASN B CG    1 
ATOM   454   O  OD1   . ASN A 1  68  ? 13.139  63.932  50.067 1.00 109.87 ? 476 ASN B OD1   1 
ATOM   455   N  ND2   . ASN A 1  68  ? 13.147  62.362  48.449 1.00 103.71 ? 476 ASN B ND2   1 
ATOM   456   N  N     . GLU A 1  69  ? 15.394  60.323  52.874 1.00 92.54  ? 477 GLU B N     1 
ATOM   457   C  CA    . GLU A 1  69  ? 15.281  59.447  54.029 1.00 92.20  ? 477 GLU B CA    1 
ATOM   458   C  C     . GLU A 1  69  ? 15.881  60.101  55.251 1.00 89.75  ? 477 GLU B C     1 
ATOM   459   O  O     . GLU A 1  69  ? 15.290  60.075  56.338 1.00 96.69  ? 477 GLU B O     1 
ATOM   460   C  CB    . GLU A 1  69  ? 15.960  58.104  53.756 1.00 102.09 ? 477 GLU B CB    1 
ATOM   461   C  CG    . GLU A 1  69  ? 15.129  56.976  54.256 1.00 115.03 ? 477 GLU B CG    1 
ATOM   462   C  CD    . GLU A 1  69  ? 13.690  57.128  53.803 1.00 126.16 ? 477 GLU B CD    1 
ATOM   463   O  OE1   . GLU A 1  69  ? 13.479  57.469  52.614 1.00 130.02 ? 477 GLU B OE1   1 
ATOM   464   O  OE2   . GLU A 1  69  ? 12.775  56.928  54.634 1.00 125.47 ? 477 GLU B OE2   1 
ATOM   465   N  N     . ILE A 1  70  ? 17.054  60.705  55.086 1.00 84.71  ? 478 ILE B N     1 
ATOM   466   C  CA    . ILE A 1  70  ? 17.719  61.352  56.207 1.00 85.37  ? 478 ILE B CA    1 
ATOM   467   C  C     . ILE A 1  70  ? 16.881  62.503  56.723 1.00 87.24  ? 478 ILE B C     1 
ATOM   468   O  O     . ILE A 1  70  ? 16.767  62.718  57.934 1.00 84.99  ? 478 ILE B O     1 
ATOM   469   C  CB    . ILE A 1  70  ? 19.118  61.838  55.803 1.00 84.87  ? 478 ILE B CB    1 
ATOM   470   C  CG1   . ILE A 1  70  ? 19.962  60.662  55.320 1.00 79.94  ? 478 ILE B CG1   1 
ATOM   471   C  CG2   . ILE A 1  70  ? 19.764  62.487  56.998 1.00 85.47  ? 478 ILE B CG2   1 
ATOM   472   C  CD1   . ILE A 1  70  ? 20.362  59.754  56.445 1.00 79.08  ? 478 ILE B CD1   1 
ATOM   473   N  N     . ARG A 1  71  ? 16.317  63.288  55.811 1.00 88.72  ? 479 ARG B N     1 
ATOM   474   C  CA    . ARG A 1  71  ? 15.547  64.450  56.230 1.00 88.65  ? 479 ARG B CA    1 
ATOM   475   C  C     . ARG A 1  71  ? 14.386  64.043  57.118 1.00 89.97  ? 479 ARG B C     1 
ATOM   476   O  O     . ARG A 1  71  ? 14.107  64.700  58.125 1.00 89.38  ? 479 ARG B O     1 
ATOM   477   C  CB    . ARG A 1  71  ? 15.049  65.220  55.010 1.00 95.13  ? 479 ARG B CB    1 
ATOM   478   C  CG    . ARG A 1  71  ? 15.872  66.453  54.713 1.00 104.22 ? 479 ARG B CG    1 
ATOM   479   C  CD    . ARG A 1  71  ? 15.532  66.991  53.347 1.00 106.00 ? 479 ARG B CD    1 
ATOM   480   N  NE    . ARG A 1  71  ? 14.182  66.610  52.947 1.00 119.01 ? 479 ARG B NE    1 
ATOM   481   C  CZ    . ARG A 1  71  ? 13.748  66.624  51.691 1.00 127.15 ? 479 ARG B CZ    1 
ATOM   482   N  NH1   . ARG A 1  71  ? 14.566  67.001  50.714 1.00 135.09 ? 479 ARG B NH1   1 
ATOM   483   N  NH2   . ARG A 1  71  ? 12.503  66.260  51.406 1.00 121.03 ? 479 ARG B NH2   1 
ATOM   484   N  N     . GLN A 1  72  ? 13.698  62.959  56.763 1.00 102.69 ? 480 GLN B N     1 
ATOM   485   C  CA    . GLN A 1  72  ? 12.566  62.512  57.569 1.00 104.64 ? 480 GLN B CA    1 
ATOM   486   C  C     . GLN A 1  72  ? 12.992  62.195  58.991 1.00 104.31 ? 480 GLN B C     1 
ATOM   487   O  O     . GLN A 1  72  ? 12.295  62.544  59.951 1.00 104.82 ? 480 GLN B O     1 
ATOM   488   C  CB    . GLN A 1  72  ? 11.911  61.283  56.943 1.00 97.53  ? 480 GLN B CB    1 
ATOM   489   C  CG    . GLN A 1  72  ? 11.135  61.576  55.704 1.00 105.16 ? 480 GLN B CG    1 
ATOM   490   C  CD    . GLN A 1  72  ? 10.249  60.419  55.325 1.00 112.82 ? 480 GLN B CD    1 
ATOM   491   O  OE1   . GLN A 1  72  ? 10.027  59.504  56.126 1.00 117.59 ? 480 GLN B OE1   1 
ATOM   492   N  NE2   . GLN A 1  72  ? 9.738   60.443  54.095 1.00 109.53 ? 480 GLN B NE2   1 
ATOM   493   N  N     . MET A 1  73  ? 14.120  61.504  59.143 1.00 102.66 ? 481 MET B N     1 
ATOM   494   C  CA    . MET A 1  73  ? 14.594  61.143  60.472 1.00 107.53 ? 481 MET B CA    1 
ATOM   495   C  C     . MET A 1  73  ? 14.931  62.379  61.278 1.00 111.54 ? 481 MET B C     1 
ATOM   496   O  O     . MET A 1  73  ? 14.574  62.486  62.456 1.00 117.39 ? 481 MET B O     1 
ATOM   497   C  CB    . MET A 1  73  ? 15.826  60.258  60.366 1.00 106.40 ? 481 MET B CB    1 
ATOM   498   C  CG    . MET A 1  73  ? 15.527  58.824  60.178 1.00 105.59 ? 481 MET B CG    1 
ATOM   499   S  SD    . MET A 1  73  ? 17.042  57.888  60.413 1.00 106.94 ? 481 MET B SD    1 
ATOM   500   C  CE    . MET A 1  73  ? 17.939  58.362  58.936 1.00 102.33 ? 481 MET B CE    1 
ATOM   501   N  N     . ILE A 1  74  ? 15.673  63.300  60.667 1.00 107.51 ? 482 ILE B N     1 
ATOM   502   C  CA    . ILE A 1  74  ? 16.011  64.551  61.336 1.00 99.71  ? 482 ILE B CA    1 
ATOM   503   C  C     . ILE A 1  74  ? 14.746  65.252  61.784 1.00 97.99  ? 482 ILE B C     1 
ATOM   504   O  O     . ILE A 1  74  ? 14.620  65.694  62.931 1.00 104.97 ? 482 ILE B O     1 
ATOM   505   C  CB    . ILE A 1  74  ? 16.818  65.462  60.398 1.00 97.50  ? 482 ILE B CB    1 
ATOM   506   C  CG1   . ILE A 1  74  ? 18.274  65.012  60.332 1.00 89.13  ? 482 ILE B CG1   1 
ATOM   507   C  CG2   . ILE A 1  74  ? 16.701  66.897  60.868 1.00 99.81  ? 482 ILE B CG2   1 
ATOM   508   C  CD1   . ILE A 1  74  ? 18.961  65.516  59.104 1.00 80.79  ? 482 ILE B CD1   1 
ATOM   509   N  N     . THR A 1  75  ? 13.802  65.393  60.859 1.00 101.14 ? 483 THR B N     1 
ATOM   510   C  CA    . THR A 1  75  ? 12.543  66.049  61.175 1.00 102.82 ? 483 THR B CA    1 
ATOM   511   C  C     . THR A 1  75  ? 11.848  65.345  62.318 1.00 109.47 ? 483 THR B C     1 
ATOM   512   O  O     . THR A 1  75  ? 11.340  65.991  63.240 1.00 115.72 ? 483 THR B O     1 
ATOM   513   C  CB    . THR A 1  75  ? 11.632  66.063  59.950 1.00 101.44 ? 483 THR B CB    1 
ATOM   514   O  OG1   . THR A 1  75  ? 12.104  67.043  59.018 1.00 98.18  ? 483 THR B OG1   1 
ATOM   515   C  CG2   . THR A 1  75  ? 10.225  66.415  60.391 1.00 98.58  ? 483 THR B CG2   1 
ATOM   516   N  N     . ALA A 1  76  ? 11.801  64.014  62.269 1.00 108.23 ? 484 ALA B N     1 
ATOM   517   C  CA    . ALA A 1  76  ? 11.072  63.277  63.292 1.00 112.17 ? 484 ALA B CA    1 
ATOM   518   C  C     . ALA A 1  76  ? 11.697  63.484  64.660 1.00 114.08 ? 484 ALA B C     1 
ATOM   519   O  O     . ALA A 1  76  ? 10.988  63.722  65.643 1.00 122.48 ? 484 ALA B O     1 
ATOM   520   C  CB    . ALA A 1  76  ? 11.014  61.793  62.933 1.00 114.89 ? 484 ALA B CB    1 
ATOM   521   N  N     . PHE A 1  77  ? 13.021  63.403  64.750 1.00 106.92 ? 485 PHE B N     1 
ATOM   522   C  CA    . PHE A 1  77  ? 13.659  63.600  66.048 1.00 108.17 ? 485 PHE B CA    1 
ATOM   523   C  C     . PHE A 1  77  ? 13.531  65.043  66.503 1.00 118.42 ? 485 PHE B C     1 
ATOM   524   O  O     . PHE A 1  77  ? 13.262  65.307  67.687 1.00 120.98 ? 485 PHE B O     1 
ATOM   525   C  CB    . PHE A 1  77  ? 15.123  63.182  65.996 1.00 107.30 ? 485 PHE B CB    1 
ATOM   526   C  CG    . PHE A 1  77  ? 15.315  61.745  65.672 1.00 110.36 ? 485 PHE B CG    1 
ATOM   527   C  CD1   . PHE A 1  77  ? 14.228  60.881  65.642 1.00 110.90 ? 485 PHE B CD1   1 
ATOM   528   C  CD2   . PHE A 1  77  ? 16.577  61.249  65.401 1.00 112.56 ? 485 PHE B CD2   1 
ATOM   529   C  CE1   . PHE A 1  77  ? 14.388  59.556  65.339 1.00 111.02 ? 485 PHE B CE1   1 
ATOM   530   C  CE2   . PHE A 1  77  ? 16.747  59.914  65.100 1.00 110.34 ? 485 PHE B CE2   1 
ATOM   531   C  CZ    . PHE A 1  77  ? 15.650  59.067  65.069 1.00 110.05 ? 485 PHE B CZ    1 
ATOM   532   N  N     . GLY A 1  78  ? 13.708  65.987  65.582 1.00 121.12 ? 486 GLY B N     1 
ATOM   533   C  CA    . GLY A 1  78  ? 13.506  67.397  65.844 1.00 117.76 ? 486 GLY B CA    1 
ATOM   534   C  C     . GLY A 1  78  ? 14.640  68.096  66.558 1.00 120.96 ? 486 GLY B C     1 
ATOM   535   O  O     . GLY A 1  78  ? 14.518  69.297  66.837 1.00 128.22 ? 486 GLY B O     1 
ATOM   536   N  N     . THR A 1  79  ? 15.734  67.402  66.875 1.00 115.73 ? 487 THR B N     1 
ATOM   537   C  CA    . THR A 1  79  ? 16.840  68.032  67.592 1.00 109.31 ? 487 THR B CA    1 
ATOM   538   C  C     . THR A 1  79  ? 17.728  68.874  66.693 1.00 105.53 ? 487 THR B C     1 
ATOM   539   O  O     . THR A 1  79  ? 18.498  69.697  67.205 1.00 110.37 ? 487 THR B O     1 
ATOM   540   C  CB    . THR A 1  79  ? 17.725  66.984  68.248 1.00 109.94 ? 487 THR B CB    1 
ATOM   541   O  OG1   . THR A 1  79  ? 18.507  66.361  67.229 1.00 115.44 ? 487 THR B OG1   1 
ATOM   542   C  CG2   . THR A 1  79  ? 16.867  65.945  68.937 1.00 111.08 ? 487 THR B CG2   1 
ATOM   543   N  N     . GLY A 1  80  ? 17.668  68.671  65.380 1.00 104.56 ? 488 GLY B N     1 
ATOM   544   C  CA    . GLY A 1  80  ? 18.600  69.318  64.475 1.00 103.65 ? 488 GLY B CA    1 
ATOM   545   C  C     . GLY A 1  80  ? 19.872  68.509  64.373 1.00 109.32 ? 488 GLY B C     1 
ATOM   546   O  O     . GLY A 1  80  ? 20.006  67.426  64.946 1.00 123.85 ? 488 GLY B O     1 
ATOM   547   N  N     . ILE A 1  81  ? 20.850  69.035  63.639 1.00 100.65 ? 489 ILE B N     1 
ATOM   548   C  CA    . ILE A 1  81  ? 22.079  68.273  63.447 1.00 106.69 ? 489 ILE B CA    1 
ATOM   549   C  C     . ILE A 1  81  ? 23.316  69.113  63.724 1.00 115.04 ? 489 ILE B C     1 
ATOM   550   O  O     . ILE A 1  81  ? 23.329  70.334  63.551 1.00 121.70 ? 489 ILE B O     1 
ATOM   551   C  CB    . ILE A 1  81  ? 22.184  67.678  62.028 1.00 101.41 ? 489 ILE B CB    1 
ATOM   552   C  CG1   . ILE A 1  81  ? 22.198  68.806  61.012 1.00 99.49  ? 489 ILE B CG1   1 
ATOM   553   C  CG2   . ILE A 1  81  ? 21.061  66.704  61.769 1.00 94.41  ? 489 ILE B CG2   1 
ATOM   554   C  CD1   . ILE A 1  81  ? 22.509  68.344  59.639 1.00 95.82  ? 489 ILE B CD1   1 
ATOM   555   N  N     . GLY A 1  82  ? 24.382  68.414  64.116 1.00 108.60 ? 490 GLY B N     1 
ATOM   556   C  CA    . GLY A 1  82  ? 25.688  69.038  64.269 1.00 110.20 ? 490 GLY B CA    1 
ATOM   557   C  C     . GLY A 1  82  ? 25.717  70.108  65.347 1.00 112.06 ? 490 GLY B C     1 
ATOM   558   O  O     . GLY A 1  82  ? 25.344  69.879  66.503 1.00 123.30 ? 490 GLY B O     1 
ATOM   559   N  N     . GLY A 1  83  ? 26.188  71.297  64.962 1.00 107.77 ? 491 GLY B N     1 
ATOM   560   C  CA    . GLY A 1  83  ? 26.340  72.381  65.922 1.00 111.52 ? 491 GLY B CA    1 
ATOM   561   C  C     . GLY A 1  83  ? 25.020  72.847  66.506 1.00 119.68 ? 491 GLY B C     1 
ATOM   562   O  O     . GLY A 1  83  ? 24.940  73.181  67.692 1.00 121.71 ? 491 GLY B O     1 
ATOM   563   N  N     . ASP A 1  84  ? 23.970  72.871  65.686 1.00 125.52 ? 492 ASP B N     1 
ATOM   564   C  CA    . ASP A 1  84  ? 22.649  73.334  66.105 1.00 123.33 ? 492 ASP B CA    1 
ATOM   565   C  C     . ASP A 1  84  ? 21.835  72.255  66.791 1.00 111.00 ? 492 ASP B C     1 
ATOM   566   O  O     . ASP A 1  84  ? 20.682  72.515  67.168 1.00 103.38 ? 492 ASP B O     1 
ATOM   567   C  CB    . ASP A 1  84  ? 21.870  73.861  64.906 1.00 124.90 ? 492 ASP B CB    1 
ATOM   568   C  CG    . ASP A 1  84  ? 22.694  74.794  64.052 1.00 131.48 ? 492 ASP B CG    1 
ATOM   569   O  OD1   . ASP A 1  84  ? 23.943  74.715  64.118 1.00 134.60 ? 492 ASP B OD1   1 
ATOM   570   O  OD2   . ASP A 1  84  ? 22.092  75.605  63.316 1.00 132.42 ? 492 ASP B OD2   1 
ATOM   571   N  N     . PHE A 1  85  ? 22.387  71.057  66.912 1.00 113.08 ? 493 PHE B N     1 
ATOM   572   C  CA    . PHE A 1  85  ? 21.702  69.985  67.606 1.00 114.54 ? 493 PHE B CA    1 
ATOM   573   C  C     . PHE A 1  85  ? 21.370  70.431  69.019 1.00 120.29 ? 493 PHE B C     1 
ATOM   574   O  O     . PHE A 1  85  ? 22.237  70.929  69.744 1.00 120.28 ? 493 PHE B O     1 
ATOM   575   C  CB    . PHE A 1  85  ? 22.580  68.731  67.627 1.00 115.32 ? 493 PHE B CB    1 
ATOM   576   C  CG    . PHE A 1  85  ? 22.114  67.687  68.586 1.00 123.41 ? 493 PHE B CG    1 
ATOM   577   C  CD1   . PHE A 1  85  ? 22.274  67.848  69.957 1.00 137.41 ? 493 PHE B CD1   1 
ATOM   578   C  CD2   . PHE A 1  85  ? 21.534  66.531  68.116 1.00 127.16 ? 493 PHE B CD2   1 
ATOM   579   C  CE1   . PHE A 1  85  ? 21.797  66.917  70.827 1.00 143.14 ? 493 PHE B CE1   1 
ATOM   580   C  CE2   . PHE A 1  85  ? 21.108  65.558  68.986 1.00 136.73 ? 493 PHE B CE2   1 
ATOM   581   C  CZ    . PHE A 1  85  ? 21.236  65.747  70.339 1.00 137.89 ? 493 PHE B CZ    1 
ATOM   582   N  N     . ASP A 1  86  ? 20.131  70.204  69.435 1.00 126.18 ? 494 ASP B N     1 
ATOM   583   C  CA    . ASP A 1  86  ? 19.704  70.526  70.789 1.00 120.23 ? 494 ASP B CA    1 
ATOM   584   C  C     . ASP A 1  86  ? 19.078  69.288  71.401 1.00 121.23 ? 494 ASP B C     1 
ATOM   585   O  O     . ASP A 1  86  ? 18.089  68.771  70.876 1.00 137.01 ? 494 ASP B O     1 
ATOM   586   C  CB    . ASP A 1  86  ? 18.714  71.688  70.789 1.00 115.02 ? 494 ASP B CB    1 
ATOM   587   C  CG    . ASP A 1  86  ? 18.620  72.360  72.130 1.00 122.57 ? 494 ASP B CG    1 
ATOM   588   O  OD1   . ASP A 1  86  ? 19.162  71.811  73.119 1.00 134.12 ? 494 ASP B OD1   1 
ATOM   589   O  OD2   . ASP A 1  86  ? 18.001  73.440  72.183 1.00 124.41 ? 494 ASP B OD2   1 
ATOM   590   N  N     . LEU A 1  87  ? 19.651  68.810  72.502 1.00 109.47 ? 495 LEU B N     1 
ATOM   591   C  CA    . LEU A 1  87  ? 19.134  67.607  73.149 1.00 104.67 ? 495 LEU B CA    1 
ATOM   592   C  C     . LEU A 1  87  ? 17.730  67.832  73.688 1.00 105.74 ? 495 LEU B C     1 
ATOM   593   O  O     . LEU A 1  87  ? 16.786  67.115  73.330 1.00 102.46 ? 495 LEU B O     1 
ATOM   594   C  CB    . LEU A 1  87  ? 20.080  67.179  74.271 1.00 100.81 ? 495 LEU B CB    1 
ATOM   595   C  CG    . LEU A 1  87  ? 19.744  65.891  75.005 1.00 100.74 ? 495 LEU B CG    1 
ATOM   596   C  CD1   . LEU A 1  87  ? 19.594  64.774  74.000 1.00 116.74 ? 495 LEU B CD1   1 
ATOM   597   C  CD2   . LEU A 1  87  ? 20.868  65.584  75.973 1.00 98.51  ? 495 LEU B CD2   1 
ATOM   598   N  N     . ALA A 1  88  ? 17.576  68.840  74.538 1.00 114.39 ? 496 ALA B N     1 
ATOM   599   C  CA    . ALA A 1  88  ? 16.328  69.194  75.201 1.00 118.16 ? 496 ALA B CA    1 
ATOM   600   C  C     . ALA A 1  88  ? 15.134  69.248  74.253 1.00 122.58 ? 496 ALA B C     1 
ATOM   601   O  O     . ALA A 1  88  ? 13.987  69.308  74.707 1.00 123.10 ? 496 ALA B O     1 
ATOM   602   C  CB    . ALA A 1  88  ? 16.505  70.529  75.921 1.00 119.73 ? 496 ALA B CB    1 
ATOM   603   N  N     . LYS A 1  89  ? 15.374  69.220  72.937 1.00 128.42 ? 497 LYS B N     1 
ATOM   604   C  CA    . LYS A 1  89  ? 14.311  69.276  71.936 1.00 122.10 ? 497 LYS B CA    1 
ATOM   605   C  C     . LYS A 1  89  ? 13.933  67.916  71.362 1.00 122.34 ? 497 LYS B C     1 
ATOM   606   O  O     . LYS A 1  89  ? 13.063  67.855  70.484 1.00 122.94 ? 497 LYS B O     1 
ATOM   607   C  CB    . LYS A 1  89  ? 14.712  70.226  70.806 1.00 115.38 ? 497 LYS B CB    1 
ATOM   608   C  CG    . LYS A 1  89  ? 14.584  71.696  71.170 1.00 120.86 ? 497 LYS B CG    1 
ATOM   609   C  CD    . LYS A 1  89  ? 15.188  72.585  70.091 1.00 118.20 ? 497 LYS B CD    1 
ATOM   610   C  CE    . LYS A 1  89  ? 14.817  74.045  70.296 1.00 112.11 ? 497 LYS B CE    1 
ATOM   611   N  NZ    . LYS A 1  89  ? 15.717  74.951  69.529 1.00 110.01 ? 497 LYS B NZ    1 
ATOM   612   N  N     . ALA A 1  90  ? 14.552  66.835  71.833 1.00 123.56 ? 498 ALA B N     1 
ATOM   613   C  CA    . ALA A 1  90  ? 14.244  65.488  71.359 1.00 127.66 ? 498 ALA B CA    1 
ATOM   614   C  C     . ALA A 1  90  ? 12.763  65.173  71.562 1.00 130.55 ? 498 ALA B C     1 
ATOM   615   O  O     . ALA A 1  90  ? 12.214  65.372  72.645 1.00 141.49 ? 498 ALA B O     1 
ATOM   616   C  CB    . ALA A 1  90  ? 15.106  64.471  72.113 1.00 127.25 ? 498 ALA B CB    1 
ATOM   617   N  N     . ARG A 1  91  ? 12.107  64.662  70.512 1.00 116.65 ? 499 ARG B N     1 
ATOM   618   C  CA    . ARG A 1  91  ? 10.677  64.395  70.648 1.00 116.67 ? 499 ARG B CA    1 
ATOM   619   C  C     . ARG A 1  91  ? 10.386  63.051  71.299 1.00 122.79 ? 499 ARG B C     1 
ATOM   620   O  O     . ARG A 1  91  ? 9.275   62.858  71.819 1.00 133.80 ? 499 ARG B O     1 
ATOM   621   C  CB    . ARG A 1  91  ? 9.988   64.470  69.287 1.00 117.26 ? 499 ARG B CB    1 
ATOM   622   C  CG    . ARG A 1  91  ? 10.208  65.782  68.574 1.00 120.12 ? 499 ARG B CG    1 
ATOM   623   C  CD    . ARG A 1  91  ? 8.893   66.364  68.134 1.00 127.11 ? 499 ARG B CD    1 
ATOM   624   N  NE    . ARG A 1  91  ? 8.184   65.459  67.238 1.00 131.93 ? 499 ARG B NE    1 
ATOM   625   C  CZ    . ARG A 1  91  ? 7.782   65.791  66.016 1.00 137.56 ? 499 ARG B CZ    1 
ATOM   626   N  NH1   . ARG A 1  91  ? 8.013   67.017  65.557 1.00 142.71 ? 499 ARG B NH1   1 
ATOM   627   N  NH2   . ARG A 1  91  ? 7.137   64.908  65.258 1.00 134.90 ? 499 ARG B NH2   1 
ATOM   628   N  N     . TYR A 1  92  ? 11.342  62.132  71.295 1.00 115.48 ? 500 TYR B N     1 
ATOM   629   C  CA    . TYR A 1  92  ? 11.183  60.806  71.864 1.00 115.45 ? 500 TYR B CA    1 
ATOM   630   C  C     . TYR A 1  92  ? 12.413  60.521  72.716 1.00 114.58 ? 500 TYR B C     1 
ATOM   631   O  O     . TYR A 1  92  ? 13.528  60.848  72.314 1.00 109.53 ? 500 TYR B O     1 
ATOM   632   C  CB    . TYR A 1  92  ? 11.022  59.754  70.736 1.00 116.96 ? 500 TYR B CB    1 
ATOM   633   C  CG    . TYR A 1  92  ? 10.032  60.122  69.628 1.00 113.84 ? 500 TYR B CG    1 
ATOM   634   C  CD1   . TYR A 1  92  ? 10.440  60.833  68.498 1.00 110.13 ? 500 TYR B CD1   1 
ATOM   635   C  CD2   . TYR A 1  92  ? 8.699   59.731  69.702 1.00 113.78 ? 500 TYR B CD2   1 
ATOM   636   C  CE1   . TYR A 1  92  ? 9.545   61.152  67.481 1.00 110.16 ? 500 TYR B CE1   1 
ATOM   637   C  CE2   . TYR A 1  92  ? 7.797   60.051  68.695 1.00 109.66 ? 500 TYR B CE2   1 
ATOM   638   C  CZ    . TYR A 1  92  ? 8.224   60.758  67.584 1.00 109.04 ? 500 TYR B CZ    1 
ATOM   639   O  OH    . TYR A 1  92  ? 7.340   61.084  66.579 1.00 112.29 ? 500 TYR B OH    1 
ATOM   640   N  N     . HIS A 1  93  ? 12.226  59.952  73.904 1.00 122.19 ? 501 HIS B N     1 
ATOM   641   C  CA    . HIS A 1  93  ? 13.392  59.584  74.704 1.00 124.78 ? 501 HIS B CA    1 
ATOM   642   C  C     . HIS A 1  93  ? 13.794  58.131  74.483 1.00 118.15 ? 501 HIS B C     1 
ATOM   643   O  O     . HIS A 1  93  ? 14.798  57.682  75.052 1.00 112.20 ? 501 HIS B O     1 
ATOM   644   C  CB    . HIS A 1  93  ? 13.166  59.885  76.203 1.00 131.01 ? 501 HIS B CB    1 
ATOM   645   C  CG    . HIS A 1  93  ? 13.164  61.356  76.547 1.00 127.69 ? 501 HIS B CG    1 
ATOM   646   N  ND1   . HIS A 1  93  ? 13.197  61.825  77.844 1.00 135.43 ? 501 HIS B ND1   1 
ATOM   647   C  CD2   . HIS A 1  93  ? 13.121  62.457  75.758 1.00 129.19 ? 501 HIS B CD2   1 
ATOM   648   C  CE1   . HIS A 1  93  ? 13.178  63.148  77.840 1.00 137.72 ? 501 HIS B CE1   1 
ATOM   649   N  NE2   . HIS A 1  93  ? 13.130  63.556  76.585 1.00 132.41 ? 501 HIS B NE2   1 
ATOM   650   N  N     . LYS A 1  94  ? 13.067  57.398  73.632 1.00 121.71 ? 502 LYS B N     1 
ATOM   651   C  CA    . LYS A 1  94  ? 13.527  56.112  73.125 1.00 117.70 ? 502 LYS B CA    1 
ATOM   652   C  C     . LYS A 1  94  ? 13.413  56.085  71.609 1.00 117.85 ? 502 LYS B C     1 
ATOM   653   O  O     . LYS A 1  94  ? 12.329  56.303  71.049 1.00 128.33 ? 502 LYS B O     1 
ATOM   654   C  CB    . LYS A 1  94  ? 12.757  54.941  73.731 1.00 117.65 ? 502 LYS B CB    1 
ATOM   655   C  CG    . LYS A 1  94  ? 13.132  54.608  75.168 1.00 121.01 ? 502 LYS B CG    1 
ATOM   656   C  CD    . LYS A 1  94  ? 12.789  53.151  75.441 1.00 117.84 ? 502 LYS B CD    1 
ATOM   657   C  CE    . LYS A 1  94  ? 13.095  52.734  76.859 1.00 117.13 ? 502 LYS B CE    1 
ATOM   658   N  NZ    . LYS A 1  94  ? 12.035  53.303  77.733 1.00 122.83 ? 502 LYS B NZ    1 
ATOM   659   N  N     . ILE A 1  95  ? 14.551  55.833  70.963 1.00 107.28 ? 503 ILE B N     1 
ATOM   660   C  CA    . ILE A 1  95  ? 14.653  55.611  69.530 1.00 104.08 ? 503 ILE B CA    1 
ATOM   661   C  C     . ILE A 1  95  ? 15.081  54.167  69.352 1.00 101.24 ? 503 ILE B C     1 
ATOM   662   O  O     . ILE A 1  95  ? 16.163  53.778  69.816 1.00 96.33  ? 503 ILE B O     1 
ATOM   663   C  CB    . ILE A 1  95  ? 15.691  56.532  68.873 1.00 107.08 ? 503 ILE B CB    1 
ATOM   664   C  CG1   . ILE A 1  95  ? 15.248  57.994  68.886 1.00 102.04 ? 503 ILE B CG1   1 
ATOM   665   C  CG2   . ILE A 1  95  ? 15.995  56.059  67.465 1.00 107.61 ? 503 ILE B CG2   1 
ATOM   666   C  CD1   . ILE A 1  95  ? 15.701  58.728  70.111 1.00 104.82 ? 503 ILE B CD1   1 
ATOM   667   N  N     . VAL A 1  96  ? 14.264  53.372  68.673 1.00 101.89 ? 504 VAL B N     1 
ATOM   668   C  CA    . VAL A 1  96  ? 14.545  51.946  68.545 1.00 102.36 ? 504 VAL B CA    1 
ATOM   669   C  C     . VAL A 1  96  ? 14.784  51.587  67.093 1.00 97.20  ? 504 VAL B C     1 
ATOM   670   O  O     . VAL A 1  96  ? 13.986  51.928  66.214 1.00 96.93  ? 504 VAL B O     1 
ATOM   671   C  CB    . VAL A 1  96  ? 13.427  51.079  69.132 1.00 108.48 ? 504 VAL B CB    1 
ATOM   672   C  CG1   . VAL A 1  96  ? 14.018  49.735  69.485 1.00 105.20 ? 504 VAL B CG1   1 
ATOM   673   C  CG2   . VAL A 1  96  ? 12.834  51.755  70.332 1.00 115.83 ? 504 VAL B CG2   1 
ATOM   674   N  N     . ILE A 1  97  ? 15.847  50.828  66.870 1.00 94.05  ? 505 ILE B N     1 
ATOM   675   C  CA    . ILE A 1  97  ? 16.206  50.338  65.549 1.00 95.94  ? 505 ILE B CA    1 
ATOM   676   C  C     . ILE A 1  97  ? 15.594  48.950  65.391 1.00 109.93 ? 505 ILE B C     1 
ATOM   677   O  O     . ILE A 1  97  ? 16.089  47.975  65.966 1.00 115.54 ? 505 ILE B O     1 
ATOM   678   C  CB    . ILE A 1  97  ? 17.724  50.291  65.375 1.00 81.86  ? 505 ILE B CB    1 
ATOM   679   C  CG1   . ILE A 1  97  ? 18.350  51.628  65.762 1.00 78.28  ? 505 ILE B CG1   1 
ATOM   680   C  CG2   . ILE A 1  97  ? 18.076  49.905  63.964 1.00 85.65  ? 505 ILE B CG2   1 
ATOM   681   C  CD1   . ILE A 1  97  ? 19.809  51.681  65.473 1.00 74.18  ? 505 ILE B CD1   1 
ATOM   682   N  N     . MET A 1  98  ? 14.530  48.843  64.609 1.00 107.11 ? 506 MET B N     1 
ATOM   683   C  CA    . MET A 1  98  ? 13.883  47.553  64.381 1.00 104.28 ? 506 MET B CA    1 
ATOM   684   C  C     . MET A 1  98  ? 14.215  47.115  62.963 1.00 98.03  ? 506 MET B C     1 
ATOM   685   O  O     . MET A 1  98  ? 13.731  47.706  61.995 1.00 99.29  ? 506 MET B O     1 
ATOM   686   C  CB    . MET A 1  98  ? 12.374  47.641  64.605 1.00 112.04 ? 506 MET B CB    1 
ATOM   687   C  CG    . MET A 1  98  ? 11.729  46.316  64.970 1.00 118.60 ? 506 MET B CG    1 
ATOM   688   S  SD    . MET A 1  98  ? 10.150  46.495  65.844 1.00 120.64 ? 506 MET B SD    1 
ATOM   689   C  CE    . MET A 1  98  ? 9.033   46.861  64.494 1.00 116.72 ? 506 MET B CE    1 
ATOM   690   N  N     . THR A 1  99  ? 15.040  46.095  62.833 1.00 97.04  ? 507 THR B N     1 
ATOM   691   C  CA    . THR A 1  99  ? 15.445  45.648  61.517 1.00 95.46  ? 507 THR B CA    1 
ATOM   692   C  C     . THR A 1  99  ? 15.084  44.184  61.357 1.00 98.89  ? 507 THR B C     1 
ATOM   693   O  O     . THR A 1  99  ? 14.816  43.486  62.339 1.00 107.76 ? 507 THR B O     1 
ATOM   694   C  CB    . THR A 1  99  ? 16.951  45.791  61.321 1.00 94.56  ? 507 THR B CB    1 
ATOM   695   O  OG1   . THR A 1  99  ? 17.592  45.217  62.460 1.00 99.92  ? 507 THR B OG1   1 
ATOM   696   C  CG2   . THR A 1  99  ? 17.316  47.230  61.194 1.00 96.81  ? 507 THR B CG2   1 
ATOM   697   N  N     . ASP A 1  100 ? 15.143  43.705  60.124 1.00 95.77  ? 508 ASP B N     1 
ATOM   698   C  CA    . ASP A 1  100 ? 15.092  42.266  59.971 1.00 90.60  ? 508 ASP B CA    1 
ATOM   699   C  C     . ASP A 1  100 ? 16.267  41.619  60.685 1.00 88.19  ? 508 ASP B C     1 
ATOM   700   O  O     . ASP A 1  100 ? 17.377  42.160  60.738 1.00 87.67  ? 508 ASP B O     1 
ATOM   701   C  CB    . ASP A 1  100 ? 15.114  41.863  58.508 1.00 92.66  ? 508 ASP B CB    1 
ATOM   702   C  CG    . ASP A 1  100 ? 13.829  42.090  57.817 1.00 101.57 ? 508 ASP B CG    1 
ATOM   703   O  OD1   . ASP A 1  100 ? 12.874  42.709  58.367 1.00 112.82 ? 508 ASP B OD1   1 
ATOM   704   O  OD2   . ASP A 1  100 ? 13.832  41.576  56.695 1.00 94.92  ? 508 ASP B OD2   1 
ATOM   705   N  N     . ALA A 1  101 ? 15.994  40.459  61.251 1.00 88.21  ? 509 ALA B N     1 
ATOM   706   C  CA    . ALA A 1  101 ? 17.017  39.669  61.908 1.00 86.08  ? 509 ALA B CA    1 
ATOM   707   C  C     . ALA A 1  101 ? 17.846  38.907  60.888 1.00 84.08  ? 509 ALA B C     1 
ATOM   708   O  O     . ALA A 1  101 ? 17.964  37.683  60.988 1.00 88.71  ? 509 ALA B O     1 
ATOM   709   C  CB    . ALA A 1  101 ? 16.376  38.698  62.903 1.00 91.44  ? 509 ALA B CB    1 
ATOM   710   N  N     . ASP A 1  102 ? 18.391  39.591  59.879 1.00 85.67  ? 510 ASP B N     1 
ATOM   711   C  CA    . ASP A 1  102 ? 19.203  38.952  58.842 1.00 75.99  ? 510 ASP B CA    1 
ATOM   712   C  C     . ASP A 1  102 ? 20.295  39.932  58.426 1.00 79.03  ? 510 ASP B C     1 
ATOM   713   O  O     . ASP A 1  102 ? 20.323  41.076  58.892 1.00 92.35  ? 510 ASP B O     1 
ATOM   714   C  CB    . ASP A 1  102 ? 18.320  38.543  57.662 1.00 74.75  ? 510 ASP B CB    1 
ATOM   715   C  CG    . ASP A 1  102 ? 17.685  39.752  56.993 1.00 77.41  ? 510 ASP B CG    1 
ATOM   716   O  OD1   . ASP A 1  102 ? 18.254  40.857  56.990 1.00 89.90  ? 510 ASP B OD1   1 
ATOM   717   O  OD2   . ASP A 1  102 ? 16.558  39.651  56.524 1.00 79.63  ? 510 ASP B OD2   1 
ATOM   718   N  N     . VAL A 1  103 ? 21.140  39.515  57.472 1.00 75.93  ? 511 VAL B N     1 
ATOM   719   C  CA    . VAL A 1  103 ? 22.362  40.280  57.232 1.00 69.19  ? 511 VAL B CA    1 
ATOM   720   C  C     . VAL A 1  103 ? 22.067  41.625  56.591 1.00 68.31  ? 511 VAL B C     1 
ATOM   721   O  O     . VAL A 1  103 ? 22.771  42.607  56.848 1.00 67.06  ? 511 VAL B O     1 
ATOM   722   C  CB    . VAL A 1  103 ? 23.390  39.485  56.397 1.00 68.95  ? 511 VAL B CB    1 
ATOM   723   C  CG1   . VAL A 1  103 ? 23.865  38.261  57.130 1.00 68.42  ? 511 VAL B CG1   1 
ATOM   724   C  CG2   . VAL A 1  103 ? 22.896  39.158  54.946 1.00 74.99  ? 511 VAL B CG2   1 
ATOM   725   N  N     . ASP A 1  104 ? 21.069  41.702  55.734 1.00 70.81  ? 512 ASP B N     1 
ATOM   726   C  CA    . ASP A 1  104 ? 20.764  43.026  55.211 1.00 72.45  ? 512 ASP B CA    1 
ATOM   727   C  C     . ASP A 1  104 ? 20.257  43.927  56.317 1.00 71.66  ? 512 ASP B C     1 
ATOM   728   O  O     . ASP A 1  104 ? 20.568  45.123  56.351 1.00 68.91  ? 512 ASP B O     1 
ATOM   729   C  CB    . ASP A 1  104 ? 19.794  42.924  54.060 1.00 75.07  ? 512 ASP B CB    1 
ATOM   730   C  CG    . ASP A 1  104 ? 20.339  42.037  52.990 1.00 81.30  ? 512 ASP B CG    1 
ATOM   731   O  OD1   . ASP A 1  104 ? 20.529  40.830  53.289 1.00 75.44  ? 512 ASP B OD1   1 
ATOM   732   O  OD2   . ASP A 1  104 ? 20.651  42.555  51.895 1.00 86.85  ? 512 ASP B OD2   1 
ATOM   733   N  N     . GLY A 1  105 ? 19.546  43.343  57.273 1.00 73.90  ? 513 GLY B N     1 
ATOM   734   C  CA    . GLY A 1  105 ? 19.159  44.084  58.455 1.00 75.14  ? 513 GLY B CA    1 
ATOM   735   C  C     . GLY A 1  105 ? 20.368  44.489  59.275 1.00 85.33  ? 513 GLY B C     1 
ATOM   736   O  O     . GLY A 1  105 ? 20.430  45.602  59.800 1.00 103.37 ? 513 GLY B O     1 
ATOM   737   N  N     . ALA A 1  106 ? 21.353  43.599  59.386 1.00 71.61  ? 514 ALA B N     1 
ATOM   738   C  CA    . ALA A 1  106 ? 22.574  43.949  60.101 1.00 71.49  ? 514 ALA B CA    1 
ATOM   739   C  C     . ALA A 1  106 ? 23.289  45.086  59.395 1.00 77.76  ? 514 ALA B C     1 
ATOM   740   O  O     . ALA A 1  106 ? 23.757  46.037  60.029 1.00 72.36  ? 514 ALA B O     1 
ATOM   741   C  CB    . ALA A 1  106 ? 23.490  42.731  60.211 1.00 71.62  ? 514 ALA B CB    1 
ATOM   742   N  N     . HIS A 1  107 ? 23.385  44.992  58.075 1.00 78.10  ? 515 HIS B N     1 
ATOM   743   C  CA    . HIS A 1  107 ? 24.030  46.030  57.289 1.00 68.60  ? 515 HIS B CA    1 
ATOM   744   C  C     . HIS A 1  107 ? 23.338  47.361  57.480 1.00 68.45  ? 515 HIS B C     1 
ATOM   745   O  O     . HIS A 1  107 ? 23.996  48.392  57.645 1.00 66.69  ? 515 HIS B O     1 
ATOM   746   C  CB    . HIS A 1  107 ? 23.994  45.633  55.828 1.00 70.19  ? 515 HIS B CB    1 
ATOM   747   C  CG    . HIS A 1  107 ? 24.542  46.663  54.906 1.00 70.29  ? 515 HIS B CG    1 
ATOM   748   N  ND1   . HIS A 1  107 ? 23.753  47.323  53.995 1.00 68.23  ? 515 HIS B ND1   1 
ATOM   749   C  CD2   . HIS A 1  107 ? 25.797  47.136  54.734 1.00 71.28  ? 515 HIS B CD2   1 
ATOM   750   C  CE1   . HIS A 1  107 ? 24.494  48.170  53.308 1.00 73.18  ? 515 HIS B CE1   1 
ATOM   751   N  NE2   . HIS A 1  107 ? 25.739  48.077  53.737 1.00 72.52  ? 515 HIS B NE2   1 
ATOM   752   N  N     . ILE A 1  108 ? 22.005  47.357  57.429 1.00 71.30  ? 516 ILE B N     1 
ATOM   753   C  CA    . ILE A 1  108 ? 21.230  48.576  57.638 1.00 70.49  ? 516 ILE B CA    1 
ATOM   754   C  C     . ILE A 1  108 ? 21.535  49.153  58.999 1.00 73.04  ? 516 ILE B C     1 
ATOM   755   O  O     . ILE A 1  108 ? 21.609  50.373  59.184 1.00 76.08  ? 516 ILE B O     1 
ATOM   756   C  CB    . ILE A 1  108 ? 19.724  48.288  57.526 1.00 72.55  ? 516 ILE B CB    1 
ATOM   757   C  CG1   . ILE A 1  108 ? 19.330  48.062  56.067 1.00 82.81  ? 516 ILE B CG1   1 
ATOM   758   C  CG2   . ILE A 1  108 ? 18.948  49.438  58.151 1.00 71.69  ? 516 ILE B CG2   1 
ATOM   759   C  CD1   . ILE A 1  108 ? 17.851  48.007  55.885 1.00 85.09  ? 516 ILE B CD1   1 
ATOM   760   N  N     . ARG A 1  109 ? 21.630  48.274  59.992 1.00 77.26  ? 517 ARG B N     1 
ATOM   761   C  CA    . ARG A 1  109 ? 21.900  48.704  61.354 1.00 77.55  ? 517 ARG B CA    1 
ATOM   762   C  C     . ARG A 1  109 ? 23.194  49.493  61.424 1.00 74.09  ? 517 ARG B C     1 
ATOM   763   O  O     . ARG A 1  109 ? 23.259  50.527  62.091 1.00 78.78  ? 517 ARG B O     1 
ATOM   764   C  CB    . ARG A 1  109 ? 21.947  47.486  62.272 1.00 77.62  ? 517 ARG B CB    1 
ATOM   765   C  CG    . ARG A 1  109 ? 22.081  47.847  63.714 1.00 79.95  ? 517 ARG B CG    1 
ATOM   766   C  CD    . ARG A 1  109 ? 21.752  46.658  64.575 1.00 82.47  ? 517 ARG B CD    1 
ATOM   767   N  NE    . ARG A 1  109 ? 22.614  45.516  64.278 1.00 80.69  ? 517 ARG B NE    1 
ATOM   768   C  CZ    . ARG A 1  109 ? 22.178  44.362  63.778 1.00 83.90  ? 517 ARG B CZ    1 
ATOM   769   N  NH1   . ARG A 1  109 ? 20.881  44.193  63.523 1.00 90.47  ? 517 ARG B NH1   1 
ATOM   770   N  NH2   . ARG A 1  109 ? 23.039  43.374  63.543 1.00 87.82  ? 517 ARG B NH2   1 
ATOM   771   N  N     . THR A 1  110 ? 24.242  49.025  60.745 1.00 70.03  ? 518 THR B N     1 
ATOM   772   C  CA    . THR A 1  110 ? 25.501  49.764  60.770 1.00 70.36  ? 518 THR B CA    1 
ATOM   773   C  C     . THR A 1  110 ? 25.346  51.118  60.106 1.00 70.40  ? 518 THR B C     1 
ATOM   774   O  O     . THR A 1  110 ? 25.961  52.097  60.533 1.00 70.89  ? 518 THR B O     1 
ATOM   775   C  CB    . THR A 1  110 ? 26.621  48.985  60.084 1.00 68.63  ? 518 THR B CB    1 
ATOM   776   O  OG1   . THR A 1  110 ? 26.246  48.675  58.740 1.00 74.49  ? 518 THR B OG1   1 
ATOM   777   C  CG2   . THR A 1  110 ? 26.916  47.733  60.831 1.00 69.26  ? 518 THR B CG2   1 
ATOM   778   N  N     . LEU A 1  111 ? 24.551  51.192  59.043 1.00 69.08  ? 519 LEU B N     1 
ATOM   779   C  CA    . LEU A 1  111 ? 24.349  52.477  58.385 1.00 69.00  ? 519 LEU B CA    1 
ATOM   780   C  C     . LEU A 1  111 ? 23.730  53.483  59.339 1.00 82.43  ? 519 LEU B C     1 
ATOM   781   O  O     . LEU A 1  111 ? 24.170  54.636  59.417 1.00 98.52  ? 519 LEU B O     1 
ATOM   782   C  CB    . LEU A 1  111 ? 23.462  52.312  57.151 1.00 70.26  ? 519 LEU B CB    1 
ATOM   783   C  CG    . LEU A 1  111 ? 24.092  51.447  56.074 1.00 66.69  ? 519 LEU B CG    1 
ATOM   784   C  CD1   . LEU A 1  111 ? 23.080  51.262  54.968 1.00 68.73  ? 519 LEU B CD1   1 
ATOM   785   C  CD2   . LEU A 1  111 ? 25.362  52.110  55.562 1.00 64.62  ? 519 LEU B CD2   1 
ATOM   786   N  N     . LEU A 1  112 ? 22.693  53.067  60.061 1.00 79.82  ? 520 LEU B N     1 
ATOM   787   C  CA    . LEU A 1  112 ? 22.020  53.965  60.992 1.00 76.68  ? 520 LEU B CA    1 
ATOM   788   C  C     . LEU A 1  112 ? 22.950  54.398  62.105 1.00 80.21  ? 520 LEU B C     1 
ATOM   789   O  O     . LEU A 1  112 ? 23.091  55.593  62.383 1.00 85.83  ? 520 LEU B O     1 
ATOM   790   C  CB    . LEU A 1  112 ? 20.801  53.276  61.583 1.00 75.14  ? 520 LEU B CB    1 
ATOM   791   C  CG    . LEU A 1  112 ? 19.677  53.170  60.577 1.00 75.79  ? 520 LEU B CG    1 
ATOM   792   C  CD1   . LEU A 1  112 ? 18.472  52.558  61.246 1.00 78.73  ? 520 LEU B CD1   1 
ATOM   793   C  CD2   . LEU A 1  112 ? 19.367  54.557  60.048 1.00 79.09  ? 520 LEU B CD2   1 
ATOM   794   N  N     . LEU A 1  113 ? 23.559  53.426  62.781 1.00 82.53  ? 521 LEU B N     1 
ATOM   795   C  CA    . LEU A 1  113 ? 24.527  53.730  63.824 1.00 84.74  ? 521 LEU B CA    1 
ATOM   796   C  C     . LEU A 1  113 ? 25.590  54.687  63.331 1.00 81.94  ? 521 LEU B C     1 
ATOM   797   O  O     . LEU A 1  113 ? 26.107  55.495  64.109 1.00 90.70  ? 521 LEU B O     1 
ATOM   798   C  CB    . LEU A 1  113 ? 25.174  52.451  64.348 1.00 88.34  ? 521 LEU B CB    1 
ATOM   799   C  CG    . LEU A 1  113 ? 24.223  51.541  65.115 1.00 93.34  ? 521 LEU B CG    1 
ATOM   800   C  CD1   . LEU A 1  113 ? 25.024  50.524  65.882 1.00 97.16  ? 521 LEU B CD1   1 
ATOM   801   C  CD2   . LEU A 1  113 ? 23.352  52.369  66.046 1.00 84.63  ? 521 LEU B CD2   1 
ATOM   802   N  N     . THR A 1  114 ? 25.925  54.617  62.049 1.00 77.89  ? 522 THR B N     1 
ATOM   803   C  CA    . THR A 1  114 ? 26.840  55.590  61.470 1.00 75.07  ? 522 THR B CA    1 
ATOM   804   C  C     . THR A 1  114 ? 26.208  56.969  61.438 1.00 74.30  ? 522 THR B C     1 
ATOM   805   O  O     . THR A 1  114 ? 26.845  57.962  61.818 1.00 76.98  ? 522 THR B O     1 
ATOM   806   C  CB    . THR A 1  114 ? 27.294  55.156  60.067 1.00 72.74  ? 522 THR B CB    1 
ATOM   807   O  OG1   . THR A 1  114 ? 27.887  53.852  60.126 1.00 75.52  ? 522 THR B OG1   1 
ATOM   808   C  CG2   . THR A 1  114 ? 28.352  56.123  59.565 1.00 68.21  ? 522 THR B CG2   1 
ATOM   809   N  N     . PHE A 1  115 ? 24.948  57.052  61.000 1.00 76.30  ? 523 PHE B N     1 
ATOM   810   C  CA    . PHE A 1  115 ? 24.274  58.343  60.967 1.00 80.18  ? 523 PHE B CA    1 
ATOM   811   C  C     . PHE A 1  115 ? 24.227  58.959  62.353 1.00 87.99  ? 523 PHE B C     1 
ATOM   812   O  O     . PHE A 1  115 ? 24.652  60.102  62.551 1.00 96.44  ? 523 PHE B O     1 
ATOM   813   C  CB    . PHE A 1  115 ? 22.873  58.199  60.378 1.00 80.27  ? 523 PHE B CB    1 
ATOM   814   C  CG    . PHE A 1  115 ? 22.050  59.459  60.471 1.00 84.82  ? 523 PHE B CG    1 
ATOM   815   C  CD1   . PHE A 1  115 ? 22.463  60.618  59.843 1.00 83.38  ? 523 PHE B CD1   1 
ATOM   816   C  CD2   . PHE A 1  115 ? 20.866  59.480  61.197 1.00 88.12  ? 523 PHE B CD2   1 
ATOM   817   C  CE1   . PHE A 1  115 ? 21.715  61.781  59.934 1.00 84.02  ? 523 PHE B CE1   1 
ATOM   818   C  CE2   . PHE A 1  115 ? 20.116  60.638  61.293 1.00 96.23  ? 523 PHE B CE2   1 
ATOM   819   C  CZ    . PHE A 1  115 ? 20.543  61.794  60.663 1.00 90.90  ? 523 PHE B CZ    1 
ATOM   820   N  N     . PHE A 1  116 ? 23.761  58.196  63.344 1.00 81.98  ? 524 PHE B N     1 
ATOM   821   C  CA    . PHE A 1  116 ? 23.730  58.711  64.713 1.00 84.22  ? 524 PHE B CA    1 
ATOM   822   C  C     . PHE A 1  116 ? 25.111  59.163  65.172 1.00 84.09  ? 524 PHE B C     1 
ATOM   823   O  O     . PHE A 1  116 ? 25.306  60.320  65.563 1.00 89.60  ? 524 PHE B O     1 
ATOM   824   C  CB    . PHE A 1  116 ? 23.160  57.650  65.653 1.00 86.59  ? 524 PHE B CB    1 
ATOM   825   C  CG    . PHE A 1  116 ? 21.737  57.323  65.378 1.00 87.67  ? 524 PHE B CG    1 
ATOM   826   C  CD1   . PHE A 1  116 ? 20.832  58.333  65.092 1.00 91.32  ? 524 PHE B CD1   1 
ATOM   827   C  CD2   . PHE A 1  116 ? 21.307  56.014  65.358 1.00 90.77  ? 524 PHE B CD2   1 
ATOM   828   C  CE1   . PHE A 1  116 ? 19.514  58.037  64.820 1.00 93.86  ? 524 PHE B CE1   1 
ATOM   829   C  CE2   . PHE A 1  116 ? 19.995  55.717  65.086 1.00 94.57  ? 524 PHE B CE2   1 
ATOM   830   C  CZ    . PHE A 1  116 ? 19.099  56.728  64.817 1.00 94.52  ? 524 PHE B CZ    1 
ATOM   831   N  N     . TYR A 1  117 ? 26.095  58.277  65.094 1.00 83.95  ? 525 TYR B N     1 
ATOM   832   C  CA    . TYR A 1  117 ? 27.399  58.604  65.658 1.00 84.72  ? 525 TYR B CA    1 
ATOM   833   C  C     . TYR A 1  117 ? 28.024  59.825  65.002 1.00 83.33  ? 525 TYR B C     1 
ATOM   834   O  O     . TYR A 1  117 ? 28.816  60.531  65.644 1.00 94.40  ? 525 TYR B O     1 
ATOM   835   C  CB    . TYR A 1  117 ? 28.344  57.427  65.530 1.00 86.09  ? 525 TYR B CB    1 
ATOM   836   C  CG    . TYR A 1  117 ? 29.644  57.714  66.208 1.00 90.49  ? 525 TYR B CG    1 
ATOM   837   C  CD1   . TYR A 1  117 ? 29.784  57.482  67.566 1.00 100.94 ? 525 TYR B CD1   1 
ATOM   838   C  CD2   . TYR A 1  117 ? 30.724  58.241  65.501 1.00 86.77  ? 525 TYR B CD2   1 
ATOM   839   C  CE1   . TYR A 1  117 ? 30.960  57.739  68.199 1.00 107.13 ? 525 TYR B CE1   1 
ATOM   840   C  CE2   . TYR A 1  117 ? 31.907  58.511  66.127 1.00 91.46  ? 525 TYR B CE2   1 
ATOM   841   C  CZ    . TYR A 1  117 ? 32.023  58.252  67.475 1.00 105.94 ? 525 TYR B CZ    1 
ATOM   842   O  OH    . TYR A 1  117 ? 33.212  58.510  68.109 1.00 114.69 ? 525 TYR B OH    1 
ATOM   843   N  N     . ARG A 1  118 ? 27.744  60.070  63.733 1.00 79.69  ? 526 ARG B N     1 
ATOM   844   C  CA    . ARG A 1  118 ? 28.355  61.236  63.093 1.00 83.58  ? 526 ARG B CA    1 
ATOM   845   C  C     . ARG A 1  118 ? 27.510  62.496  63.200 1.00 79.22  ? 526 ARG B C     1 
ATOM   846   O  O     . ARG A 1  118 ? 28.062  63.602  63.259 1.00 88.21  ? 526 ARG B O     1 
ATOM   847   C  CB    . ARG A 1  118 ? 28.673  60.943  61.618 1.00 84.59  ? 526 ARG B CB    1 
ATOM   848   C  CG    . ARG A 1  118 ? 29.807  59.965  61.428 1.00 80.29  ? 526 ARG B CG    1 
ATOM   849   C  CD    . ARG A 1  118 ? 31.106  60.448  62.080 1.00 81.41  ? 526 ARG B CD    1 
ATOM   850   N  NE    . ARG A 1  118 ? 32.170  59.463  61.916 1.00 81.94  ? 526 ARG B NE    1 
ATOM   851   C  CZ    . ARG A 1  118 ? 33.360  59.519  62.504 1.00 88.55  ? 526 ARG B CZ    1 
ATOM   852   N  NH1   . ARG A 1  118 ? 33.670  60.517  63.320 1.00 99.72  ? 526 ARG B NH1   1 
ATOM   853   N  NH2   . ARG A 1  118 ? 34.243  58.557  62.274 1.00 87.86  ? 526 ARG B NH2   1 
ATOM   854   N  N     . PHE A 1  119 ? 26.195  62.390  63.254 1.00 78.58  ? 527 PHE B N     1 
ATOM   855   C  CA    . PHE A 1  119 ? 25.391  63.600  63.180 1.00 81.39  ? 527 PHE B CA    1 
ATOM   856   C  C     . PHE A 1  119 ? 24.600  63.916  64.429 1.00 93.88  ? 527 PHE B C     1 
ATOM   857   O  O     . PHE A 1  119 ? 24.138  65.056  64.570 1.00 104.80 ? 527 PHE B O     1 
ATOM   858   C  CB    . PHE A 1  119 ? 24.432  63.543  61.982 1.00 81.08  ? 527 PHE B CB    1 
ATOM   859   C  CG    . PHE A 1  119 ? 25.082  63.906  60.709 1.00 82.49  ? 527 PHE B CG    1 
ATOM   860   C  CD1   . PHE A 1  119 ? 26.111  63.133  60.203 1.00 81.18  ? 527 PHE B CD1   1 
ATOM   861   C  CD2   . PHE A 1  119 ? 24.709  65.056  60.040 1.00 88.53  ? 527 PHE B CD2   1 
ATOM   862   C  CE1   . PHE A 1  119 ? 26.732  63.483  59.027 1.00 82.23  ? 527 PHE B CE1   1 
ATOM   863   C  CE2   . PHE A 1  119 ? 25.328  65.406  58.866 1.00 87.27  ? 527 PHE B CE2   1 
ATOM   864   C  CZ    . PHE A 1  119 ? 26.342  64.625  58.368 1.00 85.84  ? 527 PHE B CZ    1 
ATOM   865   N  N     . MET A 1  120 ? 24.452  62.970  65.335 1.00 104.29 ? 528 MET B N     1 
ATOM   866   C  CA    . MET A 1  120 ? 23.650  63.158  66.538 1.00 109.15 ? 528 MET B CA    1 
ATOM   867   C  C     . MET A 1  120 ? 24.280  62.414  67.704 1.00 108.12 ? 528 MET B C     1 
ATOM   868   O  O     . MET A 1  120 ? 23.609  61.707  68.456 1.00 106.69 ? 528 MET B O     1 
ATOM   869   C  CB    . MET A 1  120 ? 22.208  62.702  66.320 1.00 101.60 ? 528 MET B CB    1 
ATOM   870   C  CG    . MET A 1  120 ? 21.424  63.644  65.480 1.00 100.79 ? 528 MET B CG    1 
ATOM   871   S  SD    . MET A 1  120 ? 19.810  62.968  65.120 1.00 108.44 ? 528 MET B SD    1 
ATOM   872   C  CE    . MET A 1  120 ? 19.133  64.299  64.130 1.00 110.58 ? 528 MET B CE    1 
ATOM   873   N  N     . ARG A 1  121 ? 25.599  62.535  67.828 1.00 104.90 ? 529 ARG B N     1 
ATOM   874   C  CA    . ARG A 1  121 ? 26.322  61.856  68.898 1.00 97.96  ? 529 ARG B CA    1 
ATOM   875   C  C     . ARG A 1  121 ? 25.704  62.077  70.272 1.00 97.44  ? 529 ARG B C     1 
ATOM   876   O  O     . ARG A 1  121 ? 25.600  61.101  71.038 1.00 101.03 ? 529 ARG B O     1 
ATOM   877   C  CB    . ARG A 1  121 ? 27.790  62.317  68.881 1.00 102.37 ? 529 ARG B CB    1 
ATOM   878   C  CG    . ARG A 1  121 ? 28.769  61.311  69.406 1.00 101.85 ? 529 ARG B CG    1 
ATOM   879   C  CD    . ARG A 1  121 ? 30.173  61.704  69.025 1.00 109.29 ? 529 ARG B CD    1 
ATOM   880   N  NE    . ARG A 1  121 ? 31.082  61.539  70.148 1.00 121.29 ? 529 ARG B NE    1 
ATOM   881   C  CZ    . ARG A 1  121 ? 32.356  61.908  70.130 1.00 129.05 ? 529 ARG B CZ    1 
ATOM   882   N  NH1   . ARG A 1  121 ? 32.872  62.466  69.040 1.00 129.96 ? 529 ARG B NH1   1 
ATOM   883   N  NH2   . ARG A 1  121 ? 33.112  61.722  71.205 1.00 134.38 ? 529 ARG B NH2   1 
ATOM   884   N  N     . PRO A 1  122 ? 25.297  63.296  70.641 1.00 100.18 ? 530 PRO B N     1 
ATOM   885   C  CA    . PRO A 1  122 ? 24.623  63.510  71.936 1.00 99.62  ? 530 PRO B CA    1 
ATOM   886   C  C     . PRO A 1  122 ? 23.490  62.553  72.246 1.00 105.31 ? 530 PRO B C     1 
ATOM   887   O  O     . PRO A 1  122 ? 23.333  62.131  73.400 1.00 123.22 ? 530 PRO B O     1 
ATOM   888   C  CB    . PRO A 1  122 ? 24.094  64.942  71.780 1.00 98.15  ? 530 PRO B CB    1 
ATOM   889   C  CG    . PRO A 1  122 ? 24.497  65.367  70.346 1.00 100.12 ? 530 PRO B CG    1 
ATOM   890   C  CD    . PRO A 1  122 ? 25.602  64.574  69.984 1.00 106.54 ? 530 PRO B CD    1 
ATOM   891   N  N     . LEU A 1  123 ? 22.665  62.246  71.248 1.00 97.87  ? 531 LEU B N     1 
ATOM   892   C  CA    . LEU A 1  123 ? 21.554  61.320  71.430 1.00 96.61  ? 531 LEU B CA    1 
ATOM   893   C  C     . LEU A 1  123 ? 22.037  59.969  71.931 1.00 95.70  ? 531 LEU B C     1 
ATOM   894   O  O     . LEU A 1  123 ? 21.411  59.348  72.801 1.00 96.35  ? 531 LEU B O     1 
ATOM   895   C  CB    . LEU A 1  123 ? 20.835  61.159  70.097 1.00 96.76  ? 531 LEU B CB    1 
ATOM   896   C  CG    . LEU A 1  123 ? 19.365  60.791  70.111 1.00 109.91 ? 531 LEU B CG    1 
ATOM   897   C  CD1   . LEU A 1  123 ? 18.553  62.050  70.271 1.00 112.25 ? 531 LEU B CD1   1 
ATOM   898   C  CD2   . LEU A 1  123 ? 19.044  60.089  68.814 1.00 114.91 ? 531 LEU B CD2   1 
ATOM   899   N  N     . ILE A 1  124 ? 23.128  59.472  71.352 1.00 94.44  ? 532 ILE B N     1 
ATOM   900   C  CA    . ILE A 1  124 ? 23.681  58.194  71.786 1.00 98.28  ? 532 ILE B CA    1 
ATOM   901   C  C     . ILE A 1  124 ? 24.136  58.286  73.228 1.00 107.31 ? 532 ILE B C     1 
ATOM   902   O  O     . ILE A 1  124 ? 23.912  57.372  74.029 1.00 106.53 ? 532 ILE B O     1 
ATOM   903   C  CB    . ILE A 1  124 ? 24.843  57.775  70.872 1.00 91.43  ? 532 ILE B CB    1 
ATOM   904   C  CG1   . ILE A 1  124 ? 24.313  57.290  69.522 1.00 89.54  ? 532 ILE B CG1   1 
ATOM   905   C  CG2   . ILE A 1  124 ? 25.681  56.702  71.564 1.00 86.11  ? 532 ILE B CG2   1 
ATOM   906   C  CD1   . ILE A 1  124 ? 25.385  56.675  68.685 1.00 86.92  ? 532 ILE B CD1   1 
ATOM   907   N  N     . GLU A 1  125 ? 24.822  59.376  73.565 1.00 108.76 ? 533 GLU B N     1 
ATOM   908   C  CA    . GLU A 1  125 ? 25.417  59.506  74.888 1.00 103.37 ? 533 GLU B CA    1 
ATOM   909   C  C     . GLU A 1  125 ? 24.350  59.570  75.964 1.00 104.33 ? 533 GLU B C     1 
ATOM   910   O  O     . GLU A 1  125 ? 24.550  59.063  77.074 1.00 105.89 ? 533 GLU B O     1 
ATOM   911   C  CB    . GLU A 1  125 ? 26.322  60.732  74.923 1.00 104.03 ? 533 GLU B CB    1 
ATOM   912   C  CG    . GLU A 1  125 ? 27.762  60.380  74.645 1.00 109.35 ? 533 GLU B CG    1 
ATOM   913   C  CD    . GLU A 1  125 ? 28.571  61.536  74.094 1.00 115.29 ? 533 GLU B CD    1 
ATOM   914   O  OE1   . GLU A 1  125 ? 28.011  62.651  73.966 1.00 114.82 ? 533 GLU B OE1   1 
ATOM   915   O  OE2   . GLU A 1  125 ? 29.768  61.316  73.784 1.00 115.73 ? 533 GLU B OE2   1 
ATOM   916   N  N     . ALA A 1  126 ? 23.209  60.182  75.653 1.00 104.04 ? 534 ALA B N     1 
ATOM   917   C  CA    . ALA A 1  126 ? 22.108  60.230  76.611 1.00 106.91 ? 534 ALA B CA    1 
ATOM   918   C  C     . ALA A 1  126 ? 21.625  58.830  76.962 1.00 111.93 ? 534 ALA B C     1 
ATOM   919   O  O     . ALA A 1  126 ? 21.300  58.540  78.122 1.00 115.05 ? 534 ALA B O     1 
ATOM   920   C  CB    . ALA A 1  126 ? 20.951  61.065  76.057 1.00 106.00 ? 534 ALA B CB    1 
ATOM   921   N  N     . GLY A 1  127 ? 21.595  57.940  75.981 1.00 129.59 ? 535 GLY B N     1 
ATOM   922   C  CA    . GLY A 1  127 ? 21.088  56.602  76.185 1.00 127.71 ? 535 GLY B CA    1 
ATOM   923   C  C     . GLY A 1  127 ? 19.702  56.542  75.596 1.00 126.06 ? 535 GLY B C     1 
ATOM   924   O  O     . GLY A 1  127 ? 18.860  55.739  76.010 1.00 125.33 ? 535 GLY B O     1 
ATOM   925   N  N     . TYR A 1  128 ? 19.449  57.431  74.639 1.00 124.23 ? 536 TYR B N     1 
ATOM   926   C  CA    . TYR A 1  128 ? 18.157  57.473  73.984 1.00 120.82 ? 536 TYR B CA    1 
ATOM   927   C  C     . TYR A 1  128 ? 18.053  56.475  72.833 1.00 120.26 ? 536 TYR B C     1 
ATOM   928   O  O     . TYR A 1  128 ? 16.938  56.207  72.378 1.00 130.98 ? 536 TYR B O     1 
ATOM   929   C  CB    . TYR A 1  128 ? 17.839  58.905  73.498 1.00 123.09 ? 536 TYR B CB    1 
ATOM   930   C  CG    . TYR A 1  128 ? 17.522  59.956  74.584 1.00 131.62 ? 536 TYR B CG    1 
ATOM   931   C  CD1   . TYR A 1  128 ? 17.800  59.728  75.932 1.00 130.90 ? 536 TYR B CD1   1 
ATOM   932   C  CD2   . TYR A 1  128 ? 16.924  61.182  74.247 1.00 132.21 ? 536 TYR B CD2   1 
ATOM   933   C  CE1   . TYR A 1  128 ? 17.505  60.685  76.905 1.00 128.86 ? 536 TYR B CE1   1 
ATOM   934   C  CE2   . TYR A 1  128 ? 16.621  62.139  75.218 1.00 126.34 ? 536 TYR B CE2   1 
ATOM   935   C  CZ    . TYR A 1  128 ? 16.916  61.884  76.546 1.00 119.19 ? 536 TYR B CZ    1 
ATOM   936   O  OH    . TYR A 1  128 ? 16.630  62.813  77.523 1.00 116.68 ? 536 TYR B OH    1 
ATOM   937   N  N     . VAL A 1  129 ? 19.160  55.871  72.382 1.00 106.86 ? 537 VAL B N     1 
ATOM   938   C  CA    . VAL A 1  129 ? 19.147  54.965  71.233 1.00 102.82 ? 537 VAL B CA    1 
ATOM   939   C  C     . VAL A 1  129 ? 19.102  53.518  71.698 1.00 107.48 ? 537 VAL B C     1 
ATOM   940   O  O     . VAL A 1  129 ? 19.939  53.087  72.498 1.00 105.84 ? 537 VAL B O     1 
ATOM   941   C  CB    . VAL A 1  129 ? 20.361  55.199  70.324 1.00 98.71  ? 537 VAL B CB    1 
ATOM   942   C  CG1   . VAL A 1  129 ? 20.374  54.157  69.223 1.00 96.78  ? 537 VAL B CG1   1 
ATOM   943   C  CG2   . VAL A 1  129 ? 20.294  56.583  69.726 1.00 104.35 ? 537 VAL B CG2   1 
ATOM   944   N  N     . TYR A 1  130 ? 18.167  52.751  71.143 1.00 116.73 ? 538 TYR B N     1 
ATOM   945   C  CA    . TYR A 1  130 ? 17.992  51.349  71.494 1.00 119.14 ? 538 TYR B CA    1 
ATOM   946   C  C     . TYR A 1  130 ? 17.905  50.480  70.246 1.00 121.03 ? 538 TYR B C     1 
ATOM   947   O  O     . TYR A 1  130 ? 17.529  50.946  69.165 1.00 113.02 ? 538 TYR B O     1 
ATOM   948   C  CB    . TYR A 1  130 ? 16.726  51.144  72.329 1.00 121.98 ? 538 TYR B CB    1 
ATOM   949   C  CG    . TYR A 1  130 ? 16.770  51.755  73.698 1.00 121.68 ? 538 TYR B CG    1 
ATOM   950   C  CD1   . TYR A 1  130 ? 16.356  53.068  73.913 1.00 116.04 ? 538 TYR B CD1   1 
ATOM   951   C  CD2   . TYR A 1  130 ? 17.195  51.007  74.785 1.00 124.58 ? 538 TYR B CD2   1 
ATOM   952   C  CE1   . TYR A 1  130 ? 16.379  53.617  75.176 1.00 116.39 ? 538 TYR B CE1   1 
ATOM   953   C  CE2   . TYR A 1  130 ? 17.215  51.541  76.046 1.00 120.84 ? 538 TYR B CE2   1 
ATOM   954   C  CZ    . TYR A 1  130 ? 16.808  52.845  76.239 1.00 118.47 ? 538 TYR B CZ    1 
ATOM   955   O  OH    . TYR A 1  130 ? 16.834  53.376  77.507 1.00 128.92 ? 538 TYR B OH    1 
ATOM   956   N  N     . ILE A 1  131 ? 18.209  49.189  70.427 1.00 122.90 ? 539 ILE B N     1 
ATOM   957   C  CA    . ILE A 1  131 ? 18.156  48.192  69.355 1.00 105.88 ? 539 ILE B CA    1 
ATOM   958   C  C     . ILE A 1  131 ? 17.098  47.154  69.694 1.00 106.68 ? 539 ILE B C     1 
ATOM   959   O  O     . ILE A 1  131 ? 17.297  46.325  70.593 1.00 112.64 ? 539 ILE B O     1 
ATOM   960   C  CB    . ILE A 1  131 ? 19.498  47.498  69.130 1.00 93.80  ? 539 ILE B CB    1 
ATOM   961   C  CG1   . ILE A 1  131 ? 20.521  48.473  68.561 1.00 88.95  ? 539 ILE B CG1   1 
ATOM   962   C  CG2   . ILE A 1  131 ? 19.293  46.313  68.201 1.00 95.56  ? 539 ILE B CG2   1 
ATOM   963   C  CD1   . ILE A 1  131 ? 21.860  47.827  68.380 1.00 84.96  ? 539 ILE B CD1   1 
ATOM   964   N  N     . ALA A 1  132 ? 16.015  47.135  68.928 1.00 107.11 ? 540 ALA B N     1 
ATOM   965   C  CA    . ALA A 1  132 ? 14.958  46.158  69.170 1.00 113.73 ? 540 ALA B CA    1 
ATOM   966   C  C     . ALA A 1  132 ? 15.439  44.757  68.831 1.00 124.51 ? 540 ALA B C     1 
ATOM   967   O  O     . ALA A 1  132 ? 16.313  44.562  67.989 1.00 131.75 ? 540 ALA B O     1 
ATOM   968   C  CB    . ALA A 1  132 ? 13.704  46.484  68.354 1.00 111.06 ? 540 ALA B CB    1 
ATOM   969   N  N     . GLN A 1  133 ? 14.843  43.756  69.482 1.00 140.85 ? 541 GLN B N     1 
ATOM   970   C  CA    . GLN A 1  133 ? 15.215  42.367  69.230 1.00 147.89 ? 541 GLN B CA    1 
ATOM   971   C  C     . GLN A 1  133 ? 13.992  41.472  69.170 1.00 156.12 ? 541 GLN B C     1 
ATOM   972   O  O     . GLN A 1  133 ? 13.441  41.059  70.208 1.00 157.28 ? 541 GLN B O     1 
ATOM   973   C  CB    . GLN A 1  133 ? 16.235  41.874  70.248 1.00 143.34 ? 541 GLN B CB    1 
ATOM   974   C  CG    . GLN A 1  133 ? 17.636  42.238  69.829 1.00 135.95 ? 541 GLN B CG    1 
ATOM   975   C  CD    . GLN A 1  133 ? 18.662  41.517  70.647 1.00 138.09 ? 541 GLN B CD    1 
ATOM   976   O  OE1   . GLN A 1  133 ? 18.420  41.195  71.809 1.00 140.80 ? 541 GLN B OE1   1 
ATOM   977   N  NE2   . GLN A 1  133 ? 19.810  41.230  70.045 1.00 140.12 ? 541 GLN B NE2   1 
ATOM   978   N  N     . PRO A 1  134 ? 13.543  41.153  67.965 1.00 161.89 ? 542 PRO B N     1 
ATOM   979   C  CA    . PRO A 1  134 ? 12.427  40.269  67.778 1.00 171.43 ? 542 PRO B CA    1 
ATOM   980   C  C     . PRO A 1  134 ? 12.841  38.806  67.830 1.00 175.55 ? 542 PRO B C     1 
ATOM   981   O  O     . PRO A 1  134 ? 14.038  38.468  67.918 1.00 171.58 ? 542 PRO B O     1 
ATOM   982   C  CB    . PRO A 1  134 ? 11.922  40.655  66.368 1.00 168.88 ? 542 PRO B CB    1 
ATOM   983   C  CG    . PRO A 1  134 ? 12.579  41.900  66.015 1.00 159.11 ? 542 PRO B CG    1 
ATOM   984   C  CD    . PRO A 1  134 ? 13.877  41.861  66.723 1.00 158.38 ? 542 PRO B CD    1 
ATOM   985   N  N     . PRO A 1  135 ? 11.820  37.901  67.761 1.00 184.35 ? 543 PRO B N     1 
ATOM   986   C  CA    . PRO A 1  135 ? 12.008  36.436  67.766 1.00 193.22 ? 543 PRO B CA    1 
ATOM   987   C  C     . PRO A 1  135 ? 13.303  35.887  67.199 1.00 197.10 ? 543 PRO B C     1 
ATOM   988   O  O     . PRO A 1  135 ? 13.639  36.158  66.040 1.00 199.80 ? 543 PRO B O     1 
ATOM   989   C  CB    . PRO A 1  135 ? 10.828  35.971  66.898 1.00 192.72 ? 543 PRO B CB    1 
ATOM   990   C  CG    . PRO A 1  135 ? 9.828   37.114  66.919 1.00 190.37 ? 543 PRO B CG    1 
ATOM   991   C  CD    . PRO A 1  135 ? 10.396  38.249  67.643 1.00 187.93 ? 543 PRO B CD    1 
ATOM   992   N  N     . THR A 1  136 ? 14.002  35.072  67.990 1.00 193.63 ? 544 THR B N     1 
ATOM   993   C  CA    . THR A 1  136 ? 15.285  34.479  67.609 1.00 184.31 ? 544 THR B CA    1 
ATOM   994   C  C     . THR A 1  136 ? 15.285  33.906  66.194 1.00 176.95 ? 544 THR B C     1 
ATOM   995   O  O     . THR A 1  136 ? 15.967  34.420  65.308 1.00 166.97 ? 544 THR B O     1 
ATOM   996   C  CB    . THR A 1  136 ? 15.698  33.357  68.590 1.00 182.60 ? 544 THR B CB    1 
ATOM   997   O  OG1   . THR A 1  136 ? 14.773  32.264  68.499 1.00 183.94 ? 544 THR B OG1   1 
ATOM   998   C  CG2   . THR A 1  136 ? 15.723  33.878  70.018 1.00 182.04 ? 544 THR B CG2   1 
ATOM   999   N  N     . TYR A 1  138 ? 14.205  32.712  60.744 1.00 181.55 ? 580 TYR B N     1 
ATOM   1000  C  CA    . TYR A 1  138 ? 14.317  32.826  59.292 1.00 178.74 ? 580 TYR B CA    1 
ATOM   1001  C  C     . TYR A 1  138 ? 13.286  33.803  58.745 1.00 182.82 ? 580 TYR B C     1 
ATOM   1002  O  O     . TYR A 1  138 ? 13.356  34.205  57.587 1.00 182.47 ? 580 TYR B O     1 
ATOM   1003  C  CB    . TYR A 1  138 ? 14.138  31.463  58.620 1.00 179.49 ? 580 TYR B CB    1 
ATOM   1004  C  CG    . TYR A 1  138 ? 12.701  30.980  58.584 1.00 181.44 ? 580 TYR B CG    1 
ATOM   1005  C  CD1   . TYR A 1  138 ? 12.154  30.286  59.659 1.00 181.83 ? 580 TYR B CD1   1 
ATOM   1006  C  CD2   . TYR A 1  138 ? 11.893  31.211  57.470 1.00 177.51 ? 580 TYR B CD2   1 
ATOM   1007  C  CE1   . TYR A 1  138 ? 10.844  29.840  59.630 1.00 180.90 ? 580 TYR B CE1   1 
ATOM   1008  C  CE2   . TYR A 1  138 ? 10.584  30.773  57.432 1.00 175.36 ? 580 TYR B CE2   1 
ATOM   1009  C  CZ    . TYR A 1  138 ? 10.064  30.087  58.514 1.00 175.54 ? 580 TYR B CZ    1 
ATOM   1010  O  OH    . TYR A 1  138 ? 8.761   29.646  58.480 1.00 173.12 ? 580 TYR B OH    1 
ATOM   1011  N  N     . LYS A 1  139 ? 12.310  34.172  59.564 1.00 185.23 ? 581 LYS B N     1 
ATOM   1012  C  CA    . LYS A 1  139 ? 11.275  35.109  59.148 1.00 182.38 ? 581 LYS B CA    1 
ATOM   1013  C  C     . LYS A 1  139 ? 11.531  36.449  59.827 1.00 191.39 ? 581 LYS B C     1 
ATOM   1014  O  O     . LYS A 1  139 ? 11.430  36.559  61.054 1.00 206.46 ? 581 LYS B O     1 
ATOM   1015  C  CB    . LYS A 1  139 ? 9.876   34.579  59.474 1.00 174.90 ? 581 LYS B CB    1 
ATOM   1016  N  N     . GLY A 1  140 ? 11.889  37.454  59.032 1.00 186.33 ? 582 GLY B N     1 
ATOM   1017  C  CA    . GLY A 1  140 ? 12.092  38.800  59.524 1.00 183.96 ? 582 GLY B CA    1 
ATOM   1018  C  C     . GLY A 1  140 ? 10.794  39.573  59.559 1.00 186.13 ? 582 GLY B C     1 
ATOM   1019  O  O     . GLY A 1  140 ? 9.709   39.029  59.358 1.00 196.05 ? 582 GLY B O     1 
ATOM   1020  N  N     . LEU A 1  141 ? 10.907  40.868  59.826 1.00 182.94 ? 583 LEU B N     1 
ATOM   1021  C  CA    . LEU A 1  141 ? 9.714   41.700  59.789 1.00 177.72 ? 583 LEU B CA    1 
ATOM   1022  C  C     . LEU A 1  141 ? 9.132   41.640  58.386 1.00 175.79 ? 583 LEU B C     1 
ATOM   1023  O  O     . LEU A 1  141 ? 9.846   41.802  57.389 1.00 172.49 ? 583 LEU B O     1 
ATOM   1024  C  CB    . LEU A 1  141 ? 10.019  43.138  60.197 1.00 163.91 ? 583 LEU B CB    1 
ATOM   1025  C  CG    . LEU A 1  141 ? 10.716  43.243  61.548 1.00 148.58 ? 583 LEU B CG    1 
ATOM   1026  C  CD1   . LEU A 1  141 ? 11.174  44.656  61.798 1.00 146.06 ? 583 LEU B CD1   1 
ATOM   1027  C  CD2   . LEU A 1  141 ? 9.802   42.757  62.662 1.00 147.64 ? 583 LEU B CD2   1 
ATOM   1028  N  N     . GLY A 1  142 ? 7.841   41.356  58.311 1.00 174.22 ? 584 GLY B N     1 
ATOM   1029  C  CA    . GLY A 1  142 ? 7.259   40.865  57.079 1.00 172.97 ? 584 GLY B CA    1 
ATOM   1030  C  C     . GLY A 1  142 ? 6.059   39.994  57.363 1.00 178.83 ? 584 GLY B C     1 
ATOM   1031  O  O     . GLY A 1  142 ? 5.105   40.445  57.999 1.00 185.14 ? 584 GLY B O     1 
ATOM   1032  N  N     . GLU A 1  143 ? 6.103   38.748  56.913 1.00 183.40 ? 585 GLU B N     1 
ATOM   1033  C  CA    . GLU A 1  143 ? 4.971   37.842  57.009 1.00 181.84 ? 585 GLU B CA    1 
ATOM   1034  C  C     . GLU A 1  143 ? 4.717   37.529  58.470 1.00 184.52 ? 585 GLU B C     1 
ATOM   1035  O  O     . GLU A 1  143 ? 4.996   36.418  58.935 1.00 184.62 ? 585 GLU B O     1 
ATOM   1036  C  CB    . GLU A 1  143 ? 5.249   36.582  56.195 1.00 181.43 ? 585 GLU B CB    1 
ATOM   1037  C  CG    . GLU A 1  143 ? 6.304   36.756  55.117 1.00 152.49 ? 585 GLU B CG    1 
ATOM   1038  C  CD    . GLU A 1  143 ? 7.725   36.782  55.692 1.00 133.02 ? 585 GLU B CD    1 
ATOM   1039  O  OE1   . GLU A 1  143 ? 8.636   36.203  55.056 1.00 116.19 ? 585 GLU B OE1   1 
ATOM   1040  O  OE2   . GLU A 1  143 ? 7.929   37.388  56.781 1.00 135.22 ? 585 GLU B OE2   1 
ATOM   1041  N  N     . MET A 1  144 ? 4.164   38.494  59.195 1.00 195.75 ? 586 MET B N     1 
ATOM   1042  C  CA    . MET A 1  144 ? 3.994   38.342  60.631 1.00 198.50 ? 586 MET B CA    1 
ATOM   1043  C  C     . MET A 1  144 ? 2.898   39.268  61.123 1.00 201.90 ? 586 MET B C     1 
ATOM   1044  O  O     . MET A 1  144 ? 2.944   40.481  60.889 1.00 200.05 ? 586 MET B O     1 
ATOM   1045  C  CB    . MET A 1  144 ? 5.305   38.622  61.382 1.00 194.85 ? 586 MET B CB    1 
ATOM   1046  N  N     . ASN A 1  145 ? 1.945   38.677  61.833 1.00 208.09 ? 587 ASN B N     1 
ATOM   1047  C  CA    . ASN A 1  145 ? 0.766   39.395  62.283 1.00 205.18 ? 587 ASN B CA    1 
ATOM   1048  C  C     . ASN A 1  145 ? 1.137   40.621  63.107 1.00 206.70 ? 587 ASN B C     1 
ATOM   1049  O  O     . ASN A 1  145 ? 2.087   40.606  63.891 1.00 214.39 ? 587 ASN B O     1 
ATOM   1050  C  CB    . ASN A 1  145 ? -0.126  38.460  63.096 1.00 197.39 ? 587 ASN B CB    1 
ATOM   1051  C  CG    . ASN A 1  145 ? -1.587  38.841  63.005 1.00 164.05 ? 587 ASN B CG    1 
ATOM   1052  O  OD1   . ASN A 1  145 ? -2.098  39.142  61.910 1.00 146.75 ? 587 ASN B OD1   1 
ATOM   1053  N  ND2   . ASN A 1  145 ? -2.273  38.850  64.157 1.00 152.74 ? 587 ASN B ND2   1 
ATOM   1054  N  N     . ALA A 1  146 ? 0.368   41.692  62.913 1.00 199.80 ? 588 ALA B N     1 
ATOM   1055  C  CA    . ALA A 1  146 ? 0.607   42.930  63.643 1.00 197.78 ? 588 ALA B CA    1 
ATOM   1056  C  C     . ALA A 1  146 ? 0.461   42.727  65.143 1.00 206.05 ? 588 ALA B C     1 
ATOM   1057  O  O     . ALA A 1  146 ? 1.240   43.274  65.932 1.00 210.21 ? 588 ALA B O     1 
ATOM   1058  C  CB    . ALA A 1  146 ? -0.359  43.998  63.158 1.00 192.89 ? 588 ALA B CB    1 
ATOM   1059  N  N     . ASP A 1  147 ? -0.546  41.956  65.556 1.00 210.10 ? 589 ASP B N     1 
ATOM   1060  C  CA    . ASP A 1  147 ? -0.689  41.619  66.969 1.00 212.62 ? 589 ASP B CA    1 
ATOM   1061  C  C     . ASP A 1  147 ? 0.520   40.837  67.460 1.00 215.27 ? 589 ASP B C     1 
ATOM   1062  O  O     . ASP A 1  147 ? 1.033   41.090  68.557 1.00 219.01 ? 589 ASP B O     1 
ATOM   1063  C  CB    . ASP A 1  147 ? -1.973  40.819  67.193 1.00 211.01 ? 589 ASP B CB    1 
ATOM   1064  N  N     . GLN A 1  148 ? 0.991   39.880  66.655 1.00 214.35 ? 590 GLN B N     1 
ATOM   1065  C  CA    . GLN A 1  148 ? 2.197   39.135  67.001 1.00 208.90 ? 590 GLN B CA    1 
ATOM   1066  C  C     . GLN A 1  148 ? 3.401   40.055  67.105 1.00 207.25 ? 590 GLN B C     1 
ATOM   1067  O  O     . GLN A 1  148 ? 4.219   39.915  68.020 1.00 211.61 ? 590 GLN B O     1 
ATOM   1068  C  CB    . GLN A 1  148 ? 2.465   38.050  65.961 1.00 182.31 ? 590 GLN B CB    1 
ATOM   1069  C  CG    . GLN A 1  148 ? 1.574   36.825  66.067 1.00 157.27 ? 590 GLN B CG    1 
ATOM   1070  C  CD    . GLN A 1  148 ? 2.107   35.649  65.236 1.00 145.84 ? 590 GLN B CD    1 
ATOM   1071  O  OE1   . GLN A 1  148 ? 3.254   35.674  64.752 1.00 139.91 ? 590 GLN B OE1   1 
ATOM   1072  N  NE2   . GLN A 1  148 ? 1.272   34.617  65.063 1.00 137.87 ? 590 GLN B NE2   1 
ATOM   1073  N  N     . LEU A 1  149 ? 3.540   40.987  66.156 1.00 203.42 ? 591 LEU B N     1 
ATOM   1074  C  CA    . LEU A 1  149 ? 4.653   41.933  66.189 1.00 193.96 ? 591 LEU B CA    1 
ATOM   1075  C  C     . LEU A 1  149 ? 4.618   42.762  67.456 1.00 207.77 ? 591 LEU B C     1 
ATOM   1076  O  O     . LEU A 1  149 ? 5.656   42.990  68.091 1.00 213.88 ? 591 LEU B O     1 
ATOM   1077  C  CB    . LEU A 1  149 ? 4.602   42.859  64.974 1.00 176.89 ? 591 LEU B CB    1 
ATOM   1078  C  CG    . LEU A 1  149 ? 5.025   42.303  63.616 1.00 141.73 ? 591 LEU B CG    1 
ATOM   1079  C  CD1   . LEU A 1  149 ? 4.998   43.411  62.580 1.00 114.64 ? 591 LEU B CD1   1 
ATOM   1080  C  CD2   . LEU A 1  149 ? 6.409   41.677  63.706 1.00 131.25 ? 591 LEU B CD2   1 
ATOM   1081  N  N     . TRP A 1  150 ? 3.427   43.238  67.826 1.00 215.06 ? 592 TRP B N     1 
ATOM   1082  C  CA    . TRP A 1  150 ? 3.278   44.020  69.044 1.00 214.66 ? 592 TRP B CA    1 
ATOM   1083  C  C     . TRP A 1  150 ? 3.660   43.211  70.275 1.00 219.67 ? 592 TRP B C     1 
ATOM   1084  O  O     . TRP A 1  150 ? 4.348   43.709  71.176 1.00 222.06 ? 592 TRP B O     1 
ATOM   1085  C  CB    . TRP A 1  150 ? 1.847   44.555  69.157 1.00 209.68 ? 592 TRP B CB    1 
ATOM   1086  C  CG    . TRP A 1  150 ? 1.413   44.736  70.581 1.00 202.12 ? 592 TRP B CG    1 
ATOM   1087  C  CD1   . TRP A 1  150 ? 0.721   43.843  71.344 1.00 198.07 ? 592 TRP B CD1   1 
ATOM   1088  C  CD2   . TRP A 1  150 ? 1.653   45.876  71.419 1.00 198.31 ? 592 TRP B CD2   1 
ATOM   1089  N  NE1   . TRP A 1  150 ? 0.510   44.358  72.601 1.00 196.45 ? 592 TRP B NE1   1 
ATOM   1090  C  CE2   . TRP A 1  150 ? 1.073   45.606  72.670 1.00 196.46 ? 592 TRP B CE2   1 
ATOM   1091  C  CE3   . TRP A 1  150 ? 2.273   47.109  71.224 1.00 194.60 ? 592 TRP B CE3   1 
ATOM   1092  C  CZ2   . TRP A 1  150 ? 1.121   46.520  73.723 1.00 196.87 ? 592 TRP B CZ2   1 
ATOM   1093  C  CZ3   . TRP A 1  150 ? 2.345   47.996  72.268 1.00 192.28 ? 592 TRP B CZ3   1 
ATOM   1094  C  CH2   . TRP A 1  150 ? 1.764   47.707  73.498 1.00 193.87 ? 592 TRP B CH2   1 
ATOM   1095  N  N     . GLU A 1  151 ? 3.245   41.948  70.315 1.00 220.69 ? 593 GLU B N     1 
ATOM   1096  C  CA    . GLU A 1  151 ? 3.456   41.115  71.492 1.00 218.02 ? 593 GLU B CA    1 
ATOM   1097  C  C     . GLU A 1  151 ? 4.930   40.780  71.706 1.00 218.35 ? 593 GLU B C     1 
ATOM   1098  O  O     . GLU A 1  151 ? 5.420   40.817  72.843 1.00 218.06 ? 593 GLU B O     1 
ATOM   1099  C  CB    . GLU A 1  151 ? 2.604   39.851  71.364 1.00 214.06 ? 593 GLU B CB    1 
ATOM   1100  N  N     . THR A 1  152 ? 5.652   40.429  70.636 1.00 220.32 ? 594 THR B N     1 
ATOM   1101  C  CA    . THR A 1  152 ? 7.036   39.967  70.801 1.00 215.07 ? 594 THR B CA    1 
ATOM   1102  C  C     . THR A 1  152 ? 7.975   41.098  71.215 1.00 217.71 ? 594 THR B C     1 
ATOM   1103  O  O     . THR A 1  152 ? 8.814   40.916  72.109 1.00 220.32 ? 594 THR B O     1 
ATOM   1104  C  CB    . THR A 1  152 ? 7.571   39.301  69.522 1.00 199.27 ? 594 THR B CB    1 
ATOM   1105  O  OG1   . THR A 1  152 ? 7.680   40.281  68.480 1.00 191.31 ? 594 THR B OG1   1 
ATOM   1106  C  CG2   . THR A 1  152 ? 6.681   38.162  69.082 1.00 197.61 ? 594 THR B CG2   1 
ATOM   1107  N  N     . THR A 1  153 ? 7.891   42.251  70.559 1.00 215.03 ? 595 THR B N     1 
ATOM   1108  C  CA    . THR A 1  153 ? 8.809   43.341  70.885 1.00 209.54 ? 595 THR B CA    1 
ATOM   1109  C  C     . THR A 1  153 ? 8.166   44.707  71.079 1.00 205.65 ? 595 THR B C     1 
ATOM   1110  O  O     . THR A 1  153 ? 8.863   45.619  71.548 1.00 201.20 ? 595 THR B O     1 
ATOM   1111  C  CB    . THR A 1  153 ? 9.922   43.465  69.825 1.00 205.35 ? 595 THR B CB    1 
ATOM   1112  O  OG1   . THR A 1  153 ? 10.828  44.511  70.205 1.00 203.81 ? 595 THR B OG1   1 
ATOM   1113  C  CG2   . THR A 1  153 ? 9.331   43.784  68.455 1.00 201.62 ? 595 THR B CG2   1 
ATOM   1114  N  N     . MET A 1  154 ? 6.887   44.890  70.771 1.00 207.25 ? 596 MET B N     1 
ATOM   1115  C  CA    . MET A 1  154 ? 6.316   46.227  70.906 1.00 204.56 ? 596 MET B CA    1 
ATOM   1116  C  C     . MET A 1  154 ? 5.930   46.536  72.348 1.00 209.09 ? 596 MET B C     1 
ATOM   1117  O  O     . MET A 1  154 ? 6.107   47.679  72.798 1.00 207.08 ? 596 MET B O     1 
ATOM   1118  C  CB    . MET A 1  154 ? 5.104   46.376  70.000 1.00 200.09 ? 596 MET B CB    1 
ATOM   1119  C  CG    . MET A 1  154 ? 4.832   47.736  69.480 1.00 187.91 ? 596 MET B CG    1 
ATOM   1120  S  SD    . MET A 1  154 ? 5.636   47.943  67.908 1.00 176.31 ? 596 MET B SD    1 
ATOM   1121  C  CE    . MET A 1  154 ? 4.780   46.682  66.976 1.00 179.82 ? 596 MET B CE    1 
ATOM   1122  N  N     . ASN A 1  155 ? 5.427   45.539  73.095 1.00 215.19 ? 597 ASN B N     1 
ATOM   1123  C  CA    . ASN A 1  155 ? 4.874   45.809  74.421 1.00 217.86 ? 597 ASN B CA    1 
ATOM   1124  C  C     . ASN A 1  155 ? 5.958   45.909  75.484 1.00 219.20 ? 597 ASN B C     1 
ATOM   1125  O  O     . ASN A 1  155 ? 6.793   45.006  75.601 1.00 226.76 ? 597 ASN B O     1 
ATOM   1126  C  CB    . ASN A 1  155 ? 3.854   44.740  74.832 1.00 212.76 ? 597 ASN B CB    1 
ATOM   1127  N  N     . PRO A 1  156 ? 5.912   46.958  76.306 1.00 208.82 ? 598 PRO B N     1 
ATOM   1128  C  CA    . PRO A 1  156 ? 6.865   47.160  77.420 1.00 202.53 ? 598 PRO B CA    1 
ATOM   1129  C  C     . PRO A 1  156 ? 6.910   46.043  78.448 1.00 195.73 ? 598 PRO B C     1 
ATOM   1130  O  O     . PRO A 1  156 ? 7.880   45.969  79.221 1.00 192.85 ? 598 PRO B O     1 
ATOM   1131  C  CB    . PRO A 1  156 ? 6.347   48.455  78.074 1.00 202.51 ? 598 PRO B CB    1 
ATOM   1132  C  CG    . PRO A 1  156 ? 5.365   49.049  77.056 1.00 201.81 ? 598 PRO B CG    1 
ATOM   1133  C  CD    . PRO A 1  156 ? 4.825   47.939  76.266 1.00 205.30 ? 598 PRO B CD    1 
ATOM   1134  N  N     . GLU A 1  157 ? 5.892   45.193  78.504 1.00 189.15 ? 599 GLU B N     1 
ATOM   1135  C  CA    . GLU A 1  157 ? 5.780   44.188  79.546 1.00 188.87 ? 599 GLU B CA    1 
ATOM   1136  C  C     . GLU A 1  157 ? 6.473   42.872  79.209 1.00 193.89 ? 599 GLU B C     1 
ATOM   1137  O  O     . GLU A 1  157 ? 6.627   42.039  80.107 1.00 198.89 ? 599 GLU B O     1 
ATOM   1138  C  CB    . GLU A 1  157 ? 4.294   43.935  79.864 1.00 190.82 ? 599 GLU B CB    1 
ATOM   1139  N  N     . HIS A 1  158 ? 6.897   42.651  77.958 1.00 194.61 ? 600 HIS B N     1 
ATOM   1140  C  CA    . HIS A 1  158 ? 7.572   41.407  77.584 1.00 192.03 ? 600 HIS B CA    1 
ATOM   1141  C  C     . HIS A 1  158 ? 8.861   41.619  76.770 1.00 188.49 ? 600 HIS B C     1 
ATOM   1142  O  O     . HIS A 1  158 ? 9.726   40.737  76.757 1.00 187.30 ? 600 HIS B O     1 
ATOM   1143  C  CB    . HIS A 1  158 ? 6.609   40.485  76.813 1.00 186.87 ? 600 HIS B CB    1 
ATOM   1144  C  CG    . HIS A 1  158 ? 5.380   40.098  77.585 1.00 185.94 ? 600 HIS B CG    1 
ATOM   1145  N  ND1   . HIS A 1  158 ? 5.374   39.095  78.531 1.00 188.49 ? 600 HIS B ND1   1 
ATOM   1146  C  CD2   . HIS A 1  158 ? 4.111   40.569  77.531 1.00 187.77 ? 600 HIS B CD2   1 
ATOM   1147  C  CE1   . HIS A 1  158 ? 4.159   38.974  79.036 1.00 190.81 ? 600 HIS B CE1   1 
ATOM   1148  N  NE2   . HIS A 1  158 ? 3.374   39.858  78.446 1.00 190.18 ? 600 HIS B NE2   1 
ATOM   1149  N  N     . ARG A 1  159 ? 9.025   42.789  76.144 1.00 184.93 ? 601 ARG B N     1 
ATOM   1150  C  CA    . ARG A 1  159 ? 10.077  43.046  75.145 1.00 179.77 ? 601 ARG B CA    1 
ATOM   1151  C  C     . ARG A 1  159 ? 11.484  43.149  75.744 1.00 172.94 ? 601 ARG B C     1 
ATOM   1152  O  O     . ARG A 1  159 ? 11.660  43.571  76.884 1.00 174.86 ? 601 ARG B O     1 
ATOM   1153  C  CB    . ARG A 1  159 ? 9.752   44.346  74.395 1.00 178.47 ? 601 ARG B CB    1 
ATOM   1154  C  CG    . ARG A 1  159 ? 9.660   45.552  75.330 1.00 178.31 ? 601 ARG B CG    1 
ATOM   1155  C  CD    . ARG A 1  159 ? 9.158   46.789  74.609 1.00 173.35 ? 601 ARG B CD    1 
ATOM   1156  N  NE    . ARG A 1  159 ? 9.375   47.979  75.423 1.00 170.66 ? 601 ARG B NE    1 
ATOM   1157  C  CZ    . ARG A 1  159 ? 8.938   49.194  75.113 1.00 171.52 ? 601 ARG B CZ    1 
ATOM   1158  N  NH1   . ARG A 1  159 ? 8.243   49.389  73.999 1.00 173.65 ? 601 ARG B NH1   1 
ATOM   1159  N  NH2   . ARG A 1  159 ? 9.198   50.214  75.922 1.00 171.10 ? 601 ARG B NH2   1 
ATOM   1160  N  N     . ALA A 1  160 ? 12.503  42.859  74.916 1.00 161.02 ? 602 ALA B N     1 
ATOM   1161  C  CA    . ALA A 1  160 ? 13.915  42.883  75.330 1.00 147.85 ? 602 ALA B CA    1 
ATOM   1162  C  C     . ALA A 1  160 ? 14.757  43.776  74.407 1.00 135.77 ? 602 ALA B C     1 
ATOM   1163  O  O     . ALA A 1  160 ? 15.505  43.281  73.555 1.00 140.59 ? 602 ALA B O     1 
ATOM   1164  C  CB    . ALA A 1  160 ? 14.482  41.470  75.363 1.00 144.14 ? 602 ALA B CB    1 
ATOM   1165  N  N     . LEU A 1  161 ? 14.685  45.089  74.623 1.00 124.10 ? 603 LEU B N     1 
ATOM   1166  C  CA    . LEU A 1  161 ? 15.511  46.030  73.878 1.00 113.59 ? 603 LEU B CA    1 
ATOM   1167  C  C     . LEU A 1  161 ? 16.911  46.123  74.478 1.00 108.42 ? 603 LEU B C     1 
ATOM   1168  O  O     . LEU A 1  161 ? 17.149  45.762  75.633 1.00 107.30 ? 603 LEU B O     1 
ATOM   1169  C  CB    . LEU A 1  161 ? 14.879  47.425  73.866 1.00 112.83 ? 603 LEU B CB    1 
ATOM   1170  C  CG    . LEU A 1  161 ? 13.352  47.502  73.766 1.00 120.45 ? 603 LEU B CG    1 
ATOM   1171  C  CD1   . LEU A 1  161 ? 12.866  48.891  74.172 1.00 111.97 ? 603 LEU B CD1   1 
ATOM   1172  C  CD2   . LEU A 1  161 ? 12.870  47.159  72.354 1.00 122.26 ? 603 LEU B CD2   1 
ATOM   1173  N  N     . LEU A 1  162 ? 17.840  46.633  73.678 1.00 105.85 ? 604 LEU B N     1 
ATOM   1174  C  CA    . LEU A 1  162 ? 19.222  46.812  74.090 1.00 105.71 ? 604 LEU B CA    1 
ATOM   1175  C  C     . LEU A 1  162 ? 19.619  48.265  73.939 1.00 107.78 ? 604 LEU B C     1 
ATOM   1176  O  O     . LEU A 1  162 ? 19.369  48.881  72.895 1.00 113.51 ? 604 LEU B O     1 
ATOM   1177  C  CB    . LEU A 1  162 ? 20.175  45.997  73.249 1.00 104.36 ? 604 LEU B CB    1 
ATOM   1178  C  CG    . LEU A 1  162 ? 20.013  44.505  73.326 1.00 117.25 ? 604 LEU B CG    1 
ATOM   1179  C  CD1   . LEU A 1  162 ? 20.933  43.953  72.266 1.00 127.33 ? 604 LEU B CD1   1 
ATOM   1180  C  CD2   . LEU A 1  162 ? 20.436  44.128  74.714 1.00 116.96 ? 604 LEU B CD2   1 
ATOM   1181  N  N     . GLN A 1  163 ? 20.278  48.796  74.956 1.00 107.54 ? 605 GLN B N     1 
ATOM   1182  C  CA    . GLN A 1  163 ? 20.691  50.191  74.949 1.00 105.16 ? 605 GLN B CA    1 
ATOM   1183  C  C     . GLN A 1  163 ? 22.076  50.320  74.337 1.00 123.86 ? 605 GLN B C     1 
ATOM   1184  O  O     . GLN A 1  163 ? 23.004  49.616  74.743 1.00 126.18 ? 605 GLN B O     1 
ATOM   1185  C  CB    . GLN A 1  163 ? 20.689  50.754  76.367 1.00 103.25 ? 605 GLN B CB    1 
ATOM   1186  C  CG    . GLN A 1  163 ? 20.518  52.232  76.377 1.00 110.88 ? 605 GLN B CG    1 
ATOM   1187  C  CD    . GLN A 1  163 ? 20.660  52.833  77.750 1.00 112.17 ? 605 GLN B CD    1 
ATOM   1188  O  OE1   . GLN A 1  163 ? 21.610  52.534  78.481 1.00 106.74 ? 605 GLN B OE1   1 
ATOM   1189  N  NE2   . GLN A 1  163 ? 19.711  53.694  78.115 1.00 116.00 ? 605 GLN B NE2   1 
ATOM   1190  N  N     . VAL A 1  164 ? 22.230  51.247  73.393 1.00 67.66  ? 606 VAL B N     1 
ATOM   1191  C  CA    . VAL A 1  164 ? 23.516  51.408  72.713 1.00 88.19  ? 606 VAL B CA    1 
ATOM   1192  C  C     . VAL A 1  164 ? 24.441  52.265  73.572 1.00 82.23  ? 606 VAL B C     1 
ATOM   1193  O  O     . VAL A 1  164 ? 24.251  53.474  73.678 1.00 96.69  ? 606 VAL B O     1 
ATOM   1194  C  CB    . VAL A 1  164 ? 23.357  52.018  71.323 1.00 95.04  ? 606 VAL B CB    1 
ATOM   1195  C  CG1   . VAL A 1  164 ? 24.608  51.718  70.496 1.00 77.01  ? 606 VAL B CG1   1 
ATOM   1196  C  CG2   . VAL A 1  164 ? 22.101  51.505  70.667 1.00 100.43 ? 606 VAL B CG2   1 
ATOM   1197  N  N     . LYS A 1  165 ? 25.485  51.656  74.118 1.00 71.02  ? 607 LYS B N     1 
ATOM   1198  C  CA    . LYS A 1  165 ? 26.501  52.385  74.863 1.00 73.50  ? 607 LYS B CA    1 
ATOM   1199  C  C     . LYS A 1  165 ? 27.697  52.727  73.996 1.00 83.15  ? 607 LYS B C     1 
ATOM   1200  O  O     . LYS A 1  165 ? 28.114  51.955  73.128 1.00 109.07 ? 607 LYS B O     1 
ATOM   1201  C  CB    . LYS A 1  165 ? 26.968  51.574  76.073 1.00 71.02  ? 607 LYS B CB    1 
ATOM   1202  N  N     . LEU A 1  166 ? 28.272  53.881  74.249 1.00 74.24  ? 608 LEU B N     1 
ATOM   1203  C  CA    . LEU A 1  166 ? 29.546  54.362  73.655 1.00 75.80  ? 608 LEU B CA    1 
ATOM   1204  C  C     . LEU A 1  166 ? 30.719  54.336  74.619 1.00 85.66  ? 608 LEU B C     1 
ATOM   1205  O  O     . LEU A 1  166 ? 30.653  55.004  75.656 1.00 106.58 ? 608 LEU B O     1 
ATOM   1206  C  CB    . LEU A 1  166 ? 29.396  55.802  73.376 1.00 71.64  ? 608 LEU B CB    1 
ATOM   1207  C  CG    . LEU A 1  166 ? 30.662  56.605  73.031 1.00 79.01  ? 608 LEU B CG    1 
ATOM   1208  C  CD1   . LEU A 1  166 ? 31.535  55.733  72.140 1.00 78.75  ? 608 LEU B CD1   1 
ATOM   1209  C  CD2   . LEU A 1  166 ? 30.316  57.868  72.302 1.00 81.63  ? 608 LEU B CD2   1 
ATOM   1210  N  N     . GLU A 1  167 ? 31.750  53.459  74.364 1.00 135.68 ? 609 GLU B N     1 
ATOM   1211  C  CA    . GLU A 1  167 ? 32.615  53.538  75.523 1.00 99.84  ? 609 GLU B CA    1 
ATOM   1212  C  C     . GLU A 1  167 ? 33.872  54.420  75.462 1.00 97.49  ? 609 GLU B C     1 
ATOM   1213  O  O     . GLU A 1  167 ? 34.186  55.218  76.402 1.00 111.48 ? 609 GLU B O     1 
ATOM   1214  C  CB    . GLU A 1  167 ? 32.893  52.145  76.111 1.00 79.72  ? 609 GLU B CB    1 
ATOM   1215  N  N     . ASP A 1  168 ? 34.522  54.279  74.363 1.00 102.69 ? 610 ASP B N     1 
ATOM   1216  C  CA    . ASP A 1  168 ? 35.744  54.946  73.999 1.00 103.57 ? 610 ASP B CA    1 
ATOM   1217  C  C     . ASP A 1  168 ? 35.534  55.684  72.676 1.00 110.24 ? 610 ASP B C     1 
ATOM   1218  O  O     . ASP A 1  168 ? 35.396  55.056  71.621 1.00 112.81 ? 610 ASP B O     1 
ATOM   1219  C  CB    . ASP A 1  168 ? 36.867  53.908  73.876 1.00 97.17  ? 610 ASP B CB    1 
ATOM   1220  C  CG    . ASP A 1  168 ? 38.197  54.525  73.475 1.00 100.15 ? 610 ASP B CG    1 
ATOM   1221  O  OD1   . ASP A 1  168 ? 38.299  55.769  73.451 1.00 109.91 ? 610 ASP B OD1   1 
ATOM   1222  O  OD2   . ASP A 1  168 ? 39.152  53.762  73.200 1.00 97.24  ? 610 ASP B OD2   1 
ATOM   1223  N  N     . ALA A 1  169 ? 35.582  57.023  72.706 1.00 112.01 ? 611 ALA B N     1 
ATOM   1224  C  CA    . ALA A 1  169 ? 35.270  57.796  71.498 1.00 109.88 ? 611 ALA B CA    1 
ATOM   1225  C  C     . ALA A 1  169 ? 36.394  57.766  70.466 1.00 110.97 ? 611 ALA B C     1 
ATOM   1226  O  O     . ALA A 1  169 ? 36.126  57.862  69.267 1.00 112.98 ? 611 ALA B O     1 
ATOM   1227  C  CB    . ALA A 1  169 ? 34.918  59.239  71.845 1.00 113.27 ? 611 ALA B CB    1 
ATOM   1228  N  N     . ILE A 1  170 ? 37.648  57.666  70.898 1.00 112.82 ? 612 ILE B N     1 
ATOM   1229  C  CA    . ILE A 1  170 ? 38.751  57.498  69.947 1.00 115.69 ? 612 ILE B CA    1 
ATOM   1230  C  C     . ILE A 1  170 ? 38.593  56.171  69.197 1.00 116.96 ? 612 ILE B C     1 
ATOM   1231  O  O     . ILE A 1  170 ? 38.716  56.109  67.967 1.00 123.88 ? 612 ILE B O     1 
ATOM   1232  C  CB    . ILE A 1  170 ? 40.123  57.605  70.666 1.00 114.85 ? 612 ILE B CB    1 
ATOM   1233  C  CG1   . ILE A 1  170 ? 40.371  59.014  71.281 1.00 117.89 ? 612 ILE B CG1   1 
ATOM   1234  C  CG2   . ILE A 1  170 ? 41.283  57.132  69.760 1.00 106.43 ? 612 ILE B CG2   1 
ATOM   1235  C  CD1   . ILE A 1  170 ? 40.465  60.225  70.301 1.00 117.09 ? 612 ILE B CD1   1 
ATOM   1236  N  N     . GLU A 1  171 ? 38.267  55.097  69.928 1.00 111.47 ? 613 GLU B N     1 
ATOM   1237  C  CA    . GLU A 1  171 ? 38.046  53.782  69.313 1.00 110.43 ? 613 GLU B CA    1 
ATOM   1238  C  C     . GLU A 1  171 ? 36.872  53.807  68.337 1.00 109.19 ? 613 GLU B C     1 
ATOM   1239  O  O     . GLU A 1  171 ? 36.937  53.195  67.264 1.00 112.17 ? 613 GLU B O     1 
ATOM   1240  C  CB    . GLU A 1  171 ? 37.835  52.713  70.407 1.00 113.85 ? 613 GLU B CB    1 
ATOM   1241  C  CG    . GLU A 1  171 ? 37.839  51.261  69.918 1.00 118.75 ? 613 GLU B CG    1 
ATOM   1242  C  CD    . GLU A 1  171 ? 37.938  50.247  71.050 1.00 125.63 ? 613 GLU B CD    1 
ATOM   1243  O  OE1   . GLU A 1  171 ? 37.374  50.495  72.138 1.00 136.68 ? 613 GLU B OE1   1 
ATOM   1244  O  OE2   . GLU A 1  171 ? 38.585  49.198  70.853 1.00 121.64 ? 613 GLU B OE2   1 
ATOM   1245  N  N     . ALA A 1  172 ? 35.776  54.480  68.697 1.00 103.51 ? 614 ALA B N     1 
ATOM   1246  C  CA    . ALA A 1  172 ? 34.612  54.528  67.808 1.00 101.98 ? 614 ALA B CA    1 
ATOM   1247  C  C     . ALA A 1  172 ? 34.930  55.284  66.516 1.00 105.37 ? 614 ALA B C     1 
ATOM   1248  O  O     . ALA A 1  172 ? 34.602  54.819  65.418 1.00 106.25 ? 614 ALA B O     1 
ATOM   1249  C  CB    . ALA A 1  172 ? 33.412  55.137  68.538 1.00 103.63 ? 614 ALA B CB    1 
ATOM   1250  N  N     . ASP A 1  173 ? 35.565  56.454  66.632 1.00 110.37 ? 615 ASP B N     1 
ATOM   1251  C  CA    . ASP A 1  173 ? 36.012  57.220  65.466 1.00 113.46 ? 615 ASP B CA    1 
ATOM   1252  C  C     . ASP A 1  173 ? 36.798  56.371  64.480 1.00 106.81 ? 615 ASP B C     1 
ATOM   1253  O  O     . ASP A 1  173 ? 36.587  56.440  63.263 1.00 115.95 ? 615 ASP B O     1 
ATOM   1254  C  CB    . ASP A 1  173 ? 36.917  58.383  65.901 1.00 112.93 ? 615 ASP B CB    1 
ATOM   1255  C  CG    . ASP A 1  173 ? 36.171  59.526  66.510 1.00 112.29 ? 615 ASP B CG    1 
ATOM   1256  O  OD1   . ASP A 1  173 ? 34.923  59.480  66.539 1.00 108.77 ? 615 ASP B OD1   1 
ATOM   1257  O  OD2   . ASP A 1  173 ? 36.850  60.484  66.949 1.00 114.80 ? 615 ASP B OD2   1 
ATOM   1258  N  N     . GLN A 1  174 ? 37.788  55.641  64.992 1.00 101.57 ? 616 GLN B N     1 
ATOM   1259  C  CA    . GLN A 1  174 ? 38.598  54.760  64.155 1.00 100.41 ? 616 GLN B CA    1 
ATOM   1260  C  C     . GLN A 1  174 ? 37.748  53.671  63.527 1.00 103.34 ? 616 GLN B C     1 
ATOM   1261  O  O     . GLN A 1  174 ? 37.827  53.412  62.317 1.00 103.37 ? 616 GLN B O     1 
ATOM   1262  C  CB    . GLN A 1  174 ? 39.705  54.109  64.985 1.00 112.37 ? 616 GLN B CB    1 
ATOM   1263  C  CG    . GLN A 1  174 ? 40.888  54.976  65.310 1.00 132.83 ? 616 GLN B CG    1 
ATOM   1264  C  CD    . GLN A 1  174 ? 42.047  54.155  65.849 1.00 145.91 ? 616 GLN B CD    1 
ATOM   1265  O  OE1   . GLN A 1  174 ? 41.939  52.935  66.009 1.00 146.83 ? 616 GLN B OE1   1 
ATOM   1266  N  NE2   . GLN A 1  174 ? 43.165  54.817  66.125 1.00 151.57 ? 616 GLN B NE2   1 
ATOM   1267  N  N     . THR A 1  175 ? 36.957  52.994  64.353 1.00 107.95 ? 617 THR B N     1 
ATOM   1268  C  CA    . THR A 1  175 ? 36.148  51.885  63.873 1.00 95.91  ? 617 THR B CA    1 
ATOM   1269  C  C     . THR A 1  175 ? 35.174  52.340  62.804 1.00 87.98  ? 617 THR B C     1 
ATOM   1270  O  O     . THR A 1  175 ? 35.039  51.688  61.766 1.00 84.56  ? 617 THR B O     1 
ATOM   1271  C  CB    . THR A 1  175 ? 35.398  51.242  65.039 1.00 84.95  ? 617 THR B CB    1 
ATOM   1272  O  OG1   . THR A 1  175 ? 36.284  50.363  65.742 1.00 94.72  ? 617 THR B OG1   1 
ATOM   1273  C  CG2   . THR A 1  175 ? 34.217  50.452  64.514 1.00 82.63  ? 617 THR B CG2   1 
ATOM   1274  N  N     . PHE A 1  176 ? 34.465  53.441  63.043 1.00 88.76  ? 618 PHE B N     1 
ATOM   1275  C  CA    . PHE A 1  176 ? 33.540  53.926  62.026 1.00 88.61  ? 618 PHE B CA    1 
ATOM   1276  C  C     . PHE A 1  176 ? 34.283  54.281  60.756 1.00 89.41  ? 618 PHE B C     1 
ATOM   1277  O  O     . PHE A 1  176 ? 33.848  53.943  59.649 1.00 93.19  ? 618 PHE B O     1 
ATOM   1278  C  CB    . PHE A 1  176 ? 32.767  55.139  62.529 1.00 87.89  ? 618 PHE B CB    1 
ATOM   1279  C  CG    . PHE A 1  176 ? 31.505  54.788  63.222 1.00 88.57  ? 618 PHE B CG    1 
ATOM   1280  C  CD1   . PHE A 1  176 ? 30.336  54.609  62.507 1.00 94.29  ? 618 PHE B CD1   1 
ATOM   1281  C  CD2   . PHE A 1  176 ? 31.482  54.625  64.594 1.00 76.28  ? 618 PHE B CD2   1 
ATOM   1282  C  CE1   . PHE A 1  176 ? 29.174  54.273  63.155 1.00 92.59  ? 618 PHE B CE1   1 
ATOM   1283  C  CE2   . PHE A 1  176 ? 30.312  54.298  65.242 1.00 78.22  ? 618 PHE B CE2   1 
ATOM   1284  C  CZ    . PHE A 1  176 ? 29.155  54.128  64.518 1.00 87.98  ? 618 PHE B CZ    1 
ATOM   1285  N  N     . GLU A 1  177 ? 35.413  54.963  60.898 1.00 81.35  ? 619 GLU B N     1 
ATOM   1286  C  CA    . GLU A 1  177 ? 36.195  55.328  59.729 1.00 82.50  ? 619 GLU B CA    1 
ATOM   1287  C  C     . GLU A 1  177 ? 36.729  54.094  59.024 1.00 84.43  ? 619 GLU B C     1 
ATOM   1288  O  O     . GLU A 1  177 ? 36.722  54.025  57.792 1.00 87.77  ? 619 GLU B O     1 
ATOM   1289  C  CB    . GLU A 1  177 ? 37.333  56.254  60.138 1.00 87.63  ? 619 GLU B CB    1 
ATOM   1290  C  CG    . GLU A 1  177 ? 38.164  56.719  58.973 1.00 96.42  ? 619 GLU B CG    1 
ATOM   1291  C  CD    . GLU A 1  177 ? 39.226  57.703  59.404 1.00 117.78 ? 619 GLU B CD    1 
ATOM   1292  O  OE1   . GLU A 1  177 ? 38.902  58.597  60.231 1.00 121.80 ? 619 GLU B OE1   1 
ATOM   1293  O  OE2   . GLU A 1  177 ? 40.383  57.563  58.931 1.00 125.76 ? 619 GLU B OE2   1 
ATOM   1294  N  N     . MET A 1  178 ? 37.189  53.104  59.785 1.00 95.82  ? 620 MET B N     1 
ATOM   1295  C  CA    . MET A 1  178 ? 37.751  51.901  59.178 1.00 92.02  ? 620 MET B CA    1 
ATOM   1296  C  C     . MET A 1  178 ? 36.688  51.117  58.420 1.00 81.06  ? 620 MET B C     1 
ATOM   1297  O  O     . MET A 1  178 ? 36.911  50.697  57.279 1.00 86.49  ? 620 MET B O     1 
ATOM   1298  C  CB    . MET A 1  178 ? 38.415  51.028  60.248 1.00 108.90 ? 620 MET B CB    1 
ATOM   1299  C  CG    . MET A 1  178 ? 38.769  49.631  59.765 1.00 115.32 ? 620 MET B CG    1 
ATOM   1300  S  SD    . MET A 1  178 ? 39.655  48.659  61.010 1.00 108.25 ? 620 MET B SD    1 
ATOM   1301  C  CE    . MET A 1  178 ? 38.443  48.617  62.336 1.00 99.18  ? 620 MET B CE    1 
ATOM   1302  N  N     . LEU A 1  179 ? 35.519  50.930  59.027 1.00 75.53  ? 621 LEU B N     1 
ATOM   1303  C  CA    . LEU A 1  179 ? 34.479  50.095  58.427 1.00 75.38  ? 621 LEU B CA    1 
ATOM   1304  C  C     . LEU A 1  179 ? 33.638  50.839  57.396 1.00 77.40  ? 621 LEU B C     1 
ATOM   1305  O  O     . LEU A 1  179 ? 33.258  50.253  56.376 1.00 81.71  ? 621 LEU B O     1 
ATOM   1306  C  CB    . LEU A 1  179 ? 33.572  49.520  59.517 1.00 78.97  ? 621 LEU B CB    1 
ATOM   1307  C  CG    . LEU A 1  179 ? 34.309  48.717  60.579 1.00 83.85  ? 621 LEU B CG    1 
ATOM   1308  C  CD1   . LEU A 1  179 ? 33.311  47.959  61.426 1.00 83.01  ? 621 LEU B CD1   1 
ATOM   1309  C  CD2   . LEU A 1  179 ? 35.310  47.778  59.924 1.00 78.26  ? 621 LEU B CD2   1 
ATOM   1310  N  N     . MET A 1  180 ? 33.295  52.097  57.637 1.00 76.08  ? 622 MET B N     1 
ATOM   1311  C  CA    . MET A 1  180 ? 32.409  52.817  56.725 1.00 69.32  ? 622 MET B CA    1 
ATOM   1312  C  C     . MET A 1  180 ? 33.139  53.816  55.833 1.00 69.04  ? 622 MET B C     1 
ATOM   1313  O  O     . MET A 1  180 ? 32.479  54.506  55.046 1.00 66.01  ? 622 MET B O     1 
ATOM   1314  C  CB    . MET A 1  180 ? 31.297  53.525  57.506 1.00 67.29  ? 622 MET B CB    1 
ATOM   1315  C  CG    . MET A 1  180 ? 30.718  52.666  58.586 1.00 68.50  ? 622 MET B CG    1 
ATOM   1316  S  SD    . MET A 1  180 ? 30.109  51.111  57.923 1.00 74.06  ? 622 MET B SD    1 
ATOM   1317  C  CE    . MET A 1  180 ? 28.544  51.647  57.227 1.00 64.99  ? 622 MET B CE    1 
ATOM   1318  N  N     . GLY A 1  181 ? 34.469  53.898  55.913 1.00 76.84  ? 623 GLY B N     1 
ATOM   1319  C  CA    . GLY A 1  181 ? 35.211  54.899  55.157 1.00 81.57  ? 623 GLY B CA    1 
ATOM   1320  C  C     . GLY A 1  181 ? 35.287  54.588  53.670 1.00 68.31  ? 623 GLY B C     1 
ATOM   1321  O  O     . GLY A 1  181 ? 34.934  53.509  53.208 1.00 74.37  ? 623 GLY B O     1 
ATOM   1322  N  N     . ASP A 1  182 ? 35.741  55.574  52.886 1.00 67.10  ? 624 ASP B N     1 
ATOM   1323  C  CA    . ASP A 1  182 ? 35.767  55.332  51.444 1.00 69.86  ? 624 ASP B CA    1 
ATOM   1324  C  C     . ASP A 1  182 ? 37.010  54.574  51.022 1.00 67.98  ? 624 ASP B C     1 
ATOM   1325  O  O     . ASP A 1  182 ? 37.087  54.148  49.871 1.00 72.10  ? 624 ASP B O     1 
ATOM   1326  C  CB    . ASP A 1  182 ? 35.577  56.625  50.625 1.00 80.52  ? 624 ASP B CB    1 
ATOM   1327  C  CG    . ASP A 1  182 ? 36.471  57.774  51.072 1.00 102.33 ? 624 ASP B CG    1 
ATOM   1328  O  OD1   . ASP A 1  182 ? 37.442  57.533  51.820 1.00 123.40 ? 624 ASP B OD1   1 
ATOM   1329  O  OD2   . ASP A 1  182 ? 36.210  58.925  50.645 1.00 101.30 ? 624 ASP B OD2   1 
ATOM   1330  N  N     . VAL A 1  183 ? 37.933  54.333  51.941 1.00 67.57  ? 625 VAL B N     1 
ATOM   1331  C  CA    . VAL A 1  183 ? 39.104  53.523  51.651 1.00 76.82  ? 625 VAL B CA    1 
ATOM   1332  C  C     . VAL A 1  183 ? 38.732  52.052  51.798 1.00 85.54  ? 625 VAL B C     1 
ATOM   1333  O  O     . VAL A 1  183 ? 38.426  51.576  52.890 1.00 94.09  ? 625 VAL B O     1 
ATOM   1334  C  CB    . VAL A 1  183 ? 40.285  53.905  52.552 1.00 69.27  ? 625 VAL B CB    1 
ATOM   1335  C  CG1   . VAL A 1  183 ? 41.455  52.980  52.316 1.00 68.21  ? 625 VAL B CG1   1 
ATOM   1336  C  CG2   . VAL A 1  183 ? 40.656  55.358  52.253 1.00 70.58  ? 625 VAL B CG2   1 
ATOM   1337  N  N     . VAL A 1  184 ? 38.756  51.335  50.681 1.00 81.72  ? 626 VAL B N     1 
ATOM   1338  C  CA    . VAL A 1  184 ? 38.310  49.948  50.628 1.00 71.30  ? 626 VAL B CA    1 
ATOM   1339  C  C     . VAL A 1  184 ? 39.331  49.035  51.294 1.00 66.07  ? 626 VAL B C     1 
ATOM   1340  O  O     . VAL A 1  184 ? 38.968  48.125  52.050 1.00 61.80  ? 626 VAL B O     1 
ATOM   1341  C  CB    . VAL A 1  184 ? 38.028  49.590  49.152 1.00 65.10  ? 626 VAL B CB    1 
ATOM   1342  C  CG1   . VAL A 1  184 ? 38.131  48.095  48.880 1.00 65.46  ? 626 VAL B CG1   1 
ATOM   1343  C  CG2   . VAL A 1  184 ? 36.675  50.147  48.755 1.00 71.32  ? 626 VAL B CG2   1 
ATOM   1344  N  N     . GLU A 1  185 ? 40.620  49.327  51.097 1.00 75.66  ? 627 GLU B N     1 
ATOM   1345  C  CA    . GLU A 1  185 ? 41.706  48.461  51.558 1.00 76.93  ? 627 GLU B CA    1 
ATOM   1346  C  C     . GLU A 1  185 ? 41.654  48.179  53.053 1.00 71.05  ? 627 GLU B C     1 
ATOM   1347  O  O     . GLU A 1  185 ? 41.935  47.055  53.491 1.00 75.38  ? 627 GLU B O     1 
ATOM   1348  C  CB    . GLU A 1  185 ? 43.057  49.088  51.200 1.00 79.70  ? 627 GLU B CB    1 
ATOM   1349  C  CG    . GLU A 1  185 ? 44.286  48.279  51.649 1.00 76.95  ? 627 GLU B CG    1 
ATOM   1350  C  CD    . GLU A 1  185 ? 44.267  46.802  51.222 1.00 79.80  ? 627 GLU B CD    1 
ATOM   1351  O  OE1   . GLU A 1  185 ? 43.464  46.408  50.340 1.00 84.51  ? 627 GLU B OE1   1 
ATOM   1352  O  OE2   . GLU A 1  185 ? 45.071  46.027  51.776 1.00 80.87  ? 627 GLU B OE2   1 
ATOM   1353  N  N     . ASN A 1  186 ? 41.354  49.198  53.858 1.00 68.50  ? 628 ASN B N     1 
ATOM   1354  C  CA    . ASN A 1  186 ? 41.304  48.994  55.303 1.00 69.86  ? 628 ASN B CA    1 
ATOM   1355  C  C     . ASN A 1  186 ? 40.212  48.017  55.663 1.00 82.12  ? 628 ASN B C     1 
ATOM   1356  O  O     . ASN A 1  186 ? 40.390  47.122  56.504 1.00 95.25  ? 628 ASN B O     1 
ATOM   1357  C  CB    . ASN A 1  186 ? 41.038  50.311  56.017 1.00 66.06  ? 628 ASN B CB    1 
ATOM   1358  C  CG    . ASN A 1  186 ? 42.182  51.247  55.915 1.00 70.37  ? 628 ASN B CG    1 
ATOM   1359  O  OD1   . ASN A 1  186 ? 43.321  50.822  55.697 1.00 65.39  ? 628 ASN B OD1   1 
ATOM   1360  N  ND2   . ASN A 1  186 ? 41.907  52.539  56.076 1.00 84.98  ? 628 ASN B ND2   1 
ATOM   1361  N  N     . ARG A 1  187 ? 39.068  48.198  55.026 1.00 80.64  ? 629 ARG B N     1 
ATOM   1362  C  CA    . ARG A 1  187 ? 37.915  47.345  55.227 1.00 68.99  ? 629 ARG B CA    1 
ATOM   1363  C  C     . ARG A 1  187 ? 38.195  45.927  54.762 1.00 70.12  ? 629 ARG B C     1 
ATOM   1364  O  O     . ARG A 1  187 ? 37.794  44.958  55.411 1.00 77.29  ? 629 ARG B O     1 
ATOM   1365  C  CB    . ARG A 1  187 ? 36.756  47.954  54.462 1.00 64.99  ? 629 ARG B CB    1 
ATOM   1366  C  CG    . ARG A 1  187 ? 35.531  47.159  54.434 1.00 63.66  ? 629 ARG B CG    1 
ATOM   1367  C  CD    . ARG A 1  187 ? 34.444  48.028  53.868 1.00 70.08  ? 629 ARG B CD    1 
ATOM   1368  N  NE    . ARG A 1  187 ? 34.966  49.042  52.951 1.00 78.78  ? 629 ARG B NE    1 
ATOM   1369  C  CZ    . ARG A 1  187 ? 34.658  50.332  53.013 1.00 66.57  ? 629 ARG B CZ    1 
ATOM   1370  N  NH1   . ARG A 1  187 ? 33.823  50.759  53.953 1.00 79.55  ? 629 ARG B NH1   1 
ATOM   1371  N  NH2   . ARG A 1  187 ? 35.171  51.187  52.129 1.00 59.95  ? 629 ARG B NH2   1 
ATOM   1372  N  N     . ARG A 1  188 ? 38.858  45.775  53.622 1.00 70.72  ? 630 ARG B N     1 
ATOM   1373  C  CA    . ARG A 1  188 ? 39.200  44.426  53.196 1.00 70.55  ? 630 ARG B CA    1 
ATOM   1374  C  C     . ARG A 1  188 ? 40.182  43.798  54.167 1.00 72.14  ? 630 ARG B C     1 
ATOM   1375  O  O     . ARG A 1  188 ? 40.045  42.627  54.543 1.00 74.26  ? 630 ARG B O     1 
ATOM   1376  C  CB    . ARG A 1  188 ? 39.795  44.441  51.799 1.00 68.94  ? 630 ARG B CB    1 
ATOM   1377  C  CG    . ARG A 1  188 ? 40.645  43.250  51.569 1.00 70.94  ? 630 ARG B CG    1 
ATOM   1378  C  CD    . ARG A 1  188 ? 41.558  43.503  50.431 1.00 75.56  ? 630 ARG B CD    1 
ATOM   1379  N  NE    . ARG A 1  188 ? 42.915  43.689  50.909 1.00 81.47  ? 630 ARG B NE    1 
ATOM   1380  C  CZ    . ARG A 1  188 ? 43.643  42.704  51.422 1.00 90.88  ? 630 ARG B CZ    1 
ATOM   1381  N  NH1   . ARG A 1  188 ? 43.123  41.483  51.520 1.00 87.40  ? 630 ARG B NH1   1 
ATOM   1382  N  NH2   . ARG A 1  188 ? 44.884  42.930  51.842 1.00 102.65 ? 630 ARG B NH2   1 
ATOM   1383  N  N     . GLN A 1  189 ? 41.192  44.563  54.563 1.00 73.77  ? 631 GLN B N     1 
ATOM   1384  C  CA    . GLN A 1  189 ? 42.182  44.065  55.500 1.00 77.74  ? 631 GLN B CA    1 
ATOM   1385  C  C     . GLN A 1  189 ? 41.516  43.598  56.780 1.00 81.73  ? 631 GLN B C     1 
ATOM   1386  O  O     . GLN A 1  189 ? 41.854  42.537  57.314 1.00 89.65  ? 631 GLN B O     1 
ATOM   1387  C  CB    . GLN A 1  189 ? 43.212  45.155  55.791 1.00 79.24  ? 631 GLN B CB    1 
ATOM   1388  C  CG    . GLN A 1  189 ? 44.222  44.736  56.812 1.00 82.42  ? 631 GLN B CG    1 
ATOM   1389  C  CD    . GLN A 1  189 ? 45.003  43.520  56.366 1.00 86.51  ? 631 GLN B CD    1 
ATOM   1390  O  OE1   . GLN A 1  189 ? 45.448  43.441  55.217 1.00 94.15  ? 631 GLN B OE1   1 
ATOM   1391  N  NE2   . GLN A 1  189 ? 45.166  42.557  57.268 1.00 83.72  ? 631 GLN B NE2   1 
ATOM   1392  N  N     . PHE A 1  190 ? 40.563  44.378  57.287 1.00 78.95  ? 632 PHE B N     1 
ATOM   1393  C  CA    . PHE A 1  190 ? 39.871  43.998  58.510 1.00 78.96  ? 632 PHE B CA    1 
ATOM   1394  C  C     . PHE A 1  190 ? 39.121  42.697  58.322 1.00 78.55  ? 632 PHE B C     1 
ATOM   1395  O  O     . PHE A 1  190 ? 39.106  41.839  59.212 1.00 86.15  ? 632 PHE B O     1 
ATOM   1396  C  CB    . PHE A 1  190 ? 38.900  45.095  58.926 1.00 82.73  ? 632 PHE B CB    1 
ATOM   1397  C  CG    . PHE A 1  190 ? 37.885  44.638  59.919 1.00 74.89  ? 632 PHE B CG    1 
ATOM   1398  C  CD1   . PHE A 1  190 ? 38.183  44.647  61.268 1.00 75.75  ? 632 PHE B CD1   1 
ATOM   1399  C  CD2   . PHE A 1  190 ? 36.635  44.192  59.510 1.00 74.97  ? 632 PHE B CD2   1 
ATOM   1400  C  CE1   . PHE A 1  190 ? 37.253  44.228  62.198 1.00 73.83  ? 632 PHE B CE1   1 
ATOM   1401  C  CE2   . PHE A 1  190 ? 35.702  43.769  60.437 1.00 82.52  ? 632 PHE B CE2   1 
ATOM   1402  C  CZ    . PHE A 1  190 ? 36.011  43.788  61.782 1.00 76.37  ? 632 PHE B CZ    1 
ATOM   1403  N  N     . ILE A 1  191 ? 38.452  42.557  57.181 1.00 83.85  ? 633 ILE B N     1 
ATOM   1404  C  CA    . ILE A 1  191 ? 37.699  41.342  56.894 1.00 89.74  ? 633 ILE B CA    1 
ATOM   1405  C  C     . ILE A 1  191 ? 38.621  40.135  56.892 1.00 86.09  ? 633 ILE B C     1 
ATOM   1406  O  O     . ILE A 1  191 ? 38.305  39.088  57.466 1.00 75.22  ? 633 ILE B O     1 
ATOM   1407  C  CB    . ILE A 1  191 ? 36.965  41.485  55.552 1.00 80.85  ? 633 ILE B CB    1 
ATOM   1408  C  CG1   . ILE A 1  191 ? 35.762  42.411  55.718 1.00 77.62  ? 633 ILE B CG1   1 
ATOM   1409  C  CG2   . ILE A 1  191 ? 36.553  40.126  55.045 1.00 72.70  ? 633 ILE B CG2   1 
ATOM   1410  C  CD1   . ILE A 1  191 ? 35.223  42.894  54.420 1.00 80.04  ? 633 ILE B CD1   1 
ATOM   1411  N  N     . GLU A 1  192 ? 39.764  40.249  56.219 1.00 90.10  ? 634 GLU B N     1 
ATOM   1412  C  CA    . GLU A 1  192 ? 40.684  39.121  56.146 1.00 83.05  ? 634 GLU B CA    1 
ATOM   1413  C  C     . GLU A 1  192 ? 41.128  38.693  57.532 1.00 87.66  ? 634 GLU B C     1 
ATOM   1414  O  O     . GLU A 1  192 ? 41.186  37.497  57.835 1.00 96.87  ? 634 GLU B O     1 
ATOM   1415  C  CB    . GLU A 1  192 ? 41.891  39.478  55.281 1.00 86.30  ? 634 GLU B CB    1 
ATOM   1416  C  CG    . GLU A 1  192 ? 42.972  38.429  55.340 1.00 93.57  ? 634 GLU B CG    1 
ATOM   1417  C  CD    . GLU A 1  192 ? 44.169  38.803  54.503 1.00 118.38 ? 634 GLU B CD    1 
ATOM   1418  O  OE1   . GLU A 1  192 ? 44.675  37.931  53.764 1.00 131.16 ? 634 GLU B OE1   1 
ATOM   1419  O  OE2   . GLU A 1  192 ? 44.600  39.974  54.575 1.00 122.64 ? 634 GLU B OE2   1 
ATOM   1420  N  N     . ASP A 1  193 ? 41.420  39.663  58.393 1.00 90.04  ? 635 ASP B N     1 
ATOM   1421  C  CA    . ASP A 1  193 ? 41.913  39.368  59.732 1.00 81.36  ? 635 ASP B CA    1 
ATOM   1422  C  C     . ASP A 1  193 ? 40.850  38.720  60.606 1.00 94.89  ? 635 ASP B C     1 
ATOM   1423  O  O     . ASP A 1  193 ? 41.163  37.836  61.411 1.00 95.88  ? 635 ASP B O     1 
ATOM   1424  C  CB    . ASP A 1  193 ? 42.435  40.652  60.376 1.00 79.97  ? 635 ASP B CB    1 
ATOM   1425  C  CG    . ASP A 1  193 ? 43.744  41.105  59.779 1.00 79.60  ? 635 ASP B CG    1 
ATOM   1426  O  OD1   . ASP A 1  193 ? 44.400  40.269  59.112 1.00 76.91  ? 635 ASP B OD1   1 
ATOM   1427  O  OD2   . ASP A 1  193 ? 44.116  42.285  59.988 1.00 78.11  ? 635 ASP B OD2   1 
ATOM   1428  N  N     . ASN A 1  194 ? 39.595  39.129  60.471 1.00 66.42  ? 636 ASN B N     1 
ATOM   1429  C  CA    . ASN A 1  194 ? 38.586  38.703  61.430 1.00 75.15  ? 636 ASN B CA    1 
ATOM   1430  C  C     . ASN A 1  194 ? 37.603  37.677  60.892 1.00 100.74 ? 636 ASN B C     1 
ATOM   1431  O  O     . ASN A 1  194 ? 36.955  37.002  61.700 1.00 115.73 ? 636 ASN B O     1 
ATOM   1432  C  CB    . ASN A 1  194 ? 37.787  39.903  61.958 1.00 70.06  ? 636 ASN B CB    1 
ATOM   1433  C  CG    . ASN A 1  194 ? 38.662  40.965  62.541 1.00 86.43  ? 636 ASN B CG    1 
ATOM   1434  O  OD1   . ASN A 1  194 ? 38.573  41.273  63.727 1.00 97.93  ? 636 ASN B OD1   1 
ATOM   1435  N  ND2   . ASN A 1  194 ? 39.538  41.524  61.719 1.00 100.43 ? 636 ASN B ND2   1 
ATOM   1436  N  N     . ALA A 1  195 ? 37.436  37.555  59.586 1.00 108.66 ? 637 ALA B N     1 
ATOM   1437  C  CA    . ALA A 1  195 ? 36.459  36.594  59.097 1.00 115.01 ? 637 ALA B CA    1 
ATOM   1438  C  C     . ALA A 1  195 ? 36.876  35.185  59.481 1.00 122.35 ? 637 ALA B C     1 
ATOM   1439  O  O     . ALA A 1  195 ? 38.040  34.802  59.346 1.00 108.27 ? 637 ALA B O     1 
ATOM   1440  C  CB    . ALA A 1  195 ? 36.261  36.698  57.584 1.00 125.30 ? 637 ALA B CB    1 
ATOM   1441  N  N     . VAL A 1  196 ? 35.916  34.435  60.008 1.00 141.37 ? 638 VAL B N     1 
ATOM   1442  C  CA    . VAL A 1  196 ? 36.079  33.031  60.346 1.00 143.18 ? 638 VAL B CA    1 
ATOM   1443  C  C     . VAL A 1  196 ? 35.025  32.277  59.556 1.00 141.52 ? 638 VAL B C     1 
ATOM   1444  O  O     . VAL A 1  196 ? 33.846  32.647  59.586 1.00 137.85 ? 638 VAL B O     1 
ATOM   1445  C  CB    . VAL A 1  196 ? 35.894  32.784  61.852 1.00 142.31 ? 638 VAL B CB    1 
ATOM   1446  C  CG1   . VAL A 1  196 ? 35.877  31.301  62.140 1.00 139.12 ? 638 VAL B CG1   1 
ATOM   1447  C  CG2   . VAL A 1  196 ? 36.969  33.492  62.652 1.00 135.53 ? 638 VAL B CG2   1 
ATOM   1448  N  N     . TYR A 1  197 ? 35.434  31.245  58.838 1.00 153.45 ? 639 TYR B N     1 
ATOM   1449  C  CA    . TYR A 1  197 ? 34.496  30.505  58.008 1.00 165.51 ? 639 TYR B CA    1 
ATOM   1450  C  C     . TYR A 1  197 ? 34.246  29.136  58.624 1.00 178.16 ? 639 TYR B C     1 
ATOM   1451  O  O     . TYR A 1  197 ? 35.179  28.340  58.781 1.00 170.36 ? 639 TYR B O     1 
ATOM   1452  C  CB    . TYR A 1  197 ? 35.008  30.387  56.577 1.00 159.14 ? 639 TYR B CB    1 
ATOM   1453  C  CG    . TYR A 1  197 ? 35.404  31.708  55.953 1.00 147.83 ? 639 TYR B CG    1 
ATOM   1454  C  CD1   . TYR A 1  197 ? 34.447  32.653  55.593 1.00 146.78 ? 639 TYR B CD1   1 
ATOM   1455  C  CD2   . TYR A 1  197 ? 36.736  32.001  55.705 1.00 141.57 ? 639 TYR B CD2   1 
ATOM   1456  C  CE1   . TYR A 1  197 ? 34.813  33.856  55.008 1.00 133.56 ? 639 TYR B CE1   1 
ATOM   1457  C  CE2   . TYR A 1  197 ? 37.112  33.199  55.120 1.00 136.73 ? 639 TYR B CE2   1 
ATOM   1458  C  CZ    . TYR A 1  197 ? 36.145  34.121  54.774 1.00 132.32 ? 639 TYR B CZ    1 
ATOM   1459  O  OH    . TYR A 1  197 ? 36.506  35.314  54.193 1.00 106.17 ? 639 TYR B OH    1 
ATOM   1460  N  N     . ALA A 1  198 ? 32.988  28.871  58.962 1.00 200.74 ? 640 ALA B N     1 
ATOM   1461  C  CA    . ALA A 1  198 ? 32.580  27.605  59.560 1.00 198.99 ? 640 ALA B CA    1 
ATOM   1462  C  C     . ALA A 1  198 ? 31.070  27.432  59.450 1.00 199.47 ? 640 ALA B C     1 
ATOM   1463  O  O     . ALA A 1  198 ? 30.573  26.362  59.102 1.00 211.29 ? 640 ALA B O     1 
ATOM   1464  C  CB    . ALA A 1  198 ? 33.014  27.537  61.014 1.00 196.85 ? 640 ALA B CB    1 
ATOM   1465  N  N     . ASN B 2  9   ? 21.164  43.986  78.317 1.00 156.46 ? 10  ASN A N     1 
ATOM   1466  C  CA    . ASN B 2  9   ? 21.290  45.211  79.100 1.00 163.46 ? 10  ASN A CA    1 
ATOM   1467  C  C     . ASN B 2  9   ? 21.768  46.383  78.238 1.00 167.06 ? 10  ASN A C     1 
ATOM   1468  O  O     . ASN B 2  9   ? 21.005  47.318  77.992 1.00 157.12 ? 10  ASN A O     1 
ATOM   1469  C  CB    . ASN B 2  9   ? 22.223  45.016  80.307 1.00 162.87 ? 10  ASN A CB    1 
ATOM   1470  C  CG    . ASN B 2  9   ? 23.361  44.035  80.039 1.00 159.76 ? 10  ASN A CG    1 
ATOM   1471  O  OD1   . ASN B 2  9   ? 24.533  44.397  80.122 1.00 158.30 ? 10  ASN A OD1   1 
ATOM   1472  N  ND2   . ASN B 2  9   ? 23.020  42.778  79.766 1.00 164.26 ? 10  ASN A ND2   1 
ATOM   1473  N  N     . GLU B 2  10  ? 23.021  46.334  77.780 1.00 172.36 ? 11  GLU A N     1 
ATOM   1474  C  CA    . GLU B 2  10  ? 23.609  47.397  76.970 1.00 165.17 ? 11  GLU A CA    1 
ATOM   1475  C  C     . GLU B 2  10  ? 24.450  46.788  75.854 1.00 153.16 ? 11  GLU A C     1 
ATOM   1476  O  O     . GLU B 2  10  ? 24.997  45.695  76.006 1.00 140.06 ? 11  GLU A O     1 
ATOM   1477  C  CB    . GLU B 2  10  ? 24.484  48.345  77.813 1.00 175.72 ? 11  GLU A CB    1 
ATOM   1478  C  CG    . GLU B 2  10  ? 23.763  49.033  78.970 1.00 179.82 ? 11  GLU A CG    1 
ATOM   1479  C  CD    . GLU B 2  10  ? 23.965  48.325  80.299 1.00 175.60 ? 11  GLU A CD    1 
ATOM   1480  O  OE1   . GLU B 2  10  ? 23.040  48.355  81.138 1.00 174.24 ? 11  GLU A OE1   1 
ATOM   1481  O  OE2   . GLU B 2  10  ? 25.048  47.740  80.507 1.00 178.74 ? 11  GLU A OE2   1 
ATOM   1482  N  N     . ARG B 2  11  ? 24.582  47.515  74.739 1.00 144.27 ? 12  ARG A N     1 
ATOM   1483  C  CA    . ARG B 2  11  ? 25.312  47.040  73.559 1.00 135.85 ? 12  ARG A CA    1 
ATOM   1484  C  C     . ARG B 2  11  ? 26.377  48.050  73.135 1.00 119.89 ? 12  ARG A C     1 
ATOM   1485  O  O     . ARG B 2  11  ? 26.073  48.978  72.384 1.00 123.57 ? 12  ARG A O     1 
ATOM   1486  C  CB    . ARG B 2  11  ? 24.337  46.775  72.406 1.00 142.79 ? 12  ARG A CB    1 
ATOM   1487  C  CG    . ARG B 2  11  ? 24.986  46.223  71.151 1.00 145.71 ? 12  ARG A CG    1 
ATOM   1488  C  CD    . ARG B 2  11  ? 25.574  44.851  71.403 1.00 141.73 ? 12  ARG A CD    1 
ATOM   1489  N  NE    . ARG B 2  11  ? 25.966  44.195  70.160 1.00 135.17 ? 12  ARG A NE    1 
ATOM   1490  C  CZ    . ARG B 2  11  ? 26.896  43.251  70.077 1.00 127.92 ? 12  ARG A CZ    1 
ATOM   1491  N  NH1   . ARG B 2  11  ? 27.540  42.858  71.166 1.00 130.09 ? 12  ARG A NH1   1 
ATOM   1492  N  NH2   . ARG B 2  11  ? 27.187  42.709  68.904 1.00 135.15 ? 12  ARG A NH2   1 
ATOM   1493  N  N     . ASN B 2  12  ? 27.627  47.861  73.567 1.00 114.15 ? 13  ASN A N     1 
ATOM   1494  C  CA    . ASN B 2  12  ? 28.711  48.791  73.225 1.00 110.82 ? 13  ASN A CA    1 
ATOM   1495  C  C     . ASN B 2  12  ? 28.734  49.074  71.727 1.00 117.54 ? 13  ASN A C     1 
ATOM   1496  O  O     . ASN B 2  12  ? 28.682  48.156  70.916 1.00 121.54 ? 13  ASN A O     1 
ATOM   1497  C  CB    . ASN B 2  12  ? 30.053  48.211  73.673 1.00 114.61 ? 13  ASN A CB    1 
ATOM   1498  C  CG    . ASN B 2  12  ? 31.223  49.081  73.280 1.00 132.87 ? 13  ASN A CG    1 
ATOM   1499  O  OD1   . ASN B 2  12  ? 31.978  48.757  72.361 1.00 168.19 ? 13  ASN A OD1   1 
ATOM   1500  N  ND2   . ASN B 2  12  ? 31.382  50.197  73.976 1.00 138.25 ? 13  ASN A ND2   1 
ATOM   1501  N  N     . ILE B 2  13  ? 28.794  50.358  71.349 1.00 165.66 ? 14  ILE A N     1 
ATOM   1502  C  CA    . ILE B 2  13  ? 28.582  50.691  69.936 1.00 135.18 ? 14  ILE A CA    1 
ATOM   1503  C  C     . ILE B 2  13  ? 29.698  50.113  69.072 1.00 120.10 ? 14  ILE A C     1 
ATOM   1504  O  O     . ILE B 2  13  ? 29.429  49.455  68.065 1.00 119.50 ? 14  ILE A O     1 
ATOM   1505  C  CB    . ILE B 2  13  ? 28.360  52.208  69.731 1.00 119.84 ? 14  ILE A CB    1 
ATOM   1506  C  CG1   . ILE B 2  13  ? 28.086  52.510  68.251 1.00 115.08 ? 14  ILE A CG1   1 
ATOM   1507  C  CG2   . ILE B 2  13  ? 29.538  53.045  70.236 1.00 127.99 ? 14  ILE A CG2   1 
ATOM   1508  C  CD1   . ILE B 2  13  ? 27.583  53.904  68.024 1.00 111.87 ? 14  ILE A CD1   1 
ATOM   1509  N  N     . THR B 2  14  ? 30.950  50.291  69.476 1.00 103.01 ? 15  THR A N     1 
ATOM   1510  C  CA    . THR B 2  14  ? 32.056  49.744  68.684 1.00 93.83  ? 15  THR A CA    1 
ATOM   1511  C  C     . THR B 2  14  ? 31.927  48.230  68.465 1.00 92.77  ? 15  THR A C     1 
ATOM   1512  O  O     . THR B 2  14  ? 32.240  47.717  67.383 1.00 96.34  ? 15  THR A O     1 
ATOM   1513  C  CB    . THR B 2  14  ? 33.416  50.094  69.324 1.00 98.09  ? 15  THR A CB    1 
ATOM   1514  O  OG1   . THR B 2  14  ? 33.725  51.473  69.081 1.00 107.13 ? 15  THR A OG1   1 
ATOM   1515  C  CG2   . THR B 2  14  ? 34.533  49.253  68.727 1.00 91.06  ? 15  THR A CG2   1 
ATOM   1516  N  N     . SER B 2  15  ? 31.439  47.504  69.465 1.00 94.25  ? 16  SER A N     1 
ATOM   1517  C  CA    . SER B 2  15  ? 31.233  46.061  69.315 1.00 94.61  ? 16  SER A CA    1 
ATOM   1518  C  C     . SER B 2  15  ? 30.137  45.771  68.313 1.00 90.81  ? 16  SER A C     1 
ATOM   1519  O  O     . SER B 2  15  ? 30.280  44.898  67.452 1.00 89.43  ? 16  SER A O     1 
ATOM   1520  C  CB    . SER B 2  15  ? 30.862  45.409  70.652 1.00 100.76 ? 16  SER A CB    1 
ATOM   1521  O  OG    . SER B 2  15  ? 31.862  45.610  71.618 1.00 111.63 ? 16  SER A OG    1 
ATOM   1522  N  N     . GLU B 2  16  ? 29.013  46.467  68.452 1.00 88.03  ? 17  GLU A N     1 
ATOM   1523  C  CA    . GLU B 2  16  ? 27.907  46.295  67.521 1.00 84.72  ? 17  GLU A CA    1 
ATOM   1524  C  C     . GLU B 2  16  ? 28.345  46.529  66.083 1.00 82.98  ? 17  GLU A C     1 
ATOM   1525  O  O     . GLU B 2  16  ? 27.962  45.778  65.181 1.00 78.03  ? 17  GLU A O     1 
ATOM   1526  C  CB    . GLU B 2  16  ? 26.765  47.234  67.900 1.00 87.73  ? 17  GLU A CB    1 
ATOM   1527  C  CG    . GLU B 2  16  ? 25.524  47.061  67.046 1.00 93.83  ? 17  GLU A CG    1 
ATOM   1528  C  CD    . GLU B 2  16  ? 24.891  45.683  67.207 1.00 105.22 ? 17  GLU A CD    1 
ATOM   1529  O  OE1   . GLU B 2  16  ? 25.219  44.973  68.182 1.00 109.87 ? 17  GLU A OE1   1 
ATOM   1530  O  OE2   . GLU B 2  16  ? 24.050  45.312  66.360 1.00 109.45 ? 17  GLU A OE2   1 
ATOM   1531  N  N     . MET B 2  17  ? 29.172  47.545  65.855 1.00 88.15  ? 18  MET A N     1 
ATOM   1532  C  CA    . MET B 2  17  ? 29.618  47.854  64.499 1.00 84.47  ? 18  MET A CA    1 
ATOM   1533  C  C     . MET B 2  17  ? 30.471  46.733  63.918 1.00 89.71  ? 18  MET A C     1 
ATOM   1534  O  O     . MET B 2  17  ? 30.236  46.282  62.791 1.00 90.83  ? 18  MET A O     1 
ATOM   1535  C  CB    . MET B 2  17  ? 30.386  49.183  64.472 1.00 83.73  ? 18  MET A CB    1 
ATOM   1536  C  CG    . MET B 2  17  ? 29.518  50.428  64.611 1.00 88.32  ? 18  MET A CG    1 
ATOM   1537  S  SD    . MET B 2  17  ? 28.255  50.605  63.338 1.00 85.00  ? 18  MET A SD    1 
ATOM   1538  C  CE    . MET B 2  17  ? 29.289  50.910  61.925 1.00 92.36  ? 18  MET A CE    1 
ATOM   1539  N  N     . ARG B 2  18  ? 31.477  46.273  64.667 1.00 87.14  ? 19  ARG A N     1 
ATOM   1540  C  CA    . ARG B 2  18  ? 32.407  45.278  64.131 1.00 79.10  ? 19  ARG A CA    1 
ATOM   1541  C  C     . ARG B 2  18  ? 31.724  43.941  63.889 1.00 76.72  ? 19  ARG A C     1 
ATOM   1542  O  O     . ARG B 2  18  ? 32.051  43.236  62.926 1.00 78.41  ? 19  ARG A O     1 
ATOM   1543  C  CB    . ARG B 2  18  ? 33.592  45.096  65.082 1.00 82.82  ? 19  ARG A CB    1 
ATOM   1544  C  CG    . ARG B 2  18  ? 34.299  46.378  65.402 1.00 88.36  ? 19  ARG A CG    1 
ATOM   1545  C  CD    . ARG B 2  18  ? 35.306  46.216  66.520 1.00 93.39  ? 19  ARG A CD    1 
ATOM   1546  N  NE    . ARG B 2  18  ? 36.676  46.237  66.019 1.00 107.90 ? 19  ARG A NE    1 
ATOM   1547  C  CZ    . ARG B 2  18  ? 37.423  45.152  65.849 1.00 121.40 ? 19  ARG A CZ    1 
ATOM   1548  N  NH1   . ARG B 2  18  ? 38.663  45.263  65.387 1.00 128.50 ? 19  ARG A NH1   1 
ATOM   1549  N  NH2   . ARG B 2  18  ? 36.935  43.954  66.150 1.00 120.81 ? 19  ARG A NH2   1 
ATOM   1550  N  N     . GLU B 2  19  ? 30.815  43.552  64.775 1.00 77.28  ? 20  GLU A N     1 
ATOM   1551  C  CA    . GLU B 2  19  ? 30.109  42.282  64.608 1.00 79.14  ? 20  GLU A CA    1 
ATOM   1552  C  C     . GLU B 2  19  ? 29.092  42.359  63.480 1.00 77.18  ? 20  GLU A C     1 
ATOM   1553  O  O     . GLU B 2  19  ? 28.966  41.421  62.680 1.00 87.16  ? 20  GLU A O     1 
ATOM   1554  C  CB    . GLU B 2  19  ? 29.411  41.872  65.913 1.00 98.61  ? 20  GLU A CB    1 
ATOM   1555  C  CG    . GLU B 2  19  ? 30.300  42.010  67.137 1.00 113.76 ? 20  GLU A CG    1 
ATOM   1556  C  CD    . GLU B 2  19  ? 29.774  41.310  68.373 1.00 112.56 ? 20  GLU A CD    1 
ATOM   1557  O  OE1   . GLU B 2  19  ? 30.376  41.509  69.450 1.00 104.59 ? 20  GLU A OE1   1 
ATOM   1558  O  OE2   . GLU B 2  19  ? 28.776  40.562  68.278 1.00 113.24 ? 20  GLU A OE2   1 
ATOM   1559  N  N     . SER B 2  20  ? 28.369  43.476  63.390 1.00 76.30  ? 21  SER A N     1 
ATOM   1560  C  CA    . SER B 2  20  ? 27.300  43.602  62.406 1.00 72.48  ? 21  SER A CA    1 
ATOM   1561  C  C     . SER B 2  20  ? 27.839  43.752  60.997 1.00 72.50  ? 21  SER A C     1 
ATOM   1562  O  O     . SER B 2  20  ? 27.186  43.319  60.041 1.00 72.73  ? 21  SER A O     1 
ATOM   1563  C  CB    . SER B 2  20  ? 26.397  44.787  62.743 1.00 72.36  ? 21  SER A CB    1 
ATOM   1564  O  OG    . SER B 2  20  ? 25.359  44.407  63.621 1.00 68.78  ? 21  SER A OG    1 
ATOM   1565  N  N     . PHE B 2  21  ? 28.987  44.410  60.843 1.00 80.15  ? 22  PHE A N     1 
ATOM   1566  C  CA    . PHE B 2  21  ? 29.573  44.582  59.518 1.00 79.10  ? 22  PHE A CA    1 
ATOM   1567  C  C     . PHE B 2  21  ? 30.088  43.270  58.962 1.00 83.80  ? 22  PHE A C     1 
ATOM   1568  O  O     . PHE B 2  21  ? 29.941  42.988  57.765 1.00 85.58  ? 22  PHE A O     1 
ATOM   1569  C  CB    . PHE B 2  21  ? 30.722  45.582  59.563 1.00 80.01  ? 22  PHE A CB    1 
ATOM   1570  C  CG    . PHE B 2  21  ? 31.161  46.027  58.212 1.00 85.15  ? 22  PHE A CG    1 
ATOM   1571  C  CD1   . PHE B 2  21  ? 30.317  46.805  57.453 1.00 85.49  ? 22  PHE A CD1   1 
ATOM   1572  C  CD2   . PHE B 2  21  ? 32.382  45.633  57.685 1.00 91.00  ? 22  PHE A CD2   1 
ATOM   1573  C  CE1   . PHE B 2  21  ? 30.672  47.215  56.199 1.00 97.79  ? 22  PHE A CE1   1 
ATOM   1574  C  CE2   . PHE B 2  21  ? 32.764  46.053  56.423 1.00 96.54  ? 22  PHE A CE2   1 
ATOM   1575  C  CZ    . PHE B 2  21  ? 31.899  46.842  55.673 1.00 103.31 ? 22  PHE A CZ    1 
ATOM   1576  N  N     . LEU B 2  22  ? 30.744  42.479  59.808 1.00 81.99  ? 23  LEU A N     1 
ATOM   1577  C  CA    . LEU B 2  22  ? 31.349  41.233  59.358 1.00 79.01  ? 23  LEU A CA    1 
ATOM   1578  C  C     . LEU B 2  22  ? 30.301  40.269  58.833 1.00 75.96  ? 23  LEU A C     1 
ATOM   1579  O  O     . LEU B 2  22  ? 30.534  39.560  57.846 1.00 76.06  ? 23  LEU A O     1 
ATOM   1580  C  CB    . LEU B 2  22  ? 32.128  40.589  60.499 1.00 76.54  ? 23  LEU A CB    1 
ATOM   1581  C  CG    . LEU B 2  22  ? 33.298  39.756  60.003 1.00 75.71  ? 23  LEU A CG    1 
ATOM   1582  C  CD1   . LEU B 2  22  ? 34.161  40.615  59.120 1.00 79.00  ? 23  LEU A CD1   1 
ATOM   1583  C  CD2   . LEU B 2  22  ? 34.101  39.221  61.164 1.00 92.68  ? 23  LEU A CD2   1 
ATOM   1584  N  N     . ASP B 2  23  ? 29.148  40.204  59.487 1.00 75.36  ? 24  ASP A N     1 
ATOM   1585  C  CA    . ASP B 2  23  ? 28.099  39.327  58.988 1.00 82.47  ? 24  ASP A CA    1 
ATOM   1586  C  C     . ASP B 2  23  ? 27.706  39.723  57.581 1.00 87.85  ? 24  ASP A C     1 
ATOM   1587  O  O     . ASP B 2  23  ? 27.628  38.879  56.684 1.00 102.04 ? 24  ASP A O     1 
ATOM   1588  C  CB    . ASP B 2  23  ? 26.883  39.361  59.908 1.00 82.40  ? 24  ASP A CB    1 
ATOM   1589  C  CG    . ASP B 2  23  ? 27.204  38.888  61.291 1.00 103.44 ? 24  ASP A CG    1 
ATOM   1590  O  OD1   . ASP B 2  23  ? 28.398  38.928  61.670 1.00 118.29 ? 24  ASP A OD1   1 
ATOM   1591  O  OD2   . ASP B 2  23  ? 26.264  38.482  61.999 1.00 111.72 ? 24  ASP A OD2   1 
ATOM   1592  N  N     . TYR B 2  24  ? 27.470  41.015  57.365 1.00 82.83  ? 25  TYR A N     1 
ATOM   1593  C  CA    . TYR B 2  24  ? 27.115  41.468  56.028 1.00 73.62  ? 25  TYR A CA    1 
ATOM   1594  C  C     . TYR B 2  24  ? 28.272  41.279  55.062 1.00 79.92  ? 25  TYR A C     1 
ATOM   1595  O  O     . TYR B 2  24  ? 28.078  40.791  53.946 1.00 59.72  ? 25  TYR A O     1 
ATOM   1596  C  CB    . TYR B 2  24  ? 26.670  42.923  56.064 1.00 64.26  ? 25  TYR A CB    1 
ATOM   1597  C  CG    . TYR B 2  24  ? 26.123  43.385  54.742 1.00 71.35  ? 25  TYR A CG    1 
ATOM   1598  C  CD1   . TYR B 2  24  ? 24.824  43.072  54.370 1.00 77.28  ? 25  TYR A CD1   1 
ATOM   1599  C  CD2   . TYR B 2  24  ? 26.910  44.102  53.849 1.00 70.07  ? 25  TYR A CD2   1 
ATOM   1600  C  CE1   . TYR B 2  24  ? 24.299  43.514  53.177 1.00 66.09  ? 25  TYR A CE1   1 
ATOM   1601  C  CE2   . TYR B 2  24  ? 26.398  44.534  52.644 1.00 62.03  ? 25  TYR A CE2   1 
ATOM   1602  C  CZ    . TYR B 2  24  ? 25.093  44.231  52.314 1.00 69.16  ? 25  TYR A CZ    1 
ATOM   1603  O  OH    . TYR B 2  24  ? 24.574  44.648  51.113 1.00 90.31  ? 25  TYR A OH    1 
ATOM   1604  N  N     . ALA B 2  25  ? 29.481  41.638  55.478 1.00 61.62  ? 26  ALA A N     1 
ATOM   1605  C  CA    . ALA B 2  25  ? 30.629  41.549  54.592 1.00 70.36  ? 26  ALA A CA    1 
ATOM   1606  C  C     . ALA B 2  25  ? 30.902  40.108  54.195 1.00 67.29  ? 26  ALA A C     1 
ATOM   1607  O  O     . ALA B 2  25  ? 31.032  39.797  53.010 1.00 57.54  ? 26  ALA A O     1 
ATOM   1608  C  CB    . ALA B 2  25  ? 31.856  42.160  55.264 1.00 69.69  ? 26  ALA A CB    1 
ATOM   1609  N  N     . MET B 2  26  ? 30.977  39.204  55.175 1.00 75.19  ? 27  MET A N     1 
ATOM   1610  C  CA    . MET B 2  26  ? 31.174  37.781  54.880 1.00 57.44  ? 27  MET A CA    1 
ATOM   1611  C  C     . MET B 2  26  ? 30.008  37.218  54.092 1.00 53.38  ? 27  MET A C     1 
ATOM   1612  O  O     . MET B 2  26  ? 30.194  36.426  53.157 1.00 61.57  ? 27  MET A O     1 
ATOM   1613  C  CB    . MET B 2  26  ? 31.355  36.981  56.167 1.00 68.04  ? 27  MET A CB    1 
ATOM   1614  C  CG    . MET B 2  26  ? 32.576  37.319  56.981 1.00 86.32  ? 27  MET A CG    1 
ATOM   1615  S  SD    . MET B 2  26  ? 32.868  36.069  58.258 1.00 90.27  ? 27  MET A SD    1 
ATOM   1616  C  CE    . MET B 2  26  ? 31.192  35.774  58.839 1.00 80.51  ? 27  MET A CE    1 
ATOM   1617  N  N     . SER B 2  27  ? 28.792  37.600  54.456 1.00 50.86  ? 28  SER A N     1 
ATOM   1618  C  CA    . SER B 2  27  ? 27.637  37.097  53.730 1.00 50.76  ? 28  SER A CA    1 
ATOM   1619  C  C     . SER B 2  27  ? 27.625  37.615  52.304 1.00 60.84  ? 28  SER A C     1 
ATOM   1620  O  O     . SER B 2  27  ? 27.349  36.855  51.377 1.00 87.06  ? 28  SER A O     1 
ATOM   1621  C  CB    . SER B 2  27  ? 26.345  37.457  54.452 1.00 65.86  ? 28  SER A CB    1 
ATOM   1622  O  OG    . SER B 2  27  ? 25.258  36.801  53.842 1.00 63.03  ? 28  SER A OG    1 
ATOM   1623  N  N     . VAL B 2  28  ? 27.930  38.895  52.090 1.00 61.41  ? 29  VAL A N     1 
ATOM   1624  C  CA    . VAL B 2  28  ? 27.963  39.356  50.705 1.00 53.45  ? 29  VAL A CA    1 
ATOM   1625  C  C     . VAL B 2  28  ? 29.084  38.658  49.947 1.00 60.48  ? 29  VAL A C     1 
ATOM   1626  O  O     . VAL B 2  28  ? 28.922  38.274  48.782 1.00 77.60  ? 29  VAL A O     1 
ATOM   1627  C  CB    . VAL B 2  28  ? 28.100  40.893  50.629 1.00 52.24  ? 29  VAL A CB    1 
ATOM   1628  C  CG1   . VAL B 2  28  ? 28.340  41.322  49.192 1.00 64.74  ? 29  VAL A CG1   1 
ATOM   1629  C  CG2   . VAL B 2  28  ? 26.842  41.576  51.213 1.00 52.07  ? 29  VAL A CG2   1 
ATOM   1630  N  N     . ILE B 2  29  ? 30.221  38.439  50.618 1.00 64.21  ? 30  ILE A N     1 
ATOM   1631  C  CA    . ILE B 2  29  ? 31.412  37.833  50.006 1.00 64.99  ? 30  ILE A CA    1 
ATOM   1632  C  C     . ILE B 2  29  ? 31.167  36.368  49.664 1.00 84.33  ? 30  ILE A C     1 
ATOM   1633  O  O     . ILE B 2  29  ? 31.506  35.916  48.567 1.00 90.21  ? 30  ILE A O     1 
ATOM   1634  C  CB    . ILE B 2  29  ? 32.621  37.958  50.945 1.00 60.63  ? 30  ILE A CB    1 
ATOM   1635  C  CG1   . ILE B 2  29  ? 33.134  39.400  51.001 1.00 59.64  ? 30  ILE A CG1   1 
ATOM   1636  C  CG2   . ILE B 2  29  ? 33.736  36.997  50.532 1.00 60.78  ? 30  ILE A CG2   1 
ATOM   1637  C  CD1   . ILE B 2  29  ? 33.910  39.731  52.286 1.00 58.18  ? 30  ILE A CD1   1 
ATOM   1638  N  N     . VAL B 2  30  ? 30.684  35.565  50.629 1.00 97.40  ? 31  VAL A N     1 
ATOM   1639  C  CA    . VAL B 2  30  ? 30.557  34.122  50.399 1.00 69.07  ? 31  VAL A CA    1 
ATOM   1640  C  C     . VAL B 2  30  ? 29.159  33.688  49.970 1.00 63.74  ? 31  VAL A C     1 
ATOM   1641  O  O     . VAL B 2  30  ? 28.968  32.506  49.645 1.00 65.84  ? 31  VAL A O     1 
ATOM   1642  C  CB    . VAL B 2  30  ? 30.903  33.283  51.650 1.00 58.26  ? 31  VAL A CB    1 
ATOM   1643  C  CG1   . VAL B 2  30  ? 32.182  33.717  52.306 1.00 59.44  ? 31  VAL A CG1   1 
ATOM   1644  C  CG2   . VAL B 2  30  ? 29.751  33.291  52.614 1.00 60.19  ? 31  VAL A CG2   1 
ATOM   1645  N  N     . ALA B 2  31  ? 28.164  34.572  50.000 1.00 67.85  ? 32  ALA A N     1 
ATOM   1646  C  CA    . ALA B 2  31  ? 26.804  34.100  49.760 1.00 66.64  ? 32  ALA A CA    1 
ATOM   1647  C  C     . ALA B 2  31  ? 25.987  35.059  48.918 1.00 73.25  ? 32  ALA A C     1 
ATOM   1648  O  O     . ALA B 2  31  ? 24.763  35.090  49.044 1.00 76.35  ? 32  ALA A O     1 
ATOM   1649  C  CB    . ALA B 2  31  ? 26.072  33.828  51.072 1.00 64.38  ? 32  ALA A CB    1 
ATOM   1650  N  N     . ARG B 2  32  ? 26.635  35.844  48.046 1.00 82.44  ? 33  ARG A N     1 
ATOM   1651  C  CA    . ARG B 2  32  ? 25.907  36.775  47.180 1.00 72.21  ? 33  ARG A CA    1 
ATOM   1652  C  C     . ARG B 2  32  ? 26.676  37.138  45.920 1.00 62.38  ? 33  ARG A C     1 
ATOM   1653  O  O     . ARG B 2  32  ? 26.223  36.850  44.808 1.00 64.67  ? 33  ARG A O     1 
ATOM   1654  C  CB    . ARG B 2  32  ? 25.559  38.066  47.930 1.00 59.77  ? 33  ARG A CB    1 
ATOM   1655  C  CG    . ARG B 2  32  ? 24.652  38.989  47.111 1.00 59.16  ? 33  ARG A CG    1 
ATOM   1656  C  CD    . ARG B 2  32  ? 24.098  40.153  47.935 1.00 61.95  ? 33  ARG A CD    1 
ATOM   1657  N  NE    . ARG B 2  32  ? 23.334  39.641  49.058 1.00 71.11  ? 33  ARG A NE    1 
ATOM   1658  C  CZ    . ARG B 2  32  ? 22.811  40.365  50.040 1.00 74.94  ? 33  ARG A CZ    1 
ATOM   1659  N  NH1   . ARG B 2  32  ? 22.949  41.681  50.077 1.00 88.01  ? 33  ARG A NH1   1 
ATOM   1660  N  NH2   . ARG B 2  32  ? 22.147  39.751  51.000 1.00 65.61  ? 33  ARG A NH2   1 
ATOM   1661  N  N     . ALA B 2  33  ? 27.829  37.773  46.076 1.00 76.53  ? 34  ALA A N     1 
ATOM   1662  C  CA    . ALA B 2  33  ? 28.406  38.613  45.030 1.00 65.17  ? 34  ALA A CA    1 
ATOM   1663  C  C     . ALA B 2  33  ? 29.549  37.956  44.275 1.00 61.70  ? 34  ALA A C     1 
ATOM   1664  O  O     . ALA B 2  33  ? 29.960  38.487  43.230 1.00 66.23  ? 34  ALA A O     1 
ATOM   1665  C  CB    . ALA B 2  33  ? 28.870  39.946  45.630 1.00 53.70  ? 34  ALA A CB    1 
ATOM   1666  N  N     . LEU B 2  34  ? 30.054  36.829  44.749 1.00 61.54  ? 35  LEU A N     1 
ATOM   1667  C  CA    . LEU B 2  34  ? 31.208  36.199  44.135 1.00 59.22  ? 35  LEU A CA    1 
ATOM   1668  C  C     . LEU B 2  34  ? 30.882  34.795  43.636 1.00 62.43  ? 35  LEU A C     1 
ATOM   1669  O  O     . LEU B 2  34  ? 30.156  34.051  44.309 1.00 63.95  ? 35  LEU A O     1 
ATOM   1670  C  CB    . LEU B 2  34  ? 32.370  36.117  45.130 1.00 52.06  ? 35  LEU A CB    1 
ATOM   1671  C  CG    . LEU B 2  34  ? 32.897  37.412  45.713 1.00 48.25  ? 35  LEU A CG    1 
ATOM   1672  C  CD1   . LEU B 2  34  ? 33.898  37.043  46.786 1.00 51.46  ? 35  LEU A CD1   1 
ATOM   1673  C  CD2   . LEU B 2  34  ? 33.544  38.202  44.602 1.00 44.34  ? 35  LEU A CD2   1 
ATOM   1674  N  N     . PRO B 2  35  ? 31.425  34.397  42.488 1.00 55.68  ? 36  PRO A N     1 
ATOM   1675  C  CA    . PRO B 2  35  ? 31.174  33.054  41.942 1.00 48.28  ? 36  PRO A CA    1 
ATOM   1676  C  C     . PRO B 2  35  ? 32.031  31.995  42.624 1.00 54.08  ? 36  PRO A C     1 
ATOM   1677  O  O     . PRO B 2  35  ? 33.132  32.267  43.098 1.00 65.15  ? 36  PRO A O     1 
ATOM   1678  C  CB    . PRO B 2  35  ? 31.592  33.223  40.480 1.00 59.16  ? 36  PRO A CB    1 
ATOM   1679  C  CG    . PRO B 2  35  ? 32.738  34.194  40.581 1.00 48.56  ? 36  PRO A CG    1 
ATOM   1680  C  CD    . PRO B 2  35  ? 32.290  35.198  41.607 1.00 58.30  ? 36  PRO A CD    1 
ATOM   1681  N  N     . ASP B 2  36  ? 31.531  30.747  42.632 1.00 59.48  ? 37  ASP A N     1 
ATOM   1682  C  CA    . ASP B 2  36  ? 32.356  29.612  43.056 1.00 59.08  ? 37  ASP A CA    1 
ATOM   1683  C  C     . ASP B 2  36  ? 33.293  29.233  41.904 1.00 57.90  ? 37  ASP A C     1 
ATOM   1684  O  O     . ASP B 2  36  ? 32.871  29.172  40.747 1.00 66.35  ? 37  ASP A O     1 
ATOM   1685  C  CB    . ASP B 2  36  ? 31.495  28.406  43.475 1.00 66.63  ? 37  ASP A CB    1 
ATOM   1686  C  CG    . ASP B 2  36  ? 32.284  27.333  44.255 1.00 78.35  ? 37  ASP A CG    1 
ATOM   1687  O  OD1   . ASP B 2  36  ? 33.078  26.603  43.634 1.00 94.98  ? 37  ASP A OD1   1 
ATOM   1688  O  OD2   . ASP B 2  36  ? 32.093  27.195  45.484 1.00 66.50  ? 37  ASP A OD2   1 
ATOM   1689  N  N     . VAL B 2  37  ? 34.571  28.991  42.212 1.00 55.14  ? 38  VAL A N     1 
ATOM   1690  C  CA    . VAL B 2  37  ? 35.533  28.703  41.160 1.00 55.58  ? 38  VAL A CA    1 
ATOM   1691  C  C     . VAL B 2  37  ? 35.165  27.430  40.412 1.00 60.14  ? 38  VAL A C     1 
ATOM   1692  O  O     . VAL B 2  37  ? 35.585  27.236  39.266 1.00 65.89  ? 38  VAL A O     1 
ATOM   1693  C  CB    . VAL B 2  37  ? 36.977  28.594  41.711 1.00 62.49  ? 38  VAL A CB    1 
ATOM   1694  C  CG1   . VAL B 2  37  ? 37.076  27.419  42.624 1.00 61.23  ? 38  VAL A CG1   1 
ATOM   1695  C  CG2   . VAL B 2  37  ? 37.989  28.457  40.576 1.00 64.92  ? 38  VAL A CG2   1 
ATOM   1696  N  N     . ARG B 2  38  ? 34.365  26.558  41.027 1.00 64.79  ? 39  ARG A N     1 
ATOM   1697  C  CA    . ARG B 2  38  ? 34.108  25.247  40.441 1.00 67.49  ? 39  ARG A CA    1 
ATOM   1698  C  C     . ARG B 2  38  ? 33.021  25.292  39.377 1.00 65.41  ? 39  ARG A C     1 
ATOM   1699  O  O     . ARG B 2  38  ? 33.200  24.747  38.284 1.00 73.26  ? 39  ARG A O     1 
ATOM   1700  C  CB    . ARG B 2  38  ? 33.740  24.256  41.545 1.00 65.26  ? 39  ARG A CB    1 
ATOM   1701  C  CG    . ARG B 2  38  ? 34.821  24.091  42.577 1.00 65.21  ? 39  ARG A CG    1 
ATOM   1702  C  CD    . ARG B 2  38  ? 34.392  23.158  43.680 1.00 64.69  ? 39  ARG A CD    1 
ATOM   1703  N  NE    . ARG B 2  38  ? 33.358  23.742  44.527 1.00 62.69  ? 39  ARG A NE    1 
ATOM   1704  C  CZ    . ARG B 2  38  ? 32.941  23.198  45.665 1.00 63.16  ? 39  ARG A CZ    1 
ATOM   1705  N  NH1   . ARG B 2  38  ? 33.476  22.057  46.083 1.00 74.46  ? 39  ARG A NH1   1 
ATOM   1706  N  NH2   . ARG B 2  38  ? 31.996  23.791  46.384 1.00 71.57  ? 39  ARG A NH2   1 
ATOM   1707  N  N     . ASP B 2  39  ? 31.880  25.895  39.670 1.00 55.84  ? 40  ASP A N     1 
ATOM   1708  C  CA    . ASP B 2  39  ? 30.823  25.942  38.669 1.00 54.49  ? 40  ASP A CA    1 
ATOM   1709  C  C     . ASP B 2  39  ? 30.605  27.326  38.086 1.00 51.03  ? 40  ASP A C     1 
ATOM   1710  O  O     . ASP B 2  39  ? 29.799  27.467  37.158 1.00 46.21  ? 40  ASP A O     1 
ATOM   1711  C  CB    . ASP B 2  39  ? 29.506  25.385  39.232 1.00 65.87  ? 40  ASP A CB    1 
ATOM   1712  C  CG    . ASP B 2  39  ? 29.002  26.141  40.435 1.00 66.75  ? 40  ASP A CG    1 
ATOM   1713  O  OD1   . ASP B 2  39  ? 29.549  27.213  40.754 1.00 76.24  ? 40  ASP A OD1   1 
ATOM   1714  O  OD2   . ASP B 2  39  ? 28.031  25.672  41.056 1.00 70.17  ? 40  ASP A OD2   1 
ATOM   1715  N  N     . GLY B 2  40  ? 31.316  28.334  38.580 1.00 54.06  ? 41  GLY A N     1 
ATOM   1716  C  CA    . GLY B 2  40  ? 31.226  29.689  38.075 1.00 51.89  ? 41  GLY A CA    1 
ATOM   1717  C  C     . GLY B 2  40  ? 29.978  30.436  38.457 1.00 54.56  ? 41  GLY A C     1 
ATOM   1718  O  O     . GLY B 2  40  ? 29.702  31.488  37.870 1.00 73.48  ? 41  GLY A O     1 
ATOM   1719  N  N     . LEU B 2  41  ? 29.219  29.937  39.419 1.00 50.27  ? 42  LEU A N     1 
ATOM   1720  C  CA    . LEU B 2  41  ? 27.930  30.515  39.739 1.00 48.88  ? 42  LEU A CA    1 
ATOM   1721  C  C     . LEU B 2  41  ? 27.961  31.192  41.105 1.00 53.31  ? 42  LEU A C     1 
ATOM   1722  O  O     . LEU B 2  41  ? 28.707  30.801  42.012 1.00 56.20  ? 42  LEU A O     1 
ATOM   1723  C  CB    . LEU B 2  41  ? 26.840  29.439  39.706 1.00 52.78  ? 42  LEU A CB    1 
ATOM   1724  C  CG    . LEU B 2  41  ? 26.709  28.678  38.385 1.00 50.50  ? 42  LEU A CG    1 
ATOM   1725  C  CD1   . LEU B 2  41  ? 25.768  27.498  38.575 1.00 57.35  ? 42  LEU A CD1   1 
ATOM   1726  C  CD2   . LEU B 2  41  ? 26.227  29.589  37.259 1.00 42.14  ? 42  LEU A CD2   1 
ATOM   1727  N  N     . LYS B 2  42  ? 27.169  32.238  41.222 1.00 52.79  ? 43  LYS A N     1 
ATOM   1728  C  CA    . LYS B 2  42  ? 26.799  32.822  42.500 1.00 47.51  ? 43  LYS A CA    1 
ATOM   1729  C  C     . LYS B 2  42  ? 25.509  32.172  42.981 1.00 48.84  ? 43  LYS A C     1 
ATOM   1730  O  O     . LYS B 2  42  ? 24.753  31.613  42.172 1.00 49.96  ? 43  LYS A O     1 
ATOM   1731  C  CB    . LYS B 2  42  ? 26.574  34.337  42.361 1.00 50.01  ? 43  LYS A CB    1 
ATOM   1732  C  CG    . LYS B 2  42  ? 27.608  35.111  41.535 1.00 48.13  ? 43  LYS A CG    1 
ATOM   1733  C  CD    . LYS B 2  42  ? 27.104  36.547  41.305 1.00 49.92  ? 43  LYS A CD    1 
ATOM   1734  C  CE    . LYS B 2  42  ? 28.072  37.406  40.515 1.00 62.86  ? 43  LYS A CE    1 
ATOM   1735  N  NZ    . LYS B 2  42  ? 27.507  38.779  40.329 1.00 64.94  ? 43  LYS A NZ    1 
ATOM   1736  N  N     . PRO B 2  43  ? 25.216  32.210  44.285 1.00 50.35  ? 44  PRO A N     1 
ATOM   1737  C  CA    . PRO B 2  43  ? 24.009  31.524  44.766 1.00 49.81  ? 44  PRO A CA    1 
ATOM   1738  C  C     . PRO B 2  43  ? 22.729  31.827  43.985 1.00 57.47  ? 44  PRO A C     1 
ATOM   1739  O  O     . PRO B 2  43  ? 21.999  30.878  43.694 1.00 50.70  ? 44  PRO A O     1 
ATOM   1740  C  CB    . PRO B 2  43  ? 23.912  31.969  46.225 1.00 49.65  ? 44  PRO A CB    1 
ATOM   1741  C  CG    . PRO B 2  43  ? 25.276  32.370  46.603 1.00 52.61  ? 44  PRO A CG    1 
ATOM   1742  C  CD    . PRO B 2  43  ? 25.984  32.813  45.376 1.00 51.86  ? 44  PRO A CD    1 
ATOM   1743  N  N     . VAL B 2  44  ? 22.402  33.068  43.613 1.00 62.24  ? 45  VAL A N     1 
ATOM   1744  C  CA    . VAL B 2  44  ? 21.105  33.271  42.952 1.00 48.03  ? 45  VAL A CA    1 
ATOM   1745  C  C     . VAL B 2  44  ? 21.039  32.498  41.627 1.00 47.60  ? 45  VAL A C     1 
ATOM   1746  O  O     . VAL B 2  44  ? 20.021  31.865  41.318 1.00 56.17  ? 45  VAL A O     1 
ATOM   1747  C  CB    . VAL B 2  44  ? 20.766  34.769  42.778 1.00 57.83  ? 45  VAL A CB    1 
ATOM   1748  C  CG1   . VAL B 2  44  ? 21.697  35.462  41.773 1.00 50.52  ? 45  VAL A CG1   1 
ATOM   1749  C  CG2   . VAL B 2  44  ? 19.275  34.904  42.332 1.00 57.47  ? 45  VAL A CG2   1 
ATOM   1750  N  N     . HIS B 2  45  ? 22.136  32.504  40.858 1.00 63.39  ? 46  HIS A N     1 
ATOM   1751  C  CA    . HIS B 2  45  ? 22.181  31.801  39.582 1.00 58.19  ? 46  HIS A CA    1 
ATOM   1752  C  C     . HIS B 2  45  ? 22.054  30.302  39.773 1.00 60.72  ? 46  HIS A C     1 
ATOM   1753  O  O     . HIS B 2  45  ? 21.275  29.628  39.085 1.00 59.75  ? 46  HIS A O     1 
ATOM   1754  C  CB    . HIS B 2  45  ? 23.492  32.106  38.850 1.00 57.07  ? 46  HIS A CB    1 
ATOM   1755  C  CG    . HIS B 2  45  ? 23.626  33.551  38.522 1.00 68.18  ? 46  HIS A CG    1 
ATOM   1756  N  ND1   . HIS B 2  45  ? 24.312  34.434  39.318 1.00 76.89  ? 46  HIS A ND1   1 
ATOM   1757  C  CD2   . HIS B 2  45  ? 23.076  34.289  37.531 1.00 76.80  ? 46  HIS A CD2   1 
ATOM   1758  C  CE1   . HIS B 2  45  ? 24.203  35.651  38.815 1.00 72.65  ? 46  HIS A CE1   1 
ATOM   1759  N  NE2   . HIS B 2  45  ? 23.458  35.591  37.729 1.00 69.18  ? 46  HIS A NE2   1 
ATOM   1760  N  N     . ARG B 2  46  ? 22.826  29.763  40.710 1.00 65.05  ? 47  ARG A N     1 
ATOM   1761  C  CA    . ARG B 2  46  ? 22.793  28.340  41.010 1.00 68.29  ? 47  ARG A CA    1 
ATOM   1762  C  C     . ARG B 2  46  ? 21.404  27.886  41.433 1.00 59.89  ? 47  ARG A C     1 
ATOM   1763  O  O     . ARG B 2  46  ? 20.943  26.813  41.028 1.00 53.42  ? 47  ARG A O     1 
ATOM   1764  C  CB    . ARG B 2  46  ? 23.819  28.025  42.094 1.00 64.86  ? 47  ARG A CB    1 
ATOM   1765  C  CG    . ARG B 2  46  ? 24.022  26.556  42.286 1.00 69.33  ? 47  ARG A CG    1 
ATOM   1766  C  CD    . ARG B 2  46  ? 25.013  26.263  43.375 1.00 69.66  ? 47  ARG A CD    1 
ATOM   1767  N  NE    . ARG B 2  46  ? 26.344  26.729  43.022 1.00 56.48  ? 47  ARG A NE    1 
ATOM   1768  C  CZ    . ARG B 2  46  ? 26.991  27.694  43.657 1.00 56.63  ? 47  ARG A CZ    1 
ATOM   1769  N  NH1   . ARG B 2  46  ? 26.434  28.300  44.697 1.00 75.83  ? 47  ARG A NH1   1 
ATOM   1770  N  NH2   . ARG B 2  46  ? 28.200  28.052  43.258 1.00 50.97  ? 47  ARG A NH2   1 
ATOM   1771  N  N     . ARG B 2  47  ? 20.727  28.683  42.258 1.00 58.75  ? 48  ARG A N     1 
ATOM   1772  C  CA    . ARG B 2  47  ? 19.394  28.322  42.721 1.00 59.71  ? 48  ARG A CA    1 
ATOM   1773  C  C     . ARG B 2  47  ? 18.366  28.405  41.606 1.00 63.99  ? 48  ARG A C     1 
ATOM   1774  O  O     . ARG B 2  47  ? 17.397  27.638  41.594 1.00 55.29  ? 48  ARG A O     1 
ATOM   1775  C  CB    . ARG B 2  47  ? 18.990  29.208  43.886 1.00 54.84  ? 48  ARG A CB    1 
ATOM   1776  C  CG    . ARG B 2  47  ? 19.800  28.953  45.112 1.00 59.18  ? 48  ARG A CG    1 
ATOM   1777  C  CD    . ARG B 2  47  ? 19.506  29.942  46.167 1.00 69.80  ? 48  ARG A CD    1 
ATOM   1778  N  NE    . ARG B 2  47  ? 20.200  29.558  47.384 1.00 67.80  ? 48  ARG A NE    1 
ATOM   1779  C  CZ    . ARG B 2  47  ? 20.538  30.400  48.347 1.00 67.35  ? 48  ARG A CZ    1 
ATOM   1780  N  NH1   . ARG B 2  47  ? 20.249  31.683  48.249 1.00 81.18  ? 48  ARG A NH1   1 
ATOM   1781  N  NH2   . ARG B 2  47  ? 21.168  29.957  49.418 1.00 70.47  ? 48  ARG A NH2   1 
ATOM   1782  N  N     . ILE B 2  48  ? 18.537  29.335  40.671 1.00 69.85  ? 49  ILE A N     1 
ATOM   1783  C  CA    . ILE B 2  48  ? 17.638  29.407  39.522 1.00 66.77  ? 49  ILE A CA    1 
ATOM   1784  C  C     . ILE B 2  48  ? 17.752  28.143  38.684 1.00 69.11  ? 49  ILE A C     1 
ATOM   1785  O  O     . ILE B 2  48  ? 16.747  27.514  38.330 1.00 68.95  ? 49  ILE A O     1 
ATOM   1786  C  CB    . ILE B 2  48  ? 17.930  30.651  38.670 1.00 58.35  ? 49  ILE A CB    1 
ATOM   1787  C  CG1   . ILE B 2  48  ? 17.624  31.931  39.448 1.00 55.28  ? 49  ILE A CG1   1 
ATOM   1788  C  CG2   . ILE B 2  48  ? 17.136  30.574  37.364 1.00 63.64  ? 49  ILE A CG2   1 
ATOM   1789  C  CD1   . ILE B 2  48  ? 18.168  33.168  38.792 1.00 50.11  ? 49  ILE A CD1   1 
ATOM   1790  N  N     . LEU B 2  49  ? 18.984  27.765  38.335 1.00 69.69  ? 50  LEU A N     1 
ATOM   1791  C  CA    . LEU B 2  49  ? 19.189  26.613  37.470 1.00 75.33  ? 50  LEU A CA    1 
ATOM   1792  C  C     . LEU B 2  49  ? 18.781  25.325  38.168 1.00 77.80  ? 50  LEU A C     1 
ATOM   1793  O  O     . LEU B 2  49  ? 18.081  24.488  37.589 1.00 80.39  ? 50  LEU A O     1 
ATOM   1794  C  CB    . LEU B 2  49  ? 20.646  26.551  37.029 1.00 64.38  ? 50  LEU A CB    1 
ATOM   1795  C  CG    . LEU B 2  49  ? 21.159  27.765  36.248 1.00 60.33  ? 50  LEU A CG    1 
ATOM   1796  C  CD1   . LEU B 2  49  ? 22.648  27.648  35.990 1.00 68.09  ? 50  LEU A CD1   1 
ATOM   1797  C  CD2   . LEU B 2  49  ? 20.389  27.949  34.944 1.00 51.34  ? 50  LEU A CD2   1 
ATOM   1798  N  N     . TYR B 2  50  ? 19.215  25.138  39.415 1.00 75.64  ? 51  TYR A N     1 
ATOM   1799  C  CA    . TYR B 2  50  ? 18.764  23.973  40.171 1.00 73.85  ? 51  TYR A CA    1 
ATOM   1800  C  C     . TYR B 2  50  ? 17.247  23.927  40.247 1.00 66.42  ? 51  TYR A C     1 
ATOM   1801  O  O     . TYR B 2  50  ? 16.642  22.860  40.166 1.00 56.78  ? 51  TYR A O     1 
ATOM   1802  C  CB    . TYR B 2  50  ? 19.350  23.988  41.576 1.00 63.07  ? 51  TYR A CB    1 
ATOM   1803  C  CG    . TYR B 2  50  ? 18.914  22.823  42.412 1.00 64.89  ? 51  TYR A CG    1 
ATOM   1804  C  CD1   . TYR B 2  50  ? 19.232  21.529  42.035 1.00 65.68  ? 51  TYR A CD1   1 
ATOM   1805  C  CD2   . TYR B 2  50  ? 18.196  23.018  43.586 1.00 68.68  ? 51  TYR A CD2   1 
ATOM   1806  C  CE1   . TYR B 2  50  ? 18.858  20.457  42.799 1.00 73.54  ? 51  TYR A CE1   1 
ATOM   1807  C  CE2   . TYR B 2  50  ? 17.823  21.949  44.374 1.00 78.55  ? 51  TYR A CE2   1 
ATOM   1808  C  CZ    . TYR B 2  50  ? 18.159  20.665  43.971 1.00 86.88  ? 51  TYR A CZ    1 
ATOM   1809  O  OH    . TYR B 2  50  ? 17.794  19.575  44.730 1.00 96.50  ? 51  TYR A OH    1 
ATOM   1810  N  N     . GLY B 2  51  ? 16.616  25.081  40.415 1.00 54.17  ? 52  GLY A N     1 
ATOM   1811  C  CA    . GLY B 2  51  ? 15.168  25.124  40.471 1.00 52.80  ? 52  GLY A CA    1 
ATOM   1812  C  C     . GLY B 2  51  ? 14.553  24.761  39.138 1.00 51.77  ? 52  GLY A C     1 
ATOM   1813  O  O     . GLY B 2  51  ? 13.501  24.134  39.083 1.00 73.46  ? 52  GLY A O     1 
ATOM   1814  N  N     . LEU B 2  52  ? 15.212  25.132  38.043 1.00 59.78  ? 53  LEU A N     1 
ATOM   1815  C  CA    . LEU B 2  52  ? 14.718  24.782  36.712 1.00 66.33  ? 53  LEU A CA    1 
ATOM   1816  C  C     . LEU B 2  52  ? 14.796  23.280  36.476 1.00 65.45  ? 53  LEU A C     1 
ATOM   1817  O  O     . LEU B 2  52  ? 13.949  22.701  35.785 1.00 87.18  ? 53  LEU A O     1 
ATOM   1818  C  CB    . LEU B 2  52  ? 15.521  25.538  35.650 1.00 66.88  ? 53  LEU A CB    1 
ATOM   1819  C  CG    . LEU B 2  52  ? 15.298  27.023  35.346 1.00 57.71  ? 53  LEU A CG    1 
ATOM   1820  C  CD1   . LEU B 2  52  ? 16.226  27.470  34.232 1.00 55.65  ? 53  LEU A CD1   1 
ATOM   1821  C  CD2   . LEU B 2  52  ? 13.871  27.305  34.939 1.00 57.47  ? 53  LEU A CD2   1 
ATOM   1822  N  N     . ASN B 2  53  ? 15.812  22.642  37.047 1.00 59.42  ? 54  ASN A N     1 
ATOM   1823  C  CA    . ASN B 2  53  ? 15.982  21.193  36.972 1.00 66.69  ? 54  ASN A CA    1 
ATOM   1824  C  C     . ASN B 2  53  ? 14.932  20.484  37.803 1.00 78.52  ? 54  ASN A C     1 
ATOM   1825  O  O     . ASN B 2  53  ? 14.265  19.554  37.338 1.00 74.94  ? 54  ASN A O     1 
ATOM   1826  C  CB    . ASN B 2  53  ? 17.381  20.839  37.484 1.00 65.78  ? 54  ASN A CB    1 
ATOM   1827  C  CG    . ASN B 2  53  ? 17.779  19.439  37.176 1.00 70.86  ? 54  ASN A CG    1 
ATOM   1828  O  OD1   . ASN B 2  53  ? 17.628  18.975  36.043 1.00 74.87  ? 54  ASN A OD1   1 
ATOM   1829  N  ND2   . ASN B 2  53  ? 18.326  18.753  38.174 1.00 84.13  ? 54  ASN A ND2   1 
ATOM   1830  N  N     . GLU B 2  54  ? 14.828  20.882  39.066 1.00 95.86  ? 55  GLU A N     1 
ATOM   1831  C  CA    . GLU B 2  54  ? 13.904  20.252  39.993 1.00 96.16  ? 55  GLU A CA    1 
ATOM   1832  C  C     . GLU B 2  54  ? 12.477  20.359  39.495 1.00 100.86 ? 55  GLU A C     1 
ATOM   1833  O  O     . GLU B 2  54  ? 11.700  19.408  39.611 1.00 111.74 ? 55  GLU A O     1 
ATOM   1834  C  CB    . GLU B 2  54  ? 14.044  20.896  41.371 1.00 94.17  ? 55  GLU A CB    1 
ATOM   1835  C  CG    . GLU B 2  54  ? 15.146  20.296  42.187 1.00 103.28 ? 55  GLU A CG    1 
ATOM   1836  C  CD    . GLU B 2  54  ? 14.908  18.826  42.459 1.00 127.60 ? 55  GLU A CD    1 
ATOM   1837  O  OE1   . GLU B 2  54  ? 13.730  18.422  42.614 1.00 127.29 ? 55  GLU A OE1   1 
ATOM   1838  O  OE2   . GLU B 2  54  ? 15.905  18.073  42.513 1.00 139.87 ? 55  GLU A OE2   1 
ATOM   1839  N  N     . GLN B 2  55  ? 12.105  21.515  38.962 1.00 104.85 ? 56  GLN A N     1 
ATOM   1840  C  CA    . GLN B 2  55  ? 10.750  21.668  38.453 1.00 111.25 ? 56  GLN A CA    1 
ATOM   1841  C  C     . GLN B 2  55  ? 10.506  20.730  37.286 1.00 109.66 ? 56  GLN A C     1 
ATOM   1842  O  O     . GLN B 2  55  ? 9.404   20.191  37.135 1.00 118.04 ? 56  GLN A O     1 
ATOM   1843  C  CB    . GLN B 2  55  ? 10.498  23.114  38.045 1.00 138.80 ? 56  GLN A CB    1 
ATOM   1844  C  CG    . GLN B 2  55  ? 10.294  24.035  39.218 1.00 159.83 ? 56  GLN A CG    1 
ATOM   1845  C  CD    . GLN B 2  55  ? 10.408  25.486  38.820 1.00 170.12 ? 56  GLN A CD    1 
ATOM   1846  O  OE1   . GLN B 2  55  ? 9.453   26.081  38.325 1.00 179.34 ? 56  GLN A OE1   1 
ATOM   1847  N  NE2   . GLN B 2  55  ? 11.586  26.063  39.024 1.00 169.23 ? 56  GLN A NE2   1 
ATOM   1848  N  N     . GLY B 2  56  ? 11.527  20.494  36.474 1.00 114.02 ? 57  GLY A N     1 
ATOM   1849  C  CA    . GLY B 2  56  ? 11.378  19.642  35.317 1.00 121.56 ? 57  GLY A CA    1 
ATOM   1850  C  C     . GLY B 2  56  ? 11.257  20.510  34.096 1.00 133.30 ? 57  GLY A C     1 
ATOM   1851  O  O     . GLY B 2  56  ? 10.381  20.305  33.253 1.00 133.34 ? 57  GLY A O     1 
ATOM   1852  N  N     . MET B 2  57  ? 12.129  21.516  34.017 1.00 141.83 ? 58  MET A N     1 
ATOM   1853  C  CA    . MET B 2  57  ? 12.095  22.479  32.927 1.00 136.99 ? 58  MET A CA    1 
ATOM   1854  C  C     . MET B 2  57  ? 13.198  22.295  31.894 1.00 126.51 ? 58  MET A C     1 
ATOM   1855  O  O     . MET B 2  57  ? 13.912  23.250  31.592 1.00 123.24 ? 58  MET A O     1 
ATOM   1856  C  CB    . MET B 2  57  ? 12.203  23.919  33.473 1.00 132.38 ? 58  MET A CB    1 
ATOM   1857  C  CG    . MET B 2  57  ? 11.132  24.353  34.430 1.00 134.10 ? 58  MET A CG    1 
ATOM   1858  S  SD    . MET B 2  57  ? 9.564   24.246  33.589 1.00 148.57 ? 58  MET A SD    1 
ATOM   1859  C  CE    . MET B 2  57  ? 9.979   24.477  31.850 1.00 147.50 ? 58  MET A CE    1 
ATOM   1860  N  N     . THR B 2  58  ? 13.324  21.106  31.325 1.00 117.94 ? 59  THR A N     1 
ATOM   1861  C  CA    . THR B 2  58  ? 14.443  20.774  30.456 1.00 117.23 ? 59  THR A CA    1 
ATOM   1862  C  C     . THR B 2  58  ? 14.159  21.253  29.028 1.00 107.64 ? 59  THR A C     1 
ATOM   1863  O  O     . THR B 2  58  ? 13.035  21.655  28.717 1.00 86.49  ? 59  THR A O     1 
ATOM   1864  C  CB    . THR B 2  58  ? 14.714  19.266  30.567 1.00 125.45 ? 59  THR A CB    1 
ATOM   1865  O  OG1   . THR B 2  58  ? 13.522  18.522  30.266 1.00 131.23 ? 59  THR A OG1   1 
ATOM   1866  C  CG2   . THR B 2  58  ? 15.210  18.891  31.978 1.00 126.99 ? 59  THR A CG2   1 
ATOM   1867  N  N     . PRO B 2  59  ? 15.167  21.273  28.141 1.00 111.08 ? 60  PRO A N     1 
ATOM   1868  C  CA    . PRO B 2  59  ? 14.957  21.896  26.818 1.00 111.99 ? 60  PRO A CA    1 
ATOM   1869  C  C     . PRO B 2  59  ? 13.861  21.258  25.981 1.00 122.63 ? 60  PRO A C     1 
ATOM   1870  O  O     . PRO B 2  59  ? 13.339  21.920  25.067 1.00 127.17 ? 60  PRO A O     1 
ATOM   1871  C  CB    . PRO B 2  59  ? 16.326  21.746  26.140 1.00 108.96 ? 60  PRO A CB    1 
ATOM   1872  C  CG    . PRO B 2  59  ? 17.292  21.661  27.230 1.00 115.99 ? 60  PRO A CG    1 
ATOM   1873  C  CD    . PRO B 2  59  ? 16.587  20.947  28.358 1.00 114.65 ? 60  PRO A CD    1 
ATOM   1874  N  N     . ASP B 2  60  ? 13.515  19.995  26.238 1.00 119.66 ? 61  ASP A N     1 
ATOM   1875  C  CA    . ASP B 2  60  ? 12.528  19.241  25.473 1.00 110.46 ? 61  ASP A CA    1 
ATOM   1876  C  C     . ASP B 2  60  ? 11.116  19.487  25.959 1.00 116.12 ? 61  ASP A C     1 
ATOM   1877  O  O     . ASP B 2  60  ? 10.163  19.023  25.320 1.00 126.50 ? 61  ASP A O     1 
ATOM   1878  C  CB    . ASP B 2  60  ? 12.854  17.738  25.535 1.00 106.62 ? 61  ASP A CB    1 
ATOM   1879  C  CG    . ASP B 2  60  ? 12.921  17.213  26.964 1.00 104.11 ? 61  ASP A CG    1 
ATOM   1880  O  OD1   . ASP B 2  60  ? 13.690  17.768  27.768 1.00 104.46 ? 61  ASP A OD1   1 
ATOM   1881  O  OD2   . ASP B 2  60  ? 12.204  16.239  27.282 1.00 112.72 ? 61  ASP A OD2   1 
ATOM   1882  N  N     . LYS B 2  61  ? 10.971  20.195  27.071 1.00 113.09 ? 62  LYS A N     1 
ATOM   1883  C  CA    . LYS B 2  61  ? 9.708   20.473  27.718 1.00 113.83 ? 62  LYS A CA    1 
ATOM   1884  C  C     . LYS B 2  61  ? 9.292   21.910  27.478 1.00 99.31  ? 62  LYS A C     1 
ATOM   1885  O  O     . LYS B 2  61  ? 10.110  22.799  27.224 1.00 92.49  ? 62  LYS A O     1 
ATOM   1886  C  CB    . LYS B 2  61  ? 9.779   20.208  29.226 1.00 127.34 ? 62  LYS A CB    1 
ATOM   1887  C  CG    . LYS B 2  61  ? 9.777   18.742  29.603 1.00 128.23 ? 62  LYS A CG    1 
ATOM   1888  C  CD    . LYS B 2  61  ? 9.393   18.576  31.059 1.00 129.28 ? 62  LYS A CD    1 
ATOM   1889  C  CE    . LYS B 2  61  ? 9.506   17.141  31.537 1.00 125.61 ? 62  LYS A CE    1 
ATOM   1890  N  NZ    . LYS B 2  61  ? 10.919  16.721  31.756 1.00 123.42 ? 62  LYS A NZ    1 
ATOM   1891  N  N     . SER B 2  62  ? 7.985   22.100  27.577 1.00 91.23  ? 63  SER A N     1 
ATOM   1892  C  CA    . SER B 2  62  ? 7.294   23.377  27.505 1.00 90.86  ? 63  SER A CA    1 
ATOM   1893  C  C     . SER B 2  62  ? 8.043   24.532  28.162 1.00 103.89 ? 63  SER A C     1 
ATOM   1894  O  O     . SER B 2  62  ? 8.689   24.349  29.201 1.00 105.81 ? 63  SER A O     1 
ATOM   1895  C  CB    . SER B 2  62  ? 5.940   23.228  28.194 1.00 97.25  ? 63  SER A CB    1 
ATOM   1896  O  OG    . SER B 2  62  ? 4.895   23.599  27.319 1.00 112.99 ? 63  SER A OG    1 
ATOM   1897  N  N     . TYR B 2  63  ? 8.026   25.711  27.540 1.00 99.85  ? 64  TYR A N     1 
ATOM   1898  C  CA    . TYR B 2  63  ? 8.455   26.912  28.239 1.00 80.21  ? 64  TYR A CA    1 
ATOM   1899  C  C     . TYR B 2  63  ? 7.562   27.111  29.459 1.00 87.45  ? 64  TYR A C     1 
ATOM   1900  O  O     . TYR B 2  63  ? 6.338   26.962  29.380 1.00 99.52  ? 64  TYR A O     1 
ATOM   1901  C  CB    . TYR B 2  63  ? 8.341   28.134  27.338 1.00 76.80  ? 64  TYR A CB    1 
ATOM   1902  C  CG    . TYR B 2  63  ? 9.409   28.278  26.283 1.00 76.59  ? 64  TYR A CG    1 
ATOM   1903  C  CD1   . TYR B 2  63  ? 10.639  28.836  26.592 1.00 82.48  ? 64  TYR A CD1   1 
ATOM   1904  C  CD2   . TYR B 2  63  ? 9.169   27.910  24.968 1.00 81.88  ? 64  TYR A CD2   1 
ATOM   1905  C  CE1   . TYR B 2  63  ? 11.610  28.997  25.635 1.00 82.80  ? 64  TYR A CE1   1 
ATOM   1906  C  CE2   . TYR B 2  63  ? 10.137  28.066  23.999 1.00 82.36  ? 64  TYR A CE2   1 
ATOM   1907  C  CZ    . TYR B 2  63  ? 11.356  28.611  24.341 1.00 81.84  ? 64  TYR A CZ    1 
ATOM   1908  O  OH    . TYR B 2  63  ? 12.327  28.770  23.386 1.00 91.66  ? 64  TYR A OH    1 
ATOM   1909  N  N     . LYS B 2  64  ? 8.148   27.440  30.603 1.00 80.76  ? 65  LYS A N     1 
ATOM   1910  C  CA    . LYS B 2  64  ? 7.336   27.619  31.802 1.00 75.38  ? 65  LYS A CA    1 
ATOM   1911  C  C     . LYS B 2  64  ? 7.286   29.072  32.237 1.00 75.22  ? 65  LYS A C     1 
ATOM   1912  O  O     . LYS B 2  64  ? 8.257   29.812  32.088 1.00 78.27  ? 65  LYS A O     1 
ATOM   1913  C  CB    . LYS B 2  64  ? 7.849   26.786  32.957 1.00 79.71  ? 65  LYS A CB    1 
ATOM   1914  C  CG    . LYS B 2  64  ? 6.852   26.572  34.060 1.00 104.24 ? 65  LYS A CG    1 
ATOM   1915  C  CD    . LYS B 2  64  ? 7.513   26.129  35.353 1.00 125.00 ? 65  LYS A CD    1 
ATOM   1916  C  CE    . LYS B 2  64  ? 6.808   26.727  36.541 1.00 137.01 ? 65  LYS A CE    1 
ATOM   1917  N  NZ    . LYS B 2  64  ? 6.937   25.860  37.738 1.00 128.60 ? 65  LYS A NZ    1 
ATOM   1918  N  N     . LYS B 2  65  ? 6.146   29.455  32.810 1.00 77.37  ? 66  LYS A N     1 
ATOM   1919  C  CA    . LYS B 2  65  ? 5.933   30.837  33.229 1.00 83.66  ? 66  LYS A CA    1 
ATOM   1920  C  C     . LYS B 2  65  ? 6.984   31.282  34.238 1.00 83.48  ? 66  LYS A C     1 
ATOM   1921  O  O     . LYS B 2  65  ? 7.323   30.552  35.171 1.00 80.89  ? 66  LYS A O     1 
ATOM   1922  C  CB    . LYS B 2  65  ? 4.540   31.010  33.846 1.00 86.49  ? 66  LYS A CB    1 
ATOM   1923  C  CG    . LYS B 2  65  ? 3.392   30.541  32.990 1.00 81.78  ? 66  LYS A CG    1 
ATOM   1924  C  CD    . LYS B 2  65  ? 3.026   31.576  31.950 1.00 87.17  ? 66  LYS A CD    1 
ATOM   1925  C  CE    . LYS B 2  65  ? 1.771   31.162  31.196 1.00 92.44  ? 66  LYS A CE    1 
ATOM   1926  N  NZ    . LYS B 2  65  ? 1.488   32.062  30.039 1.00 93.28  ? 66  LYS A NZ    1 
ATOM   1927  N  N     . SER B 2  66  ? 7.451   32.523  34.071 1.00 86.66  ? 67  SER A N     1 
ATOM   1928  C  CA    . SER B 2  66  ? 8.515   33.061  34.917 1.00 81.99  ? 67  SER A CA    1 
ATOM   1929  C  C     . SER B 2  66  ? 8.057   33.257  36.353 1.00 76.69  ? 67  SER A C     1 
ATOM   1930  O  O     . SER B 2  66  ? 8.827   33.022  37.288 1.00 83.80  ? 67  SER A O     1 
ATOM   1931  C  CB    . SER B 2  66  ? 9.022   34.386  34.346 1.00 82.98  ? 67  SER A CB    1 
ATOM   1932  O  OG    . SER B 2  66  ? 9.622   34.195  33.082 1.00 74.78  ? 67  SER A OG    1 
ATOM   1933  N  N     . ALA B 2  67  ? 6.831   33.740  36.548 1.00 79.85  ? 68  ALA A N     1 
ATOM   1934  C  CA    . ALA B 2  67  ? 6.371   34.024  37.904 1.00 82.61  ? 68  ALA A CA    1 
ATOM   1935  C  C     . ALA B 2  67  ? 6.402   32.773  38.763 1.00 85.36  ? 68  ALA A C     1 
ATOM   1936  O  O     . ALA B 2  67  ? 6.860   32.799  39.912 1.00 92.19  ? 68  ALA A O     1 
ATOM   1937  C  CB    . ALA B 2  67  ? 4.961   34.611  37.887 1.00 89.92  ? 68  ALA A CB    1 
ATOM   1938  N  N     . ARG B 2  68  ? 5.913   31.666  38.226 1.00 93.00  ? 69  ARG A N     1 
ATOM   1939  C  CA    . ARG B 2  68  ? 5.959   30.425  38.981 1.00 104.51 ? 69  ARG A CA    1 
ATOM   1940  C  C     . ARG B 2  68  ? 7.389   29.950  39.145 1.00 93.93  ? 69  ARG A C     1 
ATOM   1941  O  O     . ARG B 2  68  ? 7.765   29.458  40.217 1.00 106.24 ? 69  ARG A O     1 
ATOM   1942  C  CB    . ARG B 2  68  ? 5.096   29.368  38.304 1.00 124.24 ? 69  ARG A CB    1 
ATOM   1943  C  CG    . ARG B 2  68  ? 3.608   29.692  38.364 1.00 128.87 ? 69  ARG A CG    1 
ATOM   1944  C  CD    . ARG B 2  68  ? 2.808   28.813  37.422 1.00 134.42 ? 69  ARG A CD    1 
ATOM   1945  N  NE    . ARG B 2  68  ? 2.963   27.396  37.730 1.00 137.39 ? 69  ARG A NE    1 
ATOM   1946  C  CZ    . ARG B 2  68  ? 2.583   26.417  36.918 1.00 137.76 ? 69  ARG A CZ    1 
ATOM   1947  N  NH1   . ARG B 2  68  ? 2.759   25.151  37.273 1.00 138.93 ? 69  ARG A NH1   1 
ATOM   1948  N  NH2   . ARG B 2  68  ? 2.033   26.708  35.745 1.00 137.51 ? 69  ARG A NH2   1 
ATOM   1949  N  N     . ILE B 2  69  ? 8.212   30.112  38.104 1.00 82.45  ? 70  ILE A N     1 
ATOM   1950  C  CA    . ILE B 2  69  ? 9.630   29.766  38.222 1.00 87.54  ? 70  ILE A CA    1 
ATOM   1951  C  C     . ILE B 2  69  ? 10.270  30.568  39.333 1.00 88.17  ? 70  ILE A C     1 
ATOM   1952  O  O     . ILE B 2  69  ? 10.991  30.037  40.187 1.00 80.49  ? 70  ILE A O     1 
ATOM   1953  C  CB    . ILE B 2  69  ? 10.379  30.028  36.912 1.00 81.34  ? 70  ILE A CB    1 
ATOM   1954  C  CG1   . ILE B 2  69  ? 9.952   29.057  35.814 1.00 91.30  ? 70  ILE A CG1   1 
ATOM   1955  C  CG2   . ILE B 2  69  ? 11.869  29.915  37.177 1.00 68.44  ? 70  ILE A CG2   1 
ATOM   1956  C  CD1   . ILE B 2  69  ? 10.793  29.226  34.586 1.00 89.32  ? 70  ILE A CD1   1 
ATOM   1957  N  N     . VAL B 2  70  ? 10.083  31.884  39.278 1.00 91.46  ? 71  VAL A N     1 
ATOM   1958  C  CA    . VAL B 2  70  ? 10.699  32.766  40.254 1.00 72.85  ? 71  VAL A CA    1 
ATOM   1959  C  C     . VAL B 2  70  ? 10.166  32.457  41.633 1.00 71.02  ? 71  VAL A C     1 
ATOM   1960  O  O     . VAL B 2  70  ? 10.924  32.381  42.602 1.00 84.98  ? 71  VAL A O     1 
ATOM   1961  C  CB    . VAL B 2  70  ? 10.447  34.233  39.882 1.00 63.82  ? 71  VAL A CB    1 
ATOM   1962  C  CG1   . VAL B 2  70  ? 10.788  35.105  41.062 1.00 62.30  ? 71  VAL A CG1   1 
ATOM   1963  C  CG2   . VAL B 2  70  ? 11.260  34.618  38.677 1.00 61.81  ? 71  VAL A CG2   1 
ATOM   1964  N  N     . GLY B 2  71  ? 8.851   32.301  41.745 1.00 73.72  ? 72  GLY A N     1 
ATOM   1965  C  CA    . GLY B 2  71  ? 8.263   32.034  43.041 1.00 78.29  ? 72  GLY A CA    1 
ATOM   1966  C  C     . GLY B 2  71  ? 8.767   30.732  43.621 1.00 79.83  ? 72  GLY A C     1 
ATOM   1967  O  O     . GLY B 2  71  ? 9.086   30.652  44.809 1.00 76.59  ? 72  GLY A O     1 
ATOM   1968  N  N     . ASP B 2  72  ? 8.859   29.699  42.784 1.00 80.83  ? 73  ASP A N     1 
ATOM   1969  C  CA    . ASP B 2  72  ? 9.375   28.415  43.239 1.00 90.62  ? 73  ASP A CA    1 
ATOM   1970  C  C     . ASP B 2  72  ? 10.786  28.568  43.779 1.00 79.90  ? 73  ASP A C     1 
ATOM   1971  O  O     . ASP B 2  72  ? 11.108  28.082  44.871 1.00 79.42  ? 73  ASP A O     1 
ATOM   1972  C  CB    . ASP B 2  72  ? 9.346   27.403  42.091 1.00 106.43 ? 73  ASP A CB    1 
ATOM   1973  C  CG    . ASP B 2  72  ? 9.538   25.979  42.568 1.00 116.31 ? 73  ASP A CG    1 
ATOM   1974  O  OD1   . ASP B 2  72  ? 8.563   25.411  43.104 1.00 121.51 ? 73  ASP A OD1   1 
ATOM   1975  O  OD2   . ASP B 2  72  ? 10.648  25.424  42.400 1.00 107.84 ? 73  ASP A OD2   1 
ATOM   1976  N  N     . VAL B 2  73  ? 11.638  29.266  43.028 1.00 75.19  ? 74  VAL A N     1 
ATOM   1977  C  CA    . VAL B 2  73  ? 13.017  29.474  43.457 1.00 73.93  ? 74  VAL A CA    1 
ATOM   1978  C  C     . VAL B 2  73  ? 13.053  30.262  44.752 1.00 79.52  ? 74  VAL A C     1 
ATOM   1979  O  O     . VAL B 2  73  ? 13.796  29.929  45.684 1.00 71.04  ? 74  VAL A O     1 
ATOM   1980  C  CB    . VAL B 2  73  ? 13.821  30.189  42.361 1.00 71.34  ? 74  VAL A CB    1 
ATOM   1981  C  CG1   . VAL B 2  73  ? 15.178  30.575  42.917 1.00 68.74  ? 74  VAL A CG1   1 
ATOM   1982  C  CG2   . VAL B 2  73  ? 13.968  29.309  41.151 1.00 73.79  ? 74  VAL A CG2   1 
ATOM   1983  N  N     . MET B 2  74  ? 12.272  31.338  44.820 1.00 90.15  ? 75  MET A N     1 
ATOM   1984  C  CA    . MET B 2  74  ? 12.308  32.195  45.997 1.00 75.54  ? 75  MET A CA    1 
ATOM   1985  C  C     . MET B 2  74  ? 11.773  31.473  47.219 1.00 81.40  ? 75  MET A C     1 
ATOM   1986  O  O     . MET B 2  74  ? 12.366  31.544  48.299 1.00 90.03  ? 75  MET A O     1 
ATOM   1987  C  CB    . MET B 2  74  ? 11.512  33.473  45.757 1.00 71.92  ? 75  MET A CB    1 
ATOM   1988  C  CG    . MET B 2  74  ? 11.637  34.422  46.918 1.00 83.68  ? 75  MET A CG    1 
ATOM   1989  S  SD    . MET B 2  74  ? 10.057  34.834  47.659 1.00 94.47  ? 75  MET A SD    1 
ATOM   1990  C  CE    . MET B 2  74  ? 10.607  35.794  49.065 1.00 93.88  ? 75  MET A CE    1 
ATOM   1991  N  N     . GLY B 2  75  ? 10.628  30.808  47.082 1.00 95.76  ? 76  GLY A N     1 
ATOM   1992  C  CA    . GLY B 2  75  ? 10.056  30.114  48.222 1.00 97.46  ? 76  GLY A CA    1 
ATOM   1993  C  C     . GLY B 2  75  ? 10.945  28.997  48.723 1.00 86.35  ? 76  GLY A C     1 
ATOM   1994  O  O     . GLY B 2  75  ? 11.193  28.877  49.928 1.00 86.36  ? 76  GLY A O     1 
ATOM   1995  N  N     . LYS B 2  76  ? 11.492  28.210  47.798 1.00 78.12  ? 77  LYS A N     1 
ATOM   1996  C  CA    . LYS B 2  76  ? 12.243  27.012  48.173 1.00 82.68  ? 77  LYS A CA    1 
ATOM   1997  C  C     . LYS B 2  76  ? 13.672  27.327  48.624 1.00 79.91  ? 77  LYS A C     1 
ATOM   1998  O  O     . LYS B 2  76  ? 14.146  26.704  49.591 1.00 93.56  ? 77  LYS A O     1 
ATOM   1999  C  CB    . LYS B 2  76  ? 12.263  26.017  47.008 1.00 88.86  ? 77  LYS A CB    1 
ATOM   2000  C  CG    . LYS B 2  76  ? 10.976  25.266  46.807 1.00 99.98  ? 77  LYS A CG    1 
ATOM   2001  C  CD    . LYS B 2  76  ? 11.259  23.894  46.224 1.00 108.54 ? 77  LYS A CD    1 
ATOM   2002  C  CE    . LYS B 2  76  ? 9.982   23.114  45.971 1.00 111.10 ? 77  LYS A CE    1 
ATOM   2003  N  NZ    . LYS B 2  76  ? 9.280   23.584  44.741 1.00 111.90 ? 77  LYS A NZ    1 
ATOM   2004  N  N     . TYR B 2  77  ? 14.401  28.256  47.925 1.00 75.92  ? 78  TYR A N     1 
ATOM   2005  C  CA    . TYR B 2  77  ? 15.841  28.378  48.220 1.00 78.36  ? 78  TYR A CA    1 
ATOM   2006  C  C     . TYR B 2  77  ? 16.341  29.798  48.458 1.00 78.85  ? 78  TYR A C     1 
ATOM   2007  O  O     . TYR B 2  77  ? 17.195  29.991  49.335 1.00 86.38  ? 78  TYR A O     1 
ATOM   2008  C  CB    . TYR B 2  77  ? 16.709  27.758  47.096 1.00 76.19  ? 78  TYR A CB    1 
ATOM   2009  C  CG    . TYR B 2  77  ? 16.032  26.667  46.322 1.00 81.16  ? 78  TYR A CG    1 
ATOM   2010  C  CD1   . TYR B 2  77  ? 15.216  26.973  45.244 1.00 93.54  ? 78  TYR A CD1   1 
ATOM   2011  C  CD2   . TYR B 2  77  ? 16.226  25.333  46.648 1.00 78.70  ? 78  TYR A CD2   1 
ATOM   2012  C  CE1   . TYR B 2  77  ? 14.593  25.985  44.522 1.00 104.63 ? 78  TYR A CE1   1 
ATOM   2013  C  CE2   . TYR B 2  77  ? 15.608  24.330  45.930 1.00 87.24  ? 78  TYR A CE2   1 
ATOM   2014  C  CZ    . TYR B 2  77  ? 14.789  24.664  44.867 1.00 102.87 ? 78  TYR A CZ    1 
ATOM   2015  O  OH    . TYR B 2  77  ? 14.162  23.678  44.135 1.00 113.97 ? 78  TYR A OH    1 
ATOM   2016  N  N     . HIS B 2  78  ? 15.883  30.783  47.683 1.00 68.95  ? 79  HIS A N     1 
ATOM   2017  C  CA    . HIS B 2  78  ? 16.426  32.137  47.749 1.00 61.73  ? 79  HIS A CA    1 
ATOM   2018  C  C     . HIS B 2  78  ? 15.506  33.036  48.570 1.00 67.70  ? 79  HIS A C     1 
ATOM   2019  O  O     . HIS B 2  78  ? 14.537  33.581  48.017 1.00 95.03  ? 79  HIS A O     1 
ATOM   2020  C  CB    . HIS B 2  78  ? 16.581  32.715  46.343 1.00 61.53  ? 79  HIS A CB    1 
ATOM   2021  C  CG    . HIS B 2  78  ? 17.745  33.642  46.184 1.00 65.08  ? 79  HIS A CG    1 
ATOM   2022  N  ND1   . HIS B 2  78  ? 19.029  33.274  46.514 1.00 64.12  ? 79  HIS A ND1   1 
ATOM   2023  C  CD2   . HIS B 2  78  ? 17.825  34.901  45.679 1.00 63.19  ? 79  HIS A CD2   1 
ATOM   2024  C  CE1   . HIS B 2  78  ? 19.848  34.273  46.240 1.00 63.37  ? 79  HIS A CE1   1 
ATOM   2025  N  NE2   . HIS B 2  78  ? 19.144  35.272  45.735 1.00 58.99  ? 79  HIS A NE2   1 
ATOM   2026  N  N     . PRO B 2  79  ? 15.780  33.303  49.872 1.00 65.68  ? 80  PRO A N     1 
ATOM   2027  C  CA    . PRO B 2  79  ? 14.815  34.160  50.608 1.00 72.78  ? 80  PRO A CA    1 
ATOM   2028  C  C     . PRO B 2  79  ? 15.072  35.652  50.404 1.00 84.84  ? 80  PRO A C     1 
ATOM   2029  O  O     . PRO B 2  79  ? 15.396  36.396  51.340 1.00 92.71  ? 80  PRO A O     1 
ATOM   2030  C  CB    . PRO B 2  79  ? 15.037  33.721  52.051 1.00 74.03  ? 80  PRO A CB    1 
ATOM   2031  C  CG    . PRO B 2  79  ? 16.522  33.508  52.092 1.00 73.96  ? 80  PRO A CG    1 
ATOM   2032  C  CD    . PRO B 2  79  ? 16.918  32.919  50.727 1.00 66.46  ? 80  PRO A CD    1 
ATOM   2033  N  N     . HIS B 2  80  ? 14.911  36.118  49.168 1.00 72.98  ? 81  HIS A N     1 
ATOM   2034  C  CA    . HIS B 2  80  ? 15.185  37.499  48.812 1.00 59.50  ? 81  HIS A CA    1 
ATOM   2035  C  C     . HIS B 2  80  ? 14.105  37.976  47.866 1.00 61.78  ? 81  HIS A C     1 
ATOM   2036  O  O     . HIS B 2  80  ? 13.160  37.248  47.538 1.00 63.05  ? 81  HIS A O     1 
ATOM   2037  C  CB    . HIS B 2  80  ? 16.566  37.643  48.183 1.00 59.99  ? 81  HIS A CB    1 
ATOM   2038  C  CG    . HIS B 2  80  ? 17.663  37.204  49.089 1.00 63.27  ? 81  HIS A CG    1 
ATOM   2039  N  ND1   . HIS B 2  80  ? 17.963  37.867  50.264 1.00 59.94  ? 81  HIS A ND1   1 
ATOM   2040  C  CD2   . HIS B 2  80  ? 18.514  36.154  49.011 1.00 68.63  ? 81  HIS A CD2   1 
ATOM   2041  C  CE1   . HIS B 2  80  ? 18.969  37.249  50.859 1.00 69.05  ? 81  HIS A CE1   1 
ATOM   2042  N  NE2   . HIS B 2  80  ? 19.329  36.218  50.112 1.00 71.19  ? 81  HIS A NE2   1 
ATOM   2043  N  N     . GLY B 2  81  ? 14.281  39.205  47.384 1.00 61.58  ? 82  GLY A N     1 
ATOM   2044  C  CA    . GLY B 2  81  ? 13.243  39.818  46.570 1.00 75.46  ? 82  GLY A CA    1 
ATOM   2045  C  C     . GLY B 2  81  ? 13.138  39.203  45.187 1.00 72.64  ? 82  GLY A C     1 
ATOM   2046  O  O     . GLY B 2  81  ? 14.107  38.709  44.612 1.00 69.05  ? 82  GLY A O     1 
ATOM   2047  N  N     . ASP B 2  82  ? 11.916  39.237  44.653 1.00 70.77  ? 83  ASP A N     1 
ATOM   2048  C  CA    . ASP B 2  82  ? 11.665  38.559  43.393 1.00 73.01  ? 83  ASP A CA    1 
ATOM   2049  C  C     . ASP B 2  82  ? 12.370  39.267  42.231 1.00 72.65  ? 83  ASP A C     1 
ATOM   2050  O  O     . ASP B 2  82  ? 12.880  38.608  41.317 1.00 76.39  ? 83  ASP A O     1 
ATOM   2051  C  CB    . ASP B 2  82  ? 10.147  38.437  43.151 1.00 81.96  ? 83  ASP A CB    1 
ATOM   2052  C  CG    . ASP B 2  82  ? 9.457   37.385  44.056 1.00 95.16  ? 83  ASP A CG    1 
ATOM   2053  O  OD1   . ASP B 2  82  ? 10.012  37.012  45.104 1.00 97.38  ? 83  ASP A OD1   1 
ATOM   2054  O  OD2   . ASP B 2  82  ? 8.347   36.917  43.697 1.00 97.39  ? 83  ASP A OD2   1 
ATOM   2055  N  N     . SER B 2  83  ? 12.424  40.599  42.252 1.00 76.20  ? 84  SER A N     1 
ATOM   2056  C  CA    . SER B 2  83  ? 13.081  41.335  41.170 1.00 78.09  ? 84  SER A CA    1 
ATOM   2057  C  C     . SER B 2  83  ? 14.518  40.871  40.972 1.00 80.62  ? 84  SER A C     1 
ATOM   2058  O  O     . SER B 2  83  ? 14.977  40.686  39.837 1.00 92.72  ? 84  SER A O     1 
ATOM   2059  C  CB    . SER B 2  83  ? 13.085  42.834  41.459 1.00 84.65  ? 84  SER A CB    1 
ATOM   2060  O  OG    . SER B 2  83  ? 14.081  43.109  42.427 1.00 96.56  ? 84  SER A OG    1 
ATOM   2061  N  N     . SER B 2  84  ? 15.256  40.696  42.067 1.00 82.92  ? 85  SER A N     1 
ATOM   2062  C  CA    . SER B 2  84  ? 16.637  40.245  41.947 1.00 70.50  ? 85  SER A CA    1 
ATOM   2063  C  C     . SER B 2  84  ? 16.705  38.922  41.211 1.00 63.36  ? 85  SER A C     1 
ATOM   2064  O  O     . SER B 2  84  ? 17.540  38.740  40.319 1.00 66.80  ? 85  SER A O     1 
ATOM   2065  C  CB    . SER B 2  84  ? 17.279  40.124  43.333 1.00 65.15  ? 85  SER A CB    1 
ATOM   2066  O  OG    . SER B 2  84  ? 16.983  41.255  44.128 1.00 76.75  ? 85  SER A OG    1 
ATOM   2067  N  N     . ILE B 2  85  ? 15.817  37.993  41.563 1.00 61.19  ? 86  ILE A N     1 
ATOM   2068  C  CA    . ILE B 2  85  ? 15.832  36.671  40.946 1.00 60.43  ? 86  ILE A CA    1 
ATOM   2069  C  C     . ILE B 2  85  ? 15.513  36.774  39.470 1.00 61.90  ? 86  ILE A C     1 
ATOM   2070  O  O     . ILE B 2  85  ? 16.163  36.144  38.627 1.00 57.30  ? 86  ILE A O     1 
ATOM   2071  C  CB    . ILE B 2  85  ? 14.833  35.739  41.649 1.00 59.96  ? 86  ILE A CB    1 
ATOM   2072  C  CG1   . ILE B 2  85  ? 15.248  35.495  43.097 1.00 54.15  ? 86  ILE A CG1   1 
ATOM   2073  C  CG2   . ILE B 2  85  ? 14.731  34.434  40.891 1.00 55.90  ? 86  ILE A CG2   1 
ATOM   2074  C  CD1   . ILE B 2  85  ? 14.182  34.827  43.888 1.00 53.98  ? 86  ILE A CD1   1 
ATOM   2075  N  N     . TYR B 2  86  ? 14.467  37.516  39.143 1.00 61.25  ? 87  TYR A N     1 
ATOM   2076  C  CA    . TYR B 2  86  ? 14.058  37.626  37.755 1.00 59.24  ? 87  TYR A CA    1 
ATOM   2077  C  C     . TYR B 2  86  ? 15.148  38.272  36.927 1.00 60.88  ? 87  TYR A C     1 
ATOM   2078  O  O     . TYR B 2  86  ? 15.448  37.823  35.817 1.00 60.77  ? 87  TYR A O     1 
ATOM   2079  C  CB    . TYR B 2  86  ? 12.769  38.431  37.661 1.00 60.28  ? 87  TYR A CB    1 
ATOM   2080  C  CG    . TYR B 2  86  ? 12.231  38.520  36.271 1.00 63.12  ? 87  TYR A CG    1 
ATOM   2081  C  CD1   . TYR B 2  86  ? 11.950  37.373  35.554 1.00 69.78  ? 87  TYR A CD1   1 
ATOM   2082  C  CD2   . TYR B 2  86  ? 11.988  39.747  35.679 1.00 55.79  ? 87  TYR A CD2   1 
ATOM   2083  C  CE1   . TYR B 2  86  ? 11.442  37.439  34.279 1.00 75.72  ? 87  TYR A CE1   1 
ATOM   2084  C  CE2   . TYR B 2  86  ? 11.479  39.828  34.405 1.00 66.03  ? 87  TYR A CE2   1 
ATOM   2085  C  CZ    . TYR B 2  86  ? 11.206  38.671  33.707 1.00 72.15  ? 87  TYR A CZ    1 
ATOM   2086  O  OH    . TYR B 2  86  ? 10.697  38.750  32.432 1.00 78.36  ? 87  TYR A OH    1 
ATOM   2087  N  N     . GLU B 2  87  ? 15.752  39.333  37.451 1.00 58.51  ? 88  GLU A N     1 
ATOM   2088  C  CA    . GLU B 2  87  ? 16.789  40.030  36.705 1.00 57.46  ? 88  GLU A CA    1 
ATOM   2089  C  C     . GLU B 2  87  ? 18.002  39.140  36.502 1.00 60.11  ? 88  GLU A C     1 
ATOM   2090  O  O     . GLU B 2  87  ? 18.615  39.145  35.429 1.00 61.94  ? 88  GLU A O     1 
ATOM   2091  C  CB    . GLU B 2  87  ? 17.171  41.319  37.425 1.00 61.94  ? 88  GLU A CB    1 
ATOM   2092  C  CG    . GLU B 2  87  ? 16.118  42.396  37.329 1.00 64.58  ? 88  GLU A CG    1 
ATOM   2093  C  CD    . GLU B 2  87  ? 16.545  43.680  38.007 1.00 100.02 ? 88  GLU A CD    1 
ATOM   2094  O  OE1   . GLU B 2  87  ? 15.729  44.628  38.049 1.00 113.23 ? 88  GLU A OE1   1 
ATOM   2095  O  OE2   . GLU B 2  87  ? 17.699  43.740  38.492 1.00 102.07 ? 88  GLU A OE2   1 
ATOM   2096  N  N     . ALA B 2  88  ? 18.361  38.360  37.518 1.00 66.23  ? 89  ALA A N     1 
ATOM   2097  C  CA    . ALA B 2  88  ? 19.473  37.432  37.365 1.00 59.67  ? 89  ALA A CA    1 
ATOM   2098  C  C     . ALA B 2  88  ? 19.167  36.404  36.293 1.00 59.79  ? 89  ALA A C     1 
ATOM   2099  O  O     . ALA B 2  88  ? 20.016  36.095  35.449 1.00 55.88  ? 89  ALA A O     1 
ATOM   2100  C  CB    . ALA B 2  88  ? 19.777  36.738  38.692 1.00 51.18  ? 89  ALA A CB    1 
ATOM   2101  N  N     . MET B 2  89  ? 17.947  35.865  36.315 1.00 74.81  ? 90  MET A N     1 
ATOM   2102  C  CA    . MET B 2  89  ? 17.532  34.875  35.327 1.00 74.68  ? 90  MET A CA    1 
ATOM   2103  C  C     . MET B 2  89  ? 17.488  35.469  33.932 1.00 69.21  ? 90  MET A C     1 
ATOM   2104  O  O     . MET B 2  89  ? 17.845  34.805  32.952 1.00 71.30  ? 90  MET A O     1 
ATOM   2105  C  CB    . MET B 2  89  ? 16.163  34.308  35.696 1.00 61.66  ? 90  MET A CB    1 
ATOM   2106  C  CG    . MET B 2  89  ? 15.732  33.196  34.780 1.00 54.76  ? 90  MET A CG    1 
ATOM   2107  S  SD    . MET B 2  89  ? 14.032  32.705  35.043 1.00 63.37  ? 90  MET A SD    1 
ATOM   2108  C  CE    . MET B 2  89  ? 13.155  33.914  34.059 1.00 57.09  ? 90  MET A CE    1 
ATOM   2109  N  N     . VAL B 2  90  ? 17.023  36.710  33.819 1.00 56.39  ? 91  VAL A N     1 
ATOM   2110  C  CA    . VAL B 2  90  ? 16.932  37.347  32.511 1.00 59.93  ? 91  VAL A CA    1 
ATOM   2111  C  C     . VAL B 2  90  ? 18.307  37.453  31.876 1.00 66.83  ? 91  VAL A C     1 
ATOM   2112  O  O     . VAL B 2  90  ? 18.476  37.207  30.676 1.00 78.05  ? 91  VAL A O     1 
ATOM   2113  C  CB    . VAL B 2  90  ? 16.263  38.727  32.625 1.00 53.64  ? 91  VAL A CB    1 
ATOM   2114  C  CG1   . VAL B 2  90  ? 16.600  39.551  31.403 1.00 59.95  ? 91  VAL A CG1   1 
ATOM   2115  C  CG2   . VAL B 2  90  ? 14.775  38.568  32.759 1.00 53.15  ? 91  VAL A CG2   1 
ATOM   2116  N  N     . ARG B 2  91  ? 19.309  37.835  32.664 1.00 57.27  ? 92  ARG A N     1 
ATOM   2117  C  CA    . ARG B 2  91  ? 20.648  38.001  32.112 1.00 57.88  ? 92  ARG A CA    1 
ATOM   2118  C  C     . ARG B 2  91  ? 21.176  36.696  31.553 1.00 55.71  ? 92  ARG A C     1 
ATOM   2119  O  O     . ARG B 2  91  ? 21.803  36.681  30.488 1.00 54.62  ? 92  ARG A O     1 
ATOM   2120  C  CB    . ARG B 2  91  ? 21.589  38.561  33.172 1.00 54.41  ? 92  ARG A CB    1 
ATOM   2121  C  CG    . ARG B 2  91  ? 21.414  40.035  33.383 1.00 72.34  ? 92  ARG A CG    1 
ATOM   2122  C  CD    . ARG B 2  91  ? 22.411  40.579  34.375 1.00 90.81  ? 92  ARG A CD    1 
ATOM   2123  N  NE    . ARG B 2  91  ? 21.926  40.476  35.747 1.00 103.03 ? 92  ARG A NE    1 
ATOM   2124  C  CZ    . ARG B 2  91  ? 21.264  41.441  36.378 1.00 98.26  ? 92  ARG A CZ    1 
ATOM   2125  N  NH1   . ARG B 2  91  ? 20.862  41.260  37.631 1.00 101.78 ? 92  ARG A NH1   1 
ATOM   2126  N  NH2   . ARG B 2  91  ? 21.005  42.589  35.759 1.00 86.01  ? 92  ARG A NH2   1 
ATOM   2127  N  N     . MET B 2  92  ? 20.912  35.587  32.239 1.00 60.69  ? 93  MET A N     1 
ATOM   2128  C  CA    . MET B 2  92  ? 21.342  34.284  31.756 1.00 63.50  ? 93  MET A CA    1 
ATOM   2129  C  C     . MET B 2  92  ? 20.683  33.917  30.435 1.00 65.82  ? 93  MET A C     1 
ATOM   2130  O  O     . MET B 2  92  ? 21.129  32.971  29.774 1.00 63.14  ? 93  MET A O     1 
ATOM   2131  C  CB    . MET B 2  92  ? 21.078  33.221  32.825 1.00 61.31  ? 93  MET A CB    1 
ATOM   2132  C  CG    . MET B 2  92  ? 22.040  33.301  34.003 1.00 65.25  ? 93  MET A CG    1 
ATOM   2133  S  SD    . MET B 2  92  ? 21.822  31.936  35.130 1.00 66.77  ? 93  MET A SD    1 
ATOM   2134  C  CE    . MET B 2  92  ? 20.161  32.264  35.648 1.00 59.96  ? 93  MET A CE    1 
ATOM   2135  N  N     . ALA B 2  93  ? 19.661  34.659  30.006 1.00 57.62  ? 94  ALA A N     1 
ATOM   2136  C  CA    . ALA B 2  93  ? 18.937  34.377  28.779 1.00 51.55  ? 94  ALA A CA    1 
ATOM   2137  C  C     . ALA B 2  93  ? 19.288  35.324  27.642 1.00 57.54  ? 94  ALA A C     1 
ATOM   2138  O  O     . ALA B 2  93  ? 18.707  35.202  26.557 1.00 69.38  ? 94  ALA A O     1 
ATOM   2139  C  CB    . ALA B 2  93  ? 17.430  34.423  29.038 1.00 55.69  ? 94  ALA A CB    1 
ATOM   2140  N  N     . GLN B 2  94  ? 20.201  36.266  27.849 1.00 64.82  ? 95  GLN A N     1 
ATOM   2141  C  CA    . GLN B 2  94  ? 20.547  37.258  26.838 1.00 67.09  ? 95  GLN A CA    1 
ATOM   2142  C  C     . GLN B 2  94  ? 21.796  36.807  26.101 1.00 66.82  ? 95  GLN A C     1 
ATOM   2143  O  O     . GLN B 2  94  ? 22.838  36.592  26.723 1.00 57.52  ? 95  GLN A O     1 
ATOM   2144  C  CB    . GLN B 2  94  ? 20.765  38.629  27.473 1.00 62.06  ? 95  GLN A CB    1 
ATOM   2145  C  CG    . GLN B 2  94  ? 19.526  39.219  28.102 1.00 69.23  ? 95  GLN A CG    1 
ATOM   2146  C  CD    . GLN B 2  94  ? 19.821  40.487  28.857 1.00 67.72  ? 95  GLN A CD    1 
ATOM   2147  O  OE1   . GLN B 2  94  ? 20.976  40.801  29.139 1.00 77.29  ? 95  GLN A OE1   1 
ATOM   2148  N  NE2   . GLN B 2  94  ? 18.778  41.228  29.190 1.00 67.67  ? 95  GLN A NE2   1 
ATOM   2149  N  N     . ASP B 2  95  ? 21.694  36.682  24.777 1.00 73.28  ? 96  ASP A N     1 
ATOM   2150  C  CA    . ASP B 2  95  ? 22.840  36.229  23.994 1.00 70.45  ? 96  ASP A CA    1 
ATOM   2151  C  C     . ASP B 2  95  ? 23.939  37.269  23.909 1.00 68.11  ? 96  ASP A C     1 
ATOM   2152  O  O     . ASP B 2  95  ? 25.020  36.953  23.404 1.00 73.67  ? 96  ASP A O     1 
ATOM   2153  C  CB    . ASP B 2  95  ? 22.417  35.826  22.587 1.00 64.12  ? 96  ASP A CB    1 
ATOM   2154  C  CG    . ASP B 2  95  ? 21.445  36.798  21.976 1.00 81.56  ? 96  ASP A CG    1 
ATOM   2155  O  OD1   . ASP B 2  95  ? 20.471  37.175  22.668 1.00 105.75 ? 96  ASP A OD1   1 
ATOM   2156  O  OD2   . ASP B 2  95  ? 21.649  37.181  20.807 1.00 84.34  ? 96  ASP A OD2   1 
ATOM   2157  N  N     . PHE B 2  96  ? 23.703  38.490  24.372 1.00 58.92  ? 97  PHE A N     1 
ATOM   2158  C  CA    . PHE B 2  96  ? 24.755  39.499  24.393 1.00 54.07  ? 97  PHE A CA    1 
ATOM   2159  C  C     . PHE B 2  96  ? 25.404  39.657  25.760 1.00 54.44  ? 97  PHE A C     1 
ATOM   2160  O  O     . PHE B 2  96  ? 26.455  40.303  25.859 1.00 61.62  ? 97  PHE A O     1 
ATOM   2161  C  CB    . PHE B 2  96  ? 24.224  40.842  23.902 1.00 55.25  ? 97  PHE A CB    1 
ATOM   2162  C  CG    . PHE B 2  96  ? 23.003  41.310  24.617 1.00 57.67  ? 97  PHE A CG    1 
ATOM   2163  C  CD1   . PHE B 2  96  ? 21.741  40.944  24.179 1.00 66.28  ? 97  PHE A CD1   1 
ATOM   2164  C  CD2   . PHE B 2  96  ? 23.115  42.129  25.720 1.00 65.45  ? 97  PHE A CD2   1 
ATOM   2165  C  CE1   . PHE B 2  96  ? 20.613  41.375  24.842 1.00 67.35  ? 97  PHE A CE1   1 
ATOM   2166  C  CE2   . PHE B 2  96  ? 21.993  42.565  26.387 1.00 68.41  ? 97  PHE A CE2   1 
ATOM   2167  C  CZ    . PHE B 2  96  ? 20.740  42.186  25.949 1.00 62.35  ? 97  PHE A CZ    1 
ATOM   2168  N  N     . SER B 2  97  ? 24.835  39.078  26.816 1.00 55.31  ? 98  SER A N     1 
ATOM   2169  C  CA    . SER B 2  97  ? 25.494  39.055  28.116 1.00 54.13  ? 98  SER A CA    1 
ATOM   2170  C  C     . SER B 2  97  ? 26.243  37.763  28.369 1.00 59.71  ? 98  SER A C     1 
ATOM   2171  O  O     . SER B 2  97  ? 27.337  37.779  28.949 1.00 54.87  ? 98  SER A O     1 
ATOM   2172  C  CB    . SER B 2  97  ? 24.476  39.231  29.234 1.00 59.47  ? 98  SER A CB    1 
ATOM   2173  O  OG    . SER B 2  97  ? 23.730  40.411  29.054 1.00 67.40  ? 98  SER A OG    1 
ATOM   2174  N  N     . TYR B 2  98  ? 25.659  36.639  27.966 1.00 59.24  ? 99  TYR A N     1 
ATOM   2175  C  CA    . TYR B 2  98  ? 26.220  35.330  28.223 1.00 49.23  ? 99  TYR A CA    1 
ATOM   2176  C  C     . TYR B 2  98  ? 26.797  34.774  26.934 1.00 55.22  ? 99  TYR A C     1 
ATOM   2177  O  O     . TYR B 2  98  ? 26.095  34.651  25.925 1.00 62.47  ? 99  TYR A O     1 
ATOM   2178  C  CB    . TYR B 2  98  ? 25.175  34.404  28.812 1.00 45.49  ? 99  TYR A CB    1 
ATOM   2179  C  CG    . TYR B 2  98  ? 25.162  34.490  30.307 1.00 52.18  ? 99  TYR A CG    1 
ATOM   2180  C  CD1   . TYR B 2  98  ? 24.682  35.616  30.954 1.00 48.16  ? 99  TYR A CD1   1 
ATOM   2181  C  CD2   . TYR B 2  98  ? 25.661  33.457  31.074 1.00 49.39  ? 99  TYR A CD2   1 
ATOM   2182  C  CE1   . TYR B 2  98  ? 24.673  35.693  32.330 1.00 53.75  ? 99  TYR A CE1   1 
ATOM   2183  C  CE2   . TYR B 2  98  ? 25.674  33.523  32.426 1.00 47.48  ? 99  TYR A CE2   1 
ATOM   2184  C  CZ    . TYR B 2  98  ? 25.175  34.635  33.061 1.00 52.19  ? 99  TYR A CZ    1 
ATOM   2185  O  OH    . TYR B 2  98  ? 25.201  34.669  34.437 1.00 64.12  ? 99  TYR A OH    1 
ATOM   2186  N  N     . ARG B 2  99  ? 28.093  34.482  26.962 1.00 55.21  ? 100 ARG A N     1 
ATOM   2187  C  CA    . ARG B 2  99  ? 28.733  33.861  25.811 1.00 64.11  ? 100 ARG A CA    1 
ATOM   2188  C  C     . ARG B 2  99  ? 28.090  32.520  25.496 1.00 62.11  ? 100 ARG A C     1 
ATOM   2189  O  O     . ARG B 2  99  ? 27.993  32.130  24.328 1.00 80.27  ? 100 ARG A O     1 
ATOM   2190  C  CB    . ARG B 2  99  ? 30.223  33.700  26.092 1.00 51.17  ? 100 ARG A CB    1 
ATOM   2191  C  CG    . ARG B 2  99  ? 31.018  33.129  24.957 1.00 43.38  ? 100 ARG A CG    1 
ATOM   2192  C  CD    . ARG B 2  99  ? 30.622  33.746  23.648 1.00 53.80  ? 100 ARG A CD    1 
ATOM   2193  N  NE    . ARG B 2  99  ? 31.673  33.589  22.661 1.00 54.05  ? 100 ARG A NE    1 
ATOM   2194  C  CZ    . ARG B 2  99  ? 31.739  32.582  21.807 1.00 64.40  ? 100 ARG A CZ    1 
ATOM   2195  N  NH1   . ARG B 2  99  ? 30.804  31.642  21.817 1.00 52.87  ? 100 ARG A NH1   1 
ATOM   2196  N  NH2   . ARG B 2  99  ? 32.742  32.517  20.945 1.00 81.08  ? 100 ARG A NH2   1 
ATOM   2197  N  N     . TYR B 2  100 ? 27.635  31.825  26.533 1.00 47.22  ? 101 TYR A N     1 
ATOM   2198  C  CA    . TYR B 2  100 ? 26.979  30.526  26.423 1.00 48.79  ? 101 TYR A CA    1 
ATOM   2199  C  C     . TYR B 2  100 ? 25.755  30.585  27.312 1.00 51.75  ? 101 TYR A C     1 
ATOM   2200  O  O     . TYR B 2  100 ? 25.789  30.163  28.475 1.00 49.31  ? 101 TYR A O     1 
ATOM   2201  C  CB    . TYR B 2  100 ? 27.937  29.409  26.821 1.00 46.54  ? 101 TYR A CB    1 
ATOM   2202  C  CG    . TYR B 2  100 ? 29.084  29.295  25.874 1.00 44.17  ? 101 TYR A CG    1 
ATOM   2203  C  CD1   . TYR B 2  100 ? 28.940  28.608  24.689 1.00 50.28  ? 101 TYR A CD1   1 
ATOM   2204  C  CD2   . TYR B 2  100 ? 30.306  29.880  26.154 1.00 46.66  ? 101 TYR A CD2   1 
ATOM   2205  C  CE1   . TYR B 2  100 ? 29.975  28.498  23.809 1.00 57.92  ? 101 TYR A CE1   1 
ATOM   2206  C  CE2   . TYR B 2  100 ? 31.356  29.773  25.278 1.00 48.41  ? 101 TYR A CE2   1 
ATOM   2207  C  CZ    . TYR B 2  100 ? 31.184  29.084  24.104 1.00 48.89  ? 101 TYR A CZ    1 
ATOM   2208  O  OH    . TYR B 2  100 ? 32.234  28.973  23.220 1.00 58.52  ? 101 TYR A OH    1 
ATOM   2209  N  N     . PRO B 2  101 ? 24.656  31.142  26.805 1.00 47.09  ? 102 PRO A N     1 
ATOM   2210  C  CA    . PRO B 2  101 ? 23.457  31.330  27.625 1.00 49.25  ? 102 PRO A CA    1 
ATOM   2211  C  C     . PRO B 2  101 ? 23.024  30.073  28.357 1.00 47.08  ? 102 PRO A C     1 
ATOM   2212  O  O     . PRO B 2  101 ? 23.029  28.975  27.805 1.00 54.85  ? 102 PRO A O     1 
ATOM   2213  C  CB    . PRO B 2  101 ? 22.410  31.769  26.600 1.00 44.11  ? 102 PRO A CB    1 
ATOM   2214  C  CG    . PRO B 2  101 ? 23.198  32.513  25.604 1.00 41.11  ? 102 PRO A CG    1 
ATOM   2215  C  CD    . PRO B 2  101 ? 24.519  31.789  25.490 1.00 40.17  ? 102 PRO A CD    1 
ATOM   2216  N  N     . LEU B 2  102 ? 22.606  30.261  29.613 1.00 48.50  ? 103 LEU A N     1 
ATOM   2217  C  CA    . LEU B 2  102 ? 22.138  29.162  30.453 1.00 46.76  ? 103 LEU A CA    1 
ATOM   2218  C  C     . LEU B 2  102 ? 20.619  29.055  30.522 1.00 51.78  ? 103 LEU A C     1 
ATOM   2219  O  O     . LEU B 2  102 ? 20.106  28.015  30.941 1.00 62.85  ? 103 LEU A O     1 
ATOM   2220  C  CB    . LEU B 2  102 ? 22.717  29.303  31.865 1.00 48.76  ? 103 LEU A CB    1 
ATOM   2221  C  CG    . LEU B 2  102 ? 24.245  29.398  31.843 1.00 46.88  ? 103 LEU A CG    1 
ATOM   2222  C  CD1   . LEU B 2  102 ? 24.847  29.518  33.227 1.00 53.56  ? 103 LEU A CD1   1 
ATOM   2223  C  CD2   . LEU B 2  102 ? 24.793  28.195  31.149 1.00 49.26  ? 103 LEU A CD2   1 
ATOM   2224  N  N     . VAL B 2  103 ? 19.897  30.079  30.101 1.00 56.04  ? 104 VAL A N     1 
ATOM   2225  C  CA    . VAL B 2  103 ? 18.445  30.091  30.144 1.00 49.15  ? 104 VAL A CA    1 
ATOM   2226  C  C     . VAL B 2  103 ? 17.935  30.361  28.737 1.00 57.41  ? 104 VAL A C     1 
ATOM   2227  O  O     . VAL B 2  103 ? 18.498  31.177  28.002 1.00 75.86  ? 104 VAL A O     1 
ATOM   2228  C  CB    . VAL B 2  103 ? 17.932  31.127  31.163 1.00 51.52  ? 104 VAL A CB    1 
ATOM   2229  C  CG1   . VAL B 2  103 ? 16.443  31.349  31.034 1.00 52.77  ? 104 VAL A CG1   1 
ATOM   2230  C  CG2   . VAL B 2  103 ? 18.294  30.668  32.571 1.00 54.83  ? 104 VAL A CG2   1 
ATOM   2231  N  N     . ASP B 2  104 ? 16.906  29.625  28.350 1.00 54.11  ? 105 ASP A N     1 
ATOM   2232  C  CA    . ASP B 2  104 ? 16.209  29.844  27.090 1.00 60.12  ? 105 ASP A CA    1 
ATOM   2233  C  C     . ASP B 2  104 ? 15.000  30.706  27.407 1.00 69.54  ? 105 ASP A C     1 
ATOM   2234  O  O     . ASP B 2  104 ? 14.150  30.303  28.204 1.00 79.48  ? 105 ASP A O     1 
ATOM   2235  C  CB    . ASP B 2  104 ? 15.789  28.515  26.462 1.00 72.87  ? 105 ASP A CB    1 
ATOM   2236  C  CG    . ASP B 2  104 ? 14.971  28.692  25.186 1.00 80.57  ? 105 ASP A CG    1 
ATOM   2237  O  OD1   . ASP B 2  104 ? 14.601  29.834  24.834 1.00 85.95  ? 105 ASP A OD1   1 
ATOM   2238  O  OD2   . ASP B 2  104 ? 14.693  27.666  24.531 1.00 70.38  ? 105 ASP A OD2   1 
ATOM   2239  N  N     . GLY B 2  105 ? 14.919  31.879  26.791 1.00 68.98  ? 106 GLY A N     1 
ATOM   2240  C  CA    . GLY B 2  105 ? 13.838  32.783  27.132 1.00 63.12  ? 106 GLY A CA    1 
ATOM   2241  C  C     . GLY B 2  105 ? 12.853  33.060  26.018 1.00 68.03  ? 106 GLY A C     1 
ATOM   2242  O  O     . GLY B 2  105 ? 13.244  33.360  24.886 1.00 74.40  ? 106 GLY A O     1 
ATOM   2243  N  N     . GLN B 2  106 ? 11.568  32.992  26.342 1.00 68.35  ? 107 GLN A N     1 
ATOM   2244  C  CA    . GLN B 2  106 ? 10.490  33.255  25.401 1.00 73.65  ? 107 GLN A CA    1 
ATOM   2245  C  C     . GLN B 2  106 ? 9.793   34.550  25.790 1.00 66.48  ? 107 GLN A C     1 
ATOM   2246  O  O     . GLN B 2  106 ? 9.318   34.681  26.923 1.00 62.30  ? 107 GLN A O     1 
ATOM   2247  C  CB    . GLN B 2  106 ? 9.490   32.099  25.392 1.00 89.03  ? 107 GLN A CB    1 
ATOM   2248  C  CG    . GLN B 2  106 ? 8.572   32.077  24.194 1.00 103.34 ? 107 GLN A CG    1 
ATOM   2249  C  CD    . GLN B 2  106 ? 7.434   31.100  24.372 1.00 109.98 ? 107 GLN A CD    1 
ATOM   2250  O  OE1   . GLN B 2  106 ? 7.186   30.620  25.476 1.00 110.24 ? 107 GLN A OE1   1 
ATOM   2251  N  NE2   . GLN B 2  106 ? 6.738   30.795  23.283 1.00 112.51 ? 107 GLN A NE2   1 
ATOM   2252  N  N     . GLY B 2  107 ? 9.714   35.486  24.861 1.00 67.64  ? 108 GLY A N     1 
ATOM   2253  C  CA    . GLY B 2  107 ? 9.136   36.793  25.113 1.00 69.40  ? 108 GLY A CA    1 
ATOM   2254  C  C     . GLY B 2  107 ? 10.183  37.868  24.961 1.00 69.61  ? 108 GLY A C     1 
ATOM   2255  O  O     . GLY B 2  107 ? 11.276  37.636  24.440 1.00 70.83  ? 108 GLY A O     1 
ATOM   2256  N  N     . ASN B 2  108 ? 9.854   39.065  25.437 1.00 74.25  ? 109 ASN A N     1 
ATOM   2257  C  CA    . ASN B 2  108 ? 10.805  40.176  25.362 1.00 74.36  ? 109 ASN A CA    1 
ATOM   2258  C  C     . ASN B 2  108 ? 11.803  40.032  26.499 1.00 70.13  ? 109 ASN A C     1 
ATOM   2259  O  O     . ASN B 2  108 ? 11.468  40.262  27.661 1.00 80.71  ? 109 ASN A O     1 
ATOM   2260  C  CB    . ASN B 2  108 ? 10.084  41.515  25.428 1.00 80.47  ? 109 ASN A CB    1 
ATOM   2261  C  CG    . ASN B 2  108 ? 11.036  42.708  25.484 1.00 92.65  ? 109 ASN A CG    1 
ATOM   2262  O  OD1   . ASN B 2  108 ? 12.231  42.615  25.163 1.00 97.00  ? 109 ASN A OD1   1 
ATOM   2263  N  ND2   . ASN B 2  108 ? 10.489  43.853  25.885 1.00 105.71 ? 109 ASN A ND2   1 
ATOM   2264  N  N     . PHE B 2  109 ? 13.036  39.653  26.173 1.00 63.60  ? 110 PHE A N     1 
ATOM   2265  C  CA    . PHE B 2  109 ? 14.068  39.510  27.189 1.00 58.42  ? 110 PHE A CA    1 
ATOM   2266  C  C     . PHE B 2  109 ? 15.134  40.586  27.074 1.00 62.51  ? 110 PHE A C     1 
ATOM   2267  O  O     . PHE B 2  109 ? 16.226  40.429  27.629 1.00 69.27  ? 110 PHE A O     1 
ATOM   2268  C  CB    . PHE B 2  109 ? 14.695  38.121  27.125 1.00 54.87  ? 110 PHE A CB    1 
ATOM   2269  C  CG    . PHE B 2  109 ? 13.990  37.122  27.969 1.00 57.36  ? 110 PHE A CG    1 
ATOM   2270  C  CD1   . PHE B 2  109 ? 12.826  36.531  27.524 1.00 56.43  ? 110 PHE A CD1   1 
ATOM   2271  C  CD2   . PHE B 2  109 ? 14.473  36.799  29.223 1.00 56.49  ? 110 PHE A CD2   1 
ATOM   2272  C  CE1   . PHE B 2  109 ? 12.163  35.622  28.305 1.00 60.58  ? 110 PHE A CE1   1 
ATOM   2273  C  CE2   . PHE B 2  109 ? 13.814  35.890  30.012 1.00 60.57  ? 110 PHE A CE2   1 
ATOM   2274  C  CZ    . PHE B 2  109 ? 12.658  35.299  29.552 1.00 68.47  ? 110 PHE A CZ    1 
ATOM   2275  N  N     . GLY B 2  110 ? 14.839  41.669  26.378 1.00 72.36  ? 111 GLY A N     1 
ATOM   2276  C  CA    . GLY B 2  110 ? 15.758  42.782  26.283 1.00 78.16  ? 111 GLY A CA    1 
ATOM   2277  C  C     . GLY B 2  110 ? 16.460  42.856  24.946 1.00 92.57  ? 111 GLY A C     1 
ATOM   2278  O  O     . GLY B 2  110 ? 16.163  42.130  23.995 1.00 104.91 ? 111 GLY A O     1 
ATOM   2279  N  N     . SER B 2  111 ? 17.424  43.772  24.891 1.00 92.25  ? 112 SER A N     1 
ATOM   2280  C  CA    . SER B 2  111 ? 18.188  44.047  23.681 1.00 95.50  ? 112 SER A CA    1 
ATOM   2281  C  C     . SER B 2  111 ? 19.469  44.770  24.074 1.00 101.61 ? 112 SER A C     1 
ATOM   2282  O  O     . SER B 2  111 ? 19.664  45.148  25.229 1.00 90.56  ? 112 SER A O     1 
ATOM   2283  C  CB    . SER B 2  111 ? 17.385  44.888  22.690 1.00 105.22 ? 112 SER A CB    1 
ATOM   2284  O  OG    . SER B 2  111 ? 17.588  46.264  22.968 1.00 118.07 ? 112 SER A OG    1 
ATOM   2285  N  N     . MET B 2  112 ? 20.339  44.981  23.080 1.00 107.57 ? 113 MET A N     1 
ATOM   2286  C  CA    . MET B 2  112 ? 21.622  45.636  23.344 1.00 112.57 ? 113 MET A CA    1 
ATOM   2287  C  C     . MET B 2  112 ? 21.448  47.073  23.800 1.00 114.72 ? 113 MET A C     1 
ATOM   2288  O  O     . MET B 2  112 ? 22.268  47.578  24.578 1.00 111.21 ? 113 MET A O     1 
ATOM   2289  C  CB    . MET B 2  112 ? 22.511  45.594  22.103 1.00 107.75 ? 113 MET A CB    1 
ATOM   2290  C  CG    . MET B 2  112 ? 22.790  44.219  21.594 1.00 101.81 ? 113 MET A CG    1 
ATOM   2291  S  SD    . MET B 2  112 ? 24.363  44.201  20.739 1.00 95.88  ? 113 MET A SD    1 
ATOM   2292  C  CE    . MET B 2  112 ? 25.443  44.731  22.067 1.00 97.35  ? 113 MET A CE    1 
ATOM   2293  N  N     . ASP B 2  113 ? 20.400  47.744  23.326 1.00 113.25 ? 114 ASP A N     1 
ATOM   2294  C  CA    . ASP B 2  113 ? 20.138  49.151  23.603 1.00 111.93 ? 114 ASP A CA    1 
ATOM   2295  C  C     . ASP B 2  113 ? 19.837  49.435  25.065 1.00 114.80 ? 114 ASP A C     1 
ATOM   2296  O  O     . ASP B 2  113 ? 19.730  50.613  25.435 1.00 124.45 ? 114 ASP A O     1 
ATOM   2297  C  CB    . ASP B 2  113 ? 18.979  49.625  22.741 1.00 115.37 ? 114 ASP A CB    1 
ATOM   2298  C  CG    . ASP B 2  113 ? 19.293  49.553  21.272 1.00 125.67 ? 114 ASP A CG    1 
ATOM   2299  O  OD1   . ASP B 2  113 ? 20.211  50.283  20.846 1.00 119.54 ? 114 ASP A OD1   1 
ATOM   2300  O  OD2   . ASP B 2  113 ? 18.631  48.774  20.549 1.00 135.29 ? 114 ASP A OD2   1 
ATOM   2301  N  N     . GLY B 2  114 ? 19.696  48.417  25.901 1.00 108.67 ? 115 GLY A N     1 
ATOM   2302  C  CA    . GLY B 2  114 ? 19.462  48.641  27.308 1.00 106.96 ? 115 GLY A CA    1 
ATOM   2303  C  C     . GLY B 2  114 ? 18.008  48.773  27.684 1.00 110.19 ? 115 GLY A C     1 
ATOM   2304  O  O     . GLY B 2  114 ? 17.709  49.003  28.862 1.00 114.43 ? 115 GLY A O     1 
ATOM   2305  N  N     . ASP B 2  115 ? 17.095  48.678  26.730 1.00 108.29 ? 116 ASP A N     1 
ATOM   2306  C  CA    . ASP B 2  115 ? 15.701  48.536  27.105 1.00 101.55 ? 116 ASP A CA    1 
ATOM   2307  C  C     . ASP B 2  115 ? 15.569  47.221  27.864 1.00 93.53  ? 116 ASP A C     1 
ATOM   2308  O  O     . ASP B 2  115 ? 16.048  46.176  27.407 1.00 90.89  ? 116 ASP A O     1 
ATOM   2309  C  CB    . ASP B 2  115 ? 14.790  48.561  25.886 1.00 103.03 ? 116 ASP A CB    1 
ATOM   2310  C  CG    . ASP B 2  115 ? 14.902  47.305  25.061 1.00 100.34 ? 116 ASP A CG    1 
ATOM   2311  O  OD1   . ASP B 2  115 ? 16.040  46.845  24.849 1.00 105.77 ? 116 ASP A OD1   1 
ATOM   2312  O  OD2   . ASP B 2  115 ? 13.854  46.752  24.664 1.00 101.30 ? 116 ASP A OD2   1 
ATOM   2313  N  N     . GLY B 2  116 ? 15.047  47.285  29.073 1.00 91.47  ? 117 GLY A N     1 
ATOM   2314  C  CA    . GLY B 2  116 ? 14.973  46.092  29.886 1.00 92.45  ? 117 GLY A CA    1 
ATOM   2315  C  C     . GLY B 2  116 ? 13.919  45.118  29.380 1.00 91.77  ? 117 GLY A C     1 
ATOM   2316  O  O     . GLY B 2  116 ? 13.088  45.417  28.521 1.00 105.24 ? 117 GLY A O     1 
ATOM   2317  N  N     . ALA B 2  117 ? 13.958  43.918  29.957 1.00 63.71  ? 118 ALA A N     1 
ATOM   2318  C  CA    . ALA B 2  117 ? 13.031  42.851  29.612 1.00 61.78  ? 118 ALA A CA    1 
ATOM   2319  C  C     . ALA B 2  117 ? 11.623  43.162  30.120 1.00 67.02  ? 118 ALA A C     1 
ATOM   2320  O  O     . ALA B 2  117 ? 11.398  44.093  30.895 1.00 70.58  ? 118 ALA A O     1 
ATOM   2321  C  CB    . ALA B 2  117 ? 13.505  41.521  30.185 1.00 57.78  ? 118 ALA A CB    1 
ATOM   2322  N  N     . ALA B 2  118 ? 10.663  42.350  29.675 1.00 69.34  ? 119 ALA A N     1 
ATOM   2323  C  CA    . ALA B 2  118 ? 9.287   42.587  30.091 1.00 76.97  ? 119 ALA A CA    1 
ATOM   2324  C  C     . ALA B 2  118 ? 9.084   42.146  31.544 1.00 81.79  ? 119 ALA A C     1 
ATOM   2325  O  O     . ALA B 2  118 ? 9.932   41.481  32.156 1.00 86.31  ? 119 ALA A O     1 
ATOM   2326  C  CB    . ALA B 2  118 ? 8.301   41.862  29.178 1.00 77.22  ? 119 ALA A CB    1 
ATOM   2327  N  N     . ALA B 2  119 ? 7.940   42.535  32.105 1.00 73.41  ? 120 ALA A N     1 
ATOM   2328  C  CA    . ALA B 2  119 ? 7.582   42.064  33.438 1.00 72.60  ? 120 ALA A CA    1 
ATOM   2329  C  C     . ALA B 2  119 ? 7.547   40.530  33.453 1.00 76.41  ? 120 ALA A C     1 
ATOM   2330  O  O     . ALA B 2  119 ? 7.345   39.874  32.427 1.00 78.81  ? 120 ALA A O     1 
ATOM   2331  C  CB    . ALA B 2  119 ? 6.233   42.646  33.864 1.00 82.77  ? 120 ALA A CB    1 
ATOM   2332  N  N     . MET B 2  120 ? 7.780   39.935  34.637 1.00 72.61  ? 121 MET A N     1 
ATOM   2333  C  CA    . MET B 2  120 ? 7.776   38.473  34.727 1.00 69.65  ? 121 MET A CA    1 
ATOM   2334  C  C     . MET B 2  120 ? 6.391   37.927  34.432 1.00 75.36  ? 121 MET A C     1 
ATOM   2335  O  O     . MET B 2  120 ? 6.227   36.719  34.226 1.00 83.76  ? 121 MET A O     1 
ATOM   2336  C  CB    . MET B 2  120 ? 8.369   38.019  36.091 1.00 66.84  ? 121 MET A CB    1 
ATOM   2337  C  CG    . MET B 2  120 ? 7.476   37.538  37.282 1.00 73.26  ? 121 MET A CG    1 
ATOM   2338  S  SD    . MET B 2  120 ? 8.443   37.509  38.832 1.00 68.70  ? 121 MET A SD    1 
ATOM   2339  C  CE    . MET B 2  120 ? 8.917   39.227  38.882 1.00 72.31  ? 121 MET A CE    1 
ATOM   2340  N  N     A ARG B 2  121 ? 5.392   38.807  34.367 0.50 82.73  ? 122 ARG A N     1 
ATOM   2341  N  N     B ARG B 2  121 ? 5.395   38.798  34.395 0.50 82.69  ? 122 ARG A N     1 
ATOM   2342  C  CA    A ARG B 2  121 ? 4.035   38.437  33.984 0.50 84.59  ? 122 ARG A CA    1 
ATOM   2343  C  CA    B ARG B 2  121 ? 4.051   38.401  34.019 0.50 84.55  ? 122 ARG A CA    1 
ATOM   2344  C  C     A ARG B 2  121 ? 3.931   37.975  32.505 0.50 80.51  ? 122 ARG A C     1 
ATOM   2345  C  C     B ARG B 2  121 ? 3.949   38.062  32.536 0.50 80.48  ? 122 ARG A C     1 
ATOM   2346  O  O     A ARG B 2  121 ? 3.002   37.234  32.181 0.50 78.86  ? 122 ARG A O     1 
ATOM   2347  O  O     B ARG B 2  121 ? 3.064   37.294  32.145 0.50 78.74  ? 122 ARG A O     1 
ATOM   2348  C  CB    A ARG B 2  121 ? 3.103   39.627  34.285 0.50 91.75  ? 122 ARG A CB    1 
ATOM   2349  C  CB    B ARG B 2  121 ? 3.095   39.521  34.440 0.50 91.61  ? 122 ARG A CB    1 
ATOM   2350  C  CG    A ARG B 2  121 ? 1.786   39.690  33.507 0.50 97.85  ? 122 ARG A CG    1 
ATOM   2351  C  CG    B ARG B 2  121 ? 1.874   39.754  33.580 0.50 97.76  ? 122 ARG A CG    1 
ATOM   2352  C  CD    A ARG B 2  121 ? 0.698   40.664  34.064 0.50 100.08 ? 122 ARG A CD    1 
ATOM   2353  C  CD    B ARG B 2  121 ? 0.990   40.856  34.201 0.50 100.06 ? 122 ARG A CD    1 
ATOM   2354  N  NE    A ARG B 2  121 ? 0.769   42.038  33.562 0.50 103.44 ? 122 ARG A NE    1 
ATOM   2355  N  NE    B ARG B 2  121 ? 1.227   42.175  33.622 0.50 102.89 ? 122 ARG A NE    1 
ATOM   2356  C  CZ    A ARG B 2  121 ? 1.017   43.116  34.305 0.50 106.42 ? 122 ARG A CZ    1 
ATOM   2357  C  CZ    B ARG B 2  121 ? 1.222   43.324  34.292 0.50 106.08 ? 122 ARG A CZ    1 
ATOM   2358  N  NH1   A ARG B 2  121 ? 1.233   43.028  35.611 0.50 105.39 ? 122 ARG A NH1   1 
ATOM   2359  N  NH1   B ARG B 2  121 ? 0.977   43.340  35.586 0.50 105.20 ? 122 ARG A NH1   1 
ATOM   2360  N  NH2   A ARG B 2  121 ? 1.036   44.297  33.728 0.50 107.62 ? 122 ARG A NH2   1 
ATOM   2361  N  NH2   B ARG B 2  121 ? 1.467   44.462  33.660 0.50 108.34 ? 122 ARG A NH2   1 
ATOM   2362  N  N     A TYR B 2  122 ? 4.906   38.322  31.647 0.50 80.70  ? 123 TYR A N     1 
ATOM   2363  N  N     B TYR B 2  122 ? 4.900   38.522  31.719 0.50 80.84  ? 123 TYR A N     1 
ATOM   2364  C  CA    A TYR B 2  122 ? 4.842   38.130  30.196 0.50 78.61  ? 123 TYR A CA    1 
ATOM   2365  C  CA    B TYR B 2  122 ? 4.828   38.341  30.279 0.50 78.67  ? 123 TYR A CA    1 
ATOM   2366  C  C     A TYR B 2  122 ? 5.914   37.268  29.647 0.50 76.74  ? 123 TYR A C     1 
ATOM   2367  C  C     B TYR B 2  122 ? 5.998   37.542  29.680 0.50 76.61  ? 123 TYR A C     1 
ATOM   2368  O  O     A TYR B 2  122 ? 6.088   37.228  28.427 0.50 74.12  ? 123 TYR A O     1 
ATOM   2369  O  O     B TYR B 2  122 ? 6.229   37.684  28.479 0.50 73.98  ? 123 TYR A O     1 
ATOM   2370  C  CB    A TYR B 2  122 ? 4.956   39.471  29.460 0.50 80.51  ? 123 TYR A CB    1 
ATOM   2371  C  CB    B TYR B 2  122 ? 4.746   39.685  29.549 0.50 80.98  ? 123 TYR A CB    1 
ATOM   2372  C  CG    A TYR B 2  122 ? 4.129   40.565  29.960 0.50 84.17  ? 123 TYR A CG    1 
ATOM   2373  C  CG    B TYR B 2  122 ? 3.882   40.785  30.125 0.50 84.82  ? 123 TYR A CG    1 
ATOM   2374  C  CD1   A TYR B 2  122 ? 2.887   40.788  29.426 0.50 91.26  ? 123 TYR A CD1   1 
ATOM   2375  C  CD1   B TYR B 2  122 ? 4.114   41.293  31.393 0.50 84.87  ? 123 TYR A CD1   1 
ATOM   2376  C  CD2   A TYR B 2  122 ? 4.601   41.416  30.948 0.50 84.18  ? 123 TYR A CD2   1 
ATOM   2377  C  CD2   B TYR B 2  122 ? 2.889   41.371  29.354 0.50 92.07  ? 123 TYR A CD2   1 
ATOM   2378  C  CE1   A TYR B 2  122 ? 2.116   41.818  29.872 0.50 96.03  ? 123 TYR A CE1   1 
ATOM   2379  C  CE1   B TYR B 2  122 ? 3.365   42.308  31.885 0.50 88.56  ? 123 TYR A CE1   1 
ATOM   2380  C  CE2   A TYR B 2  122 ? 3.842   42.451  31.382 0.50 87.88  ? 123 TYR A CE2   1 
ATOM   2381  C  CE2   B TYR B 2  122 ? 2.116   42.387  29.848 0.50 96.76  ? 123 TYR A CE2   1 
ATOM   2382  C  CZ    A TYR B 2  122 ? 2.609   42.645  30.852 0.50 105.88 ? 123 TYR A CZ    1 
ATOM   2383  C  CZ    B TYR B 2  122 ? 2.353   42.848  31.110 0.50 105.52 ? 123 TYR A CZ    1 
ATOM   2384  O  OH    A TYR B 2  122 ? 1.873   43.698  31.346 0.50 114.07 ? 123 TYR A OH    1 
ATOM   2385  O  OH    B TYR B 2  122 ? 1.560   43.860  31.584 0.50 114.52 ? 123 TYR A OH    1 
ATOM   2386  N  N     . THR B 2  123 ? 6.730   36.709  30.468 1.00 85.41  ? 124 THR A N     1 
ATOM   2387  C  CA    . THR B 2  123 ? 7.831   35.938  29.933 1.00 79.40  ? 124 THR A CA    1 
ATOM   2388  C  C     . THR B 2  123 ? 7.792   34.538  30.496 1.00 74.72  ? 124 THR A C     1 
ATOM   2389  O  O     . THR B 2  123 ? 7.321   34.298  31.607 1.00 81.02  ? 124 THR A O     1 
ATOM   2390  C  CB    . THR B 2  123 ? 9.211   36.554  30.217 1.00 65.01  ? 124 THR A CB    1 
ATOM   2391  O  OG1   . THR B 2  123 ? 9.424   36.558  31.629 1.00 65.11  ? 124 THR A OG1   1 
ATOM   2392  C  CG2   . THR B 2  123 ? 9.274   37.974  29.671 1.00 66.44  ? 124 THR A CG2   1 
ATOM   2393  N  N     . GLU B 2  124 ? 8.268   33.612  29.674 1.00 73.07  ? 125 GLU A N     1 
ATOM   2394  C  CA    . GLU B 2  124 ? 8.407   32.222  30.032 1.00 75.63  ? 125 GLU A CA    1 
ATOM   2395  C  C     . GLU B 2  124 ? 9.859   31.828  29.815 1.00 73.81  ? 125 GLU A C     1 
ATOM   2396  O  O     . GLU B 2  124 ? 10.611  32.525  29.132 1.00 67.04  ? 125 GLU A O     1 
ATOM   2397  C  CB    . GLU B 2  124 ? 7.467   31.359  29.198 1.00 80.31  ? 125 GLU A CB    1 
ATOM   2398  C  CG    . GLU B 2  124 ? 6.040   31.353  29.684 1.00 93.37  ? 125 GLU A CG    1 
ATOM   2399  C  CD    . GLU B 2  124 ? 5.093   30.757  28.665 1.00 109.89 ? 125 GLU A CD    1 
ATOM   2400  O  OE1   . GLU B 2  124 ? 5.519   30.551  27.515 1.00 127.70 ? 125 GLU A OE1   1 
ATOM   2401  O  OE2   . GLU B 2  124 ? 3.924   30.491  29.006 1.00 107.98 ? 125 GLU A OE2   1 
ATOM   2402  N  N     . ALA B 2  125 ? 10.252  30.692  30.391 1.00 77.31  ? 126 ALA A N     1 
ATOM   2403  C  CA    . ALA B 2  125 ? 11.647  30.285  30.308 1.00 75.00  ? 126 ALA A CA    1 
ATOM   2404  C  C     . ALA B 2  125 ? 11.798  28.786  30.549 1.00 73.73  ? 126 ALA A C     1 
ATOM   2405  O  O     . ALA B 2  125 ? 10.907  28.131  31.092 1.00 72.92  ? 126 ALA A O     1 
ATOM   2406  C  CB    . ALA B 2  125 ? 12.501  31.081  31.297 1.00 75.77  ? 126 ALA A CB    1 
ATOM   2407  N  N     . ARG B 2  126 ? 12.950  28.259  30.121 1.00 75.92  ? 127 ARG A N     1 
ATOM   2408  C  CA    . ARG B 2  126 ? 13.379  26.890  30.389 1.00 69.36  ? 127 ARG A CA    1 
ATOM   2409  C  C     . ARG B 2  126 ? 14.904  26.855  30.262 1.00 70.81  ? 127 ARG A C     1 
ATOM   2410  O  O     . ARG B 2  126 ? 15.537  27.856  29.901 1.00 74.90  ? 127 ARG A O     1 
ATOM   2411  C  CB    . ARG B 2  126 ? 12.719  25.891  29.430 1.00 59.62  ? 127 ARG A CB    1 
ATOM   2412  C  CG    . ARG B 2  126 ? 13.135  26.104  27.997 1.00 66.85  ? 127 ARG A CG    1 
ATOM   2413  C  CD    . ARG B 2  126 ? 12.399  25.210  27.042 1.00 77.52  ? 127 ARG A CD    1 
ATOM   2414  N  NE    . ARG B 2  126 ? 12.730  25.572  25.668 1.00 67.31  ? 127 ARG A NE    1 
ATOM   2415  C  CZ    . ARG B 2  126 ? 11.968  25.276  24.625 1.00 70.50  ? 127 ARG A CZ    1 
ATOM   2416  N  NH1   . ARG B 2  126 ? 10.833  24.620  24.802 1.00 83.86  ? 127 ARG A NH1   1 
ATOM   2417  N  NH2   . ARG B 2  126 ? 12.332  25.641  23.406 1.00 75.19  ? 127 ARG A NH2   1 
ATOM   2418  N  N     . MET B 2  127 ? 15.500  25.697  30.578 1.00 59.49  ? 128 MET A N     1 
ATOM   2419  C  CA    . MET B 2  127 ? 16.941  25.545  30.392 1.00 55.45  ? 128 MET A CA    1 
ATOM   2420  C  C     . MET B 2  127 ? 17.316  25.597  28.912 1.00 55.96  ? 128 MET A C     1 
ATOM   2421  O  O     . MET B 2  127 ? 16.523  25.267  28.033 1.00 64.16  ? 128 MET A O     1 
ATOM   2422  C  CB    . MET B 2  127 ? 17.453  24.191  30.869 1.00 64.09  ? 128 MET A CB    1 
ATOM   2423  C  CG    . MET B 2  127 ? 17.439  23.915  32.301 1.00 77.95  ? 128 MET A CG    1 
ATOM   2424  S  SD    . MET B 2  127 ? 17.764  22.163  32.382 1.00 89.25  ? 128 MET A SD    1 
ATOM   2425  C  CE    . MET B 2  127 ? 16.848  21.803  33.834 1.00 90.79  ? 128 MET A CE    1 
ATOM   2426  N  N     . THR B 2  128 ? 18.563  25.932  28.639 1.00 53.14  ? 129 THR A N     1 
ATOM   2427  C  CA    . THR B 2  128 ? 19.092  25.663  27.314 1.00 65.88  ? 129 THR A CA    1 
ATOM   2428  C  C     . THR B 2  128 ? 19.764  24.293  27.337 1.00 67.89  ? 129 THR A C     1 
ATOM   2429  O  O     . THR B 2  128 ? 19.997  23.720  28.405 1.00 70.81  ? 129 THR A O     1 
ATOM   2430  C  CB    . THR B 2  128 ? 20.081  26.741  26.901 1.00 68.62  ? 129 THR A CB    1 
ATOM   2431  O  OG1   . THR B 2  128 ? 21.022  26.939  27.955 1.00 51.57  ? 129 THR A OG1   1 
ATOM   2432  C  CG2   . THR B 2  128 ? 19.343  28.058  26.666 1.00 75.27  ? 129 THR A CG2   1 
ATOM   2433  N  N     . LYS B 2  129 ? 20.072  23.751  26.152 1.00 61.44  ? 130 LYS A N     1 
ATOM   2434  C  CA    . LYS B 2  129 ? 20.742  22.455  26.119 1.00 57.15  ? 130 LYS A CA    1 
ATOM   2435  C  C     . LYS B 2  129 ? 22.037  22.486  26.920 1.00 66.76  ? 130 LYS A C     1 
ATOM   2436  O  O     . LYS B 2  129 ? 22.333  21.549  27.663 1.00 76.86  ? 130 LYS A O     1 
ATOM   2437  C  CB    . LYS B 2  129 ? 20.983  22.002  24.676 1.00 58.91  ? 130 LYS A CB    1 
ATOM   2438  C  CG    . LYS B 2  129 ? 19.703  21.659  23.937 1.00 64.73  ? 130 LYS A CG    1 
ATOM   2439  C  CD    . LYS B 2  129 ? 19.875  21.292  22.462 1.00 67.58  ? 130 LYS A CD    1 
ATOM   2440  C  CE    . LYS B 2  129 ? 18.499  20.828  21.913 1.00 92.40  ? 130 LYS A CE    1 
ATOM   2441  N  NZ    . LYS B 2  129 ? 18.331  19.482  21.252 1.00 97.53  ? 130 LYS A NZ    1 
ATOM   2442  N  N     . ILE B 2  130 ? 22.821  23.564  26.808 1.00 68.05  ? 131 ILE A N     1 
ATOM   2443  C  CA    . ILE B 2  130 ? 24.135  23.571  27.469 1.00 60.14  ? 131 ILE A CA    1 
ATOM   2444  C  C     . ILE B 2  130 ? 24.012  23.556  28.996 1.00 64.06  ? 131 ILE A C     1 
ATOM   2445  O  O     . ILE B 2  130 ? 24.945  23.131  29.690 1.00 64.77  ? 131 ILE A O     1 
ATOM   2446  C  CB    . ILE B 2  130 ? 25.019  24.748  26.988 1.00 56.14  ? 131 ILE A CB    1 
ATOM   2447  C  CG1   . ILE B 2  130 ? 26.456  24.526  27.460 1.00 56.74  ? 131 ILE A CG1   1 
ATOM   2448  C  CG2   . ILE B 2  130 ? 24.502  26.065  27.552 1.00 58.96  ? 131 ILE A CG2   1 
ATOM   2449  C  CD1   . ILE B 2  130 ? 27.505  25.174  26.623 1.00 63.29  ? 131 ILE A CD1   1 
ATOM   2450  N  N     . THR B 2  131 ? 22.895  24.026  29.549 1.00 63.21  ? 132 THR A N     1 
ATOM   2451  C  CA    . THR B 2  131 ? 22.725  23.997  31.007 1.00 61.70  ? 132 THR A CA    1 
ATOM   2452  C  C     . THR B 2  131 ? 22.524  22.578  31.527 1.00 67.17  ? 132 THR A C     1 
ATOM   2453  O  O     . THR B 2  131 ? 22.849  22.286  32.688 1.00 68.40  ? 132 THR A O     1 
ATOM   2454  C  CB    . THR B 2  131 ? 21.549  24.890  31.442 1.00 67.03  ? 132 THR A CB    1 
ATOM   2455  O  OG1   . THR B 2  131 ? 21.896  26.251  31.217 1.00 79.92  ? 132 THR A OG1   1 
ATOM   2456  C  CG2   . THR B 2  131 ? 21.211  24.736  32.922 1.00 55.26  ? 132 THR A CG2   1 
ATOM   2457  N  N     . LEU B 2  132 ? 22.002  21.677  30.685 1.00 66.60  ? 133 LEU A N     1 
ATOM   2458  C  CA    . LEU B 2  132 ? 21.930  20.271  31.067 1.00 62.59  ? 133 LEU A CA    1 
ATOM   2459  C  C     . LEU B 2  132 ? 23.297  19.772  31.469 1.00 68.81  ? 133 LEU A C     1 
ATOM   2460  O  O     . LEU B 2  132 ? 23.425  18.916  32.351 1.00 75.66  ? 133 LEU A O     1 
ATOM   2461  C  CB    . LEU B 2  132 ? 21.403  19.422  29.911 1.00 61.06  ? 133 LEU A CB    1 
ATOM   2462  C  CG    . LEU B 2  132 ? 19.934  19.557  29.511 1.00 61.20  ? 133 LEU A CG    1 
ATOM   2463  C  CD1   . LEU B 2  132 ? 19.605  18.799  28.221 1.00 58.42  ? 133 LEU A CD1   1 
ATOM   2464  C  CD2   . LEU B 2  132 ? 19.082  19.073  30.663 1.00 63.22  ? 133 LEU A CD2   1 
ATOM   2465  N  N     . GLU B 2  133 ? 24.336  20.306  30.831 1.00 59.62  ? 134 GLU A N     1 
ATOM   2466  C  CA    . GLU B 2  133 ? 25.693  19.894  31.139 1.00 54.20  ? 134 GLU A CA    1 
ATOM   2467  C  C     . GLU B 2  133 ? 26.168  20.449  32.468 1.00 54.36  ? 134 GLU A C     1 
ATOM   2468  O  O     . GLU B 2  133 ? 27.084  19.882  33.068 1.00 69.75  ? 134 GLU A O     1 
ATOM   2469  C  CB    . GLU B 2  133 ? 26.620  20.312  30.007 1.00 50.13  ? 134 GLU A CB    1 
ATOM   2470  C  CG    . GLU B 2  133 ? 26.233  19.731  28.637 1.00 59.00  ? 134 GLU A CG    1 
ATOM   2471  C  CD    . GLU B 2  133 ? 26.287  18.209  28.577 1.00 77.51  ? 134 GLU A CD    1 
ATOM   2472  O  OE1   . GLU B 2  133 ? 25.693  17.647  27.633 1.00 80.07  ? 134 GLU A OE1   1 
ATOM   2473  O  OE2   . GLU B 2  133 ? 26.923  17.567  29.439 1.00 89.24  ? 134 GLU A OE2   1 
ATOM   2474  N  N     . LEU B 2  134 ? 25.558  21.524  32.953 1.00 50.32  ? 135 LEU A N     1 
ATOM   2475  C  CA    . LEU B 2  134 ? 25.884  22.007  34.287 1.00 51.35  ? 135 LEU A CA    1 
ATOM   2476  C  C     . LEU B 2  134 ? 25.258  21.136  35.357 1.00 56.07  ? 135 LEU A C     1 
ATOM   2477  O  O     . LEU B 2  134 ? 25.850  20.945  36.431 1.00 55.33  ? 135 LEU A O     1 
ATOM   2478  C  CB    . LEU B 2  134 ? 25.417  23.451  34.459 1.00 50.81  ? 135 LEU A CB    1 
ATOM   2479  C  CG    . LEU B 2  134 ? 26.137  24.595  33.764 1.00 52.86  ? 135 LEU A CG    1 
ATOM   2480  C  CD1   . LEU B 2  134 ? 25.471  25.876  34.184 1.00 58.13  ? 135 LEU A CD1   1 
ATOM   2481  C  CD2   . LEU B 2  134 ? 27.599  24.601  34.148 1.00 53.55  ? 135 LEU A CD2   1 
ATOM   2482  N  N     . LEU B 2  135 ? 24.074  20.599  35.077 1.00 53.64  ? 136 LEU A N     1 
ATOM   2483  C  CA    . LEU B 2  135 ? 23.305  19.781  35.995 1.00 54.21  ? 136 LEU A CA    1 
ATOM   2484  C  C     . LEU B 2  135 ? 23.466  18.301  35.719 1.00 57.55  ? 136 LEU A C     1 
ATOM   2485  O  O     . LEU B 2  135 ? 22.783  17.490  36.349 1.00 73.36  ? 136 LEU A O     1 
ATOM   2486  C  CB    . LEU B 2  135 ? 21.827  20.143  35.900 1.00 53.78  ? 136 LEU A CB    1 
ATOM   2487  C  CG    . LEU B 2  135 ? 21.469  21.604  36.101 1.00 54.24  ? 136 LEU A CG    1 
ATOM   2488  C  CD1   . LEU B 2  135 ? 20.082  21.846  35.567 1.00 47.09  ? 136 LEU A CD1   1 
ATOM   2489  C  CD2   . LEU B 2  135 ? 21.549  21.934  37.566 1.00 66.40  ? 136 LEU A CD2   1 
ATOM   2490  N  N     . ARG B 2  136 ? 24.301  17.934  34.759 1.00 68.24  ? 137 ARG A N     1 
ATOM   2491  C  CA    . ARG B 2  136 ? 24.505  16.530  34.443 1.00 62.55  ? 137 ARG A CA    1 
ATOM   2492  C  C     . ARG B 2  136 ? 25.022  15.785  35.669 1.00 60.97  ? 137 ARG A C     1 
ATOM   2493  O  O     . ARG B 2  136 ? 25.917  16.270  36.369 1.00 82.66  ? 137 ARG A O     1 
ATOM   2494  C  CB    . ARG B 2  136 ? 25.469  16.412  33.264 1.00 58.05  ? 137 ARG A CB    1 
ATOM   2495  C  CG    . ARG B 2  136 ? 25.750  15.019  32.792 1.00 65.79  ? 137 ARG A CG    1 
ATOM   2496  C  CD    . ARG B 2  136 ? 26.605  15.085  31.540 1.00 77.62  ? 137 ARG A CD    1 
ATOM   2497  N  NE    . ARG B 2  136 ? 27.349  13.854  31.306 1.00 90.02  ? 137 ARG A NE    1 
ATOM   2498  C  CZ    . ARG B 2  136 ? 28.229  13.695  30.322 1.00 96.44  ? 137 ARG A CZ    1 
ATOM   2499  N  NH1   . ARG B 2  136 ? 28.471  14.694  29.482 1.00 88.84  ? 137 ARG A NH1   1 
ATOM   2500  N  NH2   . ARG B 2  136 ? 28.867  12.539  30.178 1.00 105.15 ? 137 ARG A NH2   1 
ATOM   2501  N  N     . ASP B 2  137 ? 24.408  14.631  35.953 1.00 63.13  ? 138 ASP A N     1 
ATOM   2502  C  CA    . ASP B 2  137 ? 24.783  13.726  37.050 1.00 76.60  ? 138 ASP A CA    1 
ATOM   2503  C  C     . ASP B 2  137 ? 24.642  14.351  38.437 1.00 72.63  ? 138 ASP A C     1 
ATOM   2504  O  O     . ASP B 2  137 ? 25.355  13.968  39.365 1.00 67.65  ? 138 ASP A O     1 
ATOM   2505  C  CB    . ASP B 2  137 ? 26.212  13.191  36.884 1.00 90.95  ? 138 ASP A CB    1 
ATOM   2506  C  CG    . ASP B 2  137 ? 26.517  12.756  35.477 1.00 98.38  ? 138 ASP A CG    1 
ATOM   2507  O  OD1   . ASP B 2  137 ? 25.597  12.252  34.795 1.00 115.23 ? 138 ASP A OD1   1 
ATOM   2508  O  OD2   . ASP B 2  137 ? 27.681  12.930  35.055 1.00 88.78  ? 138 ASP A OD2   1 
ATOM   2509  N  N     . ILE B 2  138 ? 23.723  15.297  38.619 1.00 75.32  ? 139 ILE A N     1 
ATOM   2510  C  CA    . ILE B 2  138 ? 23.627  15.938  39.931 1.00 69.14  ? 139 ILE A CA    1 
ATOM   2511  C  C     . ILE B 2  138 ? 23.107  14.959  40.976 1.00 68.91  ? 139 ILE A C     1 
ATOM   2512  O  O     . ILE B 2  138 ? 23.580  14.943  42.121 1.00 67.79  ? 139 ILE A O     1 
ATOM   2513  C  CB    . ILE B 2  138 ? 22.773  17.219  39.864 1.00 61.99  ? 139 ILE A CB    1 
ATOM   2514  C  CG1   . ILE B 2  138 ? 22.571  17.777  41.272 1.00 65.09  ? 139 ILE A CG1   1 
ATOM   2515  C  CG2   . ILE B 2  138 ? 21.421  16.947  39.195 1.00 55.53  ? 139 ILE A CG2   1 
ATOM   2516  C  CD1   . ILE B 2  138 ? 22.212  19.220  41.305 1.00 69.50  ? 139 ILE A CD1   1 
ATOM   2517  N  N     . ASN B 2  139 ? 22.141  14.124  40.595 1.00 77.51  ? 140 ASN A N     1 
ATOM   2518  C  CA    . ASN B 2  139 ? 21.528  13.172  41.521 1.00 88.30  ? 140 ASN A CA    1 
ATOM   2519  C  C     . ASN B 2  139 ? 22.503  12.090  41.960 1.00 94.97  ? 140 ASN A C     1 
ATOM   2520  O  O     . ASN B 2  139 ? 22.461  11.626  43.108 1.00 102.71 ? 140 ASN A O     1 
ATOM   2521  C  CB    . ASN B 2  139 ? 20.309  12.525  40.870 1.00 85.51  ? 140 ASN A CB    1 
ATOM   2522  C  CG    . ASN B 2  139 ? 19.296  13.531  40.439 1.00 82.41  ? 140 ASN A CG    1 
ATOM   2523  O  OD1   . ASN B 2  139 ? 18.901  14.391  41.224 1.00 83.94  ? 140 ASN A OD1   1 
ATOM   2524  N  ND2   . ASN B 2  139 ? 18.879  13.457  39.176 1.00 83.16  ? 140 ASN A ND2   1 
ATOM   2525  N  N     . LYS B 2  140 ? 23.383  11.679  41.068 1.00 77.74  ? 141 LYS A N     1 
ATOM   2526  C  CA    . LYS B 2  140 ? 24.309  10.588  41.323 1.00 77.90  ? 141 LYS A CA    1 
ATOM   2527  C  C     . LYS B 2  140 ? 25.354  10.866  42.401 1.00 76.15  ? 141 LYS A C     1 
ATOM   2528  O  O     . LYS B 2  140 ? 26.490  10.395  42.288 1.00 83.71  ? 141 LYS A O     1 
ATOM   2529  C  CB    . LYS B 2  140 ? 24.987  10.206  40.017 1.00 80.68  ? 141 LYS A CB    1 
ATOM   2530  C  CG    . LYS B 2  140 ? 23.999  9.806   38.947 1.00 86.46  ? 141 LYS A CG    1 
ATOM   2531  C  CD    . LYS B 2  140 ? 24.687  9.412   37.660 1.00 94.61  ? 141 LYS A CD    1 
ATOM   2532  C  CE    . LYS B 2  140 ? 23.670  9.177   36.554 1.00 99.18  ? 141 LYS A CE    1 
ATOM   2533  N  NZ    . LYS B 2  140 ? 24.320  8.699   35.303 1.00 105.16 ? 141 LYS A NZ    1 
ATOM   2534  N  N     . ASP B 2  141 ? 24.986  11.601  43.450 1.00 85.36  ? 142 ASP A N     1 
ATOM   2535  C  CA    . ASP B 2  141 ? 25.851  11.874  44.606 1.00 84.59  ? 142 ASP A CA    1 
ATOM   2536  C  C     . ASP B 2  141 ? 27.264  12.277  44.174 1.00 80.43  ? 142 ASP A C     1 
ATOM   2537  O  O     . ASP B 2  141 ? 28.272  11.658  44.520 1.00 76.97  ? 142 ASP A O     1 
ATOM   2538  C  CB    . ASP B 2  141 ? 25.876  10.670  45.557 1.00 83.01  ? 142 ASP A CB    1 
ATOM   2539  C  CG    . ASP B 2  141 ? 26.788  10.883  46.761 1.00 87.94  ? 142 ASP A CG    1 
ATOM   2540  O  OD1   . ASP B 2  141 ? 26.496  11.783  47.580 1.00 90.92  ? 142 ASP A OD1   1 
ATOM   2541  O  OD2   . ASP B 2  141 ? 27.807  10.162  46.871 1.00 88.48  ? 142 ASP A OD2   1 
ATOM   2542  N  N     . THR B 2  142 ? 27.305  13.327  43.353 1.00 84.52  ? 143 THR A N     1 
ATOM   2543  C  CA    . THR B 2  142 ? 28.536  13.931  42.852 1.00 81.78  ? 143 THR A CA    1 
ATOM   2544  C  C     . THR B 2  142 ? 28.903  15.224  43.566 1.00 80.31  ? 143 THR A C     1 
ATOM   2545  O  O     . THR B 2  142 ? 30.077  15.611  43.561 1.00 89.94  ? 143 THR A O     1 
ATOM   2546  C  CB    . THR B 2  142 ? 28.415  14.232  41.344 1.00 73.60  ? 143 THR A CB    1 
ATOM   2547  O  OG1   . THR B 2  142 ? 27.198  14.950  41.088 1.00 60.20  ? 143 THR A OG1   1 
ATOM   2548  C  CG2   . THR B 2  142 ? 28.440  12.973  40.508 1.00 75.14  ? 143 THR A CG2   1 
ATOM   2549  N  N     . ILE B 2  143 ? 27.922  15.897  44.167 1.00 73.92  ? 144 ILE A N     1 
ATOM   2550  C  CA    . ILE B 2  143 ? 28.108  17.157  44.865 1.00 69.79  ? 144 ILE A CA    1 
ATOM   2551  C  C     . ILE B 2  143 ? 27.352  17.085  46.187 1.00 76.10  ? 144 ILE A C     1 
ATOM   2552  O  O     . ILE B 2  143 ? 26.308  16.435  46.289 1.00 99.39  ? 144 ILE A O     1 
ATOM   2553  C  CB    . ILE B 2  143 ? 27.655  18.360  43.997 1.00 67.07  ? 144 ILE A CB    1 
ATOM   2554  C  CG1   . ILE B 2  143 ? 26.210  18.207  43.524 1.00 66.52  ? 144 ILE A CG1   1 
ATOM   2555  C  CG2   . ILE B 2  143 ? 28.514  18.460  42.761 1.00 72.79  ? 144 ILE A CG2   1 
ATOM   2556  C  CD1   . ILE B 2  143 ? 25.167  18.717  44.487 1.00 64.27  ? 144 ILE A CD1   1 
ATOM   2557  N  N     . ASP B 2  144 ? 27.895  17.749  47.209 1.00 71.30  ? 145 ASP A N     1 
ATOM   2558  C  CA    . ASP B 2  144 ? 27.281  17.764  48.537 1.00 72.65  ? 145 ASP A CA    1 
ATOM   2559  C  C     . ASP B 2  144 ? 26.049  18.659  48.541 1.00 75.59  ? 145 ASP A C     1 
ATOM   2560  O  O     . ASP B 2  144 ? 26.090  19.786  48.038 1.00 77.22  ? 145 ASP A O     1 
ATOM   2561  C  CB    . ASP B 2  144 ? 28.268  18.261  49.601 1.00 75.88  ? 145 ASP A CB    1 
ATOM   2562  C  CG    . ASP B 2  144 ? 29.476  17.361  49.750 1.00 76.33  ? 145 ASP A CG    1 
ATOM   2563  O  OD1   . ASP B 2  144 ? 29.368  16.168  49.404 1.00 76.50  ? 145 ASP A OD1   1 
ATOM   2564  O  OD2   . ASP B 2  144 ? 30.529  17.842  50.227 1.00 78.63  ? 145 ASP A OD2   1 
ATOM   2565  N  N     . PHE B 2  145 ? 24.965  18.178  49.140 1.00 74.28  ? 146 PHE A N     1 
ATOM   2566  C  CA    . PHE B 2  145 ? 23.764  18.982  49.322 1.00 66.26  ? 146 PHE A CA    1 
ATOM   2567  C  C     . PHE B 2  145 ? 23.790  19.656  50.699 1.00 76.55  ? 146 PHE A C     1 
ATOM   2568  O  O     . PHE B 2  145 ? 24.466  19.202  51.626 1.00 82.52  ? 146 PHE A O     1 
ATOM   2569  C  CB    . PHE B 2  145 ? 22.508  18.123  49.175 1.00 67.32  ? 146 PHE A CB    1 
ATOM   2570  C  CG    . PHE B 2  145 ? 22.099  17.872  47.742 1.00 80.60  ? 146 PHE A CG    1 
ATOM   2571  C  CD1   . PHE B 2  145 ? 22.674  16.852  46.993 1.00 94.84  ? 146 PHE A CD1   1 
ATOM   2572  C  CD2   . PHE B 2  145 ? 21.135  18.663  47.140 1.00 73.75  ? 146 PHE A CD2   1 
ATOM   2573  C  CE1   . PHE B 2  145 ? 22.286  16.633  45.676 1.00 91.46  ? 146 PHE A CE1   1 
ATOM   2574  C  CE2   . PHE B 2  145 ? 20.746  18.452  45.829 1.00 68.72  ? 146 PHE A CE2   1 
ATOM   2575  C  CZ    . PHE B 2  145 ? 21.321  17.438  45.094 1.00 74.74  ? 146 PHE A CZ    1 
ATOM   2576  N  N     . ILE B 2  146 ? 23.060  20.770  50.829 1.00 82.33  ? 147 ILE A N     1 
ATOM   2577  C  CA    . ILE B 2  146 ? 22.955  21.474  52.104 1.00 76.83  ? 147 ILE A CA    1 
ATOM   2578  C  C     . ILE B 2  146 ? 21.491  21.792  52.359 1.00 79.10  ? 147 ILE A C     1 
ATOM   2579  O  O     . ILE B 2  146 ? 20.668  21.813  51.441 1.00 71.08  ? 147 ILE A O     1 
ATOM   2580  C  CB    . ILE B 2  146 ? 23.808  22.766  52.155 1.00 64.44  ? 147 ILE A CB    1 
ATOM   2581  C  CG1   . ILE B 2  146 ? 23.360  23.765  51.076 1.00 62.12  ? 147 ILE A CG1   1 
ATOM   2582  C  CG2   . ILE B 2  146 ? 25.317  22.442  52.021 1.00 59.23  ? 147 ILE A CG2   1 
ATOM   2583  C  CD1   . ILE B 2  146 ? 24.081  25.106  51.108 1.00 72.97  ? 147 ILE A CD1   1 
ATOM   2584  N  N     . ASP B 2  147 ? 21.174  22.014  53.637 1.00 80.61  ? 148 ASP A N     1 
ATOM   2585  C  CA    . ASP B 2  147 ? 19.861  22.522  54.031 1.00 80.57  ? 148 ASP A CA    1 
ATOM   2586  C  C     . ASP B 2  147 ? 19.637  23.921  53.473 1.00 75.75  ? 148 ASP A C     1 
ATOM   2587  O  O     . ASP B 2  147 ? 20.573  24.707  53.319 1.00 70.75  ? 148 ASP A O     1 
ATOM   2588  C  CB    . ASP B 2  147 ? 19.749  22.582  55.549 1.00 88.96  ? 148 ASP A CB    1 
ATOM   2589  C  CG    . ASP B 2  147 ? 19.424  21.241  56.173 1.00 91.81  ? 148 ASP A CG    1 
ATOM   2590  O  OD1   . ASP B 2  147 ? 19.075  20.296  55.429 1.00 91.45  ? 148 ASP A OD1   1 
ATOM   2591  O  OD2   . ASP B 2  147 ? 19.487  21.146  57.421 1.00 101.73 ? 148 ASP A OD2   1 
ATOM   2592  N  N     . ASN B 2  148 ? 18.373  24.262  53.184 1.00 73.03  ? 149 ASN A N     1 
ATOM   2593  C  CA    . ASN B 2  148 ? 18.058  25.607  52.702 1.00 78.76  ? 149 ASN A CA    1 
ATOM   2594  C  C     . ASN B 2  148 ? 17.851  26.547  53.893 1.00 90.38  ? 149 ASN A C     1 
ATOM   2595  O  O     . ASN B 2  148 ? 18.166  26.206  55.037 1.00 85.30  ? 149 ASN A O     1 
ATOM   2596  C  CB    . ASN B 2  148 ? 16.849  25.572  51.774 1.00 73.19  ? 149 ASN A CB    1 
ATOM   2597  C  CG    . ASN B 2  148 ? 15.564  25.284  52.517 1.00 76.39  ? 149 ASN A CG    1 
ATOM   2598  O  OD1   . ASN B 2  148 ? 15.590  24.780  53.637 1.00 78.81  ? 149 ASN A OD1   1 
ATOM   2599  N  ND2   . ASN B 2  148 ? 14.429  25.591  51.896 1.00 78.58  ? 149 ASN A ND2   1 
ATOM   2600  N  N     . TYR B 2  149 ? 17.288  27.739  53.653 1.00 92.45  ? 150 TYR A N     1 
ATOM   2601  C  CA    . TYR B 2  149 ? 17.247  28.749  54.713 1.00 82.08  ? 150 TYR A CA    1 
ATOM   2602  C  C     . TYR B 2  149 ? 16.327  28.350  55.866 1.00 82.82  ? 150 TYR A C     1 
ATOM   2603  O  O     . TYR B 2  149 ? 16.674  28.573  57.033 1.00 89.14  ? 150 TYR A O     1 
ATOM   2604  C  CB    . TYR B 2  149 ? 16.861  30.116  54.145 1.00 87.35  ? 150 TYR A CB    1 
ATOM   2605  C  CG    . TYR B 2  149 ? 15.495  30.196  53.530 1.00 79.85  ? 150 TYR A CG    1 
ATOM   2606  C  CD1   . TYR B 2  149 ? 15.260  29.695  52.264 1.00 80.39  ? 150 TYR A CD1   1 
ATOM   2607  C  CD2   . TYR B 2  149 ? 14.456  30.824  54.195 1.00 88.17  ? 150 TYR A CD2   1 
ATOM   2608  C  CE1   . TYR B 2  149 ? 14.022  29.789  51.688 1.00 86.10  ? 150 TYR A CE1   1 
ATOM   2609  C  CE2   . TYR B 2  149 ? 13.213  30.925  53.629 1.00 89.82  ? 150 TYR A CE2   1 
ATOM   2610  C  CZ    . TYR B 2  149 ? 12.998  30.407  52.373 1.00 87.97  ? 150 TYR A CZ    1 
ATOM   2611  O  OH    . TYR B 2  149 ? 11.752  30.504  51.799 1.00 94.07  ? 150 TYR A OH    1 
ATOM   2612  N  N     . ASP B 2  150 ? 15.159  27.779  55.585 1.00 83.19  ? 151 ASP A N     1 
ATOM   2613  C  CA    . ASP B 2  150 ? 14.245  27.405  56.670 1.00 98.18  ? 151 ASP A CA    1 
ATOM   2614  C  C     . ASP B 2  150 ? 14.376  25.942  57.093 1.00 100.70 ? 151 ASP A C     1 
ATOM   2615  O  O     . ASP B 2  150 ? 13.711  25.519  58.054 1.00 98.89  ? 151 ASP A O     1 
ATOM   2616  C  CB    . ASP B 2  150 ? 12.790  27.708  56.295 1.00 99.85  ? 151 ASP A CB    1 
ATOM   2617  C  CG    . ASP B 2  150 ? 12.347  26.967  55.062 1.00 94.71  ? 151 ASP A CG    1 
ATOM   2618  O  OD1   . ASP B 2  150 ? 13.023  25.987  54.685 1.00 92.00  ? 151 ASP A OD1   1 
ATOM   2619  O  OD2   . ASP B 2  150 ? 11.331  27.360  54.459 1.00 98.91  ? 151 ASP A OD2   1 
ATOM   2620  N  N     . GLY B 2  151 ? 15.203  25.166  56.397 1.00 96.98  ? 152 GLY A N     1 
ATOM   2621  C  CA    . GLY B 2  151 ? 15.410  23.763  56.689 1.00 91.24  ? 152 GLY A CA    1 
ATOM   2622  C  C     . GLY B 2  151 ? 14.444  22.821  56.015 1.00 89.43  ? 152 GLY A C     1 
ATOM   2623  O  O     . GLY B 2  151 ? 14.613  21.601  56.138 1.00 96.09  ? 152 GLY A O     1 
ATOM   2624  N  N     . ASN B 2  152 ? 13.447  23.344  55.299 1.00 89.17  ? 153 ASN A N     1 
ATOM   2625  C  CA    . ASN B 2  152 ? 12.443  22.496  54.664 1.00 85.18  ? 153 ASN A CA    1 
ATOM   2626  C  C     . ASN B 2  152 ? 13.024  21.682  53.512 1.00 87.84  ? 153 ASN A C     1 
ATOM   2627  O  O     . ASN B 2  152 ? 12.619  20.530  53.306 1.00 105.94 ? 153 ASN A O     1 
ATOM   2628  C  CB    . ASN B 2  152 ? 11.273  23.351  54.181 1.00 89.77  ? 153 ASN A CB    1 
ATOM   2629  C  CG    . ASN B 2  152 ? 10.465  23.900  55.311 1.00 105.93 ? 153 ASN A CG    1 
ATOM   2630  O  OD1   . ASN B 2  152 ? 10.763  23.645  56.478 1.00 115.25 ? 153 ASN A OD1   1 
ATOM   2631  N  ND2   . ASN B 2  152 ? 9.425   24.666  54.978 1.00 112.38 ? 153 ASN A ND2   1 
ATOM   2632  N  N     . GLU B 2  153 ? 13.957  22.246  52.749 1.00 82.74  ? 154 GLU A N     1 
ATOM   2633  C  CA    . GLU B 2  153 ? 14.414  21.639  51.503 1.00 79.95  ? 154 GLU A CA    1 
ATOM   2634  C  C     . GLU B 2  153 ? 15.933  21.544  51.433 1.00 82.15  ? 154 GLU A C     1 
ATOM   2635  O  O     . GLU B 2  153 ? 16.655  22.213  52.169 1.00 99.60  ? 154 GLU A O     1 
ATOM   2636  C  CB    . GLU B 2  153 ? 13.900  22.426  50.287 1.00 74.88  ? 154 GLU A CB    1 
ATOM   2637  C  CG    . GLU B 2  153 ? 12.428  22.740  50.352 1.00 78.26  ? 154 GLU A CG    1 
ATOM   2638  C  CD    . GLU B 2  153 ? 11.601  21.752  49.558 1.00 100.49 ? 154 GLU A CD    1 
ATOM   2639  O  OE1   . GLU B 2  153 ? 12.188  20.778  49.028 1.00 111.36 ? 154 GLU A OE1   1 
ATOM   2640  O  OE2   . GLU B 2  153 ? 10.370  21.959  49.454 1.00 106.88 ? 154 GLU A OE2   1 
ATOM   2641  N  N     . ARG B 2  154 ? 16.406  20.716  50.503 1.00 72.52  ? 155 ARG A N     1 
ATOM   2642  C  CA    . ARG B 2  154 ? 17.828  20.529  50.262 1.00 75.45  ? 155 ARG A CA    1 
ATOM   2643  C  C     . ARG B 2  154 ? 18.209  21.231  48.963 1.00 79.59  ? 155 ARG A C     1 
ATOM   2644  O  O     . ARG B 2  154 ? 17.447  21.205  47.989 1.00 89.56  ? 155 ARG A O     1 
ATOM   2645  C  CB    . ARG B 2  154 ? 18.176  19.034  50.198 1.00 78.06  ? 155 ARG A CB    1 
ATOM   2646  C  CG    . ARG B 2  154 ? 17.853  18.264  51.483 1.00 81.11  ? 155 ARG A CG    1 
ATOM   2647  C  CD    . ARG B 2  154 ? 18.902  18.488  52.572 1.00 83.36  ? 155 ARG A CD    1 
ATOM   2648  N  NE    . ARG B 2  154 ? 20.091  17.669  52.362 1.00 89.22  ? 155 ARG A NE    1 
ATOM   2649  C  CZ    . ARG B 2  154 ? 21.194  17.743  53.101 1.00 91.13  ? 155 ARG A CZ    1 
ATOM   2650  N  NH1   . ARG B 2  154 ? 21.274  18.608  54.104 1.00 98.16  ? 155 ARG A NH1   1 
ATOM   2651  N  NH2   . ARG B 2  154 ? 22.226  16.954  52.833 1.00 91.01  ? 155 ARG A NH2   1 
ATOM   2652  N  N     . GLU B 2  155 ? 19.370  21.877  48.941 1.00 73.95  ? 156 GLU A N     1 
ATOM   2653  C  CA    . GLU B 2  155 ? 19.865  22.515  47.730 1.00 72.18  ? 156 GLU A CA    1 
ATOM   2654  C  C     . GLU B 2  155 ? 21.306  22.114  47.485 1.00 66.54  ? 156 GLU A C     1 
ATOM   2655  O  O     . GLU B 2  155 ? 21.999  21.673  48.412 1.00 65.45  ? 156 GLU A O     1 
ATOM   2656  C  CB    . GLU B 2  155 ? 19.717  24.052  47.786 1.00 86.72  ? 156 GLU A CB    1 
ATOM   2657  C  CG    . GLU B 2  155 ? 20.475  24.796  48.915 1.00 101.28 ? 156 GLU A CG    1 
ATOM   2658  C  CD    . GLU B 2  155 ? 20.461  26.329  48.772 1.00 112.16 ? 156 GLU A CD    1 
ATOM   2659  O  OE1   . GLU B 2  155 ? 20.353  27.025  49.806 1.00 111.71 ? 156 GLU A OE1   1 
ATOM   2660  O  OE2   . GLU B 2  155 ? 20.577  26.843  47.635 1.00 121.69 ? 156 GLU A OE2   1 
ATOM   2661  N  N     . PRO B 2  156 ? 21.777  22.200  46.233 1.00 63.02  ? 157 PRO A N     1 
ATOM   2662  C  CA    . PRO B 2  156 ? 23.165  21.842  45.907 1.00 61.81  ? 157 PRO A CA    1 
ATOM   2663  C  C     . PRO B 2  156 ? 24.146  22.902  46.399 1.00 63.52  ? 157 PRO A C     1 
ATOM   2664  O  O     . PRO B 2  156 ? 23.936  24.105  46.220 1.00 79.85  ? 157 PRO A O     1 
ATOM   2665  C  CB    . PRO B 2  156 ? 23.158  21.781  44.374 1.00 59.02  ? 157 PRO A CB    1 
ATOM   2666  C  CG    . PRO B 2  156 ? 22.038  22.673  43.977 1.00 59.94  ? 157 PRO A CG    1 
ATOM   2667  C  CD    . PRO B 2  156 ? 21.001  22.532  45.031 1.00 61.35  ? 157 PRO A CD    1 
ATOM   2668  N  N     . SER B 2  157 ? 25.266  22.446  46.963 1.00 57.99  ? 158 SER A N     1 
ATOM   2669  C  CA    . SER B 2  157 ? 26.281  23.393  47.399 1.00 58.44  ? 158 SER A CA    1 
ATOM   2670  C  C     . SER B 2  157 ? 27.086  23.931  46.224 1.00 62.01  ? 158 SER A C     1 
ATOM   2671  O  O     . SER B 2  157 ? 27.692  25.009  46.325 1.00 74.80  ? 158 SER A O     1 
ATOM   2672  C  CB    . SER B 2  157 ? 27.214  22.752  48.429 1.00 69.39  ? 158 SER A CB    1 
ATOM   2673  O  OG    . SER B 2  157 ? 28.061  21.785  47.826 1.00 67.99  ? 158 SER A OG    1 
ATOM   2674  N  N     . VAL B 2  158 ? 27.081  23.197  45.115 1.00 62.30  ? 159 VAL A N     1 
ATOM   2675  C  CA    . VAL B 2  158 ? 27.819  23.485  43.890 1.00 63.24  ? 159 VAL A CA    1 
ATOM   2676  C  C     . VAL B 2  158 ? 27.254  22.529  42.844 1.00 66.47  ? 159 VAL A C     1 
ATOM   2677  O  O     . VAL B 2  158 ? 26.810  21.427  43.190 1.00 63.28  ? 159 VAL A O     1 
ATOM   2678  C  CB    . VAL B 2  158 ? 29.334  23.290  44.109 1.00 52.21  ? 159 VAL A CB    1 
ATOM   2679  C  CG1   . VAL B 2  158 ? 29.654  21.838  44.318 1.00 51.92  ? 159 VAL A CG1   1 
ATOM   2680  C  CG2   . VAL B 2  158 ? 30.119  23.832  42.958 1.00 52.34  ? 159 VAL A CG2   1 
ATOM   2681  N  N     . LEU B 2  159 ? 27.217  22.943  41.551 1.00 60.37  ? 160 LEU A N     1 
ATOM   2682  C  CA    . LEU B 2  159 ? 26.730  22.045  40.507 1.00 54.41  ? 160 LEU A CA    1 
ATOM   2683  C  C     . LEU B 2  159 ? 27.864  21.197  39.947 1.00 54.60  ? 160 LEU A C     1 
ATOM   2684  O  O     . LEU B 2  159 ? 29.037  21.565  40.049 1.00 60.23  ? 160 LEU A O     1 
ATOM   2685  C  CB    . LEU B 2  159 ? 26.060  22.835  39.389 1.00 47.04  ? 160 LEU A CB    1 
ATOM   2686  C  CG    . LEU B 2  159 ? 24.880  23.738  39.731 1.00 54.62  ? 160 LEU A CG    1 
ATOM   2687  C  CD1   . LEU B 2  159 ? 24.191  24.175  38.461 1.00 61.01  ? 160 LEU A CD1   1 
ATOM   2688  C  CD2   . LEU B 2  159 ? 23.901  23.047  40.658 1.00 58.97  ? 160 LEU A CD2   1 
ATOM   2689  N  N     . PRO B 2  160 ? 27.547  20.048  39.338 1.00 56.04  ? 161 PRO A N     1 
ATOM   2690  C  CA    . PRO B 2  160 ? 28.610  19.254  38.696 1.00 56.51  ? 161 PRO A CA    1 
ATOM   2691  C  C     . PRO B 2  160 ? 29.421  20.027  37.665 1.00 59.14  ? 161 PRO A C     1 
ATOM   2692  O  O     . PRO B 2  160 ? 30.648  19.843  37.610 1.00 60.09  ? 161 PRO A O     1 
ATOM   2693  C  CB    . PRO B 2  160 ? 27.837  18.091  38.067 1.00 56.74  ? 161 PRO A CB    1 
ATOM   2694  C  CG    . PRO B 2  160 ? 26.630  17.944  38.927 1.00 60.05  ? 161 PRO A CG    1 
ATOM   2695  C  CD    . PRO B 2  160 ? 26.257  19.343  39.349 1.00 60.67  ? 161 PRO A CD    1 
ATOM   2696  N  N     . ALA B 2  161 ? 28.787  20.874  36.847 1.00 54.93  ? 162 ALA A N     1 
ATOM   2697  C  CA    . ALA B 2  161 ? 29.481  21.803  35.959 1.00 59.57  ? 162 ALA A CA    1 
ATOM   2698  C  C     . ALA B 2  161 ? 30.447  21.068  35.023 1.00 69.27  ? 162 ALA A C     1 
ATOM   2699  O  O     . ALA B 2  161 ? 31.663  21.196  35.119 1.00 66.02  ? 162 ALA A O     1 
ATOM   2700  C  CB    . ALA B 2  161 ? 30.226  22.866  36.778 1.00 60.60  ? 162 ALA A CB    1 
ATOM   2701  N  N     . ARG B 2  162 ? 29.867  20.307  34.097 1.00 78.01  ? 163 ARG A N     1 
ATOM   2702  C  CA    . ARG B 2  162 ? 30.685  19.456  33.240 1.00 74.48  ? 163 ARG A CA    1 
ATOM   2703  C  C     . ARG B 2  162 ? 31.384  20.218  32.118 1.00 69.53  ? 163 ARG A C     1 
ATOM   2704  O  O     . ARG B 2  162 ? 32.067  19.589  31.304 1.00 67.83  ? 163 ARG A O     1 
ATOM   2705  C  CB    . ARG B 2  162 ? 29.839  18.298  32.691 1.00 62.90  ? 163 ARG A CB    1 
ATOM   2706  C  CG    . ARG B 2  162 ? 29.104  17.446  33.754 1.00 61.21  ? 163 ARG A CG    1 
ATOM   2707  C  CD    . ARG B 2  162 ? 30.044  16.923  34.811 1.00 63.79  ? 163 ARG A CD    1 
ATOM   2708  N  NE    . ARG B 2  162 ? 31.222  16.351  34.176 1.00 65.58  ? 163 ARG A NE    1 
ATOM   2709  C  CZ    . ARG B 2  162 ? 31.253  15.143  33.630 1.00 63.81  ? 163 ARG A CZ    1 
ATOM   2710  N  NH1   . ARG B 2  162 ? 30.179  14.366  33.664 1.00 59.94  ? 163 ARG A NH1   1 
ATOM   2711  N  NH2   . ARG B 2  162 ? 32.367  14.707  33.062 1.00 78.08  ? 163 ARG A NH2   1 
ATOM   2712  N  N     . PHE B 2  163 ? 31.266  21.551  32.069 1.00 59.33  ? 164 PHE A N     1 
ATOM   2713  C  CA    . PHE B 2  163 ? 32.145  22.419  31.295 1.00 63.59  ? 164 PHE A CA    1 
ATOM   2714  C  C     . PHE B 2  163 ? 32.613  23.588  32.156 1.00 65.29  ? 164 PHE A C     1 
ATOM   2715  O  O     . PHE B 2  163 ? 31.945  23.938  33.139 1.00 66.25  ? 164 PHE A O     1 
ATOM   2716  C  CB    . PHE B 2  163 ? 31.464  22.922  30.007 1.00 61.07  ? 164 PHE A CB    1 
ATOM   2717  C  CG    . PHE B 2  163 ? 30.324  23.873  30.234 1.00 60.49  ? 164 PHE A CG    1 
ATOM   2718  C  CD1   . PHE B 2  163 ? 29.039  23.415  30.411 1.00 50.52  ? 164 PHE A CD1   1 
ATOM   2719  C  CD2   . PHE B 2  163 ? 30.539  25.237  30.213 1.00 65.21  ? 164 PHE A CD2   1 
ATOM   2720  C  CE1   . PHE B 2  163 ? 28.000  24.297  30.594 1.00 57.12  ? 164 PHE A CE1   1 
ATOM   2721  C  CE2   . PHE B 2  163 ? 29.501  26.118  30.404 1.00 56.55  ? 164 PHE A CE2   1 
ATOM   2722  C  CZ    . PHE B 2  163 ? 28.234  25.652  30.590 1.00 50.93  ? 164 PHE A CZ    1 
ATOM   2723  N  N     . PRO B 2  164 ? 33.806  24.198  31.836 1.00 58.64  ? 165 PRO A N     1 
ATOM   2724  C  CA    . PRO B 2  164 ? 34.374  25.224  32.729 1.00 60.95  ? 165 PRO A CA    1 
ATOM   2725  C  C     . PRO B 2  164 ? 33.658  26.555  32.651 1.00 68.87  ? 165 PRO A C     1 
ATOM   2726  O  O     . PRO B 2  164 ? 34.080  27.500  31.974 1.00 62.73  ? 165 PRO A O     1 
ATOM   2727  C  CB    . PRO B 2  164 ? 35.827  25.345  32.254 1.00 51.16  ? 165 PRO A CB    1 
ATOM   2728  C  CG    . PRO B 2  164 ? 35.817  24.880  30.871 1.00 58.93  ? 165 PRO A CG    1 
ATOM   2729  C  CD    . PRO B 2  164 ? 34.719  23.866  30.737 1.00 60.28  ? 165 PRO A CD    1 
ATOM   2730  N  N     . ASN B 2  165 ? 32.572  26.630  33.399 1.00 64.90  ? 166 ASN A N     1 
ATOM   2731  C  CA    . ASN B 2  165 ? 31.639  27.730  33.256 1.00 50.02  ? 166 ASN A CA    1 
ATOM   2732  C  C     . ASN B 2  165 ? 32.124  29.026  33.902 1.00 60.68  ? 166 ASN A C     1 
ATOM   2733  O  O     . ASN B 2  165 ? 31.705  30.105  33.468 1.00 73.89  ? 166 ASN A O     1 
ATOM   2734  C  CB    . ASN B 2  165 ? 30.291  27.299  33.824 1.00 51.18  ? 166 ASN A CB    1 
ATOM   2735  C  CG    . ASN B 2  165 ? 29.277  28.387  33.777 1.00 56.37  ? 166 ASN A CG    1 
ATOM   2736  O  OD1   . ASN B 2  165 ? 28.942  28.879  32.721 1.00 50.29  ? 166 ASN A OD1   1 
ATOM   2737  N  ND2   . ASN B 2  165 ? 28.759  28.754  34.925 1.00 65.00  ? 166 ASN A ND2   1 
ATOM   2738  N  N     . LEU B 2  166 ? 32.973  28.967  34.937 1.00 66.98  ? 167 LEU A N     1 
ATOM   2739  C  CA    . LEU B 2  166 ? 33.495  30.208  35.500 1.00 58.42  ? 167 LEU A CA    1 
ATOM   2740  C  C     . LEU B 2  166 ? 34.113  31.051  34.404 1.00 51.51  ? 167 LEU A C     1 
ATOM   2741  O  O     . LEU B 2  166 ? 33.704  32.191  34.156 1.00 56.16  ? 167 LEU A O     1 
ATOM   2742  C  CB    . LEU B 2  166 ? 34.534  29.950  36.606 1.00 51.15  ? 167 LEU A CB    1 
ATOM   2743  C  CG    . LEU B 2  166 ? 35.153  31.271  37.100 1.00 47.48  ? 167 LEU A CG    1 
ATOM   2744  C  CD1   . LEU B 2  166 ? 34.147  32.037  37.928 1.00 55.98  ? 167 LEU A CD1   1 
ATOM   2745  C  CD2   . LEU B 2  166 ? 36.462  31.133  37.883 1.00 48.23  ? 167 LEU A CD2   1 
ATOM   2746  N  N     . LEU B 2  167 ? 35.061  30.459  33.684 1.00 52.57  ? 168 LEU A N     1 
ATOM   2747  C  CA    . LEU B 2  167 ? 35.770  31.184  32.634 1.00 52.71  ? 168 LEU A CA    1 
ATOM   2748  C  C     . LEU B 2  167 ? 34.926  31.347  31.368 1.00 56.53  ? 168 LEU A C     1 
ATOM   2749  O  O     . LEU B 2  167 ? 35.033  32.372  30.683 1.00 56.87  ? 168 LEU A O     1 
ATOM   2750  C  CB    . LEU B 2  167 ? 37.100  30.482  32.346 1.00 59.26  ? 168 LEU A CB    1 
ATOM   2751  C  CG    . LEU B 2  167 ? 38.139  30.566  33.472 1.00 64.23  ? 168 LEU A CG    1 
ATOM   2752  C  CD1   . LEU B 2  167 ? 39.349  29.759  33.144 1.00 79.62  ? 168 LEU A CD1   1 
ATOM   2753  C  CD2   . LEU B 2  167 ? 38.585  31.983  33.741 1.00 51.14  ? 168 LEU A CD2   1 
ATOM   2754  N  N     . ALA B 2  168 ? 34.072  30.368  31.044 1.00 49.98  ? 169 ALA A N     1 
ATOM   2755  C  CA    . ALA B 2  168 ? 33.329  30.439  29.782 1.00 50.63  ? 169 ALA A CA    1 
ATOM   2756  C  C     . ALA B 2  168 ? 32.364  31.618  29.756 1.00 54.71  ? 169 ALA A C     1 
ATOM   2757  O  O     . ALA B 2  168 ? 32.355  32.407  28.802 1.00 55.91  ? 169 ALA A O     1 
ATOM   2758  C  CB    . ALA B 2  168 ? 32.593  29.124  29.511 1.00 46.50  ? 169 ALA A CB    1 
ATOM   2759  N  N     . ASN B 2  169 ? 31.549  31.757  30.783 1.00 49.59  ? 170 ASN A N     1 
ATOM   2760  C  CA    . ASN B 2  169 ? 30.617  32.870  30.817 1.00 46.12  ? 170 ASN A CA    1 
ATOM   2761  C  C     . ASN B 2  169 ? 31.136  34.073  31.606 1.00 49.82  ? 170 ASN A C     1 
ATOM   2762  O  O     . ASN B 2  169 ? 30.526  35.144  31.532 1.00 57.97  ? 170 ASN A O     1 
ATOM   2763  C  CB    . ASN B 2  169 ? 29.273  32.408  31.376 1.00 44.78  ? 170 ASN A CB    1 
ATOM   2764  C  CG    . ASN B 2  169 ? 28.402  31.795  30.320 1.00 49.23  ? 170 ASN A CG    1 
ATOM   2765  O  OD1   . ASN B 2  169 ? 28.233  32.363  29.255 1.00 50.27  ? 170 ASN A OD1   1 
ATOM   2766  N  ND2   . ASN B 2  169 ? 27.858  30.618  30.601 1.00 53.36  ? 170 ASN A ND2   1 
ATOM   2767  N  N     . GLY B 2  170 ? 32.245  33.953  32.320 1.00 48.31  ? 171 GLY A N     1 
ATOM   2768  C  CA    . GLY B 2  170 ? 32.791  35.062  33.062 1.00 49.15  ? 171 GLY A CA    1 
ATOM   2769  C  C     . GLY B 2  170 ? 31.968  35.354  34.300 1.00 59.65  ? 171 GLY A C     1 
ATOM   2770  O  O     . GLY B 2  170 ? 30.964  34.709  34.591 1.00 64.76  ? 171 GLY A O     1 
ATOM   2771  N  N     . ALA B 2  171 ? 32.429  36.336  35.067 1.00 64.18  ? 172 ALA A N     1 
ATOM   2772  C  CA    . ALA B 2  171 ? 31.651  36.855  36.176 1.00 65.80  ? 172 ALA A CA    1 
ATOM   2773  C  C     . ALA B 2  171 ? 31.961  38.326  36.354 1.00 59.47  ? 172 ALA A C     1 
ATOM   2774  O  O     . ALA B 2  171 ? 33.054  38.790  36.030 1.00 63.35  ? 172 ALA A O     1 
ATOM   2775  C  CB    . ALA B 2  171 ? 31.936  36.126  37.495 1.00 70.80  ? 172 ALA A CB    1 
ATOM   2776  N  N     . SER B 2  172 ? 30.995  39.047  36.900 1.00 53.36  ? 173 SER A N     1 
ATOM   2777  C  CA    . SER B 2  172 ? 31.283  40.351  37.466 1.00 55.30  ? 173 SER A CA    1 
ATOM   2778  C  C     . SER B 2  172 ? 30.398  40.556  38.682 1.00 50.52  ? 173 SER A C     1 
ATOM   2779  O  O     . SER B 2  172 ? 29.183  40.367  38.610 1.00 54.44  ? 173 SER A O     1 
ATOM   2780  C  CB    . SER B 2  172 ? 31.104  41.472  36.430 1.00 62.25  ? 173 SER A CB    1 
ATOM   2781  O  OG    . SER B 2  172 ? 29.740  41.809  36.260 1.00 61.56  ? 173 SER A OG    1 
ATOM   2782  N  N     . GLY B 2  173 ? 31.027  40.919  39.797 1.00 49.25  ? 174 GLY A N     1 
ATOM   2783  C  CA    . GLY B 2  173 ? 30.326  41.164  41.041 1.00 50.18  ? 174 GLY A CA    1 
ATOM   2784  C  C     . GLY B 2  173 ? 30.973  42.210  41.924 1.00 52.93  ? 174 GLY A C     1 
ATOM   2785  O  O     . GLY B 2  173 ? 32.195  42.244  42.068 1.00 58.29  ? 174 GLY A O     1 
ATOM   2786  N  N     . ILE B 2  174 ? 30.166  43.076  42.514 1.00 50.18  ? 175 ILE A N     1 
ATOM   2787  C  CA    . ILE B 2  174 ? 30.629  43.991  43.548 1.00 51.46  ? 175 ILE A CA    1 
ATOM   2788  C  C     . ILE B 2  174 ? 30.303  43.365  44.897 1.00 61.56  ? 175 ILE A C     1 
ATOM   2789  O  O     . ILE B 2  174 ? 29.143  43.008  45.141 1.00 76.97  ? 175 ILE A O     1 
ATOM   2790  C  CB    . ILE B 2  174 ? 29.961  45.366  43.399 1.00 48.41  ? 175 ILE A CB    1 
ATOM   2791  C  CG1   . ILE B 2  174 ? 30.158  45.909  41.989 1.00 42.35  ? 175 ILE A CG1   1 
ATOM   2792  C  CG2   . ILE B 2  174 ? 30.556  46.332  44.366 1.00 63.92  ? 175 ILE A CG2   1 
ATOM   2793  C  CD1   . ILE B 2  174 ? 29.096  46.859  41.550 1.00 41.87  ? 175 ILE A CD1   1 
ATOM   2794  N  N     . ALA B 2  175 ? 31.292  43.243  45.773 1.00 54.01  ? 176 ALA A N     1 
ATOM   2795  C  CA    . ALA B 2  175 ? 31.051  42.623  47.092 1.00 53.03  ? 176 ALA A CA    1 
ATOM   2796  C  C     . ALA B 2  175 ? 31.170  43.673  48.178 1.00 58.55  ? 176 ALA A C     1 
ATOM   2797  O  O     . ALA B 2  175 ? 30.500  44.720  48.052 1.00 62.19  ? 176 ALA A O     1 
ATOM   2798  C  CB    . ALA B 2  175 ? 32.009  41.428  47.253 1.00 56.20  ? 176 ALA A CB    1 
ATOM   2799  N  N     . VAL B 2  176 ? 31.848  43.381  49.293 1.00 56.72  ? 177 VAL A N     1 
ATOM   2800  C  CA    . VAL B 2  176 ? 32.328  44.323  50.272 1.00 56.96  ? 177 VAL A CA    1 
ATOM   2801  C  C     . VAL B 2  176 ? 33.826  44.080  50.393 1.00 60.83  ? 177 VAL A C     1 
ATOM   2802  O  O     . VAL B 2  176 ? 34.263  42.929  50.510 1.00 62.95  ? 177 VAL A O     1 
ATOM   2803  C  CB    . VAL B 2  176 ? 31.629  44.117  51.629 1.00 57.20  ? 177 VAL A CB    1 
ATOM   2804  C  CG1   . VAL B 2  176 ? 32.173  45.058  52.679 1.00 58.53  ? 177 VAL A CG1   1 
ATOM   2805  C  CG2   . VAL B 2  176 ? 30.113  44.253  51.485 1.00 57.92  ? 177 VAL A CG2   1 
ATOM   2806  N  N     . GLY B 2  177 ? 34.620  45.153  50.318 1.00 61.20  ? 178 GLY A N     1 
ATOM   2807  C  CA    . GLY B 2  177 ? 36.058  45.040  50.434 1.00 61.22  ? 178 GLY A CA    1 
ATOM   2808  C  C     . GLY B 2  177 ? 36.765  44.476  49.231 1.00 63.05  ? 178 GLY A C     1 
ATOM   2809  O  O     . GLY B 2  177 ? 38.001  44.474  49.215 1.00 68.82  ? 178 GLY A O     1 
ATOM   2810  N  N     . MET B 2  178 ? 36.029  43.987  48.243 1.00 62.15  ? 179 MET A N     1 
ATOM   2811  C  CA    . MET B 2  178 ? 36.573  43.483  46.996 1.00 66.49  ? 179 MET A CA    1 
ATOM   2812  C  C     . MET B 2  178 ? 35.452  43.395  45.979 1.00 61.93  ? 179 MET A C     1 
ATOM   2813  O  O     . MET B 2  178 ? 34.271  43.528  46.300 1.00 57.57  ? 179 MET A O     1 
ATOM   2814  C  CB    . MET B 2  178 ? 37.234  42.121  47.183 1.00 70.63  ? 179 MET A CB    1 
ATOM   2815  C  CG    . MET B 2  178 ? 36.247  41.046  47.555 1.00 69.43  ? 179 MET A CG    1 
ATOM   2816  S  SD    . MET B 2  178 ? 37.167  39.832  48.503 1.00 80.25  ? 179 MET A SD    1 
ATOM   2817  C  CE    . MET B 2  178 ? 36.443  40.123  50.099 1.00 77.90  ? 179 MET A CE    1 
ATOM   2818  N  N     . ALA B 2  179 ? 35.850  43.133  44.751 1.00 66.81  ? 180 ALA A N     1 
ATOM   2819  C  CA    . ALA B 2  179 ? 34.928  42.883  43.663 1.00 49.83  ? 180 ALA A CA    1 
ATOM   2820  C  C     . ALA B 2  179 ? 35.567  41.828  42.768 1.00 51.91  ? 180 ALA A C     1 
ATOM   2821  O  O     . ALA B 2  179 ? 36.705  41.409  42.990 1.00 69.24  ? 180 ALA A O     1 
ATOM   2822  C  CB    . ALA B 2  179 ? 34.608  44.160  42.890 1.00 47.14  ? 180 ALA A CB    1 
ATOM   2823  N  N     . THR B 2  180 ? 34.854  41.439  41.721 1.00 49.77  ? 181 THR A N     1 
ATOM   2824  C  CA    . THR B 2  180 ? 35.419  40.513  40.756 1.00 45.76  ? 181 THR A CA    1 
ATOM   2825  C  C     . THR B 2  180 ? 34.997  40.895  39.346 1.00 51.61  ? 181 THR A C     1 
ATOM   2826  O  O     . THR B 2  180 ? 33.900  41.405  39.123 1.00 63.75  ? 181 THR A O     1 
ATOM   2827  C  CB    . THR B 2  180 ? 35.027  39.061  41.067 1.00 51.53  ? 181 THR A CB    1 
ATOM   2828  O  OG1   . THR B 2  180 ? 35.789  38.178  40.230 1.00 64.23  ? 181 THR A OG1   1 
ATOM   2829  C  CG2   . THR B 2  180 ? 33.546  38.832  40.811 1.00 42.76  ? 181 THR A CG2   1 
ATOM   2830  N  N     . ASN B 2  181 ? 35.893  40.639  38.395 1.00 49.81  ? 182 ASN A N     1 
ATOM   2831  C  CA    . ASN B 2  181 ? 35.595  40.907  36.994 1.00 46.09  ? 182 ASN A CA    1 
ATOM   2832  C  C     . ASN B 2  181 ? 36.393  39.914  36.149 1.00 52.23  ? 182 ASN A C     1 
ATOM   2833  O  O     . ASN B 2  181 ? 37.600  40.095  35.949 1.00 57.04  ? 182 ASN A O     1 
ATOM   2834  C  CB    . ASN B 2  181 ? 35.937  42.345  36.648 1.00 41.15  ? 182 ASN A CB    1 
ATOM   2835  C  CG    . ASN B 2  181 ? 35.124  42.887  35.502 1.00 42.24  ? 182 ASN A CG    1 
ATOM   2836  O  OD1   . ASN B 2  181 ? 33.964  42.501  35.299 1.00 49.45  ? 182 ASN A OD1   1 
ATOM   2837  N  ND2   . ASN B 2  181 ? 35.718  43.788  34.743 1.00 45.03  ? 182 ASN A ND2   1 
ATOM   2838  N  N     . ILE B 2  182 ? 35.721  38.857  35.697 1.00 51.15  ? 183 ILE A N     1 
ATOM   2839  C  CA    . ILE B 2  182 ? 36.294  37.785  34.896 1.00 44.34  ? 183 ILE A CA    1 
ATOM   2840  C  C     . ILE B 2  182 ? 35.636  37.807  33.523 1.00 47.91  ? 183 ILE A C     1 
ATOM   2841  O  O     . ILE B 2  182 ? 34.422  37.662  33.428 1.00 56.38  ? 183 ILE A O     1 
ATOM   2842  C  CB    . ILE B 2  182 ? 36.102  36.398  35.532 1.00 40.48  ? 183 ILE A CB    1 
ATOM   2843  C  CG1   . ILE B 2  182 ? 36.626  36.366  36.958 1.00 43.79  ? 183 ILE A CG1   1 
ATOM   2844  C  CG2   . ILE B 2  182 ? 36.839  35.354  34.752 1.00 35.24  ? 183 ILE A CG2   1 
ATOM   2845  C  CD1   . ILE B 2  182 ? 36.073  35.230  37.706 1.00 44.25  ? 183 ILE A CD1   1 
ATOM   2846  N  N     . PRO B 2  183 ? 36.389  37.928  32.437 1.00 46.78  ? 184 PRO A N     1 
ATOM   2847  C  CA    . PRO B 2  183 ? 35.769  37.987  31.125 1.00 45.72  ? 184 PRO A CA    1 
ATOM   2848  C  C     . PRO B 2  183 ? 35.411  36.601  30.607 1.00 49.27  ? 184 PRO A C     1 
ATOM   2849  O  O     . PRO B 2  183 ? 35.998  35.587  31.020 1.00 45.34  ? 184 PRO A O     1 
ATOM   2850  C  CB    . PRO B 2  183 ? 36.851  38.650  30.261 1.00 46.93  ? 184 PRO A CB    1 
ATOM   2851  C  CG    . PRO B 2  183 ? 38.104  38.225  30.890 1.00 48.24  ? 184 PRO A CG    1 
ATOM   2852  C  CD    . PRO B 2  183 ? 37.847  38.085  32.370 1.00 48.99  ? 184 PRO A CD    1 
ATOM   2853  N  N     . PRO B 2  184 ? 34.466  36.531  29.671 1.00 48.39  ? 185 PRO A N     1 
ATOM   2854  C  CA    . PRO B 2  184 ? 34.094  35.255  29.068 1.00 52.56  ? 185 PRO A CA    1 
ATOM   2855  C  C     . PRO B 2  184 ? 35.161  34.737  28.117 1.00 53.97  ? 185 PRO A C     1 
ATOM   2856  O  O     . PRO B 2  184 ? 36.056  35.457  27.674 1.00 64.00  ? 185 PRO A O     1 
ATOM   2857  C  CB    . PRO B 2  184 ? 32.816  35.598  28.311 1.00 50.24  ? 185 PRO A CB    1 
ATOM   2858  C  CG    . PRO B 2  184 ? 32.955  37.044  28.006 1.00 48.50  ? 185 PRO A CG    1 
ATOM   2859  C  CD    . PRO B 2  184 ? 33.622  37.629  29.198 1.00 44.30  ? 185 PRO A CD    1 
ATOM   2860  N  N     . HIS B 2  185 ? 35.018  33.459  27.772 1.00 52.79  ? 186 HIS A N     1 
ATOM   2861  C  CA    . HIS B 2  185 ? 36.031  32.770  26.999 1.00 55.02  ? 186 HIS A CA    1 
ATOM   2862  C  C     . HIS B 2  185 ? 35.363  31.858  25.986 1.00 59.35  ? 186 HIS A C     1 
ATOM   2863  O  O     . HIS B 2  185 ? 34.175  31.530  26.090 1.00 59.45  ? 186 HIS A O     1 
ATOM   2864  C  CB    . HIS B 2  185 ? 36.967  31.987  27.914 1.00 49.63  ? 186 HIS A CB    1 
ATOM   2865  C  CG    . HIS B 2  185 ? 37.919  32.861  28.662 1.00 58.37  ? 186 HIS A CG    1 
ATOM   2866  N  ND1   . HIS B 2  185 ? 37.585  33.514  29.832 1.00 58.80  ? 186 HIS A ND1   1 
ATOM   2867  C  CD2   . HIS B 2  185 ? 39.192  33.220  28.378 1.00 63.26  ? 186 HIS A CD2   1 
ATOM   2868  C  CE1   . HIS B 2  185 ? 38.621  34.226  30.240 1.00 59.13  ? 186 HIS A CE1   1 
ATOM   2869  N  NE2   . HIS B 2  185 ? 39.608  34.065  29.375 1.00 59.02  ? 186 HIS A NE2   1 
ATOM   2870  N  N     . ASN B 2  186 ? 36.140  31.483  24.977 1.00 54.68  ? 187 ASN A N     1 
ATOM   2871  C  CA    . ASN B 2  186 ? 35.698  30.503  23.999 1.00 52.64  ? 187 ASN A CA    1 
ATOM   2872  C  C     . ASN B 2  186 ? 35.757  29.103  24.600 1.00 59.64  ? 187 ASN A C     1 
ATOM   2873  O  O     . ASN B 2  186 ? 36.774  28.702  25.175 1.00 63.20  ? 187 ASN A O     1 
ATOM   2874  C  CB    . ASN B 2  186 ? 36.579  30.568  22.767 1.00 53.66  ? 187 ASN A CB    1 
ATOM   2875  C  CG    . ASN B 2  186 ? 36.124  29.633  21.702 1.00 61.48  ? 187 ASN A CG    1 
ATOM   2876  O  OD1   . ASN B 2  186 ? 36.493  28.466  21.691 1.00 72.22  ? 187 ASN A OD1   1 
ATOM   2877  N  ND2   . ASN B 2  186 ? 35.308  30.133  20.798 1.00 53.18  ? 187 ASN A ND2   1 
ATOM   2878  N  N     . LEU B 2  187 ? 34.672  28.341  24.434 1.00 52.41  ? 188 LEU A N     1 
ATOM   2879  C  CA    . LEU B 2  187 ? 34.598  27.037  25.085 1.00 49.63  ? 188 LEU A CA    1 
ATOM   2880  C  C     . LEU B 2  187 ? 35.523  26.015  24.439 1.00 54.01  ? 188 LEU A C     1 
ATOM   2881  O  O     . LEU B 2  187 ? 36.076  25.158  25.129 1.00 55.62  ? 188 LEU A O     1 
ATOM   2882  C  CB    . LEU B 2  187 ? 33.160  26.544  25.057 1.00 55.09  ? 188 LEU A CB    1 
ATOM   2883  C  CG    . LEU B 2  187 ? 32.741  25.230  25.696 1.00 47.83  ? 188 LEU A CG    1 
ATOM   2884  C  CD1   . LEU B 2  187 ? 32.850  25.353  27.186 1.00 38.14  ? 188 LEU A CD1   1 
ATOM   2885  C  CD2   . LEU B 2  187 ? 31.320  24.996  25.276 1.00 52.43  ? 188 LEU A CD2   1 
ATOM   2886  N  N     . THR B 2  188 ? 35.674  26.057  23.116 1.00 56.16  ? 189 THR A N     1 
ATOM   2887  C  CA    . THR B 2  188 ? 36.621  25.161  22.468 1.00 50.41  ? 189 THR A CA    1 
ATOM   2888  C  C     . THR B 2  188 ? 38.010  25.372  23.043 1.00 59.55  ? 189 THR A C     1 
ATOM   2889  O  O     . THR B 2  188 ? 38.707  24.418  23.397 1.00 64.07  ? 189 THR A O     1 
ATOM   2890  C  CB    . THR B 2  188 ? 36.640  25.381  20.953 1.00 48.51  ? 189 THR A CB    1 
ATOM   2891  O  OG1   . THR B 2  188 ? 35.311  25.358  20.434 1.00 56.58  ? 189 THR A OG1   1 
ATOM   2892  C  CG2   . THR B 2  188 ? 37.429  24.261  20.288 1.00 44.38  ? 189 THR A CG2   1 
ATOM   2893  N  N     . GLU B 2  189 ? 38.400  26.633  23.212 1.00 57.34  ? 190 GLU A N     1 
ATOM   2894  C  CA    . GLU B 2  189 ? 39.734  26.929  23.712 1.00 54.39  ? 190 GLU A CA    1 
ATOM   2895  C  C     . GLU B 2  189 ? 39.890  26.521  25.166 1.00 61.24  ? 190 GLU A C     1 
ATOM   2896  O  O     . GLU B 2  189 ? 40.912  25.938  25.535 1.00 71.63  ? 190 GLU A O     1 
ATOM   2897  C  CB    . GLU B 2  189 ? 40.038  28.408  23.510 1.00 51.65  ? 190 GLU A CB    1 
ATOM   2898  C  CG    . GLU B 2  189 ? 40.144  28.790  22.061 1.00 61.15  ? 190 GLU A CG    1 
ATOM   2899  C  CD    . GLU B 2  189 ? 40.539  30.236  21.861 1.00 73.24  ? 190 GLU A CD    1 
ATOM   2900  O  OE1   . GLU B 2  189 ? 40.936  30.894  22.847 1.00 60.93  ? 190 GLU A OE1   1 
ATOM   2901  O  OE2   . GLU B 2  189 ? 40.451  30.714  20.708 1.00 87.27  ? 190 GLU A OE2   1 
ATOM   2902  N  N     . LEU B 2  190 ? 38.902  26.818  26.005 1.00 63.76  ? 191 LEU A N     1 
ATOM   2903  C  CA    . LEU B 2  190 ? 39.019  26.460  27.417 1.00 68.41  ? 191 LEU A CA    1 
ATOM   2904  C  C     . LEU B 2  190 ? 39.189  24.970  27.594 1.00 60.97  ? 191 LEU A C     1 
ATOM   2905  O  O     . LEU B 2  190 ? 40.049  24.511  28.359 1.00 64.59  ? 191 LEU A O     1 
ATOM   2906  C  CB    . LEU B 2  190 ? 37.800  26.928  28.204 1.00 66.75  ? 191 LEU A CB    1 
ATOM   2907  C  CG    . LEU B 2  190 ? 37.606  28.402  28.451 1.00 59.30  ? 191 LEU A CG    1 
ATOM   2908  C  CD1   . LEU B 2  190 ? 36.278  28.561  29.125 1.00 62.07  ? 191 LEU A CD1   1 
ATOM   2909  C  CD2   . LEU B 2  190 ? 38.725  28.871  29.343 1.00 55.44  ? 191 LEU A CD2   1 
ATOM   2910  N  N     . ILE B 2  191 ? 38.348  24.199  26.917 1.00 47.67  ? 192 ILE A N     1 
ATOM   2911  C  CA    . ILE B 2  191 ? 38.414  22.753  27.064 1.00 53.61  ? 192 ILE A CA    1 
ATOM   2912  C  C     . ILE B 2  191 ? 39.743  22.225  26.546 1.00 59.20  ? 192 ILE A C     1 
ATOM   2913  O  O     . ILE B 2  191 ? 40.351  21.340  27.155 1.00 62.88  ? 192 ILE A O     1 
ATOM   2914  C  CB    . ILE B 2  191 ? 37.210  22.091  26.374 1.00 54.68  ? 192 ILE A CB    1 
ATOM   2915  C  CG1   . ILE B 2  191 ? 35.924  22.398  27.148 1.00 60.30  ? 192 ILE A CG1   1 
ATOM   2916  C  CG2   . ILE B 2  191 ? 37.404  20.606  26.280 1.00 48.94  ? 192 ILE A CG2   1 
ATOM   2917  C  CD1   . ILE B 2  191 ? 34.702  21.701  26.624 1.00 60.70  ? 192 ILE A CD1   1 
ATOM   2918  N  N     . ASN B 2  192 ? 40.232  22.768  25.436 1.00 59.80  ? 193 ASN A N     1 
ATOM   2919  C  CA    . ASN B 2  192 ? 41.559  22.370  24.973 1.00 59.23  ? 193 ASN A CA    1 
ATOM   2920  C  C     . ASN B 2  192 ? 42.614  22.691  26.021 1.00 60.37  ? 193 ASN A C     1 
ATOM   2921  O  O     . ASN B 2  192 ? 43.537  21.904  26.244 1.00 68.18  ? 193 ASN A O     1 
ATOM   2922  C  CB    . ASN B 2  192 ? 41.887  23.048  23.640 1.00 59.64  ? 193 ASN A CB    1 
ATOM   2923  C  CG    . ASN B 2  192 ? 41.153  22.428  22.484 1.00 58.90  ? 193 ASN A CG    1 
ATOM   2924  O  OD1   . ASN B 2  192 ? 40.700  21.294  22.574 1.00 60.54  ? 193 ASN A OD1   1 
ATOM   2925  N  ND2   . ASN B 2  192 ? 41.040  23.161  21.387 1.00 65.11  ? 193 ASN A ND2   1 
ATOM   2926  N  N     . GLY B 2  193 ? 42.472  23.831  26.692 1.00 58.53  ? 194 GLY A N     1 
ATOM   2927  C  CA    . GLY B 2  193 ? 43.349  24.141  27.806 1.00 64.49  ? 194 GLY A CA    1 
ATOM   2928  C  C     . GLY B 2  193 ? 43.280  23.108  28.914 1.00 70.50  ? 194 GLY A C     1 
ATOM   2929  O  O     . GLY B 2  193 ? 44.315  22.616  29.387 1.00 83.91  ? 194 GLY A O     1 
ATOM   2930  N  N     . VAL B 2  194 ? 42.059  22.760  29.347 1.00 55.68  ? 195 VAL A N     1 
ATOM   2931  C  CA    . VAL B 2  194 ? 41.933  21.790  30.428 1.00 52.09  ? 195 VAL A CA    1 
ATOM   2932  C  C     . VAL B 2  194 ? 42.554  20.458  30.039 1.00 55.98  ? 195 VAL A C     1 
ATOM   2933  O  O     . VAL B 2  194 ? 43.229  19.810  30.852 1.00 74.52  ? 195 VAL A O     1 
ATOM   2934  C  CB    . VAL B 2  194 ? 40.460  21.625  30.838 1.00 48.80  ? 195 VAL A CB    1 
ATOM   2935  C  CG1   . VAL B 2  194 ? 40.340  20.499  31.828 1.00 51.46  ? 195 VAL A CG1   1 
ATOM   2936  C  CG2   . VAL B 2  194 ? 39.938  22.887  31.457 1.00 50.90  ? 195 VAL A CG2   1 
ATOM   2937  N  N     . LEU B 2  195 ? 42.349  20.044  28.792 1.00 57.11  ? 196 LEU A N     1 
ATOM   2938  C  CA    . LEU B 2  195 ? 42.971  18.821  28.294 1.00 57.11  ? 196 LEU A CA    1 
ATOM   2939  C  C     . LEU B 2  195 ? 44.495  18.892  28.387 1.00 67.80  ? 196 LEU A C     1 
ATOM   2940  O  O     . LEU B 2  195 ? 45.147  17.975  28.904 1.00 85.62  ? 196 LEU A O     1 
ATOM   2941  C  CB    . LEU B 2  195 ? 42.518  18.560  26.854 1.00 57.86  ? 196 LEU A CB    1 
ATOM   2942  C  CG    . LEU B 2  195 ? 41.038  18.173  26.707 1.00 56.75  ? 196 LEU A CG    1 
ATOM   2943  C  CD1   . LEU B 2  195 ? 40.593  18.104  25.266 1.00 54.61  ? 196 LEU A CD1   1 
ATOM   2944  C  CD2   . LEU B 2  195 ? 40.793  16.845  27.367 1.00 61.80  ? 196 LEU A CD2   1 
ATOM   2945  N  N     . SER B 2  196 ? 45.082  19.983  27.894 1.00 63.75  ? 197 SER A N     1 
ATOM   2946  C  CA    . SER B 2  196 ? 46.531  20.149  27.976 1.00 62.93  ? 197 SER A CA    1 
ATOM   2947  C  C     . SER B 2  196 ? 47.030  20.061  29.417 1.00 64.14  ? 197 SER A C     1 
ATOM   2948  O  O     . SER B 2  196 ? 48.033  19.390  29.698 1.00 67.69  ? 197 SER A O     1 
ATOM   2949  C  CB    . SER B 2  196 ? 46.935  21.482  27.346 1.00 68.98  ? 197 SER A CB    1 
ATOM   2950  O  OG    . SER B 2  196 ? 46.609  21.498  25.969 1.00 76.87  ? 197 SER A OG    1 
ATOM   2951  N  N     . LEU B 2  197 ? 46.328  20.725  30.341 1.00 62.30  ? 198 LEU A N     1 
ATOM   2952  C  CA    . LEU B 2  197 ? 46.711  20.719  31.752 1.00 62.98  ? 198 LEU A CA    1 
ATOM   2953  C  C     . LEU B 2  197 ? 46.645  19.323  32.344 1.00 75.38  ? 198 LEU A C     1 
ATOM   2954  O  O     . LEU B 2  197 ? 47.486  18.948  33.174 1.00 87.45  ? 198 LEU A O     1 
ATOM   2955  C  CB    . LEU B 2  197 ? 45.796  21.650  32.539 1.00 56.23  ? 198 LEU A CB    1 
ATOM   2956  C  CG    . LEU B 2  197 ? 45.763  21.553  34.070 1.00 53.79  ? 198 LEU A CG    1 
ATOM   2957  C  CD1   . LEU B 2  197 ? 47.066  22.019  34.698 1.00 58.91  ? 198 LEU A CD1   1 
ATOM   2958  C  CD2   . LEU B 2  197 ? 44.632  22.391  34.587 1.00 49.22  ? 198 LEU A CD2   1 
ATOM   2959  N  N     . SER B 2  198 ? 45.621  18.558  31.960 1.00 74.08  ? 199 SER A N     1 
ATOM   2960  C  CA    . SER B 2  198 ? 45.434  17.205  32.463 1.00 76.79  ? 199 SER A CA    1 
ATOM   2961  C  C     . SER B 2  198 ? 46.542  16.279  32.003 1.00 77.50  ? 199 SER A C     1 
ATOM   2962  O  O     . SER B 2  198 ? 46.761  15.234  32.619 1.00 86.60  ? 199 SER A O     1 
ATOM   2963  C  CB    . SER B 2  198 ? 44.081  16.669  32.014 1.00 75.39  ? 199 SER A CB    1 
ATOM   2964  O  OG    . SER B 2  198 ? 44.155  16.149  30.696 1.00 75.53  ? 199 SER A OG    1 
ATOM   2965  N  N     . LYS B 2  199 ? 47.230  16.636  30.928 1.00 72.01  ? 200 LYS A N     1 
ATOM   2966  C  CA    . LYS B 2  199 ? 48.381  15.900  30.448 1.00 74.08  ? 200 LYS A CA    1 
ATOM   2967  C  C     . LYS B 2  199 ? 49.690  16.416  31.027 1.00 73.90  ? 200 LYS A C     1 
ATOM   2968  O  O     . LYS B 2  199 ? 50.711  15.733  30.886 1.00 80.93  ? 200 LYS A O     1 
ATOM   2969  C  CB    . LYS B 2  199 ? 48.431  15.956  28.921 1.00 78.96  ? 200 LYS A CB    1 
ATOM   2970  C  CG    . LYS B 2  199 ? 47.423  15.037  28.220 1.00 67.90  ? 200 LYS A CG    1 
ATOM   2971  C  CD    . LYS B 2  199 ? 47.125  15.513  26.792 1.00 74.89  ? 200 LYS A CD    1 
ATOM   2972  C  CE    . LYS B 2  199 ? 45.844  14.866  26.254 1.00 77.92  ? 200 LYS A CE    1 
ATOM   2973  N  NZ    . LYS B 2  199 ? 45.803  14.615  24.779 1.00 74.80  ? 200 LYS A NZ    1 
ATOM   2974  N  N     . ASN B 2  200 ? 49.695  17.590  31.675 1.00 74.96  ? 201 ASN A N     1 
ATOM   2975  C  CA    . ASN B 2  200 ? 50.943  18.163  32.166 1.00 77.32  ? 201 ASN A CA    1 
ATOM   2976  C  C     . ASN B 2  200 ? 50.690  19.077  33.356 1.00 84.69  ? 201 ASN A C     1 
ATOM   2977  O  O     . ASN B 2  200 ? 50.499  20.289  33.176 1.00 89.77  ? 201 ASN A O     1 
ATOM   2978  C  CB    . ASN B 2  200 ? 51.655  18.915  31.043 1.00 76.91  ? 201 ASN A CB    1 
ATOM   2979  C  CG    . ASN B 2  200 ? 52.882  19.664  31.526 1.00 84.63  ? 201 ASN A CG    1 
ATOM   2980  O  OD1   . ASN B 2  200 ? 53.343  19.480  32.650 1.00 85.29  ? 201 ASN A OD1   1 
ATOM   2981  N  ND2   . ASN B 2  200 ? 53.425  20.518  30.661 1.00 91.18  ? 201 ASN A ND2   1 
ATOM   2982  N  N     . PRO B 2  201 ? 50.748  18.549  34.581 1.00 74.45  ? 202 PRO A N     1 
ATOM   2983  C  CA    . PRO B 2  201 ? 50.524  19.393  35.770 1.00 74.49  ? 202 PRO A CA    1 
ATOM   2984  C  C     . PRO B 2  201 ? 51.451  20.584  35.858 1.00 87.53  ? 202 PRO A C     1 
ATOM   2985  O  O     . PRO B 2  201 ? 51.097  21.580  36.504 1.00 97.26  ? 202 PRO A O     1 
ATOM   2986  C  CB    . PRO B 2  201 ? 50.773  18.433  36.935 1.00 74.08  ? 202 PRO A CB    1 
ATOM   2987  C  CG    . PRO B 2  201 ? 50.598  17.074  36.362 1.00 73.66  ? 202 PRO A CG    1 
ATOM   2988  C  CD    . PRO B 2  201 ? 51.044  17.155  34.928 1.00 75.47  ? 202 PRO A CD    1 
ATOM   2989  N  N     . ASP B 2  202 ? 52.618  20.520  35.225 1.00 83.44  ? 203 ASP A N     1 
ATOM   2990  C  CA    . ASP B 2  202 ? 53.621  21.562  35.304 1.00 77.02  ? 203 ASP A CA    1 
ATOM   2991  C  C     . ASP B 2  202 ? 53.535  22.533  34.124 1.00 76.13  ? 203 ASP A C     1 
ATOM   2992  O  O     . ASP B 2  202 ? 54.444  23.344  33.936 1.00 79.11  ? 203 ASP A O     1 
ATOM   2993  C  CB    . ASP B 2  202 ? 55.014  20.924  35.400 1.00 80.11  ? 203 ASP A CB    1 
ATOM   2994  C  CG    . ASP B 2  202 ? 55.144  19.908  36.565 1.00 90.06  ? 203 ASP A CG    1 
ATOM   2995  O  OD1   . ASP B 2  202 ? 54.671  20.181  37.690 1.00 93.29  ? 203 ASP A OD1   1 
ATOM   2996  O  OD2   . ASP B 2  202 ? 55.736  18.825  36.348 1.00 88.03  ? 203 ASP A OD2   1 
ATOM   2997  N  N     . ILE B 2  203 ? 52.455  22.474  33.333 1.00 81.58  ? 204 ILE A N     1 
ATOM   2998  C  CA    . ILE B 2  203 ? 52.253  23.386  32.208 1.00 80.32  ? 204 ILE A CA    1 
ATOM   2999  C  C     . ILE B 2  203 ? 52.307  24.835  32.675 1.00 76.78  ? 204 ILE A C     1 
ATOM   3000  O  O     . ILE B 2  203 ? 51.787  25.186  33.739 1.00 77.75  ? 204 ILE A O     1 
ATOM   3001  C  CB    . ILE B 2  203 ? 50.922  23.061  31.505 1.00 69.60  ? 204 ILE A CB    1 
ATOM   3002  C  CG1   . ILE B 2  203 ? 50.830  23.791  30.162 1.00 64.04  ? 204 ILE A CG1   1 
ATOM   3003  C  CG2   . ILE B 2  203 ? 49.716  23.386  32.447 1.00 60.04  ? 204 ILE A CG2   1 
ATOM   3004  C  CD1   . ILE B 2  203 ? 49.769  23.252  29.222 1.00 63.46  ? 204 ILE A CD1   1 
ATOM   3005  N  N     . SER B 2  204 ? 52.947  25.690  31.872 1.00 76.01  ? 205 SER A N     1 
ATOM   3006  C  CA    . SER B 2  204 ? 53.063  27.109  32.161 1.00 72.42  ? 205 SER A CA    1 
ATOM   3007  C  C     . SER B 2  204 ? 51.902  27.895  31.555 1.00 71.35  ? 205 SER A C     1 
ATOM   3008  O  O     . SER B 2  204 ? 51.203  27.428  30.655 1.00 71.04  ? 205 SER A O     1 
ATOM   3009  C  CB    . SER B 2  204 ? 54.385  27.673  31.637 1.00 73.63  ? 205 SER A CB    1 
ATOM   3010  O  OG    . SER B 2  204 ? 54.415  27.677  30.215 1.00 71.05  ? 205 SER A OG    1 
ATOM   3011  N  N     . ILE B 2  205 ? 51.728  29.113  32.077 1.00 72.18  ? 206 ILE A N     1 
ATOM   3012  C  CA    . ILE B 2  205 ? 50.694  30.026  31.597 1.00 63.26  ? 206 ILE A CA    1 
ATOM   3013  C  C     . ILE B 2  205 ? 50.881  30.308  30.122 1.00 67.64  ? 206 ILE A C     1 
ATOM   3014  O  O     . ILE B 2  205 ? 49.923  30.324  29.345 1.00 68.19  ? 206 ILE A O     1 
ATOM   3015  C  CB    . ILE B 2  205 ? 50.743  31.331  32.408 1.00 68.23  ? 206 ILE A CB    1 
ATOM   3016  C  CG1   . ILE B 2  205 ? 50.463  31.042  33.870 1.00 66.98  ? 206 ILE A CG1   1 
ATOM   3017  C  CG2   . ILE B 2  205 ? 49.748  32.351  31.862 1.00 78.62  ? 206 ILE A CG2   1 
ATOM   3018  C  CD1   . ILE B 2  205 ? 49.028  31.020  34.171 1.00 72.21  ? 206 ILE A CD1   1 
ATOM   3019  N  N     . ALA B 2  206 ? 52.123  30.597  29.725 1.00 70.04  ? 207 ALA A N     1 
ATOM   3020  C  CA    . ALA B 2  206 ? 52.411  30.829  28.318 1.00 69.49  ? 207 ALA A CA    1 
ATOM   3021  C  C     . ALA B 2  206 ? 51.992  29.632  27.484 1.00 76.77  ? 207 ALA A C     1 
ATOM   3022  O  O     . ALA B 2  206 ? 51.372  29.786  26.427 1.00 82.36  ? 207 ALA A O     1 
ATOM   3023  C  CB    . ALA B 2  206 ? 53.897  31.117  28.146 1.00 82.45  ? 207 ALA A CB    1 
ATOM   3024  N  N     . GLU B 2  207 ? 52.310  28.426  27.962 1.00 78.77  ? 208 GLU A N     1 
ATOM   3025  C  CA    . GLU B 2  207 ? 51.904  27.206  27.273 1.00 79.41  ? 208 GLU A CA    1 
ATOM   3026  C  C     . GLU B 2  207 ? 50.391  27.084  27.226 1.00 74.89  ? 208 GLU A C     1 
ATOM   3027  O  O     . GLU B 2  207 ? 49.825  26.651  26.218 1.00 82.66  ? 208 GLU A O     1 
ATOM   3028  C  CB    . GLU B 2  207 ? 52.508  25.991  27.969 1.00 91.79  ? 208 GLU A CB    1 
ATOM   3029  C  CG    . GLU B 2  207 ? 53.971  25.757  27.687 1.00 103.89 ? 208 GLU A CG    1 
ATOM   3030  C  CD    . GLU B 2  207 ? 54.390  24.329  27.989 1.00 114.38 ? 208 GLU A CD    1 
ATOM   3031  O  OE1   . GLU B 2  207 ? 53.735  23.393  27.476 1.00 115.04 ? 208 GLU A OE1   1 
ATOM   3032  O  OE2   . GLU B 2  207 ? 55.367  24.144  28.748 1.00 122.23 ? 208 GLU A OE2   1 
ATOM   3033  N  N     . LEU B 2  208 ? 49.724  27.436  28.323 1.00 66.39  ? 209 LEU A N     1 
ATOM   3034  C  CA    . LEU B 2  208 ? 48.266  27.440  28.359 1.00 56.93  ? 209 LEU A CA    1 
ATOM   3035  C  C     . LEU B 2  208 ? 47.696  28.457  27.390 1.00 60.41  ? 209 LEU A C     1 
ATOM   3036  O  O     . LEU B 2  208 ? 46.656  28.222  26.765 1.00 62.17  ? 209 LEU A O     1 
ATOM   3037  C  CB    . LEU B 2  208 ? 47.784  27.738  29.774 1.00 54.30  ? 209 LEU A CB    1 
ATOM   3038  C  CG    . LEU B 2  208 ? 47.820  26.560  30.730 1.00 53.35  ? 209 LEU A CG    1 
ATOM   3039  C  CD1   . LEU B 2  208 ? 47.219  26.938  32.068 1.00 67.84  ? 209 LEU A CD1   1 
ATOM   3040  C  CD2   . LEU B 2  208 ? 47.066  25.411  30.110 1.00 53.13  ? 209 LEU A CD2   1 
ATOM   3041  N  N     . MET B 2  209 ? 48.355  29.604  27.266 1.00 65.58  ? 210 MET A N     1 
ATOM   3042  C  CA    . MET B 2  209 ? 47.891  30.651  26.369 1.00 68.68  ? 210 MET A CA    1 
ATOM   3043  C  C     . MET B 2  209 ? 47.925  30.219  24.920 1.00 67.48  ? 210 MET A C     1 
ATOM   3044  O  O     . MET B 2  209 ? 47.273  30.852  24.086 1.00 75.11  ? 210 MET A O     1 
ATOM   3045  C  CB    . MET B 2  209 ? 48.731  31.909  26.526 1.00 75.16  ? 210 MET A CB    1 
ATOM   3046  C  CG    . MET B 2  209 ? 48.153  32.926  27.473 1.00 63.44  ? 210 MET A CG    1 
ATOM   3047  S  SD    . MET B 2  209 ? 48.891  34.536  27.209 1.00 68.92  ? 210 MET A SD    1 
ATOM   3048  C  CE    . MET B 2  209 ? 48.148  35.002  25.652 1.00 69.27  ? 210 MET A CE    1 
ATOM   3049  N  N     . GLU B 2  210 ? 48.692  29.189  24.580 1.00 65.57  ? 211 GLU A N     1 
ATOM   3050  C  CA    . GLU B 2  210 ? 48.627  28.680  23.217 1.00 68.78  ? 211 GLU A CA    1 
ATOM   3051  C  C     . GLU B 2  210 ? 47.230  28.167  22.917 1.00 64.27  ? 211 GLU A C     1 
ATOM   3052  O  O     . GLU B 2  210 ? 46.646  28.470  21.871 1.00 69.83  ? 211 GLU A O     1 
ATOM   3053  C  CB    . GLU B 2  210 ? 49.665  27.583  23.007 1.00 74.02  ? 211 GLU A CB    1 
ATOM   3054  C  CG    . GLU B 2  210 ? 51.088  28.072  23.034 1.00 71.88  ? 211 GLU A CG    1 
ATOM   3055  C  CD    . GLU B 2  210 ? 52.073  26.946  22.805 1.00 88.70  ? 211 GLU A CD    1 
ATOM   3056  O  OE1   . GLU B 2  210 ? 53.288  27.164  22.998 1.00 90.58  ? 211 GLU A OE1   1 
ATOM   3057  O  OE2   . GLU B 2  210 ? 51.631  25.836  22.434 1.00 100.60 ? 211 GLU A OE2   1 
ATOM   3058  N  N     . ASP B 2  211 ? 46.659  27.424  23.863 1.00 63.54  ? 212 ASP A N     1 
ATOM   3059  C  CA    . ASP B 2  211 ? 45.299  26.924  23.725 1.00 68.72  ? 212 ASP A CA    1 
ATOM   3060  C  C     . ASP B 2  211 ? 44.278  28.032  23.941 1.00 61.79  ? 212 ASP A C     1 
ATOM   3061  O  O     . ASP B 2  211 ? 43.289  28.113  23.201 1.00 64.99  ? 212 ASP A O     1 
ATOM   3062  C  CB    . ASP B 2  211 ? 45.079  25.774  24.707 1.00 69.98  ? 212 ASP A CB    1 
ATOM   3063  C  CG    . ASP B 2  211 ? 45.855  24.537  24.332 1.00 80.94  ? 212 ASP A CG    1 
ATOM   3064  O  OD1   . ASP B 2  211 ? 45.719  24.086  23.175 1.00 80.86  ? 212 ASP A OD1   1 
ATOM   3065  O  OD2   . ASP B 2  211 ? 46.616  24.032  25.184 1.00 95.83  ? 212 ASP A OD2   1 
ATOM   3066  N  N     . ILE B 2  212 ? 44.488  28.894  24.929 1.00 56.99  ? 213 ILE A N     1 
ATOM   3067  C  CA    . ILE B 2  212 ? 43.532  29.952  25.259 1.00 65.84  ? 213 ILE A CA    1 
ATOM   3068  C  C     . ILE B 2  212 ? 44.143  31.297  24.890 1.00 67.86  ? 213 ILE A C     1 
ATOM   3069  O  O     . ILE B 2  212 ? 44.938  31.855  25.648 1.00 60.61  ? 213 ILE A O     1 
ATOM   3070  C  CB    . ILE B 2  212 ? 43.130  29.933  26.731 1.00 60.35  ? 213 ILE A CB    1 
ATOM   3071  C  CG1   . ILE B 2  212 ? 43.012  28.502  27.234 1.00 53.13  ? 213 ILE A CG1   1 
ATOM   3072  C  CG2   . ILE B 2  212 ? 41.829  30.685  26.909 1.00 65.09  ? 213 ILE A CG2   1 
ATOM   3073  C  CD1   . ILE B 2  212 ? 42.349  28.415  28.559 1.00 49.24  ? 213 ILE A CD1   1 
ATOM   3074  N  N     . GLU B 2  213 ? 43.698  31.868  23.772 1.00 61.38  ? 214 GLU A N     1 
ATOM   3075  C  CA    . GLU B 2  213 ? 44.306  33.092  23.259 1.00 56.56  ? 214 GLU A CA    1 
ATOM   3076  C  C     . GLU B 2  213 ? 43.953  34.311  24.098 1.00 57.31  ? 214 GLU A C     1 
ATOM   3077  O  O     . GLU B 2  213 ? 44.772  35.231  24.227 1.00 68.35  ? 214 GLU A O     1 
ATOM   3078  C  CB    . GLU B 2  213 ? 43.901  33.280  21.803 1.00 71.04  ? 214 GLU A CB    1 
ATOM   3079  C  CG    . GLU B 2  213 ? 44.448  32.170  20.931 1.00 94.27  ? 214 GLU A CG    1 
ATOM   3080  C  CD    . GLU B 2  213 ? 43.954  32.220  19.502 1.00 109.54 ? 214 GLU A CD    1 
ATOM   3081  O  OE1   . GLU B 2  213 ? 43.830  33.339  18.950 1.00 125.40 ? 214 GLU A OE1   1 
ATOM   3082  O  OE2   . GLU B 2  213 ? 43.686  31.133  18.937 1.00 108.01 ? 214 GLU A OE2   1 
ATOM   3083  N  N     . GLY B 2  214 ? 42.758  34.350  24.660 1.00 55.94  ? 215 GLY A N     1 
ATOM   3084  C  CA    . GLY B 2  214 ? 42.324  35.477  25.454 1.00 53.81  ? 215 GLY A CA    1 
ATOM   3085  C  C     . GLY B 2  214 ? 40.830  35.418  25.672 1.00 49.04  ? 215 GLY A C     1 
ATOM   3086  O  O     . GLY B 2  214 ? 40.223  34.362  25.507 1.00 62.99  ? 215 GLY A O     1 
ATOM   3087  N  N     . PRO B 2  215 ? 40.206  36.522  26.069 1.00 53.21  ? 216 PRO A N     1 
ATOM   3088  C  CA    . PRO B 2  215 ? 38.743  36.530  26.197 1.00 53.13  ? 216 PRO A CA    1 
ATOM   3089  C  C     . PRO B 2  215 ? 38.053  36.387  24.847 1.00 59.57  ? 216 PRO A C     1 
ATOM   3090  O  O     . PRO B 2  215 ? 38.611  36.650  23.780 1.00 63.65  ? 216 PRO A O     1 
ATOM   3091  C  CB    . PRO B 2  215 ? 38.436  37.895  26.818 1.00 48.61  ? 216 PRO A CB    1 
ATOM   3092  C  CG    . PRO B 2  215 ? 39.683  38.330  27.442 1.00 47.64  ? 216 PRO A CG    1 
ATOM   3093  C  CD    . PRO B 2  215 ? 40.830  37.679  26.729 1.00 49.95  ? 216 PRO A CD    1 
ATOM   3094  N  N     . ASP B 2  216 ? 36.787  35.987  24.918 1.00 52.70  ? 217 ASP A N     1 
ATOM   3095  C  CA    . ASP B 2  216 ? 35.939  35.856  23.738 1.00 55.02  ? 217 ASP A CA    1 
ATOM   3096  C  C     . ASP B 2  216 ? 34.561  36.375  24.136 1.00 56.99  ? 217 ASP A C     1 
ATOM   3097  O  O     . ASP B 2  216 ? 33.816  35.690  24.837 1.00 60.51  ? 217 ASP A O     1 
ATOM   3098  C  CB    . ASP B 2  216 ? 35.889  34.412  23.267 1.00 64.21  ? 217 ASP A CB    1 
ATOM   3099  C  CG    . ASP B 2  216 ? 35.340  34.265  21.869 1.00 67.84  ? 217 ASP A CG    1 
ATOM   3100  O  OD1   . ASP B 2  216 ? 35.104  35.293  21.212 1.00 67.37  ? 217 ASP A OD1   1 
ATOM   3101  O  OD2   . ASP B 2  216 ? 35.168  33.114  21.425 1.00 62.14  ? 217 ASP A OD2   1 
ATOM   3102  N  N     . PHE B 2  217 ? 34.236  37.562  23.709 1.00 53.38  ? 218 PHE A N     1 
ATOM   3103  C  CA    . PHE B 2  217 ? 33.001  38.179  24.162 1.00 51.03  ? 218 PHE A CA    1 
ATOM   3104  C  C     . PHE B 2  217 ? 31.848  37.821  23.235 1.00 50.65  ? 218 PHE A C     1 
ATOM   3105  O  O     . PHE B 2  217 ? 32.034  37.745  22.021 1.00 65.61  ? 218 PHE A O     1 
ATOM   3106  C  CB    . PHE B 2  217 ? 33.151  39.698  24.235 1.00 64.84  ? 218 PHE A CB    1 
ATOM   3107  C  CG    . PHE B 2  217 ? 34.319  40.146  25.060 1.00 56.96  ? 218 PHE A CG    1 
ATOM   3108  C  CD1   . PHE B 2  217 ? 34.266  40.114  26.441 1.00 57.27  ? 218 PHE A CD1   1 
ATOM   3109  C  CD2   . PHE B 2  217 ? 35.480  40.566  24.454 1.00 48.79  ? 218 PHE A CD2   1 
ATOM   3110  C  CE1   . PHE B 2  217 ? 35.344  40.506  27.196 1.00 44.43  ? 218 PHE A CE1   1 
ATOM   3111  C  CE2   . PHE B 2  217 ? 36.559  40.960  25.207 1.00 50.56  ? 218 PHE A CE2   1 
ATOM   3112  C  CZ    . PHE B 2  217 ? 36.490  40.928  26.576 1.00 49.05  ? 218 PHE A CZ    1 
ATOM   3113  N  N     . PRO B 2  218 ? 30.671  37.615  23.826 1.00 52.08  ? 219 PRO A N     1 
ATOM   3114  C  CA    . PRO B 2  218 ? 29.474  37.326  23.017 1.00 52.06  ? 219 PRO A CA    1 
ATOM   3115  C  C     . PRO B 2  218 ? 29.181  38.391  21.992 1.00 55.72  ? 219 PRO A C     1 
ATOM   3116  O  O     . PRO B 2  218 ? 28.423  38.138  21.047 1.00 64.25  ? 219 PRO A O     1 
ATOM   3117  C  CB    . PRO B 2  218 ? 28.357  37.256  24.065 1.00 51.95  ? 219 PRO A CB    1 
ATOM   3118  C  CG    . PRO B 2  218 ? 28.877  38.070  25.205 1.00 48.68  ? 219 PRO A CG    1 
ATOM   3119  C  CD    . PRO B 2  218 ? 30.339  37.795  25.249 1.00 47.93  ? 219 PRO A CD    1 
ATOM   3120  N  N     . THR B 2  219 ? 29.756  39.580  22.147 1.00 53.72  ? 220 THR A N     1 
ATOM   3121  C  CA    . THR B 2  219 ? 29.515  40.697  21.258 1.00 52.43  ? 220 THR A CA    1 
ATOM   3122  C  C     . THR B 2  219 ? 30.630  40.887  20.241 1.00 56.06  ? 220 THR A C     1 
ATOM   3123  O  O     . THR B 2  219 ? 30.686  41.949  19.616 1.00 57.33  ? 220 THR A O     1 
ATOM   3124  C  CB    . THR B 2  219 ? 29.348  41.977  22.071 1.00 53.17  ? 220 THR A CB    1 
ATOM   3125  O  OG1   . THR B 2  219 ? 30.493  42.125  22.919 1.00 51.94  ? 220 THR A OG1   1 
ATOM   3126  C  CG2   . THR B 2  219 ? 28.105  41.930  22.899 1.00 45.15  ? 220 THR A CG2   1 
ATOM   3127  N  N     . ALA B 2  220 ? 31.532  39.917  20.087 1.00 62.32  ? 221 ALA A N     1 
ATOM   3128  C  CA    . ALA B 2  220 ? 32.665  39.982  19.146 1.00 51.02  ? 221 ALA A CA    1 
ATOM   3129  C  C     . ALA B 2  220 ? 33.475  41.253  19.405 1.00 53.31  ? 221 ALA A C     1 
ATOM   3130  O  O     . ALA B 2  220 ? 33.788  41.552  20.566 1.00 62.76  ? 221 ALA A O     1 
ATOM   3131  C  CB    . ALA B 2  220 ? 32.134  39.830  17.722 1.00 46.85  ? 221 ALA A CB    1 
ATOM   3132  N  N     . GLY B 2  221 ? 33.823  42.019  18.386 1.00 57.13  ? 222 GLY A N     1 
ATOM   3133  C  CA    . GLY B 2  221 ? 34.675  43.175  18.547 1.00 52.89  ? 222 GLY A CA    1 
ATOM   3134  C  C     . GLY B 2  221 ? 36.121  42.763  18.418 1.00 62.41  ? 222 GLY A C     1 
ATOM   3135  O  O     . GLY B 2  221 ? 36.449  41.657  17.979 1.00 68.14  ? 222 GLY A O     1 
ATOM   3136  N  N     . LEU B 2  222 ? 37.005  43.660  18.835 1.00 64.11  ? 223 LEU A N     1 
ATOM   3137  C  CA    . LEU B 2  222 ? 38.432  43.399  18.768 1.00 63.69  ? 223 LEU A CA    1 
ATOM   3138  C  C     . LEU B 2  222 ? 39.095  43.708  20.096 1.00 57.05  ? 223 LEU A C     1 
ATOM   3139  O  O     . LEU B 2  222 ? 38.671  44.607  20.820 1.00 53.17  ? 223 LEU A O     1 
ATOM   3140  C  CB    . LEU B 2  222 ? 39.130  44.231  17.681 1.00 57.88  ? 223 LEU A CB    1 
ATOM   3141  C  CG    . LEU B 2  222 ? 38.620  44.252  16.250 1.00 66.47  ? 223 LEU A CG    1 
ATOM   3142  C  CD1   . LEU B 2  222 ? 37.434  45.179  16.129 1.00 93.58  ? 223 LEU A CD1   1 
ATOM   3143  C  CD2   . LEU B 2  222 ? 39.750  44.715  15.376 1.00 64.74  ? 223 LEU A CD2   1 
ATOM   3144  N  N     . ILE B 2  223 ? 40.153  42.969  20.403 1.00 57.81  ? 224 ILE A N     1 
ATOM   3145  C  CA    . ILE B 2  223 ? 41.014  43.267  21.536 1.00 56.28  ? 224 ILE A CA    1 
ATOM   3146  C  C     . ILE B 2  223 ? 42.353  43.736  20.980 1.00 63.68  ? 224 ILE A C     1 
ATOM   3147  O  O     . ILE B 2  223 ? 42.887  43.122  20.048 1.00 69.16  ? 224 ILE A O     1 
ATOM   3148  C  CB    . ILE B 2  223 ? 41.212  42.036  22.440 1.00 55.12  ? 224 ILE A CB    1 
ATOM   3149  C  CG1   . ILE B 2  223 ? 39.924  41.670  23.191 1.00 54.01  ? 224 ILE A CG1   1 
ATOM   3150  C  CG2   . ILE B 2  223 ? 42.366  42.258  23.399 1.00 57.71  ? 224 ILE A CG2   1 
ATOM   3151  C  CD1   . ILE B 2  223 ? 40.046  40.335  23.866 1.00 58.62  ? 224 ILE A CD1   1 
ATOM   3152  N  N     . LEU B 2  224 ? 42.924  44.783  21.573 1.00 69.97  ? 225 LEU A N     1 
ATOM   3153  C  CA    . LEU B 2  224 ? 44.182  45.354  21.083 1.00 65.93  ? 225 LEU A CA    1 
ATOM   3154  C  C     . LEU B 2  224 ? 45.361  44.833  21.888 1.00 63.97  ? 225 LEU A C     1 
ATOM   3155  O  O     . LEU B 2  224 ? 45.657  45.345  22.967 1.00 72.65  ? 225 LEU A O     1 
ATOM   3156  C  CB    . LEU B 2  224 ? 44.141  46.874  21.135 1.00 58.94  ? 225 LEU A CB    1 
ATOM   3157  C  CG    . LEU B 2  224 ? 43.160  47.495  20.162 1.00 69.09  ? 225 LEU A CG    1 
ATOM   3158  C  CD1   . LEU B 2  224 ? 42.975  48.943  20.532 1.00 64.19  ? 225 LEU A CD1   1 
ATOM   3159  C  CD2   . LEU B 2  224 ? 43.710  47.337  18.757 1.00 92.92  ? 225 LEU A CD2   1 
ATOM   3160  N  N     . GLY B 2  225 ? 46.095  43.882  21.326 1.00 64.23  ? 226 GLY A N     1 
ATOM   3161  C  CA    . GLY B 2  225 ? 47.323  43.427  21.939 1.00 70.85  ? 226 GLY A CA    1 
ATOM   3162  C  C     . GLY B 2  225 ? 47.112  42.270  22.892 1.00 76.87  ? 226 GLY A C     1 
ATOM   3163  O  O     . GLY B 2  225 ? 46.030  42.054  23.424 1.00 91.59  ? 226 GLY A O     1 
ATOM   3164  N  N     . LYS B 2  226 ? 48.180  41.495  23.074 1.00 78.07  ? 227 LYS A N     1 
ATOM   3165  C  CA    . LYS B 2  226 ? 48.158  40.347  23.965 1.00 74.94  ? 227 LYS A CA    1 
ATOM   3166  C  C     . LYS B 2  226 ? 48.817  40.647  25.294 1.00 78.36  ? 227 LYS A C     1 
ATOM   3167  O  O     . LYS B 2  226 ? 48.829  39.793  26.182 1.00 82.26  ? 227 LYS A O     1 
ATOM   3168  C  CB    . LYS B 2  226 ? 48.858  39.156  23.309 1.00 74.05  ? 227 LYS A CB    1 
ATOM   3169  C  CG    . LYS B 2  226 ? 48.655  39.084  21.819 1.00 87.54  ? 227 LYS A CG    1 
ATOM   3170  C  CD    . LYS B 2  226 ? 49.394  37.896  21.239 1.00 98.57  ? 227 LYS A CD    1 
ATOM   3171  N  N     . SER B 2  227 ? 49.366  41.842  25.445 1.00 88.00  ? 228 SER A N     1 
ATOM   3172  C  CA    . SER B 2  227 ? 50.119  42.146  26.647 1.00 82.58  ? 228 SER A CA    1 
ATOM   3173  C  C     . SER B 2  227 ? 49.192  42.366  27.837 1.00 86.30  ? 228 SER A C     1 
ATOM   3174  O  O     . SER B 2  227 ? 49.516  41.957  28.956 1.00 89.47  ? 228 SER A O     1 
ATOM   3175  C  CB    . SER B 2  227 ? 51.035  43.332  26.374 1.00 82.11  ? 228 SER A CB    1 
ATOM   3176  O  OG    . SER B 2  227 ? 50.557  44.512  26.988 1.00 89.71  ? 228 SER A OG    1 
ATOM   3177  N  N     . GLY B 2  228 ? 48.028  42.978  27.627 1.00 91.58  ? 229 GLY A N     1 
ATOM   3178  C  CA    . GLY B 2  228 ? 47.071  43.053  28.715 1.00 88.50  ? 229 GLY A CA    1 
ATOM   3179  C  C     . GLY B 2  228 ? 46.548  41.691  29.119 1.00 86.65  ? 229 GLY A C     1 
ATOM   3180  O  O     . GLY B 2  228 ? 46.332  41.429  30.308 1.00 81.98  ? 229 GLY A O     1 
ATOM   3181  N  N     . ILE B 2  229 ? 46.315  40.840  28.123 1.00 82.85  ? 230 ILE A N     1 
ATOM   3182  C  CA    . ILE B 2  229 ? 45.968  39.485  28.362 1.00 68.93  ? 230 ILE A CA    1 
ATOM   3183  C  C     . ILE B 2  229 ? 47.052  38.874  29.164 1.00 77.32  ? 230 ILE A C     1 
ATOM   3184  O  O     . ILE B 2  229 ? 46.806  38.380  30.266 1.00 69.09  ? 230 ILE A O     1 
ATOM   3185  C  CB    . ILE B 2  229 ? 45.606  38.772  27.054 1.00 61.66  ? 230 ILE A CB    1 
ATOM   3186  C  CG1   . ILE B 2  229 ? 44.368  39.433  26.458 1.00 66.02  ? 230 ILE A CG1   1 
ATOM   3187  C  CG2   . ILE B 2  229 ? 45.393  37.323  27.232 1.00 63.54  ? 230 ILE A CG2   1 
ATOM   3188  C  CD1   . ILE B 2  229 ? 44.076  38.993  25.052 1.00 60.76  ? 230 ILE A CD1   1 
ATOM   3189  N  N     . ARG B 2  230 ? 48.275  38.893  28.593 1.00 84.35  ? 231 ARG A N     1 
ATOM   3190  C  CA    . ARG B 2  230 ? 49.245  38.120  29.314 1.00 64.37  ? 231 ARG A CA    1 
ATOM   3191  C  C     . ARG B 2  230 ? 49.343  38.505  30.828 1.00 65.73  ? 231 ARG A C     1 
ATOM   3192  O  O     . ARG B 2  230 ? 49.494  37.612  31.660 1.00 63.16  ? 231 ARG A O     1 
ATOM   3193  C  CB    . ARG B 2  230 ? 50.561  38.228  28.576 1.00 70.84  ? 231 ARG A CB    1 
ATOM   3194  C  CG    . ARG B 2  230 ? 51.515  37.413  29.111 1.00 76.67  ? 231 ARG A CG    1 
ATOM   3195  C  CD    . ARG B 2  230 ? 52.707  37.549  28.196 1.00 88.16  ? 231 ARG A CD    1 
ATOM   3196  N  NE    . ARG B 2  230 ? 52.375  37.423  26.770 1.00 104.34 ? 231 ARG A NE    1 
ATOM   3197  C  CZ    . ARG B 2  230 ? 52.455  38.418  25.879 1.00 106.23 ? 231 ARG A CZ    1 
ATOM   3198  N  NH1   . ARG B 2  230 ? 52.850  39.638  26.258 1.00 97.03  ? 231 ARG A NH1   1 
ATOM   3199  N  NH2   . ARG B 2  230 ? 52.132  38.194  24.606 1.00 109.90 ? 231 ARG A NH2   1 
ATOM   3200  N  N     A ARG B 2  231 ? 49.216  39.756  31.216 0.50 66.39  ? 232 ARG A N     1 
ATOM   3201  N  N     B ARG B 2  231 ? 49.228  39.825  31.190 0.50 66.39  ? 232 ARG A N     1 
ATOM   3202  C  CA    A ARG B 2  231 ? 49.332  40.048  32.635 0.50 63.69  ? 232 ARG A CA    1 
ATOM   3203  C  CA    B ARG B 2  231 ? 49.248  40.320  32.587 0.50 65.95  ? 232 ARG A CA    1 
ATOM   3204  C  C     A ARG B 2  231 ? 48.125  39.523  33.412 0.50 59.93  ? 232 ARG A C     1 
ATOM   3205  C  C     B ARG B 2  231 ? 48.114  39.730  33.424 0.50 62.29  ? 232 ARG A C     1 
ATOM   3206  O  O     A ARG B 2  231 ? 48.281  38.959  34.500 0.50 52.74  ? 232 ARG A O     1 
ATOM   3207  O  O     B ARG B 2  231 ? 48.309  39.347  34.577 0.50 58.74  ? 232 ARG A O     1 
ATOM   3208  C  CB    A ARG B 2  231 ? 49.528  41.552  32.806 0.50 69.50  ? 232 ARG A CB    1 
ATOM   3209  C  CB    B ARG B 2  231 ? 49.125  41.848  32.523 0.50 72.35  ? 232 ARG A CB    1 
ATOM   3210  C  CG    A ARG B 2  231 ? 49.657  41.988  34.239 0.50 70.89  ? 232 ARG A CG    1 
ATOM   3211  C  CG    B ARG B 2  231 ? 49.692  42.809  33.696 0.50 69.97  ? 232 ARG A CG    1 
ATOM   3212  C  CD    A ARG B 2  231 ? 50.140  43.434  34.365 0.50 63.18  ? 232 ARG A CD    1 
ATOM   3213  C  CD    B ARG B 2  231 ? 49.683  44.321  33.259 0.50 64.87  ? 232 ARG A CD    1 
ATOM   3214  N  NE    A ARG B 2  231 ? 51.390  43.518  35.121 0.50 64.17  ? 232 ARG A NE    1 
ATOM   3215  N  NE    B ARG B 2  231 ? 50.733  44.608  32.274 0.50 70.55  ? 232 ARG A NE    1 
ATOM   3216  C  CZ    A ARG B 2  231 ? 52.600  43.607  34.576 0.50 68.58  ? 232 ARG A CZ    1 
ATOM   3217  C  CZ    B ARG B 2  231 ? 50.548  45.151  31.070 0.50 68.55  ? 232 ARG A CZ    1 
ATOM   3218  N  NH1   A ARG B 2  231 ? 52.739  43.638  33.257 0.50 65.66  ? 232 ARG A NH1   1 
ATOM   3219  N  NH1   B ARG B 2  231 ? 49.340  45.524  30.660 0.50 60.78  ? 232 ARG A NH1   1 
ATOM   3220  N  NH2   A ARG B 2  231 ? 53.672  43.666  35.356 0.50 68.80  ? 232 ARG A NH2   1 
ATOM   3221  N  NH2   B ARG B 2  231 ? 51.597  45.341  30.278 0.50 68.80  ? 232 ARG A NH2   1 
ATOM   3222  N  N     . ALA B 2  232 ? 46.917  39.637  32.840 1.00 67.17  ? 233 ALA A N     1 
ATOM   3223  C  CA    . ALA B 2  232 ? 45.729  39.136  33.537 1.00 67.82  ? 233 ALA A CA    1 
ATOM   3224  C  C     . ALA B 2  232 ? 45.819  37.640  33.801 1.00 66.99  ? 233 ALA A C     1 
ATOM   3225  O  O     . ALA B 2  232 ? 45.442  37.175  34.882 1.00 60.92  ? 233 ALA A O     1 
ATOM   3226  C  CB    . ALA B 2  232 ? 44.473  39.453  32.717 1.00 65.09  ? 233 ALA A CB    1 
ATOM   3227  N  N     . TYR B 2  233 ? 46.276  36.862  32.820 1.00 73.61  ? 234 TYR A N     1 
ATOM   3228  C  CA    . TYR B 2  233 ? 46.383  35.412  32.985 1.00 67.04  ? 234 TYR A CA    1 
ATOM   3229  C  C     . TYR B 2  233 ? 47.505  35.015  33.929 1.00 69.75  ? 234 TYR A C     1 
ATOM   3230  O  O     . TYR B 2  233 ? 47.393  34.002  34.627 1.00 67.18  ? 234 TYR A O     1 
ATOM   3231  C  CB    . TYR B 2  233 ? 46.598  34.743  31.626 1.00 73.71  ? 234 TYR A CB    1 
ATOM   3232  C  CG    . TYR B 2  233 ? 45.386  34.737  30.744 1.00 71.64  ? 234 TYR A CG    1 
ATOM   3233  C  CD1   . TYR B 2  233 ? 44.140  35.033  31.259 1.00 67.59  ? 234 TYR A CD1   1 
ATOM   3234  C  CD2   . TYR B 2  233 ? 45.488  34.433  29.394 1.00 59.76  ? 234 TYR A CD2   1 
ATOM   3235  C  CE1   . TYR B 2  233 ? 43.021  35.036  30.459 1.00 54.39  ? 234 TYR A CE1   1 
ATOM   3236  C  CE2   . TYR B 2  233 ? 44.366  34.429  28.586 1.00 54.88  ? 234 TYR A CE2   1 
ATOM   3237  C  CZ    . TYR B 2  233 ? 43.144  34.737  29.128 1.00 55.64  ? 234 TYR A CZ    1 
ATOM   3238  O  OH    . TYR B 2  233 ? 42.029  34.737  28.348 1.00 53.13  ? 234 TYR A OH    1 
ATOM   3239  N  N     A GLU B 2  234 ? 48.588  35.789  33.948 0.50 70.18  ? 235 GLU A N     1 
ATOM   3240  N  N     B GLU B 2  234 ? 48.608  35.771  33.946 0.50 70.23  ? 235 GLU A N     1 
ATOM   3241  C  CA    A GLU B 2  234 ? 49.730  35.502  34.810 0.50 66.98  ? 235 GLU A CA    1 
ATOM   3242  C  CA    B GLU B 2  234 ? 49.720  35.448  34.840 0.50 63.88  ? 235 GLU A CA    1 
ATOM   3243  C  C     A GLU B 2  234 ? 49.454  35.853  36.264 0.50 64.62  ? 235 GLU A C     1 
ATOM   3244  C  C     B GLU B 2  234 ? 49.433  35.826  36.284 0.50 63.43  ? 235 GLU A C     1 
ATOM   3245  O  O     A GLU B 2  234 ? 49.966  35.189  37.168 0.50 67.47  ? 235 GLU A O     1 
ATOM   3246  O  O     B GLU B 2  234 ? 49.960  35.192  37.200 0.50 68.10  ? 235 GLU A O     1 
ATOM   3247  C  CB    A GLU B 2  234 ? 50.965  36.274  34.336 0.50 63.64  ? 235 GLU A CB    1 
ATOM   3248  C  CB    B GLU B 2  234 ? 51.012  36.164  34.437 0.50 62.34  ? 235 GLU A CB    1 
ATOM   3249  C  CG    A GLU B 2  234 ? 51.364  36.050  32.878 0.50 62.81  ? 235 GLU A CG    1 
ATOM   3250  C  CG    B GLU B 2  234 ? 51.806  35.659  33.214 0.50 59.80  ? 235 GLU A CG    1 
ATOM   3251  C  CD    A GLU B 2  234 ? 52.609  36.808  32.423 0.50 72.53  ? 235 GLU A CD    1 
ATOM   3252  C  CD    B GLU B 2  234 ? 52.525  34.319  33.385 0.50 55.21  ? 235 GLU A CD    1 
ATOM   3253  O  OE1   A GLU B 2  234 ? 53.610  36.117  32.172 0.50 83.20  ? 235 GLU A OE1   1 
ATOM   3254  O  OE1   B GLU B 2  234 ? 52.661  33.797  34.515 0.50 56.05  ? 235 GLU A OE1   1 
ATOM   3255  O  OE2   A GLU B 2  234 ? 52.600  38.058  32.295 0.50 69.94  ? 235 GLU A OE2   1 
ATOM   3256  O  OE2   B GLU B 2  234 ? 52.970  33.787  32.345 0.50 52.61  ? 235 GLU A OE2   1 
ATOM   3257  N  N     . THR B 2  235 ? 48.658  36.889  36.515 1.00 56.17  ? 236 THR A N     1 
ATOM   3258  C  CA    . THR B 2  235 ? 48.499  37.430  37.859 1.00 57.00  ? 236 THR A CA    1 
ATOM   3259  C  C     . THR B 2  235 ? 47.074  37.532  38.394 1.00 56.01  ? 236 THR A C     1 
ATOM   3260  O  O     . THR B 2  235 ? 46.923  37.785  39.596 1.00 59.19  ? 236 THR A O     1 
ATOM   3261  C  CB    . THR B 2  235 ? 49.139  38.831  37.950 1.00 53.84  ? 236 THR A CB    1 
ATOM   3262  O  OG1   . THR B 2  235 ? 48.279  39.797  37.330 1.00 56.05  ? 236 THR A OG1   1 
ATOM   3263  C  CG2   . THR B 2  235 ? 50.533  38.878  37.322 1.00 55.51  ? 236 THR A CG2   1 
ATOM   3264  N  N     . GLY B 2  236 ? 46.041  37.380  37.569 1.00 57.14  ? 237 GLY A N     1 
ATOM   3265  C  CA    . GLY B 2  236 ? 44.679  37.666  37.991 1.00 59.02  ? 237 GLY A CA    1 
ATOM   3266  C  C     . GLY B 2  236 ? 44.202  39.076  37.708 1.00 61.41  ? 237 GLY A C     1 
ATOM   3267  O  O     . GLY B 2  236 ? 43.006  39.336  37.841 1.00 64.67  ? 237 GLY A O     1 
ATOM   3268  N  N     . ARG B 2  237 ? 45.100  39.983  37.308 1.00 57.50  ? 238 ARG A N     1 
ATOM   3269  C  CA    . ARG B 2  237 ? 44.779  41.393  37.152 1.00 57.57  ? 238 ARG A CA    1 
ATOM   3270  C  C     . ARG B 2  237 ? 45.421  41.953  35.899 1.00 62.05  ? 238 ARG A C     1 
ATOM   3271  O  O     . ARG B 2  237 ? 46.570  41.643  35.582 1.00 68.61  ? 238 ARG A O     1 
ATOM   3272  C  CB    . ARG B 2  237 ? 45.225  42.193  38.385 1.00 57.49  ? 238 ARG A CB    1 
ATOM   3273  C  CG    . ARG B 2  237 ? 44.315  41.942  39.555 1.00 56.38  ? 238 ARG A CG    1 
ATOM   3274  C  CD    . ARG B 2  237 ? 44.412  42.960  40.678 1.00 66.08  ? 238 ARG A CD    1 
ATOM   3275  N  NE    . ARG B 2  237 ? 43.311  42.697  41.604 1.00 96.24  ? 238 ARG A NE    1 
ATOM   3276  C  CZ    . ARG B 2  237 ? 43.330  42.886  42.923 1.00 110.32 ? 238 ARG A CZ    1 
ATOM   3277  N  NH1   . ARG B 2  237 ? 44.392  43.389  43.536 1.00 110.20 ? 238 ARG A NH1   1 
ATOM   3278  N  NH2   . ARG B 2  237 ? 42.254  42.579  43.629 1.00 104.88 ? 238 ARG A NH2   1 
ATOM   3279  N  N     . GLY B 2  238 ? 44.676  42.800  35.201 1.00 60.92  ? 239 GLY A N     1 
ATOM   3280  C  CA    . GLY B 2  238 ? 45.191  43.400  33.987 1.00 57.37  ? 239 GLY A CA    1 
ATOM   3281  C  C     . GLY B 2  238 ? 44.144  44.182  33.226 1.00 57.15  ? 239 GLY A C     1 
ATOM   3282  O  O     . GLY B 2  238 ? 42.950  43.901  33.341 1.00 55.33  ? 239 GLY A O     1 
ATOM   3283  N  N     . SER B 2  239 ? 44.565  45.180  32.467 1.00 57.13  ? 240 SER A N     1 
ATOM   3284  C  CA    . SER B 2  239 ? 43.636  45.974  31.681 1.00 60.14  ? 240 SER A CA    1 
ATOM   3285  C  C     . SER B 2  239 ? 43.684  45.505  30.237 1.00 65.37  ? 240 SER A C     1 
ATOM   3286  O  O     . SER B 2  239 ? 44.761  45.433  29.638 1.00 80.67  ? 240 SER A O     1 
ATOM   3287  C  CB    . SER B 2  239 ? 43.964  47.461  31.772 1.00 70.37  ? 240 SER A CB    1 
ATOM   3288  O  OG    . SER B 2  239 ? 42.992  48.197  31.063 1.00 78.51  ? 240 SER A OG    1 
ATOM   3289  N  N     . ILE B 2  240 ? 42.522  45.180  29.689 1.00 59.31  ? 241 ILE A N     1 
ATOM   3290  C  CA    . ILE B 2  240 ? 42.394  44.711  28.317 1.00 58.03  ? 241 ILE A CA    1 
ATOM   3291  C  C     . ILE B 2  240 ? 41.540  45.706  27.550 1.00 66.79  ? 241 ILE A C     1 
ATOM   3292  O  O     . ILE B 2  240 ? 40.448  46.063  28.001 1.00 68.92  ? 241 ILE A O     1 
ATOM   3293  C  CB    . ILE B 2  240 ? 41.771  43.309  28.255 1.00 56.05  ? 241 ILE A CB    1 
ATOM   3294  C  CG1   . ILE B 2  240 ? 42.691  42.291  28.919 1.00 56.62  ? 241 ILE A CG1   1 
ATOM   3295  C  CG2   . ILE B 2  240 ? 41.498  42.929  26.828 1.00 57.61  ? 241 ILE A CG2   1 
ATOM   3296  C  CD1   . ILE B 2  240 ? 42.126  40.913  28.913 1.00 55.24  ? 241 ILE A CD1   1 
ATOM   3297  N  N     . GLN B 2  241 ? 42.022  46.133  26.389 1.00 66.83  ? 242 GLN A N     1 
ATOM   3298  C  CA    . GLN B 2  241 ? 41.334  47.138  25.589 1.00 62.20  ? 242 GLN A CA    1 
ATOM   3299  C  C     . GLN B 2  241 ? 40.498  46.472  24.515 1.00 62.03  ? 242 GLN A C     1 
ATOM   3300  O  O     . GLN B 2  241 ? 41.022  45.720  23.687 1.00 78.01  ? 242 GLN A O     1 
ATOM   3301  C  CB    . GLN B 2  241 ? 42.321  48.115  24.953 1.00 67.48  ? 242 GLN A CB    1 
ATOM   3302  C  CG    . GLN B 2  241 ? 43.236  48.783  25.946 1.00 71.09  ? 242 GLN A CG    1 
ATOM   3303  C  CD    . GLN B 2  241 ? 42.564  49.912  26.690 1.00 77.44  ? 242 GLN A CD    1 
ATOM   3304  O  OE1   . GLN B 2  241 ? 41.747  50.647  26.128 1.00 77.99  ? 242 GLN A OE1   1 
ATOM   3305  N  NE2   . GLN B 2  241 ? 42.907  50.059  27.967 1.00 78.09  ? 242 GLN A NE2   1 
ATOM   3306  N  N     . MET B 2  242 ? 39.211  46.778  24.519 1.00 56.20  ? 243 MET A N     1 
ATOM   3307  C  CA    . MET B 2  242 ? 38.275  46.231  23.556 1.00 57.79  ? 243 MET A CA    1 
ATOM   3308  C  C     . MET B 2  242 ? 37.880  47.316  22.580 1.00 61.85  ? 243 MET A C     1 
ATOM   3309  O  O     . MET B 2  242 ? 37.568  48.443  22.976 1.00 58.96  ? 243 MET A O     1 
ATOM   3310  C  CB    . MET B 2  242 ? 37.018  45.682  24.220 1.00 58.58  ? 243 MET A CB    1 
ATOM   3311  C  CG    . MET B 2  242 ? 37.282  45.000  25.514 1.00 62.49  ? 243 MET A CG    1 
ATOM   3312  S  SD    . MET B 2  242 ? 35.735  44.553  26.295 1.00 61.67  ? 243 MET A SD    1 
ATOM   3313  C  CE    . MET B 2  242 ? 35.035  46.150  26.644 1.00 65.97  ? 243 MET A CE    1 
ATOM   3314  N  N     . ARG B 2  243 ? 37.889  46.967  21.318 1.00 68.25  ? 244 ARG A N     1 
ATOM   3315  C  CA    . ARG B 2  243 ? 37.474  47.913  20.317 1.00 59.66  ? 244 ARG A CA    1 
ATOM   3316  C  C     . ARG B 2  243 ? 36.197  47.448  19.654 1.00 58.72  ? 244 ARG A C     1 
ATOM   3317  O  O     . ARG B 2  243 ? 35.893  46.257  19.591 1.00 66.02  ? 244 ARG A O     1 
ATOM   3318  C  CB    . ARG B 2  243 ? 38.529  48.121  19.253 1.00 62.12  ? 244 ARG A CB    1 
ATOM   3319  C  CG    . ARG B 2  243 ? 38.847  49.560  19.034 1.00 68.85  ? 244 ARG A CG    1 
ATOM   3320  C  CD    . ARG B 2  243 ? 40.163  49.702  18.319 1.00 77.53  ? 244 ARG A CD    1 
ATOM   3321  N  NE    . ARG B 2  243 ? 40.839  50.931  18.712 1.00 76.29  ? 244 ARG A NE    1 
ATOM   3322  C  CZ    . ARG B 2  243 ? 41.965  51.367  18.162 1.00 81.50  ? 244 ARG A CZ    1 
ATOM   3323  N  NH1   . ARG B 2  243 ? 42.540  50.673  17.185 1.00 80.41  ? 244 ARG A NH1   1 
ATOM   3324  N  NH2   . ARG B 2  243 ? 42.516  52.495  18.587 1.00 85.72  ? 244 ARG A NH2   1 
ATOM   3325  N  N     . SER B 2  244 ? 35.440  48.439  19.233 1.00 53.02  ? 245 SER A N     1 
ATOM   3326  C  CA    . SER B 2  244 ? 34.323  48.237  18.340 1.00 56.04  ? 245 SER A CA    1 
ATOM   3327  C  C     . SER B 2  244 ? 34.870  47.815  16.988 1.00 54.29  ? 245 SER A C     1 
ATOM   3328  O  O     . SER B 2  244 ? 36.008  48.135  16.621 1.00 68.19  ? 245 SER A O     1 
ATOM   3329  C  CB    . SER B 2  244 ? 33.528  49.529  18.222 1.00 62.85  ? 245 SER A CB    1 
ATOM   3330  O  OG    . SER B 2  244 ? 33.183  49.991  19.519 1.00 85.45  ? 245 SER A OG    1 
ATOM   3331  N  N     . ARG B 2  245 ? 34.084  47.079  16.242 1.00 49.62  ? 246 ARG A N     1 
ATOM   3332  C  CA    . ARG B 2  245 ? 34.494  46.766  14.887 1.00 49.14  ? 246 ARG A CA    1 
ATOM   3333  C  C     . ARG B 2  245 ? 33.892  47.814  13.971 1.00 53.96  ? 246 ARG A C     1 
ATOM   3334  O  O     . ARG B 2  245 ? 32.666  47.918  13.865 1.00 53.27  ? 246 ARG A O     1 
ATOM   3335  C  CB    . ARG B 2  245 ? 34.084  45.368  14.451 1.00 51.92  ? 246 ARG A CB    1 
ATOM   3336  C  CG    . ARG B 2  245 ? 34.459  45.095  13.004 1.00 50.65  ? 246 ARG A CG    1 
ATOM   3337  C  CD    . ARG B 2  245 ? 34.291  43.639  12.674 1.00 49.88  ? 246 ARG A CD    1 
ATOM   3338  N  NE    . ARG B 2  245 ? 35.271  42.810  13.366 1.00 50.44  ? 246 ARG A NE    1 
ATOM   3339  C  CZ    . ARG B 2  245 ? 36.459  42.502  12.863 1.00 61.02  ? 246 ARG A CZ    1 
ATOM   3340  N  NH1   . ARG B 2  245 ? 36.808  42.961  11.666 1.00 65.43  ? 246 ARG A NH1   1 
ATOM   3341  N  NH2   . ARG B 2  245 ? 37.298  41.736  13.550 1.00 65.39  ? 246 ARG A NH2   1 
ATOM   3342  N  N     . ALA B 2  246 ? 34.745  48.599  13.330 1.00 72.50  ? 247 ALA A N     1 
ATOM   3343  C  CA    . ALA B 2  246 ? 34.274  49.687  12.494 1.00 64.23  ? 247 ALA A CA    1 
ATOM   3344  C  C     . ALA B 2  246 ? 35.143  49.797  11.255 1.00 53.43  ? 247 ALA A C     1 
ATOM   3345  O  O     . ALA B 2  246 ? 36.342  49.540  11.306 1.00 65.23  ? 247 ALA A O     1 
ATOM   3346  C  CB    . ALA B 2  246 ? 34.265  51.015  13.267 1.00 55.02  ? 247 ALA A CB    1 
ATOM   3347  N  N     . VAL B 2  247 ? 34.520  50.185  10.141 1.00 54.40  ? 248 VAL A N     1 
ATOM   3348  C  CA    . VAL B 2  247 ? 35.233  50.429  8.901  1.00 56.40  ? 248 VAL A CA    1 
ATOM   3349  C  C     . VAL B 2  247 ? 34.856  51.783  8.328  1.00 59.84  ? 248 VAL A C     1 
ATOM   3350  O  O     . VAL B 2  247 ? 33.863  52.404  8.712  1.00 64.48  ? 248 VAL A O     1 
ATOM   3351  C  CB    . VAL B 2  247 ? 34.974  49.357  7.817  1.00 52.32  ? 248 VAL A CB    1 
ATOM   3352  C  CG1   . VAL B 2  247 ? 35.556  48.031  8.210  1.00 63.54  ? 248 VAL A CG1   1 
ATOM   3353  C  CG2   . VAL B 2  247 ? 33.485  49.257  7.497  1.00 50.97  ? 248 VAL A CG2   1 
ATOM   3354  N  N     . ILE B 2  248 ? 35.645  52.202  7.341  1.00 58.92  ? 249 ILE A N     1 
ATOM   3355  C  CA    . ILE B 2  248 ? 35.397  53.411  6.582  1.00 59.77  ? 249 ILE A CA    1 
ATOM   3356  C  C     . ILE B 2  248 ? 35.010  53.001  5.164  1.00 59.70  ? 249 ILE A C     1 
ATOM   3357  O  O     . ILE B 2  248 ? 35.695  52.178  4.538  1.00 78.09  ? 249 ILE A O     1 
ATOM   3358  C  CB    . ILE B 2  248 ? 36.637  54.319  6.583  1.00 61.73  ? 249 ILE A CB    1 
ATOM   3359  C  CG1   . ILE B 2  248 ? 36.905  54.817  8.008  1.00 70.67  ? 249 ILE A CG1   1 
ATOM   3360  C  CG2   . ILE B 2  248 ? 36.422  55.495  5.694  1.00 62.20  ? 249 ILE A CG2   1 
ATOM   3361  C  CD1   . ILE B 2  248 ? 38.264  55.437  8.212  1.00 72.80  ? 249 ILE A CD1   1 
ATOM   3362  N  N     . GLU B 2  249 ? 33.896  53.548  4.661  1.00 57.59  ? 250 GLU A N     1 
ATOM   3363  C  CA    . GLU B 2  249 ? 33.426  53.196  3.325  1.00 57.80  ? 250 GLU A CA    1 
ATOM   3364  C  C     . GLU B 2  249 ? 32.863  54.427  2.618  1.00 62.09  ? 250 GLU A C     1 
ATOM   3365  O  O     . GLU B 2  249 ? 32.413  55.383  3.257  1.00 61.72  ? 250 GLU A O     1 
ATOM   3366  C  CB    . GLU B 2  249 ? 32.385  52.055  3.363  1.00 58.78  ? 250 GLU A CB    1 
ATOM   3367  C  CG    . GLU B 2  249 ? 30.974  52.450  3.779  1.00 62.50  ? 250 GLU A CG    1 
ATOM   3368  C  CD    . GLU B 2  249 ? 30.050  51.241  3.909  1.00 75.25  ? 250 GLU A CD    1 
ATOM   3369  O  OE1   . GLU B 2  249 ? 30.539  50.097  3.768  1.00 89.08  ? 250 GLU A OE1   1 
ATOM   3370  O  OE2   . GLU B 2  249 ? 28.840  51.428  4.163  1.00 73.13  ? 250 GLU A OE2   1 
ATOM   3371  N  N     . GLU B 2  250 ? 32.896  54.375  1.279  1.00 61.00  ? 251 GLU A N     1 
ATOM   3372  C  CA    . GLU B 2  250 ? 32.345  55.427  0.431  1.00 63.62  ? 251 GLU A CA    1 
ATOM   3373  C  C     . GLU B 2  250 ? 30.819  55.373  0.437  1.00 68.46  ? 251 GLU A C     1 
ATOM   3374  O  O     . GLU B 2  250 ? 30.210  54.303  0.529  1.00 73.71  ? 251 GLU A O     1 
ATOM   3375  C  CB    . GLU B 2  250 ? 32.854  55.265  -0.997 1.00 65.40  ? 251 GLU A CB    1 
ATOM   3376  C  CG    . GLU B 2  250 ? 32.302  54.039  -1.682 1.00 86.23  ? 251 GLU A CG    1 
ATOM   3377  C  CD    . GLU B 2  250 ? 33.148  53.589  -2.839 1.00 95.99  ? 251 GLU A CD    1 
ATOM   3378  O  OE1   . GLU B 2  250 ? 32.712  53.782  -3.990 1.00 96.44  ? 251 GLU A OE1   1 
ATOM   3379  O  OE2   . GLU B 2  250 ? 34.250  53.048  -2.591 1.00 103.26 ? 251 GLU A OE2   1 
ATOM   3380  N  N     . ARG B 2  251 ? 30.192  56.546  0.354  1.00 74.55  ? 252 ARG A N     1 
ATOM   3381  C  CA    . ARG B 2  251 ? 28.737  56.631  0.309  1.00 83.33  ? 252 ARG A CA    1 
ATOM   3382  C  C     . ARG B 2  251 ? 28.235  57.372  -0.918 1.00 88.45  ? 252 ARG A C     1 
ATOM   3383  O  O     . ARG B 2  251 ? 27.019  57.585  -1.042 1.00 82.99  ? 252 ARG A O     1 
ATOM   3384  C  CB    . ARG B 2  251 ? 28.195  57.288  1.583  1.00 79.76  ? 252 ARG A CB    1 
ATOM   3385  C  CG    . ARG B 2  251 ? 28.706  58.694  1.871  1.00 74.33  ? 252 ARG A CG    1 
ATOM   3386  C  CD    . ARG B 2  251 ? 28.026  59.234  3.126  1.00 73.97  ? 252 ARG A CD    1 
ATOM   3387  N  NE    . ARG B 2  251 ? 28.715  60.386  3.692  1.00 78.19  ? 252 ARG A NE    1 
ATOM   3388  C  CZ    . ARG B 2  251 ? 28.223  61.620  3.707  1.00 90.69  ? 252 ARG A CZ    1 
ATOM   3389  N  NH1   . ARG B 2  251 ? 28.928  62.611  4.241  1.00 88.67  ? 252 ARG A NH1   1 
ATOM   3390  N  NH2   . ARG B 2  251 ? 27.025  61.863  3.193  1.00 105.00 ? 252 ARG A NH2   1 
ATOM   3391  N  N     . GLY B 2  252 ? 29.121  57.745  -1.829 1.00 90.42  ? 253 GLY A N     1 
ATOM   3392  C  CA    . GLY B 2  252 ? 28.803  58.435  -3.058 1.00 90.79  ? 253 GLY A CA    1 
ATOM   3393  C  C     . GLY B 2  252 ? 29.171  59.907  -2.993 1.00 88.69  ? 253 GLY A C     1 
ATOM   3394  O  O     . GLY B 2  252 ? 29.308  60.506  -1.925 1.00 95.42  ? 253 GLY A O     1 
ATOM   3395  N  N     . GLY B 2  253 ? 29.337  60.491  -4.175 1.00 87.39  ? 254 GLY A N     1 
ATOM   3396  C  CA    . GLY B 2  253 ? 29.629  61.910  -4.241 1.00 86.75  ? 254 GLY A CA    1 
ATOM   3397  C  C     . GLY B 2  253 ? 30.984  62.272  -3.704 1.00 90.65  ? 254 GLY A C     1 
ATOM   3398  O  O     . GLY B 2  253 ? 31.244  63.447  -3.416 1.00 91.63  ? 254 GLY A O     1 
ATOM   3399  N  N     . GLY B 2  254 ? 31.866  61.284  -3.571 1.00 97.72  ? 255 GLY A N     1 
ATOM   3400  C  CA    . GLY B 2  254 ? 33.173  61.492  -2.983 1.00 87.02  ? 255 GLY A CA    1 
ATOM   3401  C  C     . GLY B 2  254 ? 33.156  61.583  -1.483 1.00 90.91  ? 255 GLY A C     1 
ATOM   3402  O  O     . GLY B 2  254 ? 34.146  62.005  -0.886 1.00 100.35 ? 255 GLY A O     1 
ATOM   3403  N  N     . ARG B 2  255 ? 32.046  61.230  -0.857 1.00 92.87  ? 256 ARG A N     1 
ATOM   3404  C  CA    . ARG B 2  255 ? 31.915  61.300  0.587  1.00 80.01  ? 256 ARG A CA    1 
ATOM   3405  C  C     . ARG B 2  255 ? 32.123  59.921  1.202  1.00 81.09  ? 256 ARG A C     1 
ATOM   3406  O  O     . ARG B 2  255 ? 32.067  58.895  0.519  1.00 93.61  ? 256 ARG A O     1 
ATOM   3407  C  CB    . ARG B 2  255 ? 30.551  61.875  0.959  1.00 79.67  ? 256 ARG A CB    1 
ATOM   3408  C  CG    . ARG B 2  255 ? 30.462  63.370  0.728  1.00 90.25  ? 256 ARG A CG    1 
ATOM   3409  C  CD    . ARG B 2  255 ? 29.040  63.883  0.902  1.00 105.36 ? 256 ARG A CD    1 
ATOM   3410  N  NE    . ARG B 2  255 ? 28.337  63.981  -0.373 1.00 113.69 ? 256 ARG A NE    1 
ATOM   3411  C  CZ    . ARG B 2  255 ? 28.298  65.082  -1.116 1.00 125.01 ? 256 ARG A CZ    1 
ATOM   3412  N  NH1   . ARG B 2  255 ? 28.917  66.184  -0.706 1.00 124.05 ? 256 ARG A NH1   1 
ATOM   3413  N  NH2   . ARG B 2  255 ? 27.638  65.086  -2.269 1.00 132.15 ? 256 ARG A NH2   1 
ATOM   3414  N  N     . GLN B 2  256 ? 32.389  59.908  2.508  1.00 77.50  ? 257 GLN A N     1 
ATOM   3415  C  CA    . GLN B 2  256 ? 32.687  58.676  3.230  1.00 68.16  ? 257 GLN A CA    1 
ATOM   3416  C  C     . GLN B 2  256 ? 31.786  58.548  4.450  1.00 69.71  ? 257 GLN A C     1 
ATOM   3417  O  O     . GLN B 2  256 ? 31.008  59.441  4.785  1.00 72.90  ? 257 GLN A O     1 
ATOM   3418  C  CB    . GLN B 2  256 ? 34.156  58.612  3.666  1.00 70.01  ? 257 GLN A CB    1 
ATOM   3419  C  CG    . GLN B 2  256 ? 35.122  58.421  2.542  1.00 71.57  ? 257 GLN A CG    1 
ATOM   3420  C  CD    . GLN B 2  256 ? 36.544  58.586  3.007  1.00 68.03  ? 257 GLN A CD    1 
ATOM   3421  O  OE1   . GLN B 2  256 ? 36.860  59.488  3.806  1.00 55.96  ? 257 GLN A OE1   1 
ATOM   3422  N  NE2   . GLN B 2  256 ? 37.416  57.698  2.535  1.00 72.46  ? 257 GLN A NE2   1 
ATOM   3423  N  N     . ARG B 2  257 ? 31.925  57.419  5.137  1.00 68.77  ? 258 ARG A N     1 
ATOM   3424  C  CA    . ARG B 2  257 ? 31.175  57.194  6.362  1.00 73.65  ? 258 ARG A CA    1 
ATOM   3425  C  C     . ARG B 2  257 ? 31.888  56.146  7.200  1.00 78.44  ? 258 ARG A C     1 
ATOM   3426  O  O     . ARG B 2  257 ? 32.733  55.390  6.707  1.00 70.48  ? 258 ARG A O     1 
ATOM   3427  C  CB    . ARG B 2  257 ? 29.728  56.784  6.077  1.00 65.83  ? 258 ARG A CB    1 
ATOM   3428  C  CG    . ARG B 2  257 ? 29.577  55.429  5.444  1.00 61.57  ? 258 ARG A CG    1 
ATOM   3429  C  CD    . ARG B 2  257 ? 28.132  55.215  5.054  1.00 67.46  ? 258 ARG A CD    1 
ATOM   3430  N  NE    . ARG B 2  257 ? 27.975  54.089  4.142  1.00 73.04  ? 258 ARG A NE    1 
ATOM   3431  C  CZ    . ARG B 2  257 ? 26.896  53.881  3.400  1.00 77.45  ? 258 ARG A CZ    1 
ATOM   3432  N  NH1   . ARG B 2  257 ? 25.878  54.731  3.460  1.00 72.62  ? 258 ARG A NH1   1 
ATOM   3433  N  NH2   . ARG B 2  257 ? 26.839  52.826  2.598  1.00 102.99 ? 258 ARG A NH2   1 
ATOM   3434  N  N     . ILE B 2  258 ? 31.543  56.134  8.483  1.00 74.62  ? 259 ILE A N     1 
ATOM   3435  C  CA    . ILE B 2  258 ? 32.090  55.199  9.455  1.00 66.01  ? 259 ILE A CA    1 
ATOM   3436  C  C     . ILE B 2  258 ? 30.965  54.254  9.834  1.00 64.10  ? 259 ILE A C     1 
ATOM   3437  O  O     . ILE B 2  258 ? 29.909  54.699  10.302 1.00 62.93  ? 259 ILE A O     1 
ATOM   3438  C  CB    . ILE B 2  258 ? 32.627  55.925  10.692 1.00 67.22  ? 259 ILE A CB    1 
ATOM   3439  C  CG1   . ILE B 2  258 ? 33.759  56.870  10.312 1.00 66.51  ? 259 ILE A CG1   1 
ATOM   3440  C  CG2   . ILE B 2  258 ? 33.073  54.932  11.736 1.00 67.37  ? 259 ILE A CG2   1 
ATOM   3441  C  CD1   . ILE B 2  258 ? 34.211  57.703  11.463 1.00 80.35  ? 259 ILE A CD1   1 
ATOM   3442  N  N     . VAL B 2  259 ? 31.174  52.957  9.639  1.00 60.07  ? 260 VAL A N     1 
ATOM   3443  C  CA    . VAL B 2  259 ? 30.146  51.961  9.932  1.00 62.04  ? 260 VAL A CA    1 
ATOM   3444  C  C     . VAL B 2  259 ? 30.644  51.039  11.026 1.00 61.55  ? 260 VAL A C     1 
ATOM   3445  O  O     . VAL B 2  259 ? 31.657  50.356  10.852 1.00 63.77  ? 260 VAL A O     1 
ATOM   3446  C  CB    . VAL B 2  259 ? 29.756  51.145  8.696  1.00 59.27  ? 260 VAL A CB    1 
ATOM   3447  C  CG1   . VAL B 2  259 ? 28.661  50.178  9.081  1.00 62.82  ? 260 VAL A CG1   1 
ATOM   3448  C  CG2   . VAL B 2  259 ? 29.320  52.059  7.586  1.00 62.05  ? 260 VAL A CG2   1 
ATOM   3449  N  N     . VAL B 2  260 ? 29.902  50.976  12.125 1.00 58.32  ? 261 VAL A N     1 
ATOM   3450  C  CA    . VAL B 2  260 ? 30.256  50.147  13.272 1.00 59.00  ? 261 VAL A CA    1 
ATOM   3451  C  C     . VAL B 2  260 ? 29.320  48.953  13.309 1.00 70.05  ? 261 VAL A C     1 
ATOM   3452  O  O     . VAL B 2  260 ? 28.098  49.117  13.395 1.00 72.11  ? 261 VAL A O     1 
ATOM   3453  C  CB    . VAL B 2  260 ? 30.173  50.929  14.586 1.00 58.07  ? 261 VAL A CB    1 
ATOM   3454  C  CG1   . VAL B 2  260 ? 30.427  49.984  15.740 1.00 67.05  ? 261 VAL A CG1   1 
ATOM   3455  C  CG2   . VAL B 2  260 ? 31.154  52.074  14.582 1.00 58.48  ? 261 VAL A CG2   1 
ATOM   3456  N  N     . THR B 2  261 ? 29.882  47.749  13.289 1.00 73.04  ? 262 THR A N     1 
ATOM   3457  C  CA    . THR B 2  261 ? 29.053  46.553  13.342 1.00 58.55  ? 262 THR A CA    1 
ATOM   3458  C  C     . THR B 2  261 ? 29.115  45.820  14.669 1.00 54.38  ? 262 THR A C     1 
ATOM   3459  O  O     . THR B 2  261 ? 28.210  45.029  14.955 1.00 54.49  ? 262 THR A O     1 
ATOM   3460  C  CB    . THR B 2  261 ? 29.434  45.592  12.211 1.00 58.19  ? 262 THR A CB    1 
ATOM   3461  O  OG1   . THR B 2  261 ? 30.856  45.550  12.075 1.00 73.02  ? 262 THR A OG1   1 
ATOM   3462  C  CG2   . THR B 2  261 ? 28.825  46.070  10.920 1.00 58.81  ? 262 THR A CG2   1 
ATOM   3463  N  N     . GLU B 2  262 ? 30.130  46.067  15.481 1.00 55.79  ? 263 GLU A N     1 
ATOM   3464  C  CA    . GLU B 2  262 ? 30.287  45.415  16.767 1.00 54.47  ? 263 GLU A CA    1 
ATOM   3465  C  C     . GLU B 2  262 ? 30.698  46.461  17.787 1.00 50.97  ? 263 GLU A C     1 
ATOM   3466  O  O     . GLU B 2  262 ? 31.358  47.441  17.449 1.00 51.27  ? 263 GLU A O     1 
ATOM   3467  C  CB    . GLU B 2  262 ? 31.314  44.280  16.680 1.00 55.26  ? 263 GLU A CB    1 
ATOM   3468  C  CG    . GLU B 2  262 ? 30.880  43.158  15.777 1.00 56.29  ? 263 GLU A CG    1 
ATOM   3469  C  CD    . GLU B 2  262 ? 32.045  42.309  15.310 1.00 70.51  ? 263 GLU A CD    1 
ATOM   3470  O  OE1   . GLU B 2  262 ? 31.826  41.366  14.523 1.00 82.82  ? 263 GLU A OE1   1 
ATOM   3471  O  OE2   . GLU B 2  262 ? 33.187  42.581  15.726 1.00 78.22  ? 263 GLU A OE2   1 
ATOM   3472  N  N     . ILE B 2  263 ? 30.281  46.261  19.030 1.00 68.47  ? 264 ILE A N     1 
ATOM   3473  C  CA    . ILE B 2  263 ? 30.644  47.184  20.100 1.00 61.54  ? 264 ILE A CA    1 
ATOM   3474  C  C     . ILE B 2  263 ? 31.251  46.415  21.266 1.00 54.12  ? 264 ILE A C     1 
ATOM   3475  O  O     . ILE B 2  263 ? 31.143  45.182  21.331 1.00 60.74  ? 264 ILE A O     1 
ATOM   3476  C  CB    . ILE B 2  263 ? 29.439  48.017  20.565 1.00 59.55  ? 264 ILE A CB    1 
ATOM   3477  C  CG1   . ILE B 2  263 ? 28.428  47.129  21.272 1.00 68.64  ? 264 ILE A CG1   1 
ATOM   3478  C  CG2   . ILE B 2  263 ? 28.814  48.759  19.424 1.00 61.30  ? 264 ILE A CG2   1 
ATOM   3479  C  CD1   . ILE B 2  263 ? 27.152  47.847  21.608 1.00 73.88  ? 264 ILE A CD1   1 
ATOM   3480  N  N     . PRO B 2  264 ? 31.873  47.112  22.213 1.00 56.16  ? 265 PRO A N     1 
ATOM   3481  C  CA    . PRO B 2  264 ? 32.523  46.441  23.341 1.00 59.53  ? 265 PRO A CA    1 
ATOM   3482  C  C     . PRO B 2  264 ? 31.547  45.732  24.268 1.00 59.57  ? 265 PRO A C     1 
ATOM   3483  O  O     . PRO B 2  264 ? 30.351  46.024  24.325 1.00 56.15  ? 265 PRO A O     1 
ATOM   3484  C  CB    . PRO B 2  264 ? 33.227  47.596  24.062 1.00 63.81  ? 265 PRO A CB    1 
ATOM   3485  C  CG    . PRO B 2  264 ? 33.424  48.618  23.011 1.00 57.55  ? 265 PRO A CG    1 
ATOM   3486  C  CD    . PRO B 2  264 ? 32.233  48.538  22.159 1.00 59.40  ? 265 PRO A CD    1 
ATOM   3487  N  N     . PHE B 2  265 ? 32.109  44.805  25.036 1.00 67.94  ? 266 PHE A N     1 
ATOM   3488  C  CA    . PHE B 2  265 ? 31.335  44.042  26.004 1.00 58.79  ? 266 PHE A CA    1 
ATOM   3489  C  C     . PHE B 2  265 ? 30.774  44.954  27.092 1.00 54.90  ? 266 PHE A C     1 
ATOM   3490  O  O     . PHE B 2  265 ? 31.440  45.887  27.551 1.00 53.90  ? 266 PHE A O     1 
ATOM   3491  C  CB    . PHE B 2  265 ? 32.217  42.939  26.598 1.00 56.61  ? 266 PHE A CB    1 
ATOM   3492  C  CG    . PHE B 2  265 ? 31.490  41.994  27.500 1.00 55.28  ? 266 PHE A CG    1 
ATOM   3493  C  CD1   . PHE B 2  265 ? 30.239  41.519  27.162 1.00 64.75  ? 266 PHE A CD1   1 
ATOM   3494  C  CD2   . PHE B 2  265 ? 32.074  41.560  28.675 1.00 56.04  ? 266 PHE A CD2   1 
ATOM   3495  C  CE1   . PHE B 2  265 ? 29.574  40.640  27.990 1.00 67.56  ? 266 PHE A CE1   1 
ATOM   3496  C  CE2   . PHE B 2  265 ? 31.417  40.682  29.502 1.00 57.54  ? 266 PHE A CE2   1 
ATOM   3497  C  CZ    . PHE B 2  265 ? 30.164  40.222  29.160 1.00 55.64  ? 266 PHE A CZ    1 
ATOM   3498  N  N     . GLN B 2  266 ? 29.525  44.682  27.484 1.00 54.58  ? 267 GLN A N     1 
ATOM   3499  C  CA    . GLN B 2  266 ? 28.819  45.415  28.543 1.00 55.92  ? 267 GLN A CA    1 
ATOM   3500  C  C     . GLN B 2  266 ? 28.704  46.911  28.257 1.00 58.18  ? 267 GLN A C     1 
ATOM   3501  O  O     . GLN B 2  266 ? 28.730  47.736  29.170 1.00 69.00  ? 267 GLN A O     1 
ATOM   3502  C  CB    . GLN B 2  266 ? 29.467  45.179  29.907 1.00 57.73  ? 267 GLN A CB    1 
ATOM   3503  C  CG    . GLN B 2  266 ? 29.178  43.823  30.500 1.00 70.16  ? 267 GLN A CG    1 
ATOM   3504  C  CD    . GLN B 2  266 ? 30.146  43.461  31.603 1.00 83.67  ? 267 GLN A CD    1 
ATOM   3505  O  OE1   . GLN B 2  266 ? 31.225  44.051  31.719 1.00 95.13  ? 267 GLN A OE1   1 
ATOM   3506  N  NE2   . GLN B 2  266 ? 29.769  42.485  32.424 1.00 85.07  ? 267 GLN A NE2   1 
ATOM   3507  N  N     . VAL B 2  267 ? 28.550  47.266  26.989 1.00 55.67  ? 268 VAL A N     1 
ATOM   3508  C  CA    . VAL B 2  267 ? 28.402  48.657  26.577 1.00 58.57  ? 268 VAL A CA    1 
ATOM   3509  C  C     . VAL B 2  267 ? 26.994  48.839  26.042 1.00 71.10  ? 268 VAL A C     1 
ATOM   3510  O  O     . VAL B 2  267 ? 26.633  48.247  25.018 1.00 72.60  ? 268 VAL A O     1 
ATOM   3511  C  CB    . VAL B 2  267 ? 29.419  49.069  25.508 1.00 54.47  ? 268 VAL A CB    1 
ATOM   3512  C  CG1   . VAL B 2  267 ? 28.900  50.286  24.762 1.00 55.30  ? 268 VAL A CG1   1 
ATOM   3513  C  CG2   . VAL B 2  267 ? 30.753  49.359  26.130 1.00 52.35  ? 268 VAL A CG2   1 
ATOM   3514  N  N     . ASN B 2  268 ? 26.203  49.654  26.715 1.00 81.95  ? 269 ASN A N     1 
ATOM   3515  C  CA    . ASN B 2  268 ? 24.898  49.967  26.166 1.00 67.24  ? 269 ASN A CA    1 
ATOM   3516  C  C     . ASN B 2  268 ? 25.100  50.683  24.843 1.00 72.54  ? 269 ASN A C     1 
ATOM   3517  O  O     . ASN B 2  268 ? 25.889  51.628  24.750 1.00 84.05  ? 269 ASN A O     1 
ATOM   3518  C  CB    . ASN B 2  268 ? 24.080  50.819  27.126 1.00 68.12  ? 269 ASN A CB    1 
ATOM   3519  C  CG    . ASN B 2  268 ? 22.712  51.152  26.574 1.00 73.03  ? 269 ASN A CG    1 
ATOM   3520  O  OD1   . ASN B 2  268 ? 22.569  51.614  25.439 1.00 79.14  ? 269 ASN A OD1   1 
ATOM   3521  N  ND2   . ASN B 2  268 ? 21.693  50.917  27.376 1.00 70.14  ? 269 ASN A ND2   1 
ATOM   3522  N  N     . LYS B 2  269 ? 24.416  50.207  23.810 1.00 72.60  ? 270 LYS A N     1 
ATOM   3523  C  CA    . LYS B 2  269 ? 24.587  50.800  22.489 1.00 66.55  ? 270 LYS A CA    1 
ATOM   3524  C  C     . LYS B 2  269 ? 23.878  52.137  22.393 1.00 76.25  ? 270 LYS A C     1 
ATOM   3525  O  O     . LYS B 2  269 ? 24.465  53.133  21.958 1.00 84.82  ? 270 LYS A O     1 
ATOM   3526  C  CB    . LYS B 2  269 ? 24.062  49.854  21.417 1.00 73.47  ? 270 LYS A CB    1 
ATOM   3527  C  CG    . LYS B 2  269 ? 24.112  50.439  20.028 1.00 70.44  ? 270 LYS A CG    1 
ATOM   3528  C  CD    . LYS B 2  269 ? 23.946  49.343  19.001 1.00 59.52  ? 270 LYS A CD    1 
ATOM   3529  C  CE    . LYS B 2  269 ? 22.604  48.676  19.125 1.00 58.89  ? 270 LYS A CE    1 
ATOM   3530  N  NZ    . LYS B 2  269 ? 21.538  49.615  18.743 1.00 62.64  ? 270 LYS A NZ    1 
ATOM   3531  N  N     . ALA B 2  270 ? 22.601  52.155  22.767 1.00 82.98  ? 271 ALA A N     1 
ATOM   3532  C  CA    . ALA B 2  270 ? 21.813  53.380  22.731 1.00 77.32  ? 271 ALA A CA    1 
ATOM   3533  C  C     . ALA B 2  270 ? 22.505  54.493  23.492 1.00 77.45  ? 271 ALA A C     1 
ATOM   3534  O  O     . ALA B 2  270 ? 22.570  55.639  23.031 1.00 79.51  ? 271 ALA A O     1 
ATOM   3535  C  CB    . ALA B 2  270 ? 20.428  53.121  23.322 1.00 71.18  ? 271 ALA A CB    1 
ATOM   3536  N  N     . ARG B 2  271 ? 23.030  54.162  24.668 1.00 77.41  ? 272 ARG A N     1 
ATOM   3537  C  CA    . ARG B 2  271 ? 23.756  55.132  25.472 1.00 70.85  ? 272 ARG A CA    1 
ATOM   3538  C  C     . ARG B 2  271 ? 25.013  55.600  24.758 1.00 70.82  ? 272 ARG A C     1 
ATOM   3539  O  O     . ARG B 2  271 ? 25.364  56.783  24.813 1.00 73.54  ? 272 ARG A O     1 
ATOM   3540  C  CB    . ARG B 2  271 ? 24.100  54.515  26.824 1.00 82.20  ? 272 ARG A CB    1 
ATOM   3541  C  CG    . ARG B 2  271 ? 24.546  55.513  27.861 1.00 96.06  ? 272 ARG A CG    1 
ATOM   3542  C  CD    . ARG B 2  271 ? 25.045  54.794  29.088 1.00 105.63 ? 272 ARG A CD    1 
ATOM   3543  N  NE    . ARG B 2  271 ? 23.975  54.058  29.751 1.00 113.39 ? 272 ARG A NE    1 
ATOM   3544  C  CZ    . ARG B 2  271 ? 24.123  52.844  30.271 1.00 115.33 ? 272 ARG A CZ    1 
ATOM   3545  N  NH1   . ARG B 2  271 ? 25.295  52.226  30.183 1.00 102.25 ? 272 ARG A NH1   1 
ATOM   3546  N  NH2   . ARG B 2  271 ? 23.099  52.241  30.866 1.00 123.87 ? 272 ARG A NH2   1 
ATOM   3547  N  N     . MET B 2  272 ? 25.709  54.685  24.083 1.00 76.08  ? 273 MET A N     1 
ATOM   3548  C  CA    . MET B 2  272 ? 26.912  55.076  23.356 1.00 76.58  ? 273 MET A CA    1 
ATOM   3549  C  C     . MET B 2  272 ? 26.585  56.055  22.243 1.00 74.78  ? 273 MET A C     1 
ATOM   3550  O  O     . MET B 2  272 ? 27.347  56.994  21.988 1.00 91.63  ? 273 MET A O     1 
ATOM   3551  C  CB    . MET B 2  272 ? 27.622  53.857  22.776 1.00 76.87  ? 273 MET A CB    1 
ATOM   3552  C  CG    . MET B 2  272 ? 28.952  54.241  22.154 1.00 83.65  ? 273 MET A CG    1 
ATOM   3553  S  SD    . MET B 2  272 ? 29.662  53.000  21.069 1.00 94.52  ? 273 MET A SD    1 
ATOM   3554  C  CE    . MET B 2  272 ? 28.495  53.030  19.712 1.00 83.89  ? 273 MET A CE    1 
ATOM   3555  N  N     . ILE B 2  273 ? 25.469  55.842  21.553 1.00 70.72  ? 274 ILE A N     1 
ATOM   3556  C  CA    . ILE B 2  273 ? 25.082  56.757  20.484 1.00 74.54  ? 274 ILE A CA    1 
ATOM   3557  C  C     . ILE B 2  273 ? 24.828  58.143  21.049 1.00 80.00  ? 274 ILE A C     1 
ATOM   3558  O  O     . ILE B 2  273 ? 25.200  59.155  20.443 1.00 74.07  ? 274 ILE A O     1 
ATOM   3559  C  CB    . ILE B 2  273 ? 23.842  56.232  19.739 1.00 73.69  ? 274 ILE A CB    1 
ATOM   3560  C  CG1   . ILE B 2  273 ? 24.136  54.887  19.082 1.00 74.39  ? 274 ILE A CG1   1 
ATOM   3561  C  CG2   . ILE B 2  273 ? 23.398  57.237  18.697 1.00 63.88  ? 274 ILE A CG2   1 
ATOM   3562  C  CD1   . ILE B 2  273 ? 22.942  54.312  18.384 1.00 83.48  ? 274 ILE A CD1   1 
ATOM   3563  N  N     . GLU B 2  274 ? 24.157  58.211  22.202 1.00 89.84  ? 275 GLU A N     1 
ATOM   3564  C  CA    . GLU B 2  274 ? 23.887  59.501  22.829 1.00 86.33  ? 275 GLU A CA    1 
ATOM   3565  C  C     . GLU B 2  274 ? 25.179  60.251  23.089 1.00 87.02  ? 275 GLU A C     1 
ATOM   3566  O  O     . GLU B 2  274 ? 25.276  61.451  22.820 1.00 89.55  ? 275 GLU A O     1 
ATOM   3567  C  CB    . GLU B 2  274 ? 23.130  59.315  24.145 1.00 90.12  ? 275 GLU A CB    1 
ATOM   3568  C  CG    . GLU B 2  274 ? 21.681  58.936  24.002 1.00 108.92 ? 275 GLU A CG    1 
ATOM   3569  C  CD    . GLU B 2  274 ? 21.020  58.710  25.357 1.00 120.42 ? 275 GLU A CD    1 
ATOM   3570  O  OE1   . GLU B 2  274 ? 21.661  59.017  26.393 1.00 117.52 ? 275 GLU A OE1   1 
ATOM   3571  O  OE2   . GLU B 2  274 ? 19.867  58.220  25.388 1.00 128.23 ? 275 GLU A OE2   1 
ATOM   3572  N  N     . LYS B 2  275 ? 26.182  59.557  23.625 1.00 92.43  ? 276 LYS A N     1 
ATOM   3573  C  CA    . LYS B 2  275 ? 27.457  60.201  23.912 1.00 91.02  ? 276 LYS A CA    1 
ATOM   3574  C  C     . LYS B 2  275 ? 28.092  60.736  22.643 1.00 84.72  ? 276 LYS A C     1 
ATOM   3575  O  O     . LYS B 2  275 ? 28.647  61.839  22.638 1.00 88.28  ? 276 LYS A O     1 
ATOM   3576  C  CB    . LYS B 2  275 ? 28.385  59.219  24.620 1.00 98.99  ? 276 LYS A CB    1 
ATOM   3577  C  CG    . LYS B 2  275 ? 27.906  58.842  26.009 1.00 108.32 ? 276 LYS A CG    1 
ATOM   3578  C  CD    . LYS B 2  275 ? 28.922  57.987  26.743 1.00 109.32 ? 276 LYS A CD    1 
ATOM   3579  C  CE    . LYS B 2  275 ? 28.497  57.746  28.181 1.00 109.25 ? 276 LYS A CE    1 
ATOM   3580  N  NZ    . LYS B 2  275 ? 29.348  56.722  28.846 1.00 109.01 ? 276 LYS A NZ    1 
ATOM   3581  N  N     . ILE B 2  276 ? 28.014  59.975  21.552 1.00 76.53  ? 277 ILE A N     1 
ATOM   3582  C  CA    . ILE B 2  276 ? 28.509  60.480  20.273 1.00 86.34  ? 277 ILE A CA    1 
ATOM   3583  C  C     . ILE B 2  276 ? 27.700  61.684  19.846 1.00 87.05  ? 277 ILE A C     1 
ATOM   3584  O  O     . ILE B 2  276 ? 28.238  62.677  19.334 1.00 82.35  ? 277 ILE A O     1 
ATOM   3585  C  CB    . ILE B 2  276 ? 28.461  59.389  19.187 1.00 83.07  ? 277 ILE A CB    1 
ATOM   3586  C  CG1   . ILE B 2  276 ? 29.223  58.141  19.629 1.00 81.82  ? 277 ILE A CG1   1 
ATOM   3587  C  CG2   . ILE B 2  276 ? 29.048  59.931  17.891 1.00 69.93  ? 277 ILE A CG2   1 
ATOM   3588  C  CD1   . ILE B 2  276 ? 29.403  57.138  18.519 1.00 73.79  ? 277 ILE A CD1   1 
ATOM   3589  N  N     . ALA B 2  277 ? 26.384  61.597  20.005 1.00 82.44  ? 278 ALA A N     1 
ATOM   3590  C  CA    . ALA B 2  277 ? 25.542  62.747  19.678 1.00 82.62  ? 278 ALA A CA    1 
ATOM   3591  C  C     . ALA B 2  277 ? 25.970  63.972  20.453 1.00 89.53  ? 278 ALA A C     1 
ATOM   3592  O  O     . ALA B 2  277 ? 26.107  65.072  19.897 1.00 82.23  ? 278 ALA A O     1 
ATOM   3593  C  CB    . ALA B 2  277 ? 24.070  62.412  19.949 1.00 79.26  ? 278 ALA A CB    1 
ATOM   3594  N  N     A GLU B 2  278 ? 26.212  63.799  21.750 0.50 91.67  ? 279 GLU A N     1 
ATOM   3595  N  N     B GLU B 2  278 ? 26.204  63.805  21.759 0.50 91.65  ? 279 GLU A N     1 
ATOM   3596  C  CA    A GLU B 2  278 ? 26.551  64.940  22.648 0.50 85.54  ? 279 GLU A CA    1 
ATOM   3597  C  CA    B GLU B 2  278 ? 26.569  64.940  22.661 0.50 88.42  ? 279 GLU A CA    1 
ATOM   3598  C  C     A GLU B 2  278 ? 27.850  65.604  22.256 0.50 83.14  ? 279 GLU A C     1 
ATOM   3599  C  C     B GLU B 2  278 ? 27.853  65.606  22.242 0.50 84.26  ? 279 GLU A C     1 
ATOM   3600  O  O     A GLU B 2  278 ? 27.907  66.813  22.194 0.50 84.04  ? 279 GLU A O     1 
ATOM   3601  O  O     B GLU B 2  278 ? 27.920  66.812  22.191 0.50 83.43  ? 279 GLU A O     1 
ATOM   3602  C  CB    A GLU B 2  278 ? 26.626  64.470  24.065 0.50 87.02  ? 279 GLU A CB    1 
ATOM   3603  C  CB    B GLU B 2  278 ? 26.746  64.481  24.072 0.50 88.54  ? 279 GLU A CB    1 
ATOM   3604  C  CG    A GLU B 2  278 ? 27.491  65.387  24.925 0.50 86.70  ? 279 GLU A CG    1 
ATOM   3605  C  CG    B GLU B 2  278 ? 25.575  63.970  24.757 0.50 91.45  ? 279 GLU A CG    1 
ATOM   3606  C  CD    A GLU B 2  278 ? 27.751  64.776  26.273 0.50 94.55  ? 279 GLU A CD    1 
ATOM   3607  C  CD    B GLU B 2  278 ? 25.868  63.626  26.196 0.50 95.21  ? 279 GLU A CD    1 
ATOM   3608  O  OE1   A GLU B 2  278 ? 28.871  64.942  26.799 0.50 89.78  ? 279 GLU A OE1   1 
ATOM   3609  O  OE1   B GLU B 2  278 ? 26.846  64.164  26.753 0.50 100.29 ? 279 GLU A OE1   1 
ATOM   3610  O  OE2   A GLU B 2  278 ? 26.831  64.115  26.797 0.50 100.10 ? 279 GLU A OE2   1 
ATOM   3611  O  OE2   B GLU B 2  278 ? 25.114  62.810  26.766 0.50 86.33  ? 279 GLU A OE2   1 
ATOM   3612  N  N     . LEU B 2  279 ? 28.845  64.839  22.067 1.00 82.56  ? 280 LEU A N     1 
ATOM   3613  C  CA    . LEU B 2  279 ? 30.113  65.301  21.590 1.00 85.61  ? 280 LEU A CA    1 
ATOM   3614  C  C     . LEU B 2  279 ? 29.961  66.228  20.414 1.00 93.49  ? 280 LEU A C     1 
ATOM   3615  O  O     . LEU B 2  279 ? 30.402  67.387  20.446 1.00 101.10 ? 280 LEU A O     1 
ATOM   3616  C  CB    . LEU B 2  279 ? 30.950  64.023  21.153 1.00 75.85  ? 280 LEU A CB    1 
ATOM   3617  C  CG    . LEU B 2  279 ? 31.783  63.676  22.336 1.00 76.50  ? 280 LEU A CG    1 
ATOM   3618  C  CD1   . LEU B 2  279 ? 32.971  63.242  21.567 1.00 72.98  ? 280 LEU A CD1   1 
ATOM   3619  C  CD2   . LEU B 2  279 ? 32.077  64.837  23.244 1.00 80.91  ? 280 LEU A CD2   1 
ATOM   3620  N  N     . VAL B 2  280 ? 29.184  65.800  19.426 1.00 91.76  ? 281 VAL A N     1 
ATOM   3621  C  CA    . VAL B 2  280 ? 28.944  66.651  18.248 1.00 94.12  ? 281 VAL A CA    1 
ATOM   3622  C  C     . VAL B 2  280 ? 28.259  67.939  18.667 1.00 103.65 ? 281 VAL A C     1 
ATOM   3623  O  O     . VAL B 2  280 ? 28.715  69.051  18.371 1.00 104.17 ? 281 VAL A O     1 
ATOM   3624  C  CB    . VAL B 2  280 ? 28.083  65.922  17.192 1.00 85.95  ? 281 VAL A CB    1 
ATOM   3625  C  CG1   . VAL B 2  280 ? 27.509  66.940  16.214 1.00 89.94  ? 281 VAL A CG1   1 
ATOM   3626  C  CG2   . VAL B 2  280 ? 28.891  64.867  16.480 1.00 83.20  ? 281 VAL A CG2   1 
ATOM   3627  N  N     . ARG B 2  281 ? 27.146  67.781  19.384 1.00 107.21 ? 282 ARG A N     1 
ATOM   3628  C  CA    . ARG B 2  281 ? 26.351  68.897  19.868 1.00 105.31 ? 282 ARG A CA    1 
ATOM   3629  C  C     . ARG B 2  281 ? 27.206  69.906  20.609 1.00 114.34 ? 282 ARG A C     1 
ATOM   3630  O  O     . ARG B 2  281 ? 26.998  71.115  20.476 1.00 122.25 ? 282 ARG A O     1 
ATOM   3631  C  CB    . ARG B 2  281 ? 25.240  68.352  20.761 1.00 100.42 ? 282 ARG A CB    1 
ATOM   3632  C  CG    . ARG B 2  281 ? 24.165  69.362  21.058 1.00 103.02 ? 282 ARG A CG    1 
ATOM   3633  C  CD    . ARG B 2  281 ? 22.915  68.721  21.643 1.00 109.30 ? 282 ARG A CD    1 
ATOM   3634  N  NE    . ARG B 2  281 ? 23.192  67.986  22.873 1.00 117.18 ? 282 ARG A NE    1 
ATOM   3635  C  CZ    . ARG B 2  281 ? 22.918  66.698  23.052 1.00 119.56 ? 282 ARG A CZ    1 
ATOM   3636  N  NH1   . ARG B 2  281 ? 23.208  66.109  24.206 1.00 122.50 ? 282 ARG A NH1   1 
ATOM   3637  N  NH2   . ARG B 2  281 ? 22.341  66.002  22.080 1.00 112.37 ? 282 ARG A NH2   1 
ATOM   3638  N  N     . ASP B 2  282 ? 28.175  69.437  21.388 1.00 114.19 ? 283 ASP A N     1 
ATOM   3639  C  CA    . ASP B 2  282 ? 29.063  70.311  22.144 1.00 104.20 ? 283 ASP A CA    1 
ATOM   3640  C  C     . ASP B 2  282 ? 30.289  70.721  21.345 1.00 105.21 ? 283 ASP A C     1 
ATOM   3641  O  O     . ASP B 2  282 ? 31.223  71.301  21.918 1.00 118.59 ? 283 ASP A O     1 
ATOM   3642  C  CB    . ASP B 2  282 ? 29.467  69.634  23.456 1.00 107.18 ? 283 ASP A CB    1 
ATOM   3643  C  CG    . ASP B 2  282 ? 28.277  69.401  24.377 1.00 115.94 ? 283 ASP A CG    1 
ATOM   3644  O  OD1   . ASP B 2  282 ? 27.125  69.658  23.949 1.00 108.86 ? 283 ASP A OD1   1 
ATOM   3645  O  OD2   . ASP B 2  282 ? 28.493  68.951  25.522 1.00 120.68 ? 283 ASP A OD2   1 
ATOM   3646  N  N     . LYS B 2  283 ? 30.310  70.413  20.044 1.00 101.28 ? 284 LYS A N     1 
ATOM   3647  C  CA    . LYS B 2  283 ? 31.397  70.741  19.118 1.00 100.65 ? 284 LYS A CA    1 
ATOM   3648  C  C     . LYS B 2  283 ? 32.738  70.187  19.580 1.00 96.33  ? 284 LYS A C     1 
ATOM   3649  O  O     . LYS B 2  283 ? 33.790  70.615  19.100 1.00 92.72  ? 284 LYS A O     1 
ATOM   3650  C  CB    . LYS B 2  283 ? 31.499  72.252  18.883 1.00 104.16 ? 284 LYS A CB    1 
ATOM   3651  C  CG    . LYS B 2  283 ? 30.156  72.950  18.703 1.00 111.00 ? 284 LYS A CG    1 
ATOM   3652  C  CD    . LYS B 2  283 ? 29.641  72.878  17.272 1.00 116.02 ? 284 LYS A CD    1 
ATOM   3653  C  CE    . LYS B 2  283 ? 28.314  73.619  17.146 1.00 118.56 ? 284 LYS A CE    1 
ATOM   3654  N  NZ    . LYS B 2  283 ? 27.879  73.765  15.729 1.00 120.28 ? 284 LYS A NZ    1 
ATOM   3655  N  N     . LYS B 2  284 ? 32.709  69.228  20.506 1.00 101.20 ? 285 LYS A N     1 
ATOM   3656  C  CA    . LYS B 2  284 ? 33.946  68.618  20.978 1.00 103.81 ? 285 LYS A CA    1 
ATOM   3657  C  C     . LYS B 2  284 ? 34.618  67.798  19.883 1.00 107.06 ? 285 LYS A C     1 
ATOM   3658  O  O     . LYS B 2  284 ? 35.852  67.722  19.824 1.00 113.48 ? 285 LYS A O     1 
ATOM   3659  C  CB    . LYS B 2  284 ? 33.678  67.750  22.202 1.00 100.62 ? 285 LYS A CB    1 
ATOM   3660  C  CG    . LYS B 2  284 ? 33.458  68.530  23.481 1.00 98.45  ? 285 LYS A CG    1 
ATOM   3661  C  CD    . LYS B 2  284 ? 33.465  67.613  24.696 1.00 107.02 ? 285 LYS A CD    1 
ATOM   3662  C  CE    . LYS B 2  284 ? 33.500  68.386  25.995 1.00 100.28 ? 285 LYS A CE    1 
ATOM   3663  N  NZ    . LYS B 2  284 ? 33.805  67.489  27.142 1.00 98.61  ? 285 LYS A NZ    1 
ATOM   3664  N  N     . ILE B 2  285 ? 33.836  67.177  19.012 1.00 103.22 ? 286 ILE A N     1 
ATOM   3665  C  CA    . ILE B 2  285 ? 34.372  66.382  17.914 1.00 104.49 ? 286 ILE A CA    1 
ATOM   3666  C  C     . ILE B 2  285 ? 34.070  67.088  16.601 1.00 106.02 ? 286 ILE A C     1 
ATOM   3667  O  O     . ILE B 2  285 ? 33.003  67.687  16.441 1.00 116.95 ? 286 ILE A O     1 
ATOM   3668  C  CB    . ILE B 2  285 ? 33.797  64.954  17.920 1.00 97.39  ? 286 ILE A CB    1 
ATOM   3669  C  CG1   . ILE B 2  285 ? 34.655  64.057  17.037 1.00 91.14  ? 286 ILE A CG1   1 
ATOM   3670  C  CG2   . ILE B 2  285 ? 32.350  64.960  17.437 1.00 94.23  ? 286 ILE A CG2   1 
ATOM   3671  C  CD1   . ILE B 2  285 ? 34.355  62.620  17.192 1.00 87.19  ? 286 ILE A CD1   1 
ATOM   3672  N  N     . ASP B 2  286 ? 34.993  67.008  15.654 1.00 95.41  ? 287 ASP A N     1 
ATOM   3673  C  CA    . ASP B 2  286 ? 34.883  67.781  14.426 1.00 96.31  ? 287 ASP A CA    1 
ATOM   3674  C  C     . ASP B 2  286 ? 34.710  66.891  13.207 1.00 92.98  ? 287 ASP A C     1 
ATOM   3675  O  O     . ASP B 2  286 ? 35.542  66.019  12.945 1.00 94.95  ? 287 ASP A O     1 
ATOM   3676  C  CB    . ASP B 2  286 ? 36.104  68.685  14.245 1.00 117.37 ? 287 ASP A CB    1 
ATOM   3677  C  CG    . ASP B 2  286 ? 36.221  69.212  12.837 1.00 129.75 ? 287 ASP A CG    1 
ATOM   3678  O  OD1   . ASP B 2  286 ? 35.177  69.409  12.167 1.00 135.60 ? 287 ASP A OD1   1 
ATOM   3679  O  OD2   . ASP B 2  286 ? 37.359  69.424  12.392 1.00 129.54 ? 287 ASP A OD2   1 
ATOM   3680  N  N     . GLY B 2  287 ? 33.671  67.170  12.431 1.00 95.95  ? 288 GLY A N     1 
ATOM   3681  C  CA    . GLY B 2  287 ? 33.494  66.584  11.119 1.00 96.98  ? 288 GLY A CA    1 
ATOM   3682  C  C     . GLY B 2  287 ? 32.356  65.571  10.934 1.00 93.58  ? 288 GLY A C     1 
ATOM   3683  O  O     . GLY B 2  287 ? 32.395  64.807  9.963  1.00 91.58  ? 288 GLY A O     1 
ATOM   3684  N  N     . ILE B 2  288 ? 31.354  65.547  11.805 1.00 91.44  ? 289 ILE A N     1 
ATOM   3685  C  CA    . ILE B 2  288 ? 30.286  64.556  11.711 1.00 77.60  ? 289 ILE A CA    1 
ATOM   3686  C  C     . ILE B 2  288 ? 29.000  65.248  11.294 1.00 83.59  ? 289 ILE A C     1 
ATOM   3687  O  O     . ILE B 2  288 ? 28.512  66.141  11.994 1.00 96.45  ? 289 ILE A O     1 
ATOM   3688  C  CB    . ILE B 2  288 ? 30.101  63.787  13.022 1.00 67.80  ? 289 ILE A CB    1 
ATOM   3689  C  CG1   . ILE B 2  288 ? 31.413  63.109  13.410 1.00 64.84  ? 289 ILE A CG1   1 
ATOM   3690  C  CG2   . ILE B 2  288 ? 29.012  62.770  12.849 1.00 65.35  ? 289 ILE A CG2   1 
ATOM   3691  C  CD1   . ILE B 2  288 ? 31.326  62.351  14.688 1.00 61.14  ? 289 ILE A CD1   1 
ATOM   3692  N  N     . THR B 2  289 ? 28.438  64.820  10.165 1.00 74.92  ? 290 THR A N     1 
ATOM   3693  C  CA    . THR B 2  289 ? 27.232  65.450  9.644  1.00 80.86  ? 290 THR A CA    1 
ATOM   3694  C  C     . THR B 2  289 ? 25.962  64.693  9.978  1.00 87.54  ? 290 THR A C     1 
ATOM   3695  O  O     . THR B 2  289 ? 24.881  65.290  9.947  1.00 100.93 ? 290 THR A O     1 
ATOM   3696  C  CB    . THR B 2  289 ? 27.329  65.612  8.123  1.00 82.57  ? 290 THR A CB    1 
ATOM   3697  O  OG1   . THR B 2  289 ? 26.786  64.454  7.484  1.00 92.49  ? 290 THR A OG1   1 
ATOM   3698  C  CG2   . THR B 2  289 ? 28.768  65.754  7.719  1.00 84.12  ? 290 THR A CG2   1 
ATOM   3699  N  N     . ASP B 2  290 ? 26.054  63.410  10.293 1.00 81.33  ? 291 ASP A N     1 
ATOM   3700  C  CA    . ASP B 2  290 ? 24.860  62.624  10.555 1.00 80.74  ? 291 ASP A CA    1 
ATOM   3701  C  C     . ASP B 2  290 ? 25.240  61.408  11.378 1.00 80.33  ? 291 ASP A C     1 
ATOM   3702  O  O     . ASP B 2  290 ? 26.382  60.942  11.351 1.00 85.28  ? 291 ASP A O     1 
ATOM   3703  C  CB    . ASP B 2  290 ? 24.170  62.201  9.253  1.00 92.71  ? 291 ASP A CB    1 
ATOM   3704  C  CG    . ASP B 2  290 ? 22.709  61.849  9.455  1.00 102.72 ? 291 ASP A CG    1 
ATOM   3705  O  OD1   . ASP B 2  290 ? 22.168  62.143  10.547 1.00 102.88 ? 291 ASP A OD1   1 
ATOM   3706  O  OD2   . ASP B 2  290 ? 22.101  61.294  8.512  1.00 107.10 ? 291 ASP A OD2   1 
ATOM   3707  N  N     . LEU B 2  291 ? 24.251  60.890  12.092 1.00 69.76  ? 292 LEU A N     1 
ATOM   3708  C  CA    . LEU B 2  291 ? 24.460  59.762  12.987 1.00 65.61  ? 292 LEU A CA    1 
ATOM   3709  C  C     . LEU B 2  291 ? 23.172  58.958  13.004 1.00 66.17  ? 292 LEU A C     1 
ATOM   3710  O  O     . LEU B 2  291 ? 22.135  59.496  13.389 1.00 70.67  ? 292 LEU A O     1 
ATOM   3711  C  CB    . LEU B 2  291 ? 24.839  60.264  14.386 1.00 64.78  ? 292 LEU A CB    1 
ATOM   3712  C  CG    . LEU B 2  291 ? 24.978  59.313  15.573 1.00 69.28  ? 292 LEU A CG    1 
ATOM   3713  C  CD1   . LEU B 2  291 ? 26.109  58.362  15.325 1.00 83.21  ? 292 LEU A CD1   1 
ATOM   3714  C  CD2   . LEU B 2  291 ? 25.229  60.083  16.852 1.00 68.63  ? 292 LEU A CD2   1 
ATOM   3715  N  N     . ARG B 2  292 ? 23.200  57.706  12.548 1.00 63.65  ? 293 ARG A N     1 
ATOM   3716  C  CA    . ARG B 2  292 ? 21.971  56.924  12.473 1.00 65.76  ? 293 ARG A CA    1 
ATOM   3717  C  C     . ARG B 2  292 ? 22.209  55.524  13.000 1.00 66.79  ? 293 ARG A C     1 
ATOM   3718  O  O     . ARG B 2  292 ? 23.255  54.933  12.741 1.00 80.84  ? 293 ARG A O     1 
ATOM   3719  C  CB    . ARG B 2  292 ? 21.431  56.836  11.037 1.00 65.36  ? 293 ARG A CB    1 
ATOM   3720  C  CG    . ARG B 2  292 ? 21.085  58.164  10.418 1.00 74.28  ? 293 ARG A CG    1 
ATOM   3721  C  CD    . ARG B 2  292 ? 20.488  57.957  9.041  1.00 85.24  ? 293 ARG A CD    1 
ATOM   3722  N  NE    . ARG B 2  292 ? 21.315  57.085  8.207  1.00 89.03  ? 293 ARG A NE    1 
ATOM   3723  C  CZ    . ARG B 2  292 ? 22.355  57.502  7.487  1.00 84.31  ? 293 ARG A CZ    1 
ATOM   3724  N  NH1   . ARG B 2  292 ? 22.708  58.784  7.502  1.00 78.61  ? 293 ARG A NH1   1 
ATOM   3725  N  NH2   . ARG B 2  292 ? 23.045  56.639  6.749  1.00 72.64  ? 293 ARG A NH2   1 
ATOM   3726  N  N     . ASP B 2  293 ? 21.246  54.988  13.735 1.00 69.97  ? 294 ASP A N     1 
ATOM   3727  C  CA    . ASP B 2  293 ? 21.313  53.596  14.162 1.00 73.13  ? 294 ASP A CA    1 
ATOM   3728  C  C     . ASP B 2  293 ? 20.527  52.773  13.158 1.00 75.67  ? 294 ASP A C     1 
ATOM   3729  O  O     . ASP B 2  293 ? 19.296  52.797  13.157 1.00 80.40  ? 294 ASP A O     1 
ATOM   3730  C  CB    . ASP B 2  293 ? 20.802  53.380  15.587 1.00 70.61  ? 294 ASP A CB    1 
ATOM   3731  C  CG    . ASP B 2  293 ? 21.046  51.957  16.071 1.00 82.81  ? 294 ASP A CG    1 
ATOM   3732  O  OD1   . ASP B 2  293 ? 21.445  51.108  15.237 1.00 91.19  ? 294 ASP A OD1   1 
ATOM   3733  O  OD2   . ASP B 2  293 ? 20.845  51.654  17.270 1.00 93.86  ? 294 ASP A OD2   1 
ATOM   3734  N  N     . GLU B 2  294 ? 21.247  52.097  12.271 1.00 82.99  ? 295 GLU A N     1 
ATOM   3735  C  CA    . GLU B 2  294 ? 20.658  51.282  11.222 1.00 80.90  ? 295 GLU A CA    1 
ATOM   3736  C  C     . GLU B 2  294 ? 20.562  49.815  11.619 1.00 81.02  ? 295 GLU A C     1 
ATOM   3737  O  O     . GLU B 2  294 ? 20.300  48.964  10.759 1.00 88.44  ? 295 GLU A O     1 
ATOM   3738  C  CB    . GLU B 2  294 ? 21.447  51.453  9.927  1.00 75.90  ? 295 GLU A CB    1 
ATOM   3739  C  CG    . GLU B 2  294 ? 21.120  52.747  9.204  1.00 82.21  ? 295 GLU A CG    1 
ATOM   3740  C  CD    . GLU B 2  294 ? 21.667  52.790  7.797  1.00 89.65  ? 295 GLU A CD    1 
ATOM   3741  O  OE1   . GLU B 2  294 ? 22.635  52.053  7.514  1.00 92.38  ? 295 GLU A OE1   1 
ATOM   3742  O  OE2   . GLU B 2  294 ? 21.122  53.555  6.972  1.00 95.16  ? 295 GLU A OE2   1 
ATOM   3743  N  N     . THR B 2  295 ? 20.781  49.516  12.901 1.00 66.91  ? 296 THR A N     1 
ATOM   3744  C  CA    . THR B 2  295 ? 20.596  48.177  13.438 1.00 63.20  ? 296 THR A CA    1 
ATOM   3745  C  C     . THR B 2  295 ? 19.192  47.680  13.137 1.00 67.77  ? 296 THR A C     1 
ATOM   3746  O  O     . THR B 2  295 ? 18.208  48.414  13.264 1.00 66.69  ? 296 THR A O     1 
ATOM   3747  C  CB    . THR B 2  295 ? 20.847  48.164  14.945 1.00 65.97  ? 296 THR A CB    1 
ATOM   3748  O  OG1   . THR B 2  295 ? 22.202  48.569  15.202 1.00 81.03  ? 296 THR A OG1   1 
ATOM   3749  C  CG2   . THR B 2  295 ? 20.619  46.786  15.537 1.00 67.03  ? 296 THR A CG2   1 
ATOM   3750  N  N     . SER B 2  296 ? 19.118  46.419  12.738 1.00 76.05  ? 297 SER A N     1 
ATOM   3751  C  CA    . SER B 2  296 ? 17.875  45.720  12.484 1.00 77.86  ? 297 SER A CA    1 
ATOM   3752  C  C     . SER B 2  296 ? 18.174  44.259  12.743 1.00 90.73  ? 297 SER A C     1 
ATOM   3753  O  O     . SER B 2  296 ? 19.325  43.823  12.654 1.00 90.84  ? 297 SER A O     1 
ATOM   3754  C  CB    . SER B 2  296 ? 17.393  45.908  11.051 1.00 82.59  ? 297 SER A CB    1 
ATOM   3755  O  OG    . SER B 2  296 ? 18.009  44.942  10.218 1.00 95.69  ? 297 SER A OG    1 
ATOM   3756  N  N     . LEU B 2  297 ? 17.134  43.497  13.055 1.00 105.84 ? 298 LEU A N     1 
ATOM   3757  C  CA    . LEU B 2  297 ? 17.353  42.095  13.390 1.00 106.00 ? 298 LEU A CA    1 
ATOM   3758  C  C     . LEU B 2  297 ? 17.923  41.356  12.197 1.00 100.55 ? 298 LEU A C     1 
ATOM   3759  O  O     . LEU B 2  297 ? 18.833  40.528  12.333 1.00 100.17 ? 298 LEU A O     1 
ATOM   3760  C  CB    . LEU B 2  297 ? 16.045  41.459  13.859 1.00 110.60 ? 298 LEU A CB    1 
ATOM   3761  C  CG    . LEU B 2  297 ? 15.186  42.391  14.724 1.00 113.24 ? 298 LEU A CG    1 
ATOM   3762  C  CD1   . LEU B 2  297 ? 14.164  41.605  15.524 1.00 105.75 ? 298 LEU A CD1   1 
ATOM   3763  C  CD2   . LEU B 2  297 ? 16.026  43.241  15.683 1.00 112.59 ? 298 LEU A CD2   1 
ATOM   3764  N  N     . ARG B 2  298 ? 17.442  41.703  11.009 1.00 100.06 ? 299 ARG A N     1 
ATOM   3765  C  CA    . ARG B 2  298 ? 17.879  41.051  9.786  1.00 107.02 ? 299 ARG A CA    1 
ATOM   3766  C  C     . ARG B 2  298 ? 19.313  41.422  9.452  1.00 96.80  ? 299 ARG A C     1 
ATOM   3767  O  O     . ARG B 2  298 ? 20.101  40.557  9.049  1.00 96.64  ? 299 ARG A O     1 
ATOM   3768  C  CB    . ARG B 2  298 ? 16.936  41.426  8.638  1.00 131.00 ? 299 ARG A CB    1 
ATOM   3769  C  CG    . ARG B 2  298 ? 15.497  40.952  8.809  1.00 139.85 ? 299 ARG A CG    1 
ATOM   3770  C  CD    . ARG B 2  298 ? 14.782  41.574  10.010 1.00 142.88 ? 299 ARG A CD    1 
ATOM   3771  N  NE    . ARG B 2  298 ? 14.759  43.031  9.941  1.00 149.56 ? 299 ARG A NE    1 
ATOM   3772  C  CZ    . ARG B 2  298 ? 14.043  43.800  10.754 1.00 151.01 ? 299 ARG A CZ    1 
ATOM   3773  N  NH1   . ARG B 2  298 ? 13.308  43.248  11.709 1.00 148.62 ? 299 ARG A NH1   1 
ATOM   3774  N  NH2   . ARG B 2  298 ? 14.054  45.117  10.609 1.00 152.69 ? 299 ARG A NH2   1 
ATOM   3775  N  N     . THR B 2  299 ? 19.674  42.698  9.616  1.00 101.39 ? 300 THR A N     1 
ATOM   3776  C  CA    . THR B 2  299 ? 20.996  43.211  9.247  1.00 98.22  ? 300 THR A CA    1 
ATOM   3777  C  C     . THR B 2  299 ? 22.022  43.105  10.368 1.00 89.00  ? 300 THR A C     1 
ATOM   3778  O  O     . THR B 2  299 ? 23.224  43.265  10.113 1.00 79.36  ? 300 THR A O     1 
ATOM   3779  C  CB    . THR B 2  299 ? 20.903  44.688  8.823  1.00 102.11 ? 300 THR A CB    1 
ATOM   3780  O  OG1   . THR B 2  299 ? 19.929  44.830  7.786  1.00 131.36 ? 300 THR A OG1   1 
ATOM   3781  C  CG2   . THR B 2  299 ? 22.234  45.191  8.295  1.00 99.32  ? 300 THR A CG2   1 
ATOM   3782  N  N     . GLY B 2  300 ? 21.602  42.853  11.589 1.00 89.51  ? 301 GLY A N     1 
ATOM   3783  C  CA    . GLY B 2  300 ? 22.555  42.889  12.678 1.00 86.95  ? 301 GLY A CA    1 
ATOM   3784  C  C     . GLY B 2  300 ? 22.762  44.316  13.145 1.00 85.88  ? 301 GLY A C     1 
ATOM   3785  O  O     . GLY B 2  300 ? 21.985  45.222  12.822 1.00 90.27  ? 301 GLY A O     1 
ATOM   3786  N  N     . VAL B 2  301 ? 23.832  44.518  13.905 1.00 75.24  ? 302 VAL A N     1 
ATOM   3787  C  CA    . VAL B 2  301 ? 24.149  45.844  14.433 1.00 72.41  ? 302 VAL A CA    1 
ATOM   3788  C  C     . VAL B 2  301 ? 24.771  46.687  13.333 1.00 81.45  ? 302 VAL A C     1 
ATOM   3789  O  O     . VAL B 2  301 ? 25.772  46.294  12.729 1.00 91.09  ? 302 VAL A O     1 
ATOM   3790  C  CB    . VAL B 2  301 ? 25.098  45.748  15.633 1.00 56.22  ? 302 VAL A CB    1 
ATOM   3791  C  CG1   . VAL B 2  301 ? 25.777  47.086  15.861 1.00 50.46  ? 302 VAL A CG1   1 
ATOM   3792  C  CG2   . VAL B 2  301 ? 24.358  45.317  16.865 1.00 60.67  ? 302 VAL A CG2   1 
ATOM   3793  N  N     . ARG B 2  302 ? 24.226  47.876  13.112 1.00 72.02  ? 303 ARG A N     1 
ATOM   3794  C  CA    . ARG B 2  302 ? 24.806  48.792  12.139 1.00 57.96  ? 303 ARG A CA    1 
ATOM   3795  C  C     . ARG B 2  302 ? 24.634  50.211  12.641 1.00 61.62  ? 303 ARG A C     1 
ATOM   3796  O  O     . ARG B 2  302 ? 23.509  50.705  12.743 1.00 62.44  ? 303 ARG A O     1 
ATOM   3797  C  CB    . ARG B 2  302 ? 24.161  48.623  10.767 1.00 52.37  ? 303 ARG A CB    1 
ATOM   3798  C  CG    . ARG B 2  302 ? 24.814  49.431  9.679  1.00 52.24  ? 303 ARG A CG    1 
ATOM   3799  C  CD    . ARG B 2  302 ? 24.186  49.120  8.342  1.00 52.22  ? 303 ARG A CD    1 
ATOM   3800  N  NE    . ARG B 2  302 ? 24.697  49.990  7.294  1.00 53.34  ? 303 ARG A NE    1 
ATOM   3801  C  CZ    . ARG B 2  302 ? 25.728  49.685  6.516  1.00 60.20  ? 303 ARG A CZ    1 
ATOM   3802  N  NH1   . ARG B 2  302 ? 26.347  48.522  6.673  1.00 77.91  ? 303 ARG A NH1   1 
ATOM   3803  N  NH2   . ARG B 2  302 ? 26.137  50.538  5.585  1.00 53.59  ? 303 ARG A NH2   1 
ATOM   3804  N  N     . VAL B 2  303 ? 25.740  50.861  12.967 1.00 58.64  ? 304 VAL A N     1 
ATOM   3805  C  CA    . VAL B 2  303 ? 25.723  52.259  13.375 1.00 61.30  ? 304 VAL A CA    1 
ATOM   3806  C  C     . VAL B 2  303 ? 26.491  53.045  12.329 1.00 61.49  ? 304 VAL A C     1 
ATOM   3807  O  O     . VAL B 2  303 ? 27.640  52.712  12.018 1.00 58.87  ? 304 VAL A O     1 
ATOM   3808  C  CB    . VAL B 2  303 ? 26.322  52.460  14.776 1.00 56.65  ? 304 VAL A CB    1 
ATOM   3809  C  CG1   . VAL B 2  303 ? 26.199  53.917  15.189 1.00 52.37  ? 304 VAL A CG1   1 
ATOM   3810  C  CG2   . VAL B 2  303 ? 25.617  51.572  15.780 1.00 53.40  ? 304 VAL A CG2   1 
ATOM   3811  N  N     . VAL B 2  304 ? 25.857  54.078  11.782 1.00 56.23  ? 305 VAL A N     1 
ATOM   3812  C  CA    . VAL B 2  304 ? 26.394  54.812  10.643 1.00 59.27  ? 305 VAL A CA    1 
ATOM   3813  C  C     . VAL B 2  304 ? 26.681  56.239  11.059 1.00 66.03  ? 305 VAL A C     1 
ATOM   3814  O  O     . VAL B 2  304 ? 25.797  56.930  11.572 1.00 66.30  ? 305 VAL A O     1 
ATOM   3815  C  CB    . VAL B 2  304 ? 25.440  54.791  9.444  1.00 58.08  ? 305 VAL A CB    1 
ATOM   3816  C  CG1   . VAL B 2  304 ? 26.053  55.589  8.313  1.00 63.89  ? 305 VAL A CG1   1 
ATOM   3817  C  CG2   . VAL B 2  304 ? 25.181  53.372  9.029  1.00 62.76  ? 305 VAL A CG2   1 
ATOM   3818  N  N     . ILE B 2  305 ? 27.898  56.691  10.776 1.00 72.48  ? 306 ILE A N     1 
ATOM   3819  C  CA    . ILE B 2  305 ? 28.336  58.056  11.031 1.00 71.93  ? 306 ILE A CA    1 
ATOM   3820  C  C     . ILE B 2  305 ? 28.740  58.678  9.703  1.00 73.60  ? 306 ILE A C     1 
ATOM   3821  O  O     . ILE B 2  305 ? 29.560  58.104  8.978  1.00 80.07  ? 306 ILE A O     1 
ATOM   3822  C  CB    . ILE B 2  305 ? 29.515  58.077  12.016 1.00 67.78  ? 306 ILE A CB    1 
ATOM   3823  C  CG1   . ILE B 2  305 ? 29.167  57.277  13.269 1.00 64.39  ? 306 ILE A CG1   1 
ATOM   3824  C  CG2   . ILE B 2  305 ? 29.881  59.483  12.362 1.00 72.70  ? 306 ILE A CG2   1 
ATOM   3825  C  CD1   . ILE B 2  305 ? 30.368  56.874  14.056 1.00 64.71  ? 306 ILE A CD1   1 
ATOM   3826  N  N     . ASP B 2  306 ? 28.198  59.853  9.391  1.00 71.57  ? 307 ASP A N     1 
ATOM   3827  C  CA    . ASP B 2  306 ? 28.456  60.493  8.101  1.00 74.14  ? 307 ASP A CA    1 
ATOM   3828  C  C     . ASP B 2  306 ? 29.480  61.610  8.246  1.00 74.50  ? 307 ASP A C     1 
ATOM   3829  O  O     . ASP B 2  306 ? 29.163  62.695  8.735  1.00 99.20  ? 307 ASP A O     1 
ATOM   3830  C  CB    . ASP B 2  306 ? 27.161  61.003  7.475  1.00 84.96  ? 307 ASP A CB    1 
ATOM   3831  C  CG    . ASP B 2  306 ? 26.430  59.925  6.714  1.00 96.27  ? 307 ASP A CG    1 
ATOM   3832  O  OD1   . ASP B 2  306 ? 27.027  58.850  6.480  1.00 105.17 ? 307 ASP A OD1   1 
ATOM   3833  O  OD2   . ASP B 2  306 ? 25.262  60.152  6.348  1.00 98.35  ? 307 ASP A OD2   1 
ATOM   3834  N  N     . VAL B 2  307 ? 30.689  61.351  7.746  1.00 71.32  ? 308 VAL A N     1 
ATOM   3835  C  CA    . VAL B 2  307 ? 31.769  62.330  7.753  1.00 68.71  ? 308 VAL A CA    1 
ATOM   3836  C  C     . VAL B 2  307 ? 31.502  63.434  6.735  1.00 74.66  ? 308 VAL A C     1 
ATOM   3837  O  O     . VAL B 2  307 ? 30.977  63.187  5.641  1.00 77.62  ? 308 VAL A O     1 
ATOM   3838  C  CB    . VAL B 2  307 ? 33.100  61.625  7.450  1.00 65.47  ? 308 VAL A CB    1 
ATOM   3839  C  CG1   . VAL B 2  307 ? 34.254  62.530  7.708  1.00 69.29  ? 308 VAL A CG1   1 
ATOM   3840  C  CG2   . VAL B 2  307 ? 33.204  60.348  8.235  1.00 68.44  ? 308 VAL A CG2   1 
ATOM   3841  N  N     . ARG B 2  308 ? 31.895  64.660  7.084  1.00 75.20  ? 309 ARG A N     1 
ATOM   3842  C  CA    . ARG B 2  308 ? 31.786  65.796  6.174  1.00 80.01  ? 309 ARG A CA    1 
ATOM   3843  C  C     . ARG B 2  308 ? 32.709  65.617  4.974  1.00 86.01  ? 309 ARG A C     1 
ATOM   3844  O  O     . ARG B 2  308 ? 33.778  65.009  5.069  1.00 84.11  ? 309 ARG A O     1 
ATOM   3845  C  CB    . ARG B 2  308 ? 32.122  67.094  6.910  1.00 82.79  ? 309 ARG A CB    1 
ATOM   3846  C  CG    . ARG B 2  308 ? 31.850  68.366  6.124  1.00 90.21  ? 309 ARG A CG    1 
ATOM   3847  C  CD    . ARG B 2  308 ? 32.256  69.612  6.907  1.00 93.08  ? 309 ARG A CD    1 
ATOM   3848  N  NE    . ARG B 2  308 ? 33.650  69.561  7.340  1.00 95.96  ? 309 ARG A NE    1 
ATOM   3849  C  CZ    . ARG B 2  308 ? 34.033  69.483  8.612  1.00 103.35 ? 309 ARG A CZ    1 
ATOM   3850  N  NH1   . ARG B 2  308 ? 33.121  69.462  9.577  1.00 108.30 ? 309 ARG A NH1   1 
ATOM   3851  N  NH2   . ARG B 2  308 ? 35.325  69.437  8.923  1.00 95.45  ? 309 ARG A NH2   1 
ATOM   3852  N  N     . LYS B 2  309 ? 32.282  66.146  3.828  1.00 85.03  ? 310 LYS A N     1 
ATOM   3853  C  CA    . LYS B 2  309 ? 33.073  65.975  2.615  1.00 80.28  ? 310 LYS A CA    1 
ATOM   3854  C  C     . LYS B 2  309 ? 34.468  66.568  2.785  1.00 85.94  ? 310 LYS A C     1 
ATOM   3855  O  O     . LYS B 2  309 ? 34.638  67.642  3.375  1.00 90.00  ? 310 LYS A O     1 
ATOM   3856  C  CB    . LYS B 2  309 ? 32.368  66.607  1.412  1.00 83.86  ? 310 LYS A CB    1 
ATOM   3857  C  CG    . LYS B 2  309 ? 33.019  66.261  0.081  1.00 86.19  ? 310 LYS A CG    1 
ATOM   3858  C  CD    . LYS B 2  309 ? 32.419  67.095  -1.036 1.00 91.83  ? 310 LYS A CD    1 
ATOM   3859  C  CE    . LYS B 2  309 ? 32.740  66.501  -2.392 1.00 95.14  ? 310 LYS A CE    1 
ATOM   3860  N  NZ    . LYS B 2  309 ? 34.175  66.134  -2.509 1.00 95.50  ? 310 LYS A NZ    1 
ATOM   3861  N  N     . ASP B 2  310 ? 35.466  65.832  2.270  1.00 84.02  ? 311 ASP A N     1 
ATOM   3862  C  CA    . ASP B 2  310 ? 36.892  66.202  2.284  1.00 91.58  ? 311 ASP A CA    1 
ATOM   3863  C  C     . ASP B 2  310 ? 37.458  66.351  3.698  1.00 87.28  ? 311 ASP A C     1 
ATOM   3864  O  O     . ASP B 2  310 ? 38.406  67.105  3.924  1.00 91.05  ? 311 ASP A O     1 
ATOM   3865  C  CB    . ASP B 2  310 ? 37.154  67.467  1.462  1.00 111.53 ? 311 ASP A CB    1 
ATOM   3866  C  CG    . ASP B 2  310 ? 37.053  67.219  -0.033 1.00 118.03 ? 311 ASP A CG    1 
ATOM   3867  O  OD1   . ASP B 2  310 ? 37.371  66.089  -0.473 1.00 116.51 ? 311 ASP A OD1   1 
ATOM   3868  O  OD2   . ASP B 2  310 ? 36.640  68.150  -0.766 1.00 120.43 ? 311 ASP A OD2   1 
ATOM   3869  N  N     . ALA B 2  311 ? 36.896  65.621  4.653  1.00 83.13  ? 312 ALA A N     1 
ATOM   3870  C  CA    . ALA B 2  311 ? 37.393  65.550  6.020  1.00 78.37  ? 312 ALA A CA    1 
ATOM   3871  C  C     . ALA B 2  311 ? 38.060  64.196  6.206  1.00 74.59  ? 312 ALA A C     1 
ATOM   3872  O  O     . ALA B 2  311 ? 37.706  63.242  5.520  1.00 79.47  ? 312 ALA A O     1 
ATOM   3873  C  CB    . ALA B 2  311 ? 36.247  65.726  7.020  1.00 83.36  ? 312 ALA A CB    1 
ATOM   3874  N  N     . ASN B 2  312 ? 39.029  64.066  7.103  1.00 72.89  ? 313 ASN A N     1 
ATOM   3875  C  CA    . ASN B 2  312 ? 39.699  62.762  7.166  1.00 74.42  ? 313 ASN A CA    1 
ATOM   3876  C  C     . ASN B 2  312 ? 38.910  61.831  8.073  1.00 85.02  ? 313 ASN A C     1 
ATOM   3877  O  O     . ASN B 2  312 ? 38.828  62.060  9.277  1.00 85.49  ? 313 ASN A O     1 
ATOM   3878  C  CB    . ASN B 2  312 ? 41.153  62.899  7.614  1.00 67.92  ? 313 ASN A CB    1 
ATOM   3879  C  CG    . ASN B 2  312 ? 41.879  61.563  7.589  1.00 66.93  ? 313 ASN A CG    1 
ATOM   3880  O  OD1   . ASN B 2  312 ? 41.369  60.585  8.114  1.00 66.06  ? 313 ASN A OD1   1 
ATOM   3881  N  ND2   . ASN B 2  312 ? 43.060  61.509  6.957  1.00 65.45  ? 313 ASN A ND2   1 
ATOM   3882  N  N     . ALA B 2  313 ? 38.356  60.751  7.505  1.00 81.58  ? 314 ALA A N     1 
ATOM   3883  C  CA    . ALA B 2  313 ? 37.510  59.863  8.302  1.00 79.42  ? 314 ALA A CA    1 
ATOM   3884  C  C     . ALA B 2  313 ? 38.297  59.033  9.309  1.00 75.74  ? 314 ALA A C     1 
ATOM   3885  O  O     . ALA B 2  313 ? 37.744  58.664  10.351 1.00 82.55  ? 314 ALA A O     1 
ATOM   3886  C  CB    . ALA B 2  313 ? 36.684  58.938  7.404  1.00 83.02  ? 314 ALA A CB    1 
ATOM   3887  N  N     . SER B 2  314 ? 39.555  58.705  9.008  1.00 71.81  ? 315 SER A N     1 
ATOM   3888  C  CA    . SER B 2  314 ? 40.354  57.888  9.919  1.00 71.77  ? 315 SER A CA    1 
ATOM   3889  C  C     . SER B 2  314 ? 40.661  58.637  11.208 1.00 68.83  ? 315 SER A C     1 
ATOM   3890  O  O     . SER B 2  314 ? 40.677  58.043  12.299 1.00 60.85  ? 315 SER A O     1 
ATOM   3891  C  CB    . SER B 2  314 ? 41.652  57.451  9.229  1.00 69.86  ? 315 SER A CB    1 
ATOM   3892  O  OG    . SER B 2  314 ? 41.424  56.559  8.152  1.00 64.52  ? 315 SER A OG    1 
ATOM   3893  N  N     . VAL B 2  315 ? 40.917  59.946  11.085 1.00 63.70  ? 316 VAL A N     1 
ATOM   3894  C  CA    . VAL B 2  315 ? 41.140  60.812  12.240 1.00 66.22  ? 316 VAL A CA    1 
ATOM   3895  C  C     . VAL B 2  315 ? 39.890  60.907  13.105 1.00 68.41  ? 316 VAL A C     1 
ATOM   3896  O  O     . VAL B 2  315 ? 39.954  60.880  14.344 1.00 80.13  ? 316 VAL A O     1 
ATOM   3897  C  CB    . VAL B 2  315 ? 41.562  62.207  11.759 1.00 65.97  ? 316 VAL A CB    1 
ATOM   3898  C  CG1   . VAL B 2  315 ? 41.224  63.260  12.810 1.00 71.48  ? 316 VAL A CG1   1 
ATOM   3899  C  CG2   . VAL B 2  315 ? 43.026  62.232  11.414 1.00 67.62  ? 316 VAL A CG2   1 
ATOM   3900  N  N     . ILE B 2  316 ? 38.737  61.074  12.464 1.00 70.36  ? 317 ILE A N     1 
ATOM   3901  C  CA    . ILE B 2  316 ? 37.481  61.158  13.197 1.00 71.06  ? 317 ILE A CA    1 
ATOM   3902  C  C     . ILE B 2  316 ? 37.233  59.875  13.960 1.00 72.83  ? 317 ILE A C     1 
ATOM   3903  O  O     . ILE B 2  316 ? 36.762  59.892  15.102 1.00 79.48  ? 317 ILE A O     1 
ATOM   3904  C  CB    . ILE B 2  316 ? 36.320  61.443  12.235 1.00 72.79  ? 317 ILE A CB    1 
ATOM   3905  C  CG1   . ILE B 2  316 ? 36.628  62.660  11.366 1.00 73.84  ? 317 ILE A CG1   1 
ATOM   3906  C  CG2   . ILE B 2  316 ? 35.046  61.633  13.034 1.00 73.96  ? 317 ILE A CG2   1 
ATOM   3907  C  CD1   . ILE B 2  316 ? 35.427  63.209  10.715 1.00 75.25  ? 317 ILE A CD1   1 
ATOM   3908  N  N     . LEU B 2  317 ? 37.492  58.740  13.315 1.00 73.90  ? 318 LEU A N     1 
ATOM   3909  C  CA    . LEU B 2  317 ? 37.300  57.451  13.964 1.00 76.37  ? 318 LEU A CA    1 
ATOM   3910  C  C     . LEU B 2  317 ? 38.179  57.333  15.195 1.00 84.53  ? 318 LEU A C     1 
ATOM   3911  O  O     . LEU B 2  317 ? 37.724  56.886  16.253 1.00 86.06  ? 318 LEU A O     1 
ATOM   3912  C  CB    . LEU B 2  317 ? 37.605  56.325  12.975 1.00 74.69  ? 318 LEU A CB    1 
ATOM   3913  C  CG    . LEU B 2  317 ? 37.518  54.903  13.515 1.00 72.16  ? 318 LEU A CG    1 
ATOM   3914  C  CD1   . LEU B 2  317 ? 36.094  54.595  13.916 1.00 70.32  ? 318 LEU A CD1   1 
ATOM   3915  C  CD2   . LEU B 2  317 ? 38.010  53.920  12.478 1.00 74.06  ? 318 LEU A CD2   1 
ATOM   3916  N  N     . ASN B 2  318 ? 39.446  57.734  15.076 1.00 82.26  ? 319 ASN A N     1 
ATOM   3917  C  CA    . ASN B 2  318 ? 40.368  57.632  16.199 1.00 74.30  ? 319 ASN A CA    1 
ATOM   3918  C  C     . ASN B 2  318 ? 39.910  58.491  17.364 1.00 75.31  ? 319 ASN A C     1 
ATOM   3919  O  O     . ASN B 2  318 ? 40.010  58.081  18.526 1.00 73.18  ? 319 ASN A O     1 
ATOM   3920  C  CB    . ASN B 2  318 ? 41.767  58.033  15.755 1.00 70.55  ? 319 ASN A CB    1 
ATOM   3921  C  CG    . ASN B 2  318 ? 42.440  56.955  14.975 1.00 79.05  ? 319 ASN A CG    1 
ATOM   3922  O  OD1   . ASN B 2  318 ? 42.729  55.887  15.507 1.00 84.32  ? 319 ASN A OD1   1 
ATOM   3923  N  ND2   . ASN B 2  318 ? 42.700  57.218  13.701 1.00 96.10  ? 319 ASN A ND2   1 
ATOM   3924  N  N     . ASN B 2  319 ? 39.416  59.692  17.072 1.00 74.11  ? 320 ASN A N     1 
ATOM   3925  C  CA    . ASN B 2  319 ? 38.889  60.550  18.125 1.00 80.02  ? 320 ASN A CA    1 
ATOM   3926  C  C     . ASN B 2  319 ? 37.705  59.893  18.806 1.00 86.66  ? 320 ASN A C     1 
ATOM   3927  O  O     . ASN B 2  319 ? 37.575  59.939  20.032 1.00 102.89 ? 320 ASN A O     1 
ATOM   3928  C  CB    . ASN B 2  319 ? 38.488  61.907  17.552 1.00 83.50  ? 320 ASN A CB    1 
ATOM   3929  C  CG    . ASN B 2  319 ? 39.677  62.706  17.069 1.00 81.44  ? 320 ASN A CG    1 
ATOM   3930  O  OD1   . ASN B 2  319 ? 40.830  62.317  17.277 1.00 82.38  ? 320 ASN A OD1   1 
ATOM   3931  N  ND2   . ASN B 2  319 ? 39.405  63.844  16.434 1.00 80.93  ? 320 ASN A ND2   1 
ATOM   3932  N  N     . LEU B 2  320 ? 36.837  59.261  18.019 1.00 80.52  ? 321 LEU A N     1 
ATOM   3933  C  CA    . LEU B 2  320 ? 35.699  58.560  18.592 1.00 74.12  ? 321 LEU A CA    1 
ATOM   3934  C  C     . LEU B 2  320 ? 36.150  57.462  19.541 1.00 75.83  ? 321 LEU A C     1 
ATOM   3935  O  O     . LEU B 2  320 ? 35.587  57.311  20.618 1.00 103.47 ? 321 LEU A O     1 
ATOM   3936  C  CB    . LEU B 2  320 ? 34.820  57.994  17.486 1.00 73.77  ? 321 LEU A CB    1 
ATOM   3937  C  CG    . LEU B 2  320 ? 33.932  59.030  16.816 1.00 75.32  ? 321 LEU A CG    1 
ATOM   3938  C  CD1   . LEU B 2  320 ? 33.318  58.475  15.551 1.00 69.41  ? 321 LEU A CD1   1 
ATOM   3939  C  CD2   . LEU B 2  320 ? 32.854  59.465  17.795 1.00 74.91  ? 321 LEU A CD2   1 
ATOM   3940  N  N     . TYR B 2  321 ? 37.162  56.682  19.187 1.00 64.51  ? 322 TYR A N     1 
ATOM   3941  C  CA    . TYR B 2  321 ? 37.651  55.692  20.147 1.00 64.27  ? 322 TYR A CA    1 
ATOM   3942  C  C     . TYR B 2  321 ? 38.129  56.344  21.432 1.00 69.67  ? 322 TYR A C     1 
ATOM   3943  O  O     . TYR B 2  321 ? 37.977  55.798  22.536 1.00 85.00  ? 322 TYR A O     1 
ATOM   3944  C  CB    . TYR B 2  321 ? 38.827  54.944  19.565 1.00 64.73  ? 322 TYR A CB    1 
ATOM   3945  C  CG    . TYR B 2  321 ? 38.552  53.993  18.455 1.00 62.38  ? 322 TYR A CG    1 
ATOM   3946  C  CD1   . TYR B 2  321 ? 37.376  53.267  18.395 1.00 71.31  ? 322 TYR A CD1   1 
ATOM   3947  C  CD2   . TYR B 2  321 ? 39.500  53.794  17.474 1.00 62.04  ? 322 TYR A CD2   1 
ATOM   3948  C  CE1   . TYR B 2  321 ? 37.151  52.375  17.367 1.00 60.69  ? 322 TYR A CE1   1 
ATOM   3949  C  CE2   . TYR B 2  321 ? 39.290  52.915  16.449 1.00 68.83  ? 322 TYR A CE2   1 
ATOM   3950  C  CZ    . TYR B 2  321 ? 38.110  52.204  16.395 1.00 69.68  ? 322 TYR A CZ    1 
ATOM   3951  O  OH    . TYR B 2  321 ? 37.896  51.318  15.360 1.00 78.06  ? 322 TYR A OH    1 
ATOM   3952  N  N     . LYS B 2  322 ? 38.767  57.499  21.277 1.00 70.00  ? 323 LYS A N     1 
ATOM   3953  C  CA    . LYS B 2  322 ? 39.430  58.211  22.356 1.00 65.92  ? 323 LYS A CA    1 
ATOM   3954  C  C     . LYS B 2  322 ? 38.431  58.904  23.257 1.00 66.36  ? 323 LYS A C     1 
ATOM   3955  O  O     . LYS B 2  322 ? 38.627  58.969  24.474 1.00 67.16  ? 323 LYS A O     1 
ATOM   3956  C  CB    . LYS B 2  322 ? 40.389  59.230  21.741 1.00 74.67  ? 323 LYS A CB    1 
ATOM   3957  C  CG    . LYS B 2  322 ? 41.525  59.629  22.627 1.00 87.87  ? 323 LYS A CG    1 
ATOM   3958  C  CD    . LYS B 2  322 ? 42.462  60.568  21.904 1.00 87.80  ? 323 LYS A CD    1 
ATOM   3959  C  CE    . LYS B 2  322 ? 41.759  61.885  21.583 1.00 90.72  ? 323 LYS A CE    1 
ATOM   3960  N  NZ    . LYS B 2  322 ? 42.654  62.807  20.820 1.00 106.46 ? 323 LYS A NZ    1 
ATOM   3961  N  N     . GLN B 2  323 ? 37.385  59.480  22.687 1.00 69.01  ? 324 GLN A N     1 
ATOM   3962  C  CA    . GLN B 2  323 ? 36.463  60.280  23.480 1.00 72.40  ? 324 GLN A CA    1 
ATOM   3963  C  C     . GLN B 2  323 ? 35.146  59.563  23.697 1.00 71.48  ? 324 GLN A C     1 
ATOM   3964  O  O     . GLN B 2  323 ? 34.148  60.183  24.093 1.00 77.35  ? 324 GLN A O     1 
ATOM   3965  C  CB    . GLN B 2  323 ? 36.226  61.633  22.834 1.00 85.92  ? 324 GLN A CB    1 
ATOM   3966  C  CG    . GLN B 2  323 ? 37.369  62.071  21.983 1.00 95.55  ? 324 GLN A CG    1 
ATOM   3967  C  CD    . GLN B 2  323 ? 37.085  63.392  21.361 1.00 104.46 ? 324 GLN A CD    1 
ATOM   3968  O  OE1   . GLN B 2  323 ? 36.021  63.967  21.598 1.00 103.63 ? 324 GLN A OE1   1 
ATOM   3969  N  NE2   . GLN B 2  323 ? 38.030  63.905  20.573 1.00 106.68 ? 324 GLN A NE2   1 
ATOM   3970  N  N     . THR B 2  324 ? 35.119  58.280  23.422 1.00 71.33  ? 325 THR A N     1 
ATOM   3971  C  CA    . THR B 2  324 ? 33.867  57.569  23.532 1.00 68.33  ? 325 THR A CA    1 
ATOM   3972  C  C     . THR B 2  324 ? 34.061  56.157  24.043 1.00 70.94  ? 325 THR A C     1 
ATOM   3973  O  O     . THR B 2  324 ? 35.184  55.644  24.175 1.00 92.35  ? 325 THR A O     1 
ATOM   3974  C  CB    . THR B 2  324 ? 33.117  57.492  22.197 1.00 77.69  ? 325 THR A CB    1 
ATOM   3975  O  OG1   . THR B 2  324 ? 34.048  57.380  21.149 1.00 108.82 ? 325 THR A OG1   1 
ATOM   3976  C  CG2   . THR B 2  324 ? 32.297  58.668  21.941 1.00 74.83  ? 325 THR A CG2   1 
ATOM   3977  N  N     . PRO B 2  325 ? 32.930  55.535  24.373 1.00 69.05  ? 326 PRO A N     1 
ATOM   3978  C  CA    . PRO B 2  325 ? 32.884  54.121  24.755 1.00 61.45  ? 326 PRO A CA    1 
ATOM   3979  C  C     . PRO B 2  325 ? 33.101  53.158  23.601 1.00 65.80  ? 326 PRO A C     1 
ATOM   3980  O  O     . PRO B 2  325 ? 32.968  51.940  23.788 1.00 77.08  ? 326 PRO A O     1 
ATOM   3981  C  CB    . PRO B 2  325 ? 31.453  53.998  25.287 1.00 58.12  ? 326 PRO A CB    1 
ATOM   3982  C  CG    . PRO B 2  325 ? 30.956  55.424  25.431 1.00 63.00  ? 326 PRO A CG    1 
ATOM   3983  C  CD    . PRO B 2  325 ? 31.588  56.149  24.427 1.00 65.54  ? 326 PRO A CD    1 
ATOM   3984  N  N     . LEU B 2  326 ? 33.366  53.696  22.404 1.00 67.82  ? 327 LEU A N     1 
ATOM   3985  C  CA    . LEU B 2  326 ? 33.631  52.872  21.237 1.00 64.66  ? 327 LEU A CA    1 
ATOM   3986  C  C     . LEU B 2  326 ? 34.819  51.968  21.488 1.00 61.56  ? 327 LEU A C     1 
ATOM   3987  O  O     . LEU B 2  326 ? 34.807  50.788  21.122 1.00 72.78  ? 327 LEU A O     1 
ATOM   3988  C  CB    . LEU B 2  326 ? 33.903  53.761  20.035 1.00 70.91  ? 327 LEU A CB    1 
ATOM   3989  C  CG    . LEU B 2  326 ? 33.311  53.285  18.716 1.00 78.97  ? 327 LEU A CG    1 
ATOM   3990  C  CD1   . LEU B 2  326 ? 31.867  53.676  18.649 1.00 83.22  ? 327 LEU A CD1   1 
ATOM   3991  C  CD2   . LEU B 2  326 ? 34.062  53.872  17.544 1.00 86.00  ? 327 LEU A CD2   1 
ATOM   3992  N  N     . GLN B 2  327 ? 35.875  52.515  22.063 1.00 60.85  ? 328 GLN A N     1 
ATOM   3993  C  CA    . GLN B 2  327 ? 36.960  51.721  22.600 1.00 63.73  ? 328 GLN A CA    1 
ATOM   3994  C  C     . GLN B 2  327 ? 36.833  51.813  24.107 1.00 69.12  ? 328 GLN A C     1 
ATOM   3995  O  O     . GLN B 2  327 ? 36.822  52.912  24.667 1.00 83.56  ? 328 GLN A O     1 
ATOM   3996  C  CB    . GLN B 2  327 ? 38.316  52.226  22.137 1.00 64.33  ? 328 GLN A CB    1 
ATOM   3997  C  CG    . GLN B 2  327 ? 39.429  51.717  23.013 1.00 58.71  ? 328 GLN A CG    1 
ATOM   3998  C  CD    . GLN B 2  327 ? 40.782  51.871  22.389 1.00 67.79  ? 328 GLN A CD    1 
ATOM   3999  O  OE1   . GLN B 2  327 ? 40.909  52.368  21.271 1.00 74.71  ? 328 GLN A OE1   1 
ATOM   4000  N  NE2   . GLN B 2  327 ? 41.812  51.437  23.104 1.00 79.83  ? 328 GLN A NE2   1 
ATOM   4001  N  N     . THR B 2  328 ? 36.667  50.678  24.753 1.00 60.23  ? 329 THR A N     1 
ATOM   4002  C  CA    . THR B 2  328 ? 36.534  50.638  26.194 1.00 58.79  ? 329 THR A CA    1 
ATOM   4003  C  C     . THR B 2  328 ? 37.489  49.584  26.701 1.00 62.09  ? 329 THR A C     1 
ATOM   4004  O  O     . THR B 2  328 ? 37.865  48.662  25.977 1.00 76.55  ? 329 THR A O     1 
ATOM   4005  C  CB    . THR B 2  328 ? 35.095  50.338  26.617 1.00 61.73  ? 329 THR A CB    1 
ATOM   4006  O  OG1   . THR B 2  328 ? 34.205  51.095  25.794 1.00 89.07  ? 329 THR A OG1   1 
ATOM   4007  C  CG2   . THR B 2  328 ? 34.859  50.733  28.059 1.00 66.98  ? 329 THR A CG2   1 
ATOM   4008  N  N     . SER B 2  329 ? 37.910  49.756  27.935 1.00 57.71  ? 330 SER A N     1 
ATOM   4009  C  CA    . SER B 2  329 ? 38.825  48.828  28.558 1.00 60.85  ? 330 SER A CA    1 
ATOM   4010  C  C     . SER B 2  329 ? 38.062  47.960  29.542 1.00 54.36  ? 330 SER A C     1 
ATOM   4011  O  O     . SER B 2  329 ? 37.085  48.400  30.151 1.00 58.84  ? 330 SER A O     1 
ATOM   4012  C  CB    . SER B 2  329 ? 39.963  49.571  29.258 1.00 76.99  ? 330 SER A CB    1 
ATOM   4013  O  OG    . SER B 2  329 ? 40.407  48.835  30.379 1.00 91.08  ? 330 SER A OG    1 
ATOM   4014  N  N     . PHE B 2  330 ? 38.506  46.720  29.673 1.00 57.64  ? 331 PHE A N     1 
ATOM   4015  C  CA    . PHE B 2  330 ? 37.914  45.764  30.595 1.00 57.64  ? 331 PHE A CA    1 
ATOM   4016  C  C     . PHE B 2  330 ? 38.921  45.499  31.701 1.00 65.32  ? 331 PHE A C     1 
ATOM   4017  O  O     . PHE B 2  330 ? 40.022  45.010  31.429 1.00 68.90  ? 331 PHE A O     1 
ATOM   4018  C  CB    . PHE B 2  330 ? 37.546  44.473  29.874 1.00 60.51  ? 331 PHE A CB    1 
ATOM   4019  C  CG    . PHE B 2  330 ? 36.777  43.509  30.708 1.00 58.23  ? 331 PHE A CG    1 
ATOM   4020  C  CD1   . PHE B 2  330 ? 35.401  43.570  30.748 1.00 63.26  ? 331 PHE A CD1   1 
ATOM   4021  C  CD2   . PHE B 2  330 ? 37.425  42.533  31.438 1.00 55.22  ? 331 PHE A CD2   1 
ATOM   4022  C  CE1   . PHE B 2  330 ? 34.683  42.684  31.503 1.00 53.93  ? 331 PHE A CE1   1 
ATOM   4023  C  CE2   . PHE B 2  330 ? 36.710  41.646  32.197 1.00 53.84  ? 331 PHE A CE2   1 
ATOM   4024  C  CZ    . PHE B 2  330 ? 35.337  41.720  32.228 1.00 49.95  ? 331 PHE A CZ    1 
ATOM   4025  N  N     . GLY B 2  331 ? 38.559  45.834  32.933 1.00 64.09  ? 332 GLY A N     1 
ATOM   4026  C  CA    . GLY B 2  331 ? 39.468  45.607  34.040 1.00 57.99  ? 332 GLY A CA    1 
ATOM   4027  C  C     . GLY B 2  331 ? 39.369  44.215  34.613 1.00 56.34  ? 332 GLY A C     1 
ATOM   4028  O  O     . GLY B 2  331 ? 38.443  43.938  35.378 1.00 60.06  ? 332 GLY A O     1 
ATOM   4029  N  N     . VAL B 2  332 ? 40.300  43.328  34.258 1.00 58.31  ? 333 VAL A N     1 
ATOM   4030  C  CA    . VAL B 2  332 ? 40.265  41.955  34.765 1.00 55.53  ? 333 VAL A CA    1 
ATOM   4031  C  C     . VAL B 2  332 ? 40.698  41.947  36.223 1.00 59.46  ? 333 VAL A C     1 
ATOM   4032  O  O     . VAL B 2  332 ? 41.742  42.508  36.590 1.00 82.09  ? 333 VAL A O     1 
ATOM   4033  C  CB    . VAL B 2  332 ? 41.157  41.007  33.944 1.00 52.41  ? 333 VAL A CB    1 
ATOM   4034  C  CG1   . VAL B 2  332 ? 41.028  39.600  34.493 1.00 46.53  ? 333 VAL A CG1   1 
ATOM   4035  C  CG2   . VAL B 2  332 ? 40.775  41.009  32.488 1.00 60.68  ? 333 VAL A CG2   1 
ATOM   4036  N  N     . ASN B 2  333 ? 39.924  41.253  37.042 1.00 51.43  ? 334 ASN A N     1 
ATOM   4037  C  CA    . ASN B 2  333 ? 40.135  41.137  38.482 1.00 47.35  ? 334 ASN A CA    1 
ATOM   4038  C  C     . ASN B 2  333 ? 39.525  39.781  38.855 1.00 50.26  ? 334 ASN A C     1 
ATOM   4039  O  O     . ASN B 2  333 ? 38.358  39.703  39.249 1.00 48.69  ? 334 ASN A O     1 
ATOM   4040  C  CB    . ASN B 2  333 ? 39.458  42.306  39.184 1.00 48.73  ? 334 ASN A CB    1 
ATOM   4041  C  CG    . ASN B 2  333 ? 39.665  42.317  40.681 1.00 56.32  ? 334 ASN A CG    1 
ATOM   4042  O  OD1   . ASN B 2  333 ? 40.677  41.848  41.184 1.00 54.72  ? 334 ASN A OD1   1 
ATOM   4043  N  ND2   . ASN B 2  333 ? 38.716  42.901  41.398 1.00 52.56  ? 334 ASN A ND2   1 
ATOM   4044  N  N     . MET B 2  334 ? 40.306  38.703  38.681 1.00 52.58  ? 335 MET A N     1 
ATOM   4045  C  CA    . MET B 2  334 ? 39.746  37.344  38.738 1.00 58.21  ? 335 MET A CA    1 
ATOM   4046  C  C     . MET B 2  334 ? 39.696  36.826  40.165 1.00 69.29  ? 335 MET A C     1 
ATOM   4047  O  O     . MET B 2  334 ? 40.583  36.098  40.615 1.00 80.72  ? 335 MET A O     1 
ATOM   4048  C  CB    . MET B 2  334 ? 40.552  36.365  37.893 1.00 58.39  ? 335 MET A CB    1 
ATOM   4049  C  CG    . MET B 2  334 ? 40.653  36.678  36.444 1.00 71.17  ? 335 MET A CG    1 
ATOM   4050  S  SD    . MET B 2  334 ? 40.774  35.156  35.494 1.00 72.11  ? 335 MET A SD    1 
ATOM   4051  C  CE    . MET B 2  334 ? 42.554  34.834  35.416 1.00 61.64  ? 335 MET A CE    1 
ATOM   4052  N  N     . ILE B 2  335 ? 38.604  37.127  40.862 1.00 60.33  ? 336 ILE A N     1 
ATOM   4053  C  CA    . ILE B 2  335 ? 38.416  36.709  42.243 1.00 63.16  ? 336 ILE A CA    1 
ATOM   4054  C  C     . ILE B 2  335 ? 37.237  35.755  42.301 1.00 63.15  ? 336 ILE A C     1 
ATOM   4055  O  O     . ILE B 2  335 ? 36.163  36.060  41.777 1.00 60.59  ? 336 ILE A O     1 
ATOM   4056  C  CB    . ILE B 2  335 ? 38.190  37.913  43.166 1.00 61.53  ? 336 ILE A CB    1 
ATOM   4057  C  CG1   . ILE B 2  335 ? 39.515  38.592  43.475 1.00 66.02  ? 336 ILE A CG1   1 
ATOM   4058  C  CG2   . ILE B 2  335 ? 37.520  37.477  44.448 1.00 60.17  ? 336 ILE A CG2   1 
ATOM   4059  C  CD1   . ILE B 2  335 ? 39.462  39.330  44.749 1.00 77.10  ? 336 ILE A CD1   1 
ATOM   4060  N  N     . ALA B 2  336 ? 37.429  34.618  42.960 1.00 61.91  ? 337 ALA A N     1 
ATOM   4061  C  CA    . ALA B 2  336 ? 36.404  33.587  43.056 1.00 56.49  ? 337 ALA A CA    1 
ATOM   4062  C  C     . ALA B 2  336 ? 36.525  32.891  44.398 1.00 56.80  ? 337 ALA A C     1 
ATOM   4063  O  O     . ALA B 2  336 ? 37.561  32.954  45.049 1.00 60.36  ? 337 ALA A O     1 
ATOM   4064  C  CB    . ALA B 2  336 ? 36.514  32.574  41.901 1.00 61.89  ? 337 ALA A CB    1 
ATOM   4065  N  N     . LEU B 2  337 ? 35.471  32.177  44.774 1.00 57.80  ? 338 LEU A N     1 
ATOM   4066  C  CA    . LEU B 2  337 ? 35.499  31.423  46.020 1.00 67.85  ? 338 LEU A CA    1 
ATOM   4067  C  C     . LEU B 2  337 ? 36.239  30.108  45.814 1.00 68.21  ? 338 LEU A C     1 
ATOM   4068  O  O     . LEU B 2  337 ? 35.882  29.309  44.939 1.00 68.87  ? 338 LEU A O     1 
ATOM   4069  C  CB    . LEU B 2  337 ? 34.082  31.209  46.549 1.00 62.26  ? 338 LEU A CB    1 
ATOM   4070  C  CG    . LEU B 2  337 ? 33.281  32.457  46.921 1.00 59.97  ? 338 LEU A CG    1 
ATOM   4071  C  CD1   . LEU B 2  337 ? 31.859  32.057  47.193 1.00 62.74  ? 338 LEU A CD1   1 
ATOM   4072  C  CD2   . LEU B 2  337 ? 33.860  33.163  48.135 1.00 62.15  ? 338 LEU A CD2   1 
ATOM   4073  N  N     . VAL B 2  338 ? 37.296  29.903  46.599 1.00 61.16  ? 339 VAL A N     1 
ATOM   4074  C  CA    . VAL B 2  338 ? 38.127  28.704  46.560 1.00 64.16  ? 339 VAL A CA    1 
ATOM   4075  C  C     . VAL B 2  338 ? 38.119  28.129  47.966 1.00 64.92  ? 339 VAL A C     1 
ATOM   4076  O  O     . VAL B 2  338 ? 38.610  28.772  48.908 1.00 58.68  ? 339 VAL A O     1 
ATOM   4077  C  CB    . VAL B 2  338 ? 39.571  28.998  46.134 1.00 60.66  ? 339 VAL A CB    1 
ATOM   4078  C  CG1   . VAL B 2  338 ? 40.420  27.739  46.224 1.00 61.74  ? 339 VAL A CG1   1 
ATOM   4079  C  CG2   . VAL B 2  338 ? 39.595  29.560  44.730 1.00 58.24  ? 339 VAL A CG2   1 
ATOM   4080  N  N     . ASN B 2  339 ? 37.567  26.924  48.112 1.00 60.57  ? 340 ASN A N     1 
ATOM   4081  C  CA    . ASN B 2  339 ? 37.378  26.331  49.430 1.00 65.47  ? 340 ASN A CA    1 
ATOM   4082  C  C     . ASN B 2  339 ? 36.535  27.255  50.306 1.00 61.97  ? 340 ASN A C     1 
ATOM   4083  O  O     . ASN B 2  339 ? 36.802  27.439  51.495 1.00 70.93  ? 340 ASN A O     1 
ATOM   4084  C  CB    . ASN B 2  339 ? 38.730  25.994  50.082 1.00 91.68  ? 340 ASN A CB    1 
ATOM   4085  C  CG    . ASN B 2  339 ? 39.551  24.952  49.267 1.00 105.90 ? 340 ASN A CG    1 
ATOM   4086  O  OD1   . ASN B 2  339 ? 38.989  24.028  48.667 1.00 108.12 ? 340 ASN A OD1   1 
ATOM   4087  N  ND2   . ASN B 2  339 ? 40.882  25.095  49.273 1.00 111.22 ? 340 ASN A ND2   1 
ATOM   4088  N  N     . GLY B 2  340 ? 35.518  27.867  49.688 1.00 63.27  ? 341 GLY A N     1 
ATOM   4089  C  CA    . GLY B 2  340 ? 34.631  28.834  50.337 1.00 64.40  ? 341 GLY A CA    1 
ATOM   4090  C  C     . GLY B 2  340 ? 35.232  30.172  50.737 1.00 68.97  ? 341 GLY A C     1 
ATOM   4091  O  O     . GLY B 2  340 ? 34.649  30.859  51.577 1.00 71.47  ? 341 GLY A O     1 
ATOM   4092  N  N     . ARG B 2  341 ? 36.376  30.573  50.175 1.00 71.60  ? 342 ARG A N     1 
ATOM   4093  C  CA    . ARG B 2  341 ? 37.030  31.829  50.524 1.00 70.96  ? 342 ARG A CA    1 
ATOM   4094  C  C     . ARG B 2  341 ? 37.329  32.640  49.277 1.00 68.27  ? 342 ARG A C     1 
ATOM   4095  O  O     . ARG B 2  341 ? 37.639  32.065  48.232 1.00 72.26  ? 342 ARG A O     1 
ATOM   4096  C  CB    . ARG B 2  341 ? 38.341  31.582  51.289 1.00 71.32  ? 342 ARG A CB    1 
ATOM   4097  C  CG    . ARG B 2  341 ? 38.168  30.884  52.615 1.00 89.76  ? 342 ARG A CG    1 
ATOM   4098  C  CD    . ARG B 2  341 ? 39.502  30.392  53.139 1.00 102.17 ? 342 ARG A CD    1 
ATOM   4099  N  NE    . ARG B 2  341 ? 39.335  29.420  54.215 1.00 110.60 ? 342 ARG A NE    1 
ATOM   4100  C  CZ    . ARG B 2  341 ? 39.417  29.715  55.508 1.00 120.86 ? 342 ARG A CZ    1 
ATOM   4101  N  NH1   . ARG B 2  341 ? 39.674  30.959  55.892 1.00 125.42 ? 342 ARG A NH1   1 
ATOM   4102  N  NH2   . ARG B 2  341 ? 39.247  28.766  56.421 1.00 129.57 ? 342 ARG A NH2   1 
ATOM   4103  N  N     . PRO B 2  342 ? 37.261  33.975  49.348 1.00 64.24  ? 343 PRO A N     1 
ATOM   4104  C  CA    . PRO B 2  342 ? 37.622  34.780  48.171 1.00 64.54  ? 343 PRO A CA    1 
ATOM   4105  C  C     . PRO B 2  342 ? 39.107  34.651  47.890 1.00 64.24  ? 343 PRO A C     1 
ATOM   4106  O  O     . PRO B 2  342 ? 39.942  34.759  48.792 1.00 68.97  ? 343 PRO A O     1 
ATOM   4107  C  CB    . PRO B 2  342 ? 37.251  36.210  48.579 1.00 68.72  ? 343 PRO A CB    1 
ATOM   4108  C  CG    . PRO B 2  342 ? 37.445  36.206  50.049 1.00 65.51  ? 343 PRO A CG    1 
ATOM   4109  C  CD    . PRO B 2  342 ? 36.957  34.839  50.499 1.00 76.49  ? 343 PRO A CD    1 
ATOM   4110  N  N     . LYS B 2  343 ? 39.442  34.445  46.630 1.00 59.86  ? 344 LYS A N     1 
ATOM   4111  C  CA    . LYS B 2  343 ? 40.847  34.310  46.285 1.00 60.83  ? 344 LYS A CA    1 
ATOM   4112  C  C     . LYS B 2  343 ? 41.088  34.891  44.902 1.00 62.24  ? 344 LYS A C     1 
ATOM   4113  O  O     . LYS B 2  343 ? 40.280  34.716  43.988 1.00 56.73  ? 344 LYS A O     1 
ATOM   4114  C  CB    . LYS B 2  343 ? 41.292  32.852  46.343 1.00 61.85  ? 344 LYS A CB    1 
ATOM   4115  C  CG    . LYS B 2  343 ? 42.795  32.672  46.352 1.00 74.51  ? 344 LYS A CG    1 
ATOM   4116  C  CD    . LYS B 2  343 ? 43.220  31.213  46.343 1.00 86.80  ? 344 LYS A CD    1 
ATOM   4117  C  CE    . LYS B 2  343 ? 44.735  31.121  46.428 1.00 97.29  ? 344 LYS A CE    1 
ATOM   4118  N  NZ    . LYS B 2  343 ? 45.364  31.678  45.206 1.00 90.53  ? 344 LYS A NZ    1 
ATOM   4119  N  N     . LEU B 2  344 ? 42.179  35.644  44.769 1.00 61.90  ? 345 LEU A N     1 
ATOM   4120  C  CA    . LEU B 2  344 ? 42.634  36.111  43.472 1.00 63.44  ? 345 LEU A CA    1 
ATOM   4121  C  C     . LEU B 2  344 ? 43.415  34.992  42.797 1.00 68.83  ? 345 LEU A C     1 
ATOM   4122  O  O     . LEU B 2  344 ? 44.382  34.488  43.366 1.00 69.95  ? 345 LEU A O     1 
ATOM   4123  C  CB    . LEU B 2  344 ? 43.513  37.340  43.624 1.00 59.07  ? 345 LEU A CB    1 
ATOM   4124  C  CG    . LEU B 2  344 ? 44.062  37.806  42.283 1.00 60.94  ? 345 LEU A CG    1 
ATOM   4125  C  CD1   . LEU B 2  344 ? 43.034  38.723  41.690 1.00 63.04  ? 345 LEU A CD1   1 
ATOM   4126  C  CD2   . LEU B 2  344 ? 45.387  38.504  42.452 1.00 65.97  ? 345 LEU A CD2   1 
ATOM   4127  N  N     . ILE B 2  345 ? 42.999  34.584  41.601 1.00 69.00  ? 346 ILE A N     1 
ATOM   4128  C  CA    . ILE B 2  345 ? 43.589  33.420  40.942 1.00 63.59  ? 346 ILE A CA    1 
ATOM   4129  C  C     . ILE B 2  345 ? 44.003  33.765  39.521 1.00 63.48  ? 346 ILE A C     1 
ATOM   4130  O  O     . ILE B 2  345 ? 43.303  34.498  38.819 1.00 77.27  ? 346 ILE A O     1 
ATOM   4131  C  CB    . ILE B 2  345 ? 42.618  32.217  40.933 1.00 59.26  ? 346 ILE A CB    1 
ATOM   4132  C  CG1   . ILE B 2  345 ? 41.328  32.566  40.200 1.00 61.86  ? 346 ILE A CG1   1 
ATOM   4133  C  CG2   . ILE B 2  345 ? 42.301  31.774  42.342 1.00 61.32  ? 346 ILE A CG2   1 
ATOM   4134  C  CD1   . ILE B 2  345 ? 40.331  31.444  40.192 1.00 57.28  ? 346 ILE A CD1   1 
ATOM   4135  N  N     . ASN B 2  346 ? 45.122  33.193  39.086 1.00 60.41  ? 347 ASN A N     1 
ATOM   4136  C  CA    . ASN B 2  346 ? 45.550  33.322  37.705 1.00 62.97  ? 347 ASN A CA    1 
ATOM   4137  C  C     . ASN B 2  346 ? 44.885  32.239  36.864 1.00 63.45  ? 347 ASN A C     1 
ATOM   4138  O  O     . ASN B 2  346 ? 44.155  31.391  37.371 1.00 73.75  ? 347 ASN A O     1 
ATOM   4139  C  CB    . ASN B 2  346 ? 47.075  33.264  37.625 1.00 65.77  ? 347 ASN A CB    1 
ATOM   4140  C  CG    . ASN B 2  346 ? 47.631  31.929  38.043 1.00 70.91  ? 347 ASN A CG    1 
ATOM   4141  O  OD1   . ASN B 2  346 ? 47.117  30.879  37.654 1.00 60.97  ? 347 ASN A OD1   1 
ATOM   4142  N  ND2   . ASN B 2  346 ? 48.700  31.956  38.842 1.00 100.58 ? 347 ASN A ND2   1 
ATOM   4143  N  N     . LEU B 2  347 ? 45.166  32.243  35.558 1.00 63.00  ? 348 LEU A N     1 
ATOM   4144  C  CA    . LEU B 2  347 ? 44.459  31.363  34.626 1.00 59.49  ? 348 LEU A CA    1 
ATOM   4145  C  C     . LEU B 2  347 ? 44.685  29.894  34.949 1.00 62.23  ? 348 LEU A C     1 
ATOM   4146  O  O     . LEU B 2  347 ? 43.748  29.091  34.892 1.00 74.57  ? 348 LEU A O     1 
ATOM   4147  C  CB    . LEU B 2  347 ? 44.895  31.644  33.191 1.00 52.31  ? 348 LEU A CB    1 
ATOM   4148  C  CG    . LEU B 2  347 ? 44.333  30.768  32.074 1.00 51.19  ? 348 LEU A CG    1 
ATOM   4149  C  CD1   . LEU B 2  347 ? 42.843  30.990  31.893 1.00 50.79  ? 348 LEU A CD1   1 
ATOM   4150  C  CD2   . LEU B 2  347 ? 45.070  31.033  30.785 1.00 51.30  ? 348 LEU A CD2   1 
ATOM   4151  N  N     . LYS B 2  348 ? 45.923  29.520  35.268 1.00 57.44  ? 349 LYS A N     1 
ATOM   4152  C  CA    . LYS B 2  348 ? 46.202  28.119  35.565 1.00 59.97  ? 349 LYS A CA    1 
ATOM   4153  C  C     . LYS B 2  348 ? 45.502  27.672  36.835 1.00 68.38  ? 349 LYS A C     1 
ATOM   4154  O  O     . LYS B 2  348 ? 44.946  26.572  36.885 1.00 82.02  ? 349 LYS A O     1 
ATOM   4155  C  CB    . LYS B 2  348 ? 47.706  27.877  35.678 1.00 58.02  ? 349 LYS A CB    1 
ATOM   4156  C  CG    . LYS B 2  348 ? 48.029  26.413  35.976 1.00 57.39  ? 349 LYS A CG    1 
ATOM   4157  C  CD    . LYS B 2  348 ? 49.513  26.113  35.992 1.00 56.72  ? 349 LYS A CD    1 
ATOM   4158  C  CE    . LYS B 2  348 ? 49.781  24.677  36.414 1.00 54.07  ? 349 LYS A CE    1 
ATOM   4159  N  NZ    . LYS B 2  348 ? 51.249  24.439  36.460 1.00 55.77  ? 349 LYS A NZ    1 
ATOM   4160  N  N     . GLU B 2  349 ? 45.518  28.513  37.869 1.00 62.23  ? 350 GLU A N     1 
ATOM   4161  C  CA    . GLU B 2  349 ? 44.785  28.188  39.087 1.00 65.90  ? 350 GLU A CA    1 
ATOM   4162  C  C     . GLU B 2  349 ? 43.342  27.829  38.759 1.00 63.71  ? 350 GLU A C     1 
ATOM   4163  O  O     . GLU B 2  349 ? 42.860  26.743  39.094 1.00 67.65  ? 350 GLU A O     1 
ATOM   4164  C  CB    . GLU B 2  349 ? 44.846  29.375  40.060 1.00 79.85  ? 350 GLU A CB    1 
ATOM   4165  C  CG    . GLU B 2  349 ? 45.224  29.018  41.469 1.00 104.12 ? 350 GLU A CG    1 
ATOM   4166  C  CD    . GLU B 2  349 ? 45.760  30.194  42.269 1.00 117.92 ? 350 GLU A CD    1 
ATOM   4167  O  OE1   . GLU B 2  349 ? 46.589  30.958  41.721 1.00 91.49  ? 350 GLU A OE1   1 
ATOM   4168  O  OE2   . GLU B 2  349 ? 45.344  30.351  43.443 1.00 140.47 ? 350 GLU A OE2   1 
ATOM   4169  N  N     . ALA B 2  350 ? 42.656  28.725  38.054 1.00 67.50  ? 351 ALA A N     1 
ATOM   4170  C  CA    . ALA B 2  350 ? 41.242  28.548  37.744 1.00 64.75  ? 351 ALA A CA    1 
ATOM   4171  C  C     . ALA B 2  350 ? 40.990  27.206  37.072 1.00 68.20  ? 351 ALA A C     1 
ATOM   4172  O  O     . ALA B 2  350 ? 40.055  26.484  37.433 1.00 74.53  ? 351 ALA A O     1 
ATOM   4173  C  CB    . ALA B 2  350 ? 40.761  29.697  36.855 1.00 65.42  ? 351 ALA A CB    1 
ATOM   4174  N  N     . LEU B 2  351 ? 41.830  26.841  36.104 1.00 65.11  ? 352 LEU A N     1 
ATOM   4175  C  CA    . LEU B 2  351 ? 41.668  25.549  35.444 1.00 59.52  ? 352 LEU A CA    1 
ATOM   4176  C  C     . LEU B 2  351 ? 42.028  24.395  36.373 1.00 56.63  ? 352 LEU A C     1 
ATOM   4177  O  O     . LEU B 2  351 ? 41.397  23.342  36.330 1.00 66.21  ? 352 LEU A O     1 
ATOM   4178  C  CB    . LEU B 2  351 ? 42.513  25.505  34.170 1.00 57.36  ? 352 LEU A CB    1 
ATOM   4179  C  CG    . LEU B 2  351 ? 42.315  26.592  33.118 1.00 54.22  ? 352 LEU A CG    1 
ATOM   4180  C  CD1   . LEU B 2  351 ? 43.407  26.439  32.084 1.00 68.11  ? 352 LEU A CD1   1 
ATOM   4181  C  CD2   . LEU B 2  351 ? 40.951  26.436  32.497 1.00 53.19  ? 352 LEU A CD2   1 
ATOM   4182  N  N     . VAL B 2  352 ? 43.042  24.563  37.211 1.00 56.35  ? 353 VAL A N     1 
ATOM   4183  C  CA    . VAL B 2  352 ? 43.467  23.497  38.124 1.00 56.03  ? 353 VAL A CA    1 
ATOM   4184  C  C     . VAL B 2  352 ? 42.337  23.127  39.075 1.00 54.84  ? 353 VAL A C     1 
ATOM   4185  O  O     . VAL B 2  352 ? 42.005  21.946  39.244 1.00 59.67  ? 353 VAL A O     1 
ATOM   4186  C  CB    . VAL B 2  352 ? 44.758  23.899  38.882 1.00 54.67  ? 353 VAL A CB    1 
ATOM   4187  C  CG1   . VAL B 2  352 ? 44.976  23.006  40.100 1.00 56.91  ? 353 VAL A CG1   1 
ATOM   4188  C  CG2   . VAL B 2  352 ? 45.960  23.844  37.953 1.00 55.21  ? 353 VAL A CG2   1 
ATOM   4189  N  N     . HIS B 2  353 ? 41.746  24.123  39.726 1.00 57.03  ? 354 HIS A N     1 
ATOM   4190  C  CA    . HIS B 2  353 ? 40.615  23.845  40.603 1.00 58.54  ? 354 HIS A CA    1 
ATOM   4191  C  C     . HIS B 2  353 ? 39.461  23.221  39.838 1.00 55.84  ? 354 HIS A C     1 
ATOM   4192  O  O     . HIS B 2  353 ? 38.790  22.308  40.339 1.00 57.27  ? 354 HIS A O     1 
ATOM   4193  C  CB    . HIS B 2  353 ? 40.176  25.126  41.316 1.00 59.32  ? 354 HIS A CB    1 
ATOM   4194  C  CG    . HIS B 2  353 ? 41.148  25.594  42.350 1.00 63.36  ? 354 HIS A CG    1 
ATOM   4195  N  ND1   . HIS B 2  353 ? 41.653  24.748  43.309 1.00 71.59  ? 354 HIS A ND1   1 
ATOM   4196  C  CD2   . HIS B 2  353 ? 41.745  26.792  42.553 1.00 70.38  ? 354 HIS A CD2   1 
ATOM   4197  C  CE1   . HIS B 2  353 ? 42.505  25.404  44.072 1.00 83.81  ? 354 HIS A CE1   1 
ATOM   4198  N  NE2   . HIS B 2  353 ? 42.574  26.650  43.639 1.00 87.92  ? 354 HIS A NE2   1 
ATOM   4199  N  N     . TYR B 2  354 ? 39.227  23.684  38.617 1.00 52.18  ? 355 TYR A N     1 
ATOM   4200  C  CA    . TYR B 2  354 ? 38.151  23.111  37.815 1.00 56.01  ? 355 TYR A CA    1 
ATOM   4201  C  C     . TYR B 2  354 ? 38.406  21.637  37.509 1.00 63.38  ? 355 TYR A C     1 
ATOM   4202  O  O     . TYR B 2  354 ? 37.527  20.788  37.704 1.00 69.26  ? 355 TYR A O     1 
ATOM   4203  C  CB    . TYR B 2  354 ? 37.959  23.898  36.521 1.00 44.26  ? 355 TYR A CB    1 
ATOM   4204  C  CG    . TYR B 2  354 ? 36.901  23.249  35.687 1.00 49.38  ? 355 TYR A CG    1 
ATOM   4205  C  CD1   . TYR B 2  354 ? 35.573  23.294  36.075 1.00 57.87  ? 355 TYR A CD1   1 
ATOM   4206  C  CD2   . TYR B 2  354 ? 37.226  22.521  34.552 1.00 60.88  ? 355 TYR A CD2   1 
ATOM   4207  C  CE1   . TYR B 2  354 ? 34.587  22.665  35.342 1.00 60.16  ? 355 TYR A CE1   1 
ATOM   4208  C  CE2   . TYR B 2  354 ? 36.254  21.886  33.820 1.00 59.97  ? 355 TYR A CE2   1 
ATOM   4209  C  CZ    . TYR B 2  354 ? 34.937  21.962  34.210 1.00 60.84  ? 355 TYR A CZ    1 
ATOM   4210  O  OH    . TYR B 2  354 ? 33.979  21.314  33.461 1.00 63.15  ? 355 TYR A OH    1 
ATOM   4211  N  N     . LEU B 2  355 ? 39.605  21.307  37.024 1.00 57.46  ? 356 LEU A N     1 
ATOM   4212  C  CA    . LEU B 2  355 ? 39.925  19.913  36.716 1.00 56.62  ? 356 LEU A CA    1 
ATOM   4213  C  C     . LEU B 2  355 ? 39.778  19.009  37.940 1.00 59.29  ? 356 LEU A C     1 
ATOM   4214  O  O     . LEU B 2  355 ? 39.343  17.858  37.822 1.00 62.25  ? 356 LEU A O     1 
ATOM   4215  C  CB    . LEU B 2  355 ? 41.340  19.828  36.143 1.00 58.15  ? 356 LEU A CB    1 
ATOM   4216  C  CG    . LEU B 2  355 ? 41.867  18.440  35.782 1.00 61.79  ? 356 LEU A CG    1 
ATOM   4217  C  CD1   . LEU B 2  355 ? 41.038  17.855  34.658 1.00 57.14  ? 356 LEU A CD1   1 
ATOM   4218  C  CD2   . LEU B 2  355 ? 43.354  18.480  35.407 1.00 68.24  ? 356 LEU A CD2   1 
ATOM   4219  N  N     . GLU B 2  356 ? 40.132  19.512  39.130 1.00 69.12  ? 357 GLU A N     1 
ATOM   4220  C  CA    . GLU B 2  356 ? 39.981  18.740  40.366 1.00 70.78  ? 357 GLU A CA    1 
ATOM   4221  C  C     . GLU B 2  356 ? 38.521  18.536  40.714 1.00 75.29  ? 357 GLU A C     1 
ATOM   4222  O  O     . GLU B 2  356 ? 38.155  17.509  41.290 1.00 80.36  ? 357 GLU A O     1 
ATOM   4223  C  CB    . GLU B 2  356 ? 40.681  19.438  41.526 1.00 72.10  ? 357 GLU A CB    1 
ATOM   4224  C  CG    . GLU B 2  356 ? 42.205  19.337  41.514 1.00 85.91  ? 357 GLU A CG    1 
ATOM   4225  C  CD    . GLU B 2  356 ? 42.725  17.898  41.524 1.00 103.03 ? 357 GLU A CD    1 
ATOM   4226  O  OE1   . GLU B 2  356 ? 42.170  17.051  42.262 1.00 107.24 ? 357 GLU A OE1   1 
ATOM   4227  O  OE2   . GLU B 2  356 ? 43.698  17.612  40.792 1.00 104.88 ? 357 GLU A OE2   1 
ATOM   4228  N  N     . HIS B 2  357 ? 37.679  19.513  40.402 1.00 76.38  ? 358 HIS A N     1 
ATOM   4229  C  CA    . HIS B 2  357 ? 36.244  19.339  40.567 1.00 71.45  ? 358 HIS A CA    1 
ATOM   4230  C  C     . HIS B 2  357 ? 35.744  18.200  39.683 1.00 79.76  ? 358 HIS A C     1 
ATOM   4231  O  O     . HIS B 2  357 ? 35.030  17.304  40.146 1.00 77.69  ? 358 HIS A O     1 
ATOM   4232  C  CB    . HIS B 2  357 ? 35.527  20.650  40.243 1.00 56.27  ? 358 HIS A CB    1 
ATOM   4233  C  CG    . HIS B 2  357 ? 34.047  20.595  40.442 1.00 53.24  ? 358 HIS A CG    1 
ATOM   4234  N  ND1   . HIS B 2  357 ? 33.461  20.080  41.577 1.00 57.46  ? 358 HIS A ND1   1 
ATOM   4235  C  CD2   . HIS B 2  357 ? 33.030  21.015  39.656 1.00 56.69  ? 358 HIS A CD2   1 
ATOM   4236  C  CE1   . HIS B 2  357 ? 32.147  20.178  41.477 1.00 58.76  ? 358 HIS A CE1   1 
ATOM   4237  N  NE2   . HIS B 2  357 ? 31.859  20.742  40.319 1.00 55.85  ? 358 HIS A NE2   1 
ATOM   4238  N  N     . GLN B 2  358 ? 36.159  18.187  38.414 1.00 86.62  ? 359 GLN A N     1 
ATOM   4239  C  CA    . GLN B 2  358 ? 35.683  17.166  37.486 1.00 77.38  ? 359 GLN A CA    1 
ATOM   4240  C  C     . GLN B 2  358 ? 36.093  15.774  37.936 1.00 83.27  ? 359 GLN A C     1 
ATOM   4241  O  O     . GLN B 2  358 ? 35.303  14.831  37.846 1.00 82.62  ? 359 GLN A O     1 
ATOM   4242  C  CB    . GLN B 2  358 ? 36.208  17.437  36.079 1.00 65.19  ? 359 GLN A CB    1 
ATOM   4243  C  CG    . GLN B 2  358 ? 35.663  18.676  35.451 1.00 69.16  ? 359 GLN A CG    1 
ATOM   4244  C  CD    . GLN B 2  358 ? 34.161  18.779  35.594 1.00 82.53  ? 359 GLN A CD    1 
ATOM   4245  O  OE1   . GLN B 2  358 ? 33.417  18.120  34.872 1.00 105.13 ? 359 GLN A OE1   1 
ATOM   4246  N  NE2   . GLN B 2  358 ? 33.705  19.602  36.526 1.00 72.48  ? 359 GLN A NE2   1 
ATOM   4247  N  N     . LYS B 2  359 ? 37.340  15.614  38.380 1.00 84.22  ? 360 LYS A N     1 
ATOM   4248  C  CA    . LYS B 2  359 ? 37.776  14.318  38.886 1.00 77.39  ? 360 LYS A CA    1 
ATOM   4249  C  C     . LYS B 2  359 ? 36.881  13.864  40.024 1.00 73.53  ? 360 LYS A C     1 
ATOM   4250  O  O     . LYS B 2  359 ? 36.338  12.756  40.001 1.00 76.37  ? 360 LYS A O     1 
ATOM   4251  C  CB    . LYS B 2  359 ? 39.237  14.388  39.329 1.00 75.92  ? 360 LYS A CB    1 
ATOM   4252  C  CG    . LYS B 2  359 ? 40.200  14.504  38.171 1.00 63.89  ? 360 LYS A CG    1 
ATOM   4253  C  CD    . LYS B 2  359 ? 41.445  15.301  38.524 1.00 75.35  ? 360 LYS A CD    1 
ATOM   4254  C  CE    . LYS B 2  359 ? 42.425  14.499  39.357 1.00 78.80  ? 360 LYS A CE    1 
ATOM   4255  N  NZ    . LYS B 2  359 ? 43.743  15.199  39.427 1.00 69.16  ? 360 LYS A NZ    1 
ATOM   4256  N  N     . THR B 2  360 ? 36.674  14.738  41.003 1.00 63.86  ? 361 THR A N     1 
ATOM   4257  C  CA    . THR B 2  360 ? 35.788  14.441  42.123 1.00 70.46  ? 361 THR A CA    1 
ATOM   4258  C  C     . THR B 2  360 ? 34.401  14.038  41.640 1.00 60.00  ? 361 THR A C     1 
ATOM   4259  O  O     . THR B 2  360 ? 33.842  13.032  42.095 1.00 65.27  ? 361 THR A O     1 
ATOM   4260  C  CB    . THR B 2  360 ? 35.758  15.657  43.070 1.00 85.21  ? 361 THR A CB    1 
ATOM   4261  O  OG1   . THR B 2  360 ? 37.046  15.824  43.679 1.00 73.68  ? 361 THR A OG1   1 
ATOM   4262  C  CG2   . THR B 2  360 ? 34.697  15.522  44.168 1.00 99.39  ? 361 THR A CG2   1 
ATOM   4263  N  N     . VAL B 2  361 ? 33.860  14.768  40.665 1.00 54.26  ? 362 VAL A N     1 
ATOM   4264  C  CA    . VAL B 2  361 ? 32.522  14.454  40.152 1.00 58.41  ? 362 VAL A CA    1 
ATOM   4265  C  C     . VAL B 2  361 ? 32.480  13.052  39.557 1.00 67.55  ? 362 VAL A C     1 
ATOM   4266  O  O     . VAL B 2  361 ? 31.629  12.225  39.913 1.00 78.08  ? 362 VAL A O     1 
ATOM   4267  C  CB    . VAL B 2  361 ? 32.079  15.494  39.106 1.00 57.83  ? 362 VAL A CB    1 
ATOM   4268  C  CG1   . VAL B 2  361 ? 30.945  14.950  38.242 1.00 65.57  ? 362 VAL A CG1   1 
ATOM   4269  C  CG2   . VAL B 2  361 ? 31.662  16.787  39.776 1.00 52.76  ? 362 VAL A CG2   1 
ATOM   4270  N  N     . VAL B 2  362 ? 33.378  12.774  38.613 1.00 57.82  ? 363 VAL A N     1 
ATOM   4271  C  CA    . VAL B 2  362 ? 33.369  11.476  37.937 1.00 64.30  ? 363 VAL A CA    1 
ATOM   4272  C  C     . VAL B 2  362 ? 33.626  10.352  38.924 1.00 65.59  ? 363 VAL A C     1 
ATOM   4273  O  O     . VAL B 2  362 ? 32.975  9.304   38.875 1.00 64.83  ? 363 VAL A O     1 
ATOM   4274  C  CB    . VAL B 2  362 ? 34.401  11.452  36.799 1.00 69.32  ? 363 VAL A CB    1 
ATOM   4275  C  CG1   . VAL B 2  362 ? 34.481  10.048  36.233 1.00 72.70  ? 363 VAL A CG1   1 
ATOM   4276  C  CG2   . VAL B 2  362 ? 34.019  12.435  35.733 1.00 61.94  ? 363 VAL A CG2   1 
ATOM   4277  N  N     . ARG B 2  363 ? 34.615  10.525  39.798 1.00 64.09  ? 364 ARG A N     1 
ATOM   4278  C  CA    . ARG B 2  363 ? 34.876  9.511   40.810 1.00 66.37  ? 364 ARG A CA    1 
ATOM   4279  C  C     . ARG B 2  363 ? 33.626  9.257   41.634 1.00 73.32  ? 364 ARG A C     1 
ATOM   4280  O  O     . ARG B 2  363 ? 33.122  8.132   41.702 1.00 67.58  ? 364 ARG A O     1 
ATOM   4281  C  CB    . ARG B 2  363 ? 36.038  9.936   41.709 1.00 69.60  ? 364 ARG A CB    1 
ATOM   4282  C  CG    . ARG B 2  363 ? 36.580  8.802   42.547 1.00 70.31  ? 364 ARG A CG    1 
ATOM   4283  C  CD    . ARG B 2  363 ? 37.605  9.282   43.544 1.00 78.55  ? 364 ARG A CD    1 
ATOM   4284  N  NE    . ARG B 2  363 ? 38.711  9.983   42.901 1.00 99.23  ? 364 ARG A NE    1 
ATOM   4285  C  CZ    . ARG B 2  363 ? 39.046  11.243  43.161 1.00 103.11 ? 364 ARG A CZ    1 
ATOM   4286  N  NH1   . ARG B 2  363 ? 38.361  11.941  44.064 1.00 102.26 ? 364 ARG A NH1   1 
ATOM   4287  N  NH2   . ARG B 2  363 ? 40.073  11.801  42.526 1.00 98.45  ? 364 ARG A NH2   1 
ATOM   4288  N  N     . ARG B 2  364 ? 33.086  10.317  42.229 1.00 79.12  ? 365 ARG A N     1 
ATOM   4289  C  CA    . ARG B 2  364 ? 31.869  10.198  43.019 1.00 74.99  ? 365 ARG A CA    1 
ATOM   4290  C  C     . ARG B 2  364 ? 30.728  9.596   42.223 1.00 73.99  ? 365 ARG A C     1 
ATOM   4291  O  O     . ARG B 2  364 ? 29.883  8.898   42.790 1.00 74.50  ? 365 ARG A O     1 
ATOM   4292  C  CB    . ARG B 2  364 ? 31.482  11.571  43.565 1.00 73.18  ? 365 ARG A CB    1 
ATOM   4293  C  CG    . ARG B 2  364 ? 32.306  11.961  44.740 1.00 66.32  ? 365 ARG A CG    1 
ATOM   4294  C  CD    . ARG B 2  364 ? 31.932  13.300  45.256 1.00 63.74  ? 365 ARG A CD    1 
ATOM   4295  N  NE    . ARG B 2  364 ? 30.607  13.279  45.862 1.00 69.80  ? 365 ARG A NE    1 
ATOM   4296  C  CZ    . ARG B 2  364 ? 30.203  14.151  46.780 1.00 74.95  ? 365 ARG A CZ    1 
ATOM   4297  N  NH1   . ARG B 2  364 ? 31.037  15.089  47.211 1.00 75.30  ? 365 ARG A NH1   1 
ATOM   4298  N  NH2   . ARG B 2  364 ? 28.980  14.070  47.286 1.00 68.61  ? 365 ARG A NH2   1 
ATOM   4299  N  N     . ARG B 2  365 ? 30.697  9.840   40.914 1.00 69.52  ? 366 ARG A N     1 
ATOM   4300  C  CA    . ARG B 2  365 ? 29.641  9.268   40.090 1.00 65.78  ? 366 ARG A CA    1 
ATOM   4301  C  C     . ARG B 2  365 ? 29.839  7.776   39.884 1.00 69.79  ? 366 ARG A C     1 
ATOM   4302  O  O     . ARG B 2  365 ? 28.889  6.990   39.983 1.00 79.07  ? 366 ARG A O     1 
ATOM   4303  C  CB    . ARG B 2  365 ? 29.580  9.959   38.740 1.00 59.54  ? 366 ARG A CB    1 
ATOM   4304  C  CG    . ARG B 2  365 ? 28.350  9.567   37.952 1.00 55.20  ? 366 ARG A CG    1 
ATOM   4305  C  CD    . ARG B 2  365 ? 28.441  10.033  36.509 1.00 57.89  ? 366 ARG A CD    1 
ATOM   4306  N  NE    . ARG B 2  365 ? 29.479  9.342   35.736 1.00 64.33  ? 366 ARG A NE    1 
ATOM   4307  C  CZ    . ARG B 2  365 ? 30.093  9.872   34.680 1.00 57.90  ? 366 ARG A CZ    1 
ATOM   4308  N  NH1   . ARG B 2  365 ? 29.793  11.106  34.298 1.00 52.56  ? 366 ARG A NH1   1 
ATOM   4309  N  NH2   . ARG B 2  365 ? 31.016  9.175   34.024 1.00 60.28  ? 366 ARG A NH2   1 
ATOM   4310  N  N     . THR B 2  366 ? 31.060  7.370   39.541 1.00 66.23  ? 367 THR A N     1 
ATOM   4311  C  CA    . THR B 2  366 ? 31.311  5.945   39.377 1.00 84.23  ? 367 THR A CA    1 
ATOM   4312  C  C     . THR B 2  366 ? 30.982  5.197   40.659 1.00 86.04  ? 367 THR A C     1 
ATOM   4313  O  O     . THR B 2  366 ? 30.341  4.139   40.632 1.00 91.48  ? 367 THR A O     1 
ATOM   4314  C  CB    . THR B 2  366 ? 32.762  5.694   38.962 1.00 82.46  ? 367 THR A CB    1 
ATOM   4315  O  OG1   . THR B 2  366 ? 32.993  6.259   37.668 1.00 67.65  ? 367 THR A OG1   1 
ATOM   4316  C  CG2   . THR B 2  366 ? 33.036  4.202   38.896 1.00 83.10  ? 367 THR A CG2   1 
ATOM   4317  N  N     . GLN B 2  367 ? 31.354  5.772   41.799 1.00 74.80  ? 368 GLN A N     1 
ATOM   4318  C  CA    . GLN B 2  367 ? 31.077  5.123   43.071 1.00 77.83  ? 368 GLN A CA    1 
ATOM   4319  C  C     . GLN B 2  367 ? 29.583  4.977   43.301 1.00 76.99  ? 368 GLN A C     1 
ATOM   4320  O  O     . GLN B 2  367 ? 29.118  3.924   43.745 1.00 75.01  ? 368 GLN A O     1 
ATOM   4321  C  CB    . GLN B 2  367 ? 31.732  5.907   44.203 1.00 84.03  ? 368 GLN A CB    1 
ATOM   4322  C  CG    . GLN B 2  367 ? 33.234  5.752   44.225 1.00 93.29  ? 368 GLN A CG    1 
ATOM   4323  C  CD    . GLN B 2  367 ? 33.893  6.688   45.209 1.00 107.59 ? 368 GLN A CD    1 
ATOM   4324  O  OE1   . GLN B 2  367 ? 33.227  7.504   45.854 1.00 117.47 ? 368 GLN A OE1   1 
ATOM   4325  N  NE2   . GLN B 2  367 ? 35.212  6.581   45.330 1.00 107.18 ? 368 GLN A NE2   1 
ATOM   4326  N  N     . TYR B 2  368 ? 28.812  6.017   43.009 1.00 80.79  ? 369 TYR A N     1 
ATOM   4327  C  CA    . TYR B 2  368 ? 27.369  5.915   43.188 1.00 80.76  ? 369 TYR A CA    1 
ATOM   4328  C  C     . TYR B 2  368 ? 26.795  4.839   42.291 1.00 86.90  ? 369 TYR A C     1 
ATOM   4329  O  O     . TYR B 2  368 ? 25.950  4.045   42.715 1.00 86.55  ? 369 TYR A O     1 
ATOM   4330  C  CB    . TYR B 2  368 ? 26.705  7.249   42.883 1.00 76.42  ? 369 TYR A CB    1 
ATOM   4331  C  CG    . TYR B 2  368 ? 25.203  7.193   42.801 1.00 68.18  ? 369 TYR A CG    1 
ATOM   4332  C  CD1   . TYR B 2  368 ? 24.428  7.341   43.939 1.00 68.18  ? 369 TYR A CD1   1 
ATOM   4333  C  CD2   . TYR B 2  368 ? 24.559  7.033   41.581 1.00 67.57  ? 369 TYR A CD2   1 
ATOM   4334  C  CE1   . TYR B 2  368 ? 23.059  7.323   43.871 1.00 66.91  ? 369 TYR A CE1   1 
ATOM   4335  C  CE2   . TYR B 2  368 ? 23.191  7.012   41.504 1.00 65.60  ? 369 TYR A CE2   1 
ATOM   4336  C  CZ    . TYR B 2  368 ? 22.444  7.158   42.653 1.00 65.64  ? 369 TYR A CZ    1 
ATOM   4337  O  OH    . TYR B 2  368 ? 21.072  7.136   42.578 1.00 69.47  ? 369 TYR A OH    1 
ATOM   4338  N  N     . ASN B 2  369 ? 27.235  4.813   41.037 1.00 89.30  ? 370 ASN A N     1 
ATOM   4339  C  CA    . ASN B 2  369 ? 26.758  3.809   40.098 1.00 79.25  ? 370 ASN A CA    1 
ATOM   4340  C  C     . ASN B 2  369 ? 27.116  2.416   40.566 1.00 72.02  ? 370 ASN A C     1 
ATOM   4341  O  O     . ASN B 2  369 ? 26.299  1.495   40.479 1.00 82.91  ? 370 ASN A O     1 
ATOM   4342  C  CB    . ASN B 2  369 ? 27.349  4.065   38.719 1.00 74.26  ? 370 ASN A CB    1 
ATOM   4343  C  CG    . ASN B 2  369 ? 26.683  5.211   38.019 1.00 80.59  ? 370 ASN A CG    1 
ATOM   4344  O  OD1   . ASN B 2  369 ? 25.602  5.660   38.423 1.00 84.29  ? 370 ASN A OD1   1 
ATOM   4345  N  ND2   . ASN B 2  369 ? 27.312  5.692   36.949 1.00 90.46  ? 370 ASN A ND2   1 
ATOM   4346  N  N     . LEU B 2  370 ? 28.343  2.240   41.049 1.00 70.68  ? 371 LEU A N     1 
ATOM   4347  C  CA    . LEU B 2  370 ? 28.752  0.937   41.551 1.00 73.64  ? 371 LEU A CA    1 
ATOM   4348  C  C     . LEU B 2  370 ? 27.891  0.523   42.727 1.00 72.19  ? 371 LEU A C     1 
ATOM   4349  O  O     . LEU B 2  370 ? 27.414  -0.612  42.790 1.00 78.04  ? 371 LEU A O     1 
ATOM   4350  C  CB    . LEU B 2  370 ? 30.220  0.964   41.962 1.00 79.42  ? 371 LEU A CB    1 
ATOM   4351  C  CG    . LEU B 2  370 ? 30.832  -0.418  42.134 1.00 84.14  ? 371 LEU A CG    1 
ATOM   4352  C  CD1   . LEU B 2  370 ? 31.088  -1.024  40.784 1.00 93.21  ? 371 LEU A CD1   1 
ATOM   4353  C  CD2   . LEU B 2  370 ? 32.110  -0.331  42.934 1.00 90.83  ? 371 LEU A CD2   1 
ATOM   4354  N  N     . ARG B 2  371 ? 27.687  1.432   43.678 1.00 67.24  ? 372 ARG A N     1 
ATOM   4355  C  CA    . ARG B 2  371 ? 26.834  1.119   44.815 1.00 70.16  ? 372 ARG A CA    1 
ATOM   4356  C  C     . ARG B 2  371 ? 25.426  0.803   44.355 1.00 70.35  ? 372 ARG A C     1 
ATOM   4357  O  O     . ARG B 2  371 ? 24.812  -0.163  44.817 1.00 77.20  ? 372 ARG A O     1 
ATOM   4358  C  CB    . ARG B 2  371 ? 26.810  2.288   45.796 1.00 81.82  ? 372 ARG A CB    1 
ATOM   4359  C  CG    . ARG B 2  371 ? 28.128  2.578   46.456 1.00 87.93  ? 372 ARG A CG    1 
ATOM   4360  C  CD    . ARG B 2  371 ? 27.918  3.508   47.634 1.00 101.23 ? 372 ARG A CD    1 
ATOM   4361  N  NE    . ARG B 2  371 ? 27.067  4.644   47.286 1.00 97.91  ? 372 ARG A NE    1 
ATOM   4362  C  CZ    . ARG B 2  371 ? 27.527  5.841   46.938 1.00 93.77  ? 372 ARG A CZ    1 
ATOM   4363  N  NH1   . ARG B 2  371 ? 28.835  6.063   46.894 1.00 94.74  ? 372 ARG A NH1   1 
ATOM   4364  N  NH2   . ARG B 2  371 ? 26.681  6.817   46.637 1.00 93.00  ? 372 ARG A NH2   1 
ATOM   4365  N  N     . LYS B 2  372 ? 24.893  1.623   43.456 1.00 79.46  ? 373 LYS A N     1 
ATOM   4366  C  CA    . LYS B 2  372 ? 23.543  1.407   42.957 1.00 80.21  ? 373 LYS A CA    1 
ATOM   4367  C  C     . LYS B 2  372 ? 23.441  0.069   42.250 1.00 77.10  ? 373 LYS A C     1 
ATOM   4368  O  O     . LYS B 2  372 ? 22.469  -0.670  42.437 1.00 79.92  ? 373 LYS A O     1 
ATOM   4369  C  CB    . LYS B 2  372 ? 23.159  2.552   42.020 1.00 79.17  ? 373 LYS A CB    1 
ATOM   4370  C  CG    . LYS B 2  372 ? 21.712  2.550   41.608 1.00 90.01  ? 373 LYS A CG    1 
ATOM   4371  C  CD    . LYS B 2  372 ? 21.490  3.501   40.446 1.00 92.69  ? 373 LYS A CD    1 
ATOM   4372  C  CE    . LYS B 2  372 ? 20.035  3.522   40.014 1.00 92.52  ? 373 LYS A CE    1 
ATOM   4373  N  NZ    . LYS B 2  372 ? 19.150  4.068   41.080 1.00 93.28  ? 373 LYS A NZ    1 
ATOM   4374  N  N     . ALA B 2  373 ? 24.451  -0.265  41.447 1.00 71.61  ? 374 ALA A N     1 
ATOM   4375  C  CA    . ALA B 2  373 ? 24.424  -1.496  40.668 1.00 69.34  ? 374 ALA A CA    1 
ATOM   4376  C  C     . ALA B 2  373 ? 24.484  -2.714  41.569 1.00 69.64  ? 374 ALA A C     1 
ATOM   4377  O  O     . ALA B 2  373 ? 23.722  -3.670  41.388 1.00 76.24  ? 374 ALA A O     1 
ATOM   4378  C  CB    . ALA B 2  373 ? 25.586  -1.511  39.674 1.00 68.13  ? 374 ALA A CB    1 
ATOM   4379  N  N     . LYS B 2  374 ? 25.413  -2.713  42.522 1.00 65.33  ? 375 LYS A N     1 
ATOM   4380  C  CA    . LYS B 2  374 ? 25.556  -3.856  43.417 1.00 60.78  ? 375 LYS A CA    1 
ATOM   4381  C  C     . LYS B 2  374 ? 24.261  -4.144  44.156 1.00 60.45  ? 375 LYS A C     1 
ATOM   4382  O  O     . LYS B 2  374 ? 23.856  -5.305  44.282 1.00 58.69  ? 375 LYS A O     1 
ATOM   4383  C  CB    . LYS B 2  374 ? 26.687  -3.618  44.418 1.00 62.09  ? 375 LYS A CB    1 
ATOM   4384  C  CG    . LYS B 2  374 ? 28.072  -3.808  43.852 1.00 64.87  ? 375 LYS A CG    1 
ATOM   4385  C  CD    . LYS B 2  374 ? 29.097  -3.812  44.968 1.00 72.22  ? 375 LYS A CD    1 
ATOM   4386  C  CE    . LYS B 2  374 ? 30.411  -4.412  44.507 1.00 87.42  ? 375 LYS A CE    1 
ATOM   4387  N  NZ    . LYS B 2  374 ? 31.375  -4.563  45.632 1.00 97.35  ? 375 LYS A NZ    1 
ATOM   4388  N  N     . ASP B 2  375 ? 23.597  -3.100  44.652 1.00 61.16  ? 376 ASP A N     1 
ATOM   4389  C  CA    . ASP B 2  375 ? 22.326  -3.287  45.342 1.00 61.99  ? 376 ASP A CA    1 
ATOM   4390  C  C     . ASP B 2  375 ? 21.326  -4.014  44.454 1.00 63.39  ? 376 ASP A C     1 
ATOM   4391  O  O     . ASP B 2  375 ? 20.618  -4.914  44.913 1.00 73.96  ? 376 ASP A O     1 
ATOM   4392  C  CB    . ASP B 2  375 ? 21.763  -1.933  45.796 1.00 78.99  ? 376 ASP A CB    1 
ATOM   4393  C  CG    . ASP B 2  375 ? 22.473  -1.367  47.024 1.00 81.87  ? 376 ASP A CG    1 
ATOM   4394  O  OD1   . ASP B 2  375 ? 23.311  -2.061  47.634 1.00 70.86  ? 376 ASP A OD1   1 
ATOM   4395  O  OD2   . ASP B 2  375 ? 22.165  -0.218  47.397 1.00 86.26  ? 376 ASP A OD2   1 
ATOM   4396  N  N     . ARG B 2  376 ? 21.274  -3.651  43.176 1.00 61.14  ? 377 ARG A N     1 
ATOM   4397  C  CA    . ARG B 2  376 ? 20.367  -4.298  42.235 1.00 62.32  ? 377 ARG A CA    1 
ATOM   4398  C  C     . ARG B 2  376 ? 20.779  -5.735  41.983 1.00 69.45  ? 377 ARG A C     1 
ATOM   4399  O  O     . ARG B 2  376 ? 19.928  -6.621  41.836 1.00 86.40  ? 377 ARG A O     1 
ATOM   4400  C  CB    . ARG B 2  376 ? 20.363  -3.537  40.915 1.00 55.42  ? 377 ARG A CB    1 
ATOM   4401  C  CG    . ARG B 2  376 ? 19.357  -4.045  39.956 1.00 53.34  ? 377 ARG A CG    1 
ATOM   4402  C  CD    . ARG B 2  376 ? 17.988  -4.056  40.571 1.00 55.31  ? 377 ARG A CD    1 
ATOM   4403  N  NE    . ARG B 2  376 ? 17.015  -4.402  39.549 1.00 64.52  ? 377 ARG A NE    1 
ATOM   4404  C  CZ    . ARG B 2  376 ? 15.761  -4.747  39.794 1.00 73.17  ? 377 ARG A CZ    1 
ATOM   4405  N  NH1   . ARG B 2  376 ? 15.338  -4.815  41.048 1.00 81.57  ? 377 ARG A NH1   1 
ATOM   4406  N  NH2   . ARG B 2  376 ? 14.945  -5.049  38.794 1.00 58.28  ? 377 ARG A NH2   1 
ATOM   4407  N  N     . ALA B 2  377 ? 22.084  -5.977  41.860 1.00 62.79  ? 378 ALA A N     1 
ATOM   4408  C  CA    . ALA B 2  377 ? 22.548  -7.340  41.631 1.00 61.85  ? 378 ALA A CA    1 
ATOM   4409  C  C     . ALA B 2  377 ? 22.129  -8.228  42.787 1.00 63.46  ? 378 ALA A C     1 
ATOM   4410  O  O     . ALA B 2  377 ? 21.697  -9.368  42.594 1.00 62.29  ? 378 ALA A O     1 
ATOM   4411  C  CB    . ALA B 2  377 ? 24.059  -7.343  41.452 1.00 66.81  ? 378 ALA A CB    1 
ATOM   4412  N  N     . HIS B 2  378 ? 22.198  -7.688  44.000 1.00 57.91  ? 379 HIS A N     1 
ATOM   4413  C  CA    . HIS B 2  378 ? 21.794  -8.418  45.189 1.00 61.83  ? 379 HIS A CA    1 
ATOM   4414  C  C     . HIS B 2  378 ? 20.307  -8.720  45.174 1.00 64.91  ? 379 HIS A C     1 
ATOM   4415  O  O     . HIS B 2  378 ? 19.891  -9.825  45.532 1.00 78.49  ? 379 HIS A O     1 
ATOM   4416  C  CB    . HIS B 2  378 ? 22.174  -7.595  46.416 1.00 63.44  ? 379 HIS A CB    1 
ATOM   4417  C  CG    . HIS B 2  378 ? 21.691  -8.166  47.711 1.00 60.62  ? 379 HIS A CG    1 
ATOM   4418  N  ND1   . HIS B 2  378 ? 22.428  -9.071  48.443 1.00 57.95  ? 379 HIS A ND1   1 
ATOM   4419  C  CD2   . HIS B 2  378 ? 20.550  -7.953  48.412 1.00 59.92  ? 379 HIS A CD2   1 
ATOM   4420  C  CE1   . HIS B 2  378 ? 21.761  -9.391  49.538 1.00 67.48  ? 379 HIS A CE1   1 
ATOM   4421  N  NE2   . HIS B 2  378 ? 20.616  -8.729  49.544 1.00 53.63  ? 379 HIS A NE2   1 
ATOM   4422  N  N     . ILE B 2  379 ? 19.480  -7.758  44.767 1.00 58.65  ? 380 ILE A N     1 
ATOM   4423  C  CA    . ILE B 2  379 ? 18.036  -7.985  44.732 1.00 56.84  ? 380 ILE A CA    1 
ATOM   4424  C  C     . ILE B 2  379 ? 17.685  -8.994  43.658 1.00 62.15  ? 380 ILE A C     1 
ATOM   4425  O  O     . ILE B 2  379 ? 16.753  -9.791  43.812 1.00 58.85  ? 380 ILE A O     1 
ATOM   4426  C  CB    . ILE B 2  379 ? 17.283  -6.663  44.512 1.00 47.48  ? 380 ILE A CB    1 
ATOM   4427  C  CG1   . ILE B 2  379 ? 17.489  -5.738  45.701 1.00 46.96  ? 380 ILE A CG1   1 
ATOM   4428  C  CG2   . ILE B 2  379 ? 15.809  -6.941  44.320 1.00 45.59  ? 380 ILE A CG2   1 
ATOM   4429  C  CD1   . ILE B 2  379 ? 16.683  -6.149  46.889 1.00 50.20  ? 380 ILE A CD1   1 
ATOM   4430  N  N     . LEU B 2  380 ? 18.391  -8.942  42.533 1.00 59.29  ? 381 LEU A N     1 
ATOM   4431  C  CA    . LEU B 2  380 ? 18.120  -9.868  41.443 1.00 62.28  ? 381 LEU A CA    1 
ATOM   4432  C  C     . LEU B 2  380 ? 18.405  -11.295 41.865 1.00 73.79  ? 381 LEU A C     1 
ATOM   4433  O  O     . LEU B 2  380 ? 17.678  -12.222 41.487 1.00 79.04  ? 381 LEU A O     1 
ATOM   4434  C  CB    . LEU B 2  380 ? 18.959  -9.498  40.223 1.00 63.23  ? 381 LEU A CB    1 
ATOM   4435  C  CG    . LEU B 2  380 ? 18.379  -8.373  39.376 1.00 60.58  ? 381 LEU A CG    1 
ATOM   4436  C  CD1   . LEU B 2  380 ? 19.155  -8.255  38.087 1.00 70.80  ? 381 LEU A CD1   1 
ATOM   4437  C  CD2   . LEU B 2  380 ? 16.911  -8.632  39.111 1.00 57.38  ? 381 LEU A CD2   1 
ATOM   4438  N  N     . GLU B 2  381 ? 19.475  -11.491 42.632 1.00 72.36  ? 382 GLU A N     1 
ATOM   4439  C  CA    . GLU B 2  381 ? 19.828  -12.824 43.096 1.00 64.84  ? 382 GLU A CA    1 
ATOM   4440  C  C     . GLU B 2  381 ? 18.687  -13.441 43.880 1.00 68.05  ? 382 GLU A C     1 
ATOM   4441  O  O     . GLU B 2  381 ? 18.358  -14.614 43.694 1.00 90.09  ? 382 GLU A O     1 
ATOM   4442  C  CB    . GLU B 2  381 ? 21.093  -12.764 43.950 1.00 62.36  ? 382 GLU A CB    1 
ATOM   4443  C  CG    . GLU B 2  381 ? 22.297  -12.266 43.190 1.00 65.81  ? 382 GLU A CG    1 
ATOM   4444  C  CD    . GLU B 2  381 ? 23.524  -12.119 44.065 1.00 84.14  ? 382 GLU A CD    1 
ATOM   4445  O  OE1   . GLU B 2  381 ? 23.410  -12.306 45.297 1.00 100.95 ? 382 GLU A OE1   1 
ATOM   4446  O  OE2   . GLU B 2  381 ? 24.606  -11.821 43.517 1.00 73.27  ? 382 GLU A OE2   1 
ATOM   4447  N  N     . GLY B 2  382 ? 18.072  -12.665 44.764 1.00 63.23  ? 383 GLY A N     1 
ATOM   4448  C  CA    . GLY B 2  382 ? 16.937  -13.171 45.513 1.00 70.22  ? 383 GLY A CA    1 
ATOM   4449  C  C     . GLY B 2  382 ? 15.778  -13.523 44.605 1.00 67.95  ? 383 GLY A C     1 
ATOM   4450  O  O     . GLY B 2  382 ? 15.098  -14.527 44.808 1.00 65.39  ? 383 GLY A O     1 
ATOM   4451  N  N     . LEU B 2  383 ? 15.550  -12.708 43.578 1.00 65.81  ? 384 LEU A N     1 
ATOM   4452  C  CA    . LEU B 2  383 ? 14.506  -13.015 42.607 1.00 67.48  ? 384 LEU A CA    1 
ATOM   4453  C  C     . LEU B 2  383 ? 14.826  -14.290 41.852 1.00 74.88  ? 384 LEU A C     1 
ATOM   4454  O  O     . LEU B 2  383 ? 13.948  -15.130 41.634 1.00 69.86  ? 384 LEU A O     1 
ATOM   4455  C  CB    . LEU B 2  383 ? 14.345  -11.859 41.628 1.00 65.52  ? 384 LEU A CB    1 
ATOM   4456  C  CG    . LEU B 2  383 ? 13.796  -10.593 42.260 1.00 64.09  ? 384 LEU A CG    1 
ATOM   4457  C  CD1   . LEU B 2  383 ? 13.077  -9.782  41.213 1.00 68.41  ? 384 LEU A CD1   1 
ATOM   4458  C  CD2   . LEU B 2  383 ? 12.890  -10.941 43.401 1.00 64.64  ? 384 LEU A CD2   1 
ATOM   4459  N  N     . ARG B 2  384 ? 16.075  -14.438 41.416 1.00 80.94  ? 385 ARG A N     1 
ATOM   4460  C  CA    . ARG B 2  384 ? 16.475  -15.667 40.744 1.00 78.09  ? 385 ARG A CA    1 
ATOM   4461  C  C     . ARG B 2  384 ? 16.218  -16.860 41.640 1.00 76.89  ? 385 ARG A C     1 
ATOM   4462  O  O     . ARG B 2  384 ? 15.587  -17.841 41.230 1.00 81.36  ? 385 ARG A O     1 
ATOM   4463  C  CB    . ARG B 2  384 ? 17.949  -15.596 40.345 1.00 76.01  ? 385 ARG A CB    1 
ATOM   4464  C  CG    . ARG B 2  384 ? 18.160  -14.968 38.990 1.00 74.04  ? 385 ARG A CG    1 
ATOM   4465  C  CD    . ARG B 2  384 ? 19.542  -14.383 38.846 1.00 74.22  ? 385 ARG A CD    1 
ATOM   4466  N  NE    . ARG B 2  384 ? 20.527  -15.353 38.381 1.00 81.45  ? 385 ARG A NE    1 
ATOM   4467  C  CZ    . ARG B 2  384 ? 21.454  -15.906 39.157 1.00 90.04  ? 385 ARG A CZ    1 
ATOM   4468  N  NH1   . ARG B 2  384 ? 21.519  -15.584 40.443 1.00 98.25  ? 385 ARG A NH1   1 
ATOM   4469  N  NH2   . ARG B 2  384 ? 22.320  -16.778 38.651 1.00 83.74  ? 385 ARG A NH2   1 
ATOM   4470  N  N     . ILE B 2  385 ? 16.680  -16.774 42.887 1.00 70.28  ? 386 ILE A N     1 
ATOM   4471  C  CA    . ILE B 2  385 ? 16.424  -17.820 43.873 1.00 63.39  ? 386 ILE A CA    1 
ATOM   4472  C  C     . ILE B 2  385 ? 14.934  -18.039 44.040 1.00 64.44  ? 386 ILE A C     1 
ATOM   4473  O  O     . ILE B 2  385 ? 14.457  -19.173 44.086 1.00 73.37  ? 386 ILE A O     1 
ATOM   4474  C  CB    . ILE B 2  385 ? 17.057  -17.448 45.220 1.00 63.08  ? 386 ILE A CB    1 
ATOM   4475  C  CG1   . ILE B 2  385 ? 18.579  -17.525 45.142 1.00 64.80  ? 386 ILE A CG1   1 
ATOM   4476  C  CG2   . ILE B 2  385 ? 16.499  -18.339 46.295 1.00 64.39  ? 386 ILE A CG2   1 
ATOM   4477  C  CD1   . ILE B 2  385 ? 19.235  -16.996 46.378 1.00 59.54  ? 386 ILE A CD1   1 
ATOM   4478  N  N     . ALA B 2  386 ? 14.180  -16.955 44.194 1.00 71.37  ? 387 ALA A N     1 
ATOM   4479  C  CA    . ALA B 2  386 ? 12.748  -17.087 44.423 1.00 71.28  ? 387 ALA A CA    1 
ATOM   4480  C  C     . ALA B 2  386 ? 12.074  -17.767 43.255 1.00 74.16  ? 387 ALA A C     1 
ATOM   4481  O  O     . ALA B 2  386 ? 11.185  -18.597 43.446 1.00 87.90  ? 387 ALA A O     1 
ATOM   4482  C  CB    . ALA B 2  386 ? 12.120  -15.719 44.663 1.00 79.07  ? 387 ALA A CB    1 
ATOM   4483  N  N     . LEU B 2  387 ? 12.470  -17.421 42.037 1.00 72.27  ? 388 LEU A N     1 
ATOM   4484  C  CA    . LEU B 2  387 ? 11.805  -17.992 40.874 1.00 73.41  ? 388 LEU A CA    1 
ATOM   4485  C  C     . LEU B 2  387 ? 12.084  -19.480 40.751 1.00 79.40  ? 388 LEU A C     1 
ATOM   4486  O  O     . LEU B 2  387 ? 11.185  -20.257 40.411 1.00 86.66  ? 388 LEU A O     1 
ATOM   4487  C  CB    . LEU B 2  387 ? 12.219  -17.239 39.614 1.00 78.73  ? 388 LEU A CB    1 
ATOM   4488  C  CG    . LEU B 2  387 ? 11.587  -15.849 39.602 1.00 69.72  ? 388 LEU A CG    1 
ATOM   4489  C  CD1   . LEU B 2  387 ? 11.888  -15.095 38.339 1.00 72.02  ? 388 LEU A CD1   1 
ATOM   4490  C  CD2   . LEU B 2  387 ? 10.079  -15.957 39.800 1.00 64.76  ? 388 LEU A CD2   1 
ATOM   4491  N  N     . ASP B 2  388 ? 13.318  -19.897 41.040 1.00 82.86  ? 389 ASP A N     1 
ATOM   4492  C  CA    . ASP B 2  388 ? 13.678  -21.313 40.958 1.00 84.58  ? 389 ASP A CA    1 
ATOM   4493  C  C     . ASP B 2  388 ? 12.908  -22.148 41.968 1.00 85.88  ? 389 ASP A C     1 
ATOM   4494  O  O     . ASP B 2  388 ? 12.466  -23.265 41.660 1.00 94.99  ? 389 ASP A O     1 
ATOM   4495  C  CB    . ASP B 2  388 ? 15.181  -21.497 41.181 1.00 84.58  ? 389 ASP A CB    1 
ATOM   4496  C  CG    . ASP B 2  388 ? 16.010  -20.880 40.078 1.00 98.41  ? 389 ASP A CG    1 
ATOM   4497  O  OD1   . ASP B 2  388 ? 15.423  -20.448 39.057 1.00 100.07 ? 389 ASP A OD1   1 
ATOM   4498  O  OD2   . ASP B 2  388 ? 17.251  -20.845 40.229 1.00 99.38  ? 389 ASP A OD2   1 
ATOM   4499  N  N     . HIS B 2  389 ? 12.754  -21.630 43.183 1.00 77.80  ? 390 HIS A N     1 
ATOM   4500  C  CA    . HIS B 2  389 ? 12.073  -22.301 44.279 1.00 71.72  ? 390 HIS A CA    1 
ATOM   4501  C  C     . HIS B 2  389 ? 10.653  -21.794 44.484 1.00 70.72  ? 390 HIS A C     1 
ATOM   4502  O  O     . HIS B 2  389 ? 10.118  -21.912 45.592 1.00 78.51  ? 390 HIS A O     1 
ATOM   4503  C  CB    . HIS B 2  389 ? 12.864  -22.128 45.574 1.00 75.30  ? 390 HIS A CB    1 
ATOM   4504  C  CG    . HIS B 2  389 ? 14.249  -22.688 45.528 1.00 90.34  ? 390 HIS A CG    1 
ATOM   4505  N  ND1   . HIS B 2  389 ? 15.001  -22.738 44.374 1.00 98.01  ? 390 HIS A ND1   1 
ATOM   4506  C  CD2   . HIS B 2  389 ? 15.025  -23.214 46.506 1.00 102.47 ? 390 HIS A CD2   1 
ATOM   4507  C  CE1   . HIS B 2  389 ? 16.177  -23.275 44.642 1.00 111.29 ? 390 HIS A CE1   1 
ATOM   4508  N  NE2   . HIS B 2  389 ? 16.217  -23.574 45.928 1.00 108.80 ? 390 HIS A NE2   1 
ATOM   4509  N  N     . ILE B 2  390 ? 10.025  -21.259 43.446 1.00 65.29  ? 391 ILE A N     1 
ATOM   4510  C  CA    . ILE B 2  390 ? 8.742   -20.559 43.536 1.00 78.13  ? 391 ILE A CA    1 
ATOM   4511  C  C     . ILE B 2  390 ? 7.655   -21.294 44.330 1.00 83.86  ? 391 ILE A C     1 
ATOM   4512  O  O     . ILE B 2  390 ? 7.021   -20.704 45.207 1.00 95.87  ? 391 ILE A O     1 
ATOM   4513  C  CB    . ILE B 2  390 ? 8.249   -20.225 42.110 1.00 86.59  ? 391 ILE A CB    1 
ATOM   4514  C  CG1   . ILE B 2  390 ? 6.891   -19.561 42.188 1.00 85.86  ? 391 ILE A CG1   1 
ATOM   4515  C  CG2   . ILE B 2  390 ? 8.253   -21.466 41.206 1.00 93.01  ? 391 ILE A CG2   1 
ATOM   4516  C  CD1   . ILE B 2  390 ? 6.986   -18.166 42.762 1.00 80.96  ? 391 ILE A CD1   1 
ATOM   4517  N  N     . ASP B 2  391 ? 7.385   -22.545 43.992 1.00 77.37  ? 392 ASP A N     1 
ATOM   4518  C  CA    . ASP B 2  391 ? 6.303   -23.320 44.624 1.00 78.74  ? 392 ASP A CA    1 
ATOM   4519  C  C     . ASP B 2  391 ? 6.359   -23.244 46.135 1.00 79.26  ? 392 ASP A C     1 
ATOM   4520  O  O     . ASP B 2  391 ? 5.333   -23.099 46.818 1.00 82.43  ? 392 ASP A O     1 
ATOM   4521  C  CB    . ASP B 2  391 ? 6.378   -24.784 44.203 1.00 92.24  ? 392 ASP A CB    1 
ATOM   4522  C  CG    . ASP B 2  391 ? 6.182   -24.950 42.754 1.00 109.29 ? 392 ASP A CG    1 
ATOM   4523  O  OD1   . ASP B 2  391 ? 5.103   -24.528 42.298 1.00 109.93 ? 392 ASP A OD1   1 
ATOM   4524  O  OD2   . ASP B 2  391 ? 7.089   -25.454 42.063 1.00 117.36 ? 392 ASP A OD2   1 
ATOM   4525  N  N     . GLU B 2  392 ? 7.555   -23.451 46.672 1.00 74.83  ? 393 GLU A N     1 
ATOM   4526  C  CA    . GLU B 2  392 ? 7.764   -23.361 48.101 1.00 77.23  ? 393 GLU A CA    1 
ATOM   4527  C  C     . GLU B 2  392 ? 7.512   -21.944 48.585 1.00 84.00  ? 393 GLU A C     1 
ATOM   4528  O  O     . GLU B 2  392 ? 6.840   -21.733 49.599 1.00 89.03  ? 393 GLU A O     1 
ATOM   4529  C  CB    . GLU B 2  392 ? 9.194   -23.796 48.393 1.00 75.68  ? 393 GLU A CB    1 
ATOM   4530  C  CG    . GLU B 2  392 ? 9.429   -24.217 49.813 1.00 86.94  ? 393 GLU A CG    1 
ATOM   4531  C  CD    . GLU B 2  392 ? 10.798  -24.830 50.002 1.00 102.99 ? 393 GLU A CD    1 
ATOM   4532  O  OE1   . GLU B 2  392 ? 11.412  -25.229 48.987 1.00 97.05  ? 393 GLU A OE1   1 
ATOM   4533  O  OE2   . GLU B 2  392 ? 11.263  -24.907 51.161 1.00 113.93 ? 393 GLU A OE2   1 
ATOM   4534  N  N     . ILE B 2  393 ? 8.022   -20.965 47.833 1.00 79.77  ? 394 ILE A N     1 
ATOM   4535  C  CA    . ILE B 2  393 ? 7.876   -19.552 48.163 1.00 66.61  ? 394 ILE A CA    1 
ATOM   4536  C  C     . ILE B 2  393 ? 6.412   -19.194 48.370 1.00 70.17  ? 394 ILE A C     1 
ATOM   4537  O  O     . ILE B 2  393 ? 6.058   -18.494 49.326 1.00 78.53  ? 394 ILE A O     1 
ATOM   4538  C  CB    . ILE B 2  393 ? 8.518   -18.707 47.046 1.00 60.20  ? 394 ILE A CB    1 
ATOM   4539  C  CG1   . ILE B 2  393 ? 10.021  -18.962 46.976 1.00 60.06  ? 394 ILE A CG1   1 
ATOM   4540  C  CG2   . ILE B 2  393 ? 8.188   -17.252 47.235 1.00 57.37  ? 394 ILE A CG2   1 
ATOM   4541  C  CD1   . ILE B 2  393 ? 10.814  -18.037 47.818 1.00 61.79  ? 394 ILE A CD1   1 
ATOM   4542  N  N     . ILE B 2  394 ? 5.539   -19.665 47.477 1.00 71.05  ? 395 ILE A N     1 
ATOM   4543  C  CA    . ILE B 2  394 ? 4.139   -19.245 47.494 1.00 72.59  ? 395 ILE A CA    1 
ATOM   4544  C  C     . ILE B 2  394 ? 3.424   -19.831 48.689 1.00 82.62  ? 395 ILE A C     1 
ATOM   4545  O  O     . ILE B 2  394 ? 2.542   -19.196 49.279 1.00 79.23  ? 395 ILE A O     1 
ATOM   4546  C  CB    . ILE B 2  394 ? 3.430   -19.672 46.204 1.00 75.75  ? 395 ILE A CB    1 
ATOM   4547  C  CG1   . ILE B 2  394 ? 4.249   -19.325 44.965 1.00 81.00  ? 395 ILE A CG1   1 
ATOM   4548  C  CG2   . ILE B 2  394 ? 2.036   -19.071 46.170 1.00 66.74  ? 395 ILE A CG2   1 
ATOM   4549  C  CD1   . ILE B 2  394 ? 4.023   -17.935 44.487 1.00 91.38  ? 395 ILE A CD1   1 
ATOM   4550  N  N     . SER B 2  395 ? 3.720   -21.092 48.993 1.00 89.31  ? 396 SER A N     1 
ATOM   4551  C  CA    . SER B 2  395 ? 3.104   -21.761 50.131 1.00 83.96  ? 396 SER A CA    1 
ATOM   4552  C  C     . SER B 2  395 ? 3.600   -21.164 51.432 1.00 79.75  ? 396 SER A C     1 
ATOM   4553  O  O     . SER B 2  395 ? 2.850   -21.047 52.411 1.00 92.01  ? 396 SER A O     1 
ATOM   4554  C  CB    . SER B 2  395 ? 3.445   -23.245 50.098 1.00 85.87  ? 396 SER A CB    1 
ATOM   4555  O  OG    . SER B 2  395 ? 4.771   -23.427 50.570 1.00 102.56 ? 396 SER A OG    1 
ATOM   4556  N  N     . THR B 2  396 ? 4.884   -20.817 51.461 1.00 72.46  ? 397 THR A N     1 
ATOM   4557  C  CA    . THR B 2  396 ? 5.465   -20.165 52.623 1.00 70.12  ? 397 THR A CA    1 
ATOM   4558  C  C     . THR B 2  396 ? 4.728   -18.879 52.931 1.00 71.37  ? 397 THR A C     1 
ATOM   4559  O  O     . THR B 2  396 ? 4.389   -18.603 54.087 1.00 84.74  ? 397 THR A O     1 
ATOM   4560  C  CB    . THR B 2  396 ? 6.942   -19.869 52.372 1.00 63.69  ? 397 THR A CB    1 
ATOM   4561  O  OG1   . THR B 2  396 ? 7.598   -21.043 51.878 1.00 60.64  ? 397 THR A OG1   1 
ATOM   4562  C  CG2   . THR B 2  396 ? 7.589   -19.436 53.655 1.00 65.54  ? 397 THR A CG2   1 
ATOM   4563  N  N     . ILE B 2  397 ? 4.473   -18.074 51.903 1.00 59.25  ? 398 ILE A N     1 
ATOM   4564  C  CA    . ILE B 2  397 ? 3.717   -16.845 52.092 1.00 58.88  ? 398 ILE A CA    1 
ATOM   4565  C  C     . ILE B 2  397 ? 2.296   -17.160 52.524 1.00 61.83  ? 398 ILE A C     1 
ATOM   4566  O  O     . ILE B 2  397 ? 1.756   -16.525 53.434 1.00 66.45  ? 398 ILE A O     1 
ATOM   4567  C  CB    . ILE B 2  397 ? 3.751   -16.014 50.800 1.00 59.93  ? 398 ILE A CB    1 
ATOM   4568  C  CG1   . ILE B 2  397 ? 5.161   -15.469 50.563 1.00 53.84  ? 398 ILE A CG1   1 
ATOM   4569  C  CG2   . ILE B 2  397 ? 2.721   -14.913 50.865 1.00 59.49  ? 398 ILE A CG2   1 
ATOM   4570  C  CD1   . ILE B 2  397 ? 5.352   -14.899 49.198 1.00 50.83  ? 398 ILE A CD1   1 
ATOM   4571  N  N     . ARG B 2  398 ? 1.666   -18.140 51.876 1.00 65.73  ? 399 ARG A N     1 
ATOM   4572  C  CA    . ARG B 2  398 ? 0.283   -18.485 52.193 1.00 73.76  ? 399 ARG A CA    1 
ATOM   4573  C  C     . ARG B 2  398 ? 0.156   -19.024 53.606 1.00 72.42  ? 399 ARG A C     1 
ATOM   4574  O  O     . ARG B 2  398 ? -0.828  -18.747 54.301 1.00 68.41  ? 399 ARG A O     1 
ATOM   4575  C  CB    . ARG B 2  398 ? -0.238  -19.509 51.190 1.00 74.57  ? 399 ARG A CB    1 
ATOM   4576  C  CG    . ARG B 2  398 ? -0.632  -18.923 49.862 1.00 58.52  ? 399 ARG A CG    1 
ATOM   4577  C  CD    . ARG B 2  398 ? -0.831  -20.008 48.832 1.00 56.06  ? 399 ARG A CD    1 
ATOM   4578  N  NE    . ARG B 2  398 ? -2.116  -20.682 48.982 1.00 71.68  ? 399 ARG A NE    1 
ATOM   4579  C  CZ    . ARG B 2  398 ? -2.431  -21.818 48.370 1.00 76.97  ? 399 ARG A CZ    1 
ATOM   4580  N  NH1   . ARG B 2  398 ? -3.635  -22.352 48.541 1.00 75.67  ? 399 ARG A NH1   1 
ATOM   4581  N  NH2   . ARG B 2  398 ? -1.555  -22.395 47.553 1.00 68.26  ? 399 ARG A NH2   1 
ATOM   4582  N  N     . GLU B 2  399 ? 1.129   -19.824 54.032 1.00 69.70  ? 400 GLU A N     1 
ATOM   4583  C  CA    . GLU B 2  399 ? 1.132   -20.362 55.386 1.00 72.61  ? 400 GLU A CA    1 
ATOM   4584  C  C     . GLU B 2  399 ? 1.196   -19.247 56.422 1.00 74.31  ? 400 GLU A C     1 
ATOM   4585  O  O     . GLU B 2  399 ? 0.520   -19.307 57.459 1.00 91.94  ? 400 GLU A O     1 
ATOM   4586  C  CB    . GLU B 2  399 ? 2.308   -21.328 55.540 1.00 81.29  ? 400 GLU A CB    1 
ATOM   4587  C  CG    . GLU B 2  399 ? 3.054   -21.226 56.853 1.00 109.73 ? 400 GLU A CG    1 
ATOM   4588  C  CD    . GLU B 2  399 ? 4.470   -21.761 56.747 1.00 126.46 ? 400 GLU A CD    1 
ATOM   4589  O  OE1   . GLU B 2  399 ? 5.351   -21.272 57.490 1.00 125.30 ? 400 GLU A OE1   1 
ATOM   4590  O  OE2   . GLU B 2  399 ? 4.703   -22.660 55.908 1.00 125.71 ? 400 GLU A OE2   1 
ATOM   4591  N  N     . SER B 2  400 ? 1.974   -18.209 56.141 1.00 71.35  ? 401 SER A N     1 
ATOM   4592  C  CA    . SER B 2  400 ? 2.197   -17.121 57.076 1.00 68.51  ? 401 SER A CA    1 
ATOM   4593  C  C     . SER B 2  400 ? 0.950   -16.276 57.261 1.00 83.47  ? 401 SER A C     1 
ATOM   4594  O  O     . SER B 2  400 ? 0.148   -16.098 56.346 1.00 89.42  ? 401 SER A O     1 
ATOM   4595  C  CB    . SER B 2  400 ? 3.342   -16.253 56.582 1.00 63.99  ? 401 SER A CB    1 
ATOM   4596  O  OG    . SER B 2  400 ? 4.379   -17.072 56.078 1.00 80.77  ? 401 SER A OG    1 
ATOM   4597  N  N     . ASP B 2  401 ? 0.807   -15.739 58.473 1.00 89.46  ? 402 ASP A N     1 
ATOM   4598  C  CA    . ASP B 2  401 ? -0.296  -14.846 58.792 1.00 86.26  ? 402 ASP A CA    1 
ATOM   4599  C  C     . ASP B 2  401 ? 0.041   -13.394 58.528 1.00 82.53  ? 402 ASP A C     1 
ATOM   4600  O  O     . ASP B 2  401 ? -0.865  -12.589 58.288 1.00 84.29  ? 402 ASP A O     1 
ATOM   4601  C  CB    . ASP B 2  401 ? -0.705  -15.000 60.259 1.00 92.28  ? 402 ASP A CB    1 
ATOM   4602  C  CG    . ASP B 2  401 ? -1.097  -16.416 60.609 1.00 103.77 ? 402 ASP A CG    1 
ATOM   4603  O  OD1   . ASP B 2  401 ? -1.352  -17.209 59.679 1.00 112.64 ? 402 ASP A OD1   1 
ATOM   4604  O  OD2   . ASP B 2  401 ? -1.161  -16.730 61.815 1.00 96.91  ? 402 ASP A OD2   1 
ATOM   4605  N  N     . THR B 2  402 ? 1.318   -13.040 58.580 1.00 88.46  ? 403 THR A N     1 
ATOM   4606  C  CA    . THR B 2  402 ? 1.741   -11.667 58.370 1.00 94.25  ? 403 THR A CA    1 
ATOM   4607  C  C     . THR B 2  402 ? 2.945   -11.619 57.453 1.00 95.84  ? 403 THR A C     1 
ATOM   4608  O  O     . THR B 2  402 ? 3.612   -12.620 57.192 1.00 98.07  ? 403 THR A O     1 
ATOM   4609  C  CB    . THR B 2  402 ? 2.072   -10.945 59.694 1.00 94.70  ? 403 THR A CB    1 
ATOM   4610  O  OG1   . THR B 2  402 ? 3.061   -11.675 60.424 1.00 83.18  ? 403 THR A OG1   1 
ATOM   4611  C  CG2   . THR B 2  402 ? 0.831   -10.778 60.523 1.00 99.83  ? 403 THR A CG2   1 
ATOM   4612  N  N     . ASP B 2  403 ? 3.199   -10.405 56.960 1.00 101.88 ? 404 ASP A N     1 
ATOM   4613  C  CA    . ASP B 2  403 ? 4.402   -10.168 56.176 1.00 102.63 ? 404 ASP A CA    1 
ATOM   4614  C  C     . ASP B 2  403 ? 5.631   -10.459 57.011 1.00 86.85  ? 404 ASP A C     1 
ATOM   4615  O  O     . ASP B 2  403 ? 6.590   -11.083 56.539 1.00 82.28  ? 404 ASP A O     1 
ATOM   4616  C  CB    . ASP B 2  403 ? 4.453   -8.722  55.689 1.00 114.34 ? 404 ASP A CB    1 
ATOM   4617  C  CG    . ASP B 2  403 ? 3.159   -8.273  55.059 1.00 127.84 ? 404 ASP A CG    1 
ATOM   4618  O  OD1   . ASP B 2  403 ? 2.106   -8.878  55.357 1.00 137.58 ? 404 ASP A OD1   1 
ATOM   4619  O  OD2   . ASP B 2  403 ? 3.192   -7.309  54.270 1.00 127.18 ? 404 ASP A OD2   1 
ATOM   4620  N  N     . LYS B 2  404 ? 5.601   -10.009 58.264 1.00 81.52  ? 405 LYS A N     1 
ATOM   4621  C  CA    . LYS B 2  404 ? 6.703   -10.232 59.184 1.00 80.53  ? 405 LYS A CA    1 
ATOM   4622  C  C     . LYS B 2  404 ? 6.982   -11.715 59.328 1.00 81.32  ? 405 LYS A C     1 
ATOM   4623  O  O     . LYS B 2  404 ? 8.135   -12.153 59.249 1.00 82.13  ? 405 LYS A O     1 
ATOM   4624  C  CB    . LYS B 2  404 ? 6.358   -9.604  60.533 1.00 79.41  ? 405 LYS A CB    1 
ATOM   4625  C  CG    . LYS B 2  404 ? 7.563   -9.168  61.330 1.00 84.59  ? 405 LYS A CG    1 
ATOM   4626  C  CD    . LYS B 2  404 ? 7.196   -9.036  62.797 1.00 89.05  ? 405 LYS A CD    1 
ATOM   4627  C  CE    . LYS B 2  404 ? 7.967   -7.919  63.476 1.00 88.75  ? 405 LYS A CE    1 
ATOM   4628  N  NZ    . LYS B 2  404 ? 7.292   -6.600  63.299 1.00 78.08  ? 405 LYS A NZ    1 
ATOM   4629  N  N     . VAL B 2  405 ? 5.930   -12.507 59.544 1.00 72.21  ? 406 VAL A N     1 
ATOM   4630  C  CA    . VAL B 2  405 ? 6.097   -13.951 59.654 1.00 66.10  ? 406 VAL A CA    1 
ATOM   4631  C  C     . VAL B 2  405 ? 6.598   -14.525 58.343 1.00 69.25  ? 406 VAL A C     1 
ATOM   4632  O  O     . VAL B 2  405 ? 7.493   -15.378 58.316 1.00 73.43  ? 406 VAL A O     1 
ATOM   4633  C  CB    . VAL B 2  405 ? 4.774   -14.612 60.061 1.00 61.41  ? 406 VAL A CB    1 
ATOM   4634  C  CG1   . VAL B 2  405 ? 4.866   -16.106 59.805 1.00 67.16  ? 406 VAL A CG1   1 
ATOM   4635  C  CG2   . VAL B 2  405 ? 4.467   -14.330 61.504 1.00 64.36  ? 406 VAL A CG2   1 
ATOM   4636  N  N     . ALA B 2  406 ? 5.990   -14.099 57.237 1.00 71.06  ? 407 ALA A N     1 
ATOM   4637  C  CA    . ALA B 2  406 ? 6.380   -14.593 55.925 1.00 69.15  ? 407 ALA A CA    1 
ATOM   4638  C  C     . ALA B 2  406 ? 7.816   -14.230 55.617 1.00 70.65  ? 407 ALA A C     1 
ATOM   4639  O  O     . ALA B 2  406 ? 8.563   -15.031 55.045 1.00 70.30  ? 407 ALA A O     1 
ATOM   4640  C  CB    . ALA B 2  406 ? 5.448   -14.021 54.860 1.00 74.38  ? 407 ALA A CB    1 
ATOM   4641  N  N     . MET B 2  407 ? 8.211   -13.012 55.962 1.00 74.40  ? 408 MET A N     1 
ATOM   4642  C  CA    . MET B 2  407 ? 9.585   -12.586 55.745 1.00 88.28  ? 408 MET A CA    1 
ATOM   4643  C  C     . MET B 2  407 ? 10.546  -13.498 56.487 1.00 95.41  ? 408 MET A C     1 
ATOM   4644  O  O     . MET B 2  407 ? 11.535  -13.981 55.923 1.00 93.83  ? 408 MET A O     1 
ATOM   4645  C  CB    . MET B 2  407 ? 9.740   -11.137 56.205 1.00 88.40  ? 408 MET A CB    1 
ATOM   4646  C  CG    . MET B 2  407 ? 11.021  -10.476 55.795 1.00 89.42  ? 408 MET A CG    1 
ATOM   4647  S  SD    . MET B 2  407 ? 10.807  -8.710  56.003 1.00 100.11 ? 408 MET A SD    1 
ATOM   4648  C  CE    . MET B 2  407 ? 12.478  -8.221  56.397 1.00 97.53  ? 408 MET A CE    1 
ATOM   4649  N  N     . GLU B 2  408 ? 10.242  -13.770 57.754 1.00 95.98  ? 409 GLU A N     1 
ATOM   4650  C  CA    . GLU B 2  408 ? 11.130  -14.573 58.578 1.00 88.95  ? 409 GLU A CA    1 
ATOM   4651  C  C     . GLU B 2  408 ? 11.332  -15.957 57.991 1.00 81.53  ? 409 GLU A C     1 
ATOM   4652  O  O     . GLU B 2  408 ? 12.456  -16.470 57.959 1.00 87.82  ? 409 GLU A O     1 
ATOM   4653  C  CB    . GLU B 2  408 ? 10.574  -14.666 60.000 1.00 95.36  ? 409 GLU A CB    1 
ATOM   4654  C  CG    . GLU B 2  408 ? 11.313  -15.659 60.874 1.00 102.38 ? 409 GLU A CG    1 
ATOM   4655  C  CD    . GLU B 2  408 ? 12.760  -15.264 61.116 1.00 107.21 ? 409 GLU A CD    1 
ATOM   4656  O  OE1   . GLU B 2  408 ? 13.232  -14.288 60.493 1.00 105.50 ? 409 GLU A OE1   1 
ATOM   4657  O  OE2   . GLU B 2  408 ? 13.426  -15.921 61.945 1.00 113.89 ? 409 GLU A OE2   1 
ATOM   4658  N  N     . SER B 2  409 ? 10.256  -16.581 57.528 1.00 70.18  ? 410 SER A N     1 
ATOM   4659  C  CA    . SER B 2  409 ? 10.379  -17.919 56.968 1.00 72.40  ? 410 SER A CA    1 
ATOM   4660  C  C     . SER B 2  409 ? 11.302  -17.924 55.763 1.00 83.51  ? 410 SER A C     1 
ATOM   4661  O  O     . SER B 2  409 ? 12.146  -18.810 55.626 1.00 93.94  ? 410 SER A O     1 
ATOM   4662  C  CB    . SER B 2  409 ? 9.001   -18.458 56.600 1.00 86.84  ? 410 SER A CB    1 
ATOM   4663  O  OG    . SER B 2  409 ? 8.162   -18.535 57.736 1.00 104.12 ? 410 SER A OG    1 
ATOM   4664  N  N     . LEU B 2  410 ? 11.187  -16.917 54.899 1.00 92.22  ? 411 LEU A N     1 
ATOM   4665  C  CA    . LEU B 2  410 ? 11.993  -16.880 53.681 1.00 87.35  ? 411 LEU A CA    1 
ATOM   4666  C  C     . LEU B 2  410 ? 13.477  -16.712 53.975 1.00 97.06  ? 411 LEU A C     1 
ATOM   4667  O  O     . LEU B 2  410 ? 14.320  -17.227 53.230 1.00 98.77  ? 411 LEU A O     1 
ATOM   4668  C  CB    . LEU B 2  410 ? 11.508  -15.752 52.774 1.00 75.74  ? 411 LEU A CB    1 
ATOM   4669  C  CG    . LEU B 2  410 ? 10.158  -15.955 52.091 1.00 67.12  ? 411 LEU A CG    1 
ATOM   4670  C  CD1   . LEU B 2  410 ? 9.759   -14.709 51.335 1.00 61.00  ? 411 LEU A CD1   1 
ATOM   4671  C  CD2   . LEU B 2  410 ? 10.227  -17.144 51.158 1.00 79.98  ? 411 LEU A CD2   1 
ATOM   4672  N  N     . GLN B 2  411 ? 13.819  -15.974 55.028 1.00 98.61  ? 412 GLN A N     1 
ATOM   4673  C  CA    . GLN B 2  411 ? 15.226  -15.798 55.374 1.00 92.73  ? 412 GLN A CA    1 
ATOM   4674  C  C     . GLN B 2  411 ? 15.817  -17.072 55.951 1.00 98.21  ? 412 GLN A C     1 
ATOM   4675  O  O     . GLN B 2  411 ? 17.020  -17.324 55.816 1.00 104.23 ? 412 GLN A O     1 
ATOM   4676  C  CB    . GLN B 2  411 ? 15.387  -14.655 56.367 1.00 77.14  ? 412 GLN A CB    1 
ATOM   4677  C  CG    . GLN B 2  411 ? 14.678  -13.393 55.971 1.00 73.35  ? 412 GLN A CG    1 
ATOM   4678  C  CD    . GLN B 2  411 ? 15.015  -12.262 56.900 1.00 86.05  ? 412 GLN A CD    1 
ATOM   4679  O  OE1   . GLN B 2  411 ? 14.127  -11.555 57.381 1.00 101.61 ? 412 GLN A OE1   1 
ATOM   4680  N  NE2   . GLN B 2  411 ? 16.308  -12.086 57.173 1.00 94.14  ? 412 GLN A NE2   1 
ATOM   4681  N  N     . GLN B 2  412 ? 14.976  -17.860 56.614 1.00 87.94  ? 413 GLN A N     1 
ATOM   4682  C  CA    . GLN B 2  412 ? 15.347  -19.152 57.183 1.00 92.40  ? 413 GLN A CA    1 
ATOM   4683  C  C     . GLN B 2  412 ? 15.504  -20.201 56.106 1.00 86.67  ? 413 GLN A C     1 
ATOM   4684  O  O     . GLN B 2  412 ? 16.533  -20.884 56.009 1.00 100.10 ? 413 GLN A O     1 
ATOM   4685  C  CB    . GLN B 2  412 ? 14.251  -19.618 58.143 1.00 104.85 ? 413 GLN A CB    1 
ATOM   4686  C  CG    . GLN B 2  412 ? 14.269  -19.060 59.516 1.00 108.23 ? 413 GLN A CG    1 
ATOM   4687  C  CD    . GLN B 2  412 ? 15.364  -19.669 60.350 1.00 115.98 ? 413 GLN A CD    1 
ATOM   4688  O  OE1   . GLN B 2  412 ? 16.339  -20.193 59.818 1.00 119.26 ? 413 GLN A OE1   1 
ATOM   4689  N  NE2   . GLN B 2  412 ? 15.214  -19.609 61.662 1.00 119.14 ? 413 GLN A NE2   1 
ATOM   4690  N  N     . ARG B 2  413 ? 14.439  -20.380 55.334 1.00 80.54  ? 414 ARG A N     1 
ATOM   4691  C  CA    . ARG B 2  413 ? 14.373  -21.457 54.366 1.00 85.50  ? 414 ARG A CA    1 
ATOM   4692  C  C     . ARG B 2  413 ? 15.383  -21.260 53.247 1.00 84.39  ? 414 ARG A C     1 
ATOM   4693  O  O     . ARG B 2  413 ? 15.979  -22.232 52.773 1.00 89.21  ? 414 ARG A O     1 
ATOM   4694  C  CB    . ARG B 2  413 ? 12.950  -21.559 53.815 1.00 103.04 ? 414 ARG A CB    1 
ATOM   4695  C  CG    . ARG B 2  413 ? 11.880  -21.492 54.878 1.00 114.22 ? 414 ARG A CG    1 
ATOM   4696  C  CD    . ARG B 2  413 ? 11.602  -22.807 55.519 1.00 121.62 ? 414 ARG A CD    1 
ATOM   4697  N  NE    . ARG B 2  413 ? 10.586  -23.526 54.763 1.00 130.32 ? 414 ARG A NE    1 
ATOM   4698  C  CZ    . ARG B 2  413 ? 9.279   -23.397 54.965 1.00 124.37 ? 414 ARG A CZ    1 
ATOM   4699  N  NH1   . ARG B 2  413 ? 8.421   -24.091 54.227 1.00 124.22 ? 414 ARG A NH1   1 
ATOM   4700  N  NH2   . ARG B 2  413 ? 8.831   -22.576 55.908 1.00 114.70 ? 414 ARG A NH2   1 
ATOM   4701  N  N     . PHE B 2  414 ? 15.607  -20.021 52.811 1.00 81.81  ? 415 PHE A N     1 
ATOM   4702  C  CA    . PHE B 2  414 ? 16.465  -19.798 51.649 1.00 75.62  ? 415 PHE A CA    1 
ATOM   4703  C  C     . PHE B 2  414 ? 17.672  -18.911 51.918 1.00 71.63  ? 415 PHE A C     1 
ATOM   4704  O  O     . PHE B 2  414 ? 18.330  -18.496 50.948 1.00 67.28  ? 415 PHE A O     1 
ATOM   4705  C  CB    . PHE B 2  414 ? 15.678  -19.206 50.475 1.00 72.53  ? 415 PHE A CB    1 
ATOM   4706  C  CG    . PHE B 2  414 ? 14.408  -19.915 50.180 1.00 68.49  ? 415 PHE A CG    1 
ATOM   4707  C  CD1   . PHE B 2  414 ? 13.271  -19.645 50.919 1.00 76.60  ? 415 PHE A CD1   1 
ATOM   4708  C  CD2   . PHE B 2  414 ? 14.342  -20.832 49.152 1.00 65.85  ? 415 PHE A CD2   1 
ATOM   4709  C  CE1   . PHE B 2  414 ? 12.095  -20.286 50.651 1.00 73.74  ? 415 PHE A CE1   1 
ATOM   4710  C  CE2   . PHE B 2  414 ? 13.165  -21.471 48.874 1.00 67.23  ? 415 PHE A CE2   1 
ATOM   4711  C  CZ    . PHE B 2  414 ? 12.038  -21.197 49.624 1.00 68.98  ? 415 PHE A CZ    1 
ATOM   4712  N  N     . LYS B 2  415 ? 17.981  -18.604 53.175 1.00 77.83  ? 416 LYS A N     1 
ATOM   4713  C  CA    . LYS B 2  415 ? 19.130  -17.769 53.528 1.00 86.20  ? 416 LYS A CA    1 
ATOM   4714  C  C     . LYS B 2  415 ? 19.131  -16.445 52.763 1.00 85.68  ? 416 LYS A C     1 
ATOM   4715  O  O     . LYS B 2  415 ? 20.098  -16.069 52.100 1.00 95.93  ? 416 LYS A O     1 
ATOM   4716  C  CB    . LYS B 2  415 ? 20.433  -18.550 53.342 1.00 84.68  ? 416 LYS A CB    1 
ATOM   4717  C  CG    . LYS B 2  415 ? 20.523  -19.735 54.302 1.00 64.00  ? 416 LYS A CG    1 
ATOM   4718  C  CD    . LYS B 2  415 ? 21.930  -20.210 54.478 1.00 59.68  ? 416 LYS A CD    1 
ATOM   4719  C  CE    . LYS B 2  415 ? 21.958  -21.246 55.480 1.00 71.90  ? 416 LYS A CE    1 
ATOM   4720  N  NZ    . LYS B 2  415 ? 21.471  -20.862 56.858 1.00 77.92  ? 416 LYS A NZ    1 
ATOM   4721  N  N     . LEU B 2  416 ? 18.012  -15.731 52.875 1.00 79.65  ? 417 LEU A N     1 
ATOM   4722  C  CA    . LEU B 2  416 ? 17.808  -14.461 52.197 1.00 74.15  ? 417 LEU A CA    1 
ATOM   4723  C  C     . LEU B 2  416 ? 17.935  -13.289 53.158 1.00 78.26  ? 417 LEU A C     1 
ATOM   4724  O  O     . LEU B 2  416 ? 17.634  -13.393 54.350 1.00 82.63  ? 417 LEU A O     1 
ATOM   4725  C  CB    . LEU B 2  416 ? 16.433  -14.408 51.524 1.00 70.83  ? 417 LEU A CB    1 
ATOM   4726  C  CG    . LEU B 2  416 ? 16.208  -15.297 50.307 1.00 67.54  ? 417 LEU A CG    1 
ATOM   4727  C  CD1   . LEU B 2  416 ? 14.783  -15.138 49.862 1.00 64.07  ? 417 LEU A CD1   1 
ATOM   4728  C  CD2   . LEU B 2  416 ? 17.161  -14.938 49.191 1.00 63.99  ? 417 LEU A CD2   1 
ATOM   4729  N  N     . SER B 2  417 ? 18.371  -12.160 52.606 1.00 72.17  ? 418 SER A N     1 
ATOM   4730  C  CA    . SER B 2  417 ? 18.472  -10.904 53.328 1.00 75.37  ? 418 SER A CA    1 
ATOM   4731  C  C     . SER B 2  417 ? 17.094  -10.268 53.450 1.00 71.25  ? 418 SER A C     1 
ATOM   4732  O  O     . SER B 2  417 ? 16.160  -10.617 52.729 1.00 80.28  ? 418 SER A O     1 
ATOM   4733  C  CB    . SER B 2  417 ? 19.422  -9.947  52.611 1.00 80.94  ? 418 SER A CB    1 
ATOM   4734  O  OG    . SER B 2  417 ? 18.842  -9.507  51.398 1.00 81.14  ? 418 SER A OG    1 
ATOM   4735  N  N     . GLU B 2  418 ? 16.974  -9.320  54.377 1.00 75.34  ? 419 GLU A N     1 
ATOM   4736  C  CA    . GLU B 2  418 ? 15.689  -8.654  54.563 1.00 79.86  ? 419 GLU A CA    1 
ATOM   4737  C  C     . GLU B 2  418 ? 15.245  -7.958  53.288 1.00 71.85  ? 419 GLU A C     1 
ATOM   4738  O  O     . GLU B 2  418 ? 14.070  -8.017  52.913 1.00 69.39  ? 419 GLU A O     1 
ATOM   4739  C  CB    . GLU B 2  418 ? 15.775  -7.643  55.706 1.00 91.64  ? 419 GLU A CB    1 
ATOM   4740  C  CG    . GLU B 2  418 ? 16.245  -8.223  57.017 1.00 100.80 ? 419 GLU A CG    1 
ATOM   4741  C  CD    . GLU B 2  418 ? 15.721  -7.444  58.206 1.00 113.86 ? 419 GLU A CD    1 
ATOM   4742  O  OE1   . GLU B 2  418 ? 14.770  -6.649  58.030 1.00 122.00 ? 419 GLU A OE1   1 
ATOM   4743  O  OE2   . GLU B 2  418 ? 16.259  -7.629  59.317 1.00 117.27 ? 419 GLU A OE2   1 
ATOM   4744  N  N     . LYS B 2  419 ? 16.175  -7.282  52.616 1.00 69.78  ? 420 LYS A N     1 
ATOM   4745  C  CA    . LYS B 2  419 ? 15.848  -6.598  51.371 1.00 65.84  ? 420 LYS A CA    1 
ATOM   4746  C  C     . LYS B 2  419 ? 15.406  -7.588  50.307 1.00 63.94  ? 420 LYS A C     1 
ATOM   4747  O  O     . LYS B 2  419 ? 14.438  -7.340  49.581 1.00 69.42  ? 420 LYS A O     1 
ATOM   4748  C  CB    . LYS B 2  419 ? 17.055  -5.796  50.889 1.00 69.47  ? 420 LYS A CB    1 
ATOM   4749  C  CG    . LYS B 2  419 ? 17.419  -4.635  51.788 1.00 66.89  ? 420 LYS A CG    1 
ATOM   4750  C  CD    . LYS B 2  419 ? 18.509  -3.784  51.164 1.00 62.87  ? 420 LYS A CD    1 
ATOM   4751  C  CE    . LYS B 2  419 ? 18.580  -2.429  51.839 1.00 66.33  ? 420 LYS A CE    1 
ATOM   4752  N  NZ    . LYS B 2  419 ? 19.707  -1.607  51.322 1.00 73.62  ? 420 LYS A NZ    1 
ATOM   4753  N  N     . GLN B 2  420 ? 16.114  -8.713  50.195 1.00 64.57  ? 421 GLN A N     1 
ATOM   4754  C  CA    . GLN B 2  420 ? 15.743  -9.738  49.225 1.00 62.51  ? 421 GLN A CA    1 
ATOM   4755  C  C     . GLN B 2  420 ? 14.356  -10.277 49.512 1.00 62.60  ? 421 GLN A C     1 
ATOM   4756  O  O     . GLN B 2  420 ? 13.556  -10.478 48.596 1.00 67.22  ? 421 GLN A O     1 
ATOM   4757  C  CB    . GLN B 2  420 ? 16.759  -10.877 49.243 1.00 59.00  ? 421 GLN A CB    1 
ATOM   4758  C  CG    . GLN B 2  420 ? 17.963  -10.642 48.366 1.00 66.95  ? 421 GLN A CG    1 
ATOM   4759  C  CD    . GLN B 2  420 ? 19.058  -11.671 48.593 1.00 72.58  ? 421 GLN A CD    1 
ATOM   4760  O  OE1   . GLN B 2  420 ? 19.259  -12.137 49.715 1.00 79.74  ? 421 GLN A OE1   1 
ATOM   4761  N  NE2   . GLN B 2  420 ? 19.772  -12.034 47.526 1.00 67.78  ? 421 GLN A NE2   1 
ATOM   4762  N  N     . ALA B 2  421 ? 14.054  -10.514 50.783 1.00 67.39  ? 422 ALA A N     1 
ATOM   4763  C  CA    . ALA B 2  421 ? 12.741  -11.022 51.152 1.00 64.23  ? 422 ALA A CA    1 
ATOM   4764  C  C     . ALA B 2  421 ? 11.652  -10.013 50.836 1.00 68.86  ? 422 ALA A C     1 
ATOM   4765  O  O     . ALA B 2  421 ? 10.588  -10.380 50.332 1.00 67.21  ? 422 ALA A O     1 
ATOM   4766  C  CB    . ALA B 2  421 ? 12.724  -11.384 52.636 1.00 57.26  ? 422 ALA A CB    1 
ATOM   4767  N  N     . GLN B 2  422 ? 11.884  -8.740  51.146 1.00 64.64  ? 423 GLN A N     1 
ATOM   4768  C  CA    . GLN B 2  422 ? 10.864  -7.730  50.877 1.00 66.61  ? 423 GLN A CA    1 
ATOM   4769  C  C     . GLN B 2  422 ? 10.623  -7.586  49.385 1.00 64.44  ? 423 GLN A C     1 
ATOM   4770  O  O     . GLN B 2  422 ? 9.489   -7.352  48.952 1.00 65.89  ? 423 GLN A O     1 
ATOM   4771  C  CB    . GLN B 2  422 ? 11.266  -6.384  51.479 1.00 82.21  ? 423 GLN A CB    1 
ATOM   4772  C  CG    . GLN B 2  422 ? 10.956  -6.245  52.954 1.00 101.04 ? 423 GLN A CG    1 
ATOM   4773  C  CD    . GLN B 2  422 ? 9.473   -6.082  53.225 1.00 109.64 ? 423 GLN A CD    1 
ATOM   4774  O  OE1   . GLN B 2  422 ? 8.763   -5.406  52.477 1.00 105.54 ? 423 GLN A OE1   1 
ATOM   4775  N  NE2   . GLN B 2  422 ? 8.996   -6.705  54.300 1.00 108.71 ? 423 GLN A NE2   1 
ATOM   4776  N  N     . ALA B 2  423 ? 11.682  -7.711  48.586 1.00 61.42  ? 424 ALA A N     1 
ATOM   4777  C  CA    . ALA B 2  423 ? 11.538  -7.642  47.137 1.00 51.43  ? 424 ALA A CA    1 
ATOM   4778  C  C     . ALA B 2  423 ? 10.657  -8.768  46.632 1.00 58.76  ? 424 ALA A C     1 
ATOM   4779  O  O     . ALA B 2  423 ? 9.778   -8.558  45.786 1.00 60.69  ? 424 ALA A O     1 
ATOM   4780  C  CB    . ALA B 2  423 ? 12.913  -7.699  46.473 1.00 44.11  ? 424 ALA A CB    1 
ATOM   4781  N  N     . ILE B 2  424 ? 10.886  -9.976  47.149 1.00 76.11  ? 425 ILE A N     1 
ATOM   4782  C  CA    . ILE B 2  424 ? 10.102  -11.147 46.768 1.00 67.24  ? 425 ILE A CA    1 
ATOM   4783  C  C     . ILE B 2  424 ? 8.643   -10.951 47.131 1.00 64.74  ? 425 ILE A C     1 
ATOM   4784  O  O     . ILE B 2  424 ? 7.742   -11.292 46.361 1.00 68.89  ? 425 ILE A O     1 
ATOM   4785  C  CB    . ILE B 2  424 ? 10.667  -12.405 47.448 1.00 60.58  ? 425 ILE A CB    1 
ATOM   4786  C  CG1   . ILE B 2  424 ? 12.105  -12.657 47.007 1.00 59.67  ? 425 ILE A CG1   1 
ATOM   4787  C  CG2   . ILE B 2  424 ? 9.795   -13.596 47.133 1.00 56.10  ? 425 ILE A CG2   1 
ATOM   4788  C  CD1   . ILE B 2  424 ? 12.607  -13.984 47.440 1.00 54.51  ? 425 ILE A CD1   1 
ATOM   4789  N  N     . LEU B 2  425 ? 8.388   -10.441 48.330 1.00 63.09  ? 426 LEU A N     1 
ATOM   4790  C  CA    . LEU B 2  425 ? 7.019   -10.220 48.770 1.00 59.62  ? 426 LEU A CA    1 
ATOM   4791  C  C     . LEU B 2  425 ? 6.333   -9.165  47.922 1.00 65.57  ? 426 LEU A C     1 
ATOM   4792  O  O     . LEU B 2  425 ? 5.127   -9.256  47.663 1.00 59.91  ? 426 LEU A O     1 
ATOM   4793  C  CB    . LEU B 2  425 ? 7.016   -9.834  50.242 1.00 58.87  ? 426 LEU A CB    1 
ATOM   4794  C  CG    . LEU B 2  425 ? 7.092   -11.042 51.166 1.00 63.59  ? 426 LEU A CG    1 
ATOM   4795  C  CD1   . LEU B 2  425 ? 7.924   -10.755 52.396 1.00 80.17  ? 426 LEU A CD1   1 
ATOM   4796  C  CD2   . LEU B 2  425 ? 5.688   -11.457 51.564 1.00 70.22  ? 426 LEU A CD2   1 
ATOM   4797  N  N     . ASP B 2  426 ? 7.086   -8.161  47.476 1.00 66.24  ? 427 ASP A N     1 
ATOM   4798  C  CA    . ASP B 2  426 ? 6.575   -7.083  46.639 1.00 64.65  ? 427 ASP A CA    1 
ATOM   4799  C  C     . ASP B 2  426 ? 6.390   -7.499  45.190 1.00 65.91  ? 427 ASP A C     1 
ATOM   4800  O  O     . ASP B 2  426 ? 5.745   -6.760  44.434 1.00 79.00  ? 427 ASP A O     1 
ATOM   4801  C  CB    . ASP B 2  426 ? 7.513   -5.875  46.698 1.00 72.86  ? 427 ASP A CB    1 
ATOM   4802  C  CG    . ASP B 2  426 ? 7.391   -5.098  47.993 1.00 86.52  ? 427 ASP A CG    1 
ATOM   4803  O  OD1   . ASP B 2  426 ? 6.410   -5.321  48.736 1.00 84.08  ? 427 ASP A OD1   1 
ATOM   4804  O  OD2   . ASP B 2  426 ? 8.271   -4.249  48.256 1.00 97.42  ? 427 ASP A OD2   1 
ATOM   4805  N  N     . MET B 2  427 ? 6.945   -8.636  44.789 1.00 61.23  ? 428 MET A N     1 
ATOM   4806  C  CA    . MET B 2  427 ? 6.842   -9.101  43.413 1.00 63.29  ? 428 MET A CA    1 
ATOM   4807  C  C     . MET B 2  427 ? 5.385   -9.276  43.003 1.00 62.20  ? 428 MET A C     1 
ATOM   4808  O  O     . MET B 2  427 ? 4.557   -9.759  43.778 1.00 63.48  ? 428 MET A O     1 
ATOM   4809  C  CB    . MET B 2  427 ? 7.601   -10.418 43.261 1.00 62.98  ? 428 MET A CB    1 
ATOM   4810  C  CG    . MET B 2  427 ? 8.006   -10.761 41.860 1.00 73.23  ? 428 MET A CG    1 
ATOM   4811  S  SD    . MET B 2  427 ? 8.692   -12.429 41.732 1.00 80.24  ? 428 MET A SD    1 
ATOM   4812  C  CE    . MET B 2  427 ? 9.968   -12.362 42.964 1.00 80.06  ? 428 MET A CE    1 
ATOM   4813  N  N     . ARG B 2  428 ? 5.068   -8.873  41.779 1.00 60.25  ? 429 ARG A N     1 
ATOM   4814  C  CA    . ARG B 2  428 ? 3.732   -9.035  41.223 1.00 58.90  ? 429 ARG A CA    1 
ATOM   4815  C  C     . ARG B 2  428 ? 3.626   -10.388 40.532 1.00 59.98  ? 429 ARG A C     1 
ATOM   4816  O  O     . ARG B 2  428 ? 4.622   -10.958 40.094 1.00 65.30  ? 429 ARG A O     1 
ATOM   4817  C  CB    . ARG B 2  428 ? 3.425   -7.907  40.244 1.00 55.60  ? 429 ARG A CB    1 
ATOM   4818  C  CG    . ARG B 2  428 ? 3.629   -6.522  40.823 1.00 54.23  ? 429 ARG A CG    1 
ATOM   4819  C  CD    . ARG B 2  428 ? 3.058   -5.453  39.911 1.00 64.46  ? 429 ARG A CD    1 
ATOM   4820  N  NE    . ARG B 2  428 ? 3.273   -4.109  40.439 1.00 68.19  ? 429 ARG A NE    1 
ATOM   4821  C  CZ    . ARG B 2  428 ? 2.397   -3.453  41.192 1.00 70.99  ? 429 ARG A CZ    1 
ATOM   4822  N  NH1   . ARG B 2  428 ? 1.238   -4.015  41.508 1.00 68.57  ? 429 ARG A NH1   1 
ATOM   4823  N  NH2   . ARG B 2  428 ? 2.678   -2.234  41.627 1.00 83.47  ? 429 ARG A NH2   1 
ATOM   4824  N  N     . LEU B 2  429 ? 2.401   -10.913 40.443 1.00 61.73  ? 430 LEU A N     1 
ATOM   4825  C  CA    . LEU B 2  429 ? 2.274   -12.243 39.852 1.00 61.05  ? 430 LEU A CA    1 
ATOM   4826  C  C     . LEU B 2  429 ? 2.693   -12.264 38.383 1.00 65.12  ? 430 LEU A C     1 
ATOM   4827  O  O     . LEU B 2  429 ? 3.208   -13.280 37.915 1.00 69.62  ? 430 LEU A O     1 
ATOM   4828  C  CB    . LEU B 2  429 ? 0.848   -12.796 40.013 1.00 55.91  ? 430 LEU A CB    1 
ATOM   4829  C  CG    . LEU B 2  429 ? 0.099   -13.040 41.321 1.00 50.24  ? 430 LEU A CG    1 
ATOM   4830  C  CD1   . LEU B 2  429 ? -1.144  -13.825 40.976 1.00 49.20  ? 430 LEU A CD1   1 
ATOM   4831  C  CD2   . LEU B 2  429 ? 0.916   -13.802 42.312 1.00 57.45  ? 430 LEU A CD2   1 
ATOM   4832  N  N     . ARG B 2  430 ? 2.513   -11.161 37.641 1.00 64.00  ? 431 ARG A N     1 
ATOM   4833  C  CA    . ARG B 2  430 ? 2.945   -11.131 36.247 1.00 69.62  ? 431 ARG A CA    1 
ATOM   4834  C  C     . ARG B 2  430 ? 4.445   -11.363 36.088 1.00 70.71  ? 431 ARG A C     1 
ATOM   4835  O  O     . ARG B 2  430 ? 4.899   -11.668 34.978 1.00 75.32  ? 431 ARG A O     1 
ATOM   4836  C  CB    . ARG B 2  430 ? 2.525   -9.817  35.566 1.00 64.67  ? 431 ARG A CB    1 
ATOM   4837  C  CG    . ARG B 2  430 ? 3.212   -8.547  36.086 1.00 73.12  ? 431 ARG A CG    1 
ATOM   4838  C  CD    . ARG B 2  430 ? 2.836   -7.283  35.283 1.00 73.24  ? 431 ARG A CD    1 
ATOM   4839  N  NE    . ARG B 2  430 ? 1.436   -6.913  35.455 1.00 73.58  ? 431 ARG A NE    1 
ATOM   4840  C  CZ    . ARG B 2  430 ? 0.534   -6.879  34.479 1.00 75.77  ? 431 ARG A CZ    1 
ATOM   4841  N  NH1   . ARG B 2  430 ? 0.865   -7.173  33.231 1.00 76.98  ? 431 ARG A NH1   1 
ATOM   4842  N  NH2   . ARG B 2  430 ? -0.709  -6.535  34.755 1.00 73.67  ? 431 ARG A NH2   1 
ATOM   4843  N  N     . ARG B 2  431 ? 5.242   -11.216 37.146 1.00 58.52  ? 432 ARG A N     1 
ATOM   4844  C  CA    . ARG B 2  431 ? 6.666   -11.539 37.039 1.00 63.35  ? 432 ARG A CA    1 
ATOM   4845  C  C     . ARG B 2  431 ? 6.927   -13.034 36.961 1.00 72.83  ? 432 ARG A C     1 
ATOM   4846  O  O     . ARG B 2  431 ? 8.084   -13.455 36.802 1.00 84.97  ? 432 ARG A O     1 
ATOM   4847  C  CB    . ARG B 2  431 ? 7.449   -10.958 38.213 1.00 64.68  ? 432 ARG A CB    1 
ATOM   4848  C  CG    . ARG B 2  431 ? 7.330   -9.480  38.269 1.00 80.01  ? 432 ARG A CG    1 
ATOM   4849  C  CD    . ARG B 2  431 ? 8.047   -8.747  37.134 1.00 94.27  ? 432 ARG A CD    1 
ATOM   4850  N  NE    . ARG B 2  431 ? 9.487   -8.578  37.346 1.00 110.30 ? 432 ARG A NE    1 
ATOM   4851  C  CZ    . ARG B 2  431 ? 10.055  -8.143  38.476 1.00 115.19 ? 432 ARG A CZ    1 
ATOM   4852  N  NH1   . ARG B 2  431 ? 9.334   -7.852  39.553 1.00 114.28 ? 432 ARG A NH1   1 
ATOM   4853  N  NH2   . ARG B 2  431 ? 11.369  -8.009  38.544 1.00 114.83 ? 432 ARG A NH2   1 
ATOM   4854  N  N     . LEU B 2  432 ? 5.882   -13.841 37.060 1.00 61.60  ? 433 LEU A N     1 
ATOM   4855  C  CA    . LEU B 2  432 ? 6.024   -15.282 37.025 1.00 56.17  ? 433 LEU A CA    1 
ATOM   4856  C  C     . LEU B 2  432 ? 6.027   -15.851 35.614 1.00 56.51  ? 433 LEU A C     1 
ATOM   4857  O  O     . LEU B 2  432 ? 6.366   -17.021 35.450 1.00 62.78  ? 433 LEU A O     1 
ATOM   4858  C  CB    . LEU B 2  432 ? 4.915   -15.930 37.858 1.00 62.10  ? 433 LEU A CB    1 
ATOM   4859  C  CG    . LEU B 2  432 ? 5.269   -16.251 39.312 1.00 57.63  ? 433 LEU A CG    1 
ATOM   4860  C  CD1   . LEU B 2  432 ? 6.296   -15.269 39.864 1.00 49.95  ? 433 LEU A CD1   1 
ATOM   4861  C  CD2   . LEU B 2  432 ? 4.002   -16.234 40.145 1.00 61.64  ? 433 LEU A CD2   1 
ATOM   4862  N  N     . THR B 2  433 ? 5.684   -15.060 34.607 1.00 61.81  ? 434 THR A N     1 
ATOM   4863  C  CA    . THR B 2  433 ? 5.598   -15.560 33.233 1.00 70.98  ? 434 THR A CA    1 
ATOM   4864  C  C     . THR B 2  433 ? 6.981   -15.912 32.678 1.00 74.57  ? 434 THR A C     1 
ATOM   4865  O  O     . THR B 2  433 ? 8.017   -15.542 33.236 1.00 81.19  ? 434 THR A O     1 
ATOM   4866  C  CB    . THR B 2  433 ? 4.911   -14.537 32.325 1.00 70.15  ? 434 THR A CB    1 
ATOM   4867  O  OG1   . THR B 2  433 ? 5.692   -13.338 32.280 1.00 72.38  ? 434 THR A OG1   1 
ATOM   4868  C  CG2   . THR B 2  433 ? 3.525   -14.215 32.841 1.00 59.48  ? 434 THR A CG2   1 
ATOM   4869  N  N     . GLY B 2  434 ? 6.969   -16.615 31.532 1.00 73.62  ? 435 GLY A N     1 
ATOM   4870  C  CA    . GLY B 2  434 ? 8.201   -17.157 30.976 1.00 83.43  ? 435 GLY A CA    1 
ATOM   4871  C  C     . GLY B 2  434 ? 9.215   -16.111 30.549 1.00 95.56  ? 435 GLY A C     1 
ATOM   4872  O  O     . GLY B 2  434 ? 10.418  -16.285 30.760 1.00 100.57 ? 435 GLY A O     1 
ATOM   4873  N  N     . LEU B 2  435 ? 8.754   -15.029 29.922 1.00 96.62  ? 436 LEU A N     1 
ATOM   4874  C  CA    . LEU B 2  435 ? 9.691   -14.009 29.448 1.00 103.48 ? 436 LEU A CA    1 
ATOM   4875  C  C     . LEU B 2  435 ? 10.420  -13.340 30.604 1.00 105.44 ? 436 LEU A C     1 
ATOM   4876  O  O     . LEU B 2  435 ? 11.627  -13.075 30.523 1.00 110.44 ? 436 LEU A O     1 
ATOM   4877  C  CB    . LEU B 2  435 ? 8.965   -12.954 28.607 1.00 106.52 ? 436 LEU A CB    1 
ATOM   4878  C  CG    . LEU B 2  435 ? 8.709   -13.350 27.156 1.00 111.06 ? 436 LEU A CG    1 
ATOM   4879  C  CD1   . LEU B 2  435 ? 8.278   -12.142 26.360 1.00 103.86 ? 436 LEU A CD1   1 
ATOM   4880  C  CD2   . LEU B 2  435 ? 9.951   -13.982 26.557 1.00 118.79 ? 436 LEU A CD2   1 
ATOM   4881  N  N     . GLU B 2  436 ? 9.698   -13.056 31.684 1.00 101.76 ? 437 GLU A N     1 
ATOM   4882  C  CA    . GLU B 2  436 ? 10.280  -12.344 32.816 1.00 98.61  ? 437 GLU A CA    1 
ATOM   4883  C  C     . GLU B 2  436 ? 11.460  -13.100 33.405 1.00 91.84  ? 437 GLU A C     1 
ATOM   4884  O  O     . GLU B 2  436 ? 12.474  -12.494 33.771 1.00 99.10  ? 437 GLU A O     1 
ATOM   4885  C  CB    . GLU B 2  436 ? 9.214   -12.108 33.885 1.00 101.28 ? 437 GLU A CB    1 
ATOM   4886  C  CG    . GLU B 2  436 ? 8.047   -11.285 33.400 1.00 103.14 ? 437 GLU A CG    1 
ATOM   4887  C  CD    . GLU B 2  436 ? 8.281   -9.802  33.576 1.00 107.74 ? 437 GLU A CD    1 
ATOM   4888  O  OE1   . GLU B 2  436 ? 9.265   -9.437  34.256 1.00 100.39 ? 437 GLU A OE1   1 
ATOM   4889  O  OE2   . GLU B 2  436 ? 7.481   -9.005  33.040 1.00 117.51 ? 437 GLU A OE2   1 
ATOM   4890  N  N     . ARG B 2  437 ? 11.346  -14.419 33.530 1.00 78.52  ? 438 ARG A N     1 
ATOM   4891  C  CA    . ARG B 2  437 ? 12.449  -15.177 34.107 1.00 87.72  ? 438 ARG A CA    1 
ATOM   4892  C  C     . ARG B 2  437 ? 13.706  -15.032 33.265 1.00 92.84  ? 438 ARG A C     1 
ATOM   4893  O  O     . ARG B 2  437 ? 14.804  -14.846 33.799 1.00 84.05  ? 438 ARG A O     1 
ATOM   4894  C  CB    . ARG B 2  437 ? 12.071  -16.650 34.252 1.00 92.46  ? 438 ARG A CB    1 
ATOM   4895  C  CG    . ARG B 2  437 ? 13.162  -17.467 34.903 1.00 93.62  ? 438 ARG A CG    1 
ATOM   4896  C  CD    . ARG B 2  437 ? 13.624  -16.804 36.174 1.00 96.99  ? 438 ARG A CD    1 
ATOM   4897  N  NE    . ARG B 2  437 ? 14.913  -17.295 36.626 1.00 99.04  ? 438 ARG A NE    1 
ATOM   4898  C  CZ    . ARG B 2  437 ? 16.060  -16.939 36.067 1.00 107.55 ? 438 ARG A CZ    1 
ATOM   4899  N  NH1   . ARG B 2  437 ? 16.063  -16.102 35.039 1.00 119.76 ? 438 ARG A NH1   1 
ATOM   4900  N  NH2   . ARG B 2  437 ? 17.202  -17.424 36.524 1.00 104.14 ? 438 ARG A NH2   1 
ATOM   4901  N  N     . ASP B 2  438 ? 13.564  -15.120 31.944 1.00 104.86 ? 439 ASP A N     1 
ATOM   4902  C  CA    . ASP B 2  438 ? 14.692  -14.899 31.046 1.00 105.28 ? 439 ASP A CA    1 
ATOM   4903  C  C     . ASP B 2  438 ? 15.153  -13.455 31.110 1.00 99.59  ? 439 ASP A C     1 
ATOM   4904  O  O     . ASP B 2  438 ? 16.357  -13.168 31.056 1.00 96.20  ? 439 ASP A O     1 
ATOM   4905  C  CB    . ASP B 2  438 ? 14.296  -15.249 29.614 1.00 111.99 ? 439 ASP A CB    1 
ATOM   4906  C  CG    . ASP B 2  438 ? 14.463  -16.715 29.303 1.00 117.72 ? 439 ASP A CG    1 
ATOM   4907  O  OD1   . ASP B 2  438 ? 15.118  -17.418 30.099 1.00 118.72 ? 439 ASP A OD1   1 
ATOM   4908  O  OD2   . ASP B 2  438 ? 13.959  -17.160 28.249 1.00 119.93 ? 439 ASP A OD2   1 
ATOM   4909  N  N     . LYS B 2  439 ? 14.191  -12.540 31.205 1.00 95.52  ? 440 LYS A N     1 
ATOM   4910  C  CA    . LYS B 2  439 ? 14.469  -11.114 31.298 1.00 88.97  ? 440 LYS A CA    1 
ATOM   4911  C  C     . LYS B 2  439 ? 15.310  -10.799 32.522 1.00 85.35  ? 440 LYS A C     1 
ATOM   4912  O  O     . LYS B 2  439 ? 16.273  -10.026 32.447 1.00 85.59  ? 440 LYS A O     1 
ATOM   4913  C  CB    . LYS B 2  439 ? 13.140  -10.362 31.353 1.00 78.99  ? 440 LYS A CB    1 
ATOM   4914  C  CG    . LYS B 2  439 ? 13.157  -8.981  30.792 1.00 87.15  ? 440 LYS A CG    1 
ATOM   4915  C  CD    . LYS B 2  439 ? 11.744  -8.422  30.811 1.00 98.58  ? 440 LYS A CD    1 
ATOM   4916  C  CE    . LYS B 2  439 ? 11.665  -7.086  30.094 1.00 117.31 ? 440 LYS A CE    1 
ATOM   4917  N  NZ    . LYS B 2  439 ? 10.318  -6.467  30.258 1.00 125.84 ? 440 LYS A NZ    1 
ATOM   4918  N  N     . ILE B 2  440 ? 14.943  -11.373 33.668 1.00 83.50  ? 441 ILE A N     1 
ATOM   4919  C  CA    . ILE B 2  440 ? 15.681  -11.122 34.900 1.00 75.89  ? 441 ILE A CA    1 
ATOM   4920  C  C     . ILE B 2  440 ? 17.112  -11.587 34.757 1.00 78.08  ? 441 ILE A C     1 
ATOM   4921  O  O     . ILE B 2  440 ? 18.050  -10.915 35.197 1.00 77.76  ? 441 ILE A O     1 
ATOM   4922  C  CB    . ILE B 2  440 ? 15.008  -11.827 36.085 1.00 68.25  ? 441 ILE A CB    1 
ATOM   4923  C  CG1   . ILE B 2  440 ? 13.741  -11.090 36.497 1.00 77.15  ? 441 ILE A CG1   1 
ATOM   4924  C  CG2   . ILE B 2  440 ? 15.981  -11.921 37.236 1.00 67.65  ? 441 ILE A CG2   1 
ATOM   4925  C  CD1   . ILE B 2  440 ? 13.178  -11.608 37.779 1.00 87.12  ? 441 ILE A CD1   1 
ATOM   4926  N  N     . GLU B 2  441 ? 17.299  -12.772 34.191 1.00 79.23  ? 442 GLU A N     1 
ATOM   4927  C  CA    . GLU B 2  441 ? 18.645  -13.301 34.051 1.00 75.15  ? 442 GLU A CA    1 
ATOM   4928  C  C     . GLU B 2  441 ? 19.476  -12.405 33.152 1.00 79.48  ? 442 GLU A C     1 
ATOM   4929  O  O     . GLU B 2  441 ? 20.635  -12.113 33.458 1.00 85.85  ? 442 GLU A O     1 
ATOM   4930  C  CB    . GLU B 2  441 ? 18.595  -14.727 33.506 1.00 74.68  ? 442 GLU A CB    1 
ATOM   4931  C  CG    . GLU B 2  441 ? 19.898  -15.473 33.673 1.00 80.14  ? 442 GLU A CG    1 
ATOM   4932  C  CD    . GLU B 2  441 ? 20.168  -15.852 35.118 1.00 90.45  ? 442 GLU A CD    1 
ATOM   4933  O  OE1   . GLU B 2  441 ? 19.195  -15.937 35.903 1.00 83.42  ? 442 GLU A OE1   1 
ATOM   4934  O  OE2   . GLU B 2  441 ? 21.352  -16.062 35.465 1.00 100.58 ? 442 GLU A OE2   1 
ATOM   4935  N  N     . ALA B 2  442 ? 18.888  -11.940 32.050 1.00 83.10  ? 443 ALA A N     1 
ATOM   4936  C  CA    . ALA B 2  442 ? 19.609  -11.084 31.114 1.00 74.80  ? 443 ALA A CA    1 
ATOM   4937  C  C     . ALA B 2  442 ? 20.121  -9.829  31.801 1.00 79.44  ? 443 ALA A C     1 
ATOM   4938  O  O     . ALA B 2  442 ? 21.286  -9.446  31.639 1.00 86.90  ? 443 ALA A O     1 
ATOM   4939  C  CB    . ALA B 2  442 ? 18.706  -10.720 29.936 1.00 75.19  ? 443 ALA A CB    1 
ATOM   4940  N  N     . GLU B 2  443 ? 19.255  -9.170  32.569 1.00 87.04  ? 444 GLU A N     1 
ATOM   4941  C  CA    . GLU B 2  443 ? 19.652  -7.951  33.268 1.00 87.37  ? 444 GLU A CA    1 
ATOM   4942  C  C     . GLU B 2  443 ? 20.774  -8.222  34.256 1.00 84.68  ? 444 GLU A C     1 
ATOM   4943  O  O     . GLU B 2  443 ? 21.726  -7.440  34.361 1.00 91.34  ? 444 GLU A O     1 
ATOM   4944  C  CB    . GLU B 2  443 ? 18.450  -7.348  33.995 1.00 77.23  ? 444 GLU A CB    1 
ATOM   4945  C  CG    . GLU B 2  443 ? 18.829  -6.272  34.984 1.00 82.04  ? 444 GLU A CG    1 
ATOM   4946  C  CD    . GLU B 2  443 ? 17.630  -5.742  35.738 1.00 88.24  ? 444 GLU A CD    1 
ATOM   4947  O  OE1   . GLU B 2  443 ? 17.821  -4.922  36.663 1.00 85.69  ? 444 GLU A OE1   1 
ATOM   4948  O  OE2   . GLU B 2  443 ? 16.496  -6.148  35.399 1.00 85.19  ? 444 GLU A OE2   1 
ATOM   4949  N  N     . TYR B 2  444 ? 20.666  -9.317  35.001 1.00 75.29  ? 445 TYR A N     1 
ATOM   4950  C  CA    . TYR B 2  444 ? 21.665  -9.645  36.008 1.00 76.81  ? 445 TYR A CA    1 
ATOM   4951  C  C     . TYR B 2  444 ? 23.041  -9.816  35.388 1.00 75.14  ? 445 TYR A C     1 
ATOM   4952  O  O     . TYR B 2  444 ? 24.048  -9.377  35.955 1.00 73.31  ? 445 TYR A O     1 
ATOM   4953  C  CB    . TYR B 2  444 ? 21.249  -10.917 36.741 1.00 74.78  ? 445 TYR A CB    1 
ATOM   4954  C  CG    . TYR B 2  444 ? 22.236  -11.366 37.780 1.00 77.83  ? 445 TYR A CG    1 
ATOM   4955  C  CD1   . TYR B 2  444 ? 22.157  -10.890 39.077 1.00 76.09  ? 445 TYR A CD1   1 
ATOM   4956  C  CD2   . TYR B 2  444 ? 23.243  -12.275 37.469 1.00 90.41  ? 445 TYR A CD2   1 
ATOM   4957  C  CE1   . TYR B 2  444 ? 23.051  -11.299 40.037 1.00 84.58  ? 445 TYR A CE1   1 
ATOM   4958  C  CE2   . TYR B 2  444 ? 24.137  -12.692 38.425 1.00 89.69  ? 445 TYR A CE2   1 
ATOM   4959  C  CZ    . TYR B 2  444 ? 24.040  -12.199 39.707 1.00 85.88  ? 445 TYR A CZ    1 
ATOM   4960  O  OH    . TYR B 2  444 ? 24.937  -12.611 40.665 1.00 81.29  ? 445 TYR A OH    1 
ATOM   4961  N  N     . ASN B 2  445 ? 23.108  -10.476 34.238 1.00 77.97  ? 446 ASN A N     1 
ATOM   4962  C  CA    . ASN B 2  445 ? 24.388  -10.666 33.573 1.00 83.12  ? 446 ASN A CA    1 
ATOM   4963  C  C     . ASN B 2  445 ? 24.974  -9.337  33.141 1.00 87.66  ? 446 ASN A C     1 
ATOM   4964  O  O     . ASN B 2  445 ? 26.188  -9.121  33.236 1.00 90.69  ? 446 ASN A O     1 
ATOM   4965  C  CB    . ASN B 2  445 ? 24.222  -11.600 32.377 1.00 89.70  ? 446 ASN A CB    1 
ATOM   4966  C  CG    . ASN B 2  445 ? 23.908  -13.018 32.795 1.00 101.66 ? 446 ASN A CG    1 
ATOM   4967  O  OD1   . ASN B 2  445 ? 24.705  -13.660 33.478 1.00 101.11 ? 446 ASN A OD1   1 
ATOM   4968  N  ND2   . ASN B 2  445 ? 22.742  -13.519 32.385 1.00 106.42 ? 446 ASN A ND2   1 
ATOM   4969  N  N     . GLU B 2  446 ? 24.118  -8.430  32.673 1.00 88.86  ? 447 GLU A N     1 
ATOM   4970  C  CA    . GLU B 2  446 ? 24.570  -7.111  32.249 1.00 90.71  ? 447 GLU A CA    1 
ATOM   4971  C  C     . GLU B 2  446 ? 25.203  -6.348  33.403 1.00 88.08  ? 447 GLU A C     1 
ATOM   4972  O  O     . GLU B 2  446 ? 26.249  -5.709  33.237 1.00 87.42  ? 447 GLU A O     1 
ATOM   4973  C  CB    . GLU B 2  446 ? 23.392  -6.329  31.673 1.00 93.30  ? 447 GLU A CB    1 
ATOM   4974  C  CG    . GLU B 2  446 ? 23.785  -5.182  30.778 1.00 114.72 ? 447 GLU A CG    1 
ATOM   4975  C  CD    . GLU B 2  446 ? 22.579  -4.444  30.223 1.00 133.50 ? 447 GLU A CD    1 
ATOM   4976  O  OE1   . GLU B 2  446 ? 22.730  -3.726  29.211 1.00 135.96 ? 447 GLU A OE1   1 
ATOM   4977  O  OE2   . GLU B 2  446 ? 21.479  -4.583  30.799 1.00 139.01 ? 447 GLU A OE2   1 
ATOM   4978  N  N     . LEU B 2  447 ? 24.576  -6.400  34.581 1.00 79.60  ? 448 LEU A N     1 
ATOM   4979  C  CA    . LEU B 2  447 ? 25.103  -5.704  35.753 1.00 73.10  ? 448 LEU A CA    1 
ATOM   4980  C  C     . LEU B 2  447 ? 26.504  -6.178  36.096 1.00 75.18  ? 448 LEU A C     1 
ATOM   4981  O  O     . LEU B 2  447 ? 27.379  -5.373  36.435 1.00 74.28  ? 448 LEU A O     1 
ATOM   4982  C  CB    . LEU B 2  447 ? 24.184  -5.928  36.950 1.00 68.79  ? 448 LEU A CB    1 
ATOM   4983  C  CG    . LEU B 2  447 ? 23.046  -4.948  37.170 1.00 73.64  ? 448 LEU A CG    1 
ATOM   4984  C  CD1   . LEU B 2  447 ? 22.247  -5.408  38.361 1.00 72.77  ? 448 LEU A CD1   1 
ATOM   4985  C  CD2   . LEU B 2  447 ? 23.605  -3.566  37.400 1.00 77.82  ? 448 LEU A CD2   1 
ATOM   4986  N  N     . LEU B 2  448 ? 26.723  -7.488  36.054 1.00 83.86  ? 449 LEU A N     1 
ATOM   4987  C  CA    . LEU B 2  448 ? 28.023  -8.029  36.428 1.00 85.91  ? 449 LEU A CA    1 
ATOM   4988  C  C     . LEU B 2  448 ? 29.114  -7.462  35.542 1.00 82.24  ? 449 LEU A C     1 
ATOM   4989  O  O     . LEU B 2  448 ? 30.177  -7.066  36.030 1.00 84.25  ? 449 LEU A O     1 
ATOM   4990  C  CB    . LEU B 2  448 ? 28.000  -9.553  36.341 1.00 93.96  ? 449 LEU A CB    1 
ATOM   4991  C  CG    . LEU B 2  448 ? 26.990  -10.197 37.285 1.00 85.88  ? 449 LEU A CG    1 
ATOM   4992  C  CD1   . LEU B 2  448 ? 27.040  -11.699 37.138 1.00 87.89  ? 449 LEU A CD1   1 
ATOM   4993  C  CD2   . LEU B 2  448 ? 27.287  -9.775  38.713 1.00 75.34  ? 449 LEU A CD2   1 
ATOM   4994  N  N     . ASN B 2  449 ? 28.876  -7.429  34.235 1.00 82.85  ? 450 ASN A N     1 
ATOM   4995  C  CA    . ASN B 2  449 ? 29.835  -6.796  33.344 1.00 80.08  ? 450 ASN A CA    1 
ATOM   4996  C  C     . ASN B 2  449 ? 29.945  -5.319  33.659 1.00 84.98  ? 450 ASN A C     1 
ATOM   4997  O  O     . ASN B 2  449 ? 31.049  -4.765  33.726 1.00 108.22 ? 450 ASN A O     1 
ATOM   4998  C  CB    . ASN B 2  449 ? 29.424  -7.002  31.890 1.00 83.08  ? 450 ASN A CB    1 
ATOM   4999  C  CG    . ASN B 2  449 ? 29.717  -8.401  31.399 1.00 96.37  ? 450 ASN A CG    1 
ATOM   5000  O  OD1   . ASN B 2  449 ? 30.540  -9.116  31.978 1.00 98.67  ? 450 ASN A OD1   1 
ATOM   5001  N  ND2   . ASN B 2  449 ? 29.056  -8.799  30.317 1.00 102.97 ? 450 ASN A ND2   1 
ATOM   5002  N  N     . TYR B 2  450 ? 28.802  -4.673  33.875 1.00 76.03  ? 451 TYR A N     1 
ATOM   5003  C  CA    . TYR B 2  450 ? 28.784  -3.255  34.201 1.00 73.31  ? 451 TYR A CA    1 
ATOM   5004  C  C     . TYR B 2  450 ? 29.554  -2.977  35.479 1.00 73.30  ? 451 TYR A C     1 
ATOM   5005  O  O     . TYR B 2  450 ? 30.310  -2.003  35.558 1.00 85.39  ? 451 TYR A O     1 
ATOM   5006  C  CB    . TYR B 2  450 ? 27.340  -2.784  34.330 1.00 73.14  ? 451 TYR A CB    1 
ATOM   5007  C  CG    . TYR B 2  450 ? 27.199  -1.323  34.649 1.00 70.54  ? 451 TYR A CG    1 
ATOM   5008  C  CD1   . TYR B 2  450 ? 27.937  -0.374  33.962 1.00 67.05  ? 451 TYR A CD1   1 
ATOM   5009  C  CD2   . TYR B 2  450 ? 26.307  -0.888  35.622 1.00 79.07  ? 451 TYR A CD2   1 
ATOM   5010  C  CE1   . TYR B 2  450 ? 27.803  0.963   34.241 1.00 67.70  ? 451 TYR A CE1   1 
ATOM   5011  C  CE2   . TYR B 2  450 ? 26.163  0.451   35.907 1.00 72.79  ? 451 TYR A CE2   1 
ATOM   5012  C  CZ    . TYR B 2  450 ? 26.913  1.373   35.214 1.00 71.64  ? 451 TYR A CZ    1 
ATOM   5013  O  OH    . TYR B 2  450 ? 26.770  2.711   35.499 1.00 69.02  ? 451 TYR A OH    1 
ATOM   5014  N  N     . ILE B 2  451 ? 29.365  -3.817  36.497 1.00 67.63  ? 452 ILE A N     1 
ATOM   5015  C  CA    . ILE B 2  451 ? 30.101  -3.653  37.747 1.00 62.50  ? 452 ILE A CA    1 
ATOM   5016  C  C     . ILE B 2  451 ? 31.587  -3.823  37.509 1.00 66.52  ? 452 ILE A C     1 
ATOM   5017  O  O     . ILE B 2  451 ? 32.416  -3.149  38.129 1.00 63.99  ? 452 ILE A O     1 
ATOM   5018  C  CB    . ILE B 2  451 ? 29.612  -4.659  38.800 1.00 58.04  ? 452 ILE A CB    1 
ATOM   5019  C  CG1   . ILE B 2  451 ? 28.234  -4.273  39.308 1.00 58.76  ? 452 ILE A CG1   1 
ATOM   5020  C  CG2   . ILE B 2  451 ? 30.605  -4.726  39.944 1.00 55.05  ? 452 ILE A CG2   1 
ATOM   5021  C  CD1   . ILE B 2  451 ? 27.639  -5.316  40.199 1.00 57.49  ? 452 ILE A CD1   1 
ATOM   5022  N  N     . SER B 2  452 ? 31.946  -4.780  36.662 1.00 82.23  ? 453 SER A N     1 
ATOM   5023  C  CA    . SER B 2  452 ? 33.350  -4.999  36.348 1.00 91.52  ? 453 SER A CA    1 
ATOM   5024  C  C     . SER B 2  452 ? 33.966  -3.734  35.780 1.00 85.72  ? 453 SER A C     1 
ATOM   5025  O  O     . SER B 2  452 ? 35.043  -3.299  36.204 1.00 90.98  ? 453 SER A O     1 
ATOM   5026  C  CB    . SER B 2  452 ? 33.481  -6.159  35.361 1.00 91.09  ? 453 SER A CB    1 
ATOM   5027  O  OG    . SER B 2  452 ? 34.836  -6.363  35.017 1.00 101.69 ? 453 SER A OG    1 
ATOM   5028  N  N     . GLU B 2  453 ? 33.268  -3.114  34.834 1.00 81.24  ? 454 GLU A N     1 
ATOM   5029  C  CA    . GLU B 2  453 ? 33.766  -1.902  34.201 1.00 88.01  ? 454 GLU A CA    1 
ATOM   5030  C  C     . GLU B 2  453 ? 33.890  -0.769  35.204 1.00 81.81  ? 454 GLU A C     1 
ATOM   5031  O  O     . GLU B 2  453 ? 34.883  -0.034  35.201 1.00 86.28  ? 454 GLU A O     1 
ATOM   5032  C  CB    . GLU B 2  453 ? 32.839  -1.524  33.047 1.00 101.49 ? 454 GLU A CB    1 
ATOM   5033  C  CG    . GLU B 2  453 ? 32.716  -2.625  32.006 1.00 106.26 ? 454 GLU A CG    1 
ATOM   5034  C  CD    . GLU B 2  453 ? 31.547  -2.422  31.058 1.00 104.75 ? 454 GLU A CD    1 
ATOM   5035  O  OE1   . GLU B 2  453 ? 30.563  -1.764  31.457 1.00 99.09  ? 454 GLU A OE1   1 
ATOM   5036  O  OE2   . GLU B 2  453 ? 31.616  -2.922  29.912 1.00 104.73 ? 454 GLU A OE2   1 
ATOM   5037  N  N     . LEU B 2  454 ? 32.896  -0.610  36.072 1.00 74.35  ? 455 LEU A N     1 
ATOM   5038  C  CA    . LEU B 2  454 ? 32.958  0.452   37.069 1.00 74.45  ? 455 LEU A CA    1 
ATOM   5039  C  C     . LEU B 2  454 ? 34.133  0.254   38.008 1.00 80.46  ? 455 LEU A C     1 
ATOM   5040  O  O     . LEU B 2  454 ? 34.836  1.210   38.351 1.00 83.16  ? 455 LEU A O     1 
ATOM   5041  C  CB    . LEU B 2  454 ? 31.662  0.503   37.867 1.00 68.08  ? 455 LEU A CB    1 
ATOM   5042  C  CG    . LEU B 2  454 ? 30.420  0.943   37.121 1.00 68.37  ? 455 LEU A CG    1 
ATOM   5043  C  CD1   . LEU B 2  454 ? 29.246  0.940   38.058 1.00 71.24  ? 455 LEU A CD1   1 
ATOM   5044  C  CD2   . LEU B 2  454 ? 30.664  2.320   36.559 1.00 71.29  ? 455 LEU A CD2   1 
ATOM   5045  N  N     . GLU B 2  455 ? 34.346  -0.980  38.451 1.00 91.00  ? 456 GLU A N     1 
ATOM   5046  C  CA    . GLU B 2  455 ? 35.436  -1.266  39.374 1.00 92.36  ? 456 GLU A CA    1 
ATOM   5047  C  C     . GLU B 2  455 ? 36.782  -1.031  38.720 1.00 87.95  ? 456 GLU A C     1 
ATOM   5048  O  O     . GLU B 2  455 ? 37.728  -0.581  39.375 1.00 77.70  ? 456 GLU A O     1 
ATOM   5049  C  CB    . GLU B 2  455 ? 35.324  -2.700  39.881 1.00 84.65  ? 456 GLU A CB    1 
ATOM   5050  C  CG    . GLU B 2  455 ? 34.327  -2.864  41.001 1.00 82.72  ? 456 GLU A CG    1 
ATOM   5051  C  CD    . GLU B 2  455 ? 34.327  -4.258  41.584 1.00 101.17 ? 456 GLU A CD    1 
ATOM   5052  O  OE1   . GLU B 2  455 ? 33.787  -4.431  42.699 1.00 111.50 ? 456 GLU A OE1   1 
ATOM   5053  O  OE2   . GLU B 2  455 ? 34.867  -5.178  40.931 1.00 108.17 ? 456 GLU A OE2   1 
ATOM   5054  N  N     . THR B 2  456 ? 36.891  -1.349  37.432 1.00 87.27  ? 457 THR A N     1 
ATOM   5055  C  CA    . THR B 2  456 ? 38.129  -1.088  36.702 1.00 83.14  ? 457 THR A CA    1 
ATOM   5056  C  C     . THR B 2  456 ? 38.480  0.382   36.747 1.00 82.09  ? 457 THR A C     1 
ATOM   5057  O  O     . THR B 2  456 ? 39.637  0.756   36.987 1.00 86.46  ? 457 THR A O     1 
ATOM   5058  C  CB    . THR B 2  456 ? 38.000  -1.519  35.240 1.00 88.07  ? 457 THR A CB    1 
ATOM   5059  O  OG1   . THR B 2  456 ? 37.737  -2.924  35.169 1.00 104.35 ? 457 THR A OG1   1 
ATOM   5060  C  CG2   . THR B 2  456 ? 39.278  -1.195  34.491 1.00 81.31  ? 457 THR A CG2   1 
ATOM   5061  N  N     . ILE B 2  457 ? 37.487  1.230   36.493 1.00 97.61  ? 458 ILE A N     1 
ATOM   5062  C  CA    . ILE B 2  457 ? 37.705  2.671   36.514 1.00 90.93  ? 458 ILE A CA    1 
ATOM   5063  C  C     . ILE B 2  457 ? 38.248  3.100   37.863 1.00 97.79  ? 458 ILE A C     1 
ATOM   5064  O  O     . ILE B 2  457 ? 39.273  3.784   37.952 1.00 109.11 ? 458 ILE A O     1 
ATOM   5065  C  CB    . ILE B 2  457 ? 36.401  3.409   36.181 1.00 86.39  ? 458 ILE A CB    1 
ATOM   5066  C  CG1   . ILE B 2  457 ? 36.066  3.253   34.697 1.00 83.89  ? 458 ILE A CG1   1 
ATOM   5067  C  CG2   . ILE B 2  457 ? 36.529  4.862   36.571 1.00 84.92  ? 458 ILE A CG2   1 
ATOM   5068  C  CD1   . ILE B 2  457 ? 34.725  3.815   34.344 1.00 86.42  ? 458 ILE A CD1   1 
ATOM   5069  N  N     . LEU B 2  458 ? 37.560  2.711   38.933 1.00 86.01  ? 459 LEU A N     1 
ATOM   5070  C  CA    . LEU B 2  458 ? 37.922  3.191   40.260 1.00 78.39  ? 459 LEU A CA    1 
ATOM   5071  C  C     . LEU B 2  458 ? 39.346  2.806   40.621 1.00 80.52  ? 459 LEU A C     1 
ATOM   5072  O  O     . LEU B 2  458 ? 40.061  3.583   41.263 1.00 91.09  ? 459 LEU A O     1 
ATOM   5073  C  CB    . LEU B 2  458 ? 36.935  2.652   41.288 1.00 77.51  ? 459 LEU A CB    1 
ATOM   5074  C  CG    . LEU B 2  458 ? 35.545  3.262   41.189 1.00 74.48  ? 459 LEU A CG    1 
ATOM   5075  C  CD1   . LEU B 2  458 ? 34.608  2.612   42.187 1.00 82.63  ? 459 LEU A CD1   1 
ATOM   5076  C  CD2   . LEU B 2  458 ? 35.638  4.748   41.433 1.00 73.40  ? 459 LEU A CD2   1 
ATOM   5077  N  N     . ALA B 2  459 ? 39.780  1.621   40.198 1.00 83.39  ? 460 ALA A N     1 
ATOM   5078  C  CA    . ALA B 2  459 ? 41.092  1.116   40.590 1.00 87.20  ? 460 ALA A CA    1 
ATOM   5079  C  C     . ALA B 2  459 ? 42.223  1.978   40.040 1.00 107.05 ? 460 ALA A C     1 
ATOM   5080  O  O     . ALA B 2  459 ? 43.251  2.167   40.708 1.00 118.54 ? 460 ALA A O     1 
ATOM   5081  C  CB    . ALA B 2  459 ? 41.253  -0.339  40.134 1.00 82.67  ? 460 ALA A CB    1 
ATOM   5082  N  N     . ASP B 2  460 ? 42.068  2.497   38.830 1.00 109.42 ? 461 ASP A N     1 
ATOM   5083  C  CA    . ASP B 2  460 ? 43.151  3.197   38.147 1.00 100.71 ? 461 ASP A CA    1 
ATOM   5084  C  C     . ASP B 2  460 ? 42.859  4.691   38.062 1.00 93.33  ? 461 ASP A C     1 
ATOM   5085  O  O     . ASP B 2  460 ? 41.896  5.101   37.409 1.00 89.42  ? 461 ASP A O     1 
ATOM   5086  C  CB    . ASP B 2  460 ? 43.380  2.619   36.751 1.00 99.65  ? 461 ASP A CB    1 
ATOM   5087  C  CG    . ASP B 2  460 ? 44.785  2.831   36.264 1.00 110.47 ? 461 ASP A CG    1 
ATOM   5088  O  OD1   . ASP B 2  460 ? 45.504  3.663   36.858 1.00 117.23 ? 461 ASP A OD1   1 
ATOM   5089  O  OD2   . ASP B 2  460 ? 45.170  2.159   35.291 1.00 111.38 ? 461 ASP A OD2   1 
ATOM   5090  N  N     . GLU B 2  461 ? 43.713  5.498   38.702 1.00 85.86  ? 462 GLU A N     1 
ATOM   5091  C  CA    . GLU B 2  461 ? 43.576  6.953   38.628 1.00 80.53  ? 462 GLU A CA    1 
ATOM   5092  C  C     . GLU B 2  461 ? 43.677  7.439   37.192 1.00 76.70  ? 462 GLU A C     1 
ATOM   5093  O  O     . GLU B 2  461 ? 42.917  8.313   36.761 1.00 78.17  ? 462 GLU A O     1 
ATOM   5094  C  CB    . GLU B 2  461 ? 44.652  7.633   39.479 1.00 91.35  ? 462 GLU A CB    1 
ATOM   5095  C  CG    . GLU B 2  461 ? 44.487  7.449   40.967 1.00 106.19 ? 462 GLU A CG    1 
ATOM   5096  C  CD    . GLU B 2  461 ? 43.490  8.424   41.558 1.00 110.04 ? 462 GLU A CD    1 
ATOM   5097  O  OE1   . GLU B 2  461 ? 43.213  9.455   40.913 1.00 111.77 ? 462 GLU A OE1   1 
ATOM   5098  O  OE2   . GLU B 2  461 ? 42.982  8.160   42.667 1.00 114.56 ? 462 GLU A OE2   1 
ATOM   5099  N  N     . GLU B 2  462 ? 44.631  6.892   36.443 1.00 93.32  ? 463 GLU A N     1 
ATOM   5100  C  CA    . GLU B 2  462 ? 44.792  7.260   35.042 1.00 101.11 ? 463 GLU A CA    1 
ATOM   5101  C  C     . GLU B 2  462 ? 43.554  6.904   34.232 1.00 87.80  ? 463 GLU A C     1 
ATOM   5102  O  O     . GLU B 2  462 ? 43.147  7.659   33.342 1.00 75.31  ? 463 GLU A O     1 
ATOM   5103  C  CB    . GLU B 2  462 ? 46.027  6.565   34.467 1.00 105.91 ? 463 GLU A CB    1 
ATOM   5104  C  CG    . GLU B 2  462 ? 46.251  6.832   32.996 1.00 106.56 ? 463 GLU A CG    1 
ATOM   5105  C  CD    . GLU B 2  462 ? 46.745  8.237   32.741 1.00 116.97 ? 463 GLU A CD    1 
ATOM   5106  O  OE1   . GLU B 2  462 ? 46.595  8.720   31.599 1.00 124.51 ? 463 GLU A OE1   1 
ATOM   5107  O  OE2   . GLU B 2  462 ? 47.286  8.856   33.684 1.00 119.66 ? 463 GLU A OE2   1 
ATOM   5108  N  N     . VAL B 2  463 ? 42.952  5.746   34.510 1.00 84.86  ? 464 VAL A N     1 
ATOM   5109  C  CA    . VAL B 2  463 ? 41.741  5.350   33.793 1.00 78.21  ? 464 VAL A CA    1 
ATOM   5110  C  C     . VAL B 2  463 ? 40.627  6.336   34.071 1.00 75.89  ? 464 VAL A C     1 
ATOM   5111  O  O     . VAL B 2  463 ? 39.865  6.721   33.173 1.00 77.35  ? 464 VAL A O     1 
ATOM   5112  C  CB    . VAL B 2  463 ? 41.308  3.930   34.190 1.00 81.03  ? 464 VAL A CB    1 
ATOM   5113  C  CG1   . VAL B 2  463 ? 39.863  3.707   33.762 1.00 82.56  ? 464 VAL A CG1   1 
ATOM   5114  C  CG2   . VAL B 2  463 ? 42.210  2.906   33.557 1.00 96.18  ? 464 VAL A CG2   1 
ATOM   5115  N  N     . LEU B 2  464 ? 40.474  6.706   35.336 1.00 75.67  ? 465 LEU A N     1 
ATOM   5116  C  CA    . LEU B 2  464 ? 39.476  7.698   35.696 1.00 75.13  ? 465 LEU A CA    1 
ATOM   5117  C  C     . LEU B 2  464 ? 39.771  9.016   34.996 1.00 71.10  ? 465 LEU A C     1 
ATOM   5118  O  O     . LEU B 2  464 ? 38.869  9.664   34.448 1.00 66.59  ? 465 LEU A O     1 
ATOM   5119  C  CB    . LEU B 2  464 ? 39.454  7.860   37.219 1.00 64.78  ? 465 LEU A CB    1 
ATOM   5120  C  CG    . LEU B 2  464 ? 39.016  9.224   37.742 1.00 75.57  ? 465 LEU A CG    1 
ATOM   5121  C  CD1   . LEU B 2  464 ? 37.709  9.674   37.133 1.00 71.07  ? 465 LEU A CD1   1 
ATOM   5122  C  CD2   . LEU B 2  464 ? 38.820  9.162   39.228 1.00 98.84  ? 465 LEU A CD2   1 
ATOM   5123  N  N     . LEU B 2  465 ? 41.029  9.433   35.027 1.00 64.81  ? 466 LEU A N     1 
ATOM   5124  C  CA    . LEU B 2  465 ? 41.421  10.694  34.419 1.00 71.59  ? 466 LEU A CA    1 
ATOM   5125  C  C     . LEU B 2  465 ? 41.098  10.714  32.935 1.00 68.52  ? 466 LEU A C     1 
ATOM   5126  O  O     . LEU B 2  465 ? 40.661  11.737  32.397 1.00 66.61  ? 466 LEU A O     1 
ATOM   5127  C  CB    . LEU B 2  465 ? 42.913  10.909  34.652 1.00 84.22  ? 466 LEU A CB    1 
ATOM   5128  C  CG    . LEU B 2  465 ? 43.561  12.100  33.963 1.00 73.56  ? 466 LEU A CG    1 
ATOM   5129  C  CD1   . LEU B 2  465 ? 42.831  13.375  34.348 1.00 60.08  ? 466 LEU A CD1   1 
ATOM   5130  C  CD2   . LEU B 2  465 ? 45.016  12.166  34.367 1.00 70.58  ? 466 LEU A CD2   1 
ATOM   5131  N  N     . GLN B 2  466 ? 41.334  9.594   32.255 1.00 69.06  ? 467 GLN A N     1 
ATOM   5132  C  CA    . GLN B 2  466 ? 41.077  9.511   30.824 1.00 77.39  ? 467 GLN A CA    1 
ATOM   5133  C  C     . GLN B 2  466 ? 39.599  9.671   30.523 1.00 82.92  ? 467 GLN A C     1 
ATOM   5134  O  O     . GLN B 2  466 ? 39.218  10.250  29.498 1.00 83.43  ? 467 GLN A O     1 
ATOM   5135  C  CB    . GLN B 2  466 ? 41.564  8.175   30.284 1.00 95.63  ? 467 GLN A CB    1 
ATOM   5136  C  CG    . GLN B 2  466 ? 41.279  8.024   28.822 1.00 91.23  ? 467 GLN A CG    1 
ATOM   5137  C  CD    . GLN B 2  466 ? 41.995  9.080   28.015 1.00 73.71  ? 467 GLN A CD    1 
ATOM   5138  O  OE1   . GLN B 2  466 ? 43.129  9.451   28.329 1.00 75.30  ? 467 GLN A OE1   1 
ATOM   5139  N  NE2   . GLN B 2  466 ? 41.336  9.579   26.973 1.00 72.43  ? 467 GLN A NE2   1 
ATOM   5140  N  N     . LEU B 2  467 ? 38.753  9.118   31.384 1.00 88.68  ? 468 LEU A N     1 
ATOM   5141  C  CA    . LEU B 2  467 ? 37.314  9.257   31.214 1.00 75.38  ? 468 LEU A CA    1 
ATOM   5142  C  C     . LEU B 2  467 ? 36.905  10.719  31.253 1.00 70.26  ? 468 LEU A C     1 
ATOM   5143  O  O     . LEU B 2  467 ? 36.104  11.176  30.426 1.00 62.48  ? 468 LEU A O     1 
ATOM   5144  C  CB    . LEU B 2  467 ? 36.595  8.472   32.308 1.00 67.27  ? 468 LEU A CB    1 
ATOM   5145  C  CG    . LEU B 2  467 ? 35.079  8.457   32.244 1.00 63.37  ? 468 LEU A CG    1 
ATOM   5146  C  CD1   . LEU B 2  467 ? 34.625  7.991   30.874 1.00 55.51  ? 468 LEU A CD1   1 
ATOM   5147  C  CD2   . LEU B 2  467 ? 34.574  7.543   33.334 1.00 58.00  ? 468 LEU A CD2   1 
ATOM   5148  N  N     . VAL B 2  468 ? 37.440  11.468  32.219 1.00 70.68  ? 469 VAL A N     1 
ATOM   5149  C  CA    . VAL B 2  468 ? 37.179  12.902  32.291 1.00 60.65  ? 469 VAL A CA    1 
ATOM   5150  C  C     . VAL B 2  468 ? 37.571  13.570  30.984 1.00 59.40  ? 469 VAL A C     1 
ATOM   5151  O  O     . VAL B 2  468 ? 36.809  14.355  30.416 1.00 50.88  ? 469 VAL A O     1 
ATOM   5152  C  CB    . VAL B 2  468 ? 37.939  13.538  33.465 1.00 60.44  ? 469 VAL A CB    1 
ATOM   5153  C  CG1   . VAL B 2  468 ? 37.669  15.024  33.462 1.00 53.99  ? 469 VAL A CG1   1 
ATOM   5154  C  CG2   . VAL B 2  468 ? 37.527  12.911  34.765 1.00 62.81  ? 469 VAL A CG2   1 
ATOM   5155  N  N     . ARG B 2  469 ? 38.790  13.289  30.511 1.00 65.83  ? 470 ARG A N     1 
ATOM   5156  C  CA    . ARG B 2  469 ? 39.230  13.819  29.227 1.00 63.40  ? 470 ARG A CA    1 
ATOM   5157  C  C     . ARG B 2  469 ? 38.224  13.486  28.143 1.00 66.02  ? 470 ARG A C     1 
ATOM   5158  O  O     . ARG B 2  469 ? 37.894  14.336  27.310 1.00 54.78  ? 470 ARG A O     1 
ATOM   5159  C  CB    . ARG B 2  469 ? 40.598  13.251  28.844 1.00 63.74  ? 470 ARG A CB    1 
ATOM   5160  C  CG    . ARG B 2  469 ? 41.779  13.665  29.674 1.00 63.50  ? 470 ARG A CG    1 
ATOM   5161  C  CD    . ARG B 2  469 ? 43.052  13.108  29.050 1.00 68.61  ? 470 ARG A CD    1 
ATOM   5162  N  NE    . ARG B 2  469 ? 44.203  13.322  29.919 1.00 74.91  ? 470 ARG A NE    1 
ATOM   5163  C  CZ    . ARG B 2  469 ? 44.901  12.360  30.516 1.00 85.52  ? 470 ARG A CZ    1 
ATOM   5164  N  NH1   . ARG B 2  469 ? 44.611  11.081  30.315 1.00 87.24  ? 470 ARG A NH1   1 
ATOM   5165  N  NH2   . ARG B 2  469 ? 45.922  12.684  31.289 1.00 83.39  ? 470 ARG A NH2   1 
ATOM   5166  N  N     . ASP B 2  470 ? 37.737  12.239  28.132 1.00 81.14  ? 471 ASP A N     1 
ATOM   5167  C  CA    . ASP B 2  470 ? 36.804  11.807  27.100 1.00 74.18  ? 471 ASP A CA    1 
ATOM   5168  C  C     . ASP B 2  470 ? 35.499  12.585  27.179 1.00 63.81  ? 471 ASP A C     1 
ATOM   5169  O  O     . ASP B 2  470 ? 34.974  13.030  26.156 1.00 77.74  ? 471 ASP A O     1 
ATOM   5170  C  CB    . ASP B 2  470 ? 36.528  10.304  27.213 1.00 75.21  ? 471 ASP A CB    1 
ATOM   5171  C  CG    . ASP B 2  470 ? 37.719  9.438   26.806 1.00 82.86  ? 471 ASP A CG    1 
ATOM   5172  O  OD1   . ASP B 2  470 ? 38.639  9.930   26.127 1.00 77.26  ? 471 ASP A OD1   1 
ATOM   5173  O  OD2   . ASP B 2  470 ? 37.712  8.238   27.165 1.00 94.23  ? 471 ASP A OD2   1 
ATOM   5174  N  N     . GLU B 2  471 ? 34.955  12.761  28.380 1.00 58.48  ? 472 GLU A N     1 
ATOM   5175  C  CA    . GLU B 2  471 ? 33.650  13.409  28.494 1.00 63.16  ? 472 GLU A CA    1 
ATOM   5176  C  C     . GLU B 2  471 ? 33.739  14.903  28.192 1.00 63.97  ? 472 GLU A C     1 
ATOM   5177  O  O     . GLU B 2  471 ? 32.811  15.478  27.612 1.00 63.31  ? 472 GLU A O     1 
ATOM   5178  C  CB    . GLU B 2  471 ? 33.046  13.130  29.872 1.00 64.46  ? 472 GLU A CB    1 
ATOM   5179  C  CG    . GLU B 2  471 ? 32.510  11.699  29.960 1.00 82.52  ? 472 GLU A CG    1 
ATOM   5180  C  CD    . GLU B 2  471 ? 31.888  11.335  31.301 1.00 89.53  ? 472 GLU A CD    1 
ATOM   5181  O  OE1   . GLU B 2  471 ? 31.726  12.227  32.161 1.00 84.69  ? 472 GLU A OE1   1 
ATOM   5182  O  OE2   . GLU B 2  471 ? 31.564  10.140  31.489 1.00 88.83  ? 472 GLU A OE2   1 
ATOM   5183  N  N     . LEU B 2  472 ? 34.854  15.537  28.553 1.00 72.09  ? 473 LEU A N     1 
ATOM   5184  C  CA    . LEU B 2  472 ? 35.087  16.924  28.172 1.00 67.53  ? 473 LEU A CA    1 
ATOM   5185  C  C     . LEU B 2  472 ? 35.153  17.087  26.662 1.00 66.70  ? 473 LEU A C     1 
ATOM   5186  O  O     . LEU B 2  472 ? 34.604  18.048  26.110 1.00 70.83  ? 473 LEU A O     1 
ATOM   5187  C  CB    . LEU B 2  472 ? 36.374  17.440  28.815 1.00 62.97  ? 473 LEU A CB    1 
ATOM   5188  C  CG    . LEU B 2  472 ? 36.257  17.998  30.223 1.00 74.30  ? 473 LEU A CG    1 
ATOM   5189  C  CD1   . LEU B 2  472 ? 37.631  18.169  30.841 1.00 72.05  ? 473 LEU A CD1   1 
ATOM   5190  C  CD2   . LEU B 2  472 ? 35.514  19.308  30.146 1.00 88.38  ? 473 LEU A CD2   1 
ATOM   5191  N  N     . THR B 2  473 ? 35.838  16.167  25.975 1.00 64.26  ? 474 THR A N     1 
ATOM   5192  C  CA    . THR B 2  473 ? 35.990  16.260  24.522 1.00 61.97  ? 474 THR A CA    1 
ATOM   5193  C  C     . THR B 2  473 ? 34.645  16.118  23.811 1.00 65.06  ? 474 THR A C     1 
ATOM   5194  O  O     . THR B 2  473 ? 34.406  16.757  22.779 1.00 59.43  ? 474 THR A O     1 
ATOM   5195  C  CB    . THR B 2  473 ? 36.976  15.199  24.002 1.00 57.42  ? 474 THR A CB    1 
ATOM   5196  O  OG1   . THR B 2  473 ? 38.260  15.359  24.613 1.00 55.31  ? 474 THR A OG1   1 
ATOM   5197  C  CG2   . THR B 2  473 ? 37.163  15.362  22.509 1.00 49.59  ? 474 THR A CG2   1 
ATOM   5198  N  N     A GLU B 2  474 ? 33.747  15.287  24.335 0.50 65.12  ? 475 GLU A N     1 
ATOM   5199  N  N     B GLU B 2  474 ? 33.776  15.262  24.346 0.50 64.88  ? 475 GLU A N     1 
ATOM   5200  C  CA    A GLU B 2  474 ? 32.425  15.206  23.722 0.50 64.23  ? 475 GLU A CA    1 
ATOM   5201  C  CA    B GLU B 2  474 ? 32.418  15.128  23.836 0.50 66.58  ? 475 GLU A CA    1 
ATOM   5202  C  C     A GLU B 2  474 ? 31.685  16.518  23.870 0.50 65.90  ? 475 GLU A C     1 
ATOM   5203  C  C     B GLU B 2  474 ? 31.681  16.457  23.903 0.50 67.57  ? 475 GLU A C     1 
ATOM   5204  O  O     A GLU B 2  474 ? 31.025  16.978  22.929 0.50 69.44  ? 475 GLU A O     1 
ATOM   5205  O  O     B GLU B 2  474 ? 31.060  16.891  22.924 0.50 70.65  ? 475 GLU A O     1 
ATOM   5206  C  CB    A GLU B 2  474 ? 31.607  14.067  24.325 0.50 63.32  ? 475 GLU A CB    1 
ATOM   5207  C  CB    B GLU B 2  474 ? 31.691  14.029  24.626 0.50 67.16  ? 475 GLU A CB    1 
ATOM   5208  C  CG    A GLU B 2  474 ? 30.418  13.645  23.459 0.50 69.18  ? 475 GLU A CG    1 
ATOM   5209  C  CG    B GLU B 2  474 ? 32.366  12.647  24.467 0.50 74.26  ? 475 GLU A CG    1 
ATOM   5210  C  CD    A GLU B 2  474 ? 29.150  14.438  23.730 0.50 70.41  ? 475 GLU A CD    1 
ATOM   5211  C  CD    B GLU B 2  474 ? 31.783  11.515  25.318 0.50 80.03  ? 475 GLU A CD    1 
ATOM   5212  O  OE1   A GLU B 2  474 ? 28.200  14.332  22.929 0.50 62.79  ? 475 GLU A OE1   1 
ATOM   5213  O  OE1   B GLU B 2  474 ? 30.952  11.762  26.219 0.50 88.07  ? 475 GLU A OE1   1 
ATOM   5214  O  OE2   A GLU B 2  474 ? 29.091  15.156  24.750 0.50 77.16  ? 475 GLU A OE2   1 
ATOM   5215  O  OE2   B GLU B 2  474 ? 32.187  10.357  25.076 0.50 76.83  ? 475 GLU A OE2   1 
ATOM   5216  N  N     . ILE B 2  475 ? 31.763  17.132  25.053 1.00 62.16  ? 476 ILE A N     1 
ATOM   5217  C  CA    . ILE B 2  475 ? 31.108  18.429  25.246 1.00 61.39  ? 476 ILE A CA    1 
ATOM   5218  C  C     . ILE B 2  475 ? 31.696  19.469  24.312 1.00 62.15  ? 476 ILE A C     1 
ATOM   5219  O  O     . ILE B 2  475 ? 30.971  20.283  23.734 1.00 65.93  ? 476 ILE A O     1 
ATOM   5220  C  CB    . ILE B 2  475 ? 31.225  18.870  26.716 1.00 60.42  ? 476 ILE A CB    1 
ATOM   5221  C  CG1   . ILE B 2  475 ? 30.230  18.110  27.576 1.00 63.38  ? 476 ILE A CG1   1 
ATOM   5222  C  CG2   . ILE B 2  475 ? 30.959  20.345  26.865 1.00 55.08  ? 476 ILE A CG2   1 
ATOM   5223  C  CD1   . ILE B 2  475 ? 30.570  18.117  29.014 1.00 62.52  ? 476 ILE A CD1   1 
ATOM   5224  N  N     . ARG B 2  476 ? 33.018  19.477  24.169 1.00 63.61  ? 477 ARG A N     1 
ATOM   5225  C  CA    . ARG B 2  476 ? 33.654  20.425  23.262 1.00 56.57  ? 477 ARG A CA    1 
ATOM   5226  C  C     . ARG B 2  476 ? 33.106  20.285  21.855 1.00 54.75  ? 477 ARG A C     1 
ATOM   5227  O  O     . ARG B 2  476 ? 32.724  21.271  21.221 1.00 52.94  ? 477 ARG A O     1 
ATOM   5228  C  CB    . ARG B 2  476 ? 35.163  20.216  23.263 1.00 52.31  ? 477 ARG A CB    1 
ATOM   5229  C  CG    . ARG B 2  476 ? 35.922  21.281  22.506 1.00 53.09  ? 477 ARG A CG    1 
ATOM   5230  C  CD    . ARG B 2  476 ? 37.316  20.808  22.195 1.00 56.46  ? 477 ARG A CD    1 
ATOM   5231  N  NE    . ARG B 2  476 ? 37.263  19.769  21.171 1.00 70.20  ? 477 ARG A NE    1 
ATOM   5232  C  CZ    . ARG B 2  476 ? 38.259  18.945  20.868 1.00 69.33  ? 477 ARG A CZ    1 
ATOM   5233  N  NH1   . ARG B 2  476 ? 39.426  19.027  21.494 1.00 66.98  ? 477 ARG A NH1   1 
ATOM   5234  N  NH2   . ARG B 2  476 ? 38.080  18.042  19.921 1.00 66.37  ? 477 ARG A NH2   1 
ATOM   5235  N  N     . ASP B 2  477 ? 33.036  19.058  21.364 1.00 60.18  ? 478 ASP A N     1 
ATOM   5236  C  CA    . ASP B 2  477 ? 32.609  18.829  19.993 1.00 66.90  ? 478 ASP A CA    1 
ATOM   5237  C  C     . ASP B 2  477 ? 31.163  19.252  19.791 1.00 65.41  ? 478 ASP A C     1 
ATOM   5238  O  O     . ASP B 2  477 ? 30.792  19.752  18.724 1.00 76.93  ? 478 ASP A O     1 
ATOM   5239  C  CB    . ASP B 2  477 ? 32.792  17.355  19.622 1.00 70.25  ? 478 ASP A CB    1 
ATOM   5240  C  CG    . ASP B 2  477 ? 34.244  16.945  19.569 1.00 80.88  ? 478 ASP A CG    1 
ATOM   5241  O  OD1   . ASP B 2  477 ? 35.126  17.823  19.450 1.00 87.36  ? 478 ASP A OD1   1 
ATOM   5242  O  OD2   . ASP B 2  477 ? 34.511  15.726  19.630 1.00 77.60  ? 478 ASP A OD2   1 
ATOM   5243  N  N     . ARG B 2  478 ? 30.330  19.077  20.815 1.00 59.20  ? 479 ARG A N     1 
ATOM   5244  C  CA    . ARG B 2  478 ? 28.900  19.319  20.653 1.00 58.79  ? 479 ARG A CA    1 
ATOM   5245  C  C     . ARG B 2  478 ? 28.534  20.779  20.864 1.00 55.13  ? 479 ARG A C     1 
ATOM   5246  O  O     . ARG B 2  478 ? 27.578  21.276  20.251 1.00 57.52  ? 479 ARG A O     1 
ATOM   5247  C  CB    . ARG B 2  478 ? 28.105  18.434  21.610 1.00 57.60  ? 479 ARG A CB    1 
ATOM   5248  C  CG    . ARG B 2  478 ? 26.580  18.617  21.517 1.00 63.21  ? 479 ARG A CG    1 
ATOM   5249  C  CD    . ARG B 2  478 ? 25.842  17.359  21.949 1.00 71.62  ? 479 ARG A CD    1 
ATOM   5250  N  NE    . ARG B 2  478 ? 26.496  16.752  23.100 1.00 74.95  ? 479 ARG A NE    1 
ATOM   5251  C  CZ    . ARG B 2  478 ? 26.044  16.839  24.342 1.00 85.81  ? 479 ARG A CZ    1 
ATOM   5252  N  NH1   . ARG B 2  478 ? 24.919  17.489  24.591 1.00 89.92  ? 479 ARG A NH1   1 
ATOM   5253  N  NH2   . ARG B 2  478 ? 26.705  16.258  25.328 1.00 84.60  ? 479 ARG A NH2   1 
ATOM   5254  N  N     . PHE B 2  479 ? 29.271  21.479  21.728 1.00 55.80  ? 480 PHE A N     1 
ATOM   5255  C  CA    . PHE B 2  479 ? 28.944  22.843  22.120 1.00 52.51  ? 480 PHE A CA    1 
ATOM   5256  C  C     . PHE B 2  479 ? 30.000  23.873  21.756 1.00 59.71  ? 480 PHE A C     1 
ATOM   5257  O  O     . PHE B 2  479 ? 29.666  25.058  21.655 1.00 58.03  ? 480 PHE A O     1 
ATOM   5258  C  CB    . PHE B 2  479 ? 28.695  22.924  23.630 1.00 52.00  ? 480 PHE A CB    1 
ATOM   5259  C  CG    . PHE B 2  479 ? 27.450  22.223  24.048 1.00 52.34  ? 480 PHE A CG    1 
ATOM   5260  C  CD1   . PHE B 2  479 ? 26.217  22.760  23.762 1.00 52.74  ? 480 PHE A CD1   1 
ATOM   5261  C  CD2   . PHE B 2  479 ? 27.515  21.001  24.678 1.00 52.59  ? 480 PHE A CD2   1 
ATOM   5262  C  CE1   . PHE B 2  479 ? 25.068  22.115  24.132 1.00 60.69  ? 480 PHE A CE1   1 
ATOM   5263  C  CE2   . PHE B 2  479 ? 26.363  20.350  25.048 1.00 59.75  ? 480 PHE A CE2   1 
ATOM   5264  C  CZ    . PHE B 2  479 ? 25.138  20.908  24.772 1.00 65.80  ? 480 PHE A CZ    1 
ATOM   5265  N  N     . GLY B 2  480 ? 31.246  23.463  21.544 1.00 63.42  ? 481 GLY A N     1 
ATOM   5266  C  CA    . GLY B 2  480 ? 32.280  24.429  21.229 1.00 57.14  ? 481 GLY A CA    1 
ATOM   5267  C  C     . GLY B 2  480 ? 31.981  25.133  19.912 1.00 62.35  ? 481 GLY A C     1 
ATOM   5268  O  O     . GLY B 2  480 ? 31.459  24.536  18.959 1.00 69.47  ? 481 GLY A O     1 
ATOM   5269  N  N     . ASP B 2  481 ? 32.308  26.426  19.853 1.00 52.09  ? 482 ASP A N     1 
ATOM   5270  C  CA    . ASP B 2  481 ? 32.004  27.203  18.660 1.00 53.36  ? 482 ASP A CA    1 
ATOM   5271  C  C     . ASP B 2  481 ? 33.155  28.127  18.302 1.00 56.57  ? 482 ASP A C     1 
ATOM   5272  O  O     . ASP B 2  481 ? 34.153  28.244  19.017 1.00 63.27  ? 482 ASP A O     1 
ATOM   5273  C  CB    . ASP B 2  481 ? 30.710  28.006  18.824 1.00 55.22  ? 482 ASP A CB    1 
ATOM   5274  C  CG    . ASP B 2  481 ? 30.756  28.957  19.988 1.00 55.38  ? 482 ASP A CG    1 
ATOM   5275  O  OD1   . ASP B 2  481 ? 31.764  28.946  20.725 1.00 49.61  ? 482 ASP A OD1   1 
ATOM   5276  O  OD2   . ASP B 2  481 ? 29.774  29.700  20.173 1.00 57.44  ? 482 ASP A OD2   1 
ATOM   5277  N  N     . ASP B 2  482 ? 32.975  28.790  17.163 1.00 52.55  ? 483 ASP A N     1 
ATOM   5278  C  CA    . ASP B 2  482 ? 33.988  29.677  16.613 1.00 52.67  ? 483 ASP A CA    1 
ATOM   5279  C  C     . ASP B 2  482 ? 34.223  30.876  17.514 1.00 52.07  ? 483 ASP A C     1 
ATOM   5280  O  O     . ASP B 2  482 ? 33.288  31.437  18.086 1.00 49.50  ? 483 ASP A O     1 
ATOM   5281  C  CB    . ASP B 2  482 ? 33.569  30.166  15.225 1.00 56.06  ? 483 ASP A CB    1 
ATOM   5282  C  CG    . ASP B 2  482 ? 33.731  29.118  14.166 1.00 65.57  ? 483 ASP A CG    1 
ATOM   5283  O  OD1   . ASP B 2  482 ? 34.403  28.101  14.428 1.00 83.92  ? 483 ASP A OD1   1 
ATOM   5284  O  OD2   . ASP B 2  482 ? 33.196  29.328  13.063 1.00 69.36  ? 483 ASP A OD2   1 
ATOM   5285  N  N     . ARG B 2  483 ? 35.484  31.285  17.601 1.00 51.34  ? 484 ARG A N     1 
ATOM   5286  C  CA    . ARG B 2  483 ? 35.839  32.494  18.329 1.00 50.69  ? 484 ARG A CA    1 
ATOM   5287  C  C     . ARG B 2  483 ? 35.211  33.711  17.671 1.00 51.02  ? 484 ARG A C     1 
ATOM   5288  O  O     . ARG B 2  483 ? 35.231  33.853  16.448 1.00 53.89  ? 484 ARG A O     1 
ATOM   5289  C  CB    . ARG B 2  483 ? 37.356  32.648  18.388 1.00 49.64  ? 484 ARG A CB    1 
ATOM   5290  C  CG    . ARG B 2  483 ? 37.824  34.062  18.608 1.00 44.39  ? 484 ARG A CG    1 
ATOM   5291  C  CD    . ARG B 2  483 ? 39.328  34.109  18.699 1.00 47.09  ? 484 ARG A CD    1 
ATOM   5292  N  NE    . ARG B 2  483 ? 39.807  33.477  19.917 1.00 57.31  ? 484 ARG A NE    1 
ATOM   5293  C  CZ    . ARG B 2  483 ? 39.829  34.083  21.096 1.00 66.88  ? 484 ARG A CZ    1 
ATOM   5294  N  NH1   . ARG B 2  483 ? 39.397  35.334  21.200 1.00 63.66  ? 484 ARG A NH1   1 
ATOM   5295  N  NH2   . ARG B 2  483 ? 40.278  33.441  22.167 1.00 83.60  ? 484 ARG A NH2   1 
ATOM   5296  N  N     . ARG B 2  484 ? 34.634  34.588  18.487 1.00 50.15  ? 485 ARG A N     1 
ATOM   5297  C  CA    . ARG B 2  484 ? 33.969  35.775  17.962 1.00 53.80  ? 485 ARG A CA    1 
ATOM   5298  C  C     . ARG B 2  484 ? 34.828  37.019  18.040 1.00 57.59  ? 485 ARG A C     1 
ATOM   5299  O  O     . ARG B 2  484 ? 34.678  37.908  17.201 1.00 66.51  ? 485 ARG A O     1 
ATOM   5300  C  CB    . ARG B 2  484 ? 32.653  36.032  18.705 1.00 50.18  ? 485 ARG A CB    1 
ATOM   5301  C  CG    . ARG B 2  484 ? 31.670  34.898  18.604 1.00 50.79  ? 485 ARG A CG    1 
ATOM   5302  C  CD    . ARG B 2  484 ? 30.446  35.183  19.416 1.00 46.77  ? 485 ARG A CD    1 
ATOM   5303  N  NE    . ARG B 2  484 ? 29.442  34.149  19.232 1.00 54.89  ? 485 ARG A NE    1 
ATOM   5304  C  CZ    . ARG B 2  484 ? 28.298  34.108  19.898 1.00 63.14  ? 485 ARG A CZ    1 
ATOM   5305  N  NH1   . ARG B 2  484 ? 28.023  35.041  20.792 1.00 73.83  ? 485 ARG A NH1   1 
ATOM   5306  N  NH2   . ARG B 2  484 ? 27.429  33.135  19.673 1.00 75.20  ? 485 ARG A NH2   1 
ATOM   5307  N  N     . THR B 2  485 ? 35.711  37.110  19.016 1.00 70.84  ? 486 THR A N     1 
ATOM   5308  C  CA    . THR B 2  485 ? 36.502  38.309  19.243 1.00 67.36  ? 486 THR A CA    1 
ATOM   5309  C  C     . THR B 2  485 ? 37.881  38.142  18.626 1.00 61.66  ? 486 THR A C     1 
ATOM   5310  O  O     . THR B 2  485 ? 38.606  37.200  18.961 1.00 67.01  ? 486 THR A O     1 
ATOM   5311  C  CB    . THR B 2  485 ? 36.612  38.623  20.731 1.00 66.33  ? 486 THR A CB    1 
ATOM   5312  O  OG1   . THR B 2  485 ? 35.492  39.420  21.124 1.00 65.03  ? 486 THR A OG1   1 
ATOM   5313  C  CG2   . THR B 2  485 ? 37.877  39.397  20.996 1.00 64.21  ? 486 THR A CG2   1 
ATOM   5314  N  N     . GLU B 2  486 ? 38.238  39.067  17.749 1.00 58.38  ? 487 GLU A N     1 
ATOM   5315  C  CA    . GLU B 2  486 ? 39.542  39.066  17.117 1.00 56.02  ? 487 GLU A CA    1 
ATOM   5316  C  C     . GLU B 2  486 ? 40.553  39.732  18.034 1.00 56.11  ? 487 GLU A C     1 
ATOM   5317  O  O     . GLU B 2  486 ? 40.284  40.804  18.581 1.00 59.51  ? 487 GLU A O     1 
ATOM   5318  C  CB    . GLU B 2  486 ? 39.500  39.786  15.772 1.00 59.10  ? 487 GLU A CB    1 
ATOM   5319  C  CG    . GLU B 2  486 ? 40.874  39.934  15.155 1.00 59.51  ? 487 GLU A CG    1 
ATOM   5320  C  CD    . GLU B 2  486 ? 40.836  40.601  13.803 1.00 64.86  ? 487 GLU A CD    1 
ATOM   5321  O  OE1   . GLU B 2  486 ? 39.729  40.987  13.360 1.00 71.88  ? 487 GLU A OE1   1 
ATOM   5322  O  OE2   . GLU B 2  486 ? 41.916  40.734  13.188 1.00 70.07  ? 487 GLU A OE2   1 
ATOM   5323  N  N     . ILE B 2  487 ? 41.715  39.112  18.180 1.00 61.20  ? 488 ILE A N     1 
ATOM   5324  C  CA    . ILE B 2  487 ? 42.799  39.651  18.999 1.00 64.64  ? 488 ILE A CA    1 
ATOM   5325  C  C     . ILE B 2  487 ? 43.855  40.230  18.064 1.00 81.84  ? 488 ILE A C     1 
ATOM   5326  O  O     . ILE B 2  487 ? 44.734  39.506  17.580 1.00 63.99  ? 488 ILE A O     1 
ATOM   5327  C  CB    . ILE B 2  487 ? 43.409  38.597  19.923 1.00 56.91  ? 488 ILE A CB    1 
ATOM   5328  C  CG1   . ILE B 2  487 ? 42.414  38.165  20.997 1.00 52.86  ? 488 ILE A CG1   1 
ATOM   5329  C  CG2   . ILE B 2  487 ? 44.675  39.146  20.566 1.00 51.82  ? 488 ILE A CG2   1 
ATOM   5330  C  CD1   . ILE B 2  487 ? 42.969  37.094  21.868 1.00 61.03  ? 488 ILE A CD1   1 
ATOM   5331  N  N     . GLN B 2  488 ? 43.829  41.547  17.889 1.00 65.73  ? 489 GLN A N     1 
ATOM   5332  C  CA    . GLN B 2  488 ? 44.658  42.216  16.891 1.00 79.93  ? 489 GLN A CA    1 
ATOM   5333  C  C     . GLN B 2  488 ? 46.093  42.464  17.312 1.00 88.81  ? 489 GLN A C     1 
ATOM   5334  O  O     . GLN B 2  488 ? 46.358  42.820  18.461 1.00 92.07  ? 489 GLN A O     1 
ATOM   5335  C  CB    . GLN B 2  488 ? 44.027  43.547  16.507 1.00 87.15  ? 489 GLN A CB    1 
ATOM   5336  C  CG    . GLN B 2  488 ? 43.588  43.540  15.096 1.00 88.16  ? 489 GLN A CG    1 
ATOM   5337  C  CD    . GLN B 2  488 ? 43.182  44.894  14.609 1.00 94.51  ? 489 GLN A CD    1 
ATOM   5338  O  OE1   . GLN B 2  488 ? 43.137  45.868  15.371 1.00 78.05  ? 489 GLN A OE1   1 
ATOM   5339  N  NE2   . GLN B 2  488 ? 42.873  44.972  13.317 1.00 120.90 ? 489 GLN A NE2   1 
ATOM   5340  N  N     . LEU B 2  489 ? 46.988  42.364  16.311 1.00 102.20 ? 490 LEU A N     1 
ATOM   5341  C  CA    . LEU B 2  489 ? 48.424  42.682  16.358 1.00 103.61 ? 490 LEU A CA    1 
ATOM   5342  C  C     . LEU B 2  489 ? 49.231  41.622  17.099 1.00 113.75 ? 490 LEU A C     1 
ATOM   5343  O  O     . LEU B 2  489 ? 48.681  40.721  17.749 1.00 126.32 ? 490 LEU A O     1 
ATOM   5344  C  CB    . LEU B 2  489 ? 48.674  44.083  16.927 1.00 92.99  ? 490 LEU A CB    1 
ATOM   5345  C  CG    . LEU B 2  489 ? 48.902  44.490  18.400 1.00 98.51  ? 490 LEU A CG    1 
ATOM   5346  C  CD1   . LEU B 2  489 ? 50.309  44.167  18.875 1.00 99.99  ? 490 LEU A CD1   1 
ATOM   5347  C  CD2   . LEU B 2  489 ? 48.614  45.980  18.583 1.00 97.77  ? 490 LEU A CD2   1 
ATOM   5348  N  N     . LYS C 1  9   ? 7.494   59.089  25.998 1.00 128.37 ? 417 LYS D N     1 
ATOM   5349  C  CA    . LYS C 1  9   ? 7.634   57.709  25.547 1.00 124.28 ? 417 LYS D CA    1 
ATOM   5350  C  C     . LYS C 1  9   ? 7.429   57.457  24.039 1.00 141.89 ? 417 LYS D C     1 
ATOM   5351  O  O     . LYS C 1  9   ? 7.509   56.303  23.623 1.00 157.43 ? 417 LYS D O     1 
ATOM   5352  C  CB    . LYS C 1  9   ? 6.667   56.820  26.329 1.00 119.26 ? 417 LYS D CB    1 
ATOM   5353  N  N     . LEU C 1  10  ? 7.138   58.460  23.207 1.00 145.09 ? 418 LEU D N     1 
ATOM   5354  C  CA    . LEU C 1  10  ? 7.099   58.182  21.772 1.00 155.27 ? 418 LEU D CA    1 
ATOM   5355  C  C     . LEU C 1  10  ? 8.495   57.862  21.261 1.00 158.67 ? 418 LEU D C     1 
ATOM   5356  O  O     . LEU C 1  10  ? 9.480   58.490  21.661 1.00 153.58 ? 418 LEU D O     1 
ATOM   5357  C  CB    . LEU C 1  10  ? 6.512   59.352  20.971 1.00 160.45 ? 418 LEU D CB    1 
ATOM   5358  C  CG    . LEU C 1  10  ? 6.897   59.491  19.480 1.00 162.24 ? 418 LEU D CG    1 
ATOM   5359  C  CD1   . LEU C 1  10  ? 6.088   58.595  18.524 1.00 158.90 ? 418 LEU D CD1   1 
ATOM   5360  C  CD2   . LEU C 1  10  ? 6.792   60.947  19.042 1.00 161.82 ? 418 LEU D CD2   1 
ATOM   5361  N  N     . ALA C 1  11  ? 8.581   56.872  20.382 1.00 170.30 ? 419 ALA D N     1 
ATOM   5362  C  CA    . ALA C 1  11  ? 9.834   56.472  19.743 1.00 177.41 ? 419 ALA D CA    1 
ATOM   5363  C  C     . ALA C 1  11  ? 9.705   56.722  18.242 1.00 182.53 ? 419 ALA D C     1 
ATOM   5364  O  O     . ALA C 1  11  ? 9.190   55.874  17.511 1.00 180.43 ? 419 ALA D O     1 
ATOM   5365  C  CB    . ALA C 1  11  ? 10.153  55.014  20.054 1.00 174.55 ? 419 ALA D CB    1 
ATOM   5366  N  N     . ASP C 1  12  ? 10.219  57.862  17.780 1.00 184.69 ? 420 ASP D N     1 
ATOM   5367  C  CA    . ASP C 1  12  ? 9.981   58.326  16.414 1.00 189.29 ? 420 ASP D CA    1 
ATOM   5368  C  C     . ASP C 1  12  ? 10.828  57.593  15.376 1.00 190.99 ? 420 ASP D C     1 
ATOM   5369  O  O     . ASP C 1  12  ? 11.936  57.144  15.652 1.00 190.57 ? 420 ASP D O     1 
ATOM   5370  C  CB    . ASP C 1  12  ? 10.256  59.828  16.324 1.00 185.20 ? 420 ASP D CB    1 
ATOM   5371  C  CG    . ASP C 1  12  ? 9.471   60.486  15.230 1.00 177.45 ? 420 ASP D CG    1 
ATOM   5372  O  OD1   . ASP C 1  12  ? 8.995   59.759  14.340 1.00 172.92 ? 420 ASP D OD1   1 
ATOM   5373  O  OD2   . ASP C 1  12  ? 9.315   61.724  15.263 1.00 173.67 ? 420 ASP D OD2   1 
ATOM   5374  N  N     . CYS C 1  13  ? 10.308  57.549  14.140 1.00 190.35 ? 421 CYS D N     1 
ATOM   5375  C  CA    . CYS C 1  13  ? 10.945  56.894  12.999 1.00 184.50 ? 421 CYS D CA    1 
ATOM   5376  C  C     . CYS C 1  13  ? 11.997  57.791  12.344 1.00 175.92 ? 421 CYS D C     1 
ATOM   5377  O  O     . CYS C 1  13  ? 11.972  59.016  12.468 1.00 175.97 ? 421 CYS D O     1 
ATOM   5378  C  CB    . CYS C 1  13  ? 9.894   56.485  11.958 1.00 180.54 ? 421 CYS D CB    1 
ATOM   5379  S  SG    . CYS C 1  13  ? 9.195   57.852  10.990 1.00 180.16 ? 421 CYS D SG    1 
ATOM   5380  N  N     . SER C 1  14  ? 12.899  57.146  11.587 1.00 168.97 ? 422 SER D N     1 
ATOM   5381  C  CA    . SER C 1  14  ? 14.043  57.839  10.991 1.00 162.97 ? 422 SER D CA    1 
ATOM   5382  C  C     . SER C 1  14  ? 13.634  58.825  9.898  1.00 173.07 ? 422 SER D C     1 
ATOM   5383  O  O     . SER C 1  14  ? 14.209  59.916  9.800  1.00 180.49 ? 422 SER D O     1 
ATOM   5384  C  CB    . SER C 1  14  ? 15.037  56.812  10.434 1.00 150.01 ? 422 SER D CB    1 
ATOM   5385  O  OG    . SER C 1  14  ? 15.707  56.116  11.470 1.00 145.29 ? 422 SER D OG    1 
ATOM   5386  N  N     . SER C 1  15  ? 12.693  58.448  9.038  1.00 179.28 ? 423 SER D N     1 
ATOM   5387  C  CA    . SER C 1  15  ? 12.336  59.283  7.890  1.00 182.96 ? 423 SER D CA    1 
ATOM   5388  C  C     . SER C 1  15  ? 11.529  60.507  8.322  1.00 188.32 ? 423 SER D C     1 
ATOM   5389  O  O     . SER C 1  15  ? 11.012  60.577  9.435  1.00 191.44 ? 423 SER D O     1 
ATOM   5390  C  CB    . SER C 1  15  ? 11.549  58.470  6.857  1.00 182.13 ? 423 SER D CB    1 
ATOM   5391  O  OG    . SER C 1  15  ? 11.251  59.249  5.713  1.00 177.18 ? 423 SER D OG    1 
ATOM   5392  N  N     . LYS C 1  16  ? 11.401  61.483  7.407  1.00 191.22 ? 424 LYS D N     1 
ATOM   5393  C  CA    . LYS C 1  16  ? 10.652  62.701  7.705  1.00 188.91 ? 424 LYS D CA    1 
ATOM   5394  C  C     . LYS C 1  16  ? 9.566   62.976  6.675  1.00 188.16 ? 424 LYS D C     1 
ATOM   5395  O  O     . LYS C 1  16  ? 8.920   64.034  6.736  1.00 187.15 ? 424 LYS D O     1 
ATOM   5396  C  CB    . LYS C 1  16  ? 11.597  63.908  7.806  1.00 184.92 ? 424 LYS D CB    1 
ATOM   5397  N  N     . SER C 1  17  ? 9.345   62.050  5.734  1.00 196.78 ? 425 SER D N     1 
ATOM   5398  C  CA    . SER C 1  17  ? 8.291   62.155  4.740  1.00 202.60 ? 425 SER D CA    1 
ATOM   5399  C  C     . SER C 1  17  ? 7.098   61.311  5.159  1.00 200.18 ? 425 SER D C     1 
ATOM   5400  O  O     . SER C 1  17  ? 7.155   60.065  5.092  1.00 198.98 ? 425 SER D O     1 
ATOM   5401  C  CB    . SER C 1  17  ? 8.799   61.745  3.362  1.00 198.58 ? 425 SER D CB    1 
ATOM   5402  O  OG    . SER C 1  17  ? 7.838   62.021  2.360  1.00 188.59 ? 425 SER D OG    1 
ATOM   5403  N  N     . PRO C 1  18  ? 5.999   61.955  5.558  1.00 184.74 ? 426 PRO D N     1 
ATOM   5404  C  CA    . PRO C 1  18  ? 4.827   61.266  6.138  1.00 178.07 ? 426 PRO D CA    1 
ATOM   5405  C  C     . PRO C 1  18  ? 4.128   60.253  5.243  1.00 169.90 ? 426 PRO D C     1 
ATOM   5406  O  O     . PRO C 1  18  ? 3.358   59.432  5.761  1.00 169.39 ? 426 PRO D O     1 
ATOM   5407  C  CB    . PRO C 1  18  ? 3.884   62.442  6.439  1.00 167.62 ? 426 PRO D CB    1 
ATOM   5408  C  CG    . PRO C 1  18  ? 4.808   63.614  6.625  1.00 170.45 ? 426 PRO D CG    1 
ATOM   5409  C  CD    . PRO C 1  18  ? 5.914   63.418  5.664  1.00 173.53 ? 426 PRO D CD    1 
ATOM   5410  N  N     . GLU C 1  19  ? 4.290   60.328  3.922  1.00 167.44 ? 427 GLU D N     1 
ATOM   5411  C  CA    . GLU C 1  19  ? 3.555   59.429  3.035  1.00 168.48 ? 427 GLU D CA    1 
ATOM   5412  C  C     . GLU C 1  19  ? 3.909   57.969  3.297  1.00 169.51 ? 427 GLU D C     1 
ATOM   5413  O  O     . GLU C 1  19  ? 3.031   57.094  3.275  1.00 165.97 ? 427 GLU D O     1 
ATOM   5414  C  CB    . GLU C 1  19  ? 3.817   59.800  1.570  1.00 173.43 ? 427 GLU D CB    1 
ATOM   5415  N  N     . GLU C 1  20  ? 5.182   57.682  3.535  1.00 173.23 ? 428 GLU D N     1 
ATOM   5416  C  CA    . GLU C 1  20  ? 5.631   56.317  3.779  1.00 181.48 ? 428 GLU D CA    1 
ATOM   5417  C  C     . GLU C 1  20  ? 5.592   55.934  5.254  1.00 181.33 ? 428 GLU D C     1 
ATOM   5418  O  O     . GLU C 1  20  ? 5.901   54.784  5.587  1.00 181.15 ? 428 GLU D O     1 
ATOM   5419  C  CB    . GLU C 1  20  ? 7.047   56.122  3.210  1.00 177.68 ? 428 GLU D CB    1 
ATOM   5420  N  N     . CYS C 1  21  ? 5.180   56.843  6.133  1.00 189.50 ? 429 CYS D N     1 
ATOM   5421  C  CA    . CYS C 1  21  ? 5.253   56.618  7.569  1.00 193.72 ? 429 CYS D CA    1 
ATOM   5422  C  C     . CYS C 1  21  ? 4.014   55.928  8.124  1.00 203.61 ? 429 CYS D C     1 
ATOM   5423  O  O     . CYS C 1  21  ? 2.916   56.010  7.571  1.00 210.16 ? 429 CYS D O     1 
ATOM   5424  C  CB    . CYS C 1  21  ? 5.485   57.937  8.310  1.00 185.12 ? 429 CYS D CB    1 
ATOM   5425  S  SG    . CYS C 1  21  ? 7.182   58.529  8.216  1.00 174.67 ? 429 CYS D SG    1 
ATOM   5426  N  N     . GLU C 1  22  ? 4.230   55.266  9.261  1.00 202.08 ? 430 GLU D N     1 
ATOM   5427  C  CA    . GLU C 1  22  ? 3.260   54.548  10.064 1.00 180.47 ? 430 GLU D CA    1 
ATOM   5428  C  C     . GLU C 1  22  ? 3.581   54.844  11.518 1.00 177.33 ? 430 GLU D C     1 
ATOM   5429  O  O     . GLU C 1  22  ? 4.755   54.943  11.882 1.00 176.39 ? 430 GLU D O     1 
ATOM   5430  C  CB    . GLU C 1  22  ? 3.357   53.027  9.846  1.00 173.70 ? 430 GLU D CB    1 
ATOM   5431  C  CG    . GLU C 1  22  ? 2.549   52.490  8.743  1.00 167.73 ? 430 GLU D CG    1 
ATOM   5432  C  CD    . GLU C 1  22  ? 3.250   51.381  7.992  1.00 169.52 ? 430 GLU D CD    1 
ATOM   5433  O  OE1   . GLU C 1  22  ? 2.849   51.098  6.842  1.00 170.23 ? 430 GLU D OE1   1 
ATOM   5434  O  OE2   . GLU C 1  22  ? 4.203   50.796  8.550  1.00 172.20 ? 430 GLU D OE2   1 
ATOM   5435  N  N     . ILE C 1  23  ? 2.555   54.991  12.347 1.00 182.33 ? 431 ILE D N     1 
ATOM   5436  C  CA    . ILE C 1  23  ? 2.730   55.055  13.796 1.00 168.17 ? 431 ILE D CA    1 
ATOM   5437  C  C     . ILE C 1  23  ? 1.910   53.942  14.421 1.00 171.02 ? 431 ILE D C     1 
ATOM   5438  O  O     . ILE C 1  23  ? 0.810   53.632  13.959 1.00 175.95 ? 431 ILE D O     1 
ATOM   5439  C  CB    . ILE C 1  23  ? 2.318   56.403  14.424 1.00 148.24 ? 431 ILE D CB    1 
ATOM   5440  C  CG1   . ILE C 1  23  ? 3.018   56.552  15.775 1.00 138.32 ? 431 ILE D CG1   1 
ATOM   5441  C  CG2   . ILE C 1  23  ? 0.804   56.423  14.696 1.00 138.47 ? 431 ILE D CG2   1 
ATOM   5442  C  CD1   . ILE C 1  23  ? 2.537   57.703  16.627 1.00 139.31 ? 431 ILE D CD1   1 
ATOM   5443  N  N     . PHE C 1  24  ? 2.418   53.364  15.492 1.00 167.81 ? 432 PHE D N     1 
ATOM   5444  C  CA    . PHE C 1  24  ? 1.691   52.307  16.172 1.00 162.14 ? 432 PHE D CA    1 
ATOM   5445  C  C     . PHE C 1  24  ? 1.350   52.737  17.591 1.00 155.29 ? 432 PHE D C     1 
ATOM   5446  O  O     . PHE C 1  24  ? 2.219   53.201  18.338 1.00 154.29 ? 432 PHE D O     1 
ATOM   5447  C  CB    . PHE C 1  24  ? 2.491   51.002  16.153 1.00 171.32 ? 432 PHE D CB    1 
ATOM   5448  C  CG    . PHE C 1  24  ? 2.599   50.370  14.774 1.00 165.86 ? 432 PHE D CG    1 
ATOM   5449  C  CD1   . PHE C 1  24  ? 3.620   50.721  13.899 1.00 166.95 ? 432 PHE D CD1   1 
ATOM   5450  C  CD2   . PHE C 1  24  ? 1.702   49.390  14.370 1.00 174.59 ? 432 PHE D CD2   1 
ATOM   5451  C  CE1   . PHE C 1  24  ? 3.729   50.121  12.644 1.00 167.46 ? 432 PHE D CE1   1 
ATOM   5452  C  CE2   . PHE C 1  24  ? 1.806   48.791  13.117 1.00 177.19 ? 432 PHE D CE2   1 
ATOM   5453  C  CZ    . PHE C 1  24  ? 2.817   49.158  12.256 1.00 173.47 ? 432 PHE D CZ    1 
ATOM   5454  N  N     . LEU C 1  25  ? 0.069   52.636  17.932 1.00 150.59 ? 433 LEU D N     1 
ATOM   5455  C  CA    . LEU C 1  25  ? -0.397  52.789  19.299 1.00 147.28 ? 433 LEU D CA    1 
ATOM   5456  C  C     . LEU C 1  25  ? -0.358  51.407  19.936 1.00 149.41 ? 433 LEU D C     1 
ATOM   5457  O  O     . LEU C 1  25  ? -1.006  50.479  19.440 1.00 135.84 ? 433 LEU D O     1 
ATOM   5458  C  CB    . LEU C 1  25  ? -1.813  53.354  19.336 1.00 140.80 ? 433 LEU D CB    1 
ATOM   5459  C  CG    . LEU C 1  25  ? -2.038  54.706  18.660 1.00 134.32 ? 433 LEU D CG    1 
ATOM   5460  C  CD1   . LEU C 1  25  ? -3.487  55.145  18.805 1.00 130.55 ? 433 LEU D CD1   1 
ATOM   5461  C  CD2   . LEU C 1  25  ? -1.099  55.737  19.250 1.00 139.90 ? 433 LEU D CD2   1 
ATOM   5462  N  N     . VAL C 1  26  ? 0.435   51.241  20.987 1.00 165.07 ? 434 VAL D N     1 
ATOM   5463  C  CA    . VAL C 1  26  ? 0.675   49.917  21.554 1.00 169.55 ? 434 VAL D CA    1 
ATOM   5464  C  C     . VAL C 1  26  ? 0.114   49.867  22.964 1.00 160.50 ? 434 VAL D C     1 
ATOM   5465  O  O     . VAL C 1  26  ? 0.357   50.772  23.768 1.00 157.18 ? 434 VAL D O     1 
ATOM   5466  C  CB    . VAL C 1  26  ? 2.165   49.542  21.544 1.00 175.43 ? 434 VAL D CB    1 
ATOM   5467  C  CG1   . VAL C 1  26  ? 2.313   48.121  21.982 1.00 176.26 ? 434 VAL D CG1   1 
ATOM   5468  C  CG2   . VAL C 1  26  ? 2.735   49.720  20.157 1.00 176.39 ? 434 VAL D CG2   1 
ATOM   5469  N  N     . GLU C 1  27  ? -0.609  48.795  23.265 1.00 154.16 ? 435 GLU D N     1 
ATOM   5470  C  CA    . GLU C 1  27  ? -1.154  48.600  24.599 1.00 148.62 ? 435 GLU D CA    1 
ATOM   5471  C  C     . GLU C 1  27  ? -0.080  48.028  25.516 1.00 145.22 ? 435 GLU D C     1 
ATOM   5472  O  O     . GLU C 1  27  ? 0.436   46.931  25.273 1.00 153.33 ? 435 GLU D O     1 
ATOM   5473  C  CB    . GLU C 1  27  ? -2.365  47.677  24.552 1.00 139.02 ? 435 GLU D CB    1 
ATOM   5474  C  CG    . GLU C 1  27  ? -2.942  47.384  25.930 1.00 127.68 ? 435 GLU D CG    1 
ATOM   5475  C  CD    . GLU C 1  27  ? -4.084  46.368  25.876 1.00 122.63 ? 435 GLU D CD    1 
ATOM   5476  O  OE1   . GLU C 1  27  ? -4.466  45.959  24.744 1.00 125.08 ? 435 GLU D OE1   1 
ATOM   5477  O  OE2   . GLU C 1  27  ? -4.605  45.993  26.961 1.00 124.42 ? 435 GLU D OE2   1 
ATOM   5478  N  N     . GLY C 1  28  ? 0.250   48.767  26.571 1.00 144.11 ? 436 GLY D N     1 
ATOM   5479  C  CA    . GLY C 1  28  ? 1.234   48.329  27.543 1.00 140.27 ? 436 GLY D CA    1 
ATOM   5480  C  C     . GLY C 1  28  ? 2.651   48.542  27.056 1.00 133.28 ? 436 GLY D C     1 
ATOM   5481  O  O     . GLY C 1  28  ? 2.926   48.418  25.863 1.00 133.05 ? 436 GLY D O     1 
ATOM   5482  N  N     . ASP C 1  29  ? 3.572   48.864  27.959 1.00 132.80 ? 437 ASP D N     1 
ATOM   5483  C  CA    . ASP C 1  29  ? 4.951   49.107  27.562 1.00 125.23 ? 437 ASP D CA    1 
ATOM   5484  C  C     . ASP C 1  29  ? 5.771   47.834  27.547 1.00 124.66 ? 437 ASP D C     1 
ATOM   5485  O  O     . ASP C 1  29  ? 7.007   47.892  27.500 1.00 124.06 ? 437 ASP D O     1 
ATOM   5486  C  CB    . ASP C 1  29  ? 5.587   50.155  28.469 1.00 114.33 ? 437 ASP D CB    1 
ATOM   5487  N  N     . SER C 1  30  ? 5.119   46.683  27.653 1.00 118.18 ? 438 SER D N     1 
ATOM   5488  C  CA    . SER C 1  30  ? 5.745   45.401  27.376 1.00 107.16 ? 438 SER D CA    1 
ATOM   5489  C  C     . SER C 1  30  ? 5.577   45.054  25.910 1.00 116.77 ? 438 SER D C     1 
ATOM   5490  O  O     . SER C 1  30  ? 6.529   44.701  25.198 1.00 100.88 ? 438 SER D O     1 
ATOM   5491  C  CB    . SER C 1  30  ? 5.114   44.315  28.245 1.00 87.37  ? 438 SER D CB    1 
ATOM   5492  N  N     . ALA C 1  31  ? 4.335   45.222  25.458 1.00 131.11 ? 439 ALA D N     1 
ATOM   5493  C  CA    . ALA C 1  31  ? 4.022   45.161  24.050 1.00 123.83 ? 439 ALA D CA    1 
ATOM   5494  C  C     . ALA C 1  31  ? 4.807   46.211  23.294 1.00 119.76 ? 439 ALA D C     1 
ATOM   5495  O  O     . ALA C 1  31  ? 5.329   45.939  22.212 1.00 119.08 ? 439 ALA D O     1 
ATOM   5496  C  CB    . ALA C 1  31  ? 2.523   45.342  23.872 1.00 119.51 ? 439 ALA D CB    1 
ATOM   5497  N  N     . GLY C 1  32  ? 4.959   47.404  23.886 1.00 113.76 ? 440 GLY D N     1 
ATOM   5498  C  CA    . GLY C 1  32  ? 5.690   48.516  23.317 1.00 111.48 ? 440 GLY D CA    1 
ATOM   5499  C  C     . GLY C 1  32  ? 7.175   48.298  23.195 1.00 118.78 ? 440 GLY D C     1 
ATOM   5500  O  O     . GLY C 1  32  ? 7.721   48.436  22.096 1.00 110.53 ? 440 GLY D O     1 
ATOM   5501  N  N     . GLY C 1  33  ? 7.839   47.977  24.313 1.00 129.44 ? 441 GLY D N     1 
ATOM   5502  C  CA    . GLY C 1  33  ? 9.267   47.684  24.306 1.00 124.25 ? 441 GLY D CA    1 
ATOM   5503  C  C     . GLY C 1  33  ? 9.581   46.726  23.182 1.00 108.71 ? 441 GLY D C     1 
ATOM   5504  O  O     . GLY C 1  33  ? 10.386  47.031  22.298 1.00 90.42  ? 441 GLY D O     1 
ATOM   5505  N  N     . SER C 1  34  ? 8.885   45.585  23.208 1.00 111.98 ? 442 SER D N     1 
ATOM   5506  C  CA    . SER C 1  34  ? 8.952   44.595  22.139 1.00 115.75 ? 442 SER D CA    1 
ATOM   5507  C  C     . SER C 1  34  ? 8.826   45.217  20.754 1.00 114.30 ? 442 SER D C     1 
ATOM   5508  O  O     . SER C 1  34  ? 9.572   44.857  19.835 1.00 108.24 ? 442 SER D O     1 
ATOM   5509  C  CB    . SER C 1  34  ? 7.858   43.545  22.354 1.00 121.33 ? 442 SER D CB    1 
ATOM   5510  O  OG    . SER C 1  34  ? 8.306   42.462  23.145 1.00 127.93 ? 442 SER D OG    1 
ATOM   5511  N  N     . THR C 1  35  ? 7.866   46.128  20.574 1.00 118.52 ? 443 THR D N     1 
ATOM   5512  C  CA    . THR C 1  35  ? 7.614   46.677  19.240 1.00 120.17 ? 443 THR D CA    1 
ATOM   5513  C  C     . THR C 1  35  ? 8.751   47.581  18.765 1.00 119.12 ? 443 THR D C     1 
ATOM   5514  O  O     . THR C 1  35  ? 9.008   47.660  17.559 1.00 119.60 ? 443 THR D O     1 
ATOM   5515  C  CB    . THR C 1  35  ? 6.257   47.406  19.204 1.00 115.19 ? 443 THR D CB    1 
ATOM   5516  O  OG1   . THR C 1  35  ? 6.188   48.381  20.255 1.00 117.01 ? 443 THR D OG1   1 
ATOM   5517  C  CG2   . THR C 1  35  ? 5.120   46.409  19.353 1.00 105.56 ? 443 THR D CG2   1 
ATOM   5518  N  N     . LYS C 1  36  ? 9.458   48.240  19.689 1.00 111.23 ? 444 LYS D N     1 
ATOM   5519  C  CA    . LYS C 1  36  ? 10.588  49.108  19.342 1.00 99.58  ? 444 LYS D CA    1 
ATOM   5520  C  C     . LYS C 1  36  ? 11.778  48.309  18.816 1.00 97.81  ? 444 LYS D C     1 
ATOM   5521  O  O     . LYS C 1  36  ? 12.482  48.746  17.893 1.00 113.11 ? 444 LYS D O     1 
ATOM   5522  C  CB    . LYS C 1  36  ? 10.985  49.931  20.569 1.00 109.68 ? 444 LYS D CB    1 
ATOM   5523  C  CG    . LYS C 1  36  ? 9.779   50.559  21.278 1.00 102.32 ? 444 LYS D CG    1 
ATOM   5524  C  CD    . LYS C 1  36  ? 10.162  51.517  22.402 1.00 107.95 ? 444 LYS D CD    1 
ATOM   5525  C  CE    . LYS C 1  36  ? 9.028   52.528  22.643 1.00 108.47 ? 444 LYS D CE    1 
ATOM   5526  N  NZ    . LYS C 1  36  ? 9.404   53.615  23.599 1.00 96.51  ? 444 LYS D NZ    1 
ATOM   5527  N  N     . SER C 1  37  ? 12.023  47.146  19.411 1.00 189.36 ? 445 SER D N     1 
ATOM   5528  C  CA    . SER C 1  37  ? 13.006  46.201  18.894 1.00 168.78 ? 445 SER D CA    1 
ATOM   5529  C  C     . SER C 1  37  ? 12.575  45.651  17.535 1.00 161.83 ? 445 SER D C     1 
ATOM   5530  O  O     . SER C 1  37  ? 13.388  45.564  16.607 1.00 164.24 ? 445 SER D O     1 
ATOM   5531  C  CB    . SER C 1  37  ? 13.188  45.062  19.905 1.00 163.62 ? 445 SER D CB    1 
ATOM   5532  O  OG    . SER C 1  37  ? 14.526  44.613  20.026 1.00 162.45 ? 445 SER D OG    1 
ATOM   5533  N  N     . GLY C 1  38  ? 11.284  45.331  17.380 1.00 162.77 ? 446 GLY D N     1 
ATOM   5534  C  CA    . GLY C 1  38  ? 10.845  44.544  16.234 1.00 162.13 ? 446 GLY D CA    1 
ATOM   5535  C  C     . GLY C 1  38  ? 10.689  45.329  14.943 1.00 161.46 ? 446 GLY D C     1 
ATOM   5536  O  O     . GLY C 1  38  ? 10.996  44.811  13.863 1.00 164.44 ? 446 GLY D O     1 
ATOM   5537  N  N     . ARG C 1  39  ? 10.267  46.593  15.041 1.00 158.97 ? 447 ARG D N     1 
ATOM   5538  C  CA    . ARG C 1  39  ? 9.840   47.424  13.909 1.00 159.24 ? 447 ARG D CA    1 
ATOM   5539  C  C     . ARG C 1  39  ? 10.980  47.830  12.970 1.00 162.13 ? 447 ARG D C     1 
ATOM   5540  O  O     . ARG C 1  39  ? 12.165  47.751  13.297 1.00 167.77 ? 447 ARG D O     1 
ATOM   5541  C  CB    . ARG C 1  39  ? 9.185   48.707  14.431 1.00 156.23 ? 447 ARG D CB    1 
ATOM   5542  C  CG    . ARG C 1  39  ? 10.102  49.392  15.432 1.00 155.93 ? 447 ARG D CG    1 
ATOM   5543  C  CD    . ARG C 1  39  ? 9.875   50.877  15.491 1.00 154.53 ? 447 ARG D CD    1 
ATOM   5544  N  NE    . ARG C 1  39  ? 10.974  51.533  16.190 1.00 160.46 ? 447 ARG D NE    1 
ATOM   5545  C  CZ    . ARG C 1  39  ? 11.052  52.841  16.404 1.00 167.67 ? 447 ARG D CZ    1 
ATOM   5546  N  NH1   . ARG C 1  39  ? 12.097  53.346  17.050 1.00 169.24 ? 447 ARG D NH1   1 
ATOM   5547  N  NH2   . ARG C 1  39  ? 10.086  53.643  15.975 1.00 170.12 ? 447 ARG D NH2   1 
ATOM   5548  N  N     . ASP C 1  40  ? 10.563  48.349  11.803 1.00 159.02 ? 448 ASP D N     1 
ATOM   5549  C  CA    . ASP C 1  40  ? 11.411  49.038  10.830 1.00 160.81 ? 448 ASP D CA    1 
ATOM   5550  C  C     . ASP C 1  40  ? 11.569  50.480  11.304 1.00 155.44 ? 448 ASP D C     1 
ATOM   5551  O  O     . ASP C 1  40  ? 10.701  51.331  11.058 1.00 151.70 ? 448 ASP D O     1 
ATOM   5552  C  CB    . ASP C 1  40  ? 10.762  48.958  9.449  1.00 161.04 ? 448 ASP D CB    1 
ATOM   5553  C  CG    . ASP C 1  40  ? 11.684  49.381  8.305  1.00 154.18 ? 448 ASP D CG    1 
ATOM   5554  O  OD1   . ASP C 1  40  ? 12.494  50.331  8.466  1.00 153.81 ? 448 ASP D OD1   1 
ATOM   5555  O  OD2   . ASP C 1  40  ? 11.564  48.765  7.221  1.00 153.13 ? 448 ASP D OD2   1 
ATOM   5556  N  N     . SER C 1  41  ? 12.661  50.750  12.029 1.00 152.80 ? 449 SER D N     1 
ATOM   5557  C  CA    . SER C 1  41  ? 12.913  52.080  12.575 1.00 149.71 ? 449 SER D CA    1 
ATOM   5558  C  C     . SER C 1  41  ? 12.771  53.158  11.515 1.00 158.54 ? 449 SER D C     1 
ATOM   5559  O  O     . SER C 1  41  ? 12.331  54.280  11.814 1.00 159.52 ? 449 SER D O     1 
ATOM   5560  C  CB    . SER C 1  41  ? 14.315  52.138  13.188 1.00 145.29 ? 449 SER D CB    1 
ATOM   5561  O  OG    . SER C 1  41  ? 15.287  51.732  12.235 1.00 144.43 ? 449 SER D OG    1 
ATOM   5562  N  N     . ARG C 1  42  ? 13.128  52.835  10.272 1.00 163.01 ? 450 ARG D N     1 
ATOM   5563  C  CA    . ARG C 1  42  ? 13.088  53.818  9.197  1.00 164.71 ? 450 ARG D CA    1 
ATOM   5564  C  C     . ARG C 1  42  ? 11.666  54.280  8.900  1.00 164.32 ? 450 ARG D C     1 
ATOM   5565  O  O     . ARG C 1  42  ? 11.429  55.480  8.708  1.00 172.29 ? 450 ARG D O     1 
ATOM   5566  C  CB    . ARG C 1  42  ? 13.750  53.242  7.945  1.00 168.19 ? 450 ARG D CB    1 
ATOM   5567  C  CG    . ARG C 1  42  ? 13.454  54.043  6.713  1.00 167.95 ? 450 ARG D CG    1 
ATOM   5568  C  CD    . ARG C 1  42  ? 14.135  53.448  5.499  1.00 171.64 ? 450 ARG D CD    1 
ATOM   5569  N  NE    . ARG C 1  42  ? 13.678  54.090  4.272  1.00 178.38 ? 450 ARG D NE    1 
ATOM   5570  C  CZ    . ARG C 1  42  ? 13.955  55.348  3.940  1.00 182.16 ? 450 ARG D CZ    1 
ATOM   5571  N  NH1   . ARG C 1  42  ? 13.500  55.851  2.799  1.00 187.34 ? 450 ARG D NH1   1 
ATOM   5572  N  NH2   . ARG C 1  42  ? 14.683  56.109  4.750  1.00 177.29 ? 450 ARG D NH2   1 
ATOM   5573  N  N     . THR C 1  43  ? 10.705  53.361  8.848  1.00 156.84 ? 451 THR D N     1 
ATOM   5574  C  CA    . THR C 1  43  ? 9.340   53.738  8.482  1.00 151.24 ? 451 THR D CA    1 
ATOM   5575  C  C     . THR C 1  43  ? 8.304   53.552  9.588  1.00 152.55 ? 451 THR D C     1 
ATOM   5576  O  O     . THR C 1  43  ? 7.118   53.782  9.327  1.00 155.62 ? 451 THR D O     1 
ATOM   5577  C  CB    . THR C 1  43  ? 8.873   52.970  7.232  1.00 148.28 ? 451 THR D CB    1 
ATOM   5578  O  OG1   . THR C 1  43  ? 9.029   51.561  7.445  1.00 147.06 ? 451 THR D OG1   1 
ATOM   5579  C  CG2   . THR C 1  43  ? 9.659   53.402  6.013  1.00 156.25 ? 451 THR D CG2   1 
ATOM   5580  N  N     . GLN C 1  44  ? 8.683   53.159  10.802 1.00 148.60 ? 452 GLN D N     1 
ATOM   5581  C  CA    . GLN C 1  44  ? 7.683   52.877  11.828 1.00 143.45 ? 452 GLN D CA    1 
ATOM   5582  C  C     . GLN C 1  44  ? 8.008   53.548  13.157 1.00 144.14 ? 452 GLN D C     1 
ATOM   5583  O  O     . GLN C 1  44  ? 9.168   53.602  13.567 1.00 149.02 ? 452 GLN D O     1 
ATOM   5584  C  CB    . GLN C 1  44  ? 7.523   51.367  12.012 1.00 144.52 ? 452 GLN D CB    1 
ATOM   5585  C  CG    . GLN C 1  44  ? 6.915   50.687  10.795 1.00 145.02 ? 452 GLN D CG    1 
ATOM   5586  C  CD    . GLN C 1  44  ? 7.136   49.187  10.789 1.00 147.65 ? 452 GLN D CD    1 
ATOM   5587  O  OE1   . GLN C 1  44  ? 8.037   48.678  11.461 1.00 148.31 ? 452 GLN D OE1   1 
ATOM   5588  N  NE2   . GLN C 1  44  ? 6.309   48.468  10.028 1.00 147.37 ? 452 GLN D NE2   1 
ATOM   5589  N  N     . ALA C 1  45  ? 6.965   54.037  13.842 1.00 139.94 ? 453 ALA D N     1 
ATOM   5590  C  CA    . ALA C 1  45  ? 7.081   54.692  15.140 1.00 137.56 ? 453 ALA D CA    1 
ATOM   5591  C  C     . ALA C 1  45  ? 6.166   54.019  16.159 1.00 137.09 ? 453 ALA D C     1 
ATOM   5592  O  O     . ALA C 1  45  ? 5.134   53.455  15.796 1.00 138.74 ? 453 ALA D O     1 
ATOM   5593  C  CB    . ALA C 1  45  ? 6.738   56.183  15.030 1.00 140.59 ? 453 ALA D CB    1 
ATOM   5594  N  N     . ILE C 1  46  ? 6.535   54.087  17.443 1.00 138.30 ? 454 ILE D N     1 
ATOM   5595  C  CA    . ILE C 1  46  ? 5.796   53.418  18.524 1.00 129.76 ? 454 ILE D CA    1 
ATOM   5596  C  C     . ILE C 1  46  ? 5.388   54.438  19.587 1.00 126.37 ? 454 ILE D C     1 
ATOM   5597  O  O     . ILE C 1  46  ? 6.243   55.134  20.141 1.00 129.79 ? 454 ILE D O     1 
ATOM   5598  C  CB    . ILE C 1  46  ? 6.615   52.290  19.186 1.00 128.15 ? 454 ILE D CB    1 
ATOM   5599  C  CG1   . ILE C 1  46  ? 7.199   51.284  18.164 1.00 128.73 ? 454 ILE D CG1   1 
ATOM   5600  C  CG2   . ILE C 1  46  ? 5.785   51.599  20.267 1.00 129.71 ? 454 ILE D CG2   1 
ATOM   5601  C  CD1   . ILE C 1  46  ? 6.241   50.752  17.125 1.00 130.19 ? 454 ILE D CD1   1 
ATOM   5602  N  N     . LEU C 1  47  ? 4.104   54.478  19.924 1.00 123.74 ? 455 LEU D N     1 
ATOM   5603  C  CA    . LEU C 1  47  ? 3.622   55.240  21.083 1.00 127.26 ? 455 LEU D CA    1 
ATOM   5604  C  C     . LEU C 1  47  ? 2.816   54.332  22.008 1.00 127.18 ? 455 LEU D C     1 
ATOM   5605  O  O     . LEU C 1  47  ? 1.699   53.919  21.645 1.00 121.51 ? 455 LEU D O     1 
ATOM   5606  C  CB    . LEU C 1  47  ? 2.749   56.420  20.647 1.00 126.94 ? 455 LEU D CB    1 
ATOM   5607  C  CG    . LEU C 1  47  ? 2.049   57.080  21.845 1.00 127.03 ? 455 LEU D CG    1 
ATOM   5608  C  CD1   . LEU C 1  47  ? 3.024   57.967  22.591 1.00 129.88 ? 455 LEU D CD1   1 
ATOM   5609  C  CD2   . LEU C 1  47  ? 0.781   57.857  21.484 1.00 123.34 ? 455 LEU D CD2   1 
ATOM   5610  N  N     . PRO C 1  48  ? 3.294   53.966  23.200 1.00 132.18 ? 456 PRO D N     1 
ATOM   5611  C  CA    . PRO C 1  48  ? 2.455   53.138  24.078 1.00 127.59 ? 456 PRO D CA    1 
ATOM   5612  C  C     . PRO C 1  48  ? 1.524   53.996  24.920 1.00 115.32 ? 456 PRO D C     1 
ATOM   5613  O  O     . PRO C 1  48  ? 1.865   55.103  25.337 1.00 108.68 ? 456 PRO D O     1 
ATOM   5614  C  CB    . PRO C 1  48  ? 3.474   52.387  24.949 1.00 127.97 ? 456 PRO D CB    1 
ATOM   5615  C  CG    . PRO C 1  48  ? 4.865   52.895  24.529 1.00 135.28 ? 456 PRO D CG    1 
ATOM   5616  C  CD    . PRO C 1  48  ? 4.613   54.192  23.802 1.00 137.74 ? 456 PRO D CD    1 
ATOM   5617  N  N     . LEU C 1  49  ? 0.295   53.501  25.133 1.00 110.30 ? 457 LEU D N     1 
ATOM   5618  C  CA    . LEU C 1  49  ? -0.653  54.134  26.042 1.00 111.05 ? 457 LEU D CA    1 
ATOM   5619  C  C     . LEU C 1  49  ? -0.698  53.319  27.336 1.00 125.61 ? 457 LEU D C     1 
ATOM   5620  O  O     . LEU C 1  49  ? -0.944  52.111  27.301 1.00 137.88 ? 457 LEU D O     1 
ATOM   5621  C  CB    . LEU C 1  49  ? -2.038  54.228  25.402 1.00 111.22 ? 457 LEU D CB    1 
ATOM   5622  C  CG    . LEU C 1  49  ? -2.147  54.868  24.003 1.00 124.24 ? 457 LEU D CG    1 
ATOM   5623  C  CD1   . LEU C 1  49  ? -3.564  54.760  23.464 1.00 127.32 ? 457 LEU D CD1   1 
ATOM   5624  C  CD2   . LEU C 1  49  ? -1.656  56.335  23.935 1.00 129.82 ? 457 LEU D CD2   1 
ATOM   5625  N  N     . ARG C 1  50  ? -0.469  53.980  28.478 1.00 121.68 ? 458 ARG D N     1 
ATOM   5626  C  CA    . ARG C 1  50  ? -0.156  53.244  29.704 1.00 106.25 ? 458 ARG D CA    1 
ATOM   5627  C  C     . ARG C 1  50  ? -1.394  52.679  30.403 1.00 109.45 ? 458 ARG D C     1 
ATOM   5628  O  O     . ARG C 1  50  ? -1.322  51.583  30.968 1.00 114.63 ? 458 ARG D O     1 
ATOM   5629  C  CB    . ARG C 1  50  ? 0.673   54.120  30.651 1.00 94.87  ? 458 ARG D CB    1 
ATOM   5630  N  N     . GLY C 1  51  ? -2.526  53.390  30.406 1.00 108.11 ? 459 GLY D N     1 
ATOM   5631  C  CA    . GLY C 1  51  ? -3.695  52.920  31.132 1.00 107.03 ? 459 GLY D CA    1 
ATOM   5632  C  C     . GLY C 1  51  ? -4.976  52.982  30.315 1.00 109.18 ? 459 GLY D C     1 
ATOM   5633  O  O     . GLY C 1  51  ? -4.953  53.368  29.151 1.00 118.33 ? 459 GLY D O     1 
ATOM   5634  N  N     . LYS C 1  52  ? -6.099  52.547  30.935 1.00 102.50 ? 460 LYS D N     1 
ATOM   5635  C  CA    . LYS C 1  52  ? -7.413  52.754  30.318 1.00 102.34 ? 460 LYS D CA    1 
ATOM   5636  C  C     . LYS C 1  52  ? -7.551  54.237  30.033 1.00 103.18 ? 460 LYS D C     1 
ATOM   5637  O  O     . LYS C 1  52  ? -7.482  55.055  30.963 1.00 103.80 ? 460 LYS D O     1 
ATOM   5638  C  CB    . LYS C 1  52  ? -8.588  52.324  31.201 1.00 99.47  ? 460 LYS D CB    1 
ATOM   5639  C  CG    . LYS C 1  52  ? -8.984  50.867  31.263 1.00 92.11  ? 460 LYS D CG    1 
ATOM   5640  C  CD    . LYS C 1  52  ? -8.680  50.115  29.990 1.00 88.48  ? 460 LYS D CD    1 
ATOM   5641  C  CE    . LYS C 1  52  ? -9.155  48.672  30.119 1.00 82.24  ? 460 LYS D CE    1 
ATOM   5642  N  NZ    . LYS C 1  52  ? -10.436 48.637  30.901 1.00 73.64  ? 460 LYS D NZ    1 
ATOM   5643  N  N     . ILE C 1  53  ? -7.678  54.596  28.766 1.00 106.05 ? 461 ILE D N     1 
ATOM   5644  C  CA    . ILE C 1  53  ? -7.741  56.009  28.411 1.00 105.82 ? 461 ILE D CA    1 
ATOM   5645  C  C     . ILE C 1  53  ? -9.151  56.518  28.621 1.00 107.19 ? 461 ILE D C     1 
ATOM   5646  O  O     . ILE C 1  53  ? -10.127 55.791  28.485 1.00 117.14 ? 461 ILE D O     1 
ATOM   5647  C  CB    . ILE C 1  53  ? -7.268  56.264  26.969 1.00 102.80 ? 461 ILE D CB    1 
ATOM   5648  C  CG1   . ILE C 1  53  ? -8.165  55.521  25.989 1.00 107.39 ? 461 ILE D CG1   1 
ATOM   5649  C  CG2   . ILE C 1  53  ? -5.830  55.912  26.762 1.00 99.75  ? 461 ILE D CG2   1 
ATOM   5650  C  CD1   . ILE C 1  53  ? -8.397  56.333  24.781 1.00 113.65 ? 461 ILE D CD1   1 
ATOM   5651  N  N     . LEU C 1  54  ? -9.232  57.799  28.910 1.00 103.20 ? 462 LEU D N     1 
ATOM   5652  C  CA    . LEU C 1  54  ? -10.491 58.420  29.283 1.00 96.66  ? 462 LEU D CA    1 
ATOM   5653  C  C     . LEU C 1  54  ? -11.586 58.193  28.239 1.00 96.12  ? 462 LEU D C     1 
ATOM   5654  O  O     . LEU C 1  54  ? -11.323 58.179  27.040 1.00 101.77 ? 462 LEU D O     1 
ATOM   5655  C  CB    . LEU C 1  54  ? -10.215 59.899  29.490 1.00 86.44  ? 462 LEU D CB    1 
ATOM   5656  C  CG    . LEU C 1  54  ? -11.309 60.781  30.001 1.00 87.33  ? 462 LEU D CG    1 
ATOM   5657  C  CD1   . LEU C 1  54  ? -11.102 60.950  31.484 1.00 88.87  ? 462 LEU D CD1   1 
ATOM   5658  C  CD2   . LEU C 1  54  ? -11.138 62.072  29.263 1.00 88.36  ? 462 LEU D CD2   1 
ATOM   5659  N  N     . ASN C 1  55  ? -12.828 58.033  28.684 1.00 94.68  ? 463 ASN D N     1 
ATOM   5660  C  CA    . ASN C 1  55  ? -13.939 57.958  27.725 1.00 104.69 ? 463 ASN D CA    1 
ATOM   5661  C  C     . ASN C 1  55  ? -14.323 59.384  27.355 1.00 109.82 ? 463 ASN D C     1 
ATOM   5662  O  O     . ASN C 1  55  ? -15.131 60.010  28.034 1.00 110.71 ? 463 ASN D O     1 
ATOM   5663  C  CB    . ASN C 1  55  ? -15.128 57.191  28.309 1.00 107.71 ? 463 ASN D CB    1 
ATOM   5664  C  CG    . ASN C 1  55  ? -16.279 57.038  27.316 1.00 105.89 ? 463 ASN D CG    1 
ATOM   5665  O  OD1   . ASN C 1  55  ? -16.058 56.866  26.124 1.00 110.72 ? 463 ASN D OD1   1 
ATOM   5666  N  ND2   . ASN C 1  55  ? -17.508 57.087  27.811 1.00 102.91 ? 463 ASN D ND2   1 
ATOM   5667  N  N     . VAL C 1  56  ? -13.765 59.923  26.261 1.00 110.57 ? 464 VAL D N     1 
ATOM   5668  C  CA    . VAL C 1  56  ? -14.009 61.341  25.976 1.00 109.99 ? 464 VAL D CA    1 
ATOM   5669  C  C     . VAL C 1  56  ? -15.496 61.641  25.792 1.00 110.34 ? 464 VAL D C     1 
ATOM   5670  O  O     . VAL C 1  56  ? -15.911 62.798  25.934 1.00 115.37 ? 464 VAL D O     1 
ATOM   5671  C  CB    . VAL C 1  56  ? -13.196 61.881  24.770 1.00 111.66 ? 464 VAL D CB    1 
ATOM   5672  C  CG1   . VAL C 1  56  ? -11.700 61.809  25.025 1.00 120.95 ? 464 VAL D CG1   1 
ATOM   5673  C  CG2   . VAL C 1  56  ? -13.605 61.229  23.432 1.00 109.51 ? 464 VAL D CG2   1 
ATOM   5674  N  N     . GLU C 1  57  ? -16.319 60.631  25.509 1.00 111.22 ? 465 GLU D N     1 
ATOM   5675  C  CA    . GLU C 1  57  ? -17.755 60.879  25.358 1.00 110.50 ? 465 GLU D CA    1 
ATOM   5676  C  C     . GLU C 1  57  ? -18.420 61.234  26.688 1.00 110.40 ? 465 GLU D C     1 
ATOM   5677  O  O     . GLU C 1  57  ? -19.196 62.198  26.768 1.00 106.56 ? 465 GLU D O     1 
ATOM   5678  C  CB    . GLU C 1  57  ? -18.459 59.674  24.725 1.00 111.75 ? 465 GLU D CB    1 
ATOM   5679  C  CG    . GLU C 1  57  ? -19.952 59.918  24.525 1.00 114.86 ? 465 GLU D CG    1 
ATOM   5680  C  CD    . GLU C 1  57  ? -20.293 60.215  23.083 1.00 124.58 ? 465 GLU D CD    1 
ATOM   5681  O  OE1   . GLU C 1  57  ? -19.791 59.486  22.204 1.00 125.32 ? 465 GLU D OE1   1 
ATOM   5682  O  OE2   . GLU C 1  57  ? -21.043 61.183  22.822 1.00 130.21 ? 465 GLU D OE2   1 
ATOM   5683  N  N     . LYS C 1  58  ? -18.142 60.455  27.741 1.00 113.79 ? 466 LYS D N     1 
ATOM   5684  C  CA    . LYS C 1  58  ? -18.794 60.645  29.042 1.00 110.27 ? 466 LYS D CA    1 
ATOM   5685  C  C     . LYS C 1  58  ? -18.254 61.854  29.808 1.00 103.22 ? 466 LYS D C     1 
ATOM   5686  O  O     . LYS C 1  58  ? -19.005 62.499  30.556 1.00 98.64  ? 466 LYS D O     1 
ATOM   5687  C  CB    . LYS C 1  58  ? -18.637 59.380  29.902 1.00 109.31 ? 466 LYS D CB    1 
ATOM   5688  C  CG    . LYS C 1  58  ? -19.702 58.315  29.761 1.00 106.78 ? 466 LYS D CG    1 
ATOM   5689  C  CD    . LYS C 1  58  ? -19.401 57.167  30.724 1.00 103.62 ? 466 LYS D CD    1 
ATOM   5690  C  CE    . LYS C 1  58  ? -20.161 55.901  30.355 1.00 108.35 ? 466 LYS D CE    1 
ATOM   5691  N  NZ    . LYS C 1  58  ? -19.369 54.670  30.659 1.00 103.53 ? 466 LYS D NZ    1 
ATOM   5692  N  N     . ALA C 1  59  ? -16.966 62.170  29.664 1.00 105.69 ? 467 ALA D N     1 
ATOM   5693  C  CA    . ALA C 1  59  ? -16.243 63.081  30.559 1.00 110.95 ? 467 ALA D CA    1 
ATOM   5694  C  C     . ALA C 1  59  ? -16.397 64.563  30.177 1.00 130.93 ? 467 ALA D C     1 
ATOM   5695  O  O     . ALA C 1  59  ? -16.595 64.913  29.012 1.00 138.68 ? 467 ALA D O     1 
ATOM   5696  C  CB    . ALA C 1  59  ? -14.758 62.719  30.591 1.00 106.10 ? 467 ALA D CB    1 
ATOM   5697  N  N     . ARG C 1  60  ? -16.280 65.433  31.202 1.00 133.26 ? 468 ARG D N     1 
ATOM   5698  C  CA    . ARG C 1  60  ? -16.311 66.885  31.029 1.00 124.74 ? 468 ARG D CA    1 
ATOM   5699  C  C     . ARG C 1  60  ? -15.129 67.347  30.188 1.00 121.58 ? 468 ARG D C     1 
ATOM   5700  O  O     . ARG C 1  60  ? -14.071 66.720  30.171 1.00 117.23 ? 468 ARG D O     1 
ATOM   5701  C  CB    . ARG C 1  60  ? -16.284 67.604  32.396 1.00 121.39 ? 468 ARG D CB    1 
ATOM   5702  C  CG    . ARG C 1  60  ? -17.643 68.094  32.928 1.00 121.41 ? 468 ARG D CG    1 
ATOM   5703  C  CD    . ARG C 1  60  ? -17.530 68.802  34.294 1.00 123.53 ? 468 ARG D CD    1 
ATOM   5704  N  NE    . ARG C 1  60  ? -16.558 69.893  34.247 1.00 129.19 ? 468 ARG D NE    1 
ATOM   5705  C  CZ    . ARG C 1  60  ? -15.837 70.336  35.278 1.00 127.79 ? 468 ARG D CZ    1 
ATOM   5706  N  NH1   . ARG C 1  60  ? -15.957 69.788  36.489 1.00 110.15 ? 468 ARG D NH1   1 
ATOM   5707  N  NH2   . ARG C 1  60  ? -14.983 71.332  35.086 1.00 136.32 ? 468 ARG D NH2   1 
ATOM   5708  N  N     . LEU C 1  61  ? -15.303 68.449  29.472 1.00 128.64 ? 469 LEU D N     1 
ATOM   5709  C  CA    . LEU C 1  61  ? -14.162 68.994  28.751 1.00 131.50 ? 469 LEU D CA    1 
ATOM   5710  C  C     . LEU C 1  61  ? -13.425 69.974  29.654 1.00 129.22 ? 469 LEU D C     1 
ATOM   5711  O  O     . LEU C 1  61  ? -14.029 70.912  30.193 1.00 132.15 ? 469 LEU D O     1 
ATOM   5712  C  CB    . LEU C 1  61  ? -14.554 69.632  27.413 1.00 131.07 ? 469 LEU D CB    1 
ATOM   5713  C  CG    . LEU C 1  61  ? -13.431 70.442  26.746 1.00 125.09 ? 469 LEU D CG    1 
ATOM   5714  C  CD1   . LEU C 1  61  ? -12.576 69.592  25.806 1.00 120.66 ? 469 LEU D CD1   1 
ATOM   5715  C  CD2   . LEU C 1  61  ? -14.004 71.646  26.015 1.00 118.31 ? 469 LEU D CD2   1 
ATOM   5716  N  N     . ASP C 1  62  ? -12.131 69.675  29.851 1.00 122.90 ? 470 ASP D N     1 
ATOM   5717  C  CA    . ASP C 1  62  ? -11.050 70.281  30.634 1.00 126.54 ? 470 ASP D CA    1 
ATOM   5718  C  C     . ASP C 1  62  ? -10.265 69.080  31.154 1.00 138.36 ? 470 ASP D C     1 
ATOM   5719  O  O     . ASP C 1  62  ? -9.030  69.098  31.232 1.00 142.63 ? 470 ASP D O     1 
ATOM   5720  C  CB    . ASP C 1  62  ? -11.487 71.210  31.779 1.00 127.22 ? 470 ASP D CB    1 
ATOM   5721  C  CG    . ASP C 1  62  ? -12.387 70.535  32.798 1.00 126.71 ? 470 ASP D CG    1 
ATOM   5722  O  OD1   . ASP C 1  62  ? -12.062 69.431  33.296 1.00 128.43 ? 470 ASP D OD1   1 
ATOM   5723  O  OD2   . ASP C 1  62  ? -13.430 71.142  33.111 1.00 118.40 ? 470 ASP D OD2   1 
ATOM   5724  N  N     . ARG C 1  63  ? -11.015 68.027  31.516 1.00 134.87 ? 471 ARG D N     1 
ATOM   5725  C  CA    . ARG C 1  63  ? -10.436 66.734  31.891 1.00 119.95 ? 471 ARG D CA    1 
ATOM   5726  C  C     . ARG C 1  63  ? -9.645  66.156  30.730 1.00 113.71 ? 471 ARG D C     1 
ATOM   5727  O  O     . ARG C 1  63  ? -8.543  65.618  30.899 1.00 114.78 ? 471 ARG D O     1 
ATOM   5728  C  CB    . ARG C 1  63  ? -11.552 65.765  32.296 1.00 112.27 ? 471 ARG D CB    1 
ATOM   5729  N  N     . ILE C 1  64  ? -10.238 66.252  29.550 1.00 111.89 ? 472 ILE D N     1 
ATOM   5730  C  CA    . ILE C 1  64  ? -9.638  65.881  28.280 1.00 114.72 ? 472 ILE D CA    1 
ATOM   5731  C  C     . ILE C 1  64  ? -8.361  66.673  28.041 1.00 119.02 ? 472 ILE D C     1 
ATOM   5732  O  O     . ILE C 1  64  ? -7.399  66.171  27.445 1.00 119.35 ? 472 ILE D O     1 
ATOM   5733  C  CB    . ILE C 1  64  ? -10.697 66.118  27.179 1.00 110.88 ? 472 ILE D CB    1 
ATOM   5734  C  CG1   . ILE C 1  64  ? -12.102 65.999  27.782 1.00 109.01 ? 472 ILE D CG1   1 
ATOM   5735  C  CG2   . ILE C 1  64  ? -10.529 65.152  26.038 1.00 106.46 ? 472 ILE D CG2   1 
ATOM   5736  C  CD1   . ILE C 1  64  ? -13.120 65.399  26.822 1.00 105.71 ? 472 ILE D CD1   1 
ATOM   5737  N  N     . LEU C 1  65  ? -8.327  67.912  28.555 1.00 128.00 ? 473 LEU D N     1 
ATOM   5738  C  CA    . LEU C 1  65  ? -7.233  68.866  28.337 1.00 126.03 ? 473 LEU D CA    1 
ATOM   5739  C  C     . LEU C 1  65  ? -6.069  68.636  29.295 1.00 117.21 ? 473 LEU D C     1 
ATOM   5740  O  O     . LEU C 1  65  ? -4.904  68.707  28.883 1.00 115.41 ? 473 LEU D O     1 
ATOM   5741  C  CB    . LEU C 1  65  ? -7.772  70.302  28.478 1.00 122.46 ? 473 LEU D CB    1 
ATOM   5742  C  CG    . LEU C 1  65  ? -9.002  70.626  27.612 1.00 118.88 ? 473 LEU D CG    1 
ATOM   5743  C  CD1   . LEU C 1  65  ? -9.527  72.049  27.856 1.00 118.14 ? 473 LEU D CD1   1 
ATOM   5744  C  CD2   . LEU C 1  65  ? -8.729  70.399  26.110 1.00 110.07 ? 473 LEU D CD2   1 
ATOM   5745  N  N     . ASN C 1  66  ? -6.346  68.420  30.582 1.00 111.89 ? 474 ASN D N     1 
ATOM   5746  C  CA    . ASN C 1  66  ? -5.245  68.166  31.528 1.00 127.92 ? 474 ASN D CA    1 
ATOM   5747  C  C     . ASN C 1  66  ? -4.699  66.743  31.438 1.00 132.18 ? 474 ASN D C     1 
ATOM   5748  O  O     . ASN C 1  66  ? -3.588  66.466  31.902 1.00 134.11 ? 474 ASN D O     1 
ATOM   5749  C  CB    . ASN C 1  66  ? -5.655  68.507  32.971 1.00 141.65 ? 474 ASN D CB    1 
ATOM   5750  C  CG    . ASN C 1  66  ? -4.449  68.648  33.923 1.00 152.55 ? 474 ASN D CG    1 
ATOM   5751  O  OD1   . ASN C 1  66  ? -3.318  68.330  33.582 1.00 163.64 ? 474 ASN D OD1   1 
ATOM   5752  N  ND2   . ASN C 1  66  ? -4.718  69.131  35.143 1.00 145.60 ? 474 ASN D ND2   1 
ATOM   5753  N  N     . ASN C 1  67  ? -5.365  65.926  30.720 1.00 125.31 ? 475 ASN D N     1 
ATOM   5754  C  CA    . ASN C 1  67  ? -4.895  64.593  30.605 1.00 124.61 ? 475 ASN D CA    1 
ATOM   5755  C  C     . ASN C 1  67  ? -3.730  63.741  30.097 1.00 131.86 ? 475 ASN D C     1 
ATOM   5756  O  O     . ASN C 1  67  ? -4.069  62.583  30.522 1.00 139.56 ? 475 ASN D O     1 
ATOM   5757  C  CB    . ASN C 1  67  ? -5.944  63.841  29.600 1.00 128.01 ? 475 ASN D CB    1 
ATOM   5758  C  CG    . ASN C 1  67  ? -6.350  62.292  30.097 1.00 133.89 ? 475 ASN D CG    1 
ATOM   5759  O  OD1   . ASN C 1  67  ? -5.994  61.298  29.416 1.00 138.32 ? 475 ASN D OD1   1 
ATOM   5760  N  ND2   . ASN C 1  67  ? -6.947  62.167  31.271 1.00 127.98 ? 475 ASN D ND2   1 
ATOM   5761  N  N     A ASN C 1  68  ? -2.627  64.191  29.336 0.50 135.47 ? 476 ASN D N     1 
ATOM   5762  N  N     B ASN C 1  68  ? -2.561  64.177  29.366 0.50 135.51 ? 476 ASN D N     1 
ATOM   5763  C  CA    A ASN C 1  68  ? -1.200  63.596  29.294 0.50 136.34 ? 476 ASN D CA    1 
ATOM   5764  C  CA    B ASN C 1  68  ? -1.140  63.548  29.326 0.50 135.91 ? 476 ASN D CA    1 
ATOM   5765  C  C     A ASN C 1  68  ? -1.200  62.549  28.304 0.50 137.72 ? 476 ASN D C     1 
ATOM   5766  C  C     B ASN C 1  68  ? -1.172  62.515  28.325 0.50 137.60 ? 476 ASN D C     1 
ATOM   5767  O  O     A ASN C 1  68  ? -0.491  62.552  27.354 0.50 144.31 ? 476 ASN D O     1 
ATOM   5768  O  O     B ASN C 1  68  ? -0.507  62.574  27.352 0.50 144.35 ? 476 ASN D O     1 
ATOM   5769  C  CB    A ASN C 1  68  ? -0.677  63.018  30.640 0.50 127.70 ? 476 ASN D CB    1 
ATOM   5770  C  CB    B ASN C 1  68  ? -0.726  63.022  30.766 0.50 127.35 ? 476 ASN D CB    1 
ATOM   5771  C  CG    A ASN C 1  68  ? 0.811   62.973  30.552 0.50 128.54 ? 476 ASN D CG    1 
ATOM   5772  C  CG    B ASN C 1  68  ? 0.271   63.891  31.410 0.50 125.83 ? 476 ASN D CG    1 
ATOM   5773  O  OD1   A ASN C 1  68  ? 1.307   63.290  29.462 0.50 130.71 ? 476 ASN D OD1   1 
ATOM   5774  O  OD1   B ASN C 1  68  ? -0.077  65.036  31.610 0.50 121.55 ? 476 ASN D OD1   1 
ATOM   5775  N  ND2   A ASN C 1  68  ? 1.524   62.782  31.636 0.50 128.72 ? 476 ASN D ND2   1 
ATOM   5776  N  ND2   B ASN C 1  68  ? 1.546   63.457  31.548 0.50 129.51 ? 476 ASN D ND2   1 
ATOM   5777  N  N     . GLU C 1  69  ? -2.084  61.631  28.518 1.00 133.22 ? 477 GLU D N     1 
ATOM   5778  C  CA    . GLU C 1  69  ? -2.394  60.559  27.586 1.00 125.59 ? 477 GLU D CA    1 
ATOM   5779  C  C     . GLU C 1  69  ? -3.042  61.089  26.316 1.00 120.65 ? 477 GLU D C     1 
ATOM   5780  O  O     . GLU C 1  69  ? -2.659  60.746  25.202 1.00 123.48 ? 477 GLU D O     1 
ATOM   5781  C  CB    . GLU C 1  69  ? -3.447  59.643  28.328 1.00 135.70 ? 477 GLU D CB    1 
ATOM   5782  C  CG    . GLU C 1  69  ? -3.106  58.412  28.260 1.00 142.45 ? 477 GLU D CG    1 
ATOM   5783  C  CD    . GLU C 1  69  ? -1.977  58.038  29.154 1.00 145.88 ? 477 GLU D CD    1 
ATOM   5784  O  OE1   . GLU C 1  69  ? -1.878  58.521  30.301 1.00 149.83 ? 477 GLU D OE1   1 
ATOM   5785  O  OE2   . GLU C 1  69  ? -1.206  57.173  28.687 1.00 142.48 ? 477 GLU D OE2   1 
ATOM   5786  N  N     . ILE C 1  70  ? -4.006  61.983  26.524 1.00 118.78 ? 478 ILE D N     1 
ATOM   5787  C  CA    . ILE C 1  70  ? -4.681  62.632  25.416 1.00 126.74 ? 478 ILE D CA    1 
ATOM   5788  C  C     . ILE C 1  70  ? -3.701  63.574  24.758 1.00 127.74 ? 478 ILE D C     1 
ATOM   5789  O  O     . ILE C 1  70  ? -3.632  63.668  23.518 1.00 127.57 ? 478 ILE D O     1 
ATOM   5790  C  CB    . ILE C 1  70  ? -5.933  63.379  25.941 1.00 128.59 ? 478 ILE D CB    1 
ATOM   5791  C  CG1   . ILE C 1  70  ? -6.925  62.401  26.572 1.00 123.60 ? 478 ILE D CG1   1 
ATOM   5792  C  CG2   . ILE C 1  70  ? -6.637  64.076  24.809 1.00 134.46 ? 478 ILE D CG2   1 
ATOM   5793  C  CD1   . ILE C 1  70  ? -7.903  61.811  25.569 1.00 122.37 ? 478 ILE D CD1   1 
ATOM   5794  N  N     . ARG C 1  71  ? -2.891  64.229  25.589 1.00 121.40 ? 479 ARG D N     1 
ATOM   5795  C  CA    . ARG C 1  71  ? -1.908  65.211  25.164 1.00 121.02 ? 479 ARG D CA    1 
ATOM   5796  C  C     . ARG C 1  71  ? -0.792  64.567  24.358 1.00 130.99 ? 479 ARG D C     1 
ATOM   5797  O  O     . ARG C 1  71  ? -0.351  65.128  23.349 1.00 141.44 ? 479 ARG D O     1 
ATOM   5798  C  CB    . ARG C 1  71  ? -1.350  65.922  26.388 1.00 113.45 ? 479 ARG D CB    1 
ATOM   5799  C  CG    . ARG C 1  71  ? -2.337  66.778  27.197 1.00 112.95 ? 479 ARG D CG    1 
ATOM   5800  C  CD    . ARG C 1  71  ? -1.598  67.787  28.083 1.00 118.68 ? 479 ARG D CD    1 
ATOM   5801  N  NE    . ARG C 1  71  ? -0.848  67.089  29.121 1.00 129.50 ? 479 ARG D NE    1 
ATOM   5802  C  CZ    . ARG C 1  71  ? 0.296   67.506  29.658 1.00 138.43 ? 479 ARG D CZ    1 
ATOM   5803  N  NH1   . ARG C 1  71  ? 0.878   68.630  29.266 1.00 147.17 ? 479 ARG D NH1   1 
ATOM   5804  N  NH2   . ARG C 1  71  ? 0.877   66.778  30.598 1.00 129.11 ? 479 ARG D NH2   1 
ATOM   5805  N  N     . GLN C 1  72  ? -0.322  63.396  24.776 1.00 124.62 ? 480 GLN D N     1 
ATOM   5806  C  CA    . GLN C 1  72  ? 0.728   62.736  24.012 1.00 125.19 ? 480 GLN D CA    1 
ATOM   5807  C  C     . GLN C 1  72  ? 0.238   62.280  22.640 1.00 129.53 ? 480 GLN D C     1 
ATOM   5808  O  O     . GLN C 1  72  ? 1.019   62.291  21.683 1.00 137.30 ? 480 GLN D O     1 
ATOM   5809  C  CB    . GLN C 1  72  ? 1.337   61.626  24.871 1.00 122.74 ? 480 GLN D CB    1 
ATOM   5810  C  CG    . GLN C 1  72  ? 2.143   62.266  26.010 1.00 129.24 ? 480 GLN D CG    1 
ATOM   5811  C  CD    . GLN C 1  72  ? 2.762   61.289  26.985 1.00 145.92 ? 480 GLN D CD    1 
ATOM   5812  O  OE1   . GLN C 1  72  ? 2.780   60.083  26.749 1.00 149.80 ? 480 GLN D OE1   1 
ATOM   5813  N  NE2   . GLN C 1  72  ? 3.291   61.815  28.091 1.00 151.36 ? 480 GLN D NE2   1 
ATOM   5814  N  N     . MET C 1  73  ? -1.047  61.959  22.497 1.00 126.62 ? 481 MET D N     1 
ATOM   5815  C  CA    . MET C 1  73  ? -1.585  61.607  21.180 1.00 132.63 ? 481 MET D CA    1 
ATOM   5816  C  C     . MET C 1  73  ? -1.696  62.826  20.268 1.00 142.18 ? 481 MET D C     1 
ATOM   5817  O  O     . MET C 1  73  ? -1.351  62.764  19.076 1.00 148.78 ? 481 MET D O     1 
ATOM   5818  C  CB    . MET C 1  73  ? -2.951  60.931  21.321 1.00 130.27 ? 481 MET D CB    1 
ATOM   5819  C  CG    . MET C 1  73  ? -2.890  59.456  21.631 1.00 136.27 ? 481 MET D CG    1 
ATOM   5820  S  SD    . MET C 1  73  ? -4.521  58.692  21.608 1.00 141.64 ? 481 MET D SD    1 
ATOM   5821  C  CE    . MET C 1  73  ? -5.165  59.233  23.201 1.00 139.51 ? 481 MET D CE    1 
ATOM   5822  N  N     . ILE C 1  74  ? -2.201  63.936  20.810 1.00 138.84 ? 482 ILE D N     1 
ATOM   5823  C  CA    . ILE C 1  74  ? -2.292  65.192  20.060 1.00 131.06 ? 482 ILE D CA    1 
ATOM   5824  C  C     . ILE C 1  74  ? -0.920  65.605  19.531 1.00 134.43 ? 482 ILE D C     1 
ATOM   5825  O  O     . ILE C 1  74  ? -0.739  65.854  18.331 1.00 135.13 ? 482 ILE D O     1 
ATOM   5826  C  CB    . ILE C 1  74  ? -2.899  66.296  20.944 1.00 122.92 ? 482 ILE D CB    1 
ATOM   5827  C  CG1   . ILE C 1  74  ? -4.318  65.929  21.386 1.00 122.26 ? 482 ILE D CG1   1 
ATOM   5828  C  CG2   . ILE C 1  74  ? -2.882  67.632  20.227 1.00 127.05 ? 482 ILE D CG2   1 
ATOM   5829  C  CD1   . ILE C 1  74  ? -4.845  66.784  22.526 1.00 120.54 ? 482 ILE D CD1   1 
ATOM   5830  N  N     . THR C 1  75  ? 0.062   65.701  20.430 1.00 132.94 ? 483 THR D N     1 
ATOM   5831  C  CA    . THR C 1  75  ? 1.428   66.028  20.029 1.00 130.02 ? 483 THR D CA    1 
ATOM   5832  C  C     . THR C 1  75  ? 1.907   65.112  18.910 1.00 139.47 ? 483 THR D C     1 
ATOM   5833  O  O     . THR C 1  75  ? 2.420   65.579  17.887 1.00 145.17 ? 483 THR D O     1 
ATOM   5834  C  CB    . THR C 1  75  ? 2.363   65.952  21.245 1.00 127.60 ? 483 THR D CB    1 
ATOM   5835  O  OG1   . THR C 1  75  ? 1.992   66.953  22.202 1.00 132.31 ? 483 THR D OG1   1 
ATOM   5836  C  CG2   . THR C 1  75  ? 3.835   66.152  20.841 1.00 129.64 ? 483 THR D CG2   1 
ATOM   5837  N  N     . ALA C 1  76  ? 1.707   63.799  19.065 1.00 141.14 ? 484 ALA D N     1 
ATOM   5838  C  CA    . ALA C 1  76  ? 2.195   62.840  18.069 1.00 139.15 ? 484 ALA D CA    1 
ATOM   5839  C  C     . ALA C 1  76  ? 1.547   63.049  16.703 1.00 138.29 ? 484 ALA D C     1 
ATOM   5840  O  O     . ALA C 1  76  ? 2.236   63.074  15.677 1.00 131.11 ? 484 ALA D O     1 
ATOM   5841  C  CB    . ALA C 1  76  ? 1.979   61.404  18.562 1.00 132.65 ? 484 ALA D CB    1 
ATOM   5842  N  N     . PHE C 1  77  ? 0.224   63.185  16.667 1.00 152.01 ? 485 PHE D N     1 
ATOM   5843  C  CA    . PHE C 1  77  ? -0.486  63.287  15.391 1.00 158.80 ? 485 PHE D CA    1 
ATOM   5844  C  C     . PHE C 1  77  ? -0.100  64.559  14.639 1.00 169.12 ? 485 PHE D C     1 
ATOM   5845  O  O     . PHE C 1  77  ? -0.153  64.596  13.395 1.00 177.01 ? 485 PHE D O     1 
ATOM   5846  C  CB    . PHE C 1  77  ? -2.007  63.199  15.615 1.00 149.47 ? 485 PHE D CB    1 
ATOM   5847  C  CG    . PHE C 1  77  ? -2.490  61.848  16.162 1.00 149.15 ? 485 PHE D CG    1 
ATOM   5848  C  CD1   . PHE C 1  77  ? -1.622  60.774  16.315 1.00 151.45 ? 485 PHE D CD1   1 
ATOM   5849  C  CD2   . PHE C 1  77  ? -3.829  61.652  16.515 1.00 152.36 ? 485 PHE D CD2   1 
ATOM   5850  C  CE1   . PHE C 1  77  ? -2.061  59.540  16.810 1.00 149.95 ? 485 PHE D CE1   1 
ATOM   5851  C  CE2   . PHE C 1  77  ? -4.271  60.419  17.009 1.00 153.58 ? 485 PHE D CE2   1 
ATOM   5852  C  CZ    . PHE C 1  77  ? -3.385  59.367  17.158 1.00 150.69 ? 485 PHE D CZ    1 
ATOM   5853  N  N     . GLY C 1  78  ? 0.343   65.591  15.357 1.00 164.17 ? 486 GLY D N     1 
ATOM   5854  C  CA    . GLY C 1  78  ? 0.854   66.806  14.748 1.00 161.12 ? 486 GLY D CA    1 
ATOM   5855  C  C     . GLY C 1  78  ? -0.159  67.678  14.034 1.00 156.99 ? 486 GLY D C     1 
ATOM   5856  O  O     . GLY C 1  78  ? 0.218   68.473  13.164 1.00 152.58 ? 486 GLY D O     1 
ATOM   5857  N  N     . THR C 1  79  ? -1.442  67.550  14.351 1.00 157.33 ? 487 THR D N     1 
ATOM   5858  C  CA    . THR C 1  79  ? -2.465  68.358  13.696 1.00 156.01 ? 487 THR D CA    1 
ATOM   5859  C  C     . THR C 1  79  ? -2.990  69.467  14.589 1.00 153.52 ? 487 THR D C     1 
ATOM   5860  O  O     . THR C 1  79  ? -3.137  70.614  14.146 1.00 161.99 ? 487 THR D O     1 
ATOM   5861  C  CB    . THR C 1  79  ? -3.671  67.504  13.275 1.00 146.16 ? 487 THR D CB    1 
ATOM   5862  O  OG1   . THR C 1  79  ? -4.314  67.022  14.456 1.00 146.32 ? 487 THR D OG1   1 
ATOM   5863  C  CG2   . THR C 1  79  ? -3.252  66.354  12.393 1.00 147.73 ? 487 THR D CG2   1 
ATOM   5864  N  N     . GLY C 1  80  ? -3.308  69.140  15.832 1.00 140.18 ? 488 GLY D N     1 
ATOM   5865  C  CA    . GLY C 1  80  ? -4.172  69.962  16.645 1.00 135.62 ? 488 GLY D CA    1 
ATOM   5866  C  C     . GLY C 1  80  ? -5.570  69.357  16.746 1.00 139.82 ? 488 GLY D C     1 
ATOM   5867  O  O     . GLY C 1  80  ? -5.943  68.437  16.007 1.00 138.57 ? 488 GLY D O     1 
ATOM   5868  N  N     . ILE C 1  81  ? -6.347  69.835  17.704 1.00 150.50 ? 489 ILE D N     1 
ATOM   5869  C  CA    . ILE C 1  81  ? -7.556  69.104  18.087 1.00 162.32 ? 489 ILE D CA    1 
ATOM   5870  C  C     . ILE C 1  81  ? -8.810  69.868  17.727 1.00 167.01 ? 489 ILE D C     1 
ATOM   5871  O  O     . ILE C 1  81  ? -8.984  71.024  18.123 1.00 165.68 ? 489 ILE D O     1 
ATOM   5872  C  CB    . ILE C 1  81  ? -7.575  68.720  19.569 1.00 159.34 ? 489 ILE D CB    1 
ATOM   5873  C  CG1   . ILE C 1  81  ? -6.467  69.440  20.334 1.00 163.34 ? 489 ILE D CG1   1 
ATOM   5874  C  CG2   . ILE C 1  81  ? -7.499  67.213  19.675 1.00 149.36 ? 489 ILE D CG2   1 
ATOM   5875  C  CD1   . ILE C 1  81  ? -6.886  69.862  21.727 1.00 160.88 ? 489 ILE D CD1   1 
ATOM   5876  N  N     . GLY C 1  82  ? -9.734  69.159  17.082 1.00 164.55 ? 490 GLY D N     1 
ATOM   5877  C  CA    . GLY C 1  82  ? -11.038 69.697  16.770 1.00 156.70 ? 490 GLY D CA    1 
ATOM   5878  C  C     . GLY C 1  82  ? -10.922 70.778  15.719 1.00 153.97 ? 490 GLY D C     1 
ATOM   5879  O  O     . GLY C 1  82  ? -10.512 70.500  14.585 1.00 156.04 ? 490 GLY D O     1 
ATOM   5880  N  N     . GLY C 1  83  ? -11.208 72.025  16.108 1.00 152.26 ? 491 GLY D N     1 
ATOM   5881  C  CA    . GLY C 1  83  ? -11.257 73.123  15.149 1.00 153.70 ? 491 GLY D CA    1 
ATOM   5882  C  C     . GLY C 1  83  ? -9.936  73.472  14.478 1.00 148.21 ? 491 GLY D C     1 
ATOM   5883  O  O     . GLY C 1  83  ? -9.931  73.998  13.361 1.00 146.35 ? 491 GLY D O     1 
ATOM   5884  N  N     . ASP C 1  84  ? -8.804  73.220  15.137 1.00 149.69 ? 492 ASP D N     1 
ATOM   5885  C  CA    . ASP C 1  84  ? -7.500  73.546  14.551 1.00 154.29 ? 492 ASP D CA    1 
ATOM   5886  C  C     . ASP C 1  84  ? -6.892  72.386  13.759 1.00 159.59 ? 492 ASP D C     1 
ATOM   5887  O  O     . ASP C 1  84  ? -5.681  72.397  13.486 1.00 156.00 ? 492 ASP D O     1 
ATOM   5888  C  CB    . ASP C 1  84  ? -6.526  74.031  15.631 1.00 147.19 ? 492 ASP D CB    1 
ATOM   5889  C  CG    . ASP C 1  84  ? -7.109  75.149  16.478 1.00 136.47 ? 492 ASP D CG    1 
ATOM   5890  O  OD1   . ASP C 1  84  ? -8.339  75.122  16.733 1.00 133.78 ? 492 ASP D OD1   1 
ATOM   5891  O  OD2   . ASP C 1  84  ? -6.344  76.056  16.877 1.00 133.96 ? 492 ASP D OD2   1 
ATOM   5892  N  N     . PHE C 1  85  ? -7.709  71.414  13.366 1.00 165.20 ? 493 PHE D N     1 
ATOM   5893  C  CA    . PHE C 1  85  ? -7.235  70.200  12.709 1.00 164.35 ? 493 PHE D CA    1 
ATOM   5894  C  C     . PHE C 1  85  ? -6.686  70.474  11.314 1.00 158.39 ? 493 PHE D C     1 
ATOM   5895  O  O     . PHE C 1  85  ? -7.383  71.030  10.464 1.00 154.49 ? 493 PHE D O     1 
ATOM   5896  C  CB    . PHE C 1  85  ? -8.373  69.189  12.632 1.00 163.16 ? 493 PHE D CB    1 
ATOM   5897  C  CG    . PHE C 1  85  ? -7.916  67.811  12.299 1.00 162.68 ? 493 PHE D CG    1 
ATOM   5898  C  CD1   . PHE C 1  85  ? -7.153  67.071  13.167 1.00 158.80 ? 493 PHE D CD1   1 
ATOM   5899  C  CD2   . PHE C 1  85  ? -8.188  67.271  11.084 1.00 168.43 ? 493 PHE D CD2   1 
ATOM   5900  C  CE1   . PHE C 1  85  ? -6.738  65.782  12.828 1.00 160.85 ? 493 PHE D CE1   1 
ATOM   5901  C  CE2   . PHE C 1  85  ? -7.766  65.969  10.763 1.00 168.73 ? 493 PHE D CE2   1 
ATOM   5902  C  CZ    . PHE C 1  85  ? -7.078  65.237  11.630 1.00 165.58 ? 493 PHE D CZ    1 
ATOM   5903  N  N     . ASP C 1  86  ? -5.458  70.021  11.061 1.00 155.40 ? 494 ASP D N     1 
ATOM   5904  C  CA    . ASP C 1  86  ? -4.808  70.171  9.758  1.00 153.40 ? 494 ASP D CA    1 
ATOM   5905  C  C     . ASP C 1  86  ? -4.391  68.805  9.221  1.00 151.10 ? 494 ASP D C     1 
ATOM   5906  O  O     . ASP C 1  86  ? -3.324  68.307  9.578  1.00 153.12 ? 494 ASP D O     1 
ATOM   5907  C  CB    . ASP C 1  86  ? -3.592  71.079  9.873  1.00 152.47 ? 494 ASP D CB    1 
ATOM   5908  C  CG    . ASP C 1  86  ? -3.147  71.626  8.534  1.00 155.05 ? 494 ASP D CG    1 
ATOM   5909  O  OD1   . ASP C 1  86  ? -3.494  71.046  7.477  1.00 157.29 ? 494 ASP D OD1   1 
ATOM   5910  O  OD2   . ASP C 1  86  ? -2.457  72.660  8.556  1.00 159.69 ? 494 ASP D OD2   1 
ATOM   5911  N  N     . LEU C 1  87  ? -5.211  68.200  8.366  1.00 153.40 ? 495 LEU D N     1 
ATOM   5912  C  CA    . LEU C 1  87  ? -4.898  66.867  7.839  1.00 153.93 ? 495 LEU D CA    1 
ATOM   5913  C  C     . LEU C 1  87  ? -3.623  66.866  7.001  1.00 151.63 ? 495 LEU D C     1 
ATOM   5914  O  O     . LEU C 1  87  ? -3.020  65.803  6.783  1.00 143.93 ? 495 LEU D O     1 
ATOM   5915  C  CB    . LEU C 1  87  ? -6.053  66.339  7.028  1.00 159.02 ? 495 LEU D CB    1 
ATOM   5916  C  CG    . LEU C 1  87  ? -5.843  64.877  6.688  1.00 165.31 ? 495 LEU D CG    1 
ATOM   5917  C  CD1   . LEU C 1  87  ? -5.946  64.065  7.964  1.00 162.84 ? 495 LEU D CD1   1 
ATOM   5918  C  CD2   . LEU C 1  87  ? -6.796  64.423  5.635  1.00 168.72 ? 495 LEU D CD2   1 
ATOM   5919  N  N     . ALA C 1  88  ? -3.243  68.034  6.493  1.00 159.73 ? 496 ALA D N     1 
ATOM   5920  C  CA    . ALA C 1  88  ? -1.949  68.266  5.865  1.00 162.01 ? 496 ALA D CA    1 
ATOM   5921  C  C     . ALA C 1  88  ? -0.819  68.353  6.888  1.00 162.38 ? 496 ALA D C     1 
ATOM   5922  O  O     . ALA C 1  88  ? 0.357   68.219  6.520  1.00 164.54 ? 496 ALA D O     1 
ATOM   5923  C  CB    . ALA C 1  88  ? -2.021  69.532  5.028  1.00 160.81 ? 496 ALA D CB    1 
ATOM   5924  N  N     . LYS C 1  89  ? -1.138  68.575  8.164  1.00 158.18 ? 497 LYS D N     1 
ATOM   5925  C  CA    . LYS C 1  89  ? -0.134  68.585  9.219  1.00 155.19 ? 497 LYS D CA    1 
ATOM   5926  C  C     . LYS C 1  89  ? 0.041   67.215  9.844  1.00 161.37 ? 497 LYS D C     1 
ATOM   5927  O  O     . LYS C 1  89  ? 0.954   67.038  10.669 1.00 160.21 ? 497 LYS D O     1 
ATOM   5928  C  CB    . LYS C 1  89  ? -0.493  69.615  10.291 1.00 148.26 ? 497 LYS D CB    1 
ATOM   5929  N  N     . ALA C 1  90  ? -0.818  66.260  9.479  1.00 165.77 ? 498 ALA D N     1 
ATOM   5930  C  CA    . ALA C 1  90  ? -0.719  64.894  9.967  1.00 159.41 ? 498 ALA D CA    1 
ATOM   5931  C  C     . ALA C 1  90  ? 0.688   64.369  9.757  1.00 161.27 ? 498 ALA D C     1 
ATOM   5932  O  O     . ALA C 1  90  ? 1.206   64.343  8.636  1.00 168.19 ? 498 ALA D O     1 
ATOM   5933  C  CB    . ALA C 1  90  ? -1.742  63.978  9.293  1.00 153.17 ? 498 ALA D CB    1 
ATOM   5934  N  N     . ARG C 1  91  ? 1.293   63.966  10.867 1.00 151.41 ? 499 ARG D N     1 
ATOM   5935  C  CA    . ARG C 1  91  ? 2.667   63.491  10.899 1.00 148.03 ? 499 ARG D CA    1 
ATOM   5936  C  C     . ARG C 1  91  ? 2.788   62.097  10.323 1.00 147.26 ? 499 ARG D C     1 
ATOM   5937  O  O     . ARG C 1  91  ? 3.874   61.705  9.869  1.00 148.71 ? 499 ARG D O     1 
ATOM   5938  C  CB    . ARG C 1  91  ? 3.135   63.532  12.334 1.00 142.01 ? 499 ARG D CB    1 
ATOM   5939  C  CG    . ARG C 1  91  ? 3.664   64.851  12.692 1.00 144.06 ? 499 ARG D CG    1 
ATOM   5940  C  CD    . ARG C 1  91  ? 5.145   64.712  12.718 1.00 152.12 ? 499 ARG D CD    1 
ATOM   5941  N  NE    . ARG C 1  91  ? 5.528   63.916  13.877 1.00 155.36 ? 499 ARG D NE    1 
ATOM   5942  C  CZ    . ARG C 1  91  ? 6.772   63.542  14.154 1.00 152.60 ? 499 ARG D CZ    1 
ATOM   5943  N  NH1   . ARG C 1  91  ? 7.765   63.883  13.337 1.00 150.43 ? 499 ARG D NH1   1 
ATOM   5944  N  NH2   . ARG C 1  91  ? 7.022   62.826  15.247 1.00 145.34 ? 499 ARG D NH2   1 
ATOM   5945  N  N     . TYR C 1  92  ? 1.713   61.338  10.362 1.00 141.93 ? 500 TYR D N     1 
ATOM   5946  C  CA    . TYR C 1  92  ? 1.687   59.975  9.878  1.00 143.28 ? 500 TYR D CA    1 
ATOM   5947  C  C     . TYR C 1  92  ? 0.479   59.817  8.977  1.00 140.03 ? 500 TYR D C     1 
ATOM   5948  O  O     . TYR C 1  92  ? -0.558  60.445  9.193  1.00 133.05 ? 500 TYR D O     1 
ATOM   5949  C  CB    . TYR C 1  92  ? 1.633   58.968  11.032 1.00 146.74 ? 500 TYR D CB    1 
ATOM   5950  C  CG    . TYR C 1  92  ? 2.823   59.056  11.953 1.00 149.43 ? 500 TYR D CG    1 
ATOM   5951  C  CD1   . TYR C 1  92  ? 2.871   59.994  12.981 1.00 150.97 ? 500 TYR D CD1   1 
ATOM   5952  C  CD2   . TYR C 1  92  ? 3.903   58.203  11.790 1.00 153.49 ? 500 TYR D CD2   1 
ATOM   5953  C  CE1   . TYR C 1  92  ? 3.964   60.074  13.822 1.00 152.30 ? 500 TYR D CE1   1 
ATOM   5954  C  CE2   . TYR C 1  92  ? 4.999   58.271  12.624 1.00 158.27 ? 500 TYR D CE2   1 
ATOM   5955  C  CZ    . TYR C 1  92  ? 5.026   59.209  13.641 1.00 156.45 ? 500 TYR D CZ    1 
ATOM   5956  O  OH    . TYR C 1  92  ? 6.117   59.286  14.480 1.00 154.57 ? 500 TYR D OH    1 
ATOM   5957  N  N     . HIS C 1  93  ? 0.633   59.016  7.938  1.00 147.73 ? 501 HIS D N     1 
ATOM   5958  C  CA    . HIS C 1  93  ? -0.492  58.733  7.066  1.00 157.55 ? 501 HIS D CA    1 
ATOM   5959  C  C     . HIS C 1  93  ? -1.140  57.418  7.415  1.00 157.02 ? 501 HIS D C     1 
ATOM   5960  O  O     . HIS C 1  93  ? -2.102  57.014  6.761  1.00 155.93 ? 501 HIS D O     1 
ATOM   5961  C  CB    . HIS C 1  93  ? -0.050  58.734  5.607  1.00 165.83 ? 501 HIS D CB    1 
ATOM   5962  C  CG    . HIS C 1  93  ? -0.055  60.095  4.987  1.00 171.14 ? 501 HIS D CG    1 
ATOM   5963  N  ND1   . HIS C 1  93  ? -0.963  60.466  4.020  1.00 172.30 ? 501 HIS D ND1   1 
ATOM   5964  C  CD2   . HIS C 1  93  ? 0.717   61.184  5.217  1.00 172.08 ? 501 HIS D CD2   1 
ATOM   5965  C  CE1   . HIS C 1  93  ? -0.741  61.720  3.668  1.00 175.68 ? 501 HIS D CE1   1 
ATOM   5966  N  NE2   . HIS C 1  93  ? 0.273   62.180  4.380  1.00 174.39 ? 501 HIS D NE2   1 
ATOM   5967  N  N     . LYS C 1  94  ? -0.592  56.721  8.392  1.00 155.66 ? 502 LYS D N     1 
ATOM   5968  C  CA    . LYS C 1  94  ? -1.136  55.477  8.887  1.00 151.60 ? 502 LYS D CA    1 
ATOM   5969  C  C     . LYS C 1  94  ? -1.101  55.588  10.396 1.00 153.44 ? 502 LYS D C     1 
ATOM   5970  O  O     . LYS C 1  94  ? -0.077  55.979  10.970 1.00 158.44 ? 502 LYS D O     1 
ATOM   5971  C  CB    . LYS C 1  94  ? -0.328  54.281  8.398  1.00 147.25 ? 502 LYS D CB    1 
ATOM   5972  C  CG    . LYS C 1  94  ? -0.759  53.751  7.042  1.00 144.58 ? 502 LYS D CG    1 
ATOM   5973  C  CD    . LYS C 1  94  ? 0.102   52.585  6.600  1.00 141.58 ? 502 LYS D CD    1 
ATOM   5974  C  CE    . LYS C 1  94  ? -0.503  51.817  5.453  1.00 137.39 ? 502 LYS D CE    1 
ATOM   5975  N  NZ    . LYS C 1  94  ? -0.541  52.626  4.203  1.00 128.42 ? 502 LYS D NZ    1 
ATOM   5976  N  N     . ILE C 1  95  ? -2.236  55.327  11.027 1.00 152.62 ? 503 ILE D N     1 
ATOM   5977  C  CA    . ILE C 1  95  ? -2.337  55.294  12.478 1.00 143.89 ? 503 ILE D CA    1 
ATOM   5978  C  C     . ILE C 1  95  ? -2.840  53.916  12.833 1.00 135.72 ? 503 ILE D C     1 
ATOM   5979  O  O     . ILE C 1  95  ? -3.933  53.523  12.403 1.00 136.18 ? 503 ILE D O     1 
ATOM   5980  C  CB    . ILE C 1  95  ? -3.301  56.345  13.037 1.00 137.83 ? 503 ILE D CB    1 
ATOM   5981  C  CG1   . ILE C 1  95  ? -2.652  57.725  13.085 1.00 140.10 ? 503 ILE D CG1   1 
ATOM   5982  C  CG2   . ILE C 1  95  ? -3.765  55.915  14.414 1.00 128.80 ? 503 ILE D CG2   1 
ATOM   5983  C  CD1   . ILE C 1  95  ? -2.548  58.378  11.738 1.00 146.54 ? 503 ILE D CD1   1 
ATOM   5984  N  N     . VAL C 1  96  ? -2.062  53.173  13.601 1.00 128.76 ? 504 VAL D N     1 
ATOM   5985  C  CA    . VAL C 1  96  ? -2.416  51.792  13.876 1.00 126.81 ? 504 VAL D CA    1 
ATOM   5986  C  C     . VAL C 1  96  ? -2.764  51.647  15.341 1.00 127.47 ? 504 VAL D C     1 
ATOM   5987  O  O     . VAL C 1  96  ? -1.976  52.009  16.223 1.00 135.07 ? 504 VAL D O     1 
ATOM   5988  C  CB    . VAL C 1  96  ? -1.317  50.811  13.464 1.00 123.25 ? 504 VAL D CB    1 
ATOM   5989  C  CG1   . VAL C 1  96  ? -1.929  49.431  13.383 1.00 122.51 ? 504 VAL D CG1   1 
ATOM   5990  C  CG2   . VAL C 1  96  ? -0.743  51.232  12.141 1.00 125.98 ? 504 VAL D CG2   1 
ATOM   5991  N  N     . ILE C 1  97  ? -3.939  51.099  15.584 1.00 122.49 ? 505 ILE D N     1 
ATOM   5992  C  CA    . ILE C 1  97  ? -4.380  50.737  16.915 1.00 122.18 ? 505 ILE D CA    1 
ATOM   5993  C  C     . ILE C 1  97  ? -4.002  49.277  17.108 1.00 131.13 ? 505 ILE D C     1 
ATOM   5994  O  O     . ILE C 1  97  ? -4.547  48.387  16.441 1.00 138.39 ? 505 ILE D O     1 
ATOM   5995  C  CB    . ILE C 1  97  ? -5.882  50.963  17.074 1.00 119.37 ? 505 ILE D CB    1 
ATOM   5996  C  CG1   . ILE C 1  97  ? -6.242  52.367  16.603 1.00 112.07 ? 505 ILE D CG1   1 
ATOM   5997  C  CG2   . ILE C 1  97  ? -6.292  50.751  18.503 1.00 134.13 ? 505 ILE D CG2   1 
ATOM   5998  C  CD1   . ILE C 1  97  ? -7.694  52.671  16.776 1.00 107.95 ? 505 ILE D CD1   1 
ATOM   5999  N  N     . MET C 1  98  ? -3.043  49.022  17.987 1.00 125.52 ? 506 MET D N     1 
ATOM   6000  C  CA    . MET C 1  98  ? -2.526  47.678  18.207 1.00 122.63 ? 506 MET D CA    1 
ATOM   6001  C  C     . MET C 1  98  ? -2.716  47.355  19.682 1.00 114.23 ? 506 MET D C     1 
ATOM   6002  O  O     . MET C 1  98  ? -2.065  47.952  20.546 1.00 119.44 ? 506 MET D O     1 
ATOM   6003  C  CB    . MET C 1  98  ? -1.063  47.596  17.770 1.00 131.96 ? 506 MET D CB    1 
ATOM   6004  C  CG    . MET C 1  98  ? -0.449  46.218  17.779 1.00 141.08 ? 506 MET D CG    1 
ATOM   6005  S  SD    . MET C 1  98  ? 1.073   46.109  16.808 1.00 149.02 ? 506 MET D SD    1 
ATOM   6006  C  CE    . MET C 1  98  ? 1.989   47.535  17.396 1.00 145.77 ? 506 MET D CE    1 
ATOM   6007  N  N     . THR C 1  99  ? -3.641  46.450  19.973 1.00 106.88 ? 507 THR D N     1 
ATOM   6008  C  CA    . THR C 1  99  ? -3.992  46.096  21.340 1.00 105.33 ? 507 THR D CA    1 
ATOM   6009  C  C     . THR C 1  99  ? -4.103  44.578  21.401 1.00 106.01 ? 507 THR D C     1 
ATOM   6010  O  O     . THR C 1  99  ? -4.220  43.911  20.369 1.00 115.05 ? 507 THR D O     1 
ATOM   6011  C  CB    . THR C 1  99  ? -5.314  46.750  21.763 1.00 112.04 ? 507 THR D CB    1 
ATOM   6012  O  OG1   . THR C 1  99  ? -6.356  46.304  20.899 1.00 118.45 ? 507 THR D OG1   1 
ATOM   6013  C  CG2   . THR C 1  99  ? -5.224  48.298  21.698 1.00 103.38 ? 507 THR D CG2   1 
ATOM   6014  N  N     . ASP C 1  100 ? -4.042  44.020  22.617 1.00 101.82 ? 508 ASP D N     1 
ATOM   6015  C  CA    . ASP C 1  100 ? -4.156  42.572  22.724 1.00 99.31  ? 508 ASP D CA    1 
ATOM   6016  C  C     . ASP C 1  100 ? -5.482  42.104  22.140 1.00 107.02 ? 508 ASP D C     1 
ATOM   6017  O  O     . ASP C 1  100 ? -6.488  42.807  22.198 1.00 109.36 ? 508 ASP D O     1 
ATOM   6018  C  CB    . ASP C 1  100 ? -4.055  42.126  24.170 1.00 97.86  ? 508 ASP D CB    1 
ATOM   6019  C  CG    . ASP C 1  100 ? -2.862  42.651  24.864 1.00 107.85 ? 508 ASP D CG    1 
ATOM   6020  O  OD1   . ASP C 1  100 ? -1.965  43.294  24.271 1.00 101.27 ? 508 ASP D OD1   1 
ATOM   6021  O  OD2   . ASP C 1  100 ? -2.859  42.354  26.056 1.00 127.93 ? 508 ASP D OD2   1 
ATOM   6022  N  N     . ALA C 1  101 ? -5.479  40.905  21.554 1.00 115.60 ? 509 ALA D N     1 
ATOM   6023  C  CA    . ALA C 1  101 ? -6.726  40.395  20.996 1.00 111.05 ? 509 ALA D CA    1 
ATOM   6024  C  C     . ALA C 1  101 ? -7.566  39.764  22.097 1.00 96.42  ? 509 ALA D C     1 
ATOM   6025  O  O     . ALA C 1  101 ? -8.055  38.641  21.948 1.00 96.34  ? 509 ALA D O     1 
ATOM   6026  C  CB    . ALA C 1  101 ? -6.468  39.400  19.858 1.00 124.01 ? 509 ALA D CB    1 
ATOM   6027  N  N     . ASP C 1  102 ? -7.695  40.470  23.222 1.00 99.07  ? 510 ASP D N     1 
ATOM   6028  C  CA    . ASP C 1  102 ? -8.529  40.079  24.354 1.00 98.38  ? 510 ASP D CA    1 
ATOM   6029  C  C     . ASP C 1  102 ? -9.642  41.111  24.562 1.00 107.75 ? 510 ASP D C     1 
ATOM   6030  O  O     . ASP C 1  102 ? -9.661  42.172  23.932 1.00 101.05 ? 510 ASP D O     1 
ATOM   6031  C  CB    . ASP C 1  102 ? -7.689  39.850  25.634 1.00 82.50  ? 510 ASP D CB    1 
ATOM   6032  C  CG    . ASP C 1  102 ? -6.690  40.992  25.961 1.00 86.57  ? 510 ASP D CG    1 
ATOM   6033  O  OD1   . ASP C 1  102 ? -6.998  42.182  25.740 1.00 79.01  ? 510 ASP D OD1   1 
ATOM   6034  O  OD2   . ASP C 1  102 ? -5.573  40.722  26.559 1.00 87.14  ? 510 ASP D OD2   1 
ATOM   6035  N  N     . VAL C 1  103 ? -10.609 40.760  25.421 1.00 115.84 ? 511 VAL D N     1 
ATOM   6036  C  CA    . VAL C 1  103 ? -11.780 41.613  25.640 1.00 104.51 ? 511 VAL D CA    1 
ATOM   6037  C  C     . VAL C 1  103 ? -11.387 42.991  26.156 1.00 93.66  ? 511 VAL D C     1 
ATOM   6038  O  O     . VAL C 1  103 ? -12.088 43.978  25.900 1.00 82.01  ? 511 VAL D O     1 
ATOM   6039  C  CB    . VAL C 1  103 ? -12.773 40.941  26.607 1.00 96.63  ? 511 VAL D CB    1 
ATOM   6040  C  CG1   . VAL C 1  103 ? -13.443 39.721  25.953 1.00 98.83  ? 511 VAL D CG1   1 
ATOM   6041  C  CG2   . VAL C 1  103 ? -12.065 40.583  27.931 1.00 86.07  ? 511 VAL D CG2   1 
ATOM   6042  N  N     . ASP C 1  104 ? -10.299 43.088  26.922 1.00 93.49  ? 512 ASP D N     1 
ATOM   6043  C  CA    . ASP C 1  104 ? -9.869  44.395  27.412 1.00 97.48  ? 512 ASP D CA    1 
ATOM   6044  C  C     . ASP C 1  104 ? -9.187  45.203  26.327 1.00 101.37 ? 512 ASP D C     1 
ATOM   6045  O  O     . ASP C 1  104 ? -9.231  46.442  26.338 1.00 99.34  ? 512 ASP D O     1 
ATOM   6046  C  CB    . ASP C 1  104 ? -8.902  44.236  28.582 1.00 100.39 ? 512 ASP D CB    1 
ATOM   6047  C  CG    . ASP C 1  104 ? -9.605  43.870  29.846 1.00 107.13 ? 512 ASP D CG    1 
ATOM   6048  O  OD1   . ASP C 1  104 ? -10.270 44.759  30.413 1.00 121.27 ? 512 ASP D OD1   1 
ATOM   6049  O  OD2   . ASP C 1  104 ? -9.497  42.693  30.250 1.00 97.52  ? 512 ASP D OD2   1 
ATOM   6050  N  N     . GLY C 1  105 ? -8.490  44.513  25.427 1.00 107.03 ? 513 GLY D N     1 
ATOM   6051  C  CA    . GLY C 1  105 ? -7.917  45.185  24.275 1.00 105.88 ? 513 GLY D CA    1 
ATOM   6052  C  C     . GLY C 1  105 ? -8.987  45.676  23.322 1.00 99.61  ? 513 GLY D C     1 
ATOM   6053  O  O     . GLY C 1  105 ? -8.820  46.702  22.661 1.00 104.39 ? 513 GLY D O     1 
ATOM   6054  N  N     . ALA C 1  106 ? -10.096 44.931  23.223 1.00 90.57  ? 514 ALA D N     1 
ATOM   6055  C  CA    . ALA C 1  106 ? -11.286 45.435  22.547 1.00 88.70  ? 514 ALA D CA    1 
ATOM   6056  C  C     . ALA C 1  106 ? -11.768 46.729  23.191 1.00 91.74  ? 514 ALA D C     1 
ATOM   6057  O  O     . ALA C 1  106 ? -12.179 47.665  22.492 1.00 92.39  ? 514 ALA D O     1 
ATOM   6058  C  CB    . ALA C 1  106 ? -12.383 44.381  22.571 1.00 88.45  ? 514 ALA D CB    1 
ATOM   6059  N  N     . HIS C 1  107 ? -11.746 46.795  24.523 1.00 99.29  ? 515 HIS D N     1 
ATOM   6060  C  CA    . HIS C 1  107 ? -12.262 47.979  25.206 1.00 93.30  ? 515 HIS D CA    1 
ATOM   6061  C  C     . HIS C 1  107 ? -11.419 49.203  24.890 1.00 92.79  ? 515 HIS D C     1 
ATOM   6062  O  O     . HIS C 1  107 ? -11.953 50.237  24.465 1.00 97.53  ? 515 HIS D O     1 
ATOM   6063  C  CB    . HIS C 1  107 ? -12.350 47.745  26.721 1.00 95.08  ? 515 HIS D CB    1 
ATOM   6064  C  CG    . HIS C 1  107 ? -13.069 48.840  27.452 1.00 92.83  ? 515 HIS D CG    1 
ATOM   6065  N  ND1   . HIS C 1  107 ? -12.700 49.273  28.709 1.00 92.30  ? 515 HIS D ND1   1 
ATOM   6066  C  CD2   . HIS C 1  107 ? -14.143 49.586  27.097 1.00 89.63  ? 515 HIS D CD2   1 
ATOM   6067  C  CE1   . HIS C 1  107 ? -13.518 50.238  29.096 1.00 90.80  ? 515 HIS D CE1   1 
ATOM   6068  N  NE2   . HIS C 1  107 ? -14.401 50.450  28.135 1.00 86.62  ? 515 HIS D NE2   1 
ATOM   6069  N  N     . ILE C 1  108 ? -10.095 49.089  25.066 1.00 100.18 ? 516 ILE D N     1 
ATOM   6070  C  CA    . ILE C 1  108 ? -9.175  50.199  24.795 1.00 110.89 ? 516 ILE D CA    1 
ATOM   6071  C  C     . ILE C 1  108 ? -9.394  50.734  23.391 1.00 112.98 ? 516 ILE D C     1 
ATOM   6072  O  O     . ILE C 1  108 ? -9.444  51.955  23.162 1.00 106.17 ? 516 ILE D O     1 
ATOM   6073  C  CB    . ILE C 1  108 ? -7.711  49.743  24.999 1.00 108.81 ? 516 ILE D CB    1 
ATOM   6074  C  CG1   . ILE C 1  108 ? -7.446  49.432  26.486 1.00 107.86 ? 516 ILE D CG1   1 
ATOM   6075  C  CG2   . ILE C 1  108 ? -6.709  50.767  24.402 1.00 108.06 ? 516 ILE D CG2   1 
ATOM   6076  C  CD1   . ILE C 1  108 ? -6.125  48.741  26.798 1.00 104.22 ? 516 ILE D CD1   1 
ATOM   6077  N  N     . ARG C 1  109 ? -9.576  49.818  22.440 1.00 111.91 ? 517 ARG D N     1 
ATOM   6078  C  CA    . ARG C 1  109 ? -9.854  50.190  21.059 1.00 107.14 ? 517 ARG D CA    1 
ATOM   6079  C  C     . ARG C 1  109 ? -11.108 51.047  20.937 1.00 102.85 ? 517 ARG D C     1 
ATOM   6080  O  O     . ARG C 1  109 ? -11.097 52.081  20.257 1.00 117.21 ? 517 ARG D O     1 
ATOM   6081  C  CB    . ARG C 1  109 ? -9.964  48.922  20.220 1.00 102.77 ? 517 ARG D CB    1 
ATOM   6082  C  CG    . ARG C 1  109 ? -10.066 49.168  18.747 1.00 108.85 ? 517 ARG D CG    1 
ATOM   6083  C  CD    . ARG C 1  109 ? -9.753  47.927  17.982 1.00 105.90 ? 517 ARG D CD    1 
ATOM   6084  N  NE    . ARG C 1  109 ? -10.655 46.833  18.315 1.00 93.58  ? 517 ARG D NE    1 
ATOM   6085  C  CZ    . ARG C 1  109 ? -10.228 45.709  18.875 1.00 91.25  ? 517 ARG D CZ    1 
ATOM   6086  N  NH1   . ARG C 1  109 ? -8.928  45.579  19.131 1.00 99.78  ? 517 ARG D NH1   1 
ATOM   6087  N  NH2   . ARG C 1  109 ? -11.074 44.719  19.167 1.00 89.33  ? 517 ARG D NH2   1 
ATOM   6088  N  N     . THR C 1  110 ? -12.203 50.639  21.584 1.00 94.02  ? 518 THR D N     1 
ATOM   6089  C  CA    . THR C 1  110 ? -13.423 51.441  21.502 1.00 96.32  ? 518 THR D CA    1 
ATOM   6090  C  C     . THR C 1  110 ? -13.189 52.847  22.027 1.00 98.65  ? 518 THR D C     1 
ATOM   6091  O  O     . THR C 1  110 ? -13.706 53.829  21.473 1.00 107.02 ? 518 THR D O     1 
ATOM   6092  C  CB    . THR C 1  110 ? -14.571 50.793  22.278 1.00 97.48  ? 518 THR D CB    1 
ATOM   6093  O  OG1   . THR C 1  110 ? -14.210 50.661  23.662 1.00 114.73 ? 518 THR D OG1   1 
ATOM   6094  C  CG2   . THR C 1  110 ? -14.925 49.440  21.681 1.00 94.62  ? 518 THR D CG2   1 
ATOM   6095  N  N     . LEU C 1  111 ? -12.416 52.961  23.102 1.00 96.01  ? 519 LEU D N     1 
ATOM   6096  C  CA    . LEU C 1  111 ? -12.114 54.270  23.661 1.00 96.24  ? 519 LEU D CA    1 
ATOM   6097  C  C     . LEU C 1  111 ? -11.282 55.107  22.701 1.00 97.19  ? 519 LEU D C     1 
ATOM   6098  O  O     . LEU C 1  111 ? -11.546 56.303  22.527 1.00 98.48  ? 519 LEU D O     1 
ATOM   6099  C  CB    . LEU C 1  111 ? -11.408 54.111  25.004 1.00 94.02  ? 519 LEU D CB    1 
ATOM   6100  C  CG    . LEU C 1  111 ? -12.171 53.452  26.153 1.00 84.54  ? 519 LEU D CG    1 
ATOM   6101  C  CD1   . LEU C 1  111 ? -11.256 53.347  27.357 1.00 83.18  ? 519 LEU D CD1   1 
ATOM   6102  C  CD2   . LEU C 1  111 ? -13.398 54.264  26.511 1.00 84.35  ? 519 LEU D CD2   1 
ATOM   6103  N  N     . LEU C 1  112 ? -10.272 54.510  22.072 1.00 99.57  ? 520 LEU D N     1 
ATOM   6104  C  CA    . LEU C 1  112 ? -9.455  55.276  21.136 1.00 104.01 ? 520 LEU D CA    1 
ATOM   6105  C  C     . LEU C 1  112 ? -10.270 55.736  19.937 1.00 111.02 ? 520 LEU D C     1 
ATOM   6106  O  O     . LEU C 1  112 ? -10.195 56.906  19.531 1.00 109.02 ? 520 LEU D O     1 
ATOM   6107  C  CB    . LEU C 1  112 ? -8.247  54.453  20.690 1.00 100.67 ? 520 LEU D CB    1 
ATOM   6108  C  CG    . LEU C 1  112 ? -7.184  54.334  21.769 1.00 96.38  ? 520 LEU D CG    1 
ATOM   6109  C  CD1   . LEU C 1  112 ? -6.033  53.480  21.276 1.00 101.42 ? 520 LEU D CD1   1 
ATOM   6110  C  CD2   . LEU C 1  112 ? -6.700  55.724  22.100 1.00 93.29  ? 520 LEU D CD2   1 
ATOM   6111  N  N     . LEU C 1  113 ? -11.065 54.830  19.366 1.00 112.28 ? 521 LEU D N     1 
ATOM   6112  C  CA    . LEU C 1  113 ? -11.973 55.211  18.289 1.00 110.88 ? 521 LEU D CA    1 
ATOM   6113  C  C     . LEU C 1  113 ? -12.907 56.342  18.718 1.00 110.59 ? 521 LEU D C     1 
ATOM   6114  O  O     . LEU C 1  113 ? -13.199 57.249  17.928 1.00 116.18 ? 521 LEU D O     1 
ATOM   6115  C  CB    . LEU C 1  113 ? -12.776 53.995  17.807 1.00 109.97 ? 521 LEU D CB    1 
ATOM   6116  C  CG    . LEU C 1  113 ? -12.041 52.892  17.020 1.00 112.19 ? 521 LEU D CG    1 
ATOM   6117  C  CD1   . LEU C 1  113 ? -12.993 51.807  16.544 1.00 116.97 ? 521 LEU D CD1   1 
ATOM   6118  C  CD2   . LEU C 1  113 ? -11.248 53.436  15.829 1.00 110.72 ? 521 LEU D CD2   1 
ATOM   6119  N  N     . THR C 1  114 ? -13.381 56.317  19.966 1.00 112.95 ? 522 THR D N     1 
ATOM   6120  C  CA    . THR C 1  114 ? -14.251 57.394  20.433 1.00 106.31 ? 522 THR D CA    1 
ATOM   6121  C  C     . THR C 1  114 ? -13.519 58.728  20.435 1.00 110.60 ? 522 THR D C     1 
ATOM   6122  O  O     . THR C 1  114 ? -14.094 59.758  20.066 1.00 113.83 ? 522 THR D O     1 
ATOM   6123  C  CB    . THR C 1  114 ? -14.809 57.106  21.831 1.00 101.41 ? 522 THR D CB    1 
ATOM   6124  O  OG1   . THR C 1  114 ? -15.569 55.894  21.830 1.00 98.62  ? 522 THR D OG1   1 
ATOM   6125  C  CG2   . THR C 1  114 ? -15.732 58.246  22.261 1.00 100.89 ? 522 THR D CG2   1 
ATOM   6126  N  N     . PHE C 1  115 ? -12.249 58.733  20.843 1.00 115.35 ? 523 PHE D N     1 
ATOM   6127  C  CA    . PHE C 1  115 ? -11.491 59.982  20.847 1.00 121.49 ? 523 PHE D CA    1 
ATOM   6128  C  C     . PHE C 1  115 ? -11.318 60.517  19.431 1.00 126.64 ? 523 PHE D C     1 
ATOM   6129  O  O     . PHE C 1  115 ? -11.561 61.703  19.168 1.00 131.96 ? 523 PHE D O     1 
ATOM   6130  C  CB    . PHE C 1  115 ? -10.140 59.787  21.554 1.00 117.13 ? 523 PHE D CB    1 
ATOM   6131  C  CG    . PHE C 1  115 ? -9.172  60.936  21.363 1.00 109.02 ? 523 PHE D CG    1 
ATOM   6132  C  CD1   . PHE C 1  115 ? -9.454  62.206  21.858 1.00 106.78 ? 523 PHE D CD1   1 
ATOM   6133  C  CD2   . PHE C 1  115 ? -7.968  60.736  20.696 1.00 111.91 ? 523 PHE D CD2   1 
ATOM   6134  C  CE1   . PHE C 1  115 ? -8.564  63.262  21.671 1.00 113.62 ? 523 PHE D CE1   1 
ATOM   6135  C  CE2   . PHE C 1  115 ? -7.078  61.777  20.510 1.00 122.17 ? 523 PHE D CE2   1 
ATOM   6136  C  CZ    . PHE C 1  115 ? -7.373  63.044  20.999 1.00 123.53 ? 523 PHE D CZ    1 
ATOM   6137  N  N     . PHE C 1  116 ? -10.942 59.647  18.493 1.00 121.95 ? 524 PHE D N     1 
ATOM   6138  C  CA    . PHE C 1  116 ? -10.782 60.088  17.110 1.00 117.99 ? 524 PHE D CA    1 
ATOM   6139  C  C     . PHE C 1  116 ? -12.095 60.603  16.525 1.00 123.87 ? 524 PHE D C     1 
ATOM   6140  O  O     . PHE C 1  116 ? -12.121 61.649  15.865 1.00 135.37 ? 524 PHE D O     1 
ATOM   6141  C  CB    . PHE C 1  116 ? -10.208 58.953  16.258 1.00 115.98 ? 524 PHE D CB    1 
ATOM   6142  C  CG    . PHE C 1  116 ? -8.921  58.398  16.787 1.00 117.66 ? 524 PHE D CG    1 
ATOM   6143  C  CD1   . PHE C 1  116 ? -8.052  59.207  17.502 1.00 111.35 ? 524 PHE D CD1   1 
ATOM   6144  C  CD2   . PHE C 1  116 ? -8.590  57.066  16.595 1.00 124.08 ? 524 PHE D CD2   1 
ATOM   6145  C  CE1   . PHE C 1  116 ? -6.873  58.709  18.011 1.00 112.62 ? 524 PHE D CE1   1 
ATOM   6146  C  CE2   . PHE C 1  116 ? -7.411  56.559  17.099 1.00 121.83 ? 524 PHE D CE2   1 
ATOM   6147  C  CZ    . PHE C 1  116 ? -6.548  57.380  17.809 1.00 116.73 ? 524 PHE D CZ    1 
ATOM   6148  N  N     . TYR C 1  117 ? -13.199 59.897  16.772 1.00 123.96 ? 525 TYR D N     1 
ATOM   6149  C  CA    . TYR C 1  117 ? -14.480 60.291  16.182 1.00 125.98 ? 525 TYR D CA    1 
ATOM   6150  C  C     . TYR C 1  117 ? -15.028 61.593  16.756 1.00 122.22 ? 525 TYR D C     1 
ATOM   6151  O  O     . TYR C 1  117 ? -15.943 62.185  16.167 1.00 124.51 ? 525 TYR D O     1 
ATOM   6152  C  CB    . TYR C 1  117 ? -15.532 59.191  16.344 1.00 123.37 ? 525 TYR D CB    1 
ATOM   6153  C  CG    . TYR C 1  117 ? -16.852 59.497  15.652 1.00 125.10 ? 525 TYR D CG    1 
ATOM   6154  C  CD1   . TYR C 1  117 ? -17.859 60.202  16.304 1.00 128.61 ? 525 TYR D CD1   1 
ATOM   6155  C  CD2   . TYR C 1  117 ? -17.087 59.082  14.348 1.00 129.94 ? 525 TYR D CD2   1 
ATOM   6156  C  CE1   . TYR C 1  117 ? -19.042 60.502  15.673 1.00 133.91 ? 525 TYR D CE1   1 
ATOM   6157  C  CE2   . TYR C 1  117 ? -18.285 59.365  13.716 1.00 134.05 ? 525 TYR D CE2   1 
ATOM   6158  C  CZ    . TYR C 1  117 ? -19.261 60.077  14.383 1.00 134.24 ? 525 TYR D CZ    1 
ATOM   6159  O  OH    . TYR C 1  117 ? -20.448 60.374  13.749 1.00 137.20 ? 525 TYR D OH    1 
ATOM   6160  N  N     . ARG C 1  118 ? -14.533 62.061  17.891 1.00 110.82 ? 526 ARG D N     1 
ATOM   6161  C  CA    . ARG C 1  118 ? -15.049 63.313  18.426 1.00 110.80 ? 526 ARG D CA    1 
ATOM   6162  C  C     . ARG C 1  118 ? -14.087 64.478  18.326 1.00 120.03 ? 526 ARG D C     1 
ATOM   6163  O  O     . ARG C 1  118 ? -14.524 65.629  18.414 1.00 133.97 ? 526 ARG D O     1 
ATOM   6164  C  CB    . ARG C 1  118 ? -15.464 63.146  19.891 1.00 112.89 ? 526 ARG D CB    1 
ATOM   6165  C  CG    . ARG C 1  118 ? -16.619 62.203  20.085 1.00 115.48 ? 526 ARG D CG    1 
ATOM   6166  C  CD    . ARG C 1  118 ? -17.838 62.521  19.199 1.00 122.76 ? 526 ARG D CD    1 
ATOM   6167  N  NE    . ARG C 1  118 ? -19.064 62.094  19.880 1.00 123.11 ? 526 ARG D NE    1 
ATOM   6168  C  CZ    . ARG C 1  118 ? -20.232 61.808  19.298 1.00 121.32 ? 526 ARG D CZ    1 
ATOM   6169  N  NH1   . ARG C 1  118 ? -20.400 61.892  17.981 1.00 129.74 ? 526 ARG D NH1   1 
ATOM   6170  N  NH2   . ARG C 1  118 ? -21.252 61.429  20.063 1.00 115.50 ? 526 ARG D NH2   1 
ATOM   6171  N  N     . PHE C 1  119 ? -12.804 64.232  18.169 1.00 119.43 ? 527 PHE D N     1 
ATOM   6172  C  CA    . PHE C 1  119 ? -11.854 65.326  18.162 1.00 119.71 ? 527 PHE D CA    1 
ATOM   6173  C  C     . PHE C 1  119 ? -10.951 65.339  16.949 1.00 120.08 ? 527 PHE D C     1 
ATOM   6174  O  O     . PHE C 1  119 ? -10.222 66.324  16.760 1.00 131.24 ? 527 PHE D O     1 
ATOM   6175  C  CB    . PHE C 1  119 ? -11.015 65.303  19.455 1.00 119.32 ? 527 PHE D CB    1 
ATOM   6176  C  CG    . PHE C 1  119 ? -11.793 65.680  20.674 1.00 108.31 ? 527 PHE D CG    1 
ATOM   6177  C  CD1   . PHE C 1  119 ? -12.500 64.729  21.384 1.00 107.54 ? 527 PHE D CD1   1 
ATOM   6178  C  CD2   . PHE C 1  119 ? -11.849 66.998  21.084 1.00 107.02 ? 527 PHE D CD2   1 
ATOM   6179  C  CE1   . PHE C 1  119 ? -13.235 65.080  22.505 1.00 105.45 ? 527 PHE D CE1   1 
ATOM   6180  C  CE2   . PHE C 1  119 ? -12.585 67.358  22.211 1.00 104.34 ? 527 PHE D CE2   1 
ATOM   6181  C  CZ    . PHE C 1  119 ? -13.282 66.396  22.918 1.00 104.13 ? 527 PHE D CZ    1 
ATOM   6182  N  N     . MET C 1  120 ? -10.983 64.301  16.119 1.00 123.14 ? 528 MET D N     1 
ATOM   6183  C  CA    . MET C 1  120 ? -10.113 64.166  14.955 1.00 131.78 ? 528 MET D CA    1 
ATOM   6184  C  C     . MET C 1  120 ? -10.880 63.349  13.909 1.00 136.37 ? 528 MET D C     1 
ATOM   6185  O  O     . MET C 1  120 ? -10.364 62.406  13.304 1.00 140.72 ? 528 MET D O     1 
ATOM   6186  C  CB    . MET C 1  120 ? -8.782  63.531  15.339 1.00 136.64 ? 528 MET D CB    1 
ATOM   6187  C  CG    . MET C 1  120 ? -8.108  64.229  16.524 1.00 136.29 ? 528 MET D CG    1 
ATOM   6188  S  SD    . MET C 1  120 ? -6.598  63.427  16.990 1.00 138.44 ? 528 MET D SD    1 
ATOM   6189  C  CE    . MET C 1  120 ? -5.918  64.565  18.191 1.00 137.96 ? 528 MET D CE    1 
ATOM   6190  N  N     . ARG C 1  121 ? -12.174 63.666  13.781 1.00 137.79 ? 529 ARG D N     1 
ATOM   6191  C  CA    . ARG C 1  121 ? -13.037 63.067  12.766 1.00 134.86 ? 529 ARG D CA    1 
ATOM   6192  C  C     . ARG C 1  121 ? -12.469 63.174  11.357 1.00 132.46 ? 529 ARG D C     1 
ATOM   6193  O  O     . ARG C 1  121 ? -12.668 62.240  10.555 1.00 124.38 ? 529 ARG D O     1 
ATOM   6194  C  CB    . ARG C 1  121 ? -14.399 63.772  12.860 1.00 138.90 ? 529 ARG D CB    1 
ATOM   6195  C  CG    . ARG C 1  121 ? -15.557 62.957  12.489 1.00 145.25 ? 529 ARG D CG    1 
ATOM   6196  C  CD    . ARG C 1  121 ? -16.792 63.610  13.012 1.00 151.01 ? 529 ARG D CD    1 
ATOM   6197  N  NE    . ARG C 1  121 ? -17.924 63.361  12.137 1.00 156.03 ? 529 ARG D NE    1 
ATOM   6198  C  CZ    . ARG C 1  121 ? -19.175 63.661  12.458 1.00 154.61 ? 529 ARG D CZ    1 
ATOM   6199  N  NH1   . ARG C 1  121 ? -19.432 64.215  13.638 1.00 153.20 ? 529 ARG D NH1   1 
ATOM   6200  N  NH2   . ARG C 1  121 ? -20.165 63.408  11.611 1.00 151.71 ? 529 ARG D NH2   1 
ATOM   6201  N  N     . PRO C 1  122 ? -11.809 64.270  10.995 1.00 142.06 ? 530 PRO D N     1 
ATOM   6202  C  CA    . PRO C 1  122 ? -11.258 64.405  9.638  1.00 150.69 ? 530 PRO D CA    1 
ATOM   6203  C  C     . PRO C 1  122 ? -10.273 63.332  9.206  1.00 159.54 ? 530 PRO D C     1 
ATOM   6204  O  O     . PRO C 1  122 ? -10.093 63.117  8.002  1.00 161.97 ? 530 PRO D O     1 
ATOM   6205  C  CB    . PRO C 1  122 ? -10.575 65.766  9.739  1.00 141.57 ? 530 PRO D CB    1 
ATOM   6206  C  CG    . PRO C 1  122 ? -11.172 66.448  10.946 1.00 136.45 ? 530 PRO D CG    1 
ATOM   6207  C  CD    . PRO C 1  122 ? -11.945 65.573  11.679 1.00 140.28 ? 530 PRO D CD    1 
ATOM   6208  N  N     . LEU C 1  123 ? -9.616  62.667  10.170 1.00 155.06 ? 531 LEU D N     1 
ATOM   6209  C  CA    . LEU C 1  123 ? -8.662  61.592  9.899  1.00 142.48 ? 531 LEU D CA    1 
ATOM   6210  C  C     . LEU C 1  123 ? -9.362  60.289  9.548  1.00 134.38 ? 531 LEU D C     1 
ATOM   6211  O  O     . LEU C 1  123 ? -8.809  59.444  8.836  1.00 123.86 ? 531 LEU D O     1 
ATOM   6212  C  CB    . LEU C 1  123 ? -7.755  61.415  11.112 1.00 132.29 ? 531 LEU D CB    1 
ATOM   6213  C  CG    . LEU C 1  123 ? -6.557  60.452  11.074 1.00 136.58 ? 531 LEU D CG    1 
ATOM   6214  C  CD1   . LEU C 1  123 ? -6.180  59.994  9.683  1.00 140.96 ? 531 LEU D CD1   1 
ATOM   6215  C  CD2   . LEU C 1  123 ? -5.341  61.130  11.681 1.00 143.98 ? 531 LEU D CD2   1 
ATOM   6216  N  N     . ILE C 1  124 ? -10.551 60.070  10.068 1.00 143.73 ? 532 ILE D N     1 
ATOM   6217  C  CA    . ILE C 1  124 ? -11.238 58.823  9.750  1.00 156.48 ? 532 ILE D CA    1 
ATOM   6218  C  C     . ILE C 1  124 ? -11.760 58.863  8.327  1.00 160.28 ? 532 ILE D C     1 
ATOM   6219  O  O     . ILE C 1  124 ? -11.751 57.851  7.609  1.00 169.04 ? 532 ILE D O     1 
ATOM   6220  C  CB    . ILE C 1  124 ? -12.366 58.552  10.763 1.00 164.52 ? 532 ILE D CB    1 
ATOM   6221  C  CG1   . ILE C 1  124 ? -11.760 58.265  12.123 1.00 168.35 ? 532 ILE D CG1   1 
ATOM   6222  C  CG2   . ILE C 1  124 ? -13.232 57.398  10.304 1.00 160.03 ? 532 ILE D CG2   1 
ATOM   6223  C  CD1   . ILE C 1  124 ? -12.335 59.088  13.236 1.00 166.03 ? 532 ILE D CD1   1 
ATOM   6224  N  N     . GLU C 1  125 ? -12.234 60.028  7.906  1.00 149.94 ? 533 GLU D N     1 
ATOM   6225  C  CA    . GLU C 1  125 ? -12.630 60.221  6.519  1.00 142.07 ? 533 GLU D CA    1 
ATOM   6226  C  C     . GLU C 1  125 ? -11.430 60.076  5.595  1.00 136.84 ? 533 GLU D C     1 
ATOM   6227  O  O     . GLU C 1  125 ? -11.527 59.475  4.516  1.00 134.10 ? 533 GLU D O     1 
ATOM   6228  C  CB    . GLU C 1  125 ? -13.275 61.598  6.345  1.00 147.30 ? 533 GLU D CB    1 
ATOM   6229  C  CG    . GLU C 1  125 ? -14.693 61.711  6.890  1.00 149.83 ? 533 GLU D CG    1 
ATOM   6230  C  CD    . GLU C 1  125 ? -14.864 62.956  7.749  1.00 150.27 ? 533 GLU D CD    1 
ATOM   6231  O  OE1   . GLU C 1  125 ? -16.020 63.337  8.055  1.00 145.30 ? 533 GLU D OE1   1 
ATOM   6232  O  OE2   . GLU C 1  125 ? -13.827 63.552  8.114  1.00 153.74 ? 533 GLU D OE2   1 
ATOM   6233  N  N     . ALA C 1  126 ? -10.283 60.604  6.024  1.00 133.59 ? 534 ALA D N     1 
ATOM   6234  C  CA    . ALA C 1  126 ? -9.061  60.541  5.226  1.00 132.05 ? 534 ALA D CA    1 
ATOM   6235  C  C     . ALA C 1  126 ? -8.661  59.103  4.924  1.00 141.80 ? 534 ALA D C     1 
ATOM   6236  O  O     . ALA C 1  126 ? -8.251  58.788  3.799  1.00 142.57 ? 534 ALA D O     1 
ATOM   6237  C  CB    . ALA C 1  126 ? -7.930  61.280  5.943  1.00 122.62 ? 534 ALA D CB    1 
ATOM   6238  N  N     . GLY C 1  127 ? -8.742  58.224  5.913  1.00 144.82 ? 535 GLY D N     1 
ATOM   6239  C  CA    . GLY C 1  127 ? -8.436  56.822  5.717  1.00 137.88 ? 535 GLY D CA    1 
ATOM   6240  C  C     . GLY C 1  127 ? -7.115  56.347  6.270  1.00 136.65 ? 535 GLY D C     1 
ATOM   6241  O  O     . GLY C 1  127 ? -6.666  55.258  5.893  1.00 135.30 ? 535 GLY D O     1 
ATOM   6242  N  N     . TYR C 1  128 ? -6.482  57.104  7.153  1.00 144.68 ? 536 TYR D N     1 
ATOM   6243  C  CA    . TYR C 1  128 ? -5.209  56.700  7.738  1.00 147.11 ? 536 TYR D CA    1 
ATOM   6244  C  C     . TYR C 1  128 ? -5.356  55.925  9.038  1.00 142.43 ? 536 TYR D C     1 
ATOM   6245  O  O     . TYR C 1  128 ? -4.340  55.650  9.689  1.00 140.21 ? 536 TYR D O     1 
ATOM   6246  C  CB    . TYR C 1  128 ? -4.325  57.901  8.025  1.00 144.16 ? 536 TYR D CB    1 
ATOM   6247  C  CG    . TYR C 1  128 ? -4.205  58.936  6.934  1.00 147.66 ? 536 TYR D CG    1 
ATOM   6248  C  CD1   . TYR C 1  128 ? -4.414  58.632  5.582  1.00 150.32 ? 536 TYR D CD1   1 
ATOM   6249  C  CD2   . TYR C 1  128 ? -3.864  60.234  7.270  1.00 152.19 ? 536 TYR D CD2   1 
ATOM   6250  C  CE1   . TYR C 1  128 ? -4.311  59.616  4.618  1.00 156.35 ? 536 TYR D CE1   1 
ATOM   6251  C  CE2   . TYR C 1  128 ? -3.766  61.214  6.327  1.00 157.90 ? 536 TYR D CE2   1 
ATOM   6252  C  CZ    . TYR C 1  128 ? -3.986  60.908  5.002  1.00 159.57 ? 536 TYR D CZ    1 
ATOM   6253  O  OH    . TYR C 1  128 ? -3.881  61.903  4.061  1.00 164.87 ? 536 TYR D OH    1 
ATOM   6254  N  N     . VAL C 1  129 ? -6.569  55.629  9.479  1.00 136.78 ? 537 VAL D N     1 
ATOM   6255  C  CA    . VAL C 1  129 ? -6.760  54.937  10.744 1.00 123.50 ? 537 VAL D CA    1 
ATOM   6256  C  C     . VAL C 1  129 ? -6.883  53.454  10.464 1.00 118.65 ? 537 VAL D C     1 
ATOM   6257  O  O     . VAL C 1  129 ? -7.781  53.025  9.731  1.00 116.97 ? 537 VAL D O     1 
ATOM   6258  C  CB    . VAL C 1  129 ? -7.988  55.446  11.500 1.00 123.36 ? 537 VAL D CB    1 
ATOM   6259  C  CG1   . VAL C 1  129 ? -8.212  54.551  12.696 1.00 118.54 ? 537 VAL D CG1   1 
ATOM   6260  C  CG2   . VAL C 1  129 ? -7.771  56.875  11.933 1.00 126.13 ? 537 VAL D CG2   1 
ATOM   6261  N  N     . TYR C 1  130 ? -6.011  52.661  11.074 1.00 115.94 ? 538 TYR D N     1 
ATOM   6262  C  CA    . TYR C 1  130 ? -6.031  51.222  10.866 1.00 119.55 ? 538 TYR D CA    1 
ATOM   6263  C  C     . TYR C 1  130 ? -5.987  50.477  12.189 1.00 113.25 ? 538 TYR D C     1 
ATOM   6264  O  O     . TYR C 1  130 ? -5.434  50.956  13.185 1.00 114.32 ? 538 TYR D O     1 
ATOM   6265  C  CB    . TYR C 1  130 ? -4.873  50.751  9.982  1.00 128.02 ? 538 TYR D CB    1 
ATOM   6266  C  CG    . TYR C 1  130 ? -4.807  51.447  8.649  1.00 133.26 ? 538 TYR D CG    1 
ATOM   6267  C  CD1   . TYR C 1  130 ? -4.181  52.688  8.524  1.00 132.66 ? 538 TYR D CD1   1 
ATOM   6268  C  CD2   . TYR C 1  130 ? -5.360  50.867  7.514  1.00 135.50 ? 538 TYR D CD2   1 
ATOM   6269  C  CE1   . TYR C 1  130 ? -4.111  53.332  7.311  1.00 133.74 ? 538 TYR D CE1   1 
ATOM   6270  C  CE2   . TYR C 1  130 ? -5.293  51.503  6.287  1.00 136.70 ? 538 TYR D CE2   1 
ATOM   6271  C  CZ    . TYR C 1  130 ? -4.666  52.739  6.193  1.00 139.45 ? 538 TYR D CZ    1 
ATOM   6272  O  OH    . TYR C 1  130 ? -4.585  53.391  4.982  1.00 149.53 ? 538 TYR D OH    1 
ATOM   6273  N  N     . ILE C 1  131 ? -6.559  49.281  12.158 1.00 110.27 ? 539 ILE D N     1 
ATOM   6274  C  CA    . ILE C 1  131 ? -6.598  48.372  13.293 1.00 116.54 ? 539 ILE D CA    1 
ATOM   6275  C  C     . ILE C 1  131 ? -5.720  47.176  12.958 1.00 124.59 ? 539 ILE D C     1 
ATOM   6276  O  O     . ILE C 1  131 ? -6.013  46.430  12.013 1.00 128.48 ? 539 ILE D O     1 
ATOM   6277  C  CB    . ILE C 1  131 ? -8.024  47.906  13.588 1.00 114.18 ? 539 ILE D CB    1 
ATOM   6278  C  CG1   . ILE C 1  131 ? -8.960  49.105  13.722 1.00 113.37 ? 539 ILE D CG1   1 
ATOM   6279  C  CG2   . ILE C 1  131 ? -8.040  47.002  14.806 1.00 104.28 ? 539 ILE D CG2   1 
ATOM   6280  C  CD1   . ILE C 1  131 ? -10.396 48.722  13.514 1.00 117.61 ? 539 ILE D CD1   1 
ATOM   6281  N  N     . ALA C 1  132 ? -4.667  46.971  13.739 1.00 120.94 ? 540 ALA D N     1 
ATOM   6282  C  CA    . ALA C 1  132 ? -3.769  45.856  13.468 1.00 123.00 ? 540 ALA D CA    1 
ATOM   6283  C  C     . ALA C 1  132 ? -4.453  44.527  13.772 1.00 133.57 ? 540 ALA D C     1 
ATOM   6284  O  O     . ALA C 1  132 ? -5.398  44.450  14.560 1.00 135.71 ? 540 ALA D O     1 
ATOM   6285  C  CB    . ALA C 1  132 ? -2.480  45.995  14.279 1.00 120.00 ? 540 ALA D CB    1 
ATOM   6286  N  N     . GLN C 1  133 ? -3.955  43.455  13.155 1.00 145.62 ? 541 GLN D N     1 
ATOM   6287  C  CA    . GLN C 1  133 ? -4.505  42.122  13.407 1.00 148.53 ? 541 GLN D CA    1 
ATOM   6288  C  C     . GLN C 1  133 ? -3.401  41.176  13.885 1.00 154.64 ? 541 GLN D C     1 
ATOM   6289  O  O     . GLN C 1  133 ? -2.735  40.493  13.086 1.00 162.46 ? 541 GLN D O     1 
ATOM   6290  C  CB    . GLN C 1  133 ? -5.237  41.593  12.176 1.00 147.57 ? 541 GLN D CB    1 
ATOM   6291  C  CG    . GLN C 1  133 ? -6.437  42.460  11.806 1.00 142.22 ? 541 GLN D CG    1 
ATOM   6292  C  CD    . GLN C 1  133 ? -7.480  41.674  11.055 1.00 138.48 ? 541 GLN D CD    1 
ATOM   6293  O  OE1   . GLN C 1  133 ? -8.541  41.346  11.592 1.00 139.95 ? 541 GLN D OE1   1 
ATOM   6294  N  NE2   . GLN C 1  133 ? -7.178  41.348  9.804  1.00 135.87 ? 541 GLN D NE2   1 
ATOM   6295  N  N     . PRO C 1  134 ? -3.190  41.117  15.196 1.00 153.11 ? 542 PRO D N     1 
ATOM   6296  C  CA    . PRO C 1  134 ? -2.213  40.180  15.807 1.00 153.71 ? 542 PRO D CA    1 
ATOM   6297  C  C     . PRO C 1  134 ? -2.725  38.752  15.729 1.00 155.01 ? 542 PRO D C     1 
ATOM   6298  O  O     . PRO C 1  134 ? -3.924  38.559  15.494 1.00 155.84 ? 542 PRO D O     1 
ATOM   6299  C  CB    . PRO C 1  134 ? -2.151  40.665  17.264 1.00 158.66 ? 542 PRO D CB    1 
ATOM   6300  C  CG    . PRO C 1  134 ? -3.073  41.926  17.344 1.00 156.72 ? 542 PRO D CG    1 
ATOM   6301  C  CD    . PRO C 1  134 ? -3.973  41.881  16.171 1.00 151.02 ? 542 PRO D CD    1 
ATOM   6302  N  N     . PRO C 1  135 ? -1.894  37.723  15.939 1.00 153.08 ? 543 PRO D N     1 
ATOM   6303  C  CA    . PRO C 1  135 ? -2.453  36.365  16.006 1.00 149.62 ? 543 PRO D CA    1 
ATOM   6304  C  C     . PRO C 1  135 ? -3.525  36.305  17.089 1.00 149.39 ? 543 PRO D C     1 
ATOM   6305  O  O     . PRO C 1  135 ? -3.339  36.818  18.194 1.00 153.72 ? 543 PRO D O     1 
ATOM   6306  C  CB    . PRO C 1  135 ? -1.244  35.485  16.365 1.00 145.83 ? 543 PRO D CB    1 
ATOM   6307  C  CG    . PRO C 1  135 ? -0.040  36.269  16.016 1.00 147.44 ? 543 PRO D CG    1 
ATOM   6308  C  CD    . PRO C 1  135 ? -0.437  37.727  16.188 1.00 150.50 ? 543 PRO D CD    1 
ATOM   6309  N  N     . THR C 1  136 ? -4.681  35.710  16.773 1.00 146.05 ? 544 THR D N     1 
ATOM   6310  C  CA    . THR C 1  136 ? -5.614  35.449  17.868 1.00 145.57 ? 544 THR D CA    1 
ATOM   6311  C  C     . THR C 1  136 ? -5.093  34.295  18.723 1.00 149.15 ? 544 THR D C     1 
ATOM   6312  O  O     . THR C 1  136 ? -4.253  33.492  18.293 1.00 150.44 ? 544 THR D O     1 
ATOM   6313  C  CB    . THR C 1  136 ? -7.041  35.145  17.369 1.00 133.28 ? 544 THR D CB    1 
ATOM   6314  O  OG1   . THR C 1  136 ? -7.033  34.127  16.360 1.00 133.61 ? 544 THR D OG1   1 
ATOM   6315  C  CG2   . THR C 1  136 ? -7.760  36.411  16.853 1.00 123.81 ? 544 THR D CG2   1 
ATOM   6316  N  N     . GLY C 1  137 ? -5.570  34.237  19.960 1.00 143.75 ? 545 GLY D N     1 
ATOM   6317  C  CA    . GLY C 1  137 ? -5.086  33.250  20.911 1.00 150.51 ? 545 GLY D CA    1 
ATOM   6318  C  C     . GLY C 1  137 ? -5.201  33.759  22.338 1.00 157.98 ? 545 GLY D C     1 
ATOM   6319  O  O     . GLY C 1  137 ? -5.714  34.846  22.606 1.00 164.70 ? 545 GLY D O     1 
ATOM   6320  N  N     . TYR C 1  138 ? -4.739  32.912  23.266 1.00 154.11 ? 580 TYR D N     1 
ATOM   6321  C  CA    . TYR C 1  138 ? -4.595  33.295  24.674 1.00 152.56 ? 580 TYR D CA    1 
ATOM   6322  C  C     . TYR C 1  138 ? -3.463  34.290  24.867 1.00 152.43 ? 580 TYR D C     1 
ATOM   6323  O  O     . TYR C 1  138 ? -3.545  35.161  25.739 1.00 141.05 ? 580 TYR D O     1 
ATOM   6324  C  CB    . TYR C 1  138 ? -4.348  32.054  25.536 1.00 152.24 ? 580 TYR D CB    1 
ATOM   6325  C  CG    . TYR C 1  138 ? -3.650  30.922  24.804 1.00 148.89 ? 580 TYR D CG    1 
ATOM   6326  C  CD1   . TYR C 1  138 ? -4.364  30.089  23.946 1.00 149.85 ? 580 TYR D CD1   1 
ATOM   6327  C  CD2   . TYR C 1  138 ? -2.293  30.663  24.993 1.00 144.91 ? 580 TYR D CD2   1 
ATOM   6328  C  CE1   . TYR C 1  138 ? -3.755  29.058  23.279 1.00 151.70 ? 580 TYR D CE1   1 
ATOM   6329  C  CE2   . TYR C 1  138 ? -1.673  29.618  24.331 1.00 149.25 ? 580 TYR D CE2   1 
ATOM   6330  C  CZ    . TYR C 1  138 ? -2.412  28.821  23.477 1.00 153.83 ? 580 TYR D CZ    1 
ATOM   6331  O  OH    . TYR C 1  138 ? -1.806  27.780  22.814 1.00 158.63 ? 580 TYR D OH    1 
ATOM   6332  N  N     . LYS C 1  139 ? -2.387  34.151  24.095 1.00 160.04 ? 581 LYS D N     1 
ATOM   6333  C  CA    . LYS C 1  139 ? -1.222  35.005  24.269 1.00 153.65 ? 581 LYS D CA    1 
ATOM   6334  C  C     . LYS C 1  139 ? -1.547  36.446  23.905 1.00 148.09 ? 581 LYS D C     1 
ATOM   6335  O  O     . LYS C 1  139 ? -2.202  36.719  22.899 1.00 137.89 ? 581 LYS D O     1 
ATOM   6336  C  CB    . LYS C 1  139 ? -0.047  34.505  23.428 1.00 147.18 ? 581 LYS D CB    1 
ATOM   6337  C  CG    . LYS C 1  139 ? 0.672   33.316  24.025 1.00 145.04 ? 581 LYS D CG    1 
ATOM   6338  C  CD    . LYS C 1  139 ? 1.987   33.054  23.318 1.00 149.25 ? 581 LYS D CD    1 
ATOM   6339  C  CE    . LYS C 1  139 ? 2.604   31.751  23.786 1.00 148.76 ? 581 LYS D CE    1 
ATOM   6340  N  NZ    . LYS C 1  139 ? 2.708   31.698  25.272 1.00 145.19 ? 581 LYS D NZ    1 
ATOM   6341  N  N     . GLY C 1  140 ? -1.095  37.377  24.757 1.00 145.47 ? 582 GLY D N     1 
ATOM   6342  C  CA    . GLY C 1  140 ? -1.230  38.791  24.488 1.00 138.73 ? 582 GLY D CA    1 
ATOM   6343  C  C     . GLY C 1  140 ? -0.044  39.317  23.697 1.00 134.88 ? 582 GLY D C     1 
ATOM   6344  O  O     . GLY C 1  140 ? 0.839   38.573  23.280 1.00 136.09 ? 582 GLY D O     1 
ATOM   6345  N  N     . LEU C 1  141 ? -0.038  40.640  23.504 1.00 132.92 ? 583 LEU D N     1 
ATOM   6346  C  CA    . LEU C 1  141 ? 1.063   41.277  22.787 1.00 134.17 ? 583 LEU D CA    1 
ATOM   6347  C  C     . LEU C 1  141 ? 2.339   41.330  23.625 1.00 137.79 ? 583 LEU D C     1 
ATOM   6348  O  O     . LEU C 1  141 ? 3.446   41.206  23.085 1.00 139.84 ? 583 LEU D O     1 
ATOM   6349  C  CB    . LEU C 1  141 ? 0.652   42.682  22.337 1.00 126.64 ? 583 LEU D CB    1 
ATOM   6350  C  CG    . LEU C 1  141 ? -0.475  42.827  21.310 1.00 120.50 ? 583 LEU D CG    1 
ATOM   6351  C  CD1   . LEU C 1  141 ? -0.308  44.123  20.546 1.00 117.28 ? 583 LEU D CD1   1 
ATOM   6352  C  CD2   . LEU C 1  141 ? -0.552  41.633  20.360 1.00 116.23 ? 583 LEU D CD2   1 
ATOM   6353  N  N     . GLY C 1  142 ? 2.210   41.521  24.938 1.00 133.12 ? 584 GLY D N     1 
ATOM   6354  C  CA    . GLY C 1  142 ? 3.388   41.618  25.787 1.00 125.72 ? 584 GLY D CA    1 
ATOM   6355  C  C     . GLY C 1  142 ? 4.202   40.341  25.890 1.00 126.92 ? 584 GLY D C     1 
ATOM   6356  O  O     . GLY C 1  142 ? 5.424   40.388  26.087 1.00 134.86 ? 584 GLY D O     1 
ATOM   6357  N  N     . GLU C 1  143 ? 3.550   39.183  25.740 1.00 124.86 ? 585 GLU D N     1 
ATOM   6358  C  CA    . GLU C 1  143 ? 4.178   37.875  25.925 1.00 125.93 ? 585 GLU D CA    1 
ATOM   6359  C  C     . GLU C 1  143 ? 4.905   37.353  24.687 1.00 130.25 ? 585 GLU D C     1 
ATOM   6360  O  O     . GLU C 1  143 ? 5.482   36.259  24.756 1.00 117.13 ? 585 GLU D O     1 
ATOM   6361  C  CB    . GLU C 1  143 ? 3.125   36.861  26.372 1.00 120.43 ? 585 GLU D CB    1 
ATOM   6362  C  CG    . GLU C 1  143 ? 2.092   37.449  27.291 1.00 126.23 ? 585 GLU D CG    1 
ATOM   6363  C  CD    . GLU C 1  143 ? 1.185   36.394  27.877 1.00 126.04 ? 585 GLU D CD    1 
ATOM   6364  O  OE1   . GLU C 1  143 ? 1.589   35.207  27.873 1.00 118.69 ? 585 GLU D OE1   1 
ATOM   6365  O  OE2   . GLU C 1  143 ? 0.074   36.751  28.335 1.00 131.75 ? 585 GLU D OE2   1 
ATOM   6366  N  N     . MET C 1  144 ? 4.903   38.078  23.574 1.00 137.80 ? 586 MET D N     1 
ATOM   6367  C  CA    . MET C 1  144 ? 5.545   37.629  22.344 1.00 134.71 ? 586 MET D CA    1 
ATOM   6368  C  C     . MET C 1  144 ? 6.892   38.313  22.115 1.00 148.41 ? 586 MET D C     1 
ATOM   6369  O  O     . MET C 1  144 ? 7.077   39.486  22.446 1.00 152.38 ? 586 MET D O     1 
ATOM   6370  C  CB    . MET C 1  144 ? 4.655   37.879  21.126 1.00 126.50 ? 586 MET D CB    1 
ATOM   6371  C  CG    . MET C 1  144 ? 3.318   37.171  21.123 1.00 120.86 ? 586 MET D CG    1 
ATOM   6372  S  SD    . MET C 1  144 ? 2.289   37.886  19.815 1.00 118.94 ? 586 MET D SD    1 
ATOM   6373  C  CE    . MET C 1  144 ? 3.044   37.145  18.349 1.00 125.41 ? 586 MET D CE    1 
ATOM   6374  N  N     . ASN C 1  145 ? 7.827   37.559  21.521 1.00 155.14 ? 587 ASN D N     1 
ATOM   6375  C  CA    . ASN C 1  145 ? 9.149   38.067  21.166 1.00 152.56 ? 587 ASN D CA    1 
ATOM   6376  C  C     . ASN C 1  145 ? 9.057   39.171  20.115 1.00 153.85 ? 587 ASN D C     1 
ATOM   6377  O  O     . ASN C 1  145 ? 8.130   39.209  19.304 1.00 154.55 ? 587 ASN D O     1 
ATOM   6378  C  CB    . ASN C 1  145 ? 10.028  36.936  20.607 1.00 149.43 ? 587 ASN D CB    1 
ATOM   6379  C  CG    . ASN C 1  145 ? 9.928   35.647  21.402 1.00 148.21 ? 587 ASN D CG    1 
ATOM   6380  O  OD1   . ASN C 1  145 ? 10.577  35.492  22.433 1.00 143.13 ? 587 ASN D OD1   1 
ATOM   6381  N  ND2   . ASN C 1  145 ? 9.134   34.703  20.910 1.00 150.59 ? 587 ASN D ND2   1 
ATOM   6382  N  N     . ALA C 1  146 ? 10.080  40.035  20.092 1.00 158.39 ? 588 ALA D N     1 
ATOM   6383  C  CA    . ALA C 1  146 ? 10.102  41.168  19.164 1.00 165.02 ? 588 ALA D CA    1 
ATOM   6384  C  C     . ALA C 1  146 ? 9.990   40.745  17.701 1.00 166.33 ? 588 ALA D C     1 
ATOM   6385  O  O     . ALA C 1  146 ? 9.285   41.398  16.916 1.00 165.74 ? 588 ALA D O     1 
ATOM   6386  C  CB    . ALA C 1  146 ? 11.370  41.991  19.382 1.00 170.06 ? 588 ALA D CB    1 
ATOM   6387  N  N     . ASP C 1  147 ? 10.705  39.698  17.296 1.00 167.11 ? 589 ASP D N     1 
ATOM   6388  C  CA    . ASP C 1  147 ? 10.693  39.329  15.879 1.00 166.38 ? 589 ASP D CA    1 
ATOM   6389  C  C     . ASP C 1  147 ? 9.429   38.582  15.447 1.00 164.35 ? 589 ASP D C     1 
ATOM   6390  O  O     . ASP C 1  147 ? 9.195   38.436  14.242 1.00 166.38 ? 589 ASP D O     1 
ATOM   6391  C  CB    . ASP C 1  147 ? 11.954  38.524  15.526 1.00 164.88 ? 589 ASP D CB    1 
ATOM   6392  C  CG    . ASP C 1  147 ? 11.759  37.024  15.639 1.00 164.28 ? 589 ASP D CG    1 
ATOM   6393  O  OD1   . ASP C 1  147 ? 10.833  36.559  16.336 1.00 164.25 ? 589 ASP D OD1   1 
ATOM   6394  O  OD2   . ASP C 1  147 ? 12.568  36.290  15.038 1.00 165.34 ? 589 ASP D OD2   1 
ATOM   6395  N  N     . GLN C 1  148 ? 8.642   38.062  16.396 1.00 160.38 ? 590 GLN D N     1 
ATOM   6396  C  CA    . GLN C 1  148 ? 7.360   37.475  16.021 1.00 158.87 ? 590 GLN D CA    1 
ATOM   6397  C  C     . GLN C 1  148 ? 6.256   38.526  15.981 1.00 159.38 ? 590 GLN D C     1 
ATOM   6398  O  O     . GLN C 1  148 ? 5.320   38.382  15.184 1.00 164.17 ? 590 GLN D O     1 
ATOM   6399  C  CB    . GLN C 1  148 ? 6.999   36.250  16.895 1.00 156.12 ? 590 GLN D CB    1 
ATOM   6400  C  CG    . GLN C 1  148 ? 6.956   36.356  18.452 1.00 152.72 ? 590 GLN D CG    1 
ATOM   6401  C  CD    . GLN C 1  148 ? 6.857   34.966  19.131 1.00 149.23 ? 590 GLN D CD    1 
ATOM   6402  O  OE1   . GLN C 1  148 ? 6.483   34.855  20.303 1.00 142.48 ? 590 GLN D OE1   1 
ATOM   6403  N  NE2   . GLN C 1  148 ? 7.234   33.911  18.397 1.00 155.44 ? 590 GLN D NE2   1 
ATOM   6404  N  N     . LEU C 1  149 ? 6.343   39.596  16.778 1.00 155.93 ? 591 LEU D N     1 
ATOM   6405  C  CA    . LEU C 1  149 ? 5.497   40.765  16.526 1.00 154.90 ? 591 LEU D CA    1 
ATOM   6406  C  C     . LEU C 1  149 ? 5.694   41.286  15.101 1.00 159.96 ? 591 LEU D C     1 
ATOM   6407  O  O     . LEU C 1  149 ? 4.738   41.722  14.441 1.00 162.46 ? 591 LEU D O     1 
ATOM   6408  C  CB    . LEU C 1  149 ? 5.783   41.885  17.544 1.00 152.11 ? 591 LEU D CB    1 
ATOM   6409  C  CG    . LEU C 1  149 ? 4.926   42.181  18.792 1.00 145.27 ? 591 LEU D CG    1 
ATOM   6410  C  CD1   . LEU C 1  149 ? 3.505   41.584  18.763 1.00 140.11 ? 591 LEU D CD1   1 
ATOM   6411  C  CD2   . LEU C 1  149 ? 5.661   41.755  20.056 1.00 148.33 ? 591 LEU D CD2   1 
ATOM   6412  N  N     . TRP C 1  150 ? 6.935   41.225  14.601 1.00 160.31 ? 592 TRP D N     1 
ATOM   6413  C  CA    . TRP C 1  150 ? 7.260   41.722  13.261 1.00 160.87 ? 592 TRP D CA    1 
ATOM   6414  C  C     . TRP C 1  150 ? 6.690   40.830  12.163 1.00 161.11 ? 592 TRP D C     1 
ATOM   6415  O  O     . TRP C 1  150 ? 5.985   41.311  11.265 1.00 165.44 ? 592 TRP D O     1 
ATOM   6416  C  CB    . TRP C 1  150 ? 8.784   41.871  13.111 1.00 162.94 ? 592 TRP D CB    1 
ATOM   6417  C  CG    . TRP C 1  150 ? 9.301   42.023  11.666 1.00 164.83 ? 592 TRP D CG    1 
ATOM   6418  C  CD1   . TRP C 1  150 ? 9.912   41.061  10.905 1.00 165.69 ? 592 TRP D CD1   1 
ATOM   6419  C  CD2   . TRP C 1  150 ? 9.262   43.209  10.844 1.00 168.14 ? 592 TRP D CD2   1 
ATOM   6420  N  NE1   . TRP C 1  150 ? 10.244  41.570  9.670  1.00 169.33 ? 592 TRP D NE1   1 
ATOM   6421  C  CE2   . TRP C 1  150 ? 9.854   42.882  9.606  1.00 169.51 ? 592 TRP D CE2   1 
ATOM   6422  C  CE3   . TRP C 1  150 ? 8.776   44.508  11.032 1.00 171.01 ? 592 TRP D CE3   1 
ATOM   6423  C  CZ2   . TRP C 1  150 ? 9.977   43.810  8.565  1.00 173.61 ? 592 TRP D CZ2   1 
ATOM   6424  C  CZ3   . TRP C 1  150 ? 8.902   45.425  9.995  1.00 172.29 ? 592 TRP D CZ3   1 
ATOM   6425  C  CH2   . TRP C 1  150 ? 9.492   45.071  8.781  1.00 173.58 ? 592 TRP D CH2   1 
ATOM   6426  N  N     . GLU C 1  151 ? 6.975   39.527  12.217 1.00 159.99 ? 593 GLU D N     1 
ATOM   6427  C  CA    . GLU C 1  151 ? 6.607   38.632  11.119 1.00 157.54 ? 593 GLU D CA    1 
ATOM   6428  C  C     . GLU C 1  151 ? 5.093   38.536  10.932 1.00 152.75 ? 593 GLU D C     1 
ATOM   6429  O  O     . GLU C 1  151 ? 4.615   38.415  9.793  1.00 159.89 ? 593 GLU D O     1 
ATOM   6430  C  CB    . GLU C 1  151 ? 7.237   37.249  11.329 1.00 154.09 ? 593 GLU D CB    1 
ATOM   6431  C  CG    . GLU C 1  151 ? 8.527   37.004  10.520 1.00 154.75 ? 593 GLU D CG    1 
ATOM   6432  C  CD    . GLU C 1  151 ? 8.413   37.479  9.068  1.00 159.08 ? 593 GLU D CD    1 
ATOM   6433  O  OE1   . GLU C 1  151 ? 7.553   36.951  8.319  1.00 157.38 ? 593 GLU D OE1   1 
ATOM   6434  O  OE2   . GLU C 1  151 ? 9.178   38.392  8.677  1.00 163.68 ? 593 GLU D OE2   1 
ATOM   6435  N  N     . THR C 1  152 ? 4.326   38.628  12.021 1.00 144.01 ? 594 THR D N     1 
ATOM   6436  C  CA    . THR C 1  152 ? 2.870   38.446  12.023 1.00 139.12 ? 594 THR D CA    1 
ATOM   6437  C  C     . THR C 1  152 ? 2.050   39.733  11.944 1.00 143.91 ? 594 THR D C     1 
ATOM   6438  O  O     . THR C 1  152 ? 0.897   39.681  11.493 1.00 138.43 ? 594 THR D O     1 
ATOM   6439  C  CB    . THR C 1  152 ? 2.397   37.701  13.290 1.00 135.10 ? 594 THR D CB    1 
ATOM   6440  O  OG1   . THR C 1  152 ? 2.507   38.577  14.427 1.00 137.14 ? 594 THR D OG1   1 
ATOM   6441  C  CG2   . THR C 1  152 ? 3.205   36.433  13.534 1.00 130.40 ? 594 THR D CG2   1 
ATOM   6442  N  N     . THR C 1  153 ? 2.573   40.871  12.408 1.00 150.09 ? 595 THR D N     1 
ATOM   6443  C  CA    . THR C 1  153 ? 1.727   42.040  12.636 1.00 144.90 ? 595 THR D CA    1 
ATOM   6444  C  C     . THR C 1  153 ? 2.287   43.359  12.091 1.00 144.75 ? 595 THR D C     1 
ATOM   6445  O  O     . THR C 1  153 ? 1.503   44.240  11.733 1.00 138.84 ? 595 THR D O     1 
ATOM   6446  C  CB    . THR C 1  153 ? 1.410   42.184  14.139 1.00 137.96 ? 595 THR D CB    1 
ATOM   6447  O  OG1   . THR C 1  153 ? 1.140   40.898  14.718 1.00 137.40 ? 595 THR D OG1   1 
ATOM   6448  C  CG2   . THR C 1  153 ? 0.189   43.094  14.369 1.00 135.73 ? 595 THR D CG2   1 
ATOM   6449  N  N     . MET C 1  154 ? 3.610   43.535  12.004 1.00 149.60 ? 596 MET D N     1 
ATOM   6450  C  CA    . MET C 1  154 ? 4.150   44.825  11.577 1.00 160.02 ? 596 MET D CA    1 
ATOM   6451  C  C     . MET C 1  154 ? 4.776   44.827  10.184 1.00 174.86 ? 596 MET D C     1 
ATOM   6452  O  O     . MET C 1  154 ? 4.890   45.905  9.585  1.00 178.29 ? 596 MET D O     1 
ATOM   6453  C  CB    . MET C 1  154 ? 5.187   45.335  12.591 1.00 156.77 ? 596 MET D CB    1 
ATOM   6454  C  CG    . MET C 1  154 ? 4.733   45.274  14.054 1.00 151.01 ? 596 MET D CG    1 
ATOM   6455  S  SD    . MET C 1  154 ? 5.969   45.991  15.162 1.00 146.13 ? 596 MET D SD    1 
ATOM   6456  C  CE    . MET C 1  154 ? 5.861   47.703  14.679 1.00 148.43 ? 596 MET D CE    1 
ATOM   6457  N  N     . ASN C 1  155 ? 5.154   43.669  9.653  1.00 179.15 ? 597 ASN D N     1 
ATOM   6458  C  CA    . ASN C 1  155 ? 5.825   43.554  8.346  1.00 180.17 ? 597 ASN D CA    1 
ATOM   6459  C  C     . ASN C 1  155 ? 4.879   43.856  7.187  1.00 180.81 ? 597 ASN D C     1 
ATOM   6460  O  O     . ASN C 1  155 ? 3.906   43.116  6.997  1.00 185.29 ? 597 ASN D O     1 
ATOM   6461  C  CB    . ASN C 1  155 ? 6.379   42.131  8.211  1.00 181.47 ? 597 ASN D CB    1 
ATOM   6462  C  CG    . ASN C 1  155 ? 7.327   41.964  7.035  1.00 187.39 ? 597 ASN D CG    1 
ATOM   6463  O  OD1   . ASN C 1  155 ? 7.358   42.786  6.124  1.00 192.15 ? 597 ASN D OD1   1 
ATOM   6464  N  ND2   . ASN C 1  155 ? 8.105   40.891  7.053  1.00 186.87 ? 597 ASN D ND2   1 
ATOM   6465  N  N     . PRO C 1  156 ? 5.143   44.880  6.368  1.00 177.37 ? 598 PRO D N     1 
ATOM   6466  C  CA    . PRO C 1  156 ? 4.280   45.133  5.196  1.00 173.96 ? 598 PRO D CA    1 
ATOM   6467  C  C     . PRO C 1  156 ? 4.014   43.907  4.319  1.00 175.62 ? 598 PRO D C     1 
ATOM   6468  O  O     . PRO C 1  156 ? 2.938   43.833  3.714  1.00 178.79 ? 598 PRO D O     1 
ATOM   6469  C  CB    . PRO C 1  156 ? 5.045   46.222  4.422  1.00 174.30 ? 598 PRO D CB    1 
ATOM   6470  C  CG    . PRO C 1  156 ? 5.967   46.855  5.417  1.00 174.94 ? 598 PRO D CG    1 
ATOM   6471  C  CD    . PRO C 1  156 ? 6.295   45.793  6.430  1.00 177.33 ? 598 PRO D CD    1 
ATOM   6472  N  N     . GLU C 1  157 ? 4.929   42.927  4.254  1.00 173.63 ? 599 GLU D N     1 
ATOM   6473  C  CA    . GLU C 1  157 ? 4.777   41.800  3.330  1.00 171.77 ? 599 GLU D CA    1 
ATOM   6474  C  C     . GLU C 1  157 ? 3.810   40.727  3.817  1.00 172.30 ? 599 GLU D C     1 
ATOM   6475  O  O     . GLU C 1  157 ? 3.274   39.979  2.992  1.00 169.41 ? 599 GLU D O     1 
ATOM   6476  C  CB    . GLU C 1  157 ? 6.127   41.139  3.043  1.00 174.44 ? 599 GLU D CB    1 
ATOM   6477  C  CG    . GLU C 1  157 ? 7.328   42.054  3.178  1.00 179.66 ? 599 GLU D CG    1 
ATOM   6478  C  CD    . GLU C 1  157 ? 8.668   41.329  3.087  1.00 187.37 ? 599 GLU D CD    1 
ATOM   6479  O  OE1   . GLU C 1  157 ? 9.240   40.967  4.143  1.00 191.38 ? 599 GLU D OE1   1 
ATOM   6480  O  OE2   . GLU C 1  157 ? 9.159   41.139  1.954  1.00 189.11 ? 599 GLU D OE2   1 
ATOM   6481  N  N     . HIS C 1  158 ? 3.601   40.583  5.124  1.00 178.15 ? 600 HIS D N     1 
ATOM   6482  C  CA    . HIS C 1  158 ? 2.753   39.511  5.639  1.00 176.44 ? 600 HIS D CA    1 
ATOM   6483  C  C     . HIS C 1  158 ? 1.620   39.979  6.550  1.00 163.81 ? 600 HIS D C     1 
ATOM   6484  O  O     . HIS C 1  158 ? 0.671   39.209  6.762  1.00 153.31 ? 600 HIS D O     1 
ATOM   6485  C  CB    . HIS C 1  158 ? 3.613   38.446  6.360  1.00 181.34 ? 600 HIS D CB    1 
ATOM   6486  C  CG    . HIS C 1  158 ? 4.630   37.787  5.466  1.00 188.76 ? 600 HIS D CG    1 
ATOM   6487  N  ND1   . HIS C 1  158 ? 5.975   37.733  5.774  1.00 191.70 ? 600 HIS D ND1   1 
ATOM   6488  C  CD2   . HIS C 1  158 ? 4.494   37.160  4.272  1.00 189.12 ? 600 HIS D CD2   1 
ATOM   6489  C  CE1   . HIS C 1  158 ? 6.622   37.104  4.808  1.00 192.93 ? 600 HIS D CE1   1 
ATOM   6490  N  NE2   . HIS C 1  158 ? 5.747   36.747  3.885  1.00 191.45 ? 600 HIS D NE2   1 
ATOM   6491  N  N     . ARG C 1  159 ? 1.654   41.215  7.041  1.00 164.42 ? 601 ARG D N     1 
ATOM   6492  C  CA    . ARG C 1  159 ? 0.628   41.738  7.939  1.00 161.60 ? 601 ARG D CA    1 
ATOM   6493  C  C     . ARG C 1  159 ? -0.704  41.935  7.213  1.00 164.64 ? 601 ARG D C     1 
ATOM   6494  O  O     . ARG C 1  159 ? -0.766  42.056  5.989  1.00 164.21 ? 601 ARG D O     1 
ATOM   6495  C  CB    . ARG C 1  159 ? 1.089   43.059  8.566  1.00 160.16 ? 601 ARG D CB    1 
ATOM   6496  C  CG    . ARG C 1  159 ? 0.816   44.293  7.711  1.00 164.56 ? 601 ARG D CG    1 
ATOM   6497  C  CD    . ARG C 1  159 ? 1.812   45.395  8.040  1.00 167.61 ? 601 ARG D CD    1 
ATOM   6498  N  NE    . ARG C 1  159 ? 1.661   46.548  7.160  1.00 169.69 ? 601 ARG D NE    1 
ATOM   6499  C  CZ    . ARG C 1  159 ? 2.095   47.770  7.449  1.00 168.74 ? 601 ARG D CZ    1 
ATOM   6500  N  NH1   . ARG C 1  159 ? 2.700   48.003  8.606  1.00 168.57 ? 601 ARG D NH1   1 
ATOM   6501  N  NH2   . ARG C 1  159 ? 1.918   48.760  6.584  1.00 166.15 ? 601 ARG D NH2   1 
ATOM   6502  N  N     . ALA C 1  160 ? -1.786  41.990  8.002  1.00 165.97 ? 602 ALA D N     1 
ATOM   6503  C  CA    . ALA C 1  160 ? -3.125  42.306  7.496  1.00 162.93 ? 602 ALA D CA    1 
ATOM   6504  C  C     . ALA C 1  160 ? -3.744  43.408  8.348  1.00 157.91 ? 602 ALA D C     1 
ATOM   6505  O  O     . ALA C 1  160 ? -4.306  43.132  9.413  1.00 152.45 ? 602 ALA D O     1 
ATOM   6506  C  CB    . ALA C 1  160 ? -4.023  41.071  7.472  1.00 159.09 ? 602 ALA D CB    1 
ATOM   6507  N  N     . LEU C 1  161 ? -3.672  44.647  7.873  1.00 153.88 ? 603 LEU D N     1 
ATOM   6508  C  CA    . LEU C 1  161 ? -4.282  45.775  8.564  1.00 145.26 ? 603 LEU D CA    1 
ATOM   6509  C  C     . LEU C 1  161 ? -5.675  46.025  8.012  1.00 147.06 ? 603 LEU D C     1 
ATOM   6510  O  O     . LEU C 1  161 ? -5.943  45.779  6.834  1.00 153.13 ? 603 LEU D O     1 
ATOM   6511  C  CB    . LEU C 1  161 ? -3.447  47.048  8.421  1.00 137.61 ? 603 LEU D CB    1 
ATOM   6512  C  CG    . LEU C 1  161 ? -2.009  46.959  8.916  1.00 142.66 ? 603 LEU D CG    1 
ATOM   6513  C  CD1   . LEU C 1  161 ? -1.633  48.315  9.470  1.00 144.35 ? 603 LEU D CD1   1 
ATOM   6514  C  CD2   . LEU C 1  161 ? -1.846  45.871  9.972  1.00 144.04 ? 603 LEU D CD2   1 
ATOM   6515  N  N     . LEU C 1  162 ? -6.563  46.523  8.863  1.00 140.92 ? 604 LEU D N     1 
ATOM   6516  C  CA    . LEU C 1  162 ? -7.915  46.863  8.443  1.00 137.67 ? 604 LEU D CA    1 
ATOM   6517  C  C     . LEU C 1  162 ? -8.076  48.371  8.455  1.00 143.86 ? 604 LEU D C     1 
ATOM   6518  O  O     . LEU C 1  162 ? -7.832  49.015  9.479  1.00 142.30 ? 604 LEU D O     1 
ATOM   6519  C  CB    . LEU C 1  162 ? -8.971  46.230  9.345  1.00 129.68 ? 604 LEU D CB    1 
ATOM   6520  C  CG    . LEU C 1  162 ? -8.976  44.715  9.499  1.00 131.22 ? 604 LEU D CG    1 
ATOM   6521  C  CD1   . LEU C 1  162 ? -10.353 44.278  9.965  1.00 122.43 ? 604 LEU D CD1   1 
ATOM   6522  C  CD2   . LEU C 1  162 ? -8.596  44.041  8.194  1.00 142.17 ? 604 LEU D CD2   1 
ATOM   6523  N  N     . GLN C 1  163 ? -8.494  48.930  7.331  1.00 146.69 ? 605 GLN D N     1 
ATOM   6524  C  CA    . GLN C 1  163 ? -8.705  50.366  7.279  1.00 152.27 ? 605 GLN D CA    1 
ATOM   6525  C  C     . GLN C 1  163 ? -10.035 50.703  7.934  1.00 170.79 ? 605 GLN D C     1 
ATOM   6526  O  O     . GLN C 1  163 ? -11.065 50.092  7.629  1.00 157.31 ? 605 GLN D O     1 
ATOM   6527  C  CB    . GLN C 1  163 ? -8.654  50.879  5.843  1.00 145.10 ? 605 GLN D CB    1 
ATOM   6528  C  CG    . GLN C 1  163 ? -8.535  52.392  5.743  1.00 140.33 ? 605 GLN D CG    1 
ATOM   6529  C  CD    . GLN C 1  163 ? -8.400  52.852  4.308  1.00 141.24 ? 605 GLN D CD    1 
ATOM   6530  O  OE1   . GLN C 1  163 ? -9.187  52.463  3.441  1.00 140.26 ? 605 GLN D OE1   1 
ATOM   6531  N  NE2   . GLN C 1  163 ? -7.390  53.673  4.044  1.00 148.95 ? 605 GLN D NE2   1 
ATOM   6532  N  N     . VAL C 1  164 ? -9.997  51.639  8.869  1.00 96.10  ? 606 VAL D N     1 
ATOM   6533  C  CA    . VAL C 1  164 ? -11.213 52.131  9.500  1.00 106.53 ? 606 VAL D CA    1 
ATOM   6534  C  C     . VAL C 1  164 ? -11.888 53.093  8.539  1.00 115.54 ? 606 VAL D C     1 
ATOM   6535  O  O     . VAL C 1  164 ? -11.237 53.974  7.966  1.00 121.52 ? 606 VAL D O     1 
ATOM   6536  C  CB    . VAL C 1  164 ? -10.896 52.829  10.826 1.00 104.35 ? 606 VAL D CB    1 
ATOM   6537  C  CG1   . VAL C 1  164 ? -12.171 53.381  11.446 1.00 89.96  ? 606 VAL D CG1   1 
ATOM   6538  C  CG2   . VAL C 1  164 ? -10.176 51.886  11.760 1.00 108.43 ? 606 VAL D CG2   1 
ATOM   6539  N  N     . LYS C 1  165 ? -13.192 52.950  8.363  1.00 111.19 ? 607 LYS D N     1 
ATOM   6540  C  CA    . LYS C 1  165 ? -13.896 53.851  7.461  1.00 103.89 ? 607 LYS D CA    1 
ATOM   6541  C  C     . LYS C 1  165 ? -15.214 54.275  8.084  1.00 114.98 ? 607 LYS D C     1 
ATOM   6542  O  O     . LYS C 1  165 ? -15.784 53.571  8.916  1.00 128.19 ? 607 LYS D O     1 
ATOM   6543  C  CB    . LYS C 1  165 ? -14.124 53.199  6.096  1.00 93.08  ? 607 LYS D CB    1 
ATOM   6544  N  N     . LEU C 1  166 ? -15.694 55.442  7.664  1.00 107.76 ? 608 LEU D N     1 
ATOM   6545  C  CA    . LEU C 1  166 ? -16.966 55.985  8.128  1.00 91.96  ? 608 LEU D CA    1 
ATOM   6546  C  C     . LEU C 1  166 ? -17.968 55.881  6.981  1.00 88.49  ? 608 LEU D C     1 
ATOM   6547  O  O     . LEU C 1  166 ? -17.829 56.567  5.965  1.00 113.64 ? 608 LEU D O     1 
ATOM   6548  C  CB    . LEU C 1  166 ? -16.776 57.427  8.597  1.00 77.37  ? 608 LEU D CB    1 
ATOM   6549  C  CG    . LEU C 1  166 ? -18.006 58.242  9.002  1.00 91.23  ? 608 LEU D CG    1 
ATOM   6550  C  CD1   . LEU C 1  166 ? -18.917 57.472  9.965  1.00 95.02  ? 608 LEU D CD1   1 
ATOM   6551  C  CD2   . LEU C 1  166 ? -17.540 59.583  9.605  1.00 96.51  ? 608 LEU D CD2   1 
ATOM   6552  N  N     . GLU C 1  167 ? -18.961 55.006  7.111  1.00 149.56 ? 609 GLU D N     1 
ATOM   6553  C  CA    . GLU C 1  167 ? -19.894 54.766  6.016  1.00 122.92 ? 609 GLU D CA    1 
ATOM   6554  C  C     . GLU C 1  167 ? -21.267 55.398  6.223  1.00 121.02 ? 609 GLU D C     1 
ATOM   6555  O  O     . GLU C 1  167 ? -22.116 55.282  5.329  1.00 124.70 ? 609 GLU D O     1 
ATOM   6556  C  CB    . GLU C 1  167 ? -20.028 53.259  5.746  1.00 118.56 ? 609 GLU D CB    1 
ATOM   6557  C  CG    . GLU C 1  167 ? -18.844 52.588  4.985  1.00 129.59 ? 609 GLU D CG    1 
ATOM   6558  C  CD    . GLU C 1  167 ? -18.630 53.080  3.535  1.00 149.19 ? 609 GLU D CD    1 
ATOM   6559  O  OE1   . GLU C 1  167 ? -19.594 53.116  2.728  1.00 153.19 ? 609 GLU D OE1   1 
ATOM   6560  O  OE2   . GLU C 1  167 ? -17.469 53.399  3.191  1.00 149.04 ? 609 GLU D OE2   1 
ATOM   6561  N  N     . ASP C 1  168 ? -21.506 56.070  7.357  1.00 124.45 ? 610 ASP D N     1 
ATOM   6562  C  CA    . ASP C 1  168 ? -22.780 56.737  7.643  1.00 119.44 ? 610 ASP D CA    1 
ATOM   6563  C  C     . ASP C 1  168 ? -22.693 57.631  8.883  1.00 119.45 ? 610 ASP D C     1 
ATOM   6564  O  O     . ASP C 1  168 ? -22.731 57.145  10.018 1.00 115.01 ? 610 ASP D O     1 
ATOM   6565  C  CB    . ASP C 1  168 ? -23.904 55.707  7.824  1.00 110.49 ? 610 ASP D CB    1 
ATOM   6566  C  CG    . ASP C 1  168 ? -25.290 56.344  7.846  1.00 115.37 ? 610 ASP D CG    1 
ATOM   6567  O  OD1   . ASP C 1  168 ? -25.373 57.603  7.816  1.00 123.94 ? 610 ASP D OD1   1 
ATOM   6568  O  OD2   . ASP C 1  168 ? -26.301 55.596  7.893  1.00 109.83 ? 610 ASP D OD2   1 
ATOM   6569  N  N     . ALA C 1  169 ? -22.627 58.951  8.677  1.00 122.17 ? 611 ALA D N     1 
ATOM   6570  C  CA    . ALA C 1  169 ? -22.271 59.857  9.767  1.00 124.99 ? 611 ALA D CA    1 
ATOM   6571  C  C     . ALA C 1  169 ? -23.385 60.013  10.802 1.00 123.55 ? 611 ALA D C     1 
ATOM   6572  O  O     . ALA C 1  169 ? -23.094 60.246  11.979 1.00 135.39 ? 611 ALA D O     1 
ATOM   6573  C  CB    . ALA C 1  169 ? -21.842 61.218  9.210  1.00 132.06 ? 611 ALA D CB    1 
ATOM   6574  N  N     . ILE C 1  170 ? -24.656 59.932  10.412 1.00 113.30 ? 612 ILE D N     1 
ATOM   6575  C  CA    . ILE C 1  170 ? -25.675 60.041  11.463 1.00 113.87 ? 612 ILE D CA    1 
ATOM   6576  C  C     . ILE C 1  170 ? -25.794 58.728  12.248 1.00 120.61 ? 612 ILE D C     1 
ATOM   6577  O  O     . ILE C 1  170 ? -26.050 58.736  13.467 1.00 112.34 ? 612 ILE D O     1 
ATOM   6578  C  CB    . ILE C 1  170 ? -27.073 60.475  10.952 1.00 116.21 ? 612 ILE D CB    1 
ATOM   6579  C  CG1   . ILE C 1  170 ? -27.074 61.464  9.739  1.00 115.02 ? 612 ILE D CG1   1 
ATOM   6580  C  CG2   . ILE C 1  170 ? -27.976 60.858  12.179 1.00 119.74 ? 612 ILE D CG2   1 
ATOM   6581  C  CD1   . ILE C 1  170 ? -26.484 62.891  9.896  1.00 116.92 ? 612 ILE D CD1   1 
ATOM   6582  N  N     . GLU C 1  171 ? -25.662 57.580  11.565 1.00 132.28 ? 613 GLU D N     1 
ATOM   6583  C  CA    . GLU C 1  171 ? -25.657 56.293  12.256 1.00 129.12 ? 613 GLU D CA    1 
ATOM   6584  C  C     . GLU C 1  171 ? -24.544 56.240  13.298 1.00 121.40 ? 613 GLU D C     1 
ATOM   6585  O  O     . GLU C 1  171 ? -24.775 55.904  14.466 1.00 123.14 ? 613 GLU D O     1 
ATOM   6586  C  CB    . GLU C 1  171 ? -25.500 55.142  11.244 1.00 131.62 ? 613 GLU D CB    1 
ATOM   6587  C  CG    . GLU C 1  171 ? -25.494 53.717  11.857 1.00 130.47 ? 613 GLU D CG    1 
ATOM   6588  C  CD    . GLU C 1  171 ? -25.150 52.609  10.852 1.00 128.95 ? 613 GLU D CD    1 
ATOM   6589  O  OE1   . GLU C 1  171 ? -25.885 51.592  10.806 1.00 128.12 ? 613 GLU D OE1   1 
ATOM   6590  O  OE2   . GLU C 1  171 ? -24.148 52.755  10.108 1.00 123.94 ? 613 GLU D OE2   1 
ATOM   6591  N  N     . ALA C 1  172 ? -23.325 56.585  12.888 1.00 119.94 ? 614 ALA D N     1 
ATOM   6592  C  CA    . ALA C 1  172 ? -22.184 56.552  13.800 1.00 121.07 ? 614 ALA D CA    1 
ATOM   6593  C  C     . ALA C 1  172 ? -22.384 57.499  14.978 1.00 113.98 ? 614 ALA D C     1 
ATOM   6594  O  O     . ALA C 1  172 ? -22.065 57.150  16.123 1.00 111.86 ? 614 ALA D O     1 
ATOM   6595  C  CB    . ALA C 1  172 ? -20.893 56.884  13.045 1.00 129.84 ? 614 ALA D CB    1 
ATOM   6596  N  N     . ASP C 1  173 ? -22.887 58.710  14.714 1.00 115.18 ? 615 ASP D N     1 
ATOM   6597  C  CA    . ASP C 1  173 ? -23.277 59.625  15.787 1.00 118.99 ? 615 ASP D CA    1 
ATOM   6598  C  C     . ASP C 1  173 ? -24.162 58.923  16.812 1.00 120.38 ? 615 ASP D C     1 
ATOM   6599  O  O     . ASP C 1  173 ? -23.899 58.967  18.021 1.00 114.23 ? 615 ASP D O     1 
ATOM   6600  C  CB    . ASP C 1  173 ? -24.027 60.841  15.220 1.00 129.34 ? 615 ASP D CB    1 
ATOM   6601  C  CG    . ASP C 1  173 ? -23.117 61.842  14.512 1.00 142.13 ? 615 ASP D CG    1 
ATOM   6602  O  OD1   . ASP C 1  173 ? -21.903 61.891  14.807 1.00 147.12 ? 615 ASP D OD1   1 
ATOM   6603  O  OD2   . ASP C 1  173 ? -23.639 62.603  13.663 1.00 146.85 ? 615 ASP D OD2   1 
ATOM   6604  N  N     . GLN C 1  174 ? -25.238 58.286  16.336 1.00 124.68 ? 616 GLN D N     1 
ATOM   6605  C  CA    . GLN C 1  174 ? -26.166 57.591  17.221 1.00 121.31 ? 616 GLN D CA    1 
ATOM   6606  C  C     . GLN C 1  174 ? -25.494 56.421  17.919 1.00 120.70 ? 616 GLN D C     1 
ATOM   6607  O  O     . GLN C 1  174 ? -25.783 56.145  19.080 1.00 124.27 ? 616 GLN D O     1 
ATOM   6608  C  CB    . GLN C 1  174 ? -27.376 57.079  16.438 1.00 126.78 ? 616 GLN D CB    1 
ATOM   6609  C  CG    . GLN C 1  174 ? -28.267 58.132  15.825 1.00 138.52 ? 616 GLN D CG    1 
ATOM   6610  C  CD    . GLN C 1  174 ? -29.137 57.541  14.725 1.00 145.60 ? 616 GLN D CD    1 
ATOM   6611  O  OE1   . GLN C 1  174 ? -29.041 56.351  14.410 1.00 140.35 ? 616 GLN D OE1   1 
ATOM   6612  N  NE2   . GLN C 1  174 ? -29.980 58.372  14.130 1.00 152.58 ? 616 GLN D NE2   1 
ATOM   6613  N  N     . THR C 1  175 ? -24.625 55.697  17.226 1.00 120.49 ? 617 THR D N     1 
ATOM   6614  C  CA    . THR C 1  175 ? -23.958 54.571  17.873 1.00 116.58 ? 617 THR D CA    1 
ATOM   6615  C  C     . THR C 1  175 ? -22.999 55.052  18.965 1.00 118.62 ? 617 THR D C     1 
ATOM   6616  O  O     . THR C 1  175 ? -23.096 54.613  20.116 1.00 125.62 ? 617 THR D O     1 
ATOM   6617  C  CB    . THR C 1  175 ? -23.262 53.685  16.828 1.00 114.32 ? 617 THR D CB    1 
ATOM   6618  O  OG1   . THR C 1  175 ? -24.251 52.909  16.134 1.00 117.79 ? 617 THR D OG1   1 
ATOM   6619  C  CG2   . THR C 1  175 ? -22.278 52.725  17.497 1.00 107.88 ? 617 THR D CG2   1 
ATOM   6620  N  N     . PHE C 1  176 ? -22.099 55.994  18.644 1.00 114.95 ? 618 PHE D N     1 
ATOM   6621  C  CA    . PHE C 1  176 ? -21.160 56.490  19.655 1.00 110.09 ? 618 PHE D CA    1 
ATOM   6622  C  C     . PHE C 1  176 ? -21.884 57.018  20.884 1.00 109.52 ? 618 PHE D C     1 
ATOM   6623  O  O     . PHE C 1  176 ? -21.445 56.791  22.017 1.00 107.16 ? 618 PHE D O     1 
ATOM   6624  C  CB    . PHE C 1  176 ? -20.242 57.580  19.085 1.00 107.80 ? 618 PHE D CB    1 
ATOM   6625  C  CG    . PHE C 1  176 ? -19.035 57.040  18.366 1.00 108.51 ? 618 PHE D CG    1 
ATOM   6626  C  CD1   . PHE C 1  176 ? -17.977 56.469  19.060 1.00 104.73 ? 618 PHE D CD1   1 
ATOM   6627  C  CD2   . PHE C 1  176 ? -18.967 57.093  16.985 1.00 117.38 ? 618 PHE D CD2   1 
ATOM   6628  C  CE1   . PHE C 1  176 ? -16.872 55.962  18.389 1.00 104.24 ? 618 PHE D CE1   1 
ATOM   6629  C  CE2   . PHE C 1  176 ? -17.869 56.583  16.316 1.00 120.29 ? 618 PHE D CE2   1 
ATOM   6630  C  CZ    . PHE C 1  176 ? -16.823 56.023  17.017 1.00 112.66 ? 618 PHE D CZ    1 
ATOM   6631  N  N     . GLU C 1  177 ? -22.997 57.719  20.691 1.00 113.03 ? 619 GLU D N     1 
ATOM   6632  C  CA    . GLU C 1  177 ? -23.749 58.192  21.848 1.00 115.06 ? 619 GLU D CA    1 
ATOM   6633  C  C     . GLU C 1  177 ? -24.330 57.027  22.641 1.00 114.00 ? 619 GLU D C     1 
ATOM   6634  O  O     . GLU C 1  177 ? -24.272 57.007  23.874 1.00 117.32 ? 619 GLU D O     1 
ATOM   6635  C  CB    . GLU C 1  177 ? -24.845 59.164  21.408 1.00 123.26 ? 619 GLU D CB    1 
ATOM   6636  C  CG    . GLU C 1  177 ? -25.522 59.772  22.586 1.00 128.41 ? 619 GLU D CG    1 
ATOM   6637  C  CD    . GLU C 1  177 ? -26.335 60.999  22.281 1.00 133.41 ? 619 GLU D CD    1 
ATOM   6638  O  OE1   . GLU C 1  177 ? -26.753 61.645  23.261 1.00 134.58 ? 619 GLU D OE1   1 
ATOM   6639  O  OE2   . GLU C 1  177 ? -26.569 61.323  21.097 1.00 133.21 ? 619 GLU D OE2   1 
ATOM   6640  N  N     A MET C 1  178 ? -24.877 56.030  21.950 0.50 111.13 ? 620 MET D N     1 
ATOM   6641  N  N     B MET C 1  178 ? -24.876 56.037  21.936 0.50 111.15 ? 620 MET D N     1 
ATOM   6642  C  CA    A MET C 1  178 ? -25.540 54.916  22.626 0.50 112.32 ? 620 MET D CA    1 
ATOM   6643  C  CA    B MET C 1  178 ? -25.531 54.901  22.582 0.50 112.38 ? 620 MET D CA    1 
ATOM   6644  C  C     A MET C 1  178 ? -24.558 54.032  23.395 0.50 106.51 ? 620 MET D C     1 
ATOM   6645  C  C     B MET C 1  178 ? -24.550 54.056  23.389 0.50 106.51 ? 620 MET D C     1 
ATOM   6646  O  O     A MET C 1  178 ? -24.858 53.584  24.508 0.50 102.37 ? 620 MET D O     1 
ATOM   6647  O  O     B MET C 1  178 ? -24.842 53.660  24.522 0.50 102.38 ? 620 MET D O     1 
ATOM   6648  C  CB    A MET C 1  178 ? -26.305 54.095  21.588 0.50 118.03 ? 620 MET D CB    1 
ATOM   6649  C  CB    B MET C 1  178 ? -26.217 54.048  21.508 0.50 117.99 ? 620 MET D CB    1 
ATOM   6650  C  CG    A MET C 1  178 ? -26.324 52.603  21.864 0.50 120.52 ? 620 MET D CG    1 
ATOM   6651  C  CG    B MET C 1  178 ? -27.421 54.702  20.864 0.50 123.07 ? 620 MET D CG    1 
ATOM   6652  S  SD    A MET C 1  178 ? -27.510 51.759  20.807 0.50 115.07 ? 620 MET D SD    1 
ATOM   6653  S  SD    B MET C 1  178 ? -28.965 54.074  21.488 0.50 116.27 ? 620 MET D SD    1 
ATOM   6654  C  CE    A MET C 1  178 ? -28.992 52.670  21.237 0.50 116.95 ? 620 MET D CE    1 
ATOM   6655  C  CE    B MET C 1  178 ? -28.700 52.320  21.225 0.50 115.92 ? 620 MET D CE    1 
ATOM   6656  N  N     . LEU C 1  179 ? -23.404 53.730  22.799 1.00 99.97  ? 621 LEU D N     1 
ATOM   6657  C  CA    . LEU C 1  179 ? -22.456 52.799  23.417 1.00 94.92  ? 621 LEU D CA    1 
ATOM   6658  C  C     . LEU C 1  179 ? -21.577 53.449  24.480 1.00 93.84  ? 621 LEU D C     1 
ATOM   6659  O  O     . LEU C 1  179 ? -21.286 52.832  25.515 1.00 100.17 ? 621 LEU D O     1 
ATOM   6660  C  CB    . LEU C 1  179 ? -21.549 52.163  22.353 1.00 93.72  ? 621 LEU D CB    1 
ATOM   6661  C  CG    . LEU C 1  179 ? -22.197 51.221  21.345 1.00 95.25  ? 621 LEU D CG    1 
ATOM   6662  C  CD1   . LEU C 1  179 ? -21.166 50.690  20.369 1.00 94.37  ? 621 LEU D CD1   1 
ATOM   6663  C  CD2   . LEU C 1  179 ? -22.903 50.073  22.030 1.00 95.88  ? 621 LEU D CD2   1 
ATOM   6664  N  N     . MET C 1  180 ? -21.090 54.657  24.220 1.00 91.55  ? 622 MET D N     1 
ATOM   6665  C  CA    . MET C 1  180 ? -20.228 55.380  25.147 1.00 88.70  ? 622 MET D CA    1 
ATOM   6666  C  C     . MET C 1  180 ? -20.974 56.512  25.840 1.00 87.93  ? 622 MET D C     1 
ATOM   6667  O  O     . MET C 1  180 ? -20.355 57.327  26.533 1.00 87.94  ? 622 MET D O     1 
ATOM   6668  C  CB    . MET C 1  180 ? -18.994 55.922  24.416 1.00 90.27  ? 622 MET D CB    1 
ATOM   6669  C  CG    . MET C 1  180 ? -18.469 54.974  23.355 1.00 94.08  ? 622 MET D CG    1 
ATOM   6670  S  SD    . MET C 1  180 ? -17.646 53.525  24.045 1.00 104.52 ? 622 MET D SD    1 
ATOM   6671  C  CE    . MET C 1  180 ? -16.104 54.265  24.564 1.00 108.18 ? 622 MET D CE    1 
ATOM   6672  N  N     . GLY C 1  181 ? -22.288 56.574  25.681 1.00 96.79  ? 623 GLY D N     1 
ATOM   6673  C  CA    . GLY C 1  181 ? -23.040 57.689  26.210 1.00 97.70  ? 623 GLY D CA    1 
ATOM   6674  C  C     . GLY C 1  181 ? -23.270 57.606  27.702 1.00 87.93  ? 623 GLY D C     1 
ATOM   6675  O  O     . GLY C 1  181 ? -23.089 56.576  28.359 1.00 85.75  ? 623 GLY D O     1 
ATOM   6676  N  N     . ASP C 1  182 ? -23.678 58.762  28.229 1.00 86.09  ? 624 ASP D N     1 
ATOM   6677  C  CA    . ASP C 1  182 ? -23.927 58.895  29.657 1.00 83.13  ? 624 ASP D CA    1 
ATOM   6678  C  C     . ASP C 1  182 ? -25.023 57.957  30.128 1.00 87.47  ? 624 ASP D C     1 
ATOM   6679  O  O     . ASP C 1  182 ? -24.937 57.386  31.222 1.00 89.10  ? 624 ASP D O     1 
ATOM   6680  C  CB    . ASP C 1  182 ? -24.308 60.337  29.986 1.00 88.14  ? 624 ASP D CB    1 
ATOM   6681  C  CG    . ASP C 1  182 ? -23.164 61.113  30.595 1.00 108.28 ? 624 ASP D CG    1 
ATOM   6682  O  OD1   . ASP C 1  182 ? -21.988 60.770  30.299 1.00 118.44 ? 624 ASP D OD1   1 
ATOM   6683  O  OD2   . ASP C 1  182 ? -23.448 62.065  31.364 1.00 109.25 ? 624 ASP D OD2   1 
ATOM   6684  N  N     . VAL C 1  183 ? -26.081 57.813  29.336 1.00 93.04  ? 625 VAL D N     1 
ATOM   6685  C  CA    . VAL C 1  183 ? -27.196 56.955  29.719 1.00 91.74  ? 625 VAL D CA    1 
ATOM   6686  C  C     . VAL C 1  183 ? -26.748 55.499  29.731 1.00 87.60  ? 625 VAL D C     1 
ATOM   6687  O  O     . VAL C 1  183 ? -26.163 55.010  28.761 1.00 92.67  ? 625 VAL D O     1 
ATOM   6688  C  CB    . VAL C 1  183 ? -28.379 57.159  28.764 1.00 80.11  ? 625 VAL D CB    1 
ATOM   6689  C  CG1   . VAL C 1  183 ? -29.483 56.182  29.108 1.00 78.56  ? 625 VAL D CG1   1 
ATOM   6690  C  CG2   . VAL C 1  183 ? -28.881 58.585  28.828 1.00 81.54  ? 625 VAL D CG2   1 
ATOM   6691  N  N     . VAL C 1  184 ? -27.063 54.788  30.818 1.00 79.55  ? 626 VAL D N     1 
ATOM   6692  C  CA    . VAL C 1  184 ? -26.725 53.364  30.935 1.00 78.03  ? 626 VAL D CA    1 
ATOM   6693  C  C     . VAL C 1  184 ? -27.796 52.479  30.294 1.00 84.74  ? 626 VAL D C     1 
ATOM   6694  O  O     . VAL C 1  184 ? -27.473 51.459  29.675 1.00 86.76  ? 626 VAL D O     1 
ATOM   6695  C  CB    . VAL C 1  184 ? -26.495 52.974  32.412 1.00 79.98  ? 626 VAL D CB    1 
ATOM   6696  C  CG1   . VAL C 1  184 ? -26.255 51.476  32.530 1.00 72.31  ? 626 VAL D CG1   1 
ATOM   6697  C  CG2   . VAL C 1  184 ? -25.334 53.751  33.021 1.00 92.55  ? 626 VAL D CG2   1 
ATOM   6698  N  N     . GLU C 1  185 ? -29.071 52.845  30.441 1.00 88.50  ? 627 GLU D N     1 
ATOM   6699  C  CA    . GLU C 1  185 ? -30.179 52.024  29.943 1.00 82.63  ? 627 GLU D CA    1 
ATOM   6700  C  C     . GLU C 1  185 ? -30.085 51.719  28.447 1.00 86.65  ? 627 GLU D C     1 
ATOM   6701  O  O     . GLU C 1  185 ? -30.419 50.610  28.009 1.00 88.98  ? 627 GLU D O     1 
ATOM   6702  C  CB    . GLU C 1  185 ? -31.508 52.711  30.263 1.00 82.10  ? 627 GLU D CB    1 
ATOM   6703  C  CG    . GLU C 1  185 ? -32.742 52.023  29.699 1.00 83.18  ? 627 GLU D CG    1 
ATOM   6704  C  CD    . GLU C 1  185 ? -32.869 50.544  30.078 1.00 90.03  ? 627 GLU D CD    1 
ATOM   6705  O  OE1   . GLU C 1  185 ? -32.296 50.093  31.098 1.00 95.02  ? 627 GLU D OE1   1 
ATOM   6706  O  OE2   . GLU C 1  185 ? -33.569 49.825  29.334 1.00 102.67 ? 627 GLU D OE2   1 
ATOM   6707  N  N     . ASN C 1  186 ? -29.695 52.705  27.635 1.00 89.44  ? 628 ASN D N     1 
ATOM   6708  C  CA    . ASN C 1  186 ? -29.522 52.454  26.203 1.00 92.80  ? 628 ASN D CA    1 
ATOM   6709  C  C     . ASN C 1  186 ? -28.465 51.388  25.976 1.00 90.00  ? 628 ASN D C     1 
ATOM   6710  O  O     . ASN C 1  186 ? -28.608 50.507  25.115 1.00 89.88  ? 628 ASN D O     1 
ATOM   6711  C  CB    . ASN C 1  186 ? -29.111 53.734  25.459 1.00 94.31  ? 628 ASN D CB    1 
ATOM   6712  C  CG    . ASN C 1  186 ? -30.198 54.801  25.467 1.00 96.86  ? 628 ASN D CG    1 
ATOM   6713  O  OD1   . ASN C 1  186 ? -31.362 54.520  25.760 1.00 88.98  ? 628 ASN D OD1   1 
ATOM   6714  N  ND2   . ASN C 1  186 ? -29.819 56.041  25.114 1.00 107.69 ? 628 ASN D ND2   1 
ATOM   6715  N  N     . ARG C 1  187 ? -27.398 51.460  26.754 1.00 93.62  ? 629 ARG D N     1 
ATOM   6716  C  CA    . ARG C 1  187 ? -26.320 50.495  26.675 1.00 88.26  ? 629 ARG D CA    1 
ATOM   6717  C  C     . ARG C 1  187 ? -26.774 49.124  27.153 1.00 84.94  ? 629 ARG D C     1 
ATOM   6718  O  O     . ARG C 1  187 ? -26.437 48.105  26.538 1.00 81.61  ? 629 ARG D O     1 
ATOM   6719  C  CB    . ARG C 1  187 ? -25.155 51.025  27.498 1.00 78.80  ? 629 ARG D CB    1 
ATOM   6720  C  CG    . ARG C 1  187 ? -23.932 50.226  27.450 1.00 75.39  ? 629 ARG D CG    1 
ATOM   6721  C  CD    . ARG C 1  187 ? -22.771 51.146  27.692 1.00 74.58  ? 629 ARG D CD    1 
ATOM   6722  N  NE    . ARG C 1  187 ? -22.886 51.960  28.900 1.00 77.66  ? 629 ARG D NE    1 
ATOM   6723  C  CZ    . ARG C 1  187 ? -23.058 53.281  28.900 1.00 73.39  ? 629 ARG D CZ    1 
ATOM   6724  N  NH1   . ARG C 1  187 ? -23.138 53.940  27.745 1.00 80.94  ? 629 ARG D NH1   1 
ATOM   6725  N  NH2   . ARG C 1  187 ? -23.153 53.944  30.049 1.00 72.13  ? 629 ARG D NH2   1 
ATOM   6726  N  N     . ARG C 1  188 ? -27.561 49.076  28.237 1.00 80.61  ? 630 ARG D N     1 
ATOM   6727  C  CA    . ARG C 1  188 ? -28.106 47.802  28.704 1.00 77.21  ? 630 ARG D CA    1 
ATOM   6728  C  C     . ARG C 1  188 ? -29.002 47.151  27.656 1.00 84.43  ? 630 ARG D C     1 
ATOM   6729  O  O     . ARG C 1  188 ? -29.031 45.920  27.527 1.00 97.25  ? 630 ARG D O     1 
ATOM   6730  C  CB    . ARG C 1  188 ? -28.904 47.980  30.003 1.00 75.76  ? 630 ARG D CB    1 
ATOM   6731  C  CG    . ARG C 1  188 ? -29.304 46.628  30.624 1.00 72.27  ? 630 ARG D CG    1 
ATOM   6732  C  CD    . ARG C 1  188 ? -30.484 46.741  31.565 1.00 73.12  ? 630 ARG D CD    1 
ATOM   6733  N  NE    . ARG C 1  188 ? -31.667 47.252  30.878 1.00 76.60  ? 630 ARG D NE    1 
ATOM   6734  C  CZ    . ARG C 1  188 ? -32.509 46.496  30.178 1.00 98.48  ? 630 ARG D CZ    1 
ATOM   6735  N  NH1   . ARG C 1  188 ? -32.289 45.187  30.069 1.00 111.38 ? 630 ARG D NH1   1 
ATOM   6736  N  NH2   . ARG C 1  188 ? -33.569 47.045  29.586 1.00 99.49  ? 630 ARG D NH2   1 
ATOM   6737  N  N     . GLN C 1  189 ? -29.801 47.955  26.957 1.00 84.71  ? 631 GLN D N     1 
ATOM   6738  C  CA    . GLN C 1  189 ? -30.743 47.414  25.978 1.00 82.87  ? 631 GLN D CA    1 
ATOM   6739  C  C     . GLN C 1  189 ? -30.004 46.855  24.776 1.00 84.06  ? 631 GLN D C     1 
ATOM   6740  O  O     . GLN C 1  189 ? -30.360 45.793  24.252 1.00 83.94  ? 631 GLN D O     1 
ATOM   6741  C  CB    . GLN C 1  189 ? -31.738 48.490  25.526 1.00 87.39  ? 631 GLN D CB    1 
ATOM   6742  C  CG    . GLN C 1  189 ? -32.867 47.996  24.614 1.00 89.47  ? 631 GLN D CG    1 
ATOM   6743  C  CD    . GLN C 1  189 ? -33.893 47.160  25.352 1.00 92.53  ? 631 GLN D CD    1 
ATOM   6744  O  OE1   . GLN C 1  189 ? -34.406 47.568  26.404 1.00 89.13  ? 631 GLN D OE1   1 
ATOM   6745  N  NE2   . GLN C 1  189 ? -34.189 45.975  24.817 1.00 94.27  ? 631 GLN D NE2   1 
ATOM   6746  N  N     . PHE C 1  190 ? -28.975 47.565  24.317 1.00 85.24  ? 632 PHE D N     1 
ATOM   6747  C  CA    . PHE C 1  190 ? -28.166 47.046  23.228 1.00 89.06  ? 632 PHE D CA    1 
ATOM   6748  C  C     . PHE C 1  190 ? -27.593 45.679  23.598 1.00 93.88  ? 632 PHE D C     1 
ATOM   6749  O  O     . PHE C 1  190 ? -27.688 44.723  22.825 1.00 99.18  ? 632 PHE D O     1 
ATOM   6750  C  CB    . PHE C 1  190 ? -27.084 48.069  22.871 1.00 95.02  ? 632 PHE D CB    1 
ATOM   6751  C  CG    . PHE C 1  190 ? -26.028 47.528  21.960 1.00 98.03  ? 632 PHE D CG    1 
ATOM   6752  C  CD1   . PHE C 1  190 ? -26.235 47.445  20.592 1.00 99.61  ? 632 PHE D CD1   1 
ATOM   6753  C  CD2   . PHE C 1  190 ? -24.822 47.085  22.481 1.00 113.99 ? 632 PHE D CD2   1 
ATOM   6754  C  CE1   . PHE C 1  190 ? -25.254 46.934  19.756 1.00 102.22 ? 632 PHE D CE1   1 
ATOM   6755  C  CE2   . PHE C 1  190 ? -23.843 46.573  21.658 1.00 112.88 ? 632 PHE D CE2   1 
ATOM   6756  C  CZ    . PHE C 1  190 ? -24.054 46.497  20.295 1.00 103.48 ? 632 PHE D CZ    1 
ATOM   6757  N  N     . ILE C 1  191 ? -27.083 45.549  24.822 1.00 94.96  ? 633 ILE D N     1 
ATOM   6758  C  CA    . ILE C 1  191 ? -26.528 44.277  25.298 1.00 83.48  ? 633 ILE D CA    1 
ATOM   6759  C  C     . ILE C 1  191 ? -27.598 43.191  25.322 1.00 89.74  ? 633 ILE D C     1 
ATOM   6760  O  O     . ILE C 1  191 ? -27.378 42.071  24.850 1.00 99.89  ? 633 ILE D O     1 
ATOM   6761  C  CB    . ILE C 1  191 ? -25.875 44.461  26.683 1.00 77.79  ? 633 ILE D CB    1 
ATOM   6762  C  CG1   . ILE C 1  191 ? -24.571 45.219  26.520 1.00 76.87  ? 633 ILE D CG1   1 
ATOM   6763  C  CG2   . ILE C 1  191 ? -25.601 43.101  27.351 1.00 80.68  ? 633 ILE D CG2   1 
ATOM   6764  C  CD1   . ILE C 1  191 ? -24.061 45.857  27.765 1.00 77.01  ? 633 ILE D CD1   1 
ATOM   6765  N  N     . GLU C 1  192 ? -28.765 43.504  25.885 1.00 93.01  ? 634 GLU D N     1 
ATOM   6766  C  CA    . GLU C 1  192 ? -29.842 42.520  25.965 1.00 93.75  ? 634 GLU D CA    1 
ATOM   6767  C  C     . GLU C 1  192 ? -30.266 42.056  24.574 1.00 104.51 ? 634 GLU D C     1 
ATOM   6768  O  O     . GLU C 1  192 ? -30.517 40.858  24.346 1.00 99.74  ? 634 GLU D O     1 
ATOM   6769  C  CB    . GLU C 1  192 ? -31.038 43.109  26.722 1.00 99.35  ? 634 GLU D CB    1 
ATOM   6770  C  CG    . GLU C 1  192 ? -32.056 42.088  27.237 1.00 109.08 ? 634 GLU D CG    1 
ATOM   6771  C  CD    . GLU C 1  192 ? -33.510 42.514  27.024 1.00 116.73 ? 634 GLU D CD    1 
ATOM   6772  O  OE1   . GLU C 1  192 ? -34.407 41.665  27.197 1.00 112.48 ? 634 GLU D OE1   1 
ATOM   6773  O  OE2   . GLU C 1  192 ? -33.760 43.694  26.687 1.00 128.21 ? 634 GLU D OE2   1 
ATOM   6774  N  N     . ASP C 1  193 ? -30.331 43.001  23.621 1.00 115.71 ? 635 ASP D N     1 
ATOM   6775  C  CA    . ASP C 1  193 ? -30.762 42.703  22.257 1.00 108.71 ? 635 ASP D CA    1 
ATOM   6776  C  C     . ASP C 1  193 ? -29.753 41.835  21.520 1.00 132.87 ? 635 ASP D C     1 
ATOM   6777  O  O     . ASP C 1  193 ? -30.139 40.946  20.751 1.00 117.28 ? 635 ASP D O     1 
ATOM   6778  C  CB    . ASP C 1  193 ? -30.972 44.007  21.473 1.00 100.64 ? 635 ASP D CB    1 
ATOM   6779  C  CG    . ASP C 1  193 ? -32.254 44.738  21.847 1.00 98.86  ? 635 ASP D CG    1 
ATOM   6780  O  OD1   . ASP C 1  193 ? -33.169 44.109  22.416 1.00 99.76  ? 635 ASP D OD1   1 
ATOM   6781  O  OD2   . ASP C 1  193 ? -32.344 45.951  21.552 1.00 93.19  ? 635 ASP D OD2   1 
ATOM   6782  N  N     . ASN C 1  194 ? -28.463 42.086  21.719 1.00 106.44 ? 636 ASN D N     1 
ATOM   6783  C  CA    . ASN C 1  194 ? -27.427 41.531  20.864 1.00 122.13 ? 636 ASN D CA    1 
ATOM   6784  C  C     . ASN C 1  194 ? -26.558 40.472  21.524 1.00 123.63 ? 636 ASN D C     1 
ATOM   6785  O  O     . ASN C 1  194 ? -25.779 39.827  20.819 1.00 130.27 ? 636 ASN D O     1 
ATOM   6786  C  CB    . ASN C 1  194 ? -26.528 42.656  20.332 1.00 131.90 ? 636 ASN D CB    1 
ATOM   6787  C  CG    . ASN C 1  194 ? -27.232 43.512  19.311 1.00 142.73 ? 636 ASN D CG    1 
ATOM   6788  O  OD1   . ASN C 1  194 ? -27.401 43.105  18.164 1.00 150.37 ? 636 ASN D OD1   1 
ATOM   6789  N  ND2   . ASN C 1  194 ? -27.661 44.700  19.724 1.00 138.85 ? 636 ASN D ND2   1 
ATOM   6790  N  N     . ALA C 1  195 ? -26.648 40.266  22.830 1.00 121.48 ? 637 ALA D N     1 
ATOM   6791  C  CA    . ALA C 1  195 ? -25.707 39.367  23.480 1.00 122.67 ? 637 ALA D CA    1 
ATOM   6792  C  C     . ALA C 1  195 ? -26.031 37.917  23.151 1.00 130.60 ? 637 ALA D C     1 
ATOM   6793  O  O     . ALA C 1  195 ? -27.189 37.494  23.196 1.00 119.13 ? 637 ALA D O     1 
ATOM   6794  C  CB    . ALA C 1  195 ? -25.698 39.579  24.987 1.00 119.80 ? 637 ALA D CB    1 
ATOM   6795  N  N     . VAL C 1  196 ? -24.994 37.166  22.809 1.00 147.71 ? 638 VAL D N     1 
ATOM   6796  C  CA    . VAL C 1  196 ? -25.084 35.749  22.501 1.00 152.16 ? 638 VAL D CA    1 
ATOM   6797  C  C     . VAL C 1  196 ? -24.354 35.022  23.627 1.00 153.90 ? 638 VAL D C     1 
ATOM   6798  O  O     . VAL C 1  196 ? -23.136 35.161  23.778 1.00 155.37 ? 638 VAL D O     1 
ATOM   6799  C  CB    . VAL C 1  196 ? -24.502 35.455  21.108 1.00 140.06 ? 638 VAL D CB    1 
ATOM   6800  C  CG1   . VAL C 1  196 ? -24.266 33.972  20.887 1.00 140.73 ? 638 VAL D CG1   1 
ATOM   6801  C  CG2   . VAL C 1  196 ? -25.448 36.005  20.022 1.00 133.49 ? 638 VAL D CG2   1 
ATOM   6802  N  N     . TYR C 1  197 ? -25.106 34.289  24.448 1.00 157.28 ? 639 TYR D N     1 
ATOM   6803  C  CA    . TYR C 1  197 ? -24.581 33.649  25.657 1.00 162.35 ? 639 TYR D CA    1 
ATOM   6804  C  C     . TYR C 1  197 ? -24.233 32.167  25.439 1.00 170.18 ? 639 TYR D C     1 
ATOM   6805  O  O     . TYR C 1  197 ? -25.091 31.289  25.276 1.00 176.43 ? 639 TYR D O     1 
ATOM   6806  C  CB    . TYR C 1  197 ? -25.586 33.800  26.816 1.00 160.14 ? 639 TYR D CB    1 
ATOM   6807  C  CG    . TYR C 1  197 ? -25.756 35.230  27.323 1.00 152.89 ? 639 TYR D CG    1 
ATOM   6808  C  CD1   . TYR C 1  197 ? -24.751 35.855  28.052 1.00 148.01 ? 639 TYR D CD1   1 
ATOM   6809  C  CD2   . TYR C 1  197 ? -26.918 35.953  27.073 1.00 148.06 ? 639 TYR D CD2   1 
ATOM   6810  C  CE1   . TYR C 1  197 ? -24.891 37.158  28.511 1.00 139.16 ? 639 TYR D CE1   1 
ATOM   6811  C  CE2   . TYR C 1  197 ? -27.066 37.266  27.536 1.00 142.84 ? 639 TYR D CE2   1 
ATOM   6812  C  CZ    . TYR C 1  197 ? -26.043 37.861  28.251 1.00 134.76 ? 639 TYR D CZ    1 
ATOM   6813  O  OH    . TYR C 1  197 ? -26.160 39.154  28.715 1.00 131.59 ? 639 TYR D OH    1 
ATOM   6814  N  N     . ASN D 3  9   ? -9.235  43.961  3.432  1.00 101.10 ? 10  ASN C N     1 
ATOM   6815  C  CA    . ASN D 3  9   ? -10.374 44.841  3.180  1.00 124.62 ? 10  ASN C CA    1 
ATOM   6816  C  C     . ASN D 3  9   ? -10.337 46.021  4.151  1.00 146.41 ? 10  ASN C C     1 
ATOM   6817  O  O     . ASN D 3  9   ? -9.263  46.429  4.605  1.00 132.28 ? 10  ASN C O     1 
ATOM   6818  C  CB    . ASN D 3  9   ? -11.690 44.069  3.312  1.00 122.20 ? 10  ASN C CB    1 
ATOM   6819  C  CG    . ASN D 3  9   ? -12.727 44.502  2.282  1.00 120.37 ? 10  ASN C CG    1 
ATOM   6820  O  OD1   . ASN D 3  9   ? -12.734 45.662  1.832  1.00 132.28 ? 10  ASN C OD1   1 
ATOM   6821  N  ND2   . ASN D 3  9   ? -13.611 43.571  1.899  1.00 113.63 ? 10  ASN C ND2   1 
ATOM   6822  N  N     . GLU D 3  10  ? -11.506 46.563  4.477  1.00 154.96 ? 11  GLU C N     1 
ATOM   6823  C  CA    . GLU D 3  10  ? -11.619 47.669  5.417  1.00 159.98 ? 11  GLU C CA    1 
ATOM   6824  C  C     . GLU D 3  10  ? -12.697 47.337  6.437  1.00 163.47 ? 11  GLU C C     1 
ATOM   6825  O  O     . GLU D 3  10  ? -13.396 46.328  6.324  1.00 168.63 ? 11  GLU C O     1 
ATOM   6826  C  CB    . GLU D 3  10  ? -11.940 48.988  4.698  1.00 155.38 ? 11  GLU C CB    1 
ATOM   6827  N  N     . ARG D 3  11  ? -12.854 48.207  7.430  1.00 157.80 ? 12  ARG C N     1 
ATOM   6828  C  CA    . ARG D 3  11  ? -13.817 47.962  8.493  1.00 150.21 ? 12  ARG C CA    1 
ATOM   6829  C  C     . ARG D 3  11  ? -14.718 49.171  8.692  1.00 132.90 ? 12  ARG C C     1 
ATOM   6830  O  O     . ARG D 3  11  ? -14.238 50.292  8.886  1.00 123.68 ? 12  ARG C O     1 
ATOM   6831  C  CB    . ARG D 3  11  ? -13.119 47.600  9.805  1.00 156.05 ? 12  ARG C CB    1 
ATOM   6832  C  CG    . ARG D 3  11  ? -14.070 47.263  10.931 1.00 157.38 ? 12  ARG C CG    1 
ATOM   6833  C  CD    . ARG D 3  11  ? -14.643 45.869  10.793 1.00 154.28 ? 12  ARG C CD    1 
ATOM   6834  N  NE    . ARG D 3  11  ? -14.748 45.229  12.099 1.00 152.56 ? 12  ARG C NE    1 
ATOM   6835  C  CZ    . ARG D 3  11  ? -15.347 44.066  12.317 1.00 154.53 ? 12  ARG C CZ    1 
ATOM   6836  N  NH1   . ARG D 3  11  ? -15.912 43.403  11.316 1.00 150.49 ? 12  ARG C NH1   1 
ATOM   6837  N  NH2   . ARG D 3  11  ? -15.378 43.568  13.543 1.00 167.20 ? 12  ARG C NH2   1 
ATOM   6838  N  N     . ASN D 3  12  ? -16.024 48.925  8.643  1.00 125.97 ? 13  ASN C N     1 
ATOM   6839  C  CA    . ASN D 3  12  ? -17.015 49.942  8.960  1.00 125.59 ? 13  ASN C CA    1 
ATOM   6840  C  C     . ASN D 3  12  ? -16.888 50.323  10.429 1.00 136.88 ? 13  ASN C C     1 
ATOM   6841  O  O     . ASN D 3  12  ? -16.891 49.450  11.302 1.00 147.38 ? 13  ASN C O     1 
ATOM   6842  C  CB    . ASN D 3  12  ? -18.411 49.398  8.663  1.00 127.20 ? 13  ASN C CB    1 
ATOM   6843  C  CG    . ASN D 3  12  ? -19.496 50.437  8.819  1.00 129.31 ? 13  ASN C CG    1 
ATOM   6844  O  OD1   . ASN D 3  12  ? -19.232 51.641  8.825  1.00 129.56 ? 13  ASN C OD1   1 
ATOM   6845  N  ND2   . ASN D 3  12  ? -20.735 49.975  8.924  1.00 122.23 ? 13  ASN C ND2   1 
ATOM   6846  N  N     . ILE D 3  13  ? -16.728 51.617  10.716 1.00 197.80 ? 14  ILE C N     1 
ATOM   6847  C  CA    . ILE D 3  13  ? -16.493 52.013  12.106 1.00 172.12 ? 14  ILE C CA    1 
ATOM   6848  C  C     . ILE D 3  13  ? -17.672 51.616  12.982 1.00 156.49 ? 14  ILE C C     1 
ATOM   6849  O  O     . ILE D 3  13  ? -17.493 51.155  14.115 1.00 178.88 ? 14  ILE C O     1 
ATOM   6850  C  CB    . ILE D 3  13  ? -16.187 53.519  12.220 1.00 171.32 ? 14  ILE C CB    1 
ATOM   6851  C  CG1   . ILE D 3  13  ? -16.195 53.934  13.688 1.00 165.81 ? 14  ILE C CG1   1 
ATOM   6852  C  CG2   . ILE D 3  13  ? -17.215 54.337  11.464 1.00 188.64 ? 14  ILE C CG2   1 
ATOM   6853  C  CD1   . ILE D 3  13  ? -15.722 55.329  13.903 1.00 167.46 ? 14  ILE C CD1   1 
ATOM   6854  N  N     . THR D 3  14  ? -18.892 51.798  12.486 1.00 134.57 ? 15  THR C N     1 
ATOM   6855  C  CA    . THR D 3  14  ? -20.054 51.427  13.289 1.00 121.51 ? 15  THR C CA    1 
ATOM   6856  C  C     . THR D 3  14  ? -20.033 49.944  13.626 1.00 121.03 ? 15  THR C C     1 
ATOM   6857  O  O     . THR D 3  14  ? -20.318 49.550  14.764 1.00 129.27 ? 15  THR C O     1 
ATOM   6858  C  CB    . THR D 3  14  ? -21.360 51.775  12.569 1.00 120.74 ? 15  THR C CB    1 
ATOM   6859  O  OG1   . THR D 3  14  ? -21.504 53.198  12.503 1.00 127.76 ? 15  THR C OG1   1 
ATOM   6860  C  CG2   . THR D 3  14  ? -22.538 51.187  13.337 1.00 116.84 ? 15  THR C CG2   1 
ATOM   6861  N  N     . SER D 3  15  ? -19.704 49.103  12.647 1.00 116.74 ? 16  SER C N     1 
ATOM   6862  C  CA    . SER D 3  15  ? -19.629 47.671  12.907 1.00 113.43 ? 16  SER C CA    1 
ATOM   6863  C  C     . SER D 3  15  ? -18.565 47.372  13.946 1.00 112.24 ? 16  SER C C     1 
ATOM   6864  O  O     . SER D 3  15  ? -18.768 46.535  14.837 1.00 107.12 ? 16  SER C O     1 
ATOM   6865  C  CB    . SER D 3  15  ? -19.338 46.914  11.612 1.00 110.13 ? 16  SER C CB    1 
ATOM   6866  O  OG    . SER D 3  15  ? -20.448 46.982  10.738 1.00 115.57 ? 16  SER C OG    1 
ATOM   6867  N  N     . GLU D 3  16  ? -17.424 48.057  13.852 1.00 110.79 ? 17  GLU C N     1 
ATOM   6868  C  CA    . GLU D 3  16  ? -16.340 47.815  14.794 1.00 105.81 ? 17  GLU C CA    1 
ATOM   6869  C  C     . GLU D 3  16  ? -16.771 48.129  16.211 1.00 106.00 ? 17  GLU C C     1 
ATOM   6870  O  O     . GLU D 3  16  ? -16.537 47.338  17.134 1.00 106.56 ? 17  GLU C O     1 
ATOM   6871  C  CB    . GLU D 3  16  ? -15.114 48.655  14.429 1.00 105.04 ? 17  GLU C CB    1 
ATOM   6872  C  CG    . GLU D 3  16  ? -13.925 48.355  15.310 1.00 113.06 ? 17  GLU C CG    1 
ATOM   6873  C  CD    . GLU D 3  16  ? -13.419 46.924  15.114 1.00 124.59 ? 17  GLU C CD    1 
ATOM   6874  O  OE1   . GLU D 3  16  ? -14.070 46.129  14.382 1.00 128.87 ? 17  GLU C OE1   1 
ATOM   6875  O  OE2   . GLU D 3  16  ? -12.352 46.596  15.680 1.00 121.83 ? 17  GLU C OE2   1 
ATOM   6876  N  N     . MET D 3  17  ? -17.377 49.297  16.403 1.00 108.45 ? 18  MET C N     1 
ATOM   6877  C  CA    . MET D 3  17  ? -17.784 49.707  17.740 1.00 102.63 ? 18  MET C CA    1 
ATOM   6878  C  C     . MET D 3  17  ? -18.764 48.718  18.345 1.00 96.67  ? 18  MET C C     1 
ATOM   6879  O  O     . MET D 3  17  ? -18.636 48.354  19.517 1.00 98.73  ? 18  MET C O     1 
ATOM   6880  C  CB    . MET D 3  17  ? -18.390 51.104  17.695 1.00 94.19  ? 18  MET C CB    1 
ATOM   6881  C  CG    . MET D 3  17  ? -17.355 52.168  17.515 1.00 94.98  ? 18  MET C CG    1 
ATOM   6882  S  SD    . MET D 3  17  ? -16.464 52.464  19.058 1.00 103.61 ? 18  MET C SD    1 
ATOM   6883  C  CE    . MET D 3  17  ? -17.791 53.169  20.048 1.00 102.93 ? 18  MET C CE    1 
ATOM   6884  N  N     . ARG D 3  18  ? -19.746 48.265  17.567 1.00 89.41  ? 19  ARG C N     1 
ATOM   6885  C  CA    . ARG D 3  18  ? -20.732 47.340  18.114 1.00 87.11  ? 19  ARG C CA    1 
ATOM   6886  C  C     . ARG D 3  18  ? -20.084 46.024  18.518 1.00 91.26  ? 19  ARG C C     1 
ATOM   6887  O  O     . ARG D 3  18  ? -20.300 45.527  19.629 1.00 92.80  ? 19  ARG C O     1 
ATOM   6888  C  CB    . ARG D 3  18  ? -21.859 47.102  17.107 1.00 87.06  ? 19  ARG C CB    1 
ATOM   6889  C  CG    . ARG D 3  18  ? -22.761 48.290  16.919 1.00 91.12  ? 19  ARG C CG    1 
ATOM   6890  C  CD    . ARG D 3  18  ? -24.096 47.842  16.352 1.00 103.29 ? 19  ARG C CD    1 
ATOM   6891  N  NE    . ARG D 3  18  ? -24.117 47.852  14.889 1.00 113.69 ? 19  ARG C NE    1 
ATOM   6892  C  CZ    . ARG D 3  18  ? -24.756 48.765  14.156 1.00 113.15 ? 19  ARG C CZ    1 
ATOM   6893  N  NH1   . ARG D 3  18  ? -25.432 49.747  14.752 1.00 112.85 ? 19  ARG C NH1   1 
ATOM   6894  N  NH2   . ARG D 3  18  ? -24.724 48.697  12.825 1.00 109.16 ? 19  ARG C NH2   1 
ATOM   6895  N  N     . GLU D 3  19  ? -19.287 45.440  17.631 1.00 95.65  ? 20  GLU C N     1 
ATOM   6896  C  CA    . GLU D 3  19  ? -18.701 44.142  17.941 1.00 97.32  ? 20  GLU C CA    1 
ATOM   6897  C  C     . GLU D 3  19  ? -17.704 44.256  19.079 1.00 93.93  ? 20  GLU C C     1 
ATOM   6898  O  O     . GLU D 3  19  ? -17.707 43.438  20.007 1.00 95.13  ? 20  GLU C O     1 
ATOM   6899  C  CB    . GLU D 3  19  ? -18.034 43.548  16.700 1.00 96.89  ? 20  GLU C CB    1 
ATOM   6900  C  CG    . GLU D 3  19  ? -18.953 43.397  15.520 1.00 113.18 ? 20  GLU C CG    1 
ATOM   6901  C  CD    . GLU D 3  19  ? -18.213 42.898  14.298 1.00 128.17 ? 20  GLU C CD    1 
ATOM   6902  O  OE1   . GLU D 3  19  ? -18.831 42.825  13.211 1.00 126.91 ? 20  GLU C OE1   1 
ATOM   6903  O  OE2   . GLU D 3  19  ? -17.008 42.579  14.429 1.00 133.65 ? 20  GLU C OE2   1 
ATOM   6904  N  N     . SER D 3  20  ? -16.829 45.258  19.023 1.00 86.36  ? 21  SER C N     1 
ATOM   6905  C  CA    . SER D 3  20  ? -15.802 45.367  20.054 1.00 82.92  ? 21  SER C CA    1 
ATOM   6906  C  C     . SER D 3  20  ? -16.417 45.676  21.407 1.00 85.11  ? 21  SER C C     1 
ATOM   6907  O  O     . SER D 3  20  ? -16.032 45.084  22.424 1.00 81.75  ? 21  SER C O     1 
ATOM   6908  C  CB    . SER D 3  20  ? -14.767 46.426  19.676 1.00 83.77  ? 21  SER C CB    1 
ATOM   6909  O  OG    . SER D 3  20  ? -13.778 45.859  18.833 1.00 85.15  ? 21  SER C OG    1 
ATOM   6910  N  N     . PHE D 3  21  ? -17.373 46.591  21.442 1.00 90.29  ? 22  PHE C N     1 
ATOM   6911  C  CA    . PHE D 3  21  ? -17.992 46.939  22.712 1.00 85.55  ? 22  PHE C CA    1 
ATOM   6912  C  C     . PHE D 3  21  ? -18.736 45.751  23.303 1.00 85.60  ? 22  PHE C C     1 
ATOM   6913  O  O     . PHE D 3  21  ? -18.631 45.479  24.503 1.00 91.75  ? 22  PHE C O     1 
ATOM   6914  C  CB    . PHE D 3  21  ? -18.946 48.115  22.525 1.00 93.37  ? 22  PHE C CB    1 
ATOM   6915  C  CG    . PHE D 3  21  ? -19.586 48.558  23.784 1.00 97.08  ? 22  PHE C CG    1 
ATOM   6916  C  CD1   . PHE D 3  21  ? -18.892 49.381  24.662 1.00 100.97 ? 22  PHE C CD1   1 
ATOM   6917  C  CD2   . PHE D 3  21  ? -20.876 48.151  24.101 1.00 87.72  ? 22  PHE C CD2   1 
ATOM   6918  C  CE1   . PHE D 3  21  ? -19.478 49.800  25.827 1.00 95.00  ? 22  PHE C CE1   1 
ATOM   6919  C  CE2   . PHE D 3  21  ? -21.463 48.571  25.270 1.00 90.91  ? 22  PHE C CE2   1 
ATOM   6920  C  CZ    . PHE D 3  21  ? -20.755 49.383  26.131 1.00 92.68  ? 22  PHE C CZ    1 
ATOM   6921  N  N     . LEU D 3  22  ? -19.515 45.051  22.476 1.00 87.08  ? 23  LEU C N     1 
ATOM   6922  C  CA    . LEU D 3  22  ? -20.278 43.895  22.943 1.00 90.39  ? 23  LEU C CA    1 
ATOM   6923  C  C     . LEU D 3  22  ? -19.357 42.826  23.488 1.00 82.88  ? 23  LEU C C     1 
ATOM   6924  O  O     . LEU D 3  22  ? -19.692 42.116  24.442 1.00 86.98  ? 23  LEU C O     1 
ATOM   6925  C  CB    . LEU D 3  22  ? -21.107 43.325  21.801 1.00 92.87  ? 23  LEU C CB    1 
ATOM   6926  C  CG    . LEU D 3  22  ? -22.111 42.260  22.197 1.00 89.49  ? 23  LEU C CG    1 
ATOM   6927  C  CD1   . LEU D 3  22  ? -23.285 42.975  22.821 1.00 88.35  ? 23  LEU C CD1   1 
ATOM   6928  C  CD2   . LEU D 3  22  ? -22.528 41.470  20.973 1.00 86.84  ? 23  LEU C CD2   1 
ATOM   6929  N  N     A ASP D 3  23  ? -18.185 42.698  22.875 0.50 79.18  ? 24  ASP C N     1 
ATOM   6930  N  N     B ASP D 3  23  ? -18.186 42.694  22.888 0.50 78.87  ? 24  ASP C N     1 
ATOM   6931  C  CA    A ASP D 3  23  ? -17.177 41.734  23.296 0.50 79.55  ? 24  ASP C CA    1 
ATOM   6932  C  CA    B ASP D 3  23  ? -17.237 41.692  23.344 0.50 82.84  ? 24  ASP C CA    1 
ATOM   6933  C  C     A ASP D 3  23  ? -16.720 42.004  24.720 0.50 82.96  ? 24  ASP C C     1 
ATOM   6934  C  C     B ASP D 3  23  ? -16.743 42.000  24.748 0.50 84.23  ? 24  ASP C C     1 
ATOM   6935  O  O     A ASP D 3  23  ? -16.607 41.083  25.540 0.50 84.31  ? 24  ASP C O     1 
ATOM   6936  O  O     B ASP D 3  23  ? -16.627 41.094  25.585 0.50 83.79  ? 24  ASP C O     1 
ATOM   6937  C  CB    A ASP D 3  23  ? -16.001 41.811  22.318 0.50 81.68  ? 24  ASP C CB    1 
ATOM   6938  C  CB    B ASP D 3  23  ? -16.076 41.612  22.359 0.50 83.62  ? 24  ASP C CB    1 
ATOM   6939  C  CG    A ASP D 3  23  ? -14.994 40.694  22.498 0.50 81.60  ? 24  ASP C CG    1 
ATOM   6940  C  CG    B ASP D 3  23  ? -16.408 40.774  21.146 0.50 85.46  ? 24  ASP C CG    1 
ATOM   6941  O  OD1   A ASP D 3  23  ? -15.389 39.508  22.455 0.50 89.25  ? 24  ASP C OD1   1 
ATOM   6942  O  OD1   B ASP D 3  23  ? -17.310 39.916  21.244 0.50 82.26  ? 24  ASP C OD1   1 
ATOM   6943  O  OD2   A ASP D 3  23  ? -13.793 41.001  22.664 0.50 78.38  ? 24  ASP C OD2   1 
ATOM   6944  O  OD2   B ASP D 3  23  ? -15.748 40.964  20.100 0.50 83.60  ? 24  ASP C OD2   1 
ATOM   6945  N  N     . TYR D 3  24  ? -16.449 43.274  25.022 1.00 84.82  ? 25  TYR C N     1 
ATOM   6946  C  CA    . TYR D 3  24  ? -15.995 43.658  26.353 1.00 79.57  ? 25  TYR C CA    1 
ATOM   6947  C  C     . TYR D 3  24  ? -17.105 43.506  27.382 1.00 93.84  ? 25  TYR C C     1 
ATOM   6948  O  O     . TYR D 3  24  ? -16.919 42.852  28.424 1.00 70.95  ? 25  TYR C O     1 
ATOM   6949  C  CB    . TYR D 3  24  ? -15.491 45.101  26.329 1.00 69.76  ? 25  TYR C CB    1 
ATOM   6950  C  CG    . TYR D 3  24  ? -14.998 45.621  27.653 1.00 69.31  ? 25  TYR C CG    1 
ATOM   6951  C  CD1   . TYR D 3  24  ? -13.897 45.058  28.270 1.00 81.45  ? 25  TYR C CD1   1 
ATOM   6952  C  CD2   . TYR D 3  24  ? -15.629 46.690  28.288 1.00 69.74  ? 25  TYR C CD2   1 
ATOM   6953  C  CE1   . TYR D 3  24  ? -13.431 45.530  29.482 1.00 71.07  ? 25  TYR C CE1   1 
ATOM   6954  C  CE2   . TYR D 3  24  ? -15.180 47.167  29.504 1.00 69.25  ? 25  TYR C CE2   1 
ATOM   6955  C  CZ    . TYR D 3  24  ? -14.083 46.584  30.104 1.00 74.82  ? 25  TYR C CZ    1 
ATOM   6956  O  OH    . TYR D 3  24  ? -13.634 47.066  31.321 1.00 92.86  ? 25  TYR C OH    1 
ATOM   6957  N  N     . ALA D 3  25  ? -18.264 44.119  27.105 1.00 56.38  ? 26  ALA C N     1 
ATOM   6958  C  CA    . ALA D 3  25  ? -19.374 44.145  28.059 1.00 65.91  ? 26  ALA C CA    1 
ATOM   6959  C  C     . ALA D 3  25  ? -19.740 42.742  28.506 1.00 75.05  ? 26  ALA C C     1 
ATOM   6960  O  O     . ALA D 3  25  ? -19.897 42.462  29.707 1.00 100.57 ? 26  ALA C O     1 
ATOM   6961  C  CB    . ALA D 3  25  ? -20.578 44.819  27.407 1.00 48.89  ? 26  ALA C CB    1 
ATOM   6962  N  N     A MET D 3  26  ? -19.852 41.845  27.544 0.50 72.40  ? 27  MET C N     1 
ATOM   6963  N  N     B MET D 3  26  ? -19.892 41.837  27.528 0.50 72.42  ? 27  MET C N     1 
ATOM   6964  C  CA    A MET D 3  26  ? -20.252 40.474  27.799 0.50 72.39  ? 27  MET C CA    1 
ATOM   6965  C  CA    B MET D 3  26  ? -20.262 40.440  27.768 0.50 69.51  ? 27  MET C CA    1 
ATOM   6966  C  C     A MET D 3  26  ? -19.265 39.750  28.686 0.50 65.13  ? 27  MET C C     1 
ATOM   6967  C  C     B MET D 3  26  ? -19.272 39.745  28.681 0.50 64.03  ? 27  MET C C     1 
ATOM   6968  O  O     A MET D 3  26  ? -19.656 38.961  29.562 0.50 64.61  ? 27  MET C O     1 
ATOM   6969  O  O     B MET D 3  26  ? -19.663 38.949  29.550 0.50 65.20  ? 27  MET C O     1 
ATOM   6970  C  CB    A MET D 3  26  ? -20.384 39.798  26.449 0.50 76.62  ? 27  MET C CB    1 
ATOM   6971  C  CB    B MET D 3  26  ? -20.335 39.686  26.429 0.50 74.95  ? 27  MET C CB    1 
ATOM   6972  C  CG    A MET D 3  26  ? -21.665 40.174  25.803 0.50 81.57  ? 27  MET C CG    1 
ATOM   6973  C  CG    B MET D 3  26  ? -21.623 39.879  25.588 0.50 81.14  ? 27  MET C CG    1 
ATOM   6974  S  SD    A MET D 3  26  ? -22.772 39.300  26.869 0.50 89.30  ? 27  MET C SD    1 
ATOM   6975  S  SD    B MET D 3  26  ? -21.762 38.875  24.080 0.50 77.44  ? 27  MET C SD    1 
ATOM   6976  C  CE    A MET D 3  26  ? -22.053 37.667  26.650 0.50 80.88  ? 27  MET C CE    1 
ATOM   6977  C  CE    B MET D 3  26  ? -21.348 37.269  24.728 0.50 52.52  ? 27  MET C CE    1 
ATOM   6978  N  N     . SER D 3  27  ? -17.980 39.995  28.457 1.00 58.50  ? 28  SER C N     1 
ATOM   6979  C  CA    . SER D 3  27  ? -16.958 39.382  29.277 1.00 73.06  ? 28  SER C CA    1 
ATOM   6980  C  C     . SER D 3  27  ? -16.973 39.962  30.678 1.00 76.88  ? 28  SER C C     1 
ATOM   6981  O  O     . SER D 3  27  ? -16.867 39.218  31.664 1.00 88.31  ? 28  SER C O     1 
ATOM   6982  C  CB    . SER D 3  27  ? -15.610 39.595  28.635 1.00 79.07  ? 28  SER C CB    1 
ATOM   6983  O  OG    . SER D 3  27  ? -14.664 38.682  29.141 1.00 87.54  ? 28  SER C OG    1 
ATOM   6984  N  N     . VAL D 3  28  ? -17.098 41.285  30.783 1.00 73.34  ? 29  VAL C N     1 
ATOM   6985  C  CA    . VAL D 3  28  ? -17.215 41.927  32.084 1.00 62.68  ? 29  VAL C CA    1 
ATOM   6986  C  C     . VAL D 3  28  ? -18.454 41.431  32.809 1.00 67.75  ? 29  VAL C C     1 
ATOM   6987  O  O     . VAL D 3  28  ? -18.427 41.190  34.024 1.00 79.44  ? 29  VAL C O     1 
ATOM   6988  C  CB    . VAL D 3  28  ? -17.257 43.465  31.952 1.00 53.50  ? 29  VAL C CB    1 
ATOM   6989  C  CG1   . VAL D 3  28  ? -17.500 44.071  33.328 1.00 61.29  ? 29  VAL C CG1   1 
ATOM   6990  C  CG2   . VAL D 3  28  ? -15.965 44.039  31.330 1.00 51.06  ? 29  VAL C CG2   1 
ATOM   6991  N  N     . ILE D 3  29  ? -19.571 41.290  32.080 1.00 67.43  ? 30  ILE C N     1 
ATOM   6992  C  CA    . ILE D 3  29  ? -20.817 40.790  32.675 1.00 68.86  ? 30  ILE C CA    1 
ATOM   6993  C  C     . ILE D 3  29  ? -20.689 39.324  33.062 1.00 69.94  ? 30  ILE C C     1 
ATOM   6994  O  O     . ILE D 3  29  ? -21.092 38.926  34.156 1.00 78.63  ? 30  ILE C O     1 
ATOM   6995  C  CB    . ILE D 3  29  ? -22.007 40.979  31.725 1.00 68.24  ? 30  ILE C CB    1 
ATOM   6996  C  CG1   . ILE D 3  29  ? -22.387 42.447  31.533 1.00 74.91  ? 30  ILE C CG1   1 
ATOM   6997  C  CG2   . ILE D 3  29  ? -23.230 40.212  32.254 1.00 63.33  ? 30  ILE C CG2   1 
ATOM   6998  C  CD1   . ILE D 3  29  ? -23.162 42.687  30.260 1.00 85.35  ? 30  ILE C CD1   1 
ATOM   6999  N  N     . VAL D 3  30  ? -20.200 38.473  32.157 1.00 84.20  ? 31  VAL C N     1 
ATOM   7000  C  CA    . VAL D 3  30  ? -20.224 37.037  32.458 1.00 78.37  ? 31  VAL C CA    1 
ATOM   7001  C  C     . VAL D 3  30  ? -18.929 36.492  33.057 1.00 73.72  ? 31  VAL C C     1 
ATOM   7002  O  O     . VAL D 3  30  ? -18.941 35.363  33.561 1.00 79.26  ? 31  VAL C O     1 
ATOM   7003  C  CB    . VAL D 3  30  ? -20.599 36.140  31.242 1.00 67.71  ? 31  VAL C CB    1 
ATOM   7004  C  CG1   . VAL D 3  30  ? -21.923 36.535  30.644 1.00 70.06  ? 31  VAL C CG1   1 
ATOM   7005  C  CG2   . VAL D 3  30  ? -19.476 36.016  30.207 1.00 62.08  ? 31  VAL C CG2   1 
ATOM   7006  N  N     . ALA D 3  31  ? -17.829 37.224  33.030 1.00 79.39  ? 32  ALA C N     1 
ATOM   7007  C  CA    . ALA D 3  31  ? -16.596 36.607  33.531 1.00 76.85  ? 32  ALA C CA    1 
ATOM   7008  C  C     . ALA D 3  31  ? -15.717 37.580  34.281 1.00 76.45  ? 32  ALA C C     1 
ATOM   7009  O  O     . ALA D 3  31  ? -14.493 37.508  34.184 1.00 75.07  ? 32  ALA C O     1 
ATOM   7010  C  CB    . ALA D 3  31  ? -15.803 35.945  32.400 1.00 68.34  ? 32  ALA C CB    1 
ATOM   7011  N  N     . ARG D 3  32  ? -16.305 38.485  35.059 1.00 67.62  ? 33  ARG C N     1 
ATOM   7012  C  CA    . ARG D 3  32  ? -15.482 39.407  35.830 1.00 69.18  ? 33  ARG C CA    1 
ATOM   7013  C  C     . ARG D 3  32  ? -16.199 40.040  37.014 1.00 73.38  ? 33  ARG C C     1 
ATOM   7014  O  O     . ARG D 3  32  ? -15.760 39.904  38.164 1.00 69.83  ? 33  ARG C O     1 
ATOM   7015  C  CB    . ARG D 3  32  ? -14.947 40.532  34.941 1.00 65.06  ? 33  ARG C CB    1 
ATOM   7016  C  CG    . ARG D 3  32  ? -14.160 41.528  35.760 1.00 66.05  ? 33  ARG C CG    1 
ATOM   7017  C  CD    . ARG D 3  32  ? -13.586 42.611  34.913 1.00 69.28  ? 33  ARG C CD    1 
ATOM   7018  N  NE    . ARG D 3  32  ? -12.777 42.054  33.842 1.00 79.00  ? 33  ARG C NE    1 
ATOM   7019  C  CZ    . ARG D 3  32  ? -11.988 42.781  33.059 1.00 81.24  ? 33  ARG C CZ    1 
ATOM   7020  N  NH1   . ARG D 3  32  ? -11.906 44.094  33.243 1.00 72.28  ? 33  ARG C NH1   1 
ATOM   7021  N  NH2   . ARG D 3  32  ? -11.282 42.196  32.097 1.00 82.98  ? 33  ARG C NH2   1 
ATOM   7022  N  N     . ALA D 3  33  ? -17.273 40.769  36.741 1.00 81.19  ? 34  ALA C N     1 
ATOM   7023  C  CA    . ALA D 3  33  ? -17.875 41.641  37.737 1.00 64.06  ? 34  ALA C CA    1 
ATOM   7024  C  C     . ALA D 3  33  ? -19.065 41.025  38.456 1.00 55.26  ? 34  ALA C C     1 
ATOM   7025  O  O     . ALA D 3  33  ? -19.410 41.493  39.540 1.00 56.56  ? 34  ALA C O     1 
ATOM   7026  C  CB    . ALA D 3  33  ? -18.308 42.967  37.087 1.00 69.86  ? 34  ALA C CB    1 
ATOM   7027  N  N     . LEU D 3  34  ? -19.684 39.975  37.909 1.00 51.74  ? 35  LEU C N     1 
ATOM   7028  C  CA    . LEU D 3  34  ? -20.917 39.495  38.546 1.00 52.28  ? 35  LEU C CA    1 
ATOM   7029  C  C     . LEU D 3  34  ? -20.738 38.106  39.173 1.00 54.48  ? 35  LEU C C     1 
ATOM   7030  O  O     . LEU D 3  34  ? -20.074 37.247  38.584 1.00 54.53  ? 35  LEU C O     1 
ATOM   7031  C  CB    . LEU D 3  34  ? -22.077 39.455  37.548 1.00 56.61  ? 35  LEU C CB    1 
ATOM   7032  C  CG    . LEU D 3  34  ? -22.503 40.780  36.903 1.00 54.34  ? 35  LEU C CG    1 
ATOM   7033  C  CD1   . LEU D 3  34  ? -23.762 40.523  36.101 1.00 55.48  ? 35  LEU C CD1   1 
ATOM   7034  C  CD2   . LEU D 3  34  ? -22.717 41.883  37.940 1.00 44.68  ? 35  LEU C CD2   1 
ATOM   7035  N  N     . PRO D 3  35  ? -21.331 37.848  40.344 1.00 52.91  ? 36  PRO C N     1 
ATOM   7036  C  CA    . PRO D 3  35  ? -21.238 36.519  40.954 1.00 45.73  ? 36  PRO C CA    1 
ATOM   7037  C  C     . PRO D 3  35  ? -22.197 35.538  40.289 1.00 60.36  ? 36  PRO C C     1 
ATOM   7038  O  O     . PRO D 3  35  ? -23.236 35.896  39.729 1.00 66.71  ? 36  PRO C O     1 
ATOM   7039  C  CB    . PRO D 3  35  ? -21.651 36.787  42.401 1.00 47.47  ? 36  PRO C CB    1 
ATOM   7040  C  CG    . PRO D 3  35  ? -22.660 37.855  42.256 1.00 45.53  ? 36  PRO C CG    1 
ATOM   7041  C  CD    . PRO D 3  35  ? -22.079 38.774  41.204 1.00 51.45  ? 36  PRO C CD    1 
ATOM   7042  N  N     . ASP D 3  36  ? -21.840 34.263  40.388 1.00 66.06  ? 37  ASP C N     1 
ATOM   7043  C  CA    . ASP D 3  36  ? -22.747 33.201  39.995 1.00 57.28  ? 37  ASP C CA    1 
ATOM   7044  C  C     . ASP D 3  36  ? -23.711 32.961  41.155 1.00 52.46  ? 37  ASP C C     1 
ATOM   7045  O  O     . ASP D 3  36  ? -23.322 33.045  42.324 1.00 55.42  ? 37  ASP C O     1 
ATOM   7046  C  CB    . ASP D 3  36  ? -21.971 31.927  39.654 1.00 62.49  ? 37  ASP C CB    1 
ATOM   7047  C  CG    . ASP D 3  36  ? -22.796 30.919  38.876 1.00 68.95  ? 37  ASP C CG    1 
ATOM   7048  O  OD1   . ASP D 3  36  ? -23.699 30.306  39.472 1.00 83.84  ? 37  ASP C OD1   1 
ATOM   7049  O  OD2   . ASP D 3  36  ? -22.524 30.717  37.674 1.00 71.45  ? 37  ASP C OD2   1 
ATOM   7050  N  N     . VAL D 3  37  ? -24.984 32.713  40.831 1.00 47.03  ? 38  VAL C N     1 
ATOM   7051  C  CA    . VAL D 3  37  ? -25.977 32.582  41.892 1.00 52.74  ? 38  VAL C CA    1 
ATOM   7052  C  C     . VAL D 3  37  ? -25.741 31.346  42.746 1.00 61.38  ? 38  VAL C C     1 
ATOM   7053  O  O     . VAL D 3  37  ? -26.183 31.305  43.902 1.00 71.85  ? 38  VAL C O     1 
ATOM   7054  C  CB    . VAL D 3  37  ? -27.399 32.585  41.296 1.00 55.65  ? 38  VAL C CB    1 
ATOM   7055  C  CG1   . VAL D 3  37  ? -27.725 31.269  40.641 1.00 52.19  ? 38  VAL C CG1   1 
ATOM   7056  C  CG2   . VAL D 3  37  ? -28.443 32.889  42.355 1.00 70.62  ? 38  VAL C CG2   1 
ATOM   7057  N  N     . ARG D 3  38  ? -25.001 30.365  42.232 1.00 58.78  ? 39  ARG C N     1 
ATOM   7058  C  CA    . ARG D 3  38  ? -24.866 29.065  42.879 1.00 60.23  ? 39  ARG C CA    1 
ATOM   7059  C  C     . ARG D 3  38  ? -23.814 29.070  43.980 1.00 66.09  ? 39  ARG C C     1 
ATOM   7060  O  O     . ARG D 3  38  ? -24.047 28.512  45.060 1.00 73.88  ? 39  ARG C O     1 
ATOM   7061  C  CB    . ARG D 3  38  ? -24.547 28.009  41.820 1.00 66.10  ? 39  ARG C CB    1 
ATOM   7062  C  CG    . ARG D 3  38  ? -25.741 27.633  40.967 1.00 61.21  ? 39  ARG C CG    1 
ATOM   7063  C  CD    . ARG D 3  38  ? -25.338 26.890  39.715 1.00 62.25  ? 39  ARG C CD    1 
ATOM   7064  N  NE    . ARG D 3  38  ? -24.323 27.609  38.952 1.00 53.33  ? 39  ARG C NE    1 
ATOM   7065  C  CZ    . ARG D 3  38  ? -23.656 27.080  37.932 1.00 63.92  ? 39  ARG C CZ    1 
ATOM   7066  N  NH1   . ARG D 3  38  ? -23.906 25.829  37.564 1.00 74.51  ? 39  ARG C NH1   1 
ATOM   7067  N  NH2   . ARG D 3  38  ? -22.733 27.787  37.288 1.00 77.64  ? 39  ARG C NH2   1 
ATOM   7068  N  N     . ASP D 3  39  ? -22.652 29.661  43.738 1.00 70.52  ? 40  ASP C N     1 
ATOM   7069  C  CA    . ASP D 3  39  ? -21.601 29.711  44.752 1.00 66.41  ? 40  ASP C CA    1 
ATOM   7070  C  C     . ASP D 3  39  ? -21.263 31.118  45.231 1.00 61.62  ? 40  ASP C C     1 
ATOM   7071  O  O     . ASP D 3  39  ? -20.368 31.264  46.068 1.00 55.99  ? 40  ASP C O     1 
ATOM   7072  C  CB    . ASP D 3  39  ? -20.329 28.987  44.258 1.00 70.21  ? 40  ASP C CB    1 
ATOM   7073  C  CG    . ASP D 3  39  ? -19.681 29.645  43.030 1.00 62.09  ? 40  ASP C CG    1 
ATOM   7074  O  OD1   . ASP D 3  39  ? -20.097 30.737  42.590 1.00 58.15  ? 40  ASP C OD1   1 
ATOM   7075  O  OD2   . ASP D 3  39  ? -18.721 29.055  42.505 1.00 60.52  ? 40  ASP C OD2   1 
ATOM   7076  N  N     . GLY D 3  40  ? -21.944 32.145  44.731 1.00 53.89  ? 41  GLY C N     1 
ATOM   7077  C  CA    . GLY D 3  40  ? -21.692 33.502  45.142 1.00 47.02  ? 41  GLY C CA    1 
ATOM   7078  C  C     . GLY D 3  40  ? -20.397 34.104  44.670 1.00 60.87  ? 41  GLY C C     1 
ATOM   7079  O  O     . GLY D 3  40  ? -20.053 35.204  45.113 1.00 71.57  ? 41  GLY C O     1 
ATOM   7080  N  N     . LEU D 3  41  ? -19.673 33.439  43.775 1.00 57.86  ? 42  LEU C N     1 
ATOM   7081  C  CA    . LEU D 3  41  ? -18.319 33.837  43.438 1.00 56.96  ? 42  LEU C CA    1 
ATOM   7082  C  C     . LEU D 3  41  ? -18.249 34.492  42.063 1.00 65.92  ? 42  LEU C C     1 
ATOM   7083  O  O     . LEU D 3  41  ? -18.986 34.152  41.136 1.00 70.29  ? 42  LEU C O     1 
ATOM   7084  C  CB    . LEU D 3  41  ? -17.375 32.631  43.506 1.00 54.56  ? 42  LEU C CB    1 
ATOM   7085  C  CG    . LEU D 3  41  ? -17.206 31.966  44.887 1.00 58.64  ? 42  LEU C CG    1 
ATOM   7086  C  CD1   . LEU D 3  41  ? -16.375 30.705  44.839 1.00 54.43  ? 42  LEU C CD1   1 
ATOM   7087  C  CD2   . LEU D 3  41  ? -16.623 32.910  45.929 1.00 56.15  ? 42  LEU C CD2   1 
ATOM   7088  N  N     . LYS D 3  42  ? -17.370 35.446  41.964 1.00 62.71  ? 43  LYS C N     1 
ATOM   7089  C  CA    . LYS D 3  42  ? -16.855 35.953  40.713 1.00 56.84  ? 43  LYS C CA    1 
ATOM   7090  C  C     . LYS D 3  42  ? -15.633 35.148  40.316 1.00 58.65  ? 43  LYS C C     1 
ATOM   7091  O  O     . LYS D 3  42  ? -14.984 34.525  41.172 1.00 56.82  ? 43  LYS C O     1 
ATOM   7092  C  CB    . LYS D 3  42  ? -16.459 37.428  40.844 1.00 64.16  ? 43  LYS C CB    1 
ATOM   7093  C  CG    . LYS D 3  42  ? -17.542 38.372  41.306 1.00 57.86  ? 43  LYS C CG    1 
ATOM   7094  C  CD    . LYS D 3  42  ? -16.936 39.735  41.483 1.00 44.67  ? 43  LYS C CD    1 
ATOM   7095  C  CE    . LYS D 3  42  ? -17.852 40.639  42.254 1.00 54.61  ? 43  LYS C CE    1 
ATOM   7096  N  NZ    . LYS D 3  42  ? -17.054 41.762  42.773 1.00 62.36  ? 43  LYS C NZ    1 
ATOM   7097  N  N     . PRO D 3  43  ? -15.313 35.102  39.024 1.00 59.51  ? 44  PRO C N     1 
ATOM   7098  C  CA    . PRO D 3  43  ? -14.129 34.354  38.576 1.00 62.49  ? 44  PRO C CA    1 
ATOM   7099  C  C     . PRO D 3  43  ? -12.861 34.500  39.384 1.00 59.56  ? 44  PRO C C     1 
ATOM   7100  O  O     . PRO D 3  43  ? -12.235 33.493  39.721 1.00 66.11  ? 44  PRO C O     1 
ATOM   7101  C  CB    . PRO D 3  43  ? -13.924 34.908  37.174 1.00 61.02  ? 44  PRO C CB    1 
ATOM   7102  C  CG    . PRO D 3  43  ? -15.319 34.969  36.695 1.00 63.61  ? 44  PRO C CG    1 
ATOM   7103  C  CD    . PRO D 3  43  ? -16.111 35.535  37.872 1.00 66.22  ? 44  PRO C CD    1 
ATOM   7104  N  N     . VAL D 3  44  ? -12.447 35.722  39.704 1.00 52.88  ? 45  VAL C N     1 
ATOM   7105  C  CA    . VAL D 3  44  ? -11.169 35.864  40.389 1.00 53.71  ? 45  VAL C CA    1 
ATOM   7106  C  C     . VAL D 3  44  ? -11.222 35.189  41.757 1.00 67.70  ? 45  VAL C C     1 
ATOM   7107  O  O     . VAL D 3  44  ? -10.264 34.528  42.170 1.00 74.28  ? 45  VAL C O     1 
ATOM   7108  C  CB    . VAL D 3  44  ? -10.766 37.349  40.476 1.00 52.33  ? 45  VAL C CB    1 
ATOM   7109  C  CG1   . VAL D 3  44  ? -11.739 38.133  41.308 1.00 51.60  ? 45  VAL C CG1   1 
ATOM   7110  C  CG2   . VAL D 3  44  ? -9.357  37.476  41.018 1.00 55.88  ? 45  VAL C CG2   1 
ATOM   7111  N  N     . HIS D 3  45  ? -12.368 35.272  42.446 1.00 69.28  ? 46  HIS C N     1 
ATOM   7112  C  CA    . HIS D 3  45  ? -12.486 34.651  43.766 1.00 65.72  ? 46  HIS C CA    1 
ATOM   7113  C  C     . HIS D 3  45  ? -12.472 33.144  43.674 1.00 65.58  ? 46  HIS C C     1 
ATOM   7114  O  O     . HIS D 3  45  ? -11.801 32.479  44.470 1.00 70.54  ? 46  HIS C O     1 
ATOM   7115  C  CB    . HIS D 3  45  ? -13.770 35.115  44.452 1.00 69.35  ? 46  HIS C CB    1 
ATOM   7116  C  CG    . HIS D 3  45  ? -13.822 36.586  44.654 1.00 67.84  ? 46  HIS C CG    1 
ATOM   7117  N  ND1   . HIS D 3  45  ? -14.578 37.422  43.875 1.00 69.20  ? 46  HIS C ND1   1 
ATOM   7118  C  CD2   . HIS D 3  45  ? -13.148 37.380  45.517 1.00 74.01  ? 46  HIS C CD2   1 
ATOM   7119  C  CE1   . HIS D 3  45  ? -14.386 38.668  44.276 1.00 81.08  ? 46  HIS C CE1   1 
ATOM   7120  N  NE2   . HIS D 3  45  ? -13.524 38.670  45.271 1.00 75.12  ? 46  HIS C NE2   1 
ATOM   7121  N  N     . ARG D 3  46  ? -13.232 32.600  42.729 1.00 63.31  ? 47  ARG C N     1 
ATOM   7122  C  CA    . ARG D 3  46  ? -13.280 31.164  42.512 1.00 63.31  ? 47  ARG C CA    1 
ATOM   7123  C  C     . ARG D 3  46  ? -11.898 30.612  42.216 1.00 64.37  ? 47  ARG C C     1 
ATOM   7124  O  O     . ARG D 3  46  ? -11.497 29.573  42.749 1.00 63.92  ? 47  ARG C O     1 
ATOM   7125  C  CB    . ARG D 3  46  ? -14.224 30.856  41.357 1.00 58.89  ? 47  ARG C CB    1 
ATOM   7126  C  CG    . ARG D 3  46  ? -14.624 29.424  41.295 1.00 62.16  ? 47  ARG C CG    1 
ATOM   7127  C  CD    . ARG D 3  46  ? -15.607 29.167  40.184 1.00 67.37  ? 47  ARG C CD    1 
ATOM   7128  N  NE    . ARG D 3  46  ? -16.919 29.733  40.464 1.00 63.91  ? 47  ARG C NE    1 
ATOM   7129  C  CZ    . ARG D 3  46  ? -17.429 30.793  39.852 1.00 59.26  ? 47  ARG C CZ    1 
ATOM   7130  N  NH1   . ARG D 3  46  ? -16.746 31.414  38.908 1.00 62.20  ? 47  ARG C NH1   1 
ATOM   7131  N  NH2   . ARG D 3  46  ? -18.634 31.224  40.181 1.00 52.66  ? 47  ARG C NH2   1 
ATOM   7132  N  N     . ARG D 3  47  ? -11.163 31.295  41.350 1.00 64.04  ? 48  ARG C N     1 
ATOM   7133  C  CA    . ARG D 3  47  ? -9.814  30.865  41.009 1.00 59.24  ? 48  ARG C CA    1 
ATOM   7134  C  C     . ARG D 3  47  ? -8.886  30.939  42.206 1.00 57.50  ? 48  ARG C C     1 
ATOM   7135  O  O     . ARG D 3  47  ? -8.035  30.066  42.393 1.00 75.53  ? 48  ARG C O     1 
ATOM   7136  C  CB    . ARG D 3  47  ? -9.294  31.695  39.841 1.00 57.76  ? 48  ARG C CB    1 
ATOM   7137  C  CG    . ARG D 3  47  ? -10.042 31.376  38.573 1.00 57.95  ? 48  ARG C CG    1 
ATOM   7138  C  CD    . ARG D 3  47  ? -9.861  32.406  37.490 1.00 61.09  ? 48  ARG C CD    1 
ATOM   7139  N  NE    . ARG D 3  47  ? -10.503 31.964  36.255 1.00 63.93  ? 48  ARG C NE    1 
ATOM   7140  C  CZ    . ARG D 3  47  ? -10.673 32.728  35.183 1.00 66.96  ? 48  ARG C CZ    1 
ATOM   7141  N  NH1   . ARG D 3  47  ? -10.252 33.983  35.190 1.00 72.66  ? 48  ARG C NH1   1 
ATOM   7142  N  NH2   . ARG D 3  47  ? -11.255 32.237  34.099 1.00 62.96  ? 48  ARG C NH2   1 
ATOM   7143  N  N     . ILE D 3  48  ? -9.039  31.958  43.040 1.00 52.55  ? 49  ILE C N     1 
ATOM   7144  C  CA    . ILE D 3  48  ? -8.201  32.048  44.235 1.00 54.85  ? 49  ILE C CA    1 
ATOM   7145  C  C     . ILE D 3  48  ? -8.470  30.876  45.167 1.00 61.78  ? 49  ILE C C     1 
ATOM   7146  O  O     . ILE D 3  48  ? -7.536  30.217  45.644 1.00 75.28  ? 49  ILE C O     1 
ATOM   7147  C  CB    . ILE D 3  48  ? -8.389  33.401  44.946 1.00 56.32  ? 49  ILE C CB    1 
ATOM   7148  C  CG1   . ILE D 3  48  ? -7.812  34.542  44.110 1.00 58.44  ? 49  ILE C CG1   1 
ATOM   7149  C  CG2   . ILE D 3  48  ? -7.701  33.362  46.291 1.00 50.90  ? 49  ILE C CG2   1 
ATOM   7150  C  CD1   . ILE D 3  48  ? -8.281  35.901  44.535 1.00 66.33  ? 49  ILE C CD1   1 
ATOM   7151  N  N     . LEU D 3  49  ? -9.748  30.595  45.427 1.00 50.24  ? 50  LEU C N     1 
ATOM   7152  C  CA    . LEU D 3  49  ? -10.111 29.503  46.327 1.00 48.61  ? 50  LEU C CA    1 
ATOM   7153  C  C     . LEU D 3  49  ? -9.721  28.147  45.759 1.00 52.44  ? 50  LEU C C     1 
ATOM   7154  O  O     . LEU D 3  49  ? -9.151  27.301  46.464 1.00 50.74  ? 50  LEU C O     1 
ATOM   7155  C  CB    . LEU D 3  49  ? -11.605 29.531  46.606 1.00 47.41  ? 50  LEU C CB    1 
ATOM   7156  C  CG    . LEU D 3  49  ? -12.045 30.752  47.392 1.00 47.75  ? 50  LEU C CG    1 
ATOM   7157  C  CD1   . LEU D 3  49  ? -13.529 30.652  47.717 1.00 43.45  ? 50  LEU C CD1   1 
ATOM   7158  C  CD2   . LEU D 3  49  ? -11.181 30.865  48.641 1.00 41.27  ? 50  LEU C CD2   1 
ATOM   7159  N  N     . TYR D 3  50  ? -10.077 27.892  44.499 1.00 47.01  ? 51  TYR C N     1 
ATOM   7160  C  CA    . TYR D 3  50  ? -9.620  26.663  43.859 1.00 51.57  ? 51  TYR C CA    1 
ATOM   7161  C  C     . TYR D 3  50  ? -8.107  26.548  43.942 1.00 61.28  ? 51  TYR C C     1 
ATOM   7162  O  O     . TYR D 3  50  ? -7.567  25.486  44.267 1.00 64.48  ? 51  TYR C O     1 
ATOM   7163  C  CB    . TYR D 3  50  ? -10.074 26.625  42.405 1.00 50.86  ? 51  TYR C CB    1 
ATOM   7164  C  CG    . TYR D 3  50  ? -9.617  25.401  41.649 1.00 58.80  ? 51  TYR C CG    1 
ATOM   7165  C  CD1   . TYR D 3  50  ? -10.201 24.162  41.882 1.00 63.25  ? 51  TYR C CD1   1 
ATOM   7166  C  CD2   . TYR D 3  50  ? -8.617  25.487  40.686 1.00 84.99  ? 51  TYR C CD2   1 
ATOM   7167  C  CE1   . TYR D 3  50  ? -9.800  23.040  41.181 1.00 83.66  ? 51  TYR C CE1   1 
ATOM   7168  C  CE2   . TYR D 3  50  ? -8.209  24.370  39.976 1.00 96.00  ? 51  TYR C CE2   1 
ATOM   7169  C  CZ    . TYR D 3  50  ? -8.801  23.150  40.227 1.00 89.77  ? 51  TYR C CZ    1 
ATOM   7170  O  OH    . TYR D 3  50  ? -8.384  22.046  39.515 1.00 81.89  ? 51  TYR C OH    1 
ATOM   7171  N  N     . GLY D 3  51  ? -7.412  27.651  43.685 1.00 66.33  ? 52  GLY C N     1 
ATOM   7172  C  CA    . GLY D 3  51  ? -5.962  27.637  43.719 1.00 68.11  ? 52  GLY C CA    1 
ATOM   7173  C  C     . GLY D 3  51  ? -5.425  27.281  45.087 1.00 71.36  ? 52  GLY C C     1 
ATOM   7174  O  O     . GLY D 3  51  ? -4.435  26.564  45.202 1.00 57.67  ? 52  GLY C O     1 
ATOM   7175  N  N     . LEU D 3  52  ? -6.077  27.769  46.143 1.00 70.32  ? 53  LEU C N     1 
ATOM   7176  C  CA    . LEU D 3  52  ? -5.663  27.414  47.497 1.00 66.53  ? 53  LEU C CA    1 
ATOM   7177  C  C     . LEU D 3  52  ? -5.829  25.924  47.740 1.00 74.55  ? 53  LEU C C     1 
ATOM   7178  O  O     . LEU D 3  52  ? -4.983  25.283  48.375 1.00 84.62  ? 53  LEU C O     1 
ATOM   7179  C  CB    . LEU D 3  52  ? -6.476  28.211  48.513 1.00 62.56  ? 53  LEU C CB    1 
ATOM   7180  C  CG    . LEU D 3  52  ? -6.150  29.697  48.591 1.00 61.87  ? 53  LEU C CG    1 
ATOM   7181  C  CD1   . LEU D 3  52  ? -7.167  30.409  49.462 1.00 59.36  ? 53  LEU C CD1   1 
ATOM   7182  C  CD2   . LEU D 3  52  ? -4.752  29.893  49.140 1.00 63.88  ? 53  LEU C CD2   1 
ATOM   7183  N  N     . ASN D 3  53  ? -6.926  25.363  47.240 1.00 71.98  ? 54  ASN C N     1 
ATOM   7184  C  CA    . ASN D 3  53  ? -7.175  23.932  47.343 1.00 73.52  ? 54  ASN C CA    1 
ATOM   7185  C  C     . ASN D 3  53  ? -6.061  23.140  46.682 1.00 82.12  ? 54  ASN C C     1 
ATOM   7186  O  O     . ASN D 3  53  ? -5.412  22.299  47.316 1.00 89.19  ? 54  ASN C O     1 
ATOM   7187  C  CB    . ASN D 3  53  ? -8.525  23.608  46.701 1.00 74.71  ? 54  ASN C CB    1 
ATOM   7188  C  CG    . ASN D 3  53  ? -9.075  22.277  47.147 1.00 77.85  ? 54  ASN C CG    1 
ATOM   7189  O  OD1   . ASN D 3  53  ? -9.106  21.969  48.340 1.00 85.96  ? 54  ASN C OD1   1 
ATOM   7190  N  ND2   . ASN D 3  53  ? -9.529  21.479  46.186 1.00 86.69  ? 54  ASN C ND2   1 
ATOM   7191  N  N     . GLU D 3  54  ? -5.827  23.405  45.395 1.00 90.89  ? 55  GLU C N     1 
ATOM   7192  C  CA    . GLU D 3  54  ? -4.858  22.633  44.626 1.00 91.88  ? 55  GLU C CA    1 
ATOM   7193  C  C     . GLU D 3  54  ? -3.486  22.693  45.259 1.00 89.72  ? 55  GLU C C     1 
ATOM   7194  O  O     . GLU D 3  54  ? -2.777  21.683  45.325 1.00 91.50  ? 55  GLU C O     1 
ATOM   7195  C  CB    . GLU D 3  54  ? -4.794  23.147  43.189 1.00 84.25  ? 55  GLU C CB    1 
ATOM   7196  C  CG    . GLU D 3  54  ? -5.974  22.737  42.350 1.00 90.42  ? 55  GLU C CG    1 
ATOM   7197  C  CD    . GLU D 3  54  ? -6.185  21.233  42.352 1.00 102.02 ? 55  GLU C CD    1 
ATOM   7198  O  OE1   . GLU D 3  54  ? -5.734  20.565  41.395 1.00 101.24 ? 55  GLU C OE1   1 
ATOM   7199  O  OE2   . GLU D 3  54  ? -6.800  20.717  43.313 1.00 113.27 ? 55  GLU C OE2   1 
ATOM   7200  N  N     . GLN D 3  55  ? -3.086  23.873  45.713 1.00 93.38  ? 56  GLN C N     1 
ATOM   7201  C  CA    . GLN D 3  55  ? -1.815  24.022  46.399 1.00 105.81 ? 56  GLN C CA    1 
ATOM   7202  C  C     . GLN D 3  55  ? -1.780  23.273  47.717 1.00 106.50 ? 56  GLN C C     1 
ATOM   7203  O  O     . GLN D 3  55  ? -0.693  23.089  48.277 1.00 108.14 ? 56  GLN C O     1 
ATOM   7204  C  CB    . GLN D 3  55  ? -1.519  25.495  46.638 1.00 120.22 ? 56  GLN C CB    1 
ATOM   7205  C  CG    . GLN D 3  55  ? -1.469  26.333  45.378 1.00 129.18 ? 56  GLN C CG    1 
ATOM   7206  C  CD    . GLN D 3  55  ? -0.900  27.691  45.652 1.00 137.25 ? 56  GLN C CD    1 
ATOM   7207  O  OE1   . GLN D 3  55  ? 0.111   27.785  46.298 1.00 139.39 ? 56  GLN C OE1   1 
ATOM   7208  N  NE2   . GLN D 3  55  ? -1.549  28.744  45.189 1.00 139.41 ? 56  GLN C NE2   1 
ATOM   7209  N  N     . GLY D 3  56  ? -2.930  22.841  48.225 1.00 110.26 ? 57  GLY C N     1 
ATOM   7210  C  CA    . GLY D 3  56  ? -2.972  22.126  49.478 1.00 102.31 ? 57  GLY C CA    1 
ATOM   7211  C  C     . GLY D 3  56  ? -2.890  23.009  50.692 1.00 100.12 ? 57  GLY C C     1 
ATOM   7212  O  O     . GLY D 3  56  ? -2.477  22.532  51.751 1.00 101.17 ? 57  GLY C O     1 
ATOM   7213  N  N     . MET D 3  57  ? -3.289  24.277  50.583 1.00 109.77 ? 58  MET C N     1 
ATOM   7214  C  CA    . MET D 3  57  ? -3.244  25.224  51.701 1.00 111.65 ? 58  MET C CA    1 
ATOM   7215  C  C     . MET D 3  57  ? -4.505  25.115  52.563 1.00 117.54 ? 58  MET C C     1 
ATOM   7216  O  O     . MET D 3  57  ? -5.302  26.046  52.666 1.00 112.12 ? 58  MET C O     1 
ATOM   7217  C  CB    . MET D 3  57  ? -3.098  26.649  51.186 1.00 111.68 ? 58  MET C CB    1 
ATOM   7218  C  CG    . MET D 3  57  ? -2.144  26.822  50.051 1.00 115.16 ? 58  MET C CG    1 
ATOM   7219  S  SD    . MET D 3  57  ? -0.478  26.786  50.683 1.00 131.01 ? 58  MET C SD    1 
ATOM   7220  C  CE    . MET D 3  57  ? -0.759  27.637  52.237 1.00 135.56 ? 58  MET C CE    1 
ATOM   7221  N  N     . THR D 3  58  ? -4.674  23.963  53.203 1.00 120.36 ? 59  THR C N     1 
ATOM   7222  C  CA    . THR D 3  58  ? -5.830  23.728  54.071 1.00 104.96 ? 59  THR C CA    1 
ATOM   7223  C  C     . THR D 3  58  ? -5.599  24.386  55.426 1.00 105.78 ? 59  THR C C     1 
ATOM   7224  O  O     . THR D 3  58  ? -4.482  24.771  55.752 1.00 108.78 ? 59  THR C O     1 
ATOM   7225  C  CB    . THR D 3  58  ? -6.064  22.228  54.221 1.00 97.52  ? 59  THR C CB    1 
ATOM   7226  O  OG1   . THR D 3  58  ? -4.872  21.617  54.735 1.00 106.59 ? 59  THR C OG1   1 
ATOM   7227  C  CG2   . THR D 3  58  ? -6.433  21.598  52.912 1.00 83.71  ? 59  THR C CG2   1 
ATOM   7228  N  N     . PRO D 3  59  ? -6.635  24.544  56.265 1.00 97.13  ? 60  PRO C N     1 
ATOM   7229  C  CA    . PRO D 3  59  ? -6.394  25.210  57.556 1.00 90.81  ? 60  PRO C CA    1 
ATOM   7230  C  C     . PRO D 3  59  ? -5.475  24.432  58.495 1.00 104.23 ? 60  PRO C C     1 
ATOM   7231  O  O     . PRO D 3  59  ? -4.896  25.052  59.397 1.00 104.30 ? 60  PRO C O     1 
ATOM   7232  C  CB    . PRO D 3  59  ? -7.802  25.372  58.150 1.00 81.96  ? 60  PRO C CB    1 
ATOM   7233  C  CG    . PRO D 3  59  ? -8.705  25.339  56.992 1.00 94.11  ? 60  PRO C CG    1 
ATOM   7234  C  CD    . PRO D 3  59  ? -8.077  24.364  56.030 1.00 93.42  ? 60  PRO C CD    1 
ATOM   7235  N  N     . ASP D 3  60  ? -5.331  23.103  58.319 1.00 113.23 ? 61  ASP C N     1 
ATOM   7236  C  CA    . ASP D 3  60  ? -4.435  22.269  59.123 1.00 106.56 ? 61  ASP C CA    1 
ATOM   7237  C  C     . ASP D 3  60  ? -2.970  22.458  58.761 1.00 114.38 ? 61  ASP C C     1 
ATOM   7238  O  O     . ASP D 3  60  ? -2.092  22.061  59.535 1.00 116.12 ? 61  ASP C O     1 
ATOM   7239  C  CB    . ASP D 3  60  ? -4.790  20.777  58.986 1.00 111.64 ? 61  ASP C CB    1 
ATOM   7240  C  CG    . ASP D 3  60  ? -4.766  20.300  57.546 1.00 117.02 ? 61  ASP C CG    1 
ATOM   7241  O  OD1   . ASP D 3  60  ? -5.377  20.983  56.725 1.00 118.76 ? 61  ASP C OD1   1 
ATOM   7242  O  OD2   . ASP D 3  60  ? -4.154  19.259  57.222 1.00 119.43 ? 61  ASP C OD2   1 
ATOM   7243  N  N     . LYS D 3  61  ? -2.696  23.029  57.590 1.00 110.92 ? 62  LYS C N     1 
ATOM   7244  C  CA    . LYS D 3  61  ? -1.365  23.311  57.081 1.00 111.73 ? 62  LYS C CA    1 
ATOM   7245  C  C     . LYS D 3  61  ? -0.956  24.750  57.382 1.00 107.73 ? 62  LYS C C     1 
ATOM   7246  O  O     . LYS D 3  61  ? -1.782  25.608  57.703 1.00 111.01 ? 62  LYS C O     1 
ATOM   7247  C  CB    . LYS D 3  61  ? -1.310  23.066  55.569 1.00 109.23 ? 62  LYS C CB    1 
ATOM   7248  C  CG    . LYS D 3  61  ? -0.684  21.751  55.157 1.00 106.58 ? 62  LYS C CG    1 
ATOM   7249  C  CD    . LYS D 3  61  ? -1.715  20.645  55.097 1.00 116.34 ? 62  LYS C CD    1 
ATOM   7250  C  CE    . LYS D 3  61  ? -1.157  19.421  54.393 1.00 133.15 ? 62  LYS C CE    1 
ATOM   7251  N  NZ    . LYS D 3  61  ? -2.220  18.422  54.102 1.00 136.68 ? 62  LYS C NZ    1 
ATOM   7252  N  N     . SER D 3  62  ? 0.341   25.008  57.230 1.00 105.17 ? 63  SER C N     1 
ATOM   7253  C  CA    . SER D 3  62  ? 0.909   26.309  57.543 1.00 105.01 ? 63  SER C CA    1 
ATOM   7254  C  C     . SER D 3  62  ? 0.578   27.343  56.468 1.00 107.55 ? 63  SER C C     1 
ATOM   7255  O  O     . SER D 3  62  ? 0.258   27.022  55.320 1.00 104.46 ? 63  SER C O     1 
ATOM   7256  C  CB    . SER D 3  62  ? 2.425   26.201  57.714 1.00 95.36  ? 63  SER C CB    1 
ATOM   7257  O  OG    . SER D 3  62  ? 2.999   25.596  56.567 1.00 93.40  ? 63  SER C OG    1 
ATOM   7258  N  N     . TYR D 3  63  ? 0.685   28.609  56.876 1.00 101.55 ? 64  TYR C N     1 
ATOM   7259  C  CA    . TYR D 3  63  ? 0.467   29.748  55.993 1.00 90.53  ? 64  TYR C CA    1 
ATOM   7260  C  C     . TYR D 3  63  ? 1.494   29.782  54.867 1.00 98.96  ? 64  TYR C C     1 
ATOM   7261  O  O     . TYR D 3  63  ? 2.663   29.443  55.057 1.00 109.90 ? 64  TYR C O     1 
ATOM   7262  C  CB    . TYR D 3  63  ? 0.581   31.047  56.787 1.00 91.62  ? 64  TYR C CB    1 
ATOM   7263  C  CG    . TYR D 3  63  ? -0.497  31.326  57.793 1.00 100.15 ? 64  TYR C CG    1 
ATOM   7264  C  CD1   . TYR D 3  63  ? -1.701  31.876  57.397 1.00 102.00 ? 64  TYR C CD1   1 
ATOM   7265  C  CD2   . TYR D 3  63  ? -0.293  31.089  59.147 1.00 103.85 ? 64  TYR C CD2   1 
ATOM   7266  C  CE1   . TYR D 3  63  ? -2.683  32.157  58.307 1.00 94.95  ? 64  TYR C CE1   1 
ATOM   7267  C  CE2   . TYR D 3  63  ? -1.276  31.367  60.070 1.00 92.97  ? 64  TYR C CE2   1 
ATOM   7268  C  CZ    . TYR D 3  63  ? -2.470  31.902  59.642 1.00 89.46  ? 64  TYR C CZ    1 
ATOM   7269  O  OH    . TYR D 3  63  ? -3.460  32.186  60.549 1.00 93.31  ? 64  TYR C OH    1 
ATOM   7270  N  N     . LYS D 3  64  ? 1.068   30.245  53.694 1.00 100.51 ? 65  LYS C N     1 
ATOM   7271  C  CA    . LYS D 3  64  ? 1.958   30.358  52.543 1.00 95.03  ? 65  LYS C CA    1 
ATOM   7272  C  C     . LYS D 3  64  ? 2.164   31.810  52.161 1.00 92.10  ? 65  LYS C C     1 
ATOM   7273  O  O     . LYS D 3  64  ? 1.277   32.648  52.334 1.00 88.71  ? 65  LYS C O     1 
ATOM   7274  C  CB    . LYS D 3  64  ? 1.409   29.631  51.318 1.00 84.98  ? 65  LYS C CB    1 
ATOM   7275  C  CG    . LYS D 3  64  ? 2.343   29.379  50.183 1.00 98.34  ? 65  LYS C CG    1 
ATOM   7276  C  CD    . LYS D 3  64  ? 1.587   28.817  48.981 1.00 109.00 ? 65  LYS C CD    1 
ATOM   7277  C  CE    . LYS D 3  64  ? 2.564   28.513  47.862 1.00 114.34 ? 65  LYS C CE    1 
ATOM   7278  N  NZ    . LYS D 3  64  ? 1.926   28.040  46.626 1.00 130.50 ? 65  LYS C NZ    1 
ATOM   7279  N  N     . LYS D 3  65  ? 3.341   32.081  51.609 1.00 94.18  ? 66  LYS C N     1 
ATOM   7280  C  CA    . LYS D 3  65  ? 3.660   33.420  51.138 1.00 91.18  ? 66  LYS C CA    1 
ATOM   7281  C  C     . LYS D 3  65  ? 2.676   33.850  50.057 1.00 79.83  ? 66  LYS C C     1 
ATOM   7282  O  O     . LYS D 3  65  ? 2.477   33.143  49.066 1.00 81.58  ? 66  LYS C O     1 
ATOM   7283  C  CB    . LYS D 3  65  ? 5.087   33.461  50.598 1.00 110.96 ? 66  LYS C CB    1 
ATOM   7284  C  CG    . LYS D 3  65  ? 5.811   34.776  50.811 1.00 124.99 ? 66  LYS C CG    1 
ATOM   7285  C  CD    . LYS D 3  65  ? 6.316   34.880  52.234 1.00 134.13 ? 66  LYS C CD    1 
ATOM   7286  N  N     . SER D 3  66  ? 2.066   35.025  50.249 1.00 74.99  ? 67  SER C N     1 
ATOM   7287  C  CA    . SER D 3  66  ? 0.996   35.471  49.357 1.00 70.37  ? 67  SER C CA    1 
ATOM   7288  C  C     . SER D 3  66  ? 1.468   35.545  47.916 1.00 79.26  ? 67  SER C C     1 
ATOM   7289  O  O     . SER D 3  66  ? 0.705   35.253  46.990 1.00 75.07  ? 67  SER C O     1 
ATOM   7290  C  CB    . SER D 3  66  ? 0.463   36.829  49.809 1.00 65.63  ? 67  SER C CB    1 
ATOM   7291  O  OG    . SER D 3  66  ? 0.235   36.818  51.201 1.00 61.23  ? 67  SER C OG    1 
ATOM   7292  N  N     . ALA D 3  67  ? 2.720   35.940  47.708 1.00 86.62  ? 68  ALA C N     1 
ATOM   7293  C  CA    . ALA D 3  67  ? 3.227   36.085  46.349 1.00 80.62  ? 68  ALA C CA    1 
ATOM   7294  C  C     . ALA D 3  67  ? 3.182   34.769  45.594 1.00 78.40  ? 68  ALA C C     1 
ATOM   7295  O  O     . ALA D 3  67  ? 2.822   34.730  44.411 1.00 86.18  ? 68  ALA C O     1 
ATOM   7296  C  CB    . ALA D 3  67  ? 4.650   36.650  46.355 1.00 82.01  ? 68  ALA C CB    1 
ATOM   7297  N  N     . ARG D 3  68  ? 3.564   33.681  46.252 1.00 77.40  ? 69  ARG C N     1 
ATOM   7298  C  CA    . ARG D 3  68  ? 3.519   32.386  45.593 1.00 82.25  ? 69  ARG C CA    1 
ATOM   7299  C  C     . ARG D 3  68  ? 2.094   32.012  45.249 1.00 83.36  ? 69  ARG C C     1 
ATOM   7300  O  O     . ARG D 3  68  ? 1.827   31.502  44.152 1.00 85.43  ? 69  ARG C O     1 
ATOM   7301  C  CB    . ARG D 3  68  ? 4.137   31.320  46.485 1.00 84.21  ? 69  ARG C CB    1 
ATOM   7302  C  CG    . ARG D 3  68  ? 5.606   31.503  46.739 1.00 98.55  ? 69  ARG C CG    1 
ATOM   7303  C  CD    . ARG D 3  68  ? 6.192   30.234  47.325 1.00 106.45 ? 69  ARG C CD    1 
ATOM   7304  N  NE    . ARG D 3  68  ? 6.107   29.118  46.387 1.00 107.14 ? 69  ARG C NE    1 
ATOM   7305  C  CZ    . ARG D 3  68  ? 6.468   27.871  46.674 1.00 116.06 ? 69  ARG C CZ    1 
ATOM   7306  N  NH1   . ARG D 3  68  ? 6.363   26.919  45.755 1.00 117.56 ? 69  ARG C NH1   1 
ATOM   7307  N  NH2   . ARG D 3  68  ? 6.933   27.574  47.881 1.00 120.53 ? 69  ARG C NH2   1 
ATOM   7308  N  N     . ILE D 3  69  ? 1.171   32.249  46.186 1.00 78.19  ? 70  ILE C N     1 
ATOM   7309  C  CA    . ILE D 3  69  ? -0.243  31.962  45.950 1.00 84.86  ? 70  ILE C CA    1 
ATOM   7310  C  C     . ILE D 3  69  ? -0.713  32.660  44.694 1.00 91.39  ? 70  ILE C C     1 
ATOM   7311  O  O     . ILE D 3  69  ? -1.372  32.071  43.831 1.00 103.32 ? 70  ILE C O     1 
ATOM   7312  C  CB    . ILE D 3  69  ? -1.090  32.410  47.145 1.00 81.89  ? 70  ILE C CB    1 
ATOM   7313  C  CG1   . ILE D 3  69  ? -0.578  31.799  48.452 1.00 86.95  ? 70  ILE C CG1   1 
ATOM   7314  C  CG2   . ILE D 3  69  ? -2.535  32.063  46.885 1.00 79.79  ? 70  ILE C CG2   1 
ATOM   7315  C  CD1   . ILE D 3  69  ? -1.571  31.963  49.551 1.00 79.34  ? 70  ILE C CD1   1 
ATOM   7316  N  N     . VAL D 3  70  ? -0.405  33.947  44.606 1.00 73.85  ? 71  VAL C N     1 
ATOM   7317  C  CA    . VAL D 3  70  ? -0.884  34.775  43.512 1.00 70.94  ? 71  VAL C CA    1 
ATOM   7318  C  C     . VAL D 3  70  ? -0.226  34.364  42.205 1.00 76.65  ? 71  VAL C C     1 
ATOM   7319  O  O     . VAL D 3  70  ? -0.898  34.223  41.182 1.00 77.43  ? 71  VAL C O     1 
ATOM   7320  C  CB    . VAL D 3  70  ? -0.640  36.259  43.835 1.00 68.17  ? 71  VAL C CB    1 
ATOM   7321  C  CG1   . VAL D 3  70  ? -1.024  37.089  42.668 1.00 71.68  ? 71  VAL C CG1   1 
ATOM   7322  C  CG2   . VAL D 3  70  ? -1.450  36.675  45.036 1.00 73.19  ? 71  VAL C CG2   1 
ATOM   7323  N  N     . GLY D 3  71  ? 1.092   34.165  42.218 1.00 81.01  ? 72  GLY C N     1 
ATOM   7324  C  CA    . GLY D 3  71  ? 1.779   33.741  41.005 1.00 86.56  ? 72  GLY C CA    1 
ATOM   7325  C  C     . GLY D 3  71  ? 1.200   32.473  40.405 1.00 91.20  ? 72  GLY C C     1 
ATOM   7326  O  O     . GLY D 3  71  ? 1.150   32.314  39.182 1.00 99.47  ? 72  GLY C O     1 
ATOM   7327  N  N     . ASP D 3  72  ? 0.735   31.561  41.258 1.00 99.42  ? 73  ASP C N     1 
ATOM   7328  C  CA    . ASP D 3  72  ? 0.140   30.317  40.780 1.00 100.04 ? 73  ASP C CA    1 
ATOM   7329  C  C     . ASP D 3  72  ? -1.236  30.554  40.181 1.00 81.59  ? 73  ASP C C     1 
ATOM   7330  O  O     . ASP D 3  72  ? -1.553  30.040  39.101 1.00 87.29  ? 73  ASP C O     1 
ATOM   7331  C  CB    . ASP D 3  72  ? 0.043   29.306  41.924 1.00 102.29 ? 73  ASP C CB    1 
ATOM   7332  C  CG    . ASP D 3  72  ? 1.305   28.526  42.113 1.00 127.11 ? 73  ASP C CG    1 
ATOM   7333  O  OD1   . ASP D 3  72  ? 2.238   28.730  41.315 1.00 133.55 ? 73  ASP C OD1   1 
ATOM   7334  O  OD2   . ASP D 3  72  ? 1.358   27.696  43.048 1.00 139.38 ? 73  ASP C OD2   1 
ATOM   7335  N  N     . VAL D 3  73  ? -2.084  31.292  40.891 1.00 67.64  ? 74  VAL C N     1 
ATOM   7336  C  CA    . VAL D 3  73  ? -3.409  31.603  40.365 1.00 65.79  ? 74  VAL C CA    1 
ATOM   7337  C  C     . VAL D 3  73  ? -3.289  32.341  39.046 1.00 70.92  ? 74  VAL C C     1 
ATOM   7338  O  O     . VAL D 3  73  ? -4.017  32.069  38.080 1.00 74.63  ? 74  VAL C O     1 
ATOM   7339  C  CB    . VAL D 3  73  ? -4.207  32.440  41.375 1.00 65.30  ? 74  VAL C CB    1 
ATOM   7340  C  CG1   . VAL D 3  73  ? -5.561  32.782  40.787 1.00 71.23  ? 74  VAL C CG1   1 
ATOM   7341  C  CG2   . VAL D 3  73  ? -4.322  31.707  42.683 1.00 57.00  ? 74  VAL C CG2   1 
ATOM   7342  N  N     . MET D 3  74  ? -2.384  33.313  38.998 1.00 78.23  ? 75  MET C N     1 
ATOM   7343  C  CA    . MET D 3  74  ? -2.245  34.138  37.808 1.00 79.33  ? 75  MET C CA    1 
ATOM   7344  C  C     . MET D 3  74  ? -1.822  33.300  36.614 1.00 78.66  ? 75  MET C C     1 
ATOM   7345  O  O     . MET D 3  74  ? -2.387  33.417  35.527 1.00 90.70  ? 75  MET C O     1 
ATOM   7346  C  CB    . MET D 3  74  ? -1.247  35.270  38.065 1.00 82.31  ? 75  MET C CB    1 
ATOM   7347  C  CG    . MET D 3  74  ? -0.806  35.956  36.781 1.00 87.47  ? 75  MET C CG    1 
ATOM   7348  S  SD    . MET D 3  74  ? 0.198   37.420  37.091 1.00 86.82  ? 75  MET C SD    1 
ATOM   7349  C  CE    . MET D 3  74  ? 1.629   36.702  37.887 1.00 78.55  ? 75  MET C CE    1 
ATOM   7350  N  N     . GLY D 3  75  ? -0.824  32.446  36.795 1.00 78.22  ? 76  GLY C N     1 
ATOM   7351  C  CA    . GLY D 3  75  ? -0.340  31.666  35.672 1.00 88.71  ? 76  GLY C CA    1 
ATOM   7352  C  C     . GLY D 3  75  ? -1.310  30.587  35.251 1.00 99.37  ? 76  GLY C C     1 
ATOM   7353  O  O     . GLY D 3  75  ? -1.505  30.350  34.055 1.00 113.41 ? 76  GLY C O     1 
ATOM   7354  N  N     . LYS D 3  76  ? -1.977  29.968  36.225 1.00 92.54  ? 77  LYS C N     1 
ATOM   7355  C  CA    . LYS D 3  76  ? -2.787  28.774  35.983 1.00 85.36  ? 77  LYS C CA    1 
ATOM   7356  C  C     . LYS D 3  76  ? -4.209  29.092  35.524 1.00 87.70  ? 77  LYS C C     1 
ATOM   7357  O  O     . LYS D 3  76  ? -4.762  28.348  34.703 1.00 85.59  ? 77  LYS C O     1 
ATOM   7358  C  CB    . LYS D 3  76  ? -2.812  27.899  37.242 1.00 71.80  ? 77  LYS C CB    1 
ATOM   7359  C  CG    . LYS D 3  76  ? -1.482  27.318  37.587 1.00 71.81  ? 77  LYS C CG    1 
ATOM   7360  C  CD    . LYS D 3  76  ? -1.638  26.118  38.467 1.00 69.97  ? 77  LYS C CD    1 
ATOM   7361  C  CE    . LYS D 3  76  ? -0.304  25.447  38.706 1.00 75.86  ? 77  LYS C CE    1 
ATOM   7362  N  NZ    . LYS D 3  76  ? -0.417  24.317  39.673 1.00 81.62  ? 77  LYS C NZ    1 
ATOM   7363  N  N     . TYR D 3  77  ? -4.836  30.133  36.056 1.00 82.97  ? 78  TYR C N     1 
ATOM   7364  C  CA    . TYR D 3  77  ? -6.273  30.318  35.822 1.00 79.71  ? 78  TYR C CA    1 
ATOM   7365  C  C     . TYR D 3  77  ? -6.683  31.737  35.413 1.00 77.05  ? 78  TYR C C     1 
ATOM   7366  O  O     . TYR D 3  77  ? -7.669  31.935  34.685 1.00 71.69  ? 78  TYR C O     1 
ATOM   7367  C  CB    . TYR D 3  77  ? -7.092  29.907  37.049 1.00 76.58  ? 78  TYR C CB    1 
ATOM   7368  C  CG    . TYR D 3  77  ? -6.605  28.642  37.720 1.00 75.15  ? 78  TYR C CG    1 
ATOM   7369  C  CD1   . TYR D 3  77  ? -6.691  27.419  37.079 1.00 68.63  ? 78  TYR C CD1   1 
ATOM   7370  C  CD2   . TYR D 3  77  ? -6.053  28.670  38.996 1.00 79.71  ? 78  TYR C CD2   1 
ATOM   7371  C  CE1   . TYR D 3  77  ? -6.241  26.254  37.679 1.00 73.87  ? 78  TYR C CE1   1 
ATOM   7372  C  CE2   . TYR D 3  77  ? -5.604  27.502  39.607 1.00 77.58  ? 78  TYR C CE2   1 
ATOM   7373  C  CZ    . TYR D 3  77  ? -5.703  26.300  38.941 1.00 78.95  ? 78  TYR C CZ    1 
ATOM   7374  O  OH    . TYR D 3  77  ? -5.270  25.136  39.532 1.00 79.54  ? 78  TYR C OH    1 
ATOM   7375  N  N     . HIS D 3  78  ? -5.921  32.721  35.878 1.00 82.69  ? 79  HIS C N     1 
ATOM   7376  C  CA    . HIS D 3  78  ? -6.252  34.146  35.780 1.00 78.05  ? 79  HIS C CA    1 
ATOM   7377  C  C     . HIS D 3  78  ? -5.152  34.907  35.044 1.00 89.99  ? 79  HIS C C     1 
ATOM   7378  O  O     . HIS D 3  78  ? -4.185  35.357  35.684 1.00 93.90  ? 79  HIS C O     1 
ATOM   7379  C  CB    . HIS D 3  78  ? -6.419  34.728  37.179 1.00 67.08  ? 79  HIS C CB    1 
ATOM   7380  C  CG    . HIS D 3  78  ? -7.442  35.804  37.279 1.00 64.10  ? 79  HIS C CG    1 
ATOM   7381  N  ND1   . HIS D 3  78  ? -8.777  35.568  37.053 1.00 63.63  ? 79  HIS C ND1   1 
ATOM   7382  C  CD2   . HIS D 3  78  ? -7.339  37.110  37.611 1.00 64.15  ? 79  HIS C CD2   1 
ATOM   7383  C  CE1   . HIS D 3  78  ? -9.455  36.683  37.236 1.00 64.35  ? 79  HIS C CE1   1 
ATOM   7384  N  NE2   . HIS D 3  78  ? -8.606  37.635  37.575 1.00 62.76  ? 79  HIS C NE2   1 
ATOM   7385  N  N     . PRO D 3  79  ? -5.260  35.124  33.775 1.00 89.54  ? 80  PRO C N     1 
ATOM   7386  C  CA    . PRO D 3  79  ? -4.186  35.876  33.095 1.00 89.02  ? 80  PRO C CA    1 
ATOM   7387  C  C     . PRO D 3  79  ? -4.354  37.382  33.269 1.00 89.59  ? 80  PRO C C     1 
ATOM   7388  O  O     . PRO D 3  79  ? -4.617  38.132  32.319 1.00 84.75  ? 80  PRO C O     1 
ATOM   7389  C  CB    . PRO D 3  79  ? -4.364  35.434  31.643 1.00 85.41  ? 80  PRO C CB    1 
ATOM   7390  C  CG    . PRO D 3  79  ? -5.860  35.373  31.517 1.00 86.96  ? 80  PRO C CG    1 
ATOM   7391  C  CD    . PRO D 3  79  ? -6.361  34.814  32.850 1.00 86.05  ? 80  PRO C CD    1 
ATOM   7392  N  N     . HIS D 3  80  ? -4.240  37.862  34.510 1.00 80.04  ? 81  HIS C N     1 
ATOM   7393  C  CA    . HIS D 3  80  ? -4.439  39.276  34.796 1.00 71.84  ? 81  HIS C CA    1 
ATOM   7394  C  C     . HIS D 3  80  ? -3.385  39.742  35.782 1.00 70.85  ? 81  HIS C C     1 
ATOM   7395  O  O     . HIS D 3  80  ? -2.635  38.948  36.341 1.00 78.15  ? 81  HIS C O     1 
ATOM   7396  C  CB    . HIS D 3  80  ? -5.847  39.546  35.326 1.00 69.32  ? 81  HIS C CB    1 
ATOM   7397  C  CG    . HIS D 3  80  ? -6.925  39.249  34.336 1.00 73.91  ? 81  HIS C CG    1 
ATOM   7398  N  ND1   . HIS D 3  80  ? -7.161  40.048  33.243 1.00 78.25  ? 81  HIS C ND1   1 
ATOM   7399  C  CD2   . HIS D 3  80  ? -7.825  38.241  34.268 1.00 72.95  ? 81  HIS C CD2   1 
ATOM   7400  C  CE1   . HIS D 3  80  ? -8.165  39.551  32.546 1.00 80.41  ? 81  HIS C CE1   1 
ATOM   7401  N  NE2   . HIS D 3  80  ? -8.586  38.453  33.145 1.00 72.32  ? 81  HIS C NE2   1 
ATOM   7402  N  N     . GLY D 3  81  ? -3.348  41.053  35.991 1.00 70.53  ? 82  GLY C N     1 
ATOM   7403  C  CA    . GLY D 3  81  ? -2.332  41.631  36.849 1.00 74.87  ? 82  GLY C CA    1 
ATOM   7404  C  C     . GLY D 3  81  ? -2.458  41.172  38.288 1.00 82.38  ? 82  GLY C C     1 
ATOM   7405  O  O     . GLY D 3  81  ? -3.544  40.879  38.784 1.00 83.94  ? 82  GLY C O     1 
ATOM   7406  N  N     . ASP D 3  82  ? -1.311  41.139  38.972 1.00 92.04  ? 83  ASP C N     1 
ATOM   7407  C  CA    . ASP D 3  82  ? -1.260  40.606  40.332 1.00 89.57  ? 83  ASP C CA    1 
ATOM   7408  C  C     . ASP D 3  82  ? -2.117  41.411  41.298 1.00 77.40  ? 83  ASP C C     1 
ATOM   7409  O  O     . ASP D 3  82  ? -2.687  40.850  42.240 1.00 87.40  ? 83  ASP C O     1 
ATOM   7410  C  CB    . ASP D 3  82  ? 0.189   40.556  40.819 1.00 103.76 ? 83  ASP C CB    1 
ATOM   7411  C  CG    . ASP D 3  82  ? 1.087   41.521  40.072 1.00 110.05 ? 83  ASP C CG    1 
ATOM   7412  O  OD1   . ASP D 3  82  ? 0.608   42.171  39.111 1.00 109.39 ? 83  ASP C OD1   1 
ATOM   7413  O  OD2   . ASP D 3  82  ? 2.278   41.610  40.427 1.00 106.35 ? 83  ASP C OD2   1 
ATOM   7414  N  N     . SER D 3  83  ? -2.186  42.728  41.114 1.00 70.66  ? 84  SER C N     1 
ATOM   7415  C  CA    . SER D 3  83  ? -2.937  43.552  42.057 1.00 68.99  ? 84  SER C CA    1 
ATOM   7416  C  C     . SER D 3  83  ? -4.394  43.129  42.104 1.00 64.63  ? 84  SER C C     1 
ATOM   7417  O  O     . SER D 3  83  ? -4.986  43.042  43.178 1.00 66.96  ? 84  SER C O     1 
ATOM   7418  C  CB    . SER D 3  83  ? -2.849  45.031  41.685 1.00 74.48  ? 84  SER C CB    1 
ATOM   7419  O  OG    . SER D 3  83  ? -3.466  45.225  40.422 1.00 90.34  ? 84  SER C OG    1 
ATOM   7420  N  N     . SER D 3  84  ? -4.999  42.862  40.955 1.00 67.52  ? 85  SER C N     1 
ATOM   7421  C  CA    . SER D 3  84  ? -6.389  42.425  40.984 1.00 67.68  ? 85  SER C CA    1 
ATOM   7422  C  C     . SER D 3  84  ? -6.538  41.186  41.851 1.00 71.08  ? 85  SER C C     1 
ATOM   7423  O  O     . SER D 3  84  ? -7.422  41.107  42.715 1.00 76.29  ? 85  SER C O     1 
ATOM   7424  C  CB    . SER D 3  84  ? -6.883  42.166  39.564 1.00 70.94  ? 85  SER C CB    1 
ATOM   7425  O  OG    . SER D 3  84  ? -6.294  43.098  38.683 1.00 79.72  ? 85  SER C OG    1 
ATOM   7426  N  N     . ILE D 3  85  ? -5.627  40.235  41.676 1.00 76.72  ? 86  ILE C N     1 
ATOM   7427  C  CA    . ILE D 3  85  ? -5.701  38.972  42.399 1.00 74.51  ? 86  ILE C CA    1 
ATOM   7428  C  C     . ILE D 3  85  ? -5.380  39.167  43.868 1.00 70.07  ? 86  ILE C C     1 
ATOM   7429  O  O     . ILE D 3  85  ? -6.076  38.640  44.741 1.00 73.64  ? 86  ILE C O     1 
ATOM   7430  C  CB    . ILE D 3  85  ? -4.759  37.944  41.769 1.00 62.67  ? 86  ILE C CB    1 
ATOM   7431  C  CG1   . ILE D 3  85  ? -5.282  37.505  40.405 1.00 63.87  ? 86  ILE C CG1   1 
ATOM   7432  C  CG2   . ILE D 3  85  ? -4.626  36.764  42.687 1.00 61.55  ? 86  ILE C CG2   1 
ATOM   7433  C  CD1   . ILE D 3  85  ? -4.236  36.863  39.578 1.00 73.58  ? 86  ILE C CD1   1 
ATOM   7434  N  N     . TYR D 3  86  ? -4.279  39.845  44.164 1.00 68.45  ? 87  TYR C N     1 
ATOM   7435  C  CA    . TYR D 3  86  ? -3.891  39.972  45.560 1.00 68.63  ? 87  TYR C CA    1 
ATOM   7436  C  C     . TYR D 3  86  ? -4.941  40.731  46.340 1.00 71.63  ? 87  TYR C C     1 
ATOM   7437  O  O     . TYR D 3  86  ? -5.297  40.347  47.458 1.00 80.48  ? 87  TYR C O     1 
ATOM   7438  C  CB    . TYR D 3  86  ? -2.543  40.669  45.690 1.00 70.26  ? 87  TYR C CB    1 
ATOM   7439  C  CG    . TYR D 3  86  ? -2.139  40.924  47.123 1.00 75.00  ? 87  TYR C CG    1 
ATOM   7440  C  CD1   . TYR D 3  86  ? -1.650  39.895  47.914 1.00 76.65  ? 87  TYR C CD1   1 
ATOM   7441  C  CD2   . TYR D 3  86  ? -2.235  42.194  47.681 1.00 80.19  ? 87  TYR C CD2   1 
ATOM   7442  C  CE1   . TYR D 3  86  ? -1.245  40.122  49.215 1.00 86.54  ? 87  TYR C CE1   1 
ATOM   7443  C  CE2   . TYR D 3  86  ? -1.841  42.431  48.984 1.00 94.02  ? 87  TYR C CE2   1 
ATOM   7444  C  CZ    . TYR D 3  86  ? -1.348  41.392  49.750 1.00 92.54  ? 87  TYR C CZ    1 
ATOM   7445  O  OH    . TYR D 3  86  ? -0.956  41.628  51.051 1.00 89.98  ? 87  TYR C OH    1 
ATOM   7446  N  N     . GLU D 3  87  ? -5.462  41.800  45.752 1.00 68.99  ? 88  GLU C N     1 
ATOM   7447  C  CA    . GLU D 3  87  ? -6.437  42.631  46.442 1.00 66.46  ? 88  GLU C CA    1 
ATOM   7448  C  C     . GLU D 3  87  ? -7.739  41.883  46.658 1.00 63.63  ? 88  GLU C C     1 
ATOM   7449  O  O     . GLU D 3  87  ? -8.391  42.044  47.695 1.00 71.36  ? 88  GLU C O     1 
ATOM   7450  C  CB    . GLU D 3  87  ? -6.669  43.917  45.658 1.00 72.41  ? 88  GLU C CB    1 
ATOM   7451  C  CG    . GLU D 3  87  ? -5.377  44.645  45.383 1.00 71.70  ? 88  GLU C CG    1 
ATOM   7452  C  CD    . GLU D 3  87  ? -5.552  46.114  45.169 1.00 95.74  ? 88  GLU C CD    1 
ATOM   7453  O  OE1   . GLU D 3  87  ? -4.526  46.826  45.198 1.00 95.74  ? 88  GLU C OE1   1 
ATOM   7454  O  OE2   . GLU D 3  87  ? -6.705  46.561  45.002 1.00 106.43 ? 88  GLU C OE2   1 
ATOM   7455  N  N     . ALA D 3  88  ? -8.134  41.058  45.694 1.00 61.81  ? 89  ALA C N     1 
ATOM   7456  C  CA    . ALA D 3  88  ? -9.321  40.234  45.887 1.00 59.28  ? 89  ALA C CA    1 
ATOM   7457  C  C     . ALA D 3  88  ? -9.123  39.275  47.050 1.00 59.48  ? 89  ALA C C     1 
ATOM   7458  O  O     . ALA D 3  88  ? -10.008 39.119  47.901 1.00 60.73  ? 89  ALA C O     1 
ATOM   7459  C  CB    . ALA D 3  88  ? -9.661  39.467  44.606 1.00 52.21  ? 89  ALA C CB    1 
ATOM   7460  N  N     . MET D 3  89  ? -7.950  38.644  47.116 1.00 60.11  ? 90  MET C N     1 
ATOM   7461  C  CA    . MET D 3  89  ? -7.646  37.723  48.203 1.00 58.98  ? 90  MET C CA    1 
ATOM   7462  C  C     . MET D 3  89  ? -7.662  38.431  49.552 1.00 60.58  ? 90  MET C C     1 
ATOM   7463  O  O     . MET D 3  89  ? -8.157  37.886  50.543 1.00 58.14  ? 90  MET C O     1 
ATOM   7464  C  CB    . MET D 3  89  ? -6.303  37.041  47.947 1.00 60.80  ? 90  MET C CB    1 
ATOM   7465  C  CG    . MET D 3  89  ? -6.048  35.895  48.902 1.00 61.03  ? 90  MET C CG    1 
ATOM   7466  S  SD    . MET D 3  89  ? -4.400  35.156  48.781 1.00 72.59  ? 90  MET C SD    1 
ATOM   7467  C  CE    . MET D 3  89  ? -3.374  36.346  49.649 1.00 79.58  ? 90  MET C CE    1 
ATOM   7468  N  N     . VAL D 3  90  ? -7.122  39.644  49.609 1.00 63.36  ? 91  VAL C N     1 
ATOM   7469  C  CA    . VAL D 3  90  ? -7.083  40.413  50.858 1.00 63.97  ? 91  VAL C CA    1 
ATOM   7470  C  C     . VAL D 3  90  ? -8.487  40.654  51.395 1.00 58.09  ? 91  VAL C C     1 
ATOM   7471  O  O     . VAL D 3  90  ? -8.769  40.426  52.576 1.00 72.56  ? 91  VAL C O     1 
ATOM   7472  C  CB    . VAL D 3  90  ? -6.314  41.737  50.648 1.00 53.33  ? 91  VAL C CB    1 
ATOM   7473  C  CG1   . VAL D 3  90  ? -6.446  42.624  51.853 1.00 49.32  ? 91  VAL C CG1   1 
ATOM   7474  C  CG2   . VAL D 3  90  ? -4.842  41.470  50.380 1.00 57.99  ? 91  VAL C CG2   1 
ATOM   7475  N  N     A ARG D 3  91  ? -9.389  41.145  50.533 0.50 55.85  ? 92  ARG C N     1 
ATOM   7476  N  N     B ARG D 3  91  ? -9.398  41.097  50.530 0.50 56.97  ? 92  ARG C N     1 
ATOM   7477  C  CA    A ARG D 3  91  ? -10.792 41.388  50.884 0.50 56.47  ? 92  ARG C CA    1 
ATOM   7478  C  CA    B ARG D 3  91  ? -10.777 41.398  50.907 0.50 58.72  ? 92  ARG C CA    1 
ATOM   7479  C  C     A ARG D 3  91  ? -11.415 40.188  51.572 0.50 53.82  ? 92  ARG C C     1 
ATOM   7480  C  C     B ARG D 3  91  ? -11.552 40.196  51.421 0.50 55.84  ? 92  ARG C C     1 
ATOM   7481  O  O     A ARG D 3  91  ? -12.136 40.332  52.564 0.50 55.67  ? 92  ARG C O     1 
ATOM   7482  O  O     B ARG D 3  91  ? -12.556 40.384  52.106 0.50 55.09  ? 92  ARG C O     1 
ATOM   7483  C  CB    A ARG D 3  91  ? -11.630 41.710  49.623 0.50 63.80  ? 92  ARG C CB    1 
ATOM   7484  C  CB    B ARG D 3  91  ? -11.541 41.944  49.704 0.50 64.56  ? 92  ARG C CB    1 
ATOM   7485  C  CG    A ARG D 3  91  ? -11.796 43.187  49.212 0.50 66.15  ? 92  ARG C CG    1 
ATOM   7486  C  CG    B ARG D 3  91  ? -11.483 43.413  49.543 0.50 67.71  ? 92  ARG C CG    1 
ATOM   7487  C  CD    A ARG D 3  91  ? -13.167 43.446  48.510 0.50 61.98  ? 92  ARG C CD    1 
ATOM   7488  C  CD    B ARG D 3  91  ? -12.073 43.799  48.202 0.50 65.27  ? 92  ARG C CD    1 
ATOM   7489  N  NE    A ARG D 3  91  ? -14.363 43.509  49.366 0.50 44.46  ? 92  ARG C NE    1 
ATOM   7490  N  NE    B ARG D 3  91  ? -11.331 44.921  47.641 0.50 52.04  ? 92  ARG C NE    1 
ATOM   7491  C  CZ    A ARG D 3  91  ? -15.442 42.766  49.142 0.50 46.12  ? 92  ARG C CZ    1 
ATOM   7492  C  CZ    B ARG D 3  91  ? -10.777 44.935  46.434 0.50 50.53  ? 92  ARG C CZ    1 
ATOM   7493  N  NH1   A ARG D 3  91  ? -15.435 41.936  48.117 0.50 39.93  ? 92  ARG C NH1   1 
ATOM   7494  N  NH1   B ARG D 3  91  ? -10.902 43.895  45.624 0.50 44.42  ? 92  ARG C NH1   1 
ATOM   7495  N  NH2   A ARG D 3  91  ? -16.531 42.857  49.896 0.50 45.84  ? 92  ARG C NH2   1 
ATOM   7496  N  NH2   B ARG D 3  91  ? -10.108 46.006  46.031 0.50 67.81  ? 92  ARG C NH2   1 
ATOM   7497  N  N     . MET D 3  92  ? -11.169 38.991  51.035 1.00 54.01  ? 93  MET C N     1 
ATOM   7498  C  CA    . MET D 3  92  ? -11.759 37.772  51.555 1.00 50.88  ? 93  MET C CA    1 
ATOM   7499  C  C     . MET D 3  92  ? -11.184 37.413  52.915 1.00 55.79  ? 93  MET C C     1 
ATOM   7500  O  O     . MET D 3  92  ? -11.746 36.564  53.617 1.00 52.47  ? 93  MET C O     1 
ATOM   7501  C  CB    . MET D 3  92  ? -11.556 36.611  50.559 1.00 59.10  ? 93  MET C CB    1 
ATOM   7502  C  CG    . MET D 3  92  ? -12.353 36.713  49.217 1.00 65.26  ? 93  MET C CG    1 
ATOM   7503  S  SD    . MET D 3  92  ? -12.160 35.290  48.123 1.00 71.00  ? 93  MET C SD    1 
ATOM   7504  C  CE    . MET D 3  92  ? -10.465 35.474  47.594 1.00 68.15  ? 93  MET C CE    1 
ATOM   7505  N  N     . ALA D 3  93  ? -10.096 38.062  53.330 1.00 52.44  ? 94  ALA C N     1 
ATOM   7506  C  CA    . ALA D 3  93  ? -9.455  37.780  54.601 1.00 47.30  ? 94  ALA C CA    1 
ATOM   7507  C  C     . ALA D 3  93  ? -9.783  38.802  55.672 1.00 50.06  ? 94  ALA C C     1 
ATOM   7508  O  O     . ALA D 3  93  ? -9.235  38.701  56.771 1.00 64.53  ? 94  ALA C O     1 
ATOM   7509  C  CB    . ALA D 3  93  ? -7.938  37.703  54.417 1.00 46.05  ? 94  ALA C CB    1 
ATOM   7510  N  N     . GLN D 3  94  ? -10.648 39.774  55.396 1.00 56.35  ? 95  GLN C N     1 
ATOM   7511  C  CA    . GLN D 3  94  ? -10.939 40.857  56.331 1.00 67.68  ? 95  GLN C CA    1 
ATOM   7512  C  C     . GLN D 3  94  ? -12.274 40.624  57.011 1.00 65.67  ? 95  GLN C C     1 
ATOM   7513  O  O     . GLN D 3  94  ? -13.295 40.511  56.336 1.00 53.71  ? 95  GLN C O     1 
ATOM   7514  C  CB    . GLN D 3  94  ? -10.966 42.211  55.626 1.00 55.90  ? 95  GLN C CB    1 
ATOM   7515  C  CG    . GLN D 3  94  ? -9.659  42.629  55.036 1.00 57.09  ? 95  GLN C CG    1 
ATOM   7516  C  CD    . GLN D 3  94  ? -9.809  43.838  54.153 1.00 62.51  ? 95  GLN C CD    1 
ATOM   7517  O  OE1   . GLN D 3  94  ? -10.926 44.223  53.790 1.00 60.08  ? 95  GLN C OE1   1 
ATOM   7518  N  NE2   . GLN D 3  94  ? -8.686  44.452  53.798 1.00 57.31  ? 95  GLN C NE2   1 
ATOM   7519  N  N     . ASP D 3  95  ? -12.271 40.602  58.348 1.00 56.74  ? 96  ASP C N     1 
ATOM   7520  C  CA    . ASP D 3  95  ? -13.513 40.353  59.081 1.00 49.70  ? 96  ASP C CA    1 
ATOM   7521  C  C     . ASP D 3  95  ? -14.529 41.456  58.864 1.00 59.20  ? 96  ASP C C     1 
ATOM   7522  O  O     . ASP D 3  95  ? -15.736 41.197  58.937 1.00 75.88  ? 96  ASP C O     1 
ATOM   7523  C  CB    . ASP D 3  95  ? -13.259 40.180  60.574 1.00 50.45  ? 96  ASP C CB    1 
ATOM   7524  C  CG    . ASP D 3  95  ? -12.065 40.957  61.058 1.00 76.90  ? 96  ASP C CG    1 
ATOM   7525  O  OD1   . ASP D 3  95  ? -11.089 41.083  60.283 1.00 108.03 ? 96  ASP C OD1   1 
ATOM   7526  O  OD2   . ASP D 3  95  ? -12.088 41.418  62.220 1.00 78.37  ? 96  ASP C OD2   1 
ATOM   7527  N  N     . PHE D 3  96  ? -14.083 42.685  58.618 1.00 44.58  ? 97  PHE C N     1 
ATOM   7528  C  CA    . PHE D 3  96  ? -15.032 43.771  58.389 1.00 45.22  ? 97  PHE C CA    1 
ATOM   7529  C  C     . PHE D 3  96  ? -15.612 43.761  56.985 1.00 50.83  ? 97  PHE C C     1 
ATOM   7530  O  O     . PHE D 3  96  ? -16.644 44.397  56.756 1.00 61.21  ? 97  PHE C O     1 
ATOM   7531  C  CB    . PHE D 3  96  ? -14.392 45.127  58.676 1.00 47.78  ? 97  PHE C CB    1 
ATOM   7532  C  CG    . PHE D 3  96  ? -13.030 45.294  58.082 1.00 56.91  ? 97  PHE C CG    1 
ATOM   7533  C  CD1   . PHE D 3  96  ? -11.906 44.865  58.767 1.00 67.65  ? 97  PHE C CD1   1 
ATOM   7534  C  CD2   . PHE D 3  96  ? -12.866 45.893  56.849 1.00 51.68  ? 97  PHE C CD2   1 
ATOM   7535  C  CE1   . PHE D 3  96  ? -10.656 45.012  58.228 1.00 55.32  ? 97  PHE C CE1   1 
ATOM   7536  C  CE2   . PHE D 3  96  ? -11.615 46.046  56.308 1.00 49.16  ? 97  PHE C CE2   1 
ATOM   7537  C  CZ    . PHE D 3  96  ? -10.510 45.603  56.999 1.00 50.79  ? 97  PHE C CZ    1 
ATOM   7538  N  N     . SER D 3  97  ? -14.995 43.058  56.047 1.00 51.45  ? 98  SER C N     1 
ATOM   7539  C  CA    . SER D 3  97  ? -15.546 42.958  54.705 1.00 47.45  ? 98  SER C CA    1 
ATOM   7540  C  C     . SER D 3  97  ? -16.372 41.702  54.498 1.00 51.70  ? 98  SER C C     1 
ATOM   7541  O  O     . SER D 3  97  ? -17.441 41.771  53.880 1.00 61.86  ? 98  SER C O     1 
ATOM   7542  C  CB    . SER D 3  97  ? -14.439 43.002  53.655 1.00 48.91  ? 98  SER C CB    1 
ATOM   7543  O  OG    . SER D 3  97  ? -13.642 44.165  53.789 1.00 57.42  ? 98  SER C OG    1 
ATOM   7544  N  N     . TYR D 3  98  ? -15.909 40.547  54.969 1.00 49.31  ? 99  TYR C N     1 
ATOM   7545  C  CA    . TYR D 3  98  ? -16.616 39.294  54.762 1.00 48.83  ? 99  TYR C CA    1 
ATOM   7546  C  C     . TYR D 3  98  ? -17.287 38.847  56.055 1.00 54.28  ? 99  TYR C C     1 
ATOM   7547  O  O     . TYR D 3  98  ? -16.617 38.611  57.069 1.00 57.47  ? 99  TYR C O     1 
ATOM   7548  C  CB    . TYR D 3  98  ? -15.682 38.207  54.241 1.00 51.68  ? 99  TYR C CB    1 
ATOM   7549  C  CG    . TYR D 3  98  ? -15.631 38.184  52.741 1.00 56.99  ? 99  TYR C CG    1 
ATOM   7550  C  CD1   . TYR D 3  98  ? -15.076 39.228  52.047 1.00 52.19  ? 99  TYR C CD1   1 
ATOM   7551  C  CD2   . TYR D 3  98  ? -16.181 37.142  52.023 1.00 56.63  ? 99  TYR C CD2   1 
ATOM   7552  C  CE1   . TYR D 3  98  ? -15.036 39.234  50.660 1.00 60.80  ? 99  TYR C CE1   1 
ATOM   7553  C  CE2   . TYR D 3  98  ? -16.147 37.130  50.648 1.00 55.48  ? 99  TYR C CE2   1 
ATOM   7554  C  CZ    . TYR D 3  98  ? -15.572 38.169  49.967 1.00 56.04  ? 99  TYR C CZ    1 
ATOM   7555  O  OH    . TYR D 3  98  ? -15.551 38.106  48.594 1.00 46.27  ? 99  TYR C OH    1 
ATOM   7556  N  N     . ARG D 3  99  ? -18.609 38.694  55.990 1.00 52.66  ? 100 ARG C N     1 
ATOM   7557  C  CA    . ARG D 3  99  ? -19.371 38.181  57.115 1.00 54.69  ? 100 ARG C CA    1 
ATOM   7558  C  C     . ARG D 3  99  ? -18.875 36.813  57.529 1.00 59.17  ? 100 ARG C C     1 
ATOM   7559  O  O     . ARG D 3  99  ? -18.882 36.477  58.716 1.00 59.53  ? 100 ARG C O     1 
ATOM   7560  C  CB    . ARG D 3  99  ? -20.849 38.119  56.727 1.00 51.95  ? 100 ARG C CB    1 
ATOM   7561  C  CG    . ARG D 3  99  ? -21.772 37.811  57.848 1.00 48.08  ? 100 ARG C CG    1 
ATOM   7562  C  CD    . ARG D 3  99  ? -21.603 38.790  58.979 1.00 46.94  ? 100 ARG C CD    1 
ATOM   7563  N  NE    . ARG D 3  99  ? -22.493 38.463  60.088 1.00 49.51  ? 100 ARG C NE    1 
ATOM   7564  C  CZ    . ARG D 3  99  ? -22.281 37.461  60.932 1.00 50.77  ? 100 ARG C CZ    1 
ATOM   7565  N  NH1   . ARG D 3  99  ? -21.212 36.690  60.786 1.00 52.44  ? 100 ARG C NH1   1 
ATOM   7566  N  NH2   . ARG D 3  99  ? -23.139 37.228  61.917 1.00 56.39  ? 100 ARG C NH2   1 
ATOM   7567  N  N     . TYR D 3  100 ? -18.450 36.007  56.554 1.00 52.90  ? 101 TYR C N     1 
ATOM   7568  C  CA    . TYR D 3  100 ? -17.899 34.676  56.791 1.00 48.80  ? 101 TYR C CA    1 
ATOM   7569  C  C     . TYR D 3  100 ? -16.651 34.588  55.942 1.00 56.72  ? 101 TYR C C     1 
ATOM   7570  O  O     . TYR D 3  100 ? -16.727 34.282  54.739 1.00 51.91  ? 101 TYR C O     1 
ATOM   7571  C  CB    . TYR D 3  100 ? -18.907 33.580  56.462 1.00 40.66  ? 101 TYR C CB    1 
ATOM   7572  C  CG    . TYR D 3  100 ? -20.128 33.700  57.314 1.00 43.07  ? 101 TYR C CG    1 
ATOM   7573  C  CD1   . TYR D 3  100 ? -20.095 33.307  58.632 1.00 43.25  ? 101 TYR C CD1   1 
ATOM   7574  C  CD2   . TYR D 3  100 ? -21.294 34.244  56.819 1.00 45.46  ? 101 TYR C CD2   1 
ATOM   7575  C  CE1   . TYR D 3  100 ? -21.188 33.420  59.428 1.00 39.66  ? 101 TYR C CE1   1 
ATOM   7576  C  CE2   . TYR D 3  100 ? -22.398 34.360  57.613 1.00 47.99  ? 101 TYR C CE2   1 
ATOM   7577  C  CZ    . TYR D 3  100 ? -22.335 33.946  58.920 1.00 41.71  ? 101 TYR C CZ    1 
ATOM   7578  O  OH    . TYR D 3  100 ? -23.430 34.055  59.734 1.00 55.34  ? 101 TYR C OH    1 
ATOM   7579  N  N     . PRO D 3  101 ? -15.495 34.919  56.510 1.00 53.87  ? 102 PRO C N     1 
ATOM   7580  C  CA    . PRO D 3  101 ? -14.260 35.019  55.732 1.00 50.85  ? 102 PRO C CA    1 
ATOM   7581  C  C     . PRO D 3  101 ? -13.864 33.717  55.072 1.00 51.18  ? 102 PRO C C     1 
ATOM   7582  O  O     . PRO D 3  101 ? -13.810 32.667  55.708 1.00 44.88  ? 102 PRO C O     1 
ATOM   7583  C  CB    . PRO D 3  101 ? -13.230 35.444  56.779 1.00 52.73  ? 102 PRO C CB    1 
ATOM   7584  C  CG    . PRO D 3  101 ? -14.021 36.238  57.713 1.00 48.97  ? 102 PRO C CG    1 
ATOM   7585  C  CD    . PRO D 3  101 ? -15.342 35.543  57.829 1.00 51.39  ? 102 PRO C CD    1 
ATOM   7586  N  N     . LEU D 3  102 ? -13.510 33.823  53.803 1.00 49.05  ? 103 LEU C N     1 
ATOM   7587  C  CA    . LEU D 3  102 ? -13.057 32.686  53.023 1.00 48.26  ? 103 LEU C CA    1 
ATOM   7588  C  C     . LEU D 3  102 ? -11.549 32.527  53.007 1.00 51.94  ? 103 LEU C C     1 
ATOM   7589  O  O     . LEU D 3  102 ? -11.061 31.535  52.467 1.00 57.13  ? 103 LEU C O     1 
ATOM   7590  C  CB    . LEU D 3  102 ? -13.561 32.799  51.588 1.00 41.97  ? 103 LEU C CB    1 
ATOM   7591  C  CG    . LEU D 3  102 ? -15.058 33.008  51.426 1.00 39.57  ? 103 LEU C CG    1 
ATOM   7592  C  CD1   . LEU D 3  102 ? -15.420 32.811  49.991 1.00 61.17  ? 103 LEU C CD1   1 
ATOM   7593  C  CD2   . LEU D 3  102 ? -15.808 32.048  52.299 1.00 43.83  ? 103 LEU C CD2   1 
ATOM   7594  N  N     . VAL D 3  103 ? -10.802 33.461  53.567 1.00 48.11  ? 104 VAL C N     1 
ATOM   7595  C  CA    . VAL D 3  103 ? -9.350  33.405  53.523 1.00 52.12  ? 104 VAL C CA    1 
ATOM   7596  C  C     . VAL D 3  103 ? -8.791  33.769  54.885 1.00 62.35  ? 104 VAL C C     1 
ATOM   7597  O  O     . VAL D 3  103 ? -9.232  34.727  55.521 1.00 67.09  ? 104 VAL C O     1 
ATOM   7598  C  CB    . VAL D 3  103 ? -8.785  34.306  52.411 1.00 53.40  ? 104 VAL C CB    1 
ATOM   7599  C  CG1   . VAL D 3  103 ? -7.288  34.459  52.553 1.00 47.50  ? 104 VAL C CG1   1 
ATOM   7600  C  CG2   . VAL D 3  103 ? -9.128  33.713  51.063 1.00 55.91  ? 104 VAL C CG2   1 
ATOM   7601  N  N     . ASP D 3  104 ? -7.856  32.963  55.345 1.00 71.44  ? 105 ASP C N     1 
ATOM   7602  C  CA    . ASP D 3  104 ? -7.141  33.198  56.584 1.00 71.15  ? 105 ASP C CA    1 
ATOM   7603  C  C     . ASP D 3  104 ? -5.801  33.805  56.217 1.00 70.95  ? 105 ASP C C     1 
ATOM   7604  O  O     . ASP D 3  104 ? -5.057  33.214  55.436 1.00 73.52  ? 105 ASP C O     1 
ATOM   7605  C  CB    . ASP D 3  104 ? -6.954  31.884  57.342 1.00 74.76  ? 105 ASP C CB    1 
ATOM   7606  C  CG    . ASP D 3  104 ? -6.218  32.058  58.654 1.00 82.66  ? 105 ASP C CG    1 
ATOM   7607  O  OD1   . ASP D 3  104 ? -5.612  33.130  58.883 1.00 88.94  ? 105 ASP C OD1   1 
ATOM   7608  O  OD2   . ASP D 3  104 ? -6.251  31.107  59.462 1.00 72.84  ? 105 ASP C OD2   1 
ATOM   7609  N  N     . GLY D 3  105 ? -5.490  34.967  56.773 1.00 71.26  ? 106 GLY C N     1 
ATOM   7610  C  CA    . GLY D 3  105 ? -4.286  35.681  56.400 1.00 79.21  ? 106 GLY C CA    1 
ATOM   7611  C  C     . GLY D 3  105 ? -3.428  36.029  57.595 1.00 85.37  ? 106 GLY C C     1 
ATOM   7612  O  O     . GLY D 3  105 ? -3.924  36.384  58.659 1.00 103.16 ? 106 GLY C O     1 
ATOM   7613  N  N     . GLN D 3  106 ? -2.120  35.958  57.381 1.00 75.27  ? 107 GLN C N     1 
ATOM   7614  C  CA    . GLN D 3  106 ? -1.155  36.294  58.408 1.00 75.80  ? 107 GLN C CA    1 
ATOM   7615  C  C     . GLN D 3  106 ? -0.377  37.522  57.981 1.00 76.70  ? 107 GLN C C     1 
ATOM   7616  O  O     . GLN D 3  106 ? 0.218   37.540  56.899 1.00 82.00  ? 107 GLN C O     1 
ATOM   7617  C  CB    . GLN D 3  106 ? -0.208  35.132  58.674 1.00 86.72  ? 107 GLN C CB    1 
ATOM   7618  C  CG    . GLN D 3  106 ? 0.565   35.269  59.951 1.00 91.45  ? 107 GLN C CG    1 
ATOM   7619  C  CD    . GLN D 3  106 ? 1.437   34.071  60.168 1.00 101.62 ? 107 GLN C CD    1 
ATOM   7620  O  OE1   . GLN D 3  106 ? 1.843   33.409  59.208 1.00 113.20 ? 107 GLN C OE1   1 
ATOM   7621  N  NE2   . GLN D 3  106 ? 1.719   33.763  61.428 1.00 108.30 ? 107 GLN C NE2   1 
ATOM   7622  N  N     . GLY D 3  107 ? -0.359  38.522  58.837 1.00 73.44  ? 108 GLY C N     1 
ATOM   7623  C  CA    . GLY D 3  107 ? 0.343   39.736  58.512 1.00 69.08  ? 108 GLY C CA    1 
ATOM   7624  C  C     . GLY D 3  107 ? -0.629  40.877  58.603 1.00 75.78  ? 108 GLY C C     1 
ATOM   7625  O  O     . GLY D 3  107 ? -1.687  40.751  59.233 1.00 81.66  ? 108 GLY C O     1 
ATOM   7626  N  N     . ASN D 3  108 ? -0.302  41.991  57.975 1.00 78.07  ? 109 ASN C N     1 
ATOM   7627  C  CA    . ASN D 3  108 ? -1.204  43.128  57.950 1.00 76.13  ? 109 ASN C CA    1 
ATOM   7628  C  C     . ASN D 3  108 ? -2.097  42.996  56.731 1.00 72.12  ? 109 ASN C C     1 
ATOM   7629  O  O     . ASN D 3  108 ? -1.643  43.170  55.599 1.00 79.67  ? 109 ASN C O     1 
ATOM   7630  C  CB    . ASN D 3  108 ? -0.437  44.438  57.922 1.00 78.15  ? 109 ASN C CB    1 
ATOM   7631  C  CG    . ASN D 3  108 ? -1.343  45.614  57.751 1.00 85.42  ? 109 ASN C CG    1 
ATOM   7632  O  OD1   . ASN D 3  108 ? -2.569  45.485  57.820 1.00 88.80  ? 109 ASN C OD1   1 
ATOM   7633  N  ND2   . ASN D 3  108 ? -0.759  46.775  57.542 1.00 93.60  ? 109 ASN C ND2   1 
ATOM   7634  N  N     . PHE D 3  109 ? -3.376  42.726  56.957 1.00 69.30  ? 110 PHE C N     1 
ATOM   7635  C  CA    . PHE D 3  109 ? -4.320  42.611  55.856 1.00 64.15  ? 110 PHE C CA    1 
ATOM   7636  C  C     . PHE D 3  109 ? -5.298  43.773  55.782 1.00 64.78  ? 110 PHE C C     1 
ATOM   7637  O  O     . PHE D 3  109 ? -6.259  43.702  55.014 1.00 67.27  ? 110 PHE C O     1 
ATOM   7638  C  CB    . PHE D 3  109 ? -5.070  41.282  55.935 1.00 58.87  ? 110 PHE C CB    1 
ATOM   7639  C  CG    . PHE D 3  109 ? -4.376  40.167  55.222 1.00 56.57  ? 110 PHE C CG    1 
ATOM   7640  C  CD1   . PHE D 3  109 ? -3.367  39.460  55.838 1.00 56.93  ? 110 PHE C CD1   1 
ATOM   7641  C  CD2   . PHE D 3  109 ? -4.721  39.846  53.926 1.00 56.80  ? 110 PHE C CD2   1 
ATOM   7642  C  CE1   . PHE D 3  109 ? -2.725  38.449  55.179 1.00 60.28  ? 110 PHE C CE1   1 
ATOM   7643  C  CE2   . PHE D 3  109 ? -4.079  38.830  53.261 1.00 63.12  ? 110 PHE C CE2   1 
ATOM   7644  C  CZ    . PHE D 3  109 ? -3.083  38.131  53.889 1.00 59.12  ? 110 PHE C CZ    1 
ATOM   7645  N  N     . GLY D 3  110 ? -5.080  44.833  56.538 1.00 75.17  ? 111 GLY C N     1 
ATOM   7646  C  CA    . GLY D 3  110 ? -5.875  46.039  56.428 1.00 81.97  ? 111 GLY C CA    1 
ATOM   7647  C  C     . GLY D 3  110 ? -6.631  46.360  57.697 1.00 87.38  ? 111 GLY C C     1 
ATOM   7648  O  O     . GLY D 3  110 ? -6.560  45.647  58.691 1.00 97.88  ? 111 GLY C O     1 
ATOM   7649  N  N     . SER D 3  111 ? -7.363  47.467  57.634 1.00 85.29  ? 112 SER C N     1 
ATOM   7650  C  CA    . SER D 3  111 ? -8.170  47.954  58.741 1.00 88.52  ? 112 SER C CA    1 
ATOM   7651  C  C     . SER D 3  111 ? -9.323  48.768  58.169 1.00 89.36  ? 112 SER C C     1 
ATOM   7652  O  O     . SER D 3  111 ? -9.400  49.009  56.964 1.00 88.94  ? 112 SER C O     1 
ATOM   7653  C  CB    . SER D 3  111 ? -7.349  48.803  59.708 1.00 103.04 ? 112 SER C CB    1 
ATOM   7654  O  OG    . SER D 3  111 ? -7.492  50.171  59.360 1.00 104.03 ? 112 SER C OG    1 
ATOM   7655  N  N     . MET D 3  112 ? -10.212 49.219  59.048 1.00 88.72  ? 113 MET C N     1 
ATOM   7656  C  CA    . MET D 3  112 ? -11.411 49.920  58.589 1.00 84.36  ? 113 MET C CA    1 
ATOM   7657  C  C     . MET D 3  112 ? -11.175 51.397  58.316 1.00 95.43  ? 113 MET C C     1 
ATOM   7658  O  O     . MET D 3  112 ? -12.144 52.114  58.026 1.00 85.41  ? 113 MET C O     1 
ATOM   7659  C  CB    . MET D 3  112 ? -12.542 49.761  59.592 1.00 84.05  ? 113 MET C CB    1 
ATOM   7660  C  CG    . MET D 3  112 ? -12.325 48.668  60.607 1.00 91.77  ? 113 MET C CG    1 
ATOM   7661  S  SD    . MET D 3  112 ? -13.822 48.424  61.582 1.00 76.67  ? 113 MET C SD    1 
ATOM   7662  C  CE    . MET D 3  112 ? -15.054 48.947  60.394 1.00 82.52  ? 113 MET C CE    1 
ATOM   7663  N  N     . ASP D 3  113 ? -9.933  51.867  58.439 1.00 102.33 ? 114 ASP C N     1 
ATOM   7664  C  CA    . ASP D 3  113 ? -9.526  53.226  58.080 1.00 89.08  ? 114 ASP C CA    1 
ATOM   7665  C  C     . ASP D 3  113 ? -9.211  53.379  56.611 1.00 87.84  ? 114 ASP C C     1 
ATOM   7666  O  O     . ASP D 3  113 ? -8.865  54.485  56.174 1.00 87.38  ? 114 ASP C O     1 
ATOM   7667  C  CB    . ASP D 3  113 ? -8.295  53.636  58.860 1.00 87.28  ? 114 ASP C CB    1 
ATOM   7668  C  CG    . ASP D 3  113 ? -8.571  53.745  60.312 1.00 97.35  ? 114 ASP C CG    1 
ATOM   7669  O  OD1   . ASP D 3  113 ? -9.487  53.034  60.776 1.00 108.94 ? 114 ASP C OD1   1 
ATOM   7670  O  OD2   . ASP D 3  113 ? -7.885  54.538  60.982 1.00 108.22 ? 114 ASP C OD2   1 
ATOM   7671  N  N     . GLY D 3  114 ? -9.290  52.293  55.855 1.00 95.88  ? 115 GLY C N     1 
ATOM   7672  C  CA    . GLY D 3  114 ? -8.966  52.306  54.458 1.00 105.00 ? 115 GLY C CA    1 
ATOM   7673  C  C     . GLY D 3  114 ? -7.491  52.188  54.196 1.00 106.40 ? 115 GLY C C     1 
ATOM   7674  O  O     . GLY D 3  114 ? -7.086  52.202  53.030 1.00 105.93 ? 115 GLY C O     1 
ATOM   7675  N  N     . ASP D 3  115 ? -6.672  52.120  55.231 1.00 108.40 ? 116 ASP C N     1 
ATOM   7676  C  CA    . ASP D 3  115 ? -5.276  51.821  55.000 1.00 115.66 ? 116 ASP C CA    1 
ATOM   7677  C  C     . ASP D 3  115 ? -5.194  50.421  54.414 1.00 108.39 ? 116 ASP C C     1 
ATOM   7678  O  O     . ASP D 3  115 ? -5.815  49.478  54.923 1.00 112.23 ? 116 ASP C O     1 
ATOM   7679  C  CB    . ASP D 3  115 ? -4.474  51.901  56.275 1.00 135.82 ? 116 ASP C CB    1 
ATOM   7680  C  CG    . ASP D 3  115 ? -4.834  50.799  57.221 1.00 145.96 ? 116 ASP C CG    1 
ATOM   7681  O  OD1   . ASP D 3  115 ? -6.051  50.541  57.359 1.00 164.52 ? 116 ASP C OD1   1 
ATOM   7682  O  OD2   . ASP D 3  115 ? -3.919  50.148  57.765 1.00 153.69 ? 116 ASP C OD2   1 
ATOM   7683  N  N     . GLY D 3  116 ? -4.511  50.305  53.298 1.00 99.63  ? 117 GLY C N     1 
ATOM   7684  C  CA    . GLY D 3  116 ? -4.417  49.026  52.640 1.00 89.79  ? 117 GLY C CA    1 
ATOM   7685  C  C     . GLY D 3  116 ? -3.584  48.044  53.430 1.00 87.34  ? 117 GLY C C     1 
ATOM   7686  O  O     . GLY D 3  116 ? -2.967  48.339  54.460 1.00 106.67 ? 117 GLY C O     1 
ATOM   7687  N  N     . ALA D 3  117 ? -3.584  46.827  52.905 1.00 68.15  ? 118 ALA C N     1 
ATOM   7688  C  CA    . ALA D 3  117 ? -2.788  45.749  53.456 1.00 67.53  ? 118 ALA C CA    1 
ATOM   7689  C  C     . ALA D 3  117 ? -1.339  45.885  53.006 1.00 75.82  ? 118 ALA C C     1 
ATOM   7690  O  O     . ALA D 3  117 ? -0.997  46.694  52.138 1.00 86.51  ? 118 ALA C O     1 
ATOM   7691  C  CB    . ALA D 3  117 ? -3.344  44.397  53.026 1.00 54.50  ? 118 ALA C CB    1 
ATOM   7692  N  N     . ALA D 3  118 ? -0.477  45.065  53.596 1.00 69.33  ? 119 ALA C N     1 
ATOM   7693  C  CA    . ALA D 3  118 ? 0.929   45.053  53.235 1.00 67.87  ? 119 ALA C CA    1 
ATOM   7694  C  C     . ALA D 3  118 ? 1.134   44.445  51.843 1.00 83.33  ? 119 ALA C C     1 
ATOM   7695  O  O     . ALA D 3  118 ? 0.278   43.739  51.310 1.00 87.97  ? 119 ALA C O     1 
ATOM   7696  C  CB    . ALA D 3  118 ? 1.729   44.271  54.273 1.00 69.53  ? 119 ALA C CB    1 
ATOM   7697  N  N     . ALA D 3  119 ? 2.314   44.685  51.268 1.00 78.91  ? 120 ALA C N     1 
ATOM   7698  C  CA    . ALA D 3  119 ? 2.639   44.096  49.965 1.00 75.35  ? 120 ALA C CA    1 
ATOM   7699  C  C     . ALA D 3  119 ? 2.715   42.566  50.055 1.00 89.24  ? 120 ALA C C     1 
ATOM   7700  O  O     . ALA D 3  119 ? 2.877   41.981  51.131 1.00 96.99  ? 120 ALA C O     1 
ATOM   7701  N  N     . MET D 3  120 ? 2.572   41.914  48.888 1.00 92.73  ? 121 MET C N     1 
ATOM   7702  C  CA    . MET D 3  120 ? 2.521   40.449  48.830 1.00 80.27  ? 121 MET C CA    1 
ATOM   7703  C  C     . MET D 3  120 ? 3.678   39.797  49.575 1.00 87.51  ? 121 MET C C     1 
ATOM   7704  O  O     . MET D 3  120 ? 3.513   38.713  50.155 1.00 101.05 ? 121 MET C O     1 
ATOM   7705  C  CB    . MET D 3  120 ? 2.533   39.964  47.377 1.00 75.89  ? 121 MET C CB    1 
ATOM   7706  C  CG    . MET D 3  120 ? 1.287   40.253  46.612 1.00 70.67  ? 121 MET C CG    1 
ATOM   7707  S  SD    . MET D 3  120 ? 1.502   40.152  44.833 1.00 67.89  ? 121 MET C SD    1 
ATOM   7708  C  CE    . MET D 3  120 ? 2.236   38.564  44.657 1.00 69.96  ? 121 MET C CE    1 
ATOM   7709  N  N     . ARG D 3  121 ? 4.847   40.424  49.563 1.00 72.81  ? 122 ARG C N     1 
ATOM   7710  C  CA    . ARG D 3  121 ? 6.027   39.872  50.203 1.00 79.51  ? 122 ARG C CA    1 
ATOM   7711  C  C     . ARG D 3  121 ? 5.833   39.696  51.709 1.00 91.73  ? 122 ARG C C     1 
ATOM   7712  O  O     . ARG D 3  121 ? 6.320   38.719  52.300 1.00 115.02 ? 122 ARG C O     1 
ATOM   7713  C  CB    . ARG D 3  121 ? 7.230   40.763  49.922 1.00 81.69  ? 122 ARG C CB    1 
ATOM   7714  C  CG    . ARG D 3  121 ? 7.037   42.194  50.362 1.00 90.47  ? 122 ARG C CG    1 
ATOM   7715  C  CD    . ARG D 3  121 ? 7.614   43.173  49.351 1.00 87.42  ? 122 ARG C CD    1 
ATOM   7716  N  NE    . ARG D 3  121 ? 9.012   42.875  49.034 1.00 81.91  ? 122 ARG C NE    1 
ATOM   7717  C  CZ    . ARG D 3  121 ? 9.701   43.462  48.057 1.00 93.50  ? 122 ARG C CZ    1 
ATOM   7718  N  NH1   . ARG D 3  121 ? 10.973  43.137  47.839 1.00 121.98 ? 122 ARG C NH1   1 
ATOM   7719  N  NH2   . ARG D 3  121 ? 9.125   44.390  47.307 1.00 72.90  ? 122 ARG C NH2   1 
HETATM 7720  N  N     . PTR D 3  122 ? 5.094   40.614  52.326 1.00 75.76  ? 123 PTR C N     1 
HETATM 7721  C  CA    . PTR D 3  122 ? 4.949   40.589  53.775 1.00 81.88  ? 123 PTR C CA    1 
HETATM 7722  C  C     . PTR D 3  122 ? 3.736   39.859  54.373 1.00 91.60  ? 123 PTR C C     1 
HETATM 7723  O  O     . PTR D 3  122 ? 3.559   39.974  55.590 1.00 111.38 ? 123 PTR C O     1 
HETATM 7724  C  CB    . PTR D 3  122 ? 4.872   42.007  54.336 1.00 82.30  ? 123 PTR C CB    1 
HETATM 7725  C  CG    . PTR D 3  122 ? 5.832   43.014  53.725 1.00 85.31  ? 123 PTR C CG    1 
HETATM 7726  C  CD1   . PTR D 3  122 ? 7.157   43.111  54.149 1.00 75.17  ? 123 PTR C CD1   1 
HETATM 7727  C  CD2   . PTR D 3  122 ? 5.393   43.905  52.750 1.00 95.31  ? 123 PTR C CD2   1 
HETATM 7728  C  CE1   . PTR D 3  122 ? 8.018   44.052  53.599 1.00 61.26  ? 123 PTR C CE1   1 
HETATM 7729  C  CE2   . PTR D 3  122 ? 6.250   44.847  52.199 1.00 95.46  ? 123 PTR C CE2   1 
HETATM 7730  C  CZ    . PTR D 3  122 ? 7.557   44.904  52.616 1.00 84.53  ? 123 PTR C CZ    1 
HETATM 7731  O  OH    . PTR D 3  122 ? 8.297   45.832  52.072 1.00 89.65  ? 123 PTR C OH    1 
HETATM 7732  P  P     . PTR D 3  122 ? 9.871   45.666  51.766 1.00 97.64  ? 123 PTR C P     1 
HETATM 7733  O  O1P   . PTR D 3  122 ? 9.990   44.673  50.580 1.00 130.04 ? 123 PTR C O1P   1 
HETATM 7734  O  O2P   . PTR D 3  122 ? 10.554  45.160  53.018 1.00 119.30 ? 123 PTR C O2P   1 
HETATM 7735  O  O3P   . PTR D 3  122 ? 10.446  47.058  51.367 1.00 117.41 ? 123 PTR C O3P   1 
ATOM   7736  N  N     . THR D 3  123 ? 2.908   39.156  53.606 1.00 82.53  ? 124 THR C N     1 
ATOM   7737  C  CA    . THR D 3  123 ? 1.717   38.511  54.191 1.00 80.53  ? 124 THR C CA    1 
ATOM   7738  C  C     . THR D 3  123 ? 1.646   37.000  53.884 1.00 91.93  ? 124 THR C C     1 
ATOM   7739  O  O     . THR D 3  123 ? 2.209   36.548  52.912 1.00 91.75  ? 124 THR C O     1 
ATOM   7740  C  CB    . THR D 3  123 ? 0.417   39.166  53.688 1.00 79.31  ? 124 THR C CB    1 
ATOM   7741  O  OG1   . THR D 3  123 ? 0.245   38.873  52.297 1.00 95.95  ? 124 THR C OG1   1 
ATOM   7742  C  CG2   . THR D 3  123 ? 0.455   40.671  53.884 1.00 71.64  ? 124 THR C CG2   1 
ATOM   7743  N  N     . GLU D 3  124 ? 0.926   36.234  54.698 1.00 99.89  ? 125 GLU C N     1 
ATOM   7744  C  CA    . GLU D 3  124 ? 0.773   34.797  54.498 1.00 88.98  ? 125 GLU C CA    1 
ATOM   7745  C  C     . GLU D 3  124 ? -0.712  34.458  54.418 1.00 80.28  ? 125 GLU C C     1 
ATOM   7746  O  O     . GLU D 3  124 ? -1.544  35.173  54.976 1.00 77.53  ? 125 GLU C O     1 
ATOM   7747  C  CB    . GLU D 3  124 ? 1.469   34.030  55.628 1.00 100.96 ? 125 GLU C CB    1 
ATOM   7748  C  CG    . GLU D 3  124 ? 2.888   34.464  55.888 1.00 113.92 ? 125 GLU C CG    1 
ATOM   7749  C  CD    . GLU D 3  124 ? 3.845   33.312  56.142 1.00 131.71 ? 125 GLU C CD    1 
ATOM   7750  O  OE1   . GLU D 3  124 ? 3.363   32.193  56.390 1.00 138.81 ? 125 GLU C OE1   1 
ATOM   7751  O  OE2   . GLU D 3  124 ? 5.080   33.518  56.085 1.00 137.77 ? 125 GLU C OE2   1 
ATOM   7752  N  N     . ALA D 3  125 ? -1.074  33.369  53.730 1.00 70.98  ? 126 ALA C N     1 
ATOM   7753  C  CA    . ALA D 3  125 ? -2.508  33.088  53.613 1.00 63.11  ? 126 ALA C CA    1 
ATOM   7754  C  C     . ALA D 3  125 ? -2.811  31.600  53.459 1.00 64.16  ? 126 ALA C C     1 
ATOM   7755  O  O     . ALA D 3  125 ? -1.984  30.822  52.990 1.00 71.57  ? 126 ALA C O     1 
ATOM   7756  C  CB    . ALA D 3  125 ? -3.134  33.869  52.447 1.00 61.72  ? 126 ALA C CB    1 
ATOM   7757  N  N     . ARG D 3  126 ? -4.033  31.215  53.854 1.00 63.70  ? 127 ARG C N     1 
ATOM   7758  C  CA    . ARG D 3  126 ? -4.574  29.877  53.611 1.00 64.39  ? 127 ARG C CA    1 
ATOM   7759  C  C     . ARG D 3  126 ? -6.102  29.954  53.617 1.00 69.21  ? 127 ARG C C     1 
ATOM   7760  O  O     . ARG D 3  126 ? -6.687  31.018  53.846 1.00 59.59  ? 127 ARG C O     1 
ATOM   7761  C  CB    . ARG D 3  126 ? -4.055  28.865  54.643 1.00 66.24  ? 127 ARG C CB    1 
ATOM   7762  C  CG    . ARG D 3  126 ? -4.403  29.212  56.069 1.00 67.12  ? 127 ARG C CG    1 
ATOM   7763  C  CD    . ARG D 3  126 ? -3.731  28.303  57.063 1.00 73.12  ? 127 ARG C CD    1 
ATOM   7764  N  NE    . ARG D 3  126 ? -4.101  28.707  58.411 1.00 71.01  ? 127 ARG C NE    1 
ATOM   7765  C  CZ    . ARG D 3  126 ? -3.396  28.414  59.493 1.00 73.47  ? 127 ARG C CZ    1 
ATOM   7766  N  NH1   . ARG D 3  126 ? -2.277  27.709  59.382 1.00 79.85  ? 127 ARG C NH1   1 
ATOM   7767  N  NH2   . ARG D 3  126 ? -3.805  28.836  60.685 1.00 79.03  ? 127 ARG C NH2   1 
ATOM   7768  N  N     . MET D 3  127 ? -6.750  28.810  53.348 1.00 75.16  ? 128 MET C N     1 
ATOM   7769  C  CA    . MET D 3  127 ? -8.197  28.703  53.518 1.00 64.32  ? 128 MET C CA    1 
ATOM   7770  C  C     . MET D 3  127 ? -8.583  28.921  54.979 1.00 65.26  ? 128 MET C C     1 
ATOM   7771  O  O     . MET D 3  127 ? -7.845  28.568  55.911 1.00 59.78  ? 128 MET C O     1 
ATOM   7772  C  CB    . MET D 3  127 ? -8.714  27.315  53.155 1.00 68.06  ? 128 MET C CB    1 
ATOM   7773  C  CG    . MET D 3  127 ? -8.825  26.995  51.727 1.00 70.89  ? 128 MET C CG    1 
ATOM   7774  S  SD    . MET D 3  127 ? -9.218  25.254  51.686 1.00 81.77  ? 128 MET C SD    1 
ATOM   7775  C  CE    . MET D 3  127 ? -8.108  24.772  50.407 1.00 84.01  ? 128 MET C CE    1 
ATOM   7776  N  N     . THR D 3  128 ? -9.790  29.436  55.175 1.00 62.35  ? 129 THR C N     1 
ATOM   7777  C  CA    . THR D 3  128 ? -10.491 29.277  56.432 1.00 62.31  ? 129 THR C CA    1 
ATOM   7778  C  C     . THR D 3  128 ? -11.227 27.941  56.428 1.00 65.29  ? 129 THR C C     1 
ATOM   7779  O  O     . THR D 3  128 ? -11.463 27.333  55.377 1.00 63.18  ? 129 THR C O     1 
ATOM   7780  C  CB    . THR D 3  128 ? -11.503 30.391  56.636 1.00 61.49  ? 129 THR C CB    1 
ATOM   7781  O  OG1   . THR D 3  128 ? -12.488 30.313  55.603 1.00 63.76  ? 129 THR C OG1   1 
ATOM   7782  C  CG2   . THR D 3  128 ? -10.832 31.761  56.614 1.00 58.19  ? 129 THR C CG2   1 
ATOM   7783  N  N     . LYS D 3  129 ? -11.607 27.505  57.631 1.00 66.80  ? 130 LYS C N     1 
ATOM   7784  C  CA    . LYS D 3  129 ? -12.377 26.274  57.788 1.00 62.71  ? 130 LYS C CA    1 
ATOM   7785  C  C     . LYS D 3  129 ? -13.683 26.305  57.008 1.00 69.66  ? 130 LYS C C     1 
ATOM   7786  O  O     . LYS D 3  129 ? -14.081 25.289  56.420 1.00 74.03  ? 130 LYS C O     1 
ATOM   7787  C  CB    . LYS D 3  129 ? -12.641 26.020  59.272 1.00 56.09  ? 130 LYS C CB    1 
ATOM   7788  C  CG    . LYS D 3  129 ? -11.465 25.381  59.979 1.00 65.76  ? 130 LYS C CG    1 
ATOM   7789  C  CD    . LYS D 3  129 ? -11.428 25.649  61.463 1.00 69.65  ? 130 LYS C CD    1 
ATOM   7790  C  CE    . LYS D 3  129 ? -10.093 25.177  62.029 1.00 89.32  ? 130 LYS C CE    1 
ATOM   7791  N  NZ    . LYS D 3  129 ? -9.879  25.657  63.418 1.00 104.18 ? 130 LYS C NZ    1 
ATOM   7792  N  N     . ILE D 3  130 ? -14.377 27.454  56.995 1.00 63.73  ? 131 ILE C N     1 
ATOM   7793  C  CA    . ILE D 3  130 ? -15.652 27.496  56.280 1.00 63.25  ? 131 ILE C CA    1 
ATOM   7794  C  C     . ILE D 3  130 ? -15.442 27.308  54.784 1.00 62.77  ? 131 ILE C C     1 
ATOM   7795  O  O     . ILE D 3  130 ? -16.294 26.721  54.106 1.00 56.27  ? 131 ILE C O     1 
ATOM   7796  C  CB    . ILE D 3  130 ? -16.450 28.786  56.589 1.00 55.62  ? 131 ILE C CB    1 
ATOM   7797  C  CG1   . ILE D 3  130 ? -17.939 28.543  56.352 1.00 38.82  ? 131 ILE C CG1   1 
ATOM   7798  C  CG2   . ILE D 3  130 ? -16.016 29.968  55.717 1.00 44.93  ? 131 ILE C CG2   1 
ATOM   7799  C  CD1   . ILE D 3  130 ? -18.842 29.617  56.894 1.00 46.63  ? 131 ILE C CD1   1 
ATOM   7800  N  N     . THR D 3  131 ? -14.304 27.764  54.248 1.00 58.21  ? 132 THR C N     1 
ATOM   7801  C  CA    . THR D 3  131 ? -14.044 27.601  52.820 1.00 53.60  ? 132 THR C CA    1 
ATOM   7802  C  C     . THR D 3  131 ? -13.966 26.135  52.431 1.00 59.13  ? 132 THR C C     1 
ATOM   7803  O  O     . THR D 3  131 ? -14.348 25.768  51.314 1.00 67.62  ? 132 THR C O     1 
ATOM   7804  C  CB    . THR D 3  131 ? -12.755 28.318  52.400 1.00 51.66  ? 132 THR C CB    1 
ATOM   7805  O  OG1   . THR D 3  131 ? -12.955 29.722  52.435 1.00 58.03  ? 132 THR C OG1   1 
ATOM   7806  C  CG2   . THR D 3  131 ? -12.376 27.956  50.980 1.00 49.18  ? 132 THR C CG2   1 
ATOM   7807  N  N     . LEU D 3  132 ? -13.486 25.270  53.333 1.00 52.29  ? 133 LEU C N     1 
ATOM   7808  C  CA    . LEU D 3  132 ? -13.507 23.845  53.028 1.00 64.41  ? 133 LEU C CA    1 
ATOM   7809  C  C     . LEU D 3  132 ? -14.906 23.388  52.630 1.00 68.08  ? 133 LEU C C     1 
ATOM   7810  O  O     . LEU D 3  132 ? -15.051 22.499  51.786 1.00 74.81  ? 133 LEU C O     1 
ATOM   7811  C  CB    . LEU D 3  132 ? -12.985 23.032  54.217 1.00 69.27  ? 133 LEU C CB    1 
ATOM   7812  C  CG    . LEU D 3  132 ? -11.505 23.101  54.618 1.00 64.51  ? 133 LEU C CG    1 
ATOM   7813  C  CD1   . LEU D 3  132 ? -11.268 22.348  55.913 1.00 67.56  ? 133 LEU C CD1   1 
ATOM   7814  C  CD2   . LEU D 3  132 ? -10.602 22.553  53.536 1.00 70.62  ? 133 LEU C CD2   1 
ATOM   7815  N  N     . GLU D 3  133 ? -15.945 24.018  53.174 1.00 59.50  ? 134 GLU C N     1 
ATOM   7816  C  CA    . GLU D 3  133 ? -17.303 23.666  52.794 1.00 55.35  ? 134 GLU C CA    1 
ATOM   7817  C  C     . GLU D 3  133 ? -17.698 24.228  51.437 1.00 56.60  ? 134 GLU C C     1 
ATOM   7818  O  O     . GLU D 3  133 ? -18.634 23.716  50.824 1.00 60.68  ? 134 GLU C O     1 
ATOM   7819  C  CB    . GLU D 3  133 ? -18.299 24.122  53.853 1.00 56.26  ? 134 GLU C CB    1 
ATOM   7820  C  CG    . GLU D 3  133 ? -17.997 23.628  55.267 1.00 64.62  ? 134 GLU C CG    1 
ATOM   7821  C  CD    . GLU D 3  133 ? -18.090 22.118  55.386 1.00 88.26  ? 134 GLU C CD    1 
ATOM   7822  O  OE1   . GLU D 3  133 ? -17.446 21.539  56.292 1.00 101.90 ? 134 GLU C OE1   1 
ATOM   7823  O  OE2   . GLU D 3  133 ? -18.811 21.508  54.566 1.00 100.08 ? 134 GLU C OE2   1 
ATOM   7824  N  N     . LEU D 3  134 ? -17.033 25.270  50.947 1.00 53.40  ? 135 LEU C N     1 
ATOM   7825  C  CA    . LEU D 3  134 ? -17.280 25.660  49.561 1.00 46.53  ? 135 LEU C CA    1 
ATOM   7826  C  C     . LEU D 3  134 ? -16.648 24.681  48.598 1.00 52.19  ? 135 LEU C C     1 
ATOM   7827  O  O     . LEU D 3  134 ? -17.134 24.503  47.472 1.00 59.78  ? 135 LEU C O     1 
ATOM   7828  C  CB    . LEU D 3  134 ? -16.737 27.044  49.262 1.00 41.10  ? 135 LEU C CB    1 
ATOM   7829  C  CG    . LEU D 3  134 ? -17.394 28.233  49.926 1.00 44.74  ? 135 LEU C CG    1 
ATOM   7830  C  CD1   . LEU D 3  134 ? -16.625 29.478  49.584 1.00 48.30  ? 135 LEU C CD1   1 
ATOM   7831  C  CD2   . LEU D 3  134 ? -18.820 28.303  49.439 1.00 43.42  ? 135 LEU C CD2   1 
ATOM   7832  N  N     . LEU D 3  135 ? -15.538 24.084  49.002 1.00 50.15  ? 136 LEU C N     1 
ATOM   7833  C  CA    . LEU D 3  135 ? -14.753 23.213  48.150 1.00 51.17  ? 136 LEU C CA    1 
ATOM   7834  C  C     . LEU D 3  135 ? -15.065 21.749  48.382 1.00 56.86  ? 136 LEU C C     1 
ATOM   7835  O  O     . LEU D 3  135 ? -14.509 20.893  47.692 1.00 56.90  ? 136 LEU C O     1 
ATOM   7836  C  CB    . LEU D 3  135 ? -13.271 23.466  48.391 1.00 50.10  ? 136 LEU C CB    1 
ATOM   7837  C  CG    . LEU D 3  135 ? -12.757 24.817  47.908 1.00 58.84  ? 136 LEU C CG    1 
ATOM   7838  C  CD1   . LEU D 3  135 ? -11.534 25.202  48.707 1.00 62.27  ? 136 LEU C CD1   1 
ATOM   7839  C  CD2   . LEU D 3  135 ? -12.439 24.731  46.427 1.00 56.06  ? 136 LEU C CD2   1 
ATOM   7840  N  N     . ARG D 3  136 ? -15.928 21.455  49.343 1.00 70.21  ? 137 ARG C N     1 
ATOM   7841  C  CA    . ARG D 3  136 ? -16.229 20.090  49.727 1.00 56.96  ? 137 ARG C CA    1 
ATOM   7842  C  C     . ARG D 3  136 ? -16.790 19.317  48.547 1.00 60.76  ? 137 ARG C C     1 
ATOM   7843  O  O     . ARG D 3  136 ? -17.587 19.842  47.762 1.00 69.57  ? 137 ARG C O     1 
ATOM   7844  C  CB    . ARG D 3  136 ? -17.214 20.109  50.890 1.00 52.88  ? 137 ARG C CB    1 
ATOM   7845  C  CG    . ARG D 3  136 ? -17.472 18.800  51.542 1.00 59.18  ? 137 ARG C CG    1 
ATOM   7846  C  CD    . ARG D 3  136 ? -18.529 19.028  52.589 1.00 75.45  ? 137 ARG C CD    1 
ATOM   7847  N  NE    . ARG D 3  136 ? -19.165 17.809  53.064 1.00 94.83  ? 137 ARG C NE    1 
ATOM   7848  C  CZ    . ARG D 3  136 ? -20.180 17.805  53.921 1.00 89.53  ? 137 ARG C CZ    1 
ATOM   7849  N  NH1   . ARG D 3  136 ? -20.721 16.660  54.321 1.00 93.15  ? 137 ARG C NH1   1 
ATOM   7850  N  NH2   . ARG D 3  136 ? -20.657 18.958  54.376 1.00 65.12  ? 137 ARG C NH2   1 
ATOM   7851  N  N     . ASP D 3  137 ? -16.363 18.059  48.437 1.00 74.54  ? 138 ASP C N     1 
ATOM   7852  C  CA    . ASP D 3  137 ? -16.768 17.133  47.381 1.00 83.40  ? 138 ASP C CA    1 
ATOM   7853  C  C     . ASP D 3  137 ? -16.489 17.660  45.975 1.00 73.63  ? 138 ASP C C     1 
ATOM   7854  O  O     . ASP D 3  137 ? -17.163 17.265  45.024 1.00 56.58  ? 138 ASP C O     1 
ATOM   7855  C  CB    . ASP D 3  137 ? -18.252 16.760  47.510 1.00 85.12  ? 138 ASP C CB    1 
ATOM   7856  C  CG    . ASP D 3  137 ? -18.629 16.347  48.911 1.00 89.59  ? 138 ASP C CG    1 
ATOM   7857  O  OD1   . ASP D 3  137 ? -17.757 15.798  49.618 1.00 95.85  ? 138 ASP C OD1   1 
ATOM   7858  O  OD2   . ASP D 3  137 ? -19.790 16.583  49.311 1.00 92.26  ? 138 ASP C OD2   1 
ATOM   7859  N  N     . ILE D 3  138 ? -15.511 18.552  45.804 1.00 62.99  ? 139 ILE C N     1 
ATOM   7860  C  CA    . ILE D 3  138 ? -15.280 19.082  44.461 1.00 62.09  ? 139 ILE C CA    1 
ATOM   7861  C  C     . ILE D 3  138 ? -14.721 17.998  43.555 1.00 68.70  ? 139 ILE C C     1 
ATOM   7862  O  O     . ILE D 3  138 ? -15.066 17.918  42.369 1.00 67.45  ? 139 ILE C O     1 
ATOM   7863  C  CB    . ILE D 3  138 ? -14.383 20.341  44.484 1.00 61.41  ? 139 ILE C CB    1 
ATOM   7864  C  CG1   . ILE D 3  138 ? -14.243 20.881  43.066 1.00 53.95  ? 139 ILE C CG1   1 
ATOM   7865  C  CG2   . ILE D 3  138 ? -12.983 20.045  45.035 1.00 66.45  ? 139 ILE C CG2   1 
ATOM   7866  C  CD1   . ILE D 3  138 ? -13.202 21.935  42.915 1.00 54.81  ? 139 ILE C CD1   1 
ATOM   7867  N  N     . ASN D 3  139 ? -13.889 17.126  44.112 1.00 71.92  ? 140 ASN C N     1 
ATOM   7868  C  CA    . ASN D 3  139 ? -13.257 16.068  43.331 1.00 73.34  ? 140 ASN C CA    1 
ATOM   7869  C  C     . ASN D 3  139 ? -14.238 14.958  42.982 1.00 74.55  ? 140 ASN C C     1 
ATOM   7870  O  O     . ASN D 3  139 ? -14.153 14.360  41.899 1.00 80.59  ? 140 ASN C O     1 
ATOM   7871  C  CB    . ASN D 3  139 ? -12.066 15.510  44.101 1.00 74.27  ? 140 ASN C CB    1 
ATOM   7872  C  CG    . ASN D 3  139 ? -10.921 16.470  44.135 1.00 83.26  ? 140 ASN C CG    1 
ATOM   7873  O  OD1   . ASN D 3  139 ? -10.581 17.066  43.115 1.00 77.24  ? 140 ASN C OD1   1 
ATOM   7874  N  ND2   . ASN D 3  139 ? -10.331 16.659  45.316 1.00 90.03  ? 140 ASN C ND2   1 
ATOM   7875  N  N     . LYS D 3  140 ? -15.187 14.687  43.859 1.00 66.23  ? 141 LYS C N     1 
ATOM   7876  C  CA    . LYS D 3  140 ? -16.150 13.619  43.640 1.00 72.34  ? 141 LYS C CA    1 
ATOM   7877  C  C     . LYS D 3  140 ? -17.140 13.921  42.520 1.00 72.99  ? 141 LYS C C     1 
ATOM   7878  O  O     . LYS D 3  140 ? -18.314 13.542  42.613 1.00 66.06  ? 141 LYS C O     1 
ATOM   7879  C  CB    . LYS D 3  140 ? -16.886 13.315  44.940 1.00 72.39  ? 141 LYS C CB    1 
ATOM   7880  C  CG    . LYS D 3  140 ? -15.954 13.143  46.109 1.00 69.88  ? 141 LYS C CG    1 
ATOM   7881  C  CD    . LYS D 3  140 ? -16.654 12.525  47.293 1.00 70.31  ? 141 LYS C CD    1 
ATOM   7882  C  CE    . LYS D 3  140 ? -15.967 12.926  48.581 1.00 83.25  ? 141 LYS C CE    1 
ATOM   7883  N  NZ    . LYS D 3  140 ? -14.486 12.909  48.432 1.00 94.95  ? 141 LYS C NZ    1 
ATOM   7884  N  N     . ASP D 3  141 ? -16.690 14.600  41.469 1.00 73.10  ? 142 ASP C N     1 
ATOM   7885  C  CA    . ASP D 3  141 ? -17.487 14.851  40.266 1.00 69.70  ? 142 ASP C CA    1 
ATOM   7886  C  C     . ASP D 3  141 ? -18.875 15.403  40.605 1.00 79.05  ? 142 ASP C C     1 
ATOM   7887  O  O     . ASP D 3  141 ? -19.909 14.775  40.394 1.00 79.50  ? 142 ASP C O     1 
ATOM   7888  C  CB    . ASP D 3  141 ? -17.619 13.586  39.417 1.00 72.37  ? 142 ASP C CB    1 
ATOM   7889  C  CG    . ASP D 3  141 ? -18.499 13.801  38.201 1.00 85.65  ? 142 ASP C CG    1 
ATOM   7890  O  OD1   . ASP D 3  141 ? -18.027 14.453  37.248 1.00 87.16  ? 142 ASP C OD1   1 
ATOM   7891  O  OD2   . ASP D 3  141 ? -19.668 13.352  38.214 1.00 95.40  ? 142 ASP C OD2   1 
ATOM   7892  N  N     . THR D 3  142 ? -18.866 16.607  41.159 1.00 81.10  ? 143 THR C N     1 
ATOM   7893  C  CA    . THR D 3  142 ? -20.101 17.260  41.554 1.00 77.40  ? 143 THR C CA    1 
ATOM   7894  C  C     . THR D 3  142 ? -20.403 18.496  40.736 1.00 83.40  ? 143 THR C C     1 
ATOM   7895  O  O     . THR D 3  142 ? -21.531 19.001  40.792 1.00 85.09  ? 143 THR C O     1 
ATOM   7896  C  CB    . THR D 3  142 ? -20.030 17.668  43.027 1.00 69.26  ? 143 THR C CB    1 
ATOM   7897  O  OG1   . THR D 3  142 ? -18.725 18.185  43.290 1.00 82.45  ? 143 THR C OG1   1 
ATOM   7898  C  CG2   . THR D 3  142 ? -20.247 16.487  43.911 1.00 60.42  ? 143 THR C CG2   1 
ATOM   7899  N  N     . ILE D 3  143 ? -19.419 19.009  40.002 1.00 85.36  ? 144 ILE C N     1 
ATOM   7900  C  CA    . ILE D 3  143 ? -19.526 20.231  39.224 1.00 78.60  ? 144 ILE C CA    1 
ATOM   7901  C  C     . ILE D 3  143 ? -18.690 20.041  37.968 1.00 83.82  ? 144 ILE C C     1 
ATOM   7902  O  O     . ILE D 3  143 ? -17.750 19.246  37.936 1.00 94.13  ? 144 ILE C O     1 
ATOM   7903  C  CB    . ILE D 3  143 ? -19.030 21.448  40.032 1.00 69.79  ? 144 ILE C CB    1 
ATOM   7904  C  CG1   . ILE D 3  143 ? -17.675 21.120  40.656 1.00 71.23  ? 144 ILE C CG1   1 
ATOM   7905  C  CG2   . ILE D 3  143 ? -20.039 21.837  41.088 1.00 51.43  ? 144 ILE C CG2   1 
ATOM   7906  C  CD1   . ILE D 3  143 ? -16.527 21.866  40.021 1.00 58.49  ? 144 ILE C CD1   1 
ATOM   7907  N  N     . ASP D 3  144 ? -19.020 20.811  36.935 1.00 76.98  ? 145 ASP C N     1 
ATOM   7908  C  CA    . ASP D 3  144 ? -18.381 20.653  35.630 1.00 77.69  ? 145 ASP C CA    1 
ATOM   7909  C  C     . ASP D 3  144 ? -17.082 21.453  35.546 1.00 71.42  ? 145 ASP C C     1 
ATOM   7910  O  O     . ASP D 3  144 ? -17.066 22.660  35.808 1.00 74.30  ? 145 ASP C O     1 
ATOM   7911  C  CB    . ASP D 3  144 ? -19.309 21.097  34.493 1.00 79.65  ? 145 ASP C CB    1 
ATOM   7912  C  CG    . ASP D 3  144 ? -20.596 20.291  34.421 1.00 80.05  ? 145 ASP C CG    1 
ATOM   7913  O  OD1   . ASP D 3  144 ? -20.665 19.187  34.998 1.00 94.29  ? 145 ASP C OD1   1 
ATOM   7914  O  OD2   . ASP D 3  144 ? -21.543 20.771  33.759 1.00 68.96  ? 145 ASP C OD2   1 
ATOM   7915  N  N     . PHE D 3  145 ? -16.011 20.794  35.124 1.00 65.30  ? 146 PHE C N     1 
ATOM   7916  C  CA    . PHE D 3  145 ? -14.771 21.503  34.868 1.00 69.64  ? 146 PHE C CA    1 
ATOM   7917  C  C     . PHE D 3  145 ? -14.749 22.014  33.436 1.00 72.30  ? 146 PHE C C     1 
ATOM   7918  O  O     . PHE D 3  145 ? -15.490 21.545  32.573 1.00 81.47  ? 146 PHE C O     1 
ATOM   7919  C  CB    . PHE D 3  145 ? -13.567 20.604  35.136 1.00 73.93  ? 146 PHE C CB    1 
ATOM   7920  C  CG    . PHE D 3  145 ? -13.233 20.472  36.583 1.00 76.20  ? 146 PHE C CG    1 
ATOM   7921  C  CD1   . PHE D 3  145 ? -14.060 19.765  37.437 1.00 80.64  ? 146 PHE C CD1   1 
ATOM   7922  C  CD2   . PHE D 3  145 ? -12.096 21.063  37.092 1.00 78.41  ? 146 PHE C CD2   1 
ATOM   7923  C  CE1   . PHE D 3  145 ? -13.751 19.649  38.775 1.00 72.20  ? 146 PHE C CE1   1 
ATOM   7924  C  CE2   . PHE D 3  145 ? -11.784 20.947  38.429 1.00 77.20  ? 146 PHE C CE2   1 
ATOM   7925  C  CZ    . PHE D 3  145 ? -12.610 20.241  39.269 1.00 69.11  ? 146 PHE C CZ    1 
ATOM   7926  N  N     . ILE D 3  146 ? -13.901 23.013  33.191 1.00 72.11  ? 147 ILE C N     1 
ATOM   7927  C  CA    . ILE D 3  146 ? -13.731 23.591  31.865 1.00 81.07  ? 147 ILE C CA    1 
ATOM   7928  C  C     . ILE D 3  146 ? -12.242 23.796  31.641 1.00 89.31  ? 147 ILE C C     1 
ATOM   7929  O  O     . ILE D 3  146 ? -11.454 23.869  32.587 1.00 85.85  ? 147 ILE C O     1 
ATOM   7930  C  CB    . ILE D 3  146 ? -14.490 24.935  31.696 1.00 71.49  ? 147 ILE C CB    1 
ATOM   7931  C  CG1   . ILE D 3  146 ? -13.860 25.984  32.625 1.00 69.22  ? 147 ILE C CG1   1 
ATOM   7932  C  CG2   . ILE D 3  146 ? -16.003 24.751  31.881 1.00 61.07  ? 147 ILE C CG2   1 
ATOM   7933  C  CD1   . ILE D 3  146 ? -14.741 27.151  33.034 1.00 69.60  ? 147 ILE C CD1   1 
ATOM   7934  N  N     . ASP D 3  147 ? -11.855 23.874  30.366 1.00 89.93  ? 148 ASP C N     1 
ATOM   7935  C  CA    . ASP D 3  147 ? -10.483 24.248  30.044 1.00 85.84  ? 148 ASP C CA    1 
ATOM   7936  C  C     . ASP D 3  147 ? -10.174 25.649  30.549 1.00 83.02  ? 148 ASP C C     1 
ATOM   7937  O  O     . ASP D 3  147 ? -11.023 26.539  30.518 1.00 81.79  ? 148 ASP C O     1 
ATOM   7938  C  CB    . ASP D 3  147 ? -10.258 24.202  28.532 1.00 91.20  ? 148 ASP C CB    1 
ATOM   7939  C  CG    . ASP D 3  147 ? -9.857  22.844  28.028 1.00 100.82 ? 148 ASP C CG    1 
ATOM   7940  O  OD1   . ASP D 3  147 ? -9.781  21.900  28.836 1.00 96.80  ? 148 ASP C OD1   1 
ATOM   7941  O  OD2   . ASP D 3  147 ? -9.623  22.730  26.806 1.00 109.00 ? 148 ASP C OD2   1 
ATOM   7942  N  N     . ASN D 3  148 ? -8.939  25.845  31.013 1.00 84.86  ? 149 ASN C N     1 
ATOM   7943  C  CA    . ASN D 3  148 ? -8.471  27.183  31.355 1.00 86.70  ? 149 ASN C CA    1 
ATOM   7944  C  C     . ASN D 3  148 ? -7.996  27.929  30.101 1.00 90.88  ? 149 ASN C C     1 
ATOM   7945  O  O     . ASN D 3  148 ? -7.928  27.372  29.005 1.00 98.26  ? 149 ASN C O     1 
ATOM   7946  C  CB    . ASN D 3  148 ? -7.346  27.105  32.391 1.00 84.97  ? 149 ASN C CB    1 
ATOM   7947  C  CG    . ASN D 3  148 ? -6.005  26.764  31.770 1.00 95.16  ? 149 ASN C CG    1 
ATOM   7948  O  OD1   . ASN D 3  148 ? -5.938  26.193  30.675 1.00 92.73  ? 149 ASN C OD1   1 
ATOM   7949  N  ND2   . ASN D 3  148 ? -4.928  27.098  32.469 1.00 99.68  ? 149 ASN C ND2   1 
ATOM   7950  N  N     . TYR D 3  149 ? -7.540  29.172  30.312 1.00 89.50  ? 150 TYR C N     1 
ATOM   7951  C  CA    . TYR D 3  149 ? -7.316  30.122  29.217 1.00 89.41  ? 150 TYR C CA    1 
ATOM   7952  C  C     . TYR D 3  149 ? -6.295  29.651  28.174 1.00 92.24  ? 150 TYR C C     1 
ATOM   7953  O  O     . TYR D 3  149 ? -6.424  29.988  26.989 1.00 97.35  ? 150 TYR C O     1 
ATOM   7954  C  CB    . TYR D 3  149 ? -6.906  31.481  29.796 1.00 95.00  ? 150 TYR C CB    1 
ATOM   7955  C  CG    . TYR D 3  149 ? -5.504  31.540  30.380 1.00 95.55  ? 150 TYR C CG    1 
ATOM   7956  C  CD1   . TYR D 3  149 ? -5.259  31.175  31.699 1.00 93.34  ? 150 TYR C CD1   1 
ATOM   7957  C  CD2   . TYR D 3  149 ? -4.442  32.020  29.625 1.00 93.72  ? 150 TYR C CD2   1 
ATOM   7958  C  CE1   . TYR D 3  149 ? -3.994  31.253  32.234 1.00 97.21  ? 150 TYR C CE1   1 
ATOM   7959  C  CE2   . TYR D 3  149 ? -3.178  32.102  30.145 1.00 97.12  ? 150 TYR C CE2   1 
ATOM   7960  C  CZ    . TYR D 3  149 ? -2.953  31.719  31.452 1.00 100.10 ? 150 TYR C CZ    1 
ATOM   7961  O  OH    . TYR D 3  149 ? -1.680  31.805  31.976 1.00 99.60  ? 150 TYR C OH    1 
ATOM   7962  N  N     . ASP D 3  150 ? -5.246  28.946  28.574 1.00 92.13  ? 151 ASP C N     1 
ATOM   7963  C  CA    . ASP D 3  150 ? -4.246  28.544  27.575 1.00 92.82  ? 151 ASP C CA    1 
ATOM   7964  C  C     . ASP D 3  150 ? -4.358  27.081  27.162 1.00 96.50  ? 151 ASP C C     1 
ATOM   7965  O  O     . ASP D 3  150 ? -3.516  26.587  26.392 1.00 113.59 ? 151 ASP C O     1 
ATOM   7966  C  CB    . ASP D 3  150 ? -2.820  28.852  28.047 1.00 90.91  ? 151 ASP C CB    1 
ATOM   7967  C  CG    . ASP D 3  150 ? -2.411  28.033  29.237 1.00 93.62  ? 151 ASP C CG    1 
ATOM   7968  O  OD1   . ASP D 3  150 ? -3.174  27.118  29.611 1.00 102.78 ? 151 ASP C OD1   1 
ATOM   7969  O  OD2   . ASP D 3  150 ? -1.334  28.304  29.805 1.00 97.33  ? 151 ASP C OD2   1 
ATOM   7970  N  N     . GLY D 3  151 ? -5.372  26.382  27.642 1.00 84.51  ? 152 GLY C N     1 
ATOM   7971  C  CA    . GLY D 3  151 ? -5.571  24.990  27.323 1.00 85.38  ? 152 GLY C CA    1 
ATOM   7972  C  C     . GLY D 3  151 ? -4.815  24.057  28.221 1.00 92.46  ? 152 GLY C C     1 
ATOM   7973  O  O     . GLY D 3  151 ? -4.964  22.835  28.086 1.00 93.75  ? 152 GLY C O     1 
ATOM   7974  N  N     . ASN D 3  152 ? -4.040  24.592  29.159 1.00 101.42 ? 153 ASN C N     1 
ATOM   7975  C  CA    . ASN D 3  152 ? -3.030  23.818  29.856 1.00 87.94  ? 153 ASN C CA    1 
ATOM   7976  C  C     . ASN D 3  152 ? -3.470  23.330  31.220 1.00 88.66  ? 153 ASN C C     1 
ATOM   7977  O  O     . ASN D 3  152 ? -2.772  22.498  31.804 1.00 96.59  ? 153 ASN C O     1 
ATOM   7978  C  CB    . ASN D 3  152 ? -1.750  24.631  30.000 1.00 87.14  ? 153 ASN C CB    1 
ATOM   7979  C  CG    . ASN D 3  152 ? -1.095  24.901  28.670 1.00 95.17  ? 153 ASN C CG    1 
ATOM   7980  O  OD1   . ASN D 3  152 ? -1.604  24.501  27.620 1.00 109.62 ? 153 ASN C OD1   1 
ATOM   7981  N  ND2   . ASN D 3  152 ? 0.051   25.570  28.702 1.00 97.56  ? 153 ASN C ND2   1 
ATOM   7982  N  N     . GLU D 3  153 ? -4.593  23.816  31.744 1.00 80.89  ? 154 GLU C N     1 
ATOM   7983  C  CA    . GLU D 3  153 ? -5.145  23.300  32.984 1.00 79.04  ? 154 GLU C CA    1 
ATOM   7984  C  C     . GLU D 3  153 ? -6.648  23.155  32.855 1.00 78.67  ? 154 GLU C C     1 
ATOM   7985  O  O     . GLU D 3  153 ? -7.257  23.512  31.839 1.00 85.75  ? 154 GLU C O     1 
ATOM   7986  C  CB    . GLU D 3  153 ? -4.822  24.197  34.184 1.00 85.96  ? 154 GLU C CB    1 
ATOM   7987  C  CG    . GLU D 3  153 ? -3.389  24.640  34.305 1.00 96.00  ? 154 GLU C CG    1 
ATOM   7988  C  CD    . GLU D 3  153 ? -2.487  23.544  34.818 1.00 94.33  ? 154 GLU C CD    1 
ATOM   7989  O  OE1   . GLU D 3  153 ? -2.984  22.417  35.016 1.00 97.54  ? 154 GLU C OE1   1 
ATOM   7990  O  OE2   . GLU D 3  153 ? -1.283  23.812  35.031 1.00 88.86  ? 154 GLU C OE2   1 
ATOM   7991  N  N     . ARG D 3  154 ? -7.228  22.626  33.923 1.00 73.71  ? 155 ARG C N     1 
ATOM   7992  C  CA    . ARG D 3  154 ? -8.664  22.546  34.114 1.00 74.84  ? 155 ARG C CA    1 
ATOM   7993  C  C     . ARG D 3  154 ? -9.028  23.353  35.347 1.00 76.71  ? 155 ARG C C     1 
ATOM   7994  O  O     . ARG D 3  154 ? -8.290  23.349  36.349 1.00 73.24  ? 155 ARG C O     1 
ATOM   7995  C  CB    . ARG D 3  154 ? -9.146  21.103  34.321 1.00 80.44  ? 155 ARG C CB    1 
ATOM   7996  C  CG    . ARG D 3  154 ? -8.836  20.149  33.187 1.00 88.70  ? 155 ARG C CG    1 
ATOM   7997  C  CD    . ARG D 3  154 ? -9.805  20.322  32.031 1.00 93.25  ? 155 ARG C CD    1 
ATOM   7998  N  NE    . ARG D 3  154 ? -11.039 19.557  32.209 1.00 91.24  ? 155 ARG C NE    1 
ATOM   7999  C  CZ    . ARG D 3  154 ? -12.103 19.669  31.419 1.00 96.55  ? 155 ARG C CZ    1 
ATOM   8000  N  NH1   . ARG D 3  154 ? -12.089 20.528  30.405 1.00 97.34  ? 155 ARG C NH1   1 
ATOM   8001  N  NH2   . ARG D 3  154 ? -13.181 18.924  31.647 1.00 105.54 ? 155 ARG C NH2   1 
ATOM   8002  N  N     . GLU D 3  155 ? -10.164 24.028  35.293 1.00 74.66  ? 156 GLU C N     1 
ATOM   8003  C  CA    . GLU D 3  155 ? -10.664 24.795  36.424 1.00 71.23  ? 156 GLU C CA    1 
ATOM   8004  C  C     . GLU D 3  155 ? -12.145 24.536  36.602 1.00 77.72  ? 156 GLU C C     1 
ATOM   8005  O  O     . GLU D 3  155 ? -12.833 24.101  35.665 1.00 78.06  ? 156 GLU C O     1 
ATOM   8006  C  CB    . GLU D 3  155 ? -10.397 26.298  36.238 1.00 71.01  ? 156 GLU C CB    1 
ATOM   8007  C  CG    . GLU D 3  155 ? -11.056 26.924  35.025 1.00 74.70  ? 156 GLU C CG    1 
ATOM   8008  C  CD    . GLU D 3  155 ? -10.985 28.440  35.039 1.00 79.17  ? 156 GLU C CD    1 
ATOM   8009  O  OE1   . GLU D 3  155 ? -10.985 29.049  33.950 1.00 80.00  ? 156 GLU C OE1   1 
ATOM   8010  O  OE2   . GLU D 3  155 ? -10.927 29.028  36.137 1.00 83.05  ? 156 GLU C OE2   1 
ATOM   8011  N  N     . PRO D 3  156 ? -12.672 24.740  37.815 1.00 72.89  ? 157 PRO C N     1 
ATOM   8012  C  CA    . PRO D 3  156 ? -14.103 24.537  38.061 1.00 63.72  ? 157 PRO C CA    1 
ATOM   8013  C  C     . PRO D 3  156 ? -14.938 25.636  37.429 1.00 63.65  ? 157 PRO C C     1 
ATOM   8014  O  O     . PRO D 3  156 ? -14.559 26.806  37.435 1.00 65.02  ? 157 PRO C O     1 
ATOM   8015  C  CB    . PRO D 3  156 ? -14.199 24.577  39.588 1.00 60.91  ? 157 PRO C CB    1 
ATOM   8016  C  CG    . PRO D 3  156 ? -13.059 25.459  39.983 1.00 60.53  ? 157 PRO C CG    1 
ATOM   8017  C  CD    . PRO D 3  156 ? -11.954 25.106  39.048 1.00 60.77  ? 157 PRO C CD    1 
ATOM   8018  N  N     . SER D 3  157 ? -16.103 25.267  36.897 1.00 72.75  ? 158 SER C N     1 
ATOM   8019  C  CA    . SER D 3  157 ? -17.025 26.297  36.415 1.00 67.20  ? 158 SER C CA    1 
ATOM   8020  C  C     . SER D 3  157 ? -17.774 26.988  37.543 1.00 60.33  ? 158 SER C C     1 
ATOM   8021  O  O     . SER D 3  157 ? -18.263 28.109  37.351 1.00 77.78  ? 158 SER C O     1 
ATOM   8022  C  CB    . SER D 3  157 ? -18.020 25.714  35.405 1.00 67.27  ? 158 SER C CB    1 
ATOM   8023  O  OG    . SER D 3  157 ? -18.910 24.776  35.995 1.00 66.88  ? 158 SER C OG    1 
ATOM   8024  N  N     . VAL D 3  158 ? -17.848 26.347  38.704 1.00 56.15  ? 159 VAL C N     1 
ATOM   8025  C  CA    . VAL D 3  158 ? -18.664 26.741  39.849 1.00 60.34  ? 159 VAL C CA    1 
ATOM   8026  C  C     . VAL D 3  158 ? -18.203 25.856  41.004 1.00 61.67  ? 159 VAL C C     1 
ATOM   8027  O  O     . VAL D 3  158 ? -17.726 24.737  40.774 1.00 66.96  ? 159 VAL C O     1 
ATOM   8028  C  CB    . VAL D 3  158 ? -20.173 26.567  39.552 1.00 60.27  ? 159 VAL C CB    1 
ATOM   8029  C  CG1   . VAL D 3  158 ? -20.565 25.101  39.537 1.00 49.67  ? 159 VAL C CG1   1 
ATOM   8030  C  CG2   . VAL D 3  158 ? -21.019 27.328  40.548 1.00 70.52  ? 159 VAL C CG2   1 
ATOM   8031  N  N     . LEU D 3  159 ? -18.278 26.352  42.231 1.00 57.13  ? 160 LEU C N     1 
ATOM   8032  C  CA    . LEU D 3  159 ? -17.890 25.474  43.319 1.00 50.73  ? 160 LEU C CA    1 
ATOM   8033  C  C     . LEU D 3  159 ? -19.104 24.817  43.948 1.00 55.17  ? 160 LEU C C     1 
ATOM   8034  O  O     . LEU D 3  159 ? -20.231 25.311  43.828 1.00 65.09  ? 160 LEU C O     1 
ATOM   8035  C  CB    . LEU D 3  159 ? -17.098 26.226  44.394 1.00 52.86  ? 160 LEU C CB    1 
ATOM   8036  C  CG    . LEU D 3  159 ? -15.823 26.940  43.958 1.00 56.94  ? 160 LEU C CG    1 
ATOM   8037  C  CD1   . LEU D 3  159 ? -15.131 27.530  45.162 1.00 61.59  ? 160 LEU C CD1   1 
ATOM   8038  C  CD2   . LEU D 3  159 ? -14.900 25.996  43.224 1.00 46.65  ? 160 LEU C CD2   1 
ATOM   8039  N  N     . PRO D 3  160 ? -18.898 23.688  44.635 1.00 58.66  ? 161 PRO C N     1 
ATOM   8040  C  CA    . PRO D 3  160 ? -20.033 22.952  45.222 1.00 58.62  ? 161 PRO C CA    1 
ATOM   8041  C  C     . PRO D 3  160 ? -20.839 23.758  46.214 1.00 58.76  ? 161 PRO C C     1 
ATOM   8042  O  O     . PRO D 3  160 ? -22.057 23.547  46.319 1.00 72.42  ? 161 PRO C O     1 
ATOM   8043  C  CB    . PRO D 3  160 ? -19.345 21.767  45.912 1.00 55.09  ? 161 PRO C CB    1 
ATOM   8044  C  CG    . PRO D 3  160 ? -18.102 21.577  45.138 1.00 61.65  ? 161 PRO C CG    1 
ATOM   8045  C  CD    . PRO D 3  160 ? -17.639 22.936  44.760 1.00 70.36  ? 161 PRO C CD    1 
ATOM   8046  N  N     . ALA D 3  161 ? -20.185 24.613  46.997 1.00 50.96  ? 162 ALA C N     1 
ATOM   8047  C  CA    . ALA D 3  161 ? -20.839 25.624  47.810 1.00 48.85  ? 162 ALA C CA    1 
ATOM   8048  C  C     . ALA D 3  161 ? -21.855 25.001  48.768 1.00 62.92  ? 162 ALA C C     1 
ATOM   8049  O  O     . ALA D 3  161 ? -23.057 25.209  48.671 1.00 64.50  ? 162 ALA C O     1 
ATOM   8050  C  CB    . ALA D 3  161 ? -21.498 26.678  46.918 1.00 43.80  ? 162 ALA C CB    1 
ATOM   8051  N  N     . ARG D 3  162 ? -21.337 24.237  49.734 1.00 59.41  ? 163 ARG C N     1 
ATOM   8052  C  CA    . ARG D 3  162 ? -22.240 23.521  50.624 1.00 54.03  ? 163 ARG C CA    1 
ATOM   8053  C  C     . ARG D 3  162 ? -22.916 24.426  51.644 1.00 65.29  ? 163 ARG C C     1 
ATOM   8054  O  O     . ARG D 3  162 ? -23.606 23.924  52.538 1.00 84.08  ? 163 ARG C O     1 
ATOM   8055  C  CB    . ARG D 3  162 ? -21.499 22.372  51.314 1.00 63.25  ? 163 ARG C CB    1 
ATOM   8056  C  CG    . ARG D 3  162 ? -20.843 21.404  50.339 1.00 69.50  ? 163 ARG C CG    1 
ATOM   8057  C  CD    . ARG D 3  162 ? -21.802 20.916  49.262 1.00 71.65  ? 163 ARG C CD    1 
ATOM   8058  N  NE    . ARG D 3  162 ? -23.074 20.459  49.825 1.00 56.26  ? 163 ARG C NE    1 
ATOM   8059  C  CZ    . ARG D 3  162 ? -23.248 19.281  50.406 1.00 55.34  ? 163 ARG C CZ    1 
ATOM   8060  N  NH1   . ARG D 3  162 ? -22.232 18.440  50.505 1.00 62.92  ? 163 ARG C NH1   1 
ATOM   8061  N  NH2   . ARG D 3  162 ? -24.439 18.938  50.880 1.00 58.69  ? 163 ARG C NH2   1 
ATOM   8062  N  N     . PHE D 3  163 ? -22.758 25.743  51.517 1.00 57.11  ? 164 PHE C N     1 
ATOM   8063  C  CA    . PHE D 3  163 ? -23.455 26.728  52.330 1.00 55.11  ? 164 PHE C CA    1 
ATOM   8064  C  C     . PHE D 3  163 ? -23.757 27.975  51.505 1.00 54.60  ? 164 PHE C C     1 
ATOM   8065  O  O     . PHE D 3  163 ? -22.894 28.431  50.737 1.00 59.81  ? 164 PHE C O     1 
ATOM   8066  C  CB    . PHE D 3  163 ? -22.659 27.083  53.586 1.00 57.68  ? 164 PHE C CB    1 
ATOM   8067  C  CG    . PHE D 3  163 ? -21.537 28.031  53.344 1.00 60.53  ? 164 PHE C CG    1 
ATOM   8068  C  CD1   . PHE D 3  163 ? -20.294 27.572  52.967 1.00 55.47  ? 164 PHE C CD1   1 
ATOM   8069  C  CD2   . PHE D 3  163 ? -21.721 29.389  53.519 1.00 61.69  ? 164 PHE C CD2   1 
ATOM   8070  C  CE1   . PHE D 3  163 ? -19.264 28.453  52.771 1.00 56.23  ? 164 PHE C CE1   1 
ATOM   8071  C  CE2   . PHE D 3  163 ? -20.693 30.268  53.306 1.00 46.90  ? 164 PHE C CE2   1 
ATOM   8072  C  CZ    . PHE D 3  163 ? -19.467 29.801  52.931 1.00 42.14  ? 164 PHE C CZ    1 
ATOM   8073  N  N     . PRO D 3  164 ? -24.945 28.559  51.674 1.00 60.11  ? 165 PRO C N     1 
ATOM   8074  C  CA    . PRO D 3  164 ? -25.479 29.522  50.696 1.00 52.93  ? 165 PRO C CA    1 
ATOM   8075  C  C     . PRO D 3  164 ? -24.701 30.813  50.629 1.00 62.39  ? 165 PRO C C     1 
ATOM   8076  O  O     . PRO D 3  164 ? -25.034 31.774  51.323 1.00 63.34  ? 165 PRO C O     1 
ATOM   8077  C  CB    . PRO D 3  164 ? -26.900 29.771  51.205 1.00 49.29  ? 165 PRO C CB    1 
ATOM   8078  C  CG    . PRO D 3  164 ? -26.822 29.479  52.658 1.00 55.29  ? 165 PRO C CG    1 
ATOM   8079  C  CD    . PRO D 3  164 ? -25.879 28.335  52.786 1.00 70.22  ? 165 PRO C CD    1 
ATOM   8080  N  N     . ASN D 3  165 ? -23.703 30.872  49.758 1.00 67.83  ? 166 ASN C N     1 
ATOM   8081  C  CA    . ASN D 3  165 ? -22.607 31.812  49.917 1.00 49.23  ? 166 ASN C CA    1 
ATOM   8082  C  C     . ASN D 3  165 ? -22.811 33.116  49.168 1.00 56.94  ? 166 ASN C C     1 
ATOM   8083  O  O     . ASN D 3  165 ? -22.105 34.093  49.437 1.00 64.96  ? 166 ASN C O     1 
ATOM   8084  C  CB    . ASN D 3  165 ? -21.317 31.155  49.453 1.00 44.89  ? 166 ASN C CB    1 
ATOM   8085  C  CG    . ASN D 3  165 ? -20.171 32.116  49.399 1.00 62.80  ? 166 ASN C CG    1 
ATOM   8086  O  OD1   . ASN D 3  165 ? -19.930 32.865  50.341 1.00 63.43  ? 166 ASN C OD1   1 
ATOM   8087  N  ND2   . ASN D 3  165 ? -19.472 32.133  48.273 1.00 66.34  ? 166 ASN C ND2   1 
ATOM   8088  N  N     . LEU D 3  166 ? -23.725 33.158  48.212 1.00 56.60  ? 167 LEU C N     1 
ATOM   8089  C  CA    . LEU D 3  166 ? -24.006 34.426  47.560 1.00 57.33  ? 167 LEU C CA    1 
ATOM   8090  C  C     . LEU D 3  166 ? -24.707 35.361  48.519 1.00 56.57  ? 167 LEU C C     1 
ATOM   8091  O  O     . LEU D 3  166 ? -24.409 36.559  48.580 1.00 62.68  ? 167 LEU C O     1 
ATOM   8092  C  CB    . LEU D 3  166 ? -24.877 34.206  46.335 1.00 52.34  ? 167 LEU C CB    1 
ATOM   8093  C  CG    . LEU D 3  166 ? -25.501 35.488  45.804 1.00 44.01  ? 167 LEU C CG    1 
ATOM   8094  C  CD1   . LEU D 3  166 ? -24.557 36.180  44.854 1.00 40.87  ? 167 LEU C CD1   1 
ATOM   8095  C  CD2   . LEU D 3  166 ? -26.822 35.195  45.143 1.00 48.83  ? 167 LEU C CD2   1 
ATOM   8096  N  N     . LEU D 3  167 ? -25.653 34.825  49.265 1.00 63.60  ? 168 LEU C N     1 
ATOM   8097  C  CA    . LEU D 3  167 ? -26.478 35.628  50.139 1.00 54.28  ? 168 LEU C CA    1 
ATOM   8098  C  C     . LEU D 3  167 ? -25.780 35.933  51.433 1.00 55.64  ? 168 LEU C C     1 
ATOM   8099  O  O     . LEU D 3  167 ? -26.149 36.894  52.113 1.00 55.07  ? 168 LEU C O     1 
ATOM   8100  C  CB    . LEU D 3  167 ? -27.771 34.897  50.439 1.00 39.28  ? 168 LEU C CB    1 
ATOM   8101  C  CG    . LEU D 3  167 ? -28.869 35.167  49.431 1.00 44.04  ? 168 LEU C CG    1 
ATOM   8102  C  CD1   . LEU D 3  167 ? -30.199 34.948  50.079 1.00 54.15  ? 168 LEU C CD1   1 
ATOM   8103  C  CD2   . LEU D 3  167 ? -28.745 36.580  48.943 1.00 42.88  ? 168 LEU C CD2   1 
ATOM   8104  N  N     . ALA D 3  168 ? -24.792 35.126  51.787 1.00 59.63  ? 169 ALA C N     1 
ATOM   8105  C  CA    . ALA D 3  168 ? -24.223 35.146  53.118 1.00 40.77  ? 169 ALA C CA    1 
ATOM   8106  C  C     . ALA D 3  168 ? -23.068 36.109  53.222 1.00 51.79  ? 169 ALA C C     1 
ATOM   8107  O  O     . ALA D 3  168 ? -22.934 36.813  54.223 1.00 66.73  ? 169 ALA C O     1 
ATOM   8108  C  CB    . ALA D 3  168 ? -23.770 33.747  53.509 1.00 41.49  ? 169 ALA C CB    1 
ATOM   8109  N  N     . ASN D 3  169 ? -22.255 36.150  52.189 1.00 43.41  ? 170 ASN C N     1 
ATOM   8110  C  CA    . ASN D 3  169 ? -21.182 37.098  52.105 1.00 38.54  ? 170 ASN C CA    1 
ATOM   8111  C  C     . ASN D 3  169 ? -21.530 38.263  51.195 1.00 46.03  ? 170 ASN C C     1 
ATOM   8112  O  O     . ASN D 3  169 ? -20.780 39.245  51.173 1.00 47.34  ? 170 ASN C O     1 
ATOM   8113  C  CB    . ASN D 3  169 ? -19.914 36.395  51.641 1.00 41.39  ? 170 ASN C CB    1 
ATOM   8114  C  CG    . ASN D 3  169 ? -19.157 35.789  52.797 1.00 47.84  ? 170 ASN C CG    1 
ATOM   8115  O  OD1   . ASN D 3  169 ? -18.980 36.438  53.825 1.00 56.33  ? 170 ASN C OD1   1 
ATOM   8116  N  ND2   . ASN D 3  169 ? -18.708 34.547  52.642 1.00 46.63  ? 170 ASN C ND2   1 
ATOM   8117  N  N     . GLY D 3  170 ? -22.651 38.197  50.474 1.00 47.53  ? 171 GLY C N     1 
ATOM   8118  C  CA    . GLY D 3  170 ? -23.069 39.271  49.588 1.00 44.65  ? 171 GLY C CA    1 
ATOM   8119  C  C     . GLY D 3  170 ? -22.132 39.432  48.420 1.00 50.49  ? 171 GLY C C     1 
ATOM   8120  O  O     . GLY D 3  170 ? -21.186 38.659  48.266 1.00 56.40  ? 171 GLY C O     1 
ATOM   8121  N  N     . ALA D 3  171 ? -22.366 40.446  47.596 1.00 49.50  ? 172 ALA C N     1 
ATOM   8122  C  CA    . ALA D 3  171 ? -21.466 40.762  46.491 1.00 55.48  ? 172 ALA C CA    1 
ATOM   8123  C  C     . ALA D 3  171 ? -21.629 42.231  46.124 1.00 49.94  ? 172 ALA C C     1 
ATOM   8124  O  O     . ALA D 3  171 ? -22.681 42.825  46.353 1.00 58.36  ? 172 ALA C O     1 
ATOM   8125  C  CB    . ALA D 3  171 ? -21.729 39.863  45.276 1.00 58.95  ? 172 ALA C CB    1 
ATOM   8126  N  N     . SER D 3  172 ? -20.587 42.805  45.534 1.00 44.67  ? 173 SER C N     1 
ATOM   8127  C  CA    . SER D 3  172 ? -20.707 44.118  44.923 1.00 57.34  ? 173 SER C CA    1 
ATOM   8128  C  C     . SER D 3  172 ? -19.825 44.155  43.692 1.00 58.41  ? 173 SER C C     1 
ATOM   8129  O  O     . SER D 3  172 ? -18.662 43.759  43.756 1.00 71.72  ? 173 SER C O     1 
ATOM   8130  C  CB    . SER D 3  172 ? -20.373 45.236  45.927 1.00 60.82  ? 173 SER C CB    1 
ATOM   8131  O  OG    . SER D 3  172 ? -19.049 45.720  45.773 1.00 65.50  ? 173 SER C OG    1 
ATOM   8132  N  N     . GLY D 3  173 ? -20.392 44.567  42.559 1.00 50.72  ? 174 GLY C N     1 
ATOM   8133  C  CA    . GLY D 3  173 ? -19.678 44.488  41.303 1.00 53.20  ? 174 GLY C CA    1 
ATOM   8134  C  C     . GLY D 3  173 ? -20.212 45.429  40.239 1.00 56.90  ? 174 GLY C C     1 
ATOM   8135  O  O     . GLY D 3  173 ? -21.418 45.417  39.943 1.00 56.82  ? 174 GLY C O     1 
ATOM   8136  N  N     . ILE D 3  174 ? -19.342 46.260  39.678 1.00 51.97  ? 175 ILE C N     1 
ATOM   8137  C  CA    . ILE D 3  174 ? -19.723 47.203  38.629 1.00 50.55  ? 175 ILE C CA    1 
ATOM   8138  C  C     . ILE D 3  174 ? -19.417 46.538  37.291 1.00 63.44  ? 175 ILE C C     1 
ATOM   8139  O  O     . ILE D 3  174 ? -18.274 46.154  37.023 1.00 73.71  ? 175 ILE C O     1 
ATOM   8140  C  CB    . ILE D 3  174 ? -18.958 48.519  38.798 1.00 52.10  ? 175 ILE C CB    1 
ATOM   8141  C  CG1   . ILE D 3  174 ? -19.397 49.208  40.077 1.00 52.55  ? 175 ILE C CG1   1 
ATOM   8142  C  CG2   . ILE D 3  174 ? -19.180 49.459  37.650 1.00 55.13  ? 175 ILE C CG2   1 
ATOM   8143  C  CD1   . ILE D 3  174 ? -18.356 50.064  40.655 1.00 54.61  ? 175 ILE C CD1   1 
ATOM   8144  N  N     . ALA D 3  175 ? -20.443 46.361  36.454 1.00 70.64  ? 176 ALA C N     1 
ATOM   8145  C  CA    . ALA D 3  175 ? -20.235 45.652  35.194 1.00 72.94  ? 176 ALA C CA    1 
ATOM   8146  C  C     . ALA D 3  175 ? -20.267 46.644  34.027 1.00 70.63  ? 176 ALA C C     1 
ATOM   8147  O  O     . ALA D 3  175 ? -19.702 47.739  34.120 1.00 82.36  ? 176 ALA C O     1 
ATOM   8148  C  CB    . ALA D 3  175 ? -21.274 44.545  35.008 1.00 69.95  ? 176 ALA C CB    1 
ATOM   8149  N  N     . VAL D 3  176 ? -20.907 46.284  32.918 1.00 64.88  ? 177 VAL C N     1 
ATOM   8150  C  CA    . VAL D 3  176 ? -21.185 47.241  31.859 1.00 67.16  ? 177 VAL C CA    1 
ATOM   8151  C  C     . VAL D 3  176 ? -22.675 47.138  31.554 1.00 71.79  ? 177 VAL C C     1 
ATOM   8152  O  O     . VAL D 3  176 ? -23.201 46.032  31.375 1.00 68.60  ? 177 VAL C O     1 
ATOM   8153  C  CB    . VAL D 3  176 ? -20.331 46.978  30.599 1.00 67.07  ? 177 VAL C CB    1 
ATOM   8154  C  CG1   . VAL D 3  176 ? -20.700 47.958  29.481 1.00 74.72  ? 177 VAL C CG1   1 
ATOM   8155  C  CG2   . VAL D 3  176 ? -18.819 47.074  30.944 1.00 60.23  ? 177 VAL C CG2   1 
ATOM   8156  N  N     . GLY D 3  177 ? -23.364 48.283  31.550 1.00 72.89  ? 178 GLY C N     1 
ATOM   8157  C  CA    . GLY D 3  177 ? -24.801 48.326  31.377 1.00 72.82  ? 178 GLY C CA    1 
ATOM   8158  C  C     . GLY D 3  177 ? -25.603 47.824  32.556 1.00 72.32  ? 178 GLY C C     1 
ATOM   8159  O  O     . GLY D 3  177 ? -26.838 47.916  32.513 1.00 56.79  ? 178 GLY C O     1 
ATOM   8160  N  N     . MET D 3  178 ? -24.953 47.273  33.588 1.00 78.92  ? 179 MET C N     1 
ATOM   8161  C  CA    . MET D 3  178 ? -25.584 46.910  34.850 1.00 68.18  ? 179 MET C CA    1 
ATOM   8162  C  C     . MET D 3  178 ? -24.514 46.822  35.929 1.00 64.48  ? 179 MET C C     1 
ATOM   8163  O  O     . MET D 3  178 ? -23.318 46.811  35.649 1.00 78.36  ? 179 MET C O     1 
ATOM   8164  C  CB    . MET D 3  178 ? -26.310 45.579  34.723 1.00 69.66  ? 179 MET C CB    1 
ATOM   8165  C  CG    . MET D 3  178 ? -25.325 44.516  34.296 1.00 70.73  ? 179 MET C CG    1 
ATOM   8166  S  SD    . MET D 3  178 ? -26.036 43.079  33.500 1.00 72.48  ? 179 MET C SD    1 
ATOM   8167  C  CE    . MET D 3  178 ? -26.561 43.749  31.932 1.00 77.34  ? 179 MET C CE    1 
ATOM   8168  N  N     . ALA D 3  179 ? -24.977 46.684  37.176 1.00 60.45  ? 180 ALA C N     1 
ATOM   8169  C  CA    . ALA D 3  179 ? -24.095 46.424  38.314 1.00 58.37  ? 180 ALA C CA    1 
ATOM   8170  C  C     . ALA D 3  179 ? -24.836 45.560  39.336 1.00 65.72  ? 180 ALA C C     1 
ATOM   8171  O  O     . ALA D 3  179 ? -26.022 45.262  39.175 1.00 75.83  ? 180 ALA C O     1 
ATOM   8172  C  CB    . ALA D 3  179 ? -23.588 47.740  38.920 1.00 52.25  ? 180 ALA C CB    1 
ATOM   8173  N  N     . THR D 3  180 ? -24.133 45.160  40.406 1.00 55.40  ? 181 THR C N     1 
ATOM   8174  C  CA    . THR D 3  180 ? -24.746 44.362  41.467 1.00 51.67  ? 181 THR C CA    1 
ATOM   8175  C  C     . THR D 3  180 ? -24.336 44.853  42.852 1.00 55.11  ? 181 THR C C     1 
ATOM   8176  O  O     . THR D 3  180 ? -23.196 45.279  43.068 1.00 59.14  ? 181 THR C O     1 
ATOM   8177  C  CB    . THR D 3  180 ? -24.410 42.850  41.332 1.00 55.21  ? 181 THR C CB    1 
ATOM   8178  O  OG1   . THR D 3  180 ? -25.260 42.092  42.204 1.00 61.83  ? 181 THR C OG1   1 
ATOM   8179  C  CG2   . THR D 3  180 ? -22.969 42.546  41.672 1.00 64.57  ? 181 THR C CG2   1 
ATOM   8180  N  N     . ASN D 3  181 ? -25.290 44.796  43.796 1.00 43.72  ? 182 ASN C N     1 
ATOM   8181  C  CA    . ASN D 3  181 ? -25.014 45.121  45.197 1.00 40.70  ? 182 ASN C CA    1 
ATOM   8182  C  C     . ASN D 3  181 ? -25.932 44.243  46.053 1.00 42.00  ? 182 ASN C C     1 
ATOM   8183  O  O     . ASN D 3  181 ? -27.120 44.562  46.219 1.00 49.78  ? 182 ASN C O     1 
ATOM   8184  C  CB    . ASN D 3  181 ? -25.251 46.599  45.477 1.00 39.43  ? 182 ASN C CB    1 
ATOM   8185  C  CG    . ASN D 3  181 ? -24.401 47.125  46.621 1.00 44.92  ? 182 ASN C CG    1 
ATOM   8186  O  OD1   . ASN D 3  181 ? -23.318 46.598  46.905 1.00 58.83  ? 182 ASN C OD1   1 
ATOM   8187  N  ND2   . ASN D 3  181 ? -24.876 48.170  47.274 1.00 47.71  ? 182 ASN C ND2   1 
ATOM   8188  N  N     . ILE D 3  182 ? -25.388 43.160  46.600 1.00 40.89  ? 183 ILE C N     1 
ATOM   8189  C  CA    . ILE D 3  182 ? -26.104 42.278  47.523 1.00 42.58  ? 183 ILE C CA    1 
ATOM   8190  C  C     . ILE D 3  182 ? -25.471 42.380  48.891 1.00 46.04  ? 183 ILE C C     1 
ATOM   8191  O  O     . ILE D 3  182 ? -24.254 42.166  49.027 1.00 46.86  ? 183 ILE C O     1 
ATOM   8192  C  CB    . ILE D 3  182 ? -26.114 40.821  47.023 1.00 42.76  ? 183 ILE C CB    1 
ATOM   8193  C  CG1   . ILE D 3  182 ? -26.517 40.768  45.529 1.00 42.79  ? 183 ILE C CG1   1 
ATOM   8194  C  CG2   . ILE D 3  182 ? -27.017 39.984  47.924 1.00 38.47  ? 183 ILE C CG2   1 
ATOM   8195  C  CD1   . ILE D 3  182 ? -26.420 39.412  44.843 1.00 40.24  ? 183 ILE C CD1   1 
ATOM   8196  N  N     . PRO D 3  183 ? -26.218 42.652  49.950 1.00 50.75  ? 184 PRO C N     1 
ATOM   8197  C  CA    . PRO D 3  183 ? -25.662 42.748  51.273 1.00 44.08  ? 184 PRO C CA    1 
ATOM   8198  C  C     . PRO D 3  183 ? -25.385 41.283  51.873 1.00 40.40  ? 184 PRO C C     1 
ATOM   8199  O  O     . PRO D 3  183 ? -26.044 40.363  51.440 1.00 44.58  ? 184 PRO C O     1 
ATOM   8200  C  CB    . PRO D 3  183 ? -26.718 43.453  52.098 1.00 40.94  ? 184 PRO C CB    1 
ATOM   8201  C  CG    . PRO D 3  183 ? -28.004 43.023  51.445 1.00 47.98  ? 184 PRO C CG    1 
ATOM   8202  C  CD    . PRO D 3  183 ? -27.695 42.836  49.975 1.00 49.31  ? 184 PRO C CD    1 
ATOM   8203  N  N     . PRO D 3  184 ? -24.482 41.230  52.829 1.00 47.52  ? 185 PRO C N     1 
ATOM   8204  C  CA    . PRO D 3  184 ? -24.316 39.935  53.550 1.00 47.60  ? 185 PRO C CA    1 
ATOM   8205  C  C     . PRO D 3  184 ? -25.499 39.618  54.463 1.00 46.13  ? 185 PRO C C     1 
ATOM   8206  O  O     . PRO D 3  184 ? -26.310 40.481  54.799 1.00 42.22  ? 185 PRO C O     1 
ATOM   8207  C  CB    . PRO D 3  184 ? -23.057 40.201  54.389 1.00 43.53  ? 185 PRO C CB    1 
ATOM   8208  C  CG    . PRO D 3  184 ? -23.101 41.680  54.626 1.00 47.14  ? 185 PRO C CG    1 
ATOM   8209  C  CD    . PRO D 3  184 ? -23.580 42.256  53.332 1.00 52.41  ? 185 PRO C CD    1 
ATOM   8210  N  N     . HIS D 3  185 ? -25.565 38.353  54.918 1.00 45.25  ? 186 HIS C N     1 
ATOM   8211  C  CA    . HIS D 3  185 ? -26.673 37.860  55.744 1.00 46.26  ? 186 HIS C CA    1 
ATOM   8212  C  C     . HIS D 3  185 ? -26.162 36.934  56.848 1.00 48.54  ? 186 HIS C C     1 
ATOM   8213  O  O     . HIS D 3  185 ? -25.018 36.480  56.825 1.00 59.76  ? 186 HIS C O     1 
ATOM   8214  C  CB    . HIS D 3  185 ? -27.709 37.126  54.894 1.00 40.19  ? 186 HIS C CB    1 
ATOM   8215  C  CG    . HIS D 3  185 ? -28.500 38.044  54.025 1.00 48.65  ? 186 HIS C CG    1 
ATOM   8216  N  ND1   . HIS D 3  185 ? -27.998 38.567  52.851 1.00 50.39  ? 186 HIS C ND1   1 
ATOM   8217  C  CD2   . HIS D 3  185 ? -29.724 38.594  54.194 1.00 49.14  ? 186 HIS C CD2   1 
ATOM   8218  C  CE1   . HIS D 3  185 ? -28.892 39.378  52.318 1.00 47.28  ? 186 HIS C CE1   1 
ATOM   8219  N  NE2   . HIS D 3  185 ? -29.947 39.411  53.113 1.00 50.97  ? 186 HIS C NE2   1 
ATOM   8220  N  N     . ASN D 3  186 ? -27.024 36.644  57.828 1.00 44.14  ? 187 ASN C N     1 
ATOM   8221  C  CA    . ASN D 3  186 ? -26.641 35.715  58.886 1.00 52.36  ? 187 ASN C CA    1 
ATOM   8222  C  C     . ASN D 3  186 ? -26.828 34.280  58.412 1.00 51.75  ? 187 ASN C C     1 
ATOM   8223  O  O     . ASN D 3  186 ? -27.863 33.937  57.841 1.00 56.13  ? 187 ASN C O     1 
ATOM   8224  C  CB    . ASN D 3  186 ? -27.451 35.968  60.157 1.00 46.43  ? 187 ASN C CB    1 
ATOM   8225  C  CG    . ASN D 3  186 ? -27.123 34.978  61.265 1.00 52.26  ? 187 ASN C CG    1 
ATOM   8226  O  OD1   . ASN D 3  186 ? -27.698 33.904  61.324 1.00 71.48  ? 187 ASN C OD1   1 
ATOM   8227  N  ND2   . ASN D 3  186 ? -26.200 35.338  62.140 1.00 47.36  ? 187 ASN C ND2   1 
ATOM   8228  N  N     . LEU D 3  187 ? -25.803 33.446  58.633 1.00 47.84  ? 188 LEU C N     1 
ATOM   8229  C  CA    . LEU D 3  187 ? -25.817 32.082  58.102 1.00 46.08  ? 188 LEU C CA    1 
ATOM   8230  C  C     . LEU D 3  187 ? -26.918 31.238  58.718 1.00 52.28  ? 188 LEU C C     1 
ATOM   8231  O  O     . LEU D 3  187 ? -27.559 30.441  58.025 1.00 63.48  ? 188 LEU C O     1 
ATOM   8232  C  CB    . LEU D 3  187 ? -24.473 31.399  58.340 1.00 50.68  ? 188 LEU C CB    1 
ATOM   8233  C  CG    . LEU D 3  187 ? -24.231 30.172  57.470 1.00 46.42  ? 188 LEU C CG    1 
ATOM   8234  C  CD1   . LEU D 3  187 ? -24.509 30.541  56.033 1.00 44.07  ? 188 LEU C CD1   1 
ATOM   8235  C  CD2   . LEU D 3  187 ? -22.793 29.740  57.638 1.00 47.68  ? 188 LEU C CD2   1 
ATOM   8236  N  N     . THR D 3  188 ? -27.102 31.340  60.026 1.00 53.18  ? 189 THR C N     1 
ATOM   8237  C  CA    . THR D 3  188 ? -28.131 30.547  60.676 1.00 54.99  ? 189 THR C CA    1 
ATOM   8238  C  C     . THR D 3  188 ? -29.489 30.819  60.049 1.00 60.29  ? 189 THR C C     1 
ATOM   8239  O  O     . THR D 3  188 ? -30.223 29.893  59.694 1.00 69.77  ? 189 THR C O     1 
ATOM   8240  C  CB    . THR D 3  188 ? -28.169 30.846  62.173 1.00 55.41  ? 189 THR C CB    1 
ATOM   8241  O  OG1   . THR D 3  188 ? -26.852 30.713  62.720 1.00 54.12  ? 189 THR C OG1   1 
ATOM   8242  C  CG2   . THR D 3  188 ? -29.081 29.859  62.860 1.00 48.88  ? 189 THR C CG2   1 
ATOM   8243  N  N     . GLU D 3  189 ? -29.829 32.094  59.872 1.00 58.05  ? 190 GLU C N     1 
ATOM   8244  C  CA    . GLU D 3  189 ? -31.121 32.433  59.288 1.00 58.22  ? 190 GLU C CA    1 
ATOM   8245  C  C     . GLU D 3  189 ? -31.190 32.016  57.833 1.00 62.47  ? 190 GLU C C     1 
ATOM   8246  O  O     . GLU D 3  189 ? -32.237 31.571  57.360 1.00 63.09  ? 190 GLU C O     1 
ATOM   8247  C  CB    . GLU D 3  189 ? -31.367 33.925  59.424 1.00 54.55  ? 190 GLU C CB    1 
ATOM   8248  C  CG    . GLU D 3  189 ? -31.478 34.358  60.850 1.00 68.50  ? 190 GLU C CG    1 
ATOM   8249  C  CD    . GLU D 3  189 ? -31.459 35.859  60.993 1.00 77.89  ? 190 GLU C CD    1 
ATOM   8250  O  OE1   . GLU D 3  189 ? -31.469 36.552  59.952 1.00 74.59  ? 190 GLU C OE1   1 
ATOM   8251  O  OE2   . GLU D 3  189 ? -31.429 36.346  62.145 1.00 80.20  ? 190 GLU C OE2   1 
ATOM   8252  N  N     . LEU D 3  190 ? -30.093 32.184  57.100 1.00 63.98  ? 191 LEU C N     1 
ATOM   8253  C  CA    . LEU D 3  190 ? -30.069 31.795  55.696 1.00 55.25  ? 191 LEU C CA    1 
ATOM   8254  C  C     . LEU D 3  190 ? -30.427 30.335  55.534 1.00 61.58  ? 191 LEU C C     1 
ATOM   8255  O  O     . LEU D 3  190 ? -31.239 29.964  54.681 1.00 75.84  ? 191 LEU C O     1 
ATOM   8256  C  CB    . LEU D 3  190 ? -28.685 32.042  55.108 1.00 48.83  ? 191 LEU C CB    1 
ATOM   8257  C  CG    . LEU D 3  190 ? -28.507 33.405  54.496 1.00 47.98  ? 191 LEU C CG    1 
ATOM   8258  C  CD1   . LEU D 3  190 ? -27.172 33.413  53.868 1.00 47.26  ? 191 LEU C CD1   1 
ATOM   8259  C  CD2   . LEU D 3  190 ? -29.597 33.603  53.479 1.00 46.81  ? 191 LEU C CD2   1 
ATOM   8260  N  N     . ILE D 3  191 ? -29.807 29.485  56.336 1.00 54.09  ? 192 ILE C N     1 
ATOM   8261  C  CA    . ILE D 3  191 ? -30.017 28.058  56.174 1.00 54.11  ? 192 ILE C CA    1 
ATOM   8262  C  C     . ILE D 3  191 ? -31.385 27.660  56.676 1.00 58.09  ? 192 ILE C C     1 
ATOM   8263  O  O     . ILE D 3  191 ? -32.057 26.825  56.068 1.00 65.86  ? 192 ILE C O     1 
ATOM   8264  C  CB    . ILE D 3  191 ? -28.910 27.273  56.880 1.00 51.39  ? 192 ILE C CB    1 
ATOM   8265  C  CG1   . ILE D 3  191 ? -27.676 27.214  55.989 1.00 50.06  ? 192 ILE C CG1   1 
ATOM   8266  C  CG2   . ILE D 3  191 ? -29.409 25.889  57.186 1.00 56.82  ? 192 ILE C CG2   1 
ATOM   8267  C  CD1   . ILE D 3  191 ? -26.462 26.795  56.735 1.00 57.07  ? 192 ILE C CD1   1 
ATOM   8268  N  N     . ASN D 3  192 ? -31.822 28.223  57.797 1.00 52.10  ? 193 ASN C N     1 
ATOM   8269  C  CA    . ASN D 3  192 ? -33.181 27.968  58.236 1.00 51.78  ? 193 ASN C CA    1 
ATOM   8270  C  C     . ASN D 3  192 ? -34.174 28.330  57.145 1.00 57.63  ? 193 ASN C C     1 
ATOM   8271  O  O     . ASN D 3  192 ? -35.178 27.645  56.954 1.00 67.00  ? 193 ASN C O     1 
ATOM   8272  C  CB    . ASN D 3  192 ? -33.470 28.738  59.518 1.00 50.52  ? 193 ASN C CB    1 
ATOM   8273  C  CG    . ASN D 3  192 ? -32.863 28.086  60.716 1.00 63.16  ? 193 ASN C CG    1 
ATOM   8274  O  OD1   . ASN D 3  192 ? -32.455 26.936  60.655 1.00 74.48  ? 193 ASN C OD1   1 
ATOM   8275  N  ND2   . ASN D 3  192 ? -32.804 28.808  61.820 1.00 57.89  ? 193 ASN C ND2   1 
ATOM   8276  N  N     . GLY D 3  193 ? -33.904 29.399  56.403 1.00 56.12  ? 194 GLY C N     1 
ATOM   8277  C  CA    . GLY D 3  193 ? -34.766 29.745  55.287 1.00 53.74  ? 194 GLY C CA    1 
ATOM   8278  C  C     . GLY D 3  193 ? -34.724 28.707  54.183 1.00 53.26  ? 194 GLY C C     1 
ATOM   8279  O  O     . GLY D 3  193 ? -35.758 28.339  53.626 1.00 66.86  ? 194 GLY C O     1 
ATOM   8280  N  N     . VAL D 3  194 ? -33.532 28.219  53.850 1.00 48.09  ? 195 VAL C N     1 
ATOM   8281  C  CA    . VAL D 3  194 ? -33.431 27.147  52.865 1.00 50.34  ? 195 VAL C CA    1 
ATOM   8282  C  C     . VAL D 3  194 ? -34.196 25.921  53.338 1.00 56.79  ? 195 VAL C C     1 
ATOM   8283  O  O     . VAL D 3  194 ? -34.926 25.288  52.565 1.00 70.87  ? 195 VAL C O     1 
ATOM   8284  C  CB    . VAL D 3  194 ? -31.953 26.822  52.561 1.00 47.18  ? 195 VAL C CB    1 
ATOM   8285  C  CG1   . VAL D 3  194 ? -31.866 25.648  51.619 1.00 45.92  ? 195 VAL C CG1   1 
ATOM   8286  C  CG2   . VAL D 3  194 ? -31.301 28.009  51.927 1.00 49.47  ? 195 VAL C CG2   1 
ATOM   8287  N  N     . LEU D 3  195 ? -34.080 25.589  54.625 1.00 56.05  ? 196 LEU C N     1 
ATOM   8288  C  CA    . LEU D 3  195 ? -34.803 24.433  55.162 1.00 57.56  ? 196 LEU C CA    1 
ATOM   8289  C  C     . LEU D 3  195 ? -36.308 24.607  55.026 1.00 68.73  ? 196 LEU C C     1 
ATOM   8290  O  O     . LEU D 3  195 ? -37.006 23.707  54.546 1.00 73.65  ? 196 LEU C O     1 
ATOM   8291  C  CB    . LEU D 3  195 ? -34.396 24.195  56.609 1.00 58.13  ? 196 LEU C CB    1 
ATOM   8292  C  CG    . LEU D 3  195 ? -32.961 23.702  56.753 1.00 56.39  ? 196 LEU C CG    1 
ATOM   8293  C  CD1   . LEU D 3  195 ? -32.492 23.781  58.174 1.00 55.07  ? 196 LEU C CD1   1 
ATOM   8294  C  CD2   . LEU D 3  195 ? -32.881 22.282  56.265 1.00 55.80  ? 196 LEU C CD2   1 
ATOM   8295  N  N     . SER D 3  196 ? -36.828 25.757  55.451 1.00 70.45  ? 197 SER C N     1 
ATOM   8296  C  CA    . SER D 3  196 ? -38.255 26.028  55.277 1.00 74.17  ? 197 SER C CA    1 
ATOM   8297  C  C     . SER D 3  196 ? -38.663 25.957  53.811 1.00 74.17  ? 197 SER C C     1 
ATOM   8298  O  O     . SER D 3  196 ? -39.750 25.469  53.477 1.00 76.29  ? 197 SER C O     1 
ATOM   8299  C  CB    . SER D 3  196 ? -38.611 27.405  55.838 1.00 72.22  ? 197 SER C CB    1 
ATOM   8300  O  OG    . SER D 3  196 ? -37.851 27.667  56.997 1.00 88.35  ? 197 SER C OG    1 
ATOM   8301  N  N     . LEU D 3  197 ? -37.817 26.455  52.920 1.00 66.34  ? 198 LEU C N     1 
ATOM   8302  C  CA    . LEU D 3  197 ? -38.167 26.452  51.505 1.00 59.84  ? 198 LEU C CA    1 
ATOM   8303  C  C     . LEU D 3  197 ? -38.209 25.037  50.956 1.00 64.59  ? 198 LEU C C     1 
ATOM   8304  O  O     . LEU D 3  197 ? -38.964 24.741  50.019 1.00 66.84  ? 198 LEU C O     1 
ATOM   8305  C  CB    . LEU D 3  197 ? -37.175 27.301  50.713 1.00 55.71  ? 198 LEU C CB    1 
ATOM   8306  C  CG    . LEU D 3  197 ? -37.022 26.906  49.241 1.00 54.52  ? 198 LEU C CG    1 
ATOM   8307  C  CD1   . LEU D 3  197 ? -38.314 27.122  48.465 1.00 49.17  ? 198 LEU C CD1   1 
ATOM   8308  C  CD2   . LEU D 3  197 ? -35.913 27.668  48.583 1.00 48.95  ? 198 LEU C CD2   1 
ATOM   8309  N  N     . SER D 3  198 ? -37.410 24.149  51.523 1.00 71.95  ? 199 SER C N     1 
ATOM   8310  C  CA    . SER D 3  198 ? -37.362 22.783  51.031 1.00 75.81  ? 199 SER C CA    1 
ATOM   8311  C  C     . SER D 3  198 ? -38.610 22.011  51.418 1.00 82.38  ? 199 SER C C     1 
ATOM   8312  O  O     . SER D 3  198 ? -38.992 21.060  50.727 1.00 82.03  ? 199 SER C O     1 
ATOM   8313  C  CB    . SER D 3  198 ? -36.129 22.084  51.586 1.00 59.81  ? 199 SER C CB    1 
ATOM   8314  O  OG    . SER D 3  198 ? -36.330 21.779  52.955 1.00 71.52  ? 199 SER C OG    1 
ATOM   8315  N  N     . LYS D 3  199 ? -39.238 22.385  52.523 1.00 72.64  ? 200 LYS C N     1 
ATOM   8316  C  CA    . LYS D 3  199 ? -40.434 21.713  52.995 1.00 72.47  ? 200 LYS C CA    1 
ATOM   8317  C  C     . LYS D 3  199 ? -41.690 22.298  52.387 1.00 84.84  ? 200 LYS C C     1 
ATOM   8318  O  O     . LYS D 3  199 ? -42.787 21.800  52.662 1.00 102.35 ? 200 LYS C O     1 
ATOM   8319  C  CB    . LYS D 3  199 ? -40.513 21.802  54.513 1.00 72.99  ? 200 LYS C CB    1 
ATOM   8320  C  CG    . LYS D 3  199 ? -39.219 21.486  55.216 1.00 70.21  ? 200 LYS C CG    1 
ATOM   8321  C  CD    . LYS D 3  199 ? -39.426 21.502  56.717 1.00 78.29  ? 200 LYS C CD    1 
ATOM   8322  C  CE    . LYS D 3  199 ? -38.126 21.262  57.458 1.00 86.73  ? 200 LYS C CE    1 
ATOM   8323  N  NZ    . LYS D 3  199 ? -38.027 22.107  58.678 1.00 82.10  ? 200 LYS C NZ    1 
ATOM   8324  N  N     . ASN D 3  200 ? -41.557 23.334  51.574 1.00 72.63  ? 201 ASN C N     1 
ATOM   8325  C  CA    . ASN D 3  200 ? -42.701 24.113  51.137 1.00 68.63  ? 201 ASN C CA    1 
ATOM   8326  C  C     . ASN D 3  200 ? -42.312 25.001  49.972 1.00 66.79  ? 201 ASN C C     1 
ATOM   8327  O  O     . ASN D 3  200 ? -41.988 26.177  50.166 1.00 76.01  ? 201 ASN C O     1 
ATOM   8328  C  CB    . ASN D 3  200 ? -43.248 24.959  52.279 1.00 67.77  ? 201 ASN C CB    1 
ATOM   8329  C  CG    . ASN D 3  200 ? -44.471 25.743  51.874 1.00 77.20  ? 201 ASN C CG    1 
ATOM   8330  O  OD1   . ASN D 3  200 ? -44.803 25.852  50.684 1.00 76.14  ? 201 ASN C OD1   1 
ATOM   8331  N  ND2   . ASN D 3  200 ? -45.156 26.295  52.859 1.00 83.64  ? 201 ASN C ND2   1 
ATOM   8332  N  N     . PRO D 3  201 ? -42.386 24.488  48.745 1.00 68.25  ? 202 PRO C N     1 
ATOM   8333  C  CA    . PRO D 3  201 ? -41.875 25.241  47.587 1.00 69.56  ? 202 PRO C CA    1 
ATOM   8334  C  C     . PRO D 3  201 ? -42.745 26.405  47.162 1.00 73.84  ? 202 PRO C C     1 
ATOM   8335  O  O     . PRO D 3  201 ? -42.296 27.200  46.325 1.00 73.52  ? 202 PRO C O     1 
ATOM   8336  C  CB    . PRO D 3  201 ? -41.818 24.178  46.481 1.00 67.04  ? 202 PRO C CB    1 
ATOM   8337  C  CG    . PRO D 3  201 ? -41.791 22.878  47.217 1.00 63.46  ? 202 PRO C CG    1 
ATOM   8338  C  CD    . PRO D 3  201 ? -42.645 23.080  48.413 1.00 69.25  ? 202 PRO C CD    1 
ATOM   8339  N  N     . ASP D 3  202 ? -43.979 26.513  47.661 1.00 76.74  ? 203 ASP C N     1 
ATOM   8340  C  CA    . ASP D 3  202 ? -44.845 27.654  47.388 1.00 82.74  ? 203 ASP C CA    1 
ATOM   8341  C  C     . ASP D 3  202 ? -44.805 28.669  48.513 1.00 72.16  ? 203 ASP C C     1 
ATOM   8342  O  O     . ASP D 3  202 ? -45.813 29.332  48.798 1.00 75.19  ? 203 ASP C O     1 
ATOM   8343  C  CB    . ASP D 3  202 ? -46.284 27.213  47.149 1.00 99.10  ? 203 ASP C CB    1 
ATOM   8344  C  CG    . ASP D 3  202 ? -46.496 26.633  45.774 1.00 103.93 ? 203 ASP C CG    1 
ATOM   8345  O  OD1   . ASP D 3  202 ? -45.655 26.877  44.879 1.00 105.03 ? 203 ASP C OD1   1 
ATOM   8346  O  OD2   . ASP D 3  202 ? -47.518 25.942  45.594 1.00 101.10 ? 203 ASP C OD2   1 
ATOM   8347  N  N     . ILE D 3  203 ? -43.673 28.761  49.185 1.00 62.11  ? 204 ILE C N     1 
ATOM   8348  C  CA    . ILE D 3  203 ? -43.512 29.645  50.326 1.00 63.28  ? 204 ILE C CA    1 
ATOM   8349  C  C     . ILE D 3  203 ? -43.300 31.059  49.820 1.00 70.66  ? 204 ILE C C     1 
ATOM   8350  O  O     . ILE D 3  203 ? -42.762 31.288  48.729 1.00 79.19  ? 204 ILE C O     1 
ATOM   8351  C  CB    . ILE D 3  203 ? -42.332 29.194  51.196 1.00 71.66  ? 204 ILE C CB    1 
ATOM   8352  C  CG1   . ILE D 3  203 ? -42.492 29.706  52.619 1.00 65.23  ? 204 ILE C CG1   1 
ATOM   8353  C  CG2   . ILE D 3  203 ? -41.046 29.745  50.626 1.00 69.70  ? 204 ILE C CG2   1 
ATOM   8354  C  CD1   . ILE D 3  203 ? -41.279 29.450  53.448 1.00 63.24  ? 204 ILE C CD1   1 
ATOM   8355  N  N     . SER D 3  204 ? -43.680 32.021  50.639 1.00 80.76  ? 205 SER C N     1 
ATOM   8356  C  CA    . SER D 3  204 ? -43.780 33.409  50.222 1.00 84.32  ? 205 SER C CA    1 
ATOM   8357  C  C     . SER D 3  204 ? -42.666 34.227  50.853 1.00 76.14  ? 205 SER C C     1 
ATOM   8358  O  O     . SER D 3  204 ? -42.160 33.896  51.927 1.00 83.20  ? 205 SER C O     1 
ATOM   8359  C  CB    . SER D 3  204 ? -45.130 33.980  50.634 1.00 94.65  ? 205 SER C CB    1 
ATOM   8360  O  OG    . SER D 3  204 ? -45.190 33.996  52.045 1.00 93.44  ? 205 SER C OG    1 
ATOM   8361  N  N     . ILE D 3  205 ? -42.307 35.323  50.187 1.00 70.27  ? 206 ILE C N     1 
ATOM   8362  C  CA    . ILE D 3  205 ? -41.125 36.072  50.611 1.00 60.27  ? 206 ILE C CA    1 
ATOM   8363  C  C     . ILE D 3  205 ? -41.296 36.564  52.041 1.00 65.56  ? 206 ILE C C     1 
ATOM   8364  O  O     . ILE D 3  205 ? -40.353 36.548  52.836 1.00 64.34  ? 206 ILE C O     1 
ATOM   8365  C  CB    . ILE D 3  205 ? -40.842 37.233  49.649 1.00 63.30  ? 206 ILE C CB    1 
ATOM   8366  C  CG1   . ILE D 3  205 ? -40.913 36.731  48.208 1.00 67.83  ? 206 ILE C CG1   1 
ATOM   8367  C  CG2   . ILE D 3  205 ? -39.483 37.808  49.966 1.00 64.23  ? 206 ILE C CG2   1 
ATOM   8368  C  CD1   . ILE D 3  205 ? -39.680 36.996  47.415 1.00 62.85  ? 206 ILE C CD1   1 
ATOM   8369  N  N     . ALA D 3  206 ? -42.495 37.042  52.373 1.00 65.67  ? 207 ALA C N     1 
ATOM   8370  C  CA    . ALA D 3  206 ? -42.915 37.279  53.748 1.00 60.50  ? 207 ALA C CA    1 
ATOM   8371  C  C     . ALA D 3  206 ? -42.563 36.134  54.666 1.00 66.05  ? 207 ALA C C     1 
ATOM   8372  O  O     . ALA D 3  206 ? -41.969 36.312  55.739 1.00 79.00  ? 207 ALA C O     1 
ATOM   8373  C  CB    . ALA D 3  206 ? -44.422 37.484  53.784 1.00 66.54  ? 207 ALA C CB    1 
ATOM   8374  N  N     A GLU D 3  207 ? -42.969 34.934  54.266 0.50 66.27  ? 208 GLU C N     1 
ATOM   8375  N  N     B GLU D 3  207 ? -42.968 34.936  54.265 0.50 66.18  ? 208 GLU C N     1 
ATOM   8376  C  CA    A GLU D 3  207 ? -42.770 33.771  55.119 0.50 70.08  ? 208 GLU C CA    1 
ATOM   8377  C  CA    B GLU D 3  207 ? -42.765 33.778  55.122 0.50 72.02  ? 208 GLU C CA    1 
ATOM   8378  C  C     A GLU D 3  207 ? -41.285 33.492  55.294 0.50 70.82  ? 208 GLU C C     1 
ATOM   8379  C  C     B GLU D 3  207 ? -41.282 33.497  55.295 0.50 71.71  ? 208 GLU C C     1 
ATOM   8380  O  O     A GLU D 3  207 ? -40.807 33.299  56.418 0.50 73.94  ? 208 GLU C O     1 
ATOM   8381  O  O     B GLU D 3  207 ? -40.802 33.298  56.418 0.50 73.54  ? 208 GLU C O     1 
ATOM   8382  C  CB    A GLU D 3  207 ? -43.513 32.566  54.523 0.50 73.14  ? 208 GLU C CB    1 
ATOM   8383  C  CB    B GLU D 3  207 ? -43.506 32.570  54.539 0.50 74.01  ? 208 GLU C CB    1 
ATOM   8384  C  CG    A GLU D 3  207 ? -44.404 31.822  55.497 0.50 80.80  ? 208 GLU C CG    1 
ATOM   8385  C  CG    B GLU D 3  207 ? -44.708 32.140  55.340 0.50 83.47  ? 208 GLU C CG    1 
ATOM   8386  C  CD    A GLU D 3  207 ? -45.594 31.180  54.807 0.50 83.68  ? 208 GLU C CD    1 
ATOM   8387  C  CD    B GLU D 3  207 ? -45.154 30.750  54.962 0.50 93.57  ? 208 GLU C CD    1 
ATOM   8388  O  OE1   A GLU D 3  207 ? -45.393 30.523  53.759 0.50 94.46  ? 208 GLU C OE1   1 
ATOM   8389  O  OE1   B GLU D 3  207 ? -45.997 30.623  54.046 0.50 95.23  ? 208 GLU C OE1   1 
ATOM   8390  O  OE2   A GLU D 3  207 ? -46.732 31.355  55.300 0.50 92.60  ? 208 GLU C OE2   1 
ATOM   8391  O  OE2   B GLU D 3  207 ? -44.634 29.784  55.563 0.50 81.90  ? 208 GLU C OE2   1 
ATOM   8392  N  N     . LEU D 3  208 ? -40.543 33.483  54.187 1.00 75.27  ? 209 LEU C N     1 
ATOM   8393  C  CA    . LEU D 3  208 ? -39.095 33.388  54.249 1.00 71.72  ? 209 LEU C CA    1 
ATOM   8394  C  C     . LEU D 3  208 ? -38.512 34.396  55.230 1.00 62.84  ? 209 LEU C C     1 
ATOM   8395  O  O     . LEU D 3  208 ? -37.550 34.075  55.938 1.00 62.56  ? 209 LEU C O     1 
ATOM   8396  C  CB    . LEU D 3  208 ? -38.525 33.584  52.841 1.00 67.13  ? 209 LEU C CB    1 
ATOM   8397  C  CG    . LEU D 3  208 ? -38.689 32.347  51.968 1.00 51.82  ? 209 LEU C CG    1 
ATOM   8398  C  CD1   . LEU D 3  208 ? -38.142 32.624  50.597 1.00 50.47  ? 209 LEU C CD1   1 
ATOM   8399  C  CD2   . LEU D 3  208 ? -37.950 31.209  52.623 1.00 49.05  ? 209 LEU C CD2   1 
ATOM   8400  N  N     . MET D 3  209 ? -39.090 35.596  55.313 1.00 56.44  ? 210 MET C N     1 
ATOM   8401  C  CA    . MET D 3  209 ? -38.606 36.668  56.180 1.00 52.36  ? 210 MET C CA    1 
ATOM   8402  C  C     . MET D 3  209 ? -38.870 36.428  57.659 1.00 61.58  ? 210 MET C C     1 
ATOM   8403  O  O     . MET D 3  209 ? -38.456 37.257  58.474 1.00 70.20  ? 210 MET C O     1 
ATOM   8404  C  CB    . MET D 3  209 ? -39.240 37.992  55.774 1.00 54.14  ? 210 MET C CB    1 
ATOM   8405  C  CG    . MET D 3  209 ? -38.302 38.914  55.082 1.00 66.29  ? 210 MET C CG    1 
ATOM   8406  S  SD    . MET D 3  209 ? -39.162 40.411  54.628 1.00 75.42  ? 210 MET C SD    1 
ATOM   8407  C  CE    . MET D 3  209 ? -38.870 41.387  56.092 1.00 82.88  ? 210 MET C CE    1 
ATOM   8408  N  N     . GLU D 3  210 ? -39.593 35.372  58.017 1.00 65.37  ? 211 GLU C N     1 
ATOM   8409  C  CA    . GLU D 3  210 ? -39.648 34.941  59.409 1.00 59.15  ? 211 GLU C CA    1 
ATOM   8410  C  C     . GLU D 3  210 ? -38.349 34.277  59.828 1.00 63.23  ? 211 GLU C C     1 
ATOM   8411  O  O     . GLU D 3  210 ? -38.043 34.223  61.026 1.00 90.40  ? 211 GLU C O     1 
ATOM   8412  C  CB    . GLU D 3  210 ? -40.822 33.994  59.626 1.00 75.46  ? 211 GLU C CB    1 
ATOM   8413  C  CG    . GLU D 3  210 ? -42.133 34.540  59.088 1.00 89.71  ? 211 GLU C CG    1 
ATOM   8414  C  CD    . GLU D 3  210 ? -43.339 33.716  59.501 1.00 106.02 ? 211 GLU C CD    1 
ATOM   8415  O  OE1   . GLU D 3  210 ? -44.474 34.121  59.176 1.00 111.71 ? 211 GLU C OE1   1 
ATOM   8416  O  OE2   . GLU D 3  210 ? -43.157 32.668  60.156 1.00 111.76 ? 211 GLU C OE2   1 
ATOM   8417  N  N     . ASP D 3  211 ? -37.587 33.759  58.871 1.00 53.36  ? 212 ASP C N     1 
ATOM   8418  C  CA    . ASP D 3  211 ? -36.241 33.262  59.120 1.00 56.91  ? 212 ASP C CA    1 
ATOM   8419  C  C     . ASP D 3  211 ? -35.195 34.321  58.801 1.00 53.78  ? 212 ASP C C     1 
ATOM   8420  O  O     . ASP D 3  211 ? -34.417 34.721  59.668 1.00 55.48  ? 212 ASP C O     1 
ATOM   8421  C  CB    . ASP D 3  211 ? -35.989 31.990  58.299 1.00 65.49  ? 212 ASP C CB    1 
ATOM   8422  C  CG    . ASP D 3  211 ? -36.913 30.871  58.675 1.00 78.86  ? 212 ASP C CG    1 
ATOM   8423  O  OD1   . ASP D 3  211 ? -36.927 30.497  59.864 1.00 78.56  ? 212 ASP C OD1   1 
ATOM   8424  O  OD2   . ASP D 3  211 ? -37.636 30.385  57.780 1.00 89.99  ? 212 ASP C OD2   1 
ATOM   8425  N  N     . ILE D 3  212 ? -35.191 34.802  57.561 1.00 55.81  ? 213 ILE C N     1 
ATOM   8426  C  CA    . ILE D 3  212 ? -34.249 35.828  57.118 1.00 52.57  ? 213 ILE C CA    1 
ATOM   8427  C  C     . ILE D 3  212 ? -34.826 37.188  57.487 1.00 54.78  ? 213 ILE C C     1 
ATOM   8428  O  O     . ILE D 3  212 ? -35.691 37.721  56.796 1.00 59.01  ? 213 ILE C O     1 
ATOM   8429  C  CB    . ILE D 3  212 ? -33.958 35.737  55.623 1.00 43.55  ? 213 ILE C CB    1 
ATOM   8430  C  CG1   . ILE D 3  212 ? -33.166 34.466  55.322 1.00 56.02  ? 213 ILE C CG1   1 
ATOM   8431  C  CG2   . ILE D 3  212 ? -33.216 36.965  55.182 1.00 41.02  ? 213 ILE C CG2   1 
ATOM   8432  C  CD1   . ILE D 3  212 ? -33.803 33.633  54.263 1.00 75.37  ? 213 ILE C CD1   1 
ATOM   8433  N  N     . GLU D 3  213 ? -34.297 37.787  58.542 1.00 50.05  ? 214 GLU C N     1 
ATOM   8434  C  CA    . GLU D 3  213 ? -34.891 39.007  59.078 1.00 56.63  ? 214 GLU C CA    1 
ATOM   8435  C  C     . GLU D 3  213 ? -34.564 40.261  58.282 1.00 64.50  ? 214 GLU C C     1 
ATOM   8436  O  O     . GLU D 3  213 ? -35.250 41.280  58.456 1.00 85.32  ? 214 GLU C O     1 
ATOM   8437  C  CB    . GLU D 3  213 ? -34.429 39.216  60.509 1.00 75.39  ? 214 GLU C CB    1 
ATOM   8438  C  CG    . GLU D 3  213 ? -35.096 38.325  61.509 1.00 90.03  ? 214 GLU C CG    1 
ATOM   8439  C  CD    . GLU D 3  213 ? -34.655 38.663  62.918 1.00 103.29 ? 214 GLU C CD    1 
ATOM   8440  O  OE1   . GLU D 3  213 ? -34.639 39.874  63.262 1.00 112.92 ? 214 GLU C OE1   1 
ATOM   8441  O  OE2   . GLU D 3  213 ? -34.302 37.722  63.665 1.00 107.26 ? 214 GLU C OE2   1 
ATOM   8442  N  N     . GLY D 3  214 ? -33.555 40.202  57.422 1.00 54.87  ? 215 GLY C N     1 
ATOM   8443  C  CA    . GLY D 3  214 ? -32.804 41.352  57.000 1.00 49.50  ? 215 GLY C CA    1 
ATOM   8444  C  C     . GLY D 3  214 ? -31.345 40.982  56.849 1.00 49.24  ? 215 GLY C C     1 
ATOM   8445  O  O     . GLY D 3  214 ? -30.935 39.845  57.134 1.00 47.15  ? 215 GLY C O     1 
ATOM   8446  N  N     . PRO D 3  215 ? -30.557 41.914  56.325 1.00 48.52  ? 216 PRO C N     1 
ATOM   8447  C  CA    . PRO D 3  215 ? -29.105 41.711  56.229 1.00 46.63  ? 216 PRO C CA    1 
ATOM   8448  C  C     . PRO D 3  215 ? -28.453 41.568  57.593 1.00 49.81  ? 216 PRO C C     1 
ATOM   8449  O  O     . PRO D 3  215 ? -29.024 41.937  58.617 1.00 57.23  ? 216 PRO C O     1 
ATOM   8450  C  CB    . PRO D 3  215 ? -28.613 42.974  55.528 1.00 44.04  ? 216 PRO C CB    1 
ATOM   8451  C  CG    . PRO D 3  215 ? -29.775 43.451  54.775 1.00 44.05  ? 216 PRO C CG    1 
ATOM   8452  C  CD    . PRO D 3  215 ? -30.986 43.113  55.593 1.00 56.61  ? 216 PRO C CD    1 
ATOM   8453  N  N     . ASP D 3  216 ? -27.217 41.071  57.595 1.00 52.10  ? 217 ASP C N     1 
ATOM   8454  C  CA    . ASP D 3  216 ? -26.425 40.990  58.827 1.00 46.85  ? 217 ASP C CA    1 
ATOM   8455  C  C     . ASP D 3  216 ? -24.991 41.367  58.463 1.00 51.12  ? 217 ASP C C     1 
ATOM   8456  O  O     . ASP D 3  216 ? -24.226 40.538  57.963 1.00 56.10  ? 217 ASP C O     1 
ATOM   8457  C  CB    . ASP D 3  216 ? -26.498 39.597  59.456 1.00 47.24  ? 217 ASP C CB    1 
ATOM   8458  C  CG    . ASP D 3  216 ? -25.930 39.560  60.853 1.00 51.47  ? 217 ASP C CG    1 
ATOM   8459  O  OD1   . ASP D 3  216 ? -25.848 40.618  61.491 1.00 53.14  ? 217 ASP C OD1   1 
ATOM   8460  O  OD2   . ASP D 3  216 ? -25.582 38.461  61.309 1.00 55.57  ? 217 ASP C OD2   1 
ATOM   8461  N  N     . PHE D 3  217 ? -24.620 42.608  58.723 1.00 49.72  ? 218 PHE C N     1 
ATOM   8462  C  CA    . PHE D 3  217 ? -23.317 43.095  58.295 1.00 49.82  ? 218 PHE C CA    1 
ATOM   8463  C  C     . PHE D 3  217 ? -22.213 42.655  59.262 1.00 52.90  ? 218 PHE C C     1 
ATOM   8464  O  O     . PHE D 3  217 ? -22.431 42.584  60.473 1.00 49.97  ? 218 PHE C O     1 
ATOM   8465  C  CB    . PHE D 3  217 ? -23.320 44.617  58.205 1.00 49.06  ? 218 PHE C CB    1 
ATOM   8466  C  CG    . PHE D 3  217 ? -24.393 45.180  57.324 1.00 47.50  ? 218 PHE C CG    1 
ATOM   8467  C  CD1   . PHE D 3  217 ? -24.348 45.002  55.954 1.00 46.79  ? 218 PHE C CD1   1 
ATOM   8468  C  CD2   . PHE D 3  217 ? -25.423 45.927  57.861 1.00 51.85  ? 218 PHE C CD2   1 
ATOM   8469  C  CE1   . PHE D 3  217 ? -25.330 45.536  55.143 1.00 44.14  ? 218 PHE C CE1   1 
ATOM   8470  C  CE2   . PHE D 3  217 ? -26.398 46.462  57.057 1.00 55.63  ? 218 PHE C CE2   1 
ATOM   8471  C  CZ    . PHE D 3  217 ? -26.350 46.262  55.697 1.00 48.48  ? 218 PHE C CZ    1 
ATOM   8472  N  N     . PRO D 3  218 ? -21.014 42.352  58.747 1.00 55.27  ? 219 PRO C N     1 
ATOM   8473  C  CA    . PRO D 3  218 ? -19.898 42.005  59.643 1.00 55.11  ? 219 PRO C CA    1 
ATOM   8474  C  C     . PRO D 3  218 ? -19.629 43.045  60.704 1.00 49.85  ? 219 PRO C C     1 
ATOM   8475  O  O     . PRO D 3  218 ? -19.223 42.691  61.820 1.00 53.69  ? 219 PRO C O     1 
ATOM   8476  C  CB    . PRO D 3  218 ? -18.711 41.860  58.686 1.00 54.05  ? 219 PRO C CB    1 
ATOM   8477  C  CG    . PRO D 3  218 ? -19.140 42.446  57.403 1.00 44.13  ? 219 PRO C CG    1 
ATOM   8478  C  CD    . PRO D 3  218 ? -20.614 42.270  57.335 1.00 47.15  ? 219 PRO C CD    1 
ATOM   8479  N  N     . THR D 3  219 ? -19.894 44.303  60.400 1.00 46.74  ? 220 THR C N     1 
ATOM   8480  C  CA    . THR D 3  219 ? -19.600 45.455  61.230 1.00 48.46  ? 220 THR C CA    1 
ATOM   8481  C  C     . THR D 3  219 ? -20.699 45.797  62.230 1.00 48.52  ? 220 THR C C     1 
ATOM   8482  O  O     . THR D 3  219 ? -20.560 46.815  62.924 1.00 55.71  ? 220 THR C O     1 
ATOM   8483  C  CB    . THR D 3  219 ? -19.346 46.650  60.317 1.00 46.10  ? 220 THR C CB    1 
ATOM   8484  O  OG1   . THR D 3  219 ? -20.352 46.654  59.300 1.00 45.81  ? 220 THR C OG1   1 
ATOM   8485  C  CG2   . THR D 3  219 ? -17.994 46.517  59.656 1.00 42.49  ? 220 THR C CG2   1 
ATOM   8486  N  N     . ALA D 3  220 ? -21.782 45.006  62.306 1.00 51.19  ? 221 ALA C N     1 
ATOM   8487  C  CA    . ALA D 3  220 ? -22.915 45.245  63.200 1.00 52.15  ? 221 ALA C CA    1 
ATOM   8488  C  C     . ALA D 3  220 ? -23.660 46.529  62.826 1.00 51.65  ? 221 ALA C C     1 
ATOM   8489  O  O     . ALA D 3  220 ? -24.058 46.684  61.669 1.00 53.03  ? 221 ALA C O     1 
ATOM   8490  C  CB    . ALA D 3  220 ? -22.453 45.264  64.646 1.00 49.49  ? 221 ALA C CB    1 
ATOM   8491  N  N     . GLY D 3  221 ? -23.894 47.436  63.756 1.00 48.11  ? 222 GLY C N     1 
ATOM   8492  C  CA    . GLY D 3  221 ? -24.687 48.591  63.427 1.00 43.88  ? 222 GLY C CA    1 
ATOM   8493  C  C     . GLY D 3  221 ? -26.166 48.339  63.546 1.00 46.33  ? 222 GLY C C     1 
ATOM   8494  O  O     . GLY D 3  221 ? -26.639 47.313  64.043 1.00 56.76  ? 222 GLY C O     1 
ATOM   8495  N  N     . LEU D 3  222 ? -26.925 49.331  63.092 1.00 53.63  ? 223 LEU C N     1 
ATOM   8496  C  CA    . LEU D 3  222 ? -28.375 49.297  63.130 1.00 51.06  ? 223 LEU C CA    1 
ATOM   8497  C  C     . LEU D 3  222 ? -28.888 49.403  61.702 1.00 57.09  ? 223 LEU C C     1 
ATOM   8498  O  O     . LEU D 3  222 ? -28.267 50.068  60.857 1.00 54.06  ? 223 LEU C O     1 
ATOM   8499  C  CB    . LEU D 3  222 ? -28.934 50.447  63.981 1.00 51.70  ? 223 LEU C CB    1 
ATOM   8500  C  CG    . LEU D 3  222 ? -28.958 50.396  65.522 1.00 58.48  ? 223 LEU C CG    1 
ATOM   8501  C  CD1   . LEU D 3  222 ? -27.587 50.176  66.177 1.00 56.18  ? 223 LEU C CD1   1 
ATOM   8502  C  CD2   . LEU D 3  222 ? -29.600 51.661  66.053 1.00 71.88  ? 223 LEU C CD2   1 
ATOM   8503  N  N     . ILE D 3  223 ? -29.992 48.716  61.426 1.00 58.58  ? 224 ILE C N     1 
ATOM   8504  C  CA    . ILE D 3  223 ? -30.832 49.017  60.281 1.00 58.08  ? 224 ILE C CA    1 
ATOM   8505  C  C     . ILE D 3  223 ? -32.105 49.676  60.794 1.00 66.64  ? 224 ILE C C     1 
ATOM   8506  O  O     . ILE D 3  223 ? -32.773 49.149  61.701 1.00 65.63  ? 224 ILE C O     1 
ATOM   8507  C  CB    . ILE D 3  223 ? -31.182 47.751  59.482 1.00 48.19  ? 224 ILE C CB    1 
ATOM   8508  C  CG1   . ILE D 3  223 ? -29.926 47.164  58.826 1.00 45.84  ? 224 ILE C CG1   1 
ATOM   8509  C  CG2   . ILE D 3  223 ? -32.239 48.102  58.452 1.00 59.28  ? 224 ILE C CG2   1 
ATOM   8510  C  CD1   . ILE D 3  223 ? -30.158 45.834  58.153 1.00 47.98  ? 224 ILE C CD1   1 
ATOM   8511  N  N     . LEU D 3  224 ? -32.455 50.816  60.197 1.00 62.69  ? 225 LEU C N     1 
ATOM   8512  C  CA    . LEU D 3  224 ? -33.636 51.589  60.577 1.00 56.63  ? 225 LEU C CA    1 
ATOM   8513  C  C     . LEU D 3  224 ? -34.829 51.111  59.752 1.00 57.12  ? 225 LEU C C     1 
ATOM   8514  O  O     . LEU D 3  224 ? -34.970 51.458  58.575 1.00 57.90  ? 225 LEU C O     1 
ATOM   8515  C  CB    . LEU D 3  224 ? -33.388 53.076  60.349 1.00 51.87  ? 225 LEU C CB    1 
ATOM   8516  C  CG    . LEU D 3  224 ? -32.298 53.783  61.158 1.00 57.57  ? 225 LEU C CG    1 
ATOM   8517  C  CD1   . LEU D 3  224 ? -32.551 55.275  61.160 1.00 68.41  ? 225 LEU C CD1   1 
ATOM   8518  C  CD2   . LEU D 3  224 ? -32.255 53.252  62.566 1.00 62.59  ? 225 LEU C CD2   1 
ATOM   8519  N  N     . GLY D 3  225 ? -35.705 50.337  60.377 1.00 52.49  ? 226 GLY C N     1 
ATOM   8520  C  CA    . GLY D 3  225 ? -37.008 50.041  59.806 1.00 60.57  ? 226 GLY C CA    1 
ATOM   8521  C  C     . GLY D 3  225 ? -36.998 48.835  58.894 1.00 68.07  ? 226 GLY C C     1 
ATOM   8522  O  O     . GLY D 3  225 ? -35.997 48.488  58.277 1.00 64.75  ? 226 GLY C O     1 
ATOM   8523  N  N     . LYS D 3  226 ? -38.152 48.178  58.814 1.00 76.54  ? 227 LYS C N     1 
ATOM   8524  C  CA    . LYS D 3  226 ? -38.278 46.927  58.077 1.00 75.02  ? 227 LYS C CA    1 
ATOM   8525  C  C     . LYS D 3  226 ? -38.768 47.141  56.661 1.00 76.90  ? 227 LYS C C     1 
ATOM   8526  O  O     . LYS D 3  226 ? -39.062 46.169  55.956 1.00 73.41  ? 227 LYS C O     1 
ATOM   8527  C  CB    . LYS D 3  226 ? -39.230 45.988  58.804 1.00 78.69  ? 227 LYS C CB    1 
ATOM   8528  C  CG    . LYS D 3  226 ? -38.561 45.071  59.805 1.00 91.72  ? 227 LYS C CG    1 
ATOM   8529  C  CD    . LYS D 3  226 ? -39.609 44.367  60.655 1.00 115.39 ? 227 LYS C CD    1 
ATOM   8530  C  CE    . LYS D 3  226 ? -39.047 43.138  61.345 1.00 122.15 ? 227 LYS C CE    1 
ATOM   8531  N  NZ    . LYS D 3  226 ? -40.132 42.274  61.893 1.00 127.64 ? 227 LYS C NZ    1 
ATOM   8532  N  N     . SER D 3  227 ? -38.862 48.388  56.233 1.00 85.24  ? 228 SER C N     1 
ATOM   8533  C  CA    . SER D 3  227 ? -39.679 48.744  55.089 1.00 78.98  ? 228 SER C CA    1 
ATOM   8534  C  C     . SER D 3  227 ? -38.919 48.659  53.787 1.00 78.37  ? 228 SER C C     1 
ATOM   8535  O  O     . SER D 3  227 ? -39.543 48.579  52.722 1.00 90.22  ? 228 SER C O     1 
ATOM   8536  C  CB    . SER D 3  227 ? -40.200 50.163  55.258 1.00 80.69  ? 228 SER C CB    1 
ATOM   8537  O  OG    . SER D 3  227 ? -39.209 51.081  54.833 1.00 83.32  ? 228 SER C OG    1 
ATOM   8538  N  N     . GLY D 3  228 ? -37.597 48.697  53.851 1.00 60.96  ? 229 GLY C N     1 
ATOM   8539  C  CA    . GLY D 3  228 ? -36.772 48.750  52.671 1.00 53.69  ? 229 GLY C CA    1 
ATOM   8540  C  C     . GLY D 3  228 ? -36.084 47.426  52.481 1.00 63.20  ? 229 GLY C C     1 
ATOM   8541  O  O     . GLY D 3  228 ? -35.653 47.093  51.375 1.00 66.93  ? 229 GLY C O     1 
ATOM   8542  N  N     . ILE D 3  229 ? -35.942 46.679  53.578 1.00 69.84  ? 230 ILE C N     1 
ATOM   8543  C  CA    . ILE D 3  229 ? -35.620 45.259  53.469 1.00 62.93  ? 230 ILE C CA    1 
ATOM   8544  C  C     . ILE D 3  229 ? -36.670 44.558  52.633 1.00 62.28  ? 230 ILE C C     1 
ATOM   8545  O  O     . ILE D 3  229 ? -36.362 43.850  51.669 1.00 62.20  ? 230 ILE C O     1 
ATOM   8546  C  CB    . ILE D 3  229 ? -35.533 44.616  54.861 1.00 52.73  ? 230 ILE C CB    1 
ATOM   8547  C  CG1   . ILE D 3  229 ? -34.214 44.962  55.519 1.00 54.19  ? 230 ILE C CG1   1 
ATOM   8548  C  CG2   . ILE D 3  229 ? -35.711 43.123  54.749 1.00 48.91  ? 230 ILE C CG2   1 
ATOM   8549  C  CD1   . ILE D 3  229 ? -34.314 45.004  56.992 1.00 54.44  ? 230 ILE C CD1   1 
ATOM   8550  N  N     . ARG D 3  230 ? -37.930 44.727  53.020 1.00 56.27  ? 231 ARG C N     1 
ATOM   8551  C  CA    . ARG D 3  230 ? -39.015 44.014  52.367 1.00 56.04  ? 231 ARG C CA    1 
ATOM   8552  C  C     . ARG D 3  230 ? -39.050 44.330  50.884 1.00 58.88  ? 231 ARG C C     1 
ATOM   8553  O  O     . ARG D 3  230 ? -39.208 43.430  50.052 1.00 56.81  ? 231 ARG C O     1 
ATOM   8554  C  CB    . ARG D 3  230 ? -40.343 44.370  53.034 1.00 58.53  ? 231 ARG C CB    1 
ATOM   8555  C  CG    . ARG D 3  230 ? -41.513 43.588  52.496 1.00 75.52  ? 231 ARG C CG    1 
ATOM   8556  C  CD    . ARG D 3  230 ? -42.058 42.644  53.547 1.00 96.83  ? 231 ARG C CD    1 
ATOM   8557  N  NE    . ARG D 3  230 ? -42.917 41.617  52.961 1.00 109.37 ? 231 ARG C NE    1 
ATOM   8558  C  CZ    . ARG D 3  230 ? -44.246 41.624  53.018 1.00 117.40 ? 231 ARG C CZ    1 
ATOM   8559  N  NH1   . ARG D 3  230 ? -44.884 42.604  53.646 1.00 122.17 ? 231 ARG C NH1   1 
ATOM   8560  N  NH2   . ARG D 3  230 ? -44.939 40.643  52.453 1.00 116.01 ? 231 ARG C NH2   1 
ATOM   8561  N  N     . ARG D 3  231 ? -38.877 45.604  50.531 1.00 58.32  ? 232 ARG C N     1 
ATOM   8562  C  CA    . ARG D 3  231 ? -38.869 45.985  49.126 1.00 55.32  ? 232 ARG C CA    1 
ATOM   8563  C  C     . ARG D 3  231 ? -37.736 45.281  48.386 1.00 56.61  ? 232 ARG C C     1 
ATOM   8564  O  O     . ARG D 3  231 ? -37.924 44.782  47.273 1.00 60.69  ? 232 ARG C O     1 
ATOM   8565  C  CB    . ARG D 3  231 ? -38.765 47.504  48.979 1.00 52.68  ? 232 ARG C CB    1 
ATOM   8566  C  CG    . ARG D 3  231 ? -39.050 47.949  47.544 1.00 59.92  ? 232 ARG C CG    1 
ATOM   8567  C  CD    . ARG D 3  231 ? -39.020 49.462  47.356 1.00 62.63  ? 232 ARG C CD    1 
ATOM   8568  N  NE    . ARG D 3  231 ? -40.298 50.078  47.692 1.00 66.96  ? 232 ARG C NE    1 
ATOM   8569  C  CZ    . ARG D 3  231 ? -40.605 50.642  48.854 1.00 79.10  ? 232 ARG C CZ    1 
ATOM   8570  N  NH1   . ARG D 3  231 ? -39.733 50.683  49.843 1.00 76.67  ? 232 ARG C NH1   1 
ATOM   8571  N  NH2   . ARG D 3  231 ? -41.813 51.156  49.023 1.00 81.14  ? 232 ARG C NH2   1 
ATOM   8572  N  N     . ALA D 3  232 ? -36.557 45.192  49.006 1.00 64.02  ? 233 ALA C N     1 
ATOM   8573  C  CA    . ALA D 3  232 ? -35.421 44.529  48.372 1.00 59.47  ? 233 ALA C CA    1 
ATOM   8574  C  C     . ALA D 3  232 ? -35.654 43.028  48.223 1.00 52.05  ? 233 ALA C C     1 
ATOM   8575  O  O     . ALA D 3  232 ? -35.404 42.465  47.155 1.00 52.53  ? 233 ALA C O     1 
ATOM   8576  C  CB    . ALA D 3  232 ? -34.142 44.811  49.167 1.00 47.25  ? 233 ALA C CB    1 
ATOM   8577  N  N     . TYR D 3  233 ? -36.135 42.361  49.270 1.00 54.65  ? 234 TYR C N     1 
ATOM   8578  C  CA    . TYR D 3  233 ? -36.392 40.921  49.187 1.00 56.07  ? 234 TYR C CA    1 
ATOM   8579  C  C     . TYR D 3  233 ? -37.556 40.581  48.271 1.00 64.41  ? 234 TYR C C     1 
ATOM   8580  O  O     . TYR D 3  233 ? -37.726 39.415  47.910 1.00 77.33  ? 234 TYR C O     1 
ATOM   8581  C  CB    . TYR D 3  233 ? -36.680 40.305  50.553 1.00 52.64  ? 234 TYR C CB    1 
ATOM   8582  C  CG    . TYR D 3  233 ? -35.483 40.270  51.452 1.00 54.68  ? 234 TYR C CG    1 
ATOM   8583  C  CD1   . TYR D 3  233 ? -34.220 40.492  50.953 1.00 51.51  ? 234 TYR C CD1   1 
ATOM   8584  C  CD2   . TYR D 3  233 ? -35.616 40.022  52.803 1.00 52.40  ? 234 TYR C CD2   1 
ATOM   8585  C  CE1   . TYR D 3  233 ? -33.114 40.461  51.763 1.00 53.45  ? 234 TYR C CE1   1 
ATOM   8586  C  CE2   . TYR D 3  233 ? -34.505 39.988  53.628 1.00 56.10  ? 234 TYR C CE2   1 
ATOM   8587  C  CZ    . TYR D 3  233 ? -33.259 40.208  53.100 1.00 60.35  ? 234 TYR C CZ    1 
ATOM   8588  O  OH    . TYR D 3  233 ? -32.155 40.199  53.909 1.00 48.95  ? 234 TYR C OH    1 
ATOM   8589  N  N     . GLU D 3  234 ? -38.387 41.542  47.907 1.00 61.68  ? 235 GLU C N     1 
ATOM   8590  C  CA    . GLU D 3  234 ? -39.526 41.191  47.069 1.00 65.21  ? 235 GLU C CA    1 
ATOM   8591  C  C     . GLU D 3  234 ? -39.295 41.511  45.608 1.00 67.18  ? 235 GLU C C     1 
ATOM   8592  O  O     . GLU D 3  234 ? -39.779 40.782  44.729 1.00 75.81  ? 235 GLU C O     1 
ATOM   8593  C  CB    . GLU D 3  234 ? -40.776 41.896  47.574 1.00 73.94  ? 235 GLU C CB    1 
ATOM   8594  C  CG    . GLU D 3  234 ? -41.733 40.926  48.192 1.00 90.45  ? 235 GLU C CG    1 
ATOM   8595  C  CD    . GLU D 3  234 ? -42.675 41.549  49.170 1.00 101.21 ? 235 GLU C CD    1 
ATOM   8596  O  OE1   . GLU D 3  234 ? -43.127 42.683  48.937 1.00 97.88  ? 235 GLU C OE1   1 
ATOM   8597  O  OE2   . GLU D 3  234 ? -42.976 40.889  50.180 1.00 105.04 ? 235 GLU C OE2   1 
ATOM   8598  N  N     . THR D 3  235 ? -38.521 42.549  45.350 1.00 59.10  ? 236 THR C N     1 
ATOM   8599  C  CA    . THR D 3  235 ? -38.285 43.070  44.019 1.00 56.54  ? 236 THR C CA    1 
ATOM   8600  C  C     . THR D 3  235 ? -36.829 43.026  43.609 1.00 62.13  ? 236 THR C C     1 
ATOM   8601  O  O     . THR D 3  235 ? -36.523 43.196  42.421 1.00 71.34  ? 236 THR C O     1 
ATOM   8602  C  CB    . THR D 3  235 ? -38.747 44.525  43.944 1.00 56.69  ? 236 THR C CB    1 
ATOM   8603  O  OG1   . THR D 3  235 ? -37.902 45.286  44.809 1.00 59.91  ? 236 THR C OG1   1 
ATOM   8604  C  CG2   . THR D 3  235 ? -40.195 44.647  44.429 1.00 53.70  ? 236 THR C CG2   1 
ATOM   8605  N  N     . GLY D 3  236 ? -35.921 42.841  44.555 1.00 56.75  ? 237 GLY C N     1 
ATOM   8606  C  CA    . GLY D 3  236 ? -34.511 42.763  44.284 1.00 52.86  ? 237 GLY C CA    1 
ATOM   8607  C  C     . GLY D 3  236 ? -33.783 44.072  44.437 1.00 60.07  ? 237 GLY C C     1 
ATOM   8608  O  O     . GLY D 3  236 ? -32.549 44.071  44.409 1.00 66.39  ? 237 GLY C O     1 
ATOM   8609  N  N     . ARG D 3  237 ? -34.510 45.185  44.593 1.00 55.08  ? 238 ARG C N     1 
ATOM   8610  C  CA    . ARG D 3  237 ? -33.906 46.507  44.667 1.00 52.81  ? 238 ARG C CA    1 
ATOM   8611  C  C     . ARG D 3  237 ? -34.538 47.260  45.816 1.00 55.56  ? 238 ARG C C     1 
ATOM   8612  O  O     . ARG D 3  237 ? -35.766 47.375  45.883 1.00 60.83  ? 238 ARG C O     1 
ATOM   8613  C  CB    . ARG D 3  237 ? -34.103 47.285  43.361 1.00 51.40  ? 238 ARG C CB    1 
ATOM   8614  C  CG    . ARG D 3  237 ? -33.876 46.492  42.080 1.00 56.63  ? 238 ARG C CG    1 
ATOM   8615  C  CD    . ARG D 3  237 ? -33.202 47.318  40.988 1.00 63.29  ? 238 ARG C CD    1 
ATOM   8616  N  NE    . ARG D 3  237 ? -33.806 48.627  40.749 1.00 80.51  ? 238 ARG C NE    1 
ATOM   8617  C  CZ    . ARG D 3  237 ? -34.478 48.953  39.649 1.00 95.98  ? 238 ARG C CZ    1 
ATOM   8618  N  NH1   . ARG D 3  237 ? -34.639 48.069  38.673 1.00 102.86 ? 238 ARG C NH1   1 
ATOM   8619  N  NH2   . ARG D 3  237 ? -34.980 50.167  39.519 1.00 96.70  ? 238 ARG C NH2   1 
ATOM   8620  N  N     . GLY D 3  238 ? -33.719 47.781  46.716 1.00 49.38  ? 239 GLY C N     1 
ATOM   8621  C  CA    . GLY D 3  238 ? -34.287 48.588  47.789 1.00 52.63  ? 239 GLY C CA    1 
ATOM   8622  C  C     . GLY D 3  238 ? -33.195 49.371  48.486 1.00 58.62  ? 239 GLY C C     1 
ATOM   8623  O  O     . GLY D 3  238 ? -31.999 49.116  48.313 1.00 55.88  ? 239 GLY C O     1 
ATOM   8624  N  N     . SER D 3  239 ? -33.625 50.352  49.285 1.00 52.43  ? 240 SER C N     1 
ATOM   8625  C  CA    . SER D 3  239 ? -32.692 51.122  50.086 1.00 55.38  ? 240 SER C CA    1 
ATOM   8626  C  C     . SER D 3  239 ? -32.830 50.749  51.549 1.00 58.58  ? 240 SER C C     1 
ATOM   8627  O  O     . SER D 3  239 ? -33.939 50.701  52.087 1.00 76.24  ? 240 SER C O     1 
ATOM   8628  C  CB    . SER D 3  239 ? -32.911 52.625  49.916 1.00 61.21  ? 240 SER C CB    1 
ATOM   8629  O  OG    . SER D 3  239 ? -31.671 53.307  50.043 1.00 63.12  ? 240 SER C OG    1 
ATOM   8630  N  N     . ILE D 3  240 ? -31.695 50.533  52.195 1.00 60.29  ? 241 ILE C N     1 
ATOM   8631  C  CA    . ILE D 3  240 ? -31.621 50.146  53.596 1.00 53.63  ? 241 ILE C CA    1 
ATOM   8632  C  C     . ILE D 3  240 ? -30.800 51.188  54.344 1.00 58.07  ? 241 ILE C C     1 
ATOM   8633  O  O     . ILE D 3  240 ? -29.647 51.443  53.983 1.00 68.81  ? 241 ILE C O     1 
ATOM   8634  C  CB    . ILE D 3  240 ? -30.999 48.744  53.758 1.00 49.38  ? 241 ILE C CB    1 
ATOM   8635  C  CG1   . ILE D 3  240 ? -31.871 47.694  53.063 1.00 50.15  ? 241 ILE C CG1   1 
ATOM   8636  C  CG2   . ILE D 3  240 ? -30.806 48.411  55.199 1.00 49.51  ? 241 ILE C CG2   1 
ATOM   8637  C  CD1   . ILE D 3  240 ? -31.367 46.280  53.216 1.00 43.58  ? 241 ILE C CD1   1 
ATOM   8638  N  N     . GLN D 3  241 ? -31.393 51.794  55.378 1.00 57.13  ? 242 GLN C N     1 
ATOM   8639  C  CA    . GLN D 3  241 ? -30.709 52.822  56.156 1.00 57.57  ? 242 GLN C CA    1 
ATOM   8640  C  C     . GLN D 3  241 ? -29.881 52.202  57.277 1.00 60.18  ? 242 GLN C C     1 
ATOM   8641  O  O     . GLN D 3  241 ? -30.414 51.467  58.119 1.00 56.77  ? 242 GLN C O     1 
ATOM   8642  C  CB    . GLN D 3  241 ? -31.689 53.821  56.776 1.00 64.83  ? 242 GLN C CB    1 
ATOM   8643  C  CG    . GLN D 3  241 ? -32.464 54.639  55.781 1.00 84.98  ? 242 GLN C CG    1 
ATOM   8644  C  CD    . GLN D 3  241 ? -31.582 55.331  54.766 1.00 103.45 ? 242 GLN C CD    1 
ATOM   8645  O  OE1   . GLN D 3  241 ? -30.593 55.965  55.111 1.00 99.81  ? 242 GLN C OE1   1 
ATOM   8646  N  NE2   . GLN D 3  241 ? -31.935 55.200  53.501 1.00 115.86 ? 242 GLN C NE2   1 
ATOM   8647  N  N     . MET D 3  242 ? -28.602 52.552  57.327 1.00 48.90  ? 243 MET C N     1 
ATOM   8648  C  CA    . MET D 3  242 ? -27.695 52.014  58.324 1.00 46.38  ? 243 MET C CA    1 
ATOM   8649  C  C     . MET D 3  242 ? -27.326 53.106  59.315 1.00 57.85  ? 243 MET C C     1 
ATOM   8650  O  O     . MET D 3  242 ? -27.163 54.265  58.939 1.00 76.74  ? 243 MET C O     1 
ATOM   8651  C  CB    . MET D 3  242 ? -26.443 51.438  57.657 1.00 52.32  ? 243 MET C CB    1 
ATOM   8652  C  CG    . MET D 3  242 ? -26.784 50.283  56.763 1.00 48.53  ? 243 MET C CG    1 
ATOM   8653  S  SD    . MET D 3  242 ? -25.312 49.564  56.042 1.00 56.69  ? 243 MET C SD    1 
ATOM   8654  C  CE    . MET D 3  242 ? -24.810 50.926  55.026 1.00 55.97  ? 243 MET C CE    1 
ATOM   8655  N  N     . ARG D 3  243 ? -27.224 52.749  60.585 1.00 55.95  ? 244 ARG C N     1 
ATOM   8656  C  CA    . ARG D 3  243 ? -26.711 53.676  61.577 1.00 52.82  ? 244 ARG C CA    1 
ATOM   8657  C  C     . ARG D 3  243 ? -25.602 53.055  62.379 1.00 50.20  ? 244 ARG C C     1 
ATOM   8658  O  O     . ARG D 3  243 ? -25.687 51.898  62.766 1.00 48.54  ? 244 ARG C O     1 
ATOM   8659  C  CB    . ARG D 3  243 ? -27.759 54.158  62.552 1.00 50.39  ? 244 ARG C CB    1 
ATOM   8660  C  CG    . ARG D 3  243 ? -28.619 55.209  62.017 1.00 50.15  ? 244 ARG C CG    1 
ATOM   8661  C  CD    . ARG D 3  243 ? -29.301 55.928  63.114 1.00 59.74  ? 244 ARG C CD    1 
ATOM   8662  N  NE    . ARG D 3  243 ? -29.937 57.128  62.597 1.00 61.09  ? 244 ARG C NE    1 
ATOM   8663  C  CZ    . ARG D 3  243 ? -30.818 57.836  63.282 1.00 66.04  ? 244 ARG C CZ    1 
ATOM   8664  N  NH1   . ARG D 3  243 ? -31.156 57.450  64.501 1.00 75.04  ? 244 ARG C NH1   1 
ATOM   8665  N  NH2   . ARG D 3  243 ? -31.361 58.919  62.760 1.00 66.20  ? 244 ARG C NH2   1 
ATOM   8666  N  N     . SER D 3  244 ? -24.578 53.855  62.612 1.00 55.66  ? 245 SER C N     1 
ATOM   8667  C  CA    . SER D 3  244 ? -23.644 53.591  63.687 1.00 54.85  ? 245 SER C CA    1 
ATOM   8668  C  C     . SER D 3  244 ? -24.374 53.273  64.987 1.00 52.45  ? 245 SER C C     1 
ATOM   8669  O  O     . SER D 3  244 ? -25.478 53.767  65.239 1.00 57.55  ? 245 SER C O     1 
ATOM   8670  C  CB    . SER D 3  244 ? -22.745 54.808  63.882 1.00 65.09  ? 245 SER C CB    1 
ATOM   8671  O  OG    . SER D 3  244 ? -22.043 55.044  62.677 1.00 79.36  ? 245 SER C OG    1 
ATOM   8672  N  N     . ARG D 3  245 ? -23.742 52.454  65.830 1.00 52.53  ? 246 ARG C N     1 
ATOM   8673  C  CA    . ARG D 3  245 ? -24.178 52.303  67.210 1.00 55.67  ? 246 ARG C CA    1 
ATOM   8674  C  C     . ARG D 3  245 ? -23.496 53.374  68.049 1.00 57.04  ? 246 ARG C C     1 
ATOM   8675  O  O     . ARG D 3  245 ? -22.273 53.357  68.211 1.00 56.47  ? 246 ARG C O     1 
ATOM   8676  C  CB    . ARG D 3  245 ? -23.880 50.909  67.768 1.00 48.33  ? 246 ARG C CB    1 
ATOM   8677  C  CG    . ARG D 3  245 ? -24.514 50.683  69.170 1.00 46.87  ? 246 ARG C CG    1 
ATOM   8678  C  CD    . ARG D 3  245 ? -24.482 49.238  69.655 1.00 46.37  ? 246 ARG C CD    1 
ATOM   8679  N  NE    . ARG D 3  245 ? -25.400 48.426  68.874 1.00 54.81  ? 246 ARG C NE    1 
ATOM   8680  C  CZ    . ARG D 3  245 ? -26.719 48.423  69.055 1.00 48.57  ? 246 ARG C CZ    1 
ATOM   8681  N  NH1   . ARG D 3  245 ? -27.280 49.167  70.002 1.00 43.81  ? 246 ARG C NH1   1 
ATOM   8682  N  NH2   . ARG D 3  245 ? -27.484 47.653  68.295 1.00 50.12  ? 246 ARG C NH2   1 
ATOM   8683  N  N     . ALA D 3  246 ? -24.291 54.290  68.608 1.00 55.23  ? 247 ALA C N     1 
ATOM   8684  C  CA    . ALA D 3  246 ? -23.752 55.396  69.383 1.00 55.69  ? 247 ALA C CA    1 
ATOM   8685  C  C     . ALA D 3  246 ? -24.560 55.585  70.661 1.00 69.87  ? 247 ALA C C     1 
ATOM   8686  O  O     . ALA D 3  246 ? -25.796 55.497  70.648 1.00 80.30  ? 247 ALA C O     1 
ATOM   8687  C  CB    . ALA D 3  246 ? -23.776 56.705  68.581 1.00 53.77  ? 247 ALA C CB    1 
ATOM   8688  N  N     . VAL D 3  247 ? -23.868 55.878  71.765 1.00 67.36  ? 248 VAL C N     1 
ATOM   8689  C  CA    . VAL D 3  247 ? -24.525 56.257  73.006 1.00 58.80  ? 248 VAL C CA    1 
ATOM   8690  C  C     . VAL D 3  247 ? -24.026 57.612  73.476 1.00 58.99  ? 248 VAL C C     1 
ATOM   8691  O  O     . VAL D 3  247 ? -22.987 58.114  73.047 1.00 59.48  ? 248 VAL C O     1 
ATOM   8692  C  CB    . VAL D 3  247 ? -24.342 55.210  74.130 1.00 53.37  ? 248 VAL C CB    1 
ATOM   8693  C  CG1   . VAL D 3  247 ? -25.018 53.914  73.750 1.00 48.72  ? 248 VAL C CG1   1 
ATOM   8694  C  CG2   . VAL D 3  247 ? -22.841 55.035  74.495 1.00 51.06  ? 248 VAL C CG2   1 
ATOM   8695  N  N     . ILE D 3  248 ? -24.805 58.195  74.385 1.00 66.67  ? 249 ILE C N     1 
ATOM   8696  C  CA    . ILE D 3  248 ? -24.488 59.439  75.076 1.00 67.39  ? 249 ILE C CA    1 
ATOM   8697  C  C     . ILE D 3  248 ? -24.193 59.112  76.532 1.00 68.63  ? 249 ILE C C     1 
ATOM   8698  O  O     . ILE D 3  248 ? -24.940 58.359  77.162 1.00 63.84  ? 249 ILE C O     1 
ATOM   8699  C  CB    . ILE D 3  248 ? -25.640 60.446  74.931 1.00 59.76  ? 249 ILE C CB    1 
ATOM   8700  C  CG1   . ILE D 3  248 ? -25.722 60.899  73.472 1.00 64.66  ? 249 ILE C CG1   1 
ATOM   8701  C  CG2   . ILE D 3  248 ? -25.462 61.611  75.876 1.00 60.01  ? 249 ILE C CG2   1 
ATOM   8702  C  CD1   . ILE D 3  248 ? -27.008 61.565  73.049 1.00 76.68  ? 249 ILE C CD1   1 
ATOM   8703  N  N     . GLU D 3  249 ? -23.084 59.650  77.060 1.00 64.78  ? 250 GLU C N     1 
ATOM   8704  C  CA    . GLU D 3  249 ? -22.627 59.223  78.380 1.00 64.28  ? 250 GLU C CA    1 
ATOM   8705  C  C     . GLU D 3  249 ? -21.832 60.328  79.074 1.00 72.48  ? 250 GLU C C     1 
ATOM   8706  O  O     . GLU D 3  249 ? -21.220 61.176  78.426 1.00 68.30  ? 250 GLU C O     1 
ATOM   8707  C  CB    . GLU D 3  249 ? -21.793 57.926  78.295 1.00 62.28  ? 250 GLU C CB    1 
ATOM   8708  C  CG    . GLU D 3  249 ? -20.299 58.106  77.951 1.00 63.03  ? 250 GLU C CG    1 
ATOM   8709  C  CD    . GLU D 3  249 ? -19.497 56.794  77.989 1.00 66.91  ? 250 GLU C CD    1 
ATOM   8710  O  OE1   . GLU D 3  249 ? -20.094 55.698  78.142 1.00 80.14  ? 250 GLU C OE1   1 
ATOM   8711  O  OE2   . GLU D 3  249 ? -18.252 56.864  77.878 1.00 68.05  ? 250 GLU C OE2   1 
ATOM   8712  N  N     . GLU D 3  250 ? -21.861 60.297  80.413 1.00 80.76  ? 251 GLU C N     1 
ATOM   8713  C  CA    . GLU D 3  250 ? -21.163 61.293  81.219 1.00 84.10  ? 251 GLU C CA    1 
ATOM   8714  C  C     . GLU D 3  250 ? -19.655 61.066  81.198 1.00 75.59  ? 251 GLU C C     1 
ATOM   8715  O  O     . GLU D 3  250 ? -19.180 59.934  81.129 1.00 69.94  ? 251 GLU C O     1 
ATOM   8716  C  CB    . GLU D 3  250 ? -21.674 61.247  82.664 1.00 96.65  ? 251 GLU C CB    1 
ATOM   8717  C  CG    . GLU D 3  250 ? -22.500 59.998  82.960 1.00 111.33 ? 251 GLU C CG    1 
ATOM   8718  C  CD    . GLU D 3  250 ? -22.414 59.566  84.418 1.00 111.31 ? 251 GLU C CD    1 
ATOM   8719  O  OE1   . GLU D 3  250 ? -23.308 58.813  84.875 1.00 111.47 ? 251 GLU C OE1   1 
ATOM   8720  O  OE2   . GLU D 3  250 ? -21.446 59.981  85.102 1.00 99.54  ? 251 GLU C OE2   1 
ATOM   8721  N  N     . ARG D 3  251 ? -18.894 62.164  81.266 1.00 80.74  ? 252 ARG C N     1 
ATOM   8722  C  CA    . ARG D 3  251 ? -17.442 62.062  81.329 1.00 79.97  ? 252 ARG C CA    1 
ATOM   8723  C  C     . ARG D 3  251 ? -16.833 62.844  82.487 1.00 81.17  ? 252 ARG C C     1 
ATOM   8724  O  O     . ARG D 3  251 ? -15.608 63.004  82.535 1.00 77.80  ? 252 ARG C O     1 
ATOM   8725  C  CB    . ARG D 3  251 ? -16.803 62.506  80.007 1.00 80.04  ? 252 ARG C CB    1 
ATOM   8726  C  CG    . ARG D 3  251 ? -17.082 63.945  79.617 1.00 80.90  ? 252 ARG C CG    1 
ATOM   8727  C  CD    . ARG D 3  251 ? -16.431 64.300  78.274 1.00 85.43  ? 252 ARG C CD    1 
ATOM   8728  N  NE    . ARG D 3  251 ? -16.863 65.593  77.739 1.00 85.01  ? 252 ARG C NE    1 
ATOM   8729  C  CZ    . ARG D 3  251 ? -16.115 66.691  77.737 1.00 92.58  ? 252 ARG C CZ    1 
ATOM   8730  N  NH1   . ARG D 3  251 ? -14.895 66.662  78.245 1.00 92.78  ? 252 ARG C NH1   1 
ATOM   8731  N  NH2   . ARG D 3  251 ? -16.585 67.819  77.224 1.00 105.09 ? 252 ARG C NH2   1 
ATOM   8732  N  N     . GLY D 3  252 ? -17.654 63.337  83.412 1.00 83.06  ? 253 GLY C N     1 
ATOM   8733  C  CA    . GLY D 3  252 ? -17.163 64.048  84.577 1.00 89.71  ? 253 GLY C CA    1 
ATOM   8734  C  C     . GLY D 3  252 ? -17.228 65.561  84.469 1.00 101.24 ? 253 GLY C C     1 
ATOM   8735  O  O     . GLY D 3  252 ? -16.900 66.145  83.429 1.00 108.49 ? 253 GLY C O     1 
ATOM   8736  N  N     . GLY D 3  253 ? -17.621 66.215  85.556 1.00 95.18  ? 254 GLY C N     1 
ATOM   8737  C  CA    . GLY D 3  253 ? -17.788 67.647  85.541 1.00 85.89  ? 254 GLY C CA    1 
ATOM   8738  C  C     . GLY D 3  253 ? -19.111 68.106  84.992 1.00 93.00  ? 254 GLY C C     1 
ATOM   8739  O  O     . GLY D 3  253 ? -19.251 69.287  84.650 1.00 108.73 ? 254 GLY C O     1 
ATOM   8740  N  N     . GLY D 3  254 ? -20.098 67.221  84.925 1.00 90.72  ? 255 GLY C N     1 
ATOM   8741  C  CA    . GLY D 3  254 ? -21.361 67.598  84.332 1.00 103.06 ? 255 GLY C CA    1 
ATOM   8742  C  C     . GLY D 3  254 ? -21.258 67.757  82.840 1.00 99.06  ? 255 GLY C C     1 
ATOM   8743  O  O     . GLY D 3  254 ? -21.935 68.612  82.259 1.00 93.93  ? 255 GLY C O     1 
ATOM   8744  N  N     . ARG D 3  255 ? -20.396 66.973  82.208 1.00 96.35  ? 256 ARG C N     1 
ATOM   8745  C  CA    . ARG D 3  255 ? -20.110 67.033  80.787 1.00 95.00  ? 256 ARG C CA    1 
ATOM   8746  C  C     . ARG D 3  255 ? -20.369 65.669  80.165 1.00 96.91  ? 256 ARG C C     1 
ATOM   8747  O  O     . ARG D 3  255 ? -20.368 64.644  80.854 1.00 105.38 ? 256 ARG C O     1 
ATOM   8748  C  CB    . ARG D 3  255 ? -18.660 67.462  80.549 1.00 83.16  ? 256 ARG C CB    1 
ATOM   8749  C  CG    . ARG D 3  255 ? -18.420 68.929  80.729 1.00 84.37  ? 256 ARG C CG    1 
ATOM   8750  C  CD    . ARG D 3  255 ? -17.008 69.270  80.319 1.00 96.65  ? 256 ARG C CD    1 
ATOM   8751  N  NE    . ARG D 3  255 ? -16.126 69.368  81.475 1.00 111.72 ? 256 ARG C NE    1 
ATOM   8752  C  CZ    . ARG D 3  255 ? -15.764 70.520  82.033 1.00 119.42 ? 256 ARG C CZ    1 
ATOM   8753  N  NH1   . ARG D 3  255 ? -16.206 71.669  81.530 1.00 114.41 ? 256 ARG C NH1   1 
ATOM   8754  N  NH2   . ARG D 3  255 ? -14.955 70.525  83.088 1.00 124.37 ? 256 ARG C NH2   1 
ATOM   8755  N  N     . GLN D 3  256 ? -20.561 65.655  78.844 1.00 74.64  ? 257 GLN C N     1 
ATOM   8756  C  CA    . GLN D 3  256 ? -20.926 64.432  78.142 1.00 70.87  ? 257 GLN C CA    1 
ATOM   8757  C  C     . GLN D 3  256 ? -20.060 64.194  76.918 1.00 70.64  ? 257 GLN C C     1 
ATOM   8758  O  O     . GLN D 3  256 ? -19.308 65.058  76.469 1.00 75.31  ? 257 GLN C O     1 
ATOM   8759  C  CB    . GLN D 3  256 ? -22.394 64.451  77.699 1.00 64.67  ? 257 GLN C CB    1 
ATOM   8760  C  CG    . GLN D 3  256 ? -23.358 64.314  78.804 1.00 63.46  ? 257 GLN C CG    1 
ATOM   8761  C  CD    . GLN D 3  256 ? -24.746 64.683  78.346 1.00 69.55  ? 257 GLN C CD    1 
ATOM   8762  O  OE1   . GLN D 3  256 ? -24.913 65.536  77.462 1.00 63.02  ? 257 GLN C OE1   1 
ATOM   8763  N  NE2   . GLN D 3  256 ? -25.756 64.032  78.923 1.00 77.29  ? 257 GLN C NE2   1 
ATOM   8764  N  N     . ARG D 3  257 ? -20.231 62.999  76.361 1.00 66.95  ? 258 ARG C N     1 
ATOM   8765  C  CA    . ARG D 3  257 ? -19.604 62.615  75.108 1.00 70.63  ? 258 ARG C CA    1 
ATOM   8766  C  C     . ARG D 3  257 ? -20.522 61.646  74.368 1.00 70.35  ? 258 ARG C C     1 
ATOM   8767  O  O     . ARG D 3  257 ? -21.360 60.968  74.974 1.00 64.72  ? 258 ARG C O     1 
ATOM   8768  C  CB    . ARG D 3  257 ? -18.222 61.988  75.341 1.00 75.98  ? 258 ARG C CB    1 
ATOM   8769  C  CG    . ARG D 3  257 ? -18.244 60.778  76.239 1.00 77.29  ? 258 ARG C CG    1 
ATOM   8770  C  CD    . ARG D 3  257 ? -16.862 60.258  76.427 1.00 72.12  ? 258 ARG C CD    1 
ATOM   8771  N  NE    . ARG D 3  257 ? -16.855 59.194  77.419 1.00 67.57  ? 258 ARG C NE    1 
ATOM   8772  C  CZ    . ARG D 3  257 ? -15.852 58.988  78.260 1.00 69.16  ? 258 ARG C CZ    1 
ATOM   8773  N  NH1   . ARG D 3  257 ? -14.778 59.772  78.219 1.00 81.21  ? 258 ARG C NH1   1 
ATOM   8774  N  NH2   . ARG D 3  257 ? -15.916 57.995  79.136 1.00 66.21  ? 258 ARG C NH2   1 
ATOM   8775  N  N     . ILE D 3  258 ? -20.373 61.608  73.043 1.00 71.93  ? 259 ILE C N     1 
ATOM   8776  C  CA    . ILE D 3  258 ? -21.019 60.624  72.171 1.00 65.40  ? 259 ILE C CA    1 
ATOM   8777  C  C     . ILE D 3  258 ? -19.993 59.532  71.887 1.00 66.90  ? 259 ILE C C     1 
ATOM   8778  O  O     . ILE D 3  258 ? -18.863 59.833  71.478 1.00 74.34  ? 259 ILE C O     1 
ATOM   8779  C  CB    . ILE D 3  258 ? -21.480 61.276  70.858 1.00 60.46  ? 259 ILE C CB    1 
ATOM   8780  C  CG1   . ILE D 3  258 ? -22.493 62.394  71.120 1.00 59.77  ? 259 ILE C CG1   1 
ATOM   8781  C  CG2   . ILE D 3  258 ? -22.063 60.258  69.905 1.00 57.22  ? 259 ILE C CG2   1 
ATOM   8782  C  CD1   . ILE D 3  258 ? -22.588 63.367  69.977 1.00 61.33  ? 259 ILE C CD1   1 
ATOM   8783  N  N     . VAL D 3  259 ? -20.355 58.267  72.094 1.00 61.87  ? 260 VAL C N     1 
ATOM   8784  C  CA    . VAL D 3  259 ? -19.401 57.176  71.897 1.00 61.40  ? 260 VAL C CA    1 
ATOM   8785  C  C     . VAL D 3  259 ? -19.946 56.215  70.848 1.00 62.85  ? 260 VAL C C     1 
ATOM   8786  O  O     . VAL D 3  259 ? -21.015 55.618  71.031 1.00 68.02  ? 260 VAL C O     1 
ATOM   8787  C  CB    . VAL D 3  259 ? -19.075 56.446  73.212 1.00 61.86  ? 260 VAL C CB    1 
ATOM   8788  C  CG1   . VAL D 3  259 ? -17.884 55.535  73.014 1.00 59.96  ? 260 VAL C CG1   1 
ATOM   8789  C  CG2   . VAL D 3  259 ? -18.757 57.458  74.304 1.00 79.47  ? 260 VAL C CG2   1 
ATOM   8790  N  N     . VAL D 3  260 ? -19.200 56.055  69.760 1.00 58.85  ? 261 VAL C N     1 
ATOM   8791  C  CA    . VAL D 3  260 ? -19.600 55.222  68.627 1.00 57.13  ? 261 VAL C CA    1 
ATOM   8792  C  C     . VAL D 3  260 ? -18.800 53.929  68.705 1.00 59.27  ? 261 VAL C C     1 
ATOM   8793  O  O     . VAL D 3  260 ? -17.563 53.951  68.743 1.00 59.18  ? 261 VAL C O     1 
ATOM   8794  C  CB    . VAL D 3  260 ? -19.361 55.946  67.290 1.00 55.94  ? 261 VAL C CB    1 
ATOM   8795  C  CG1   . VAL D 3  260 ? -19.751 55.077  66.125 1.00 63.02  ? 261 VAL C CG1   1 
ATOM   8796  C  CG2   . VAL D 3  260 ? -20.150 57.243  67.233 1.00 53.14  ? 261 VAL C CG2   1 
ATOM   8797  N  N     . THR D 3  261 ? -19.489 52.787  68.739 1.00 62.05  ? 262 THR C N     1 
ATOM   8798  C  CA    . THR D 3  261 ? -18.802 51.507  68.838 1.00 61.03  ? 262 THR C CA    1 
ATOM   8799  C  C     . THR D 3  261 ? -19.011 50.610  67.623 1.00 65.38  ? 262 THR C C     1 
ATOM   8800  O  O     . THR D 3  261 ? -18.305 49.600  67.490 1.00 79.86  ? 262 THR C O     1 
ATOM   8801  C  CB    . THR D 3  261 ? -19.226 50.768  70.116 1.00 59.06  ? 262 THR C CB    1 
ATOM   8802  O  OG1   . THR D 3  261 ? -20.650 50.643  70.177 1.00 65.35  ? 262 THR C OG1   1 
ATOM   8803  C  CG2   . THR D 3  261 ? -18.737 51.504  71.358 1.00 61.33  ? 262 THR C CG2   1 
ATOM   8804  N  N     . GLU D 3  262 ? -19.929 50.955  66.727 1.00 61.90  ? 263 GLU C N     1 
ATOM   8805  C  CA    . GLU D 3  262 ? -20.128 50.243  65.471 1.00 57.49  ? 263 GLU C CA    1 
ATOM   8806  C  C     . GLU D 3  262 ? -20.392 51.264  64.377 1.00 59.08  ? 263 GLU C C     1 
ATOM   8807  O  O     . GLU D 3  262 ? -21.154 52.209  64.594 1.00 57.64  ? 263 GLU C O     1 
ATOM   8808  C  CB    . GLU D 3  262 ? -21.319 49.264  65.551 1.00 60.74  ? 263 GLU C CB    1 
ATOM   8809  C  CG    . GLU D 3  262 ? -21.181 48.173  66.591 1.00 61.54  ? 263 GLU C CG    1 
ATOM   8810  C  CD    . GLU D 3  262 ? -22.494 47.564  67.046 1.00 68.35  ? 263 GLU C CD    1 
ATOM   8811  O  OE1   . GLU D 3  262 ? -22.474 46.892  68.084 1.00 68.86  ? 263 GLU C OE1   1 
ATOM   8812  O  OE2   . GLU D 3  262 ? -23.546 47.728  66.392 1.00 79.41  ? 263 GLU C OE2   1 
ATOM   8813  N  N     . ILE D 3  263 ? -19.800 51.072  63.199 1.00 68.56  ? 264 ILE C N     1 
ATOM   8814  C  CA    . ILE D 3  263 ? -20.050 51.967  62.060 1.00 65.45  ? 264 ILE C CA    1 
ATOM   8815  C  C     . ILE D 3  263 ? -20.712 51.212  60.909 1.00 67.56  ? 264 ILE C C     1 
ATOM   8816  O  O     . ILE D 3  263 ? -20.726 49.969  60.912 1.00 83.76  ? 264 ILE C O     1 
ATOM   8817  C  CB    . ILE D 3  263 ? -18.758 52.658  61.593 1.00 64.43  ? 264 ILE C CB    1 
ATOM   8818  C  CG1   . ILE D 3  263 ? -17.776 51.631  61.019 1.00 79.53  ? 264 ILE C CG1   1 
ATOM   8819  C  CG2   . ILE D 3  263 ? -18.141 53.437  62.743 1.00 56.39  ? 264 ILE C CG2   1 
ATOM   8820  C  CD1   . ILE D 3  263 ? -16.473 52.224  60.501 1.00 81.50  ? 264 ILE C CD1   1 
ATOM   8821  N  N     . PRO D 3  264 ? -21.302 51.903  59.931 1.00 56.01  ? 265 PRO C N     1 
ATOM   8822  C  CA    . PRO D 3  264 ? -22.016 51.193  58.866 1.00 52.70  ? 265 PRO C CA    1 
ATOM   8823  C  C     . PRO D 3  264 ? -21.075 50.418  57.959 1.00 58.41  ? 265 PRO C C     1 
ATOM   8824  O  O     . PRO D 3  264 ? -19.880 50.702  57.836 1.00 60.66  ? 265 PRO C O     1 
ATOM   8825  C  CB    . PRO D 3  264 ? -22.706 52.312  58.095 1.00 50.37  ? 265 PRO C CB    1 
ATOM   8826  C  CG    . PRO D 3  264 ? -22.865 53.377  59.082 1.00 52.96  ? 265 PRO C CG    1 
ATOM   8827  C  CD    . PRO D 3  264 ? -21.596 53.339  59.878 1.00 55.91  ? 265 PRO C CD    1 
ATOM   8828  N  N     . PHE D 3  265 ? -21.653 49.394  57.338 1.00 56.12  ? 266 PHE C N     1 
ATOM   8829  C  CA    . PHE D 3  265 ? -20.917 48.536  56.427 1.00 63.24  ? 266 PHE C CA    1 
ATOM   8830  C  C     . PHE D 3  265 ? -20.276 49.345  55.313 1.00 64.09  ? 266 PHE C C     1 
ATOM   8831  O  O     . PHE D 3  265 ? -20.915 50.217  54.720 1.00 66.32  ? 266 PHE C O     1 
ATOM   8832  C  CB    . PHE D 3  265 ? -21.889 47.520  55.848 1.00 59.94  ? 266 PHE C CB    1 
ATOM   8833  C  CG    . PHE D 3  265 ? -21.241 46.467  55.031 1.00 54.21  ? 266 PHE C CG    1 
ATOM   8834  C  CD1   . PHE D 3  265 ? -20.063 45.883  55.449 1.00 58.20  ? 266 PHE C CD1   1 
ATOM   8835  C  CD2   . PHE D 3  265 ? -21.827 46.025  53.863 1.00 43.05  ? 266 PHE C CD2   1 
ATOM   8836  C  CE1   . PHE D 3  265 ? -19.476 44.898  54.700 1.00 55.88  ? 266 PHE C CE1   1 
ATOM   8837  C  CE2   . PHE D 3  265 ? -21.248 45.042  53.122 1.00 43.53  ? 266 PHE C CE2   1 
ATOM   8838  C  CZ    . PHE D 3  265 ? -20.065 44.480  53.537 1.00 45.23  ? 266 PHE C CZ    1 
ATOM   8839  N  N     . GLN D 3  266 ? -18.998 49.072  55.049 1.00 50.61  ? 267 GLN C N     1 
ATOM   8840  C  CA    . GLN D 3  266 ? -18.247 49.655  53.938 1.00 49.30  ? 267 GLN C CA    1 
ATOM   8841  C  C     . GLN D 3  266 ? -17.871 51.113  54.144 1.00 49.17  ? 267 GLN C C     1 
ATOM   8842  O  O     . GLN D 3  266 ? -17.252 51.702  53.256 1.00 49.70  ? 267 GLN C O     1 
ATOM   8843  C  CB    . GLN D 3  266 ? -18.990 49.489  52.609 1.00 45.32  ? 267 GLN C CB    1 
ATOM   8844  C  CG    . GLN D 3  266 ? -18.851 48.107  52.063 1.00 50.42  ? 267 GLN C CG    1 
ATOM   8845  C  CD    . GLN D 3  266 ? -19.850 47.834  50.996 1.00 58.68  ? 267 GLN C CD    1 
ATOM   8846  O  OE1   . GLN D 3  266 ? -20.840 48.554  50.881 1.00 73.21  ? 267 GLN C OE1   1 
ATOM   8847  N  NE2   . GLN D 3  266 ? -19.611 46.807  50.202 1.00 50.83  ? 267 GLN C NE2   1 
ATOM   8848  N  N     . VAL D 3  267 ? -18.224 51.706  55.277 1.00 45.99  ? 268 VAL C N     1 
ATOM   8849  C  CA    . VAL D 3  267 ? -17.771 53.044  55.625 1.00 47.98  ? 268 VAL C CA    1 
ATOM   8850  C  C     . VAL D 3  267 ? -16.348 52.986  56.122 1.00 49.87  ? 268 VAL C C     1 
ATOM   8851  O  O     . VAL D 3  267 ? -16.016 52.197  56.996 1.00 56.34  ? 268 VAL C O     1 
ATOM   8852  C  CB    . VAL D 3  267 ? -18.698 53.698  56.657 1.00 48.15  ? 268 VAL C CB    1 
ATOM   8853  C  CG1   . VAL D 3  267 ? -18.104 55.001  57.146 1.00 53.82  ? 268 VAL C CG1   1 
ATOM   8854  C  CG2   . VAL D 3  267 ? -20.045 53.922  56.088 1.00 45.81  ? 268 VAL C CG2   1 
ATOM   8855  N  N     . ASN D 3  268 ? -15.517 53.827  55.556 1.00 55.85  ? 269 ASN C N     1 
ATOM   8856  C  CA    . ASN D 3  268 ? -14.146 53.952  55.993 1.00 63.92  ? 269 ASN C CA    1 
ATOM   8857  C  C     . ASN D 3  268 ? -14.129 54.800  57.256 1.00 65.37  ? 269 ASN C C     1 
ATOM   8858  O  O     . ASN D 3  268 ? -14.714 55.883  57.289 1.00 67.69  ? 269 ASN C O     1 
ATOM   8859  C  CB    . ASN D 3  268 ? -13.345 54.568  54.858 1.00 75.41  ? 269 ASN C CB    1 
ATOM   8860  C  CG    . ASN D 3  268 ? -11.955 54.914  55.240 1.00 74.19  ? 269 ASN C CG    1 
ATOM   8861  O  OD1   . ASN D 3  268 ? -11.678 55.414  56.332 1.00 65.57  ? 269 ASN C OD1   1 
ATOM   8862  N  ND2   . ASN D 3  268 ? -11.050 54.689  54.306 1.00 84.88  ? 269 ASN C ND2   1 
ATOM   8863  N  N     . LYS D 3  269 ? -13.483 54.305  58.308 1.00 67.74  ? 270 LYS C N     1 
ATOM   8864  C  CA    . LYS D 3  269 ? -13.541 55.007  59.593 1.00 68.43  ? 270 LYS C CA    1 
ATOM   8865  C  C     . LYS D 3  269 ? -12.718 56.277  59.568 1.00 76.59  ? 270 LYS C C     1 
ATOM   8866  O  O     . LYS D 3  269 ? -13.202 57.355  59.935 1.00 81.69  ? 270 LYS C O     1 
ATOM   8867  C  CB    . LYS D 3  269 ? -13.037 54.113  60.717 1.00 51.47  ? 270 LYS C CB    1 
ATOM   8868  C  CG    . LYS D 3  269 ? -13.772 54.327  61.995 1.00 52.14  ? 270 LYS C CG    1 
ATOM   8869  C  CD    . LYS D 3  269 ? -12.923 53.920  63.153 1.00 49.62  ? 270 LYS C CD    1 
ATOM   8870  C  CE    . LYS D 3  269 ? -11.970 52.822  62.749 1.00 48.94  ? 270 LYS C CE    1 
ATOM   8871  N  NZ    . LYS D 3  269 ? -10.690 52.948  63.474 1.00 58.94  ? 270 LYS C NZ    1 
ATOM   8872  N  N     . ALA D 3  270 ? -11.439 56.134  59.227 1.00 76.45  ? 271 ALA C N     1 
ATOM   8873  C  CA    . ALA D 3  270 ? -10.526 57.266  59.176 1.00 64.50  ? 271 ALA C CA    1 
ATOM   8874  C  C     . ALA D 3  270 ? -11.129 58.401  58.383 1.00 69.84  ? 271 ALA C C     1 
ATOM   8875  O  O     . ALA D 3  270 ? -11.071 59.566  58.791 1.00 74.81  ? 271 ALA C O     1 
ATOM   8876  C  CB    . ALA D 3  270 ? -9.197  56.867  58.533 1.00 63.87  ? 271 ALA C CB    1 
ATOM   8877  N  N     . ARG D 3  271 ? -11.692 58.083  57.224 1.00 69.22  ? 272 ARG C N     1 
ATOM   8878  C  CA    . ARG D 3  271 ? -12.393 59.101  56.463 1.00 70.71  ? 272 ARG C CA    1 
ATOM   8879  C  C     . ARG D 3  271 ? -13.511 59.696  57.301 1.00 68.48  ? 272 ARG C C     1 
ATOM   8880  O  O     . ARG D 3  271 ? -13.540 60.902  57.553 1.00 84.46  ? 272 ARG C O     1 
ATOM   8881  C  CB    . ARG D 3  271 ? -12.932 58.510  55.165 1.00 79.25  ? 272 ARG C CB    1 
ATOM   8882  C  CG    . ARG D 3  271 ? -12.362 59.162  53.945 1.00 93.47  ? 272 ARG C CG    1 
ATOM   8883  C  CD    . ARG D 3  271 ? -12.885 58.446  52.729 1.00 114.17 ? 272 ARG C CD    1 
ATOM   8884  N  NE    . ARG D 3  271 ? -12.018 57.336  52.351 1.00 123.03 ? 272 ARG C NE    1 
ATOM   8885  C  CZ    . ARG D 3  271 ? -12.097 56.693  51.191 1.00 126.25 ? 272 ARG C CZ    1 
ATOM   8886  N  NH1   . ARG D 3  271 ? -13.011 57.047  50.296 1.00 129.89 ? 272 ARG C NH1   1 
ATOM   8887  N  NH2   . ARG D 3  271 ? -11.258 55.700  50.925 1.00 126.16 ? 272 ARG C NH2   1 
ATOM   8888  N  N     . MET D 3  272 ? -14.411 58.857  57.791 1.00 70.43  ? 273 MET C N     1 
ATOM   8889  C  CA    . MET D 3  272 ? -15.520 59.338  58.594 1.00 72.90  ? 273 MET C CA    1 
ATOM   8890  C  C     . MET D 3  272 ? -15.061 60.312  59.670 1.00 82.83  ? 273 MET C C     1 
ATOM   8891  O  O     . MET D 3  272 ? -15.700 61.346  59.869 1.00 85.08  ? 273 MET C O     1 
ATOM   8892  C  CB    . MET D 3  272 ? -16.269 58.182  59.228 1.00 70.75  ? 273 MET C CB    1 
ATOM   8893  C  CG    . MET D 3  272 ? -17.515 58.680  59.919 1.00 86.87  ? 273 MET C CG    1 
ATOM   8894  S  SD    . MET D 3  272 ? -18.136 57.552  61.161 1.00 96.75  ? 273 MET C SD    1 
ATOM   8895  C  CE    . MET D 3  272 ? -16.837 57.561  62.393 1.00 85.04  ? 273 MET C CE    1 
ATOM   8896  N  N     . ILE D 3  273 ? -13.966 59.996  60.372 1.00 90.45  ? 274 ILE C N     1 
ATOM   8897  C  CA    . ILE D 3  273 ? -13.472 60.877  61.434 1.00 84.18  ? 274 ILE C CA    1 
ATOM   8898  C  C     . ILE D 3  273 ? -12.961 62.185  60.853 1.00 72.16  ? 274 ILE C C     1 
ATOM   8899  O  O     . ILE D 3  273 ? -13.099 63.249  61.471 1.00 68.71  ? 274 ILE C O     1 
ATOM   8900  C  CB    . ILE D 3  273 ? -12.361 60.185  62.252 1.00 85.19  ? 274 ILE C CB    1 
ATOM   8901  C  CG1   . ILE D 3  273 ? -12.879 58.935  62.952 1.00 89.77  ? 274 ILE C CG1   1 
ATOM   8902  C  CG2   . ILE D 3  273 ? -11.817 61.124  63.311 1.00 81.95  ? 274 ILE C CG2   1 
ATOM   8903  C  CD1   . ILE D 3  273 ? -11.827 58.256  63.799 1.00 95.01  ? 274 ILE C CD1   1 
ATOM   8904  N  N     A GLU D 3  274 ? -12.365 62.139  59.667 0.50 70.81  ? 275 GLU C N     1 
ATOM   8905  N  N     B GLU D 3  274 ? -12.328 62.111  59.677 0.50 69.11  ? 275 GLU C N     1 
ATOM   8906  C  CA    A GLU D 3  274 ? -11.853 63.362  59.050 0.50 72.02  ? 275 GLU C CA    1 
ATOM   8907  C  CA    B GLU D 3  274 ? -11.846 63.299  58.972 0.50 69.25  ? 275 GLU C CA    1 
ATOM   8908  C  C     A GLU D 3  274 ? -12.990 64.258  58.575 0.50 70.08  ? 275 GLU C C     1 
ATOM   8909  C  C     B GLU D 3  274 ? -13.000 64.229  58.628 0.50 68.33  ? 275 GLU C C     1 
ATOM   8910  O  O     A GLU D 3  274 ? -12.898 65.489  58.664 0.50 70.40  ? 275 GLU C O     1 
ATOM   8911  O  O     B GLU D 3  274 ? -12.910 65.453  58.796 0.50 68.47  ? 275 GLU C O     1 
ATOM   8912  C  CB    A GLU D 3  274 ? -10.909 62.994  57.908 0.50 75.23  ? 275 GLU C CB    1 
ATOM   8913  C  CB    B GLU D 3  274 ? -11.146 62.898  57.671 0.50 73.47  ? 275 GLU C CB    1 
ATOM   8914  C  CG    A GLU D 3  274 ? -10.176 64.168  57.241 0.50 78.85  ? 275 GLU C CG    1 
ATOM   8915  C  CG    B GLU D 3  274 ? -9.766  62.254  57.670 0.50 77.42  ? 275 GLU C CG    1 
ATOM   8916  C  CD    A GLU D 3  274 ? -9.598  65.186  58.226 0.50 89.34  ? 275 GLU C CD    1 
ATOM   8917  C  CD    B GLU D 3  274 ? -9.343  61.942  56.231 0.50 77.85  ? 275 GLU C CD    1 
ATOM   8918  O  OE1   A GLU D 3  274 ? -8.777  64.814  59.096 0.50 87.94  ? 275 GLU C OE1   1 
ATOM   8919  O  OE1   B GLU D 3  274 ? -9.676  62.752  55.336 0.50 74.82  ? 275 GLU C OE1   1 
ATOM   8920  O  OE2   A GLU D 3  274 ? -9.965  66.377  58.117 0.50 95.04  ? 275 GLU C OE2   1 
ATOM   8921  O  OE2   B GLU D 3  274 ? -8.729  60.884  55.978 0.50 73.03  ? 275 GLU C OE2   1 
ATOM   8922  N  N     . LYS D 3  275 ? -14.070 63.659  58.074 1.00 68.72  ? 276 LYS C N     1 
ATOM   8923  C  CA    . LYS D 3  275 ? -15.256 64.439  57.747 1.00 71.21  ? 276 LYS C CA    1 
ATOM   8924  C  C     . LYS D 3  275 ? -15.804 65.160  58.970 1.00 69.26  ? 276 LYS C C     1 
ATOM   8925  O  O     . LYS D 3  275 ? -16.205 66.323  58.881 1.00 68.74  ? 276 LYS C O     1 
ATOM   8926  C  CB    . LYS D 3  275 ? -16.308 63.532  57.108 1.00 67.15  ? 276 LYS C CB    1 
ATOM   8927  C  CG    . LYS D 3  275 ? -17.639 64.209  56.774 1.00 70.63  ? 276 LYS C CG    1 
ATOM   8928  C  CD    . LYS D 3  275 ? -17.475 65.304  55.731 1.00 75.24  ? 276 LYS C CD    1 
ATOM   8929  C  CE    . LYS D 3  275 ? -18.834 65.837  55.279 1.00 80.32  ? 276 LYS C CE    1 
ATOM   8930  N  NZ    . LYS D 3  275 ? -18.762 66.636  54.018 1.00 85.45  ? 276 LYS C NZ    1 
ATOM   8931  N  N     . ILE D 3  276 ? -15.804 64.504  60.132 1.00 71.60  ? 277 ILE C N     1 
ATOM   8932  C  CA    . ILE D 3  276 ? -16.250 65.169  61.365 1.00 75.52  ? 277 ILE C CA    1 
ATOM   8933  C  C     . ILE D 3  276 ? -15.316 66.324  61.727 1.00 76.41  ? 277 ILE C C     1 
ATOM   8934  O  O     . ILE D 3  276 ? -15.761 67.445  62.016 1.00 77.40  ? 277 ILE C O     1 
ATOM   8935  C  CB    . ILE D 3  276 ? -16.378 64.161  62.527 1.00 76.37  ? 277 ILE C CB    1 
ATOM   8936  C  CG1   . ILE D 3  276 ? -17.382 63.051  62.177 1.00 78.13  ? 277 ILE C CG1   1 
ATOM   8937  C  CG2   . ILE D 3  276 ? -16.819 64.895  63.807 1.00 75.79  ? 277 ILE C CG2   1 
ATOM   8938  C  CD1   . ILE D 3  276 ? -17.505 61.919  63.213 1.00 81.83  ? 277 ILE C CD1   1 
ATOM   8939  N  N     . ALA D 3  277 ? -14.005 66.058  61.733 1.00 75.57  ? 278 ALA C N     1 
ATOM   8940  C  CA    . ALA D 3  277 ? -13.023 67.090  62.068 1.00 79.94  ? 278 ALA C CA    1 
ATOM   8941  C  C     . ALA D 3  277 ? -13.160 68.289  61.147 1.00 86.34  ? 278 ALA C C     1 
ATOM   8942  O  O     . ALA D 3  277 ? -13.114 69.444  61.594 1.00 81.70  ? 278 ALA C O     1 
ATOM   8943  C  CB    . ALA D 3  277 ? -11.612 66.524  61.971 1.00 81.93  ? 278 ALA C CB    1 
ATOM   8944  N  N     . GLU D 3  278 ? -13.311 68.022  59.852 1.00 92.69  ? 279 GLU C N     1 
ATOM   8945  C  CA    . GLU D 3  278 ? -13.487 69.075  58.868 1.00 81.12  ? 279 GLU C CA    1 
ATOM   8946  C  C     . GLU D 3  278 ? -14.762 69.882  59.133 1.00 78.13  ? 279 GLU C C     1 
ATOM   8947  O  O     . GLU D 3  278 ? -14.730 71.113  59.149 1.00 86.80  ? 279 GLU C O     1 
ATOM   8948  C  CB    . GLU D 3  278 ? -13.452 68.422  57.483 1.00 81.14  ? 279 GLU C CB    1 
ATOM   8949  C  CG    . GLU D 3  278 ? -13.880 69.239  56.298 1.00 97.95  ? 279 GLU C CG    1 
ATOM   8950  C  CD    . GLU D 3  278 ? -14.582 68.373  55.277 1.00 111.15 ? 279 GLU C CD    1 
ATOM   8951  O  OE1   . GLU D 3  278 ? -15.760 68.651  54.976 1.00 119.37 ? 279 GLU C OE1   1 
ATOM   8952  O  OE2   . GLU D 3  278 ? -13.966 67.391  54.806 1.00 102.12 ? 279 GLU C OE2   1 
ATOM   8953  N  N     . LEU D 3  279 ? -15.883 69.217  59.417 1.00 74.94  ? 280 LEU C N     1 
ATOM   8954  C  CA    . LEU D 3  279 ? -17.099 69.957  59.779 1.00 74.66  ? 280 LEU C CA    1 
ATOM   8955  C  C     . LEU D 3  279 ? -16.865 70.867  60.974 1.00 77.15  ? 280 LEU C C     1 
ATOM   8956  O  O     . LEU D 3  279 ? -17.389 71.987  61.021 1.00 83.26  ? 280 LEU C O     1 
ATOM   8957  C  CB    . LEU D 3  279 ? -18.262 69.017  60.105 1.00 76.80  ? 280 LEU C CB    1 
ATOM   8958  C  CG    . LEU D 3  279 ? -18.987 68.286  58.988 1.00 81.53  ? 280 LEU C CG    1 
ATOM   8959  C  CD1   . LEU D 3  279 ? -20.152 67.505  59.584 1.00 83.16  ? 280 LEU C CD1   1 
ATOM   8960  C  CD2   . LEU D 3  279 ? -19.461 69.264  57.932 1.00 90.28  ? 280 LEU C CD2   1 
ATOM   8961  N  N     . VAL D 3  280 ? -16.157 70.369  61.987 1.00 79.04  ? 281 VAL C N     1 
ATOM   8962  C  CA    . VAL D 3  280 ? -15.844 71.177  63.164 1.00 83.09  ? 281 VAL C CA    1 
ATOM   8963  C  C     . VAL D 3  280 ? -15.017 72.382  62.755 1.00 90.93  ? 281 VAL C C     1 
ATOM   8964  O  O     . VAL D 3  280 ? -15.356 73.534  63.057 1.00 100.67 ? 281 VAL C O     1 
ATOM   8965  C  CB    . VAL D 3  280 ? -15.103 70.319  64.209 1.00 88.95  ? 281 VAL C CB    1 
ATOM   8966  C  CG1   . VAL D 3  280 ? -14.574 71.167  65.346 1.00 90.75  ? 281 VAL C CG1   1 
ATOM   8967  C  CG2   . VAL D 3  280 ? -16.012 69.221  64.740 1.00 89.87  ? 281 VAL C CG2   1 
ATOM   8968  N  N     . ARG D 3  281 ? -13.932 72.116  62.029 1.00 91.02  ? 282 ARG C N     1 
ATOM   8969  C  CA    . ARG D 3  281 ? -13.020 73.149  61.550 1.00 87.54  ? 282 ARG C CA    1 
ATOM   8970  C  C     . ARG D 3  281 ? -13.745 74.247  60.772 1.00 84.87  ? 282 ARG C C     1 
ATOM   8971  O  O     . ARG D 3  281 ? -13.512 75.440  61.002 1.00 85.41  ? 282 ARG C O     1 
ATOM   8972  C  CB    . ARG D 3  281 ? -11.953 72.473  60.695 1.00 89.34  ? 282 ARG C CB    1 
ATOM   8973  C  CG    . ARG D 3  281 ? -10.583 73.034  60.833 1.00 94.44  ? 282 ARG C CG    1 
ATOM   8974  C  CD    . ARG D 3  281 ? -9.614  72.269  59.961 1.00 101.36 ? 282 ARG C CD    1 
ATOM   8975  N  NE    . ARG D 3  281 ? -10.123 72.111  58.602 1.00 117.14 ? 282 ARG C NE    1 
ATOM   8976  C  CZ    . ARG D 3  281 ? -10.253 70.943  57.980 1.00 124.38 ? 282 ARG C CZ    1 
ATOM   8977  N  NH1   . ARG D 3  281 ? -9.899  69.817  58.585 1.00 118.56 ? 282 ARG C NH1   1 
ATOM   8978  N  NH2   . ARG D 3  281 ? -10.724 70.905  56.741 1.00 132.28 ? 282 ARG C NH2   1 
ATOM   8979  N  N     . ASP D 3  282 ? -14.612 73.873  59.828 1.00 80.71  ? 283 ASP C N     1 
ATOM   8980  C  CA    . ASP D 3  282 ? -15.326 74.853  59.007 1.00 85.25  ? 283 ASP C CA    1 
ATOM   8981  C  C     . ASP D 3  282 ? -16.581 75.417  59.693 1.00 92.71  ? 283 ASP C C     1 
ATOM   8982  O  O     . ASP D 3  282 ? -17.416 76.022  59.009 1.00 104.92 ? 283 ASP C O     1 
ATOM   8983  C  CB    . ASP D 3  282 ? -15.740 74.258  57.650 1.00 83.59  ? 283 ASP C CB    1 
ATOM   8984  C  CG    . ASP D 3  282 ? -14.572 73.674  56.851 1.00 88.68  ? 283 ASP C CG    1 
ATOM   8985  O  OD1   . ASP D 3  282 ? -13.401 73.936  57.189 1.00 91.24  ? 283 ASP C OD1   1 
ATOM   8986  O  OD2   . ASP D 3  282 ? -14.838 72.954  55.862 1.00 89.11  ? 283 ASP C OD2   1 
ATOM   8987  N  N     . LYS D 3  283 ? -16.753 75.198  60.994 1.00 84.00  ? 284 LYS C N     1 
ATOM   8988  C  CA    . LYS D 3  283 ? -17.918 75.676  61.755 1.00 91.55  ? 284 LYS C CA    1 
ATOM   8989  C  C     . LYS D 3  283 ? -19.255 75.312  61.108 1.00 92.40  ? 284 LYS C C     1 
ATOM   8990  O  O     . LYS D 3  283 ? -20.245 76.028  61.273 1.00 87.16  ? 284 LYS C O     1 
ATOM   8991  C  CB    . LYS D 3  283 ? -17.812 77.184  62.054 1.00 92.55  ? 284 LYS C CB    1 
ATOM   8992  C  CG    . LYS D 3  283 ? -16.822 77.381  63.218 1.00 92.92  ? 284 LYS C CG    1 
ATOM   8993  C  CD    . LYS D 3  283 ? -16.701 78.724  63.963 1.00 93.14  ? 284 LYS C CD    1 
ATOM   8994  C  CE    . LYS D 3  283 ? -16.137 78.346  65.380 1.00 100.00 ? 284 LYS C CE    1 
ATOM   8995  N  NZ    . LYS D 3  283 ? -15.050 79.115  66.094 1.00 104.35 ? 284 LYS C NZ    1 
ATOM   8996  N  N     . LYS D 3  284 ? -19.334 74.158  60.435 1.00 88.00  ? 285 LYS C N     1 
ATOM   8997  C  CA    . LYS D 3  284 ? -20.612 73.655  59.931 1.00 83.42  ? 285 LYS C CA    1 
ATOM   8998  C  C     . LYS D 3  284 ? -21.376 72.786  60.932 1.00 82.81  ? 285 LYS C C     1 
ATOM   8999  O  O     . LYS D 3  284 ? -22.480 72.331  60.607 1.00 86.12  ? 285 LYS C O     1 
ATOM   9000  C  CB    . LYS D 3  284 ? -20.407 72.879  58.617 1.00 74.21  ? 285 LYS C CB    1 
ATOM   9001  N  N     . ILE D 3  285 ? -20.843 72.547  62.133 1.00 81.48  ? 286 ILE C N     1 
ATOM   9002  C  CA    . ILE D 3  285 ? -21.566 71.855  63.201 1.00 81.36  ? 286 ILE C CA    1 
ATOM   9003  C  C     . ILE D 3  285 ? -21.127 72.414  64.546 1.00 86.41  ? 286 ILE C C     1 
ATOM   9004  O  O     . ILE D 3  285 ? -19.929 72.499  64.829 1.00 95.78  ? 286 ILE C O     1 
ATOM   9005  C  CB    . ILE D 3  285 ? -21.381 70.320  63.165 1.00 89.30  ? 286 ILE C CB    1 
ATOM   9006  C  CG1   . ILE D 3  285 ? -22.322 69.643  64.167 1.00 89.55  ? 286 ILE C CG1   1 
ATOM   9007  C  CG2   . ILE D 3  285 ? -19.905 69.903  63.418 1.00 87.63  ? 286 ILE C CG2   1 
ATOM   9008  C  CD1   . ILE D 3  285 ? -22.501 68.160  63.922 1.00 82.22  ? 286 ILE C CD1   1 
ATOM   9009  N  N     A ASP D 3  286 ? -22.096 72.782  65.372 0.50 91.38  ? 287 ASP C N     1 
ATOM   9010  N  N     B ASP D 3  286 ? -22.094 72.796  65.376 0.50 91.65  ? 287 ASP C N     1 
ATOM   9011  C  CA    A ASP D 3  286 ? -21.799 73.383  66.657 0.50 97.00  ? 287 ASP C CA    1 
ATOM   9012  C  CA    B ASP D 3  286 ? -21.786 73.401  66.664 0.50 93.32  ? 287 ASP C CA    1 
ATOM   9013  C  C     A ASP D 3  286 ? -21.747 72.342  67.762 0.50 96.16  ? 287 ASP C C     1 
ATOM   9014  C  C     B ASP D 3  286 ? -21.761 72.376  67.783 0.50 94.43  ? 287 ASP C C     1 
ATOM   9015  O  O     A ASP D 3  286 ? -22.685 71.559  67.943 0.50 91.07  ? 287 ASP C O     1 
ATOM   9016  O  O     B ASP D 3  286 ? -22.717 71.622  67.977 0.50 92.38  ? 287 ASP C O     1 
ATOM   9017  C  CB    A ASP D 3  286 ? -22.837 74.436  67.028 0.50 96.90  ? 287 ASP C CB    1 
ATOM   9018  C  CB    B ASP D 3  286 ? -22.787 74.489  67.043 0.50 95.08  ? 287 ASP C CB    1 
ATOM   9019  C  CG    A ASP D 3  286 ? -22.974 74.599  68.539 0.50 91.32  ? 287 ASP C CG    1 
ATOM   9020  C  CG    B ASP D 3  286 ? -23.797 74.756  65.969 0.50 90.96  ? 287 ASP C CG    1 
ATOM   9021  O  OD1   A ASP D 3  286 ? -23.580 73.725  69.202 0.50 83.34  ? 287 ASP C OD1   1 
ATOM   9022  O  OD1   B ASP D 3  286 ? -24.181 73.801  65.264 0.50 96.38  ? 287 ASP C OD1   1 
ATOM   9023  O  OD2   A ASP D 3  286 ? -22.487 75.618  69.066 0.50 99.13  ? 287 ASP C OD2   1 
ATOM   9024  O  OD2   B ASP D 3  286 ? -24.205 75.928  65.824 0.50 77.27  ? 287 ASP C OD2   1 
ATOM   9025  N  N     . GLY D 3  287 ? -20.669 72.373  68.528 1.00 99.81  ? 288 GLY C N     1 
ATOM   9026  C  CA    . GLY D 3  287 ? -20.725 71.875  69.878 1.00 96.96  ? 288 GLY C CA    1 
ATOM   9027  C  C     . GLY D 3  287 ? -19.742 70.812  70.241 1.00 93.40  ? 288 GLY C C     1 
ATOM   9028  O  O     . GLY D 3  287 ? -19.812 70.260  71.334 1.00 93.15  ? 288 GLY C O     1 
ATOM   9029  N  N     . ILE D 3  288 ? -18.821 70.526  69.331 1.00 88.57  ? 289 ILE C N     1 
ATOM   9030  C  CA    . ILE D 3  288 ? -17.854 69.457  69.506 1.00 79.72  ? 289 ILE C CA    1 
ATOM   9031  C  C     . ILE D 3  288 ? -16.536 70.045  69.974 1.00 74.95  ? 289 ILE C C     1 
ATOM   9032  O  O     . ILE D 3  288 ? -15.973 70.924  69.321 1.00 70.91  ? 289 ILE C O     1 
ATOM   9033  C  CB    . ILE D 3  288 ? -17.670 68.651  68.205 1.00 64.41  ? 289 ILE C CB    1 
ATOM   9034  C  CG1   . ILE D 3  288 ? -18.976 67.905  67.872 1.00 61.61  ? 289 ILE C CG1   1 
ATOM   9035  C  CG2   . ILE D 3  288 ? -16.453 67.732  68.335 1.00 61.22  ? 289 ILE C CG2   1 
ATOM   9036  C  CD1   . ILE D 3  288 ? -19.026 67.257  66.490 1.00 57.42  ? 289 ILE C CD1   1 
ATOM   9037  N  N     . THR D 3  289 ? -16.033 69.538  71.098 1.00 73.12  ? 290 THR C N     1 
ATOM   9038  C  CA    . THR D 3  289 ? -14.813 70.049  71.703 1.00 75.23  ? 290 THR C CA    1 
ATOM   9039  C  C     . THR D 3  289 ? -13.611 69.141  71.523 1.00 80.84  ? 290 THR C C     1 
ATOM   9040  O  O     . THR D 3  289 ? -12.478 69.625  71.619 1.00 83.51  ? 290 THR C O     1 
ATOM   9041  C  CB    . THR D 3  289 ? -15.024 70.292  73.202 1.00 71.32  ? 290 THR C CB    1 
ATOM   9042  O  OG1   . THR D 3  289 ? -14.688 69.110  73.928 1.00 70.55  ? 290 THR C OG1   1 
ATOM   9043  C  CG2   . THR D 3  289 ? -16.467 70.605  73.460 1.00 70.80  ? 290 THR C CG2   1 
ATOM   9044  N  N     . ASP D 3  290 ? -13.822 67.850  71.279 1.00 78.64  ? 291 ASP C N     1 
ATOM   9045  C  CA    . ASP D 3  290 ? -12.724 66.931  71.020 1.00 76.19  ? 291 ASP C CA    1 
ATOM   9046  C  C     . ASP D 3  290 ? -13.236 65.729  70.234 1.00 78.96  ? 291 ASP C C     1 
ATOM   9047  O  O     . ASP D 3  290 ? -14.433 65.432  70.204 1.00 75.96  ? 291 ASP C O     1 
ATOM   9048  C  CB    . ASP D 3  290 ? -12.028 66.489  72.309 1.00 76.47  ? 291 ASP C CB    1 
ATOM   9049  C  CG    . ASP D 3  290 ? -10.638 65.958  72.048 1.00 85.91  ? 291 ASP C CG    1 
ATOM   9050  O  OD1   . ASP D 3  290 ? -10.136 66.205  70.935 1.00 88.44  ? 291 ASP C OD1   1 
ATOM   9051  O  OD2   . ASP D 3  290 ? -10.047 65.284  72.924 1.00 87.86  ? 291 ASP C OD2   1 
ATOM   9052  N  N     . LEU D 3  291 ? -12.291 65.037  69.610 1.00 77.80  ? 292 LEU C N     1 
ATOM   9053  C  CA    . LEU D 3  291 ? -12.573 63.968  68.660 1.00 72.15  ? 292 LEU C CA    1 
ATOM   9054  C  C     . LEU D 3  291 ? -11.416 62.988  68.727 1.00 69.15  ? 292 LEU C C     1 
ATOM   9055  O  O     . LEU D 3  291 ? -10.305 63.340  68.330 1.00 72.74  ? 292 LEU C O     1 
ATOM   9056  C  CB    . LEU D 3  291 ? -12.728 64.524  67.250 1.00 72.10  ? 292 LEU C CB    1 
ATOM   9057  C  CG    . LEU D 3  291 ? -13.198 63.564  66.169 1.00 81.44  ? 292 LEU C CG    1 
ATOM   9058  C  CD1   . LEU D 3  291 ? -14.587 63.120  66.539 1.00 75.04  ? 292 LEU C CD1   1 
ATOM   9059  C  CD2   . LEU D 3  291 ? -13.181 64.271  64.829 1.00 96.31  ? 292 LEU C CD2   1 
ATOM   9060  N  N     . ARG D 3  292 ? -11.664 61.778  69.199 1.00 66.64  ? 293 ARG C N     1 
ATOM   9061  C  CA    . ARG D 3  292 ? -10.586 60.822  69.396 1.00 67.30  ? 293 ARG C CA    1 
ATOM   9062  C  C     . ARG D 3  292 ? -10.973 59.454  68.885 1.00 72.74  ? 293 ARG C C     1 
ATOM   9063  O  O     . ARG D 3  292 ? -12.099 58.985  69.069 1.00 66.76  ? 293 ARG C O     1 
ATOM   9064  C  CB    . ARG D 3  292 ? -10.160 60.688  70.855 1.00 66.81  ? 293 ARG C CB    1 
ATOM   9065  C  CG    . ARG D 3  292 ? -9.744  61.987  71.491 1.00 67.76  ? 293 ARG C CG    1 
ATOM   9066  C  CD    . ARG D 3  292 ? -9.193  61.814  72.911 1.00 76.24  ? 293 ARG C CD    1 
ATOM   9067  N  NE    . ARG D 3  292 ? -10.048 61.060  73.839 1.00 77.42  ? 293 ARG C NE    1 
ATOM   9068  C  CZ    . ARG D 3  292 ? -11.136 61.540  74.444 1.00 75.55  ? 293 ARG C CZ    1 
ATOM   9069  N  NH1   . ARG D 3  292 ? -11.553 62.775  74.202 1.00 88.16  ? 293 ARG C NH1   1 
ATOM   9070  N  NH2   . ARG D 3  292 ? -11.819 60.784  75.288 1.00 64.92  ? 293 ARG C NH2   1 
ATOM   9071  N  N     . ASP D 3  293 ? -10.018 58.829  68.243 1.00 71.31  ? 294 ASP C N     1 
ATOM   9072  C  CA    . ASP D 3  293 ? -10.143 57.448  67.842 1.00 65.40  ? 294 ASP C CA    1 
ATOM   9073  C  C     . ASP D 3  293 ? -9.492  56.630  68.940 1.00 68.23  ? 294 ASP C C     1 
ATOM   9074  O  O     . ASP D 3  293 ? -8.269  56.655  69.092 1.00 67.41  ? 294 ASP C O     1 
ATOM   9075  C  CB    . ASP D 3  293 ? -9.462  57.227  66.506 1.00 67.43  ? 294 ASP C CB    1 
ATOM   9076  C  CG    . ASP D 3  293 ? -9.720  55.870  65.966 1.00 81.48  ? 294 ASP C CG    1 
ATOM   9077  O  OD1   . ASP D 3  293 ? -10.017 54.958  66.762 1.00 83.44  ? 294 ASP C OD1   1 
ATOM   9078  O  OD2   . ASP D 3  293 ? -9.645  55.737  64.732 1.00 85.92  ? 294 ASP C OD2   1 
ATOM   9079  N  N     . GLU D 3  294 ? -10.295 55.936  69.735 1.00 83.27  ? 295 GLU C N     1 
ATOM   9080  C  CA    . GLU D 3  294 ? -9.749  55.183  70.858 1.00 82.72  ? 295 GLU C CA    1 
ATOM   9081  C  C     . GLU D 3  294 ? -9.765  53.689  70.600 1.00 79.80  ? 295 GLU C C     1 
ATOM   9082  O  O     . GLU D 3  294 ? -9.710  52.901  71.548 1.00 88.16  ? 295 GLU C O     1 
ATOM   9083  C  CB    . GLU D 3  294 ? -10.493 55.528  72.147 1.00 70.73  ? 295 GLU C CB    1 
ATOM   9084  C  CG    . GLU D 3  294 ? -9.780  56.582  72.977 1.00 67.47  ? 295 GLU C CG    1 
ATOM   9085  C  CD    . GLU D 3  294 ? -10.653 57.163  74.072 1.00 69.45  ? 295 GLU C CD    1 
ATOM   9086  O  OE1   . GLU D 3  294 ? -11.713 56.572  74.372 1.00 80.81  ? 295 GLU C OE1   1 
ATOM   9087  O  OE2   . GLU D 3  294 ? -10.281 58.219  74.628 1.00 74.19  ? 295 GLU C OE2   1 
ATOM   9088  N  N     . THR D 3  295 ? -9.823  53.295  69.332 1.00 69.45  ? 296 THR C N     1 
ATOM   9089  C  CA    . THR D 3  295 ? -10.020 51.905  68.959 1.00 69.07  ? 296 THR C CA    1 
ATOM   9090  C  C     . THR D 3  295 ? -8.756  51.099  69.196 1.00 75.34  ? 296 THR C C     1 
ATOM   9091  O  O     . THR D 3  295 ? -7.666  51.492  68.769 1.00 71.84  ? 296 THR C O     1 
ATOM   9092  C  CB    . THR D 3  295 ? -10.433 51.790  67.494 1.00 68.42  ? 296 THR C CB    1 
ATOM   9093  O  OG1   . THR D 3  295 ? -11.771 52.273  67.330 1.00 76.67  ? 296 THR C OG1   1 
ATOM   9094  C  CG2   . THR D 3  295 ? -10.360 50.346  67.031 1.00 70.35  ? 296 THR C CG2   1 
ATOM   9095  N  N     . SER D 3  296 ? -8.907  49.970  69.867 1.00 85.66  ? 297 SER C N     1 
ATOM   9096  C  CA    . SER D 3  296 ? -7.849  48.989  69.987 1.00 96.08  ? 297 SER C CA    1 
ATOM   9097  C  C     . SER D 3  296 ? -8.319  47.686  69.369 1.00 95.52  ? 297 SER C C     1 
ATOM   9098  O  O     . SER D 3  296 ? -9.492  47.513  69.029 1.00 96.77  ? 297 SER C O     1 
ATOM   9099  C  CB    . SER D 3  296 ? -7.494  48.726  71.449 1.00 113.07 ? 297 SER C CB    1 
ATOM   9100  O  OG    . SER D 3  296 ? -8.535  47.939  71.999 1.00 114.32 ? 297 SER C OG    1 
ATOM   9101  N  N     . LEU D 3  297 ? -7.372  46.756  69.270 1.00 101.82 ? 298 LEU C N     1 
ATOM   9102  C  CA    . LEU D 3  297 ? -7.732  45.345  69.193 1.00 108.96 ? 298 LEU C CA    1 
ATOM   9103  C  C     . LEU D 3  297 ? -8.637  44.955  70.350 1.00 112.23 ? 298 LEU C C     1 
ATOM   9104  O  O     . LEU D 3  297 ? -9.681  44.324  70.160 1.00 122.27 ? 298 LEU C O     1 
ATOM   9105  C  CB    . LEU D 3  297 ? -6.473  44.476  69.208 1.00 103.97 ? 298 LEU C CB    1 
ATOM   9106  C  CG    . LEU D 3  297 ? -5.710  44.334  67.896 1.00 101.54 ? 298 LEU C CG    1 
ATOM   9107  C  CD1   . LEU D 3  297 ? -6.356  45.164  66.795 1.00 91.83  ? 298 LEU C CD1   1 
ATOM   9108  C  CD2   . LEU D 3  297 ? -4.249  44.717  68.073 1.00 100.30 ? 298 LEU C CD2   1 
ATOM   9109  N  N     . ARG D 3  298 ? -8.236  45.309  71.569 1.00 98.13  ? 299 ARG C N     1 
ATOM   9110  C  CA    . ARG D 3  298 ? -8.934  44.822  72.754 1.00 95.97  ? 299 ARG C CA    1 
ATOM   9111  C  C     . ARG D 3  298 ? -10.380 45.279  72.766 1.00 97.43  ? 299 ARG C C     1 
ATOM   9112  O  O     . ARG D 3  298 ? -11.315 44.466  72.730 1.00 98.53  ? 299 ARG C O     1 
ATOM   9113  C  CB    . ARG D 3  298 ? -8.231  45.312  74.021 1.00 83.69  ? 299 ARG C CB    1 
ATOM   9114  N  N     . THR D 3  299 ? -10.574 46.590  72.788 1.00 96.99  ? 300 THR C N     1 
ATOM   9115  C  CA    . THR D 3  299 ? -11.816 47.207  73.224 1.00 95.49  ? 300 THR C CA    1 
ATOM   9116  C  C     . THR D 3  299 ? -12.770 47.476  72.077 1.00 85.87  ? 300 THR C C     1 
ATOM   9117  O  O     . THR D 3  299 ? -13.816 48.107  72.286 1.00 74.90  ? 300 THR C O     1 
ATOM   9118  C  CB    . THR D 3  299 ? -11.509 48.509  73.946 1.00 95.50  ? 300 THR C CB    1 
ATOM   9119  O  OG1   . THR D 3  299 ? -11.395 49.562  72.984 1.00 94.31  ? 300 THR C OG1   1 
ATOM   9120  C  CG2   . THR D 3  299 ? -10.193 48.385  74.696 1.00 93.45  ? 300 THR C CG2   1 
ATOM   9121  N  N     . GLY D 3  300 ? -12.436 47.019  70.877 1.00 76.91  ? 301 GLY C N     1 
ATOM   9122  C  CA    . GLY D 3  300 ? -13.312 47.152  69.740 1.00 74.43  ? 301 GLY C CA    1 
ATOM   9123  C  C     . GLY D 3  300 ? -13.147 48.512  69.114 1.00 71.64  ? 301 GLY C C     1 
ATOM   9124  O  O     . GLY D 3  300 ? -12.210 49.260  69.398 1.00 80.74  ? 301 GLY C O     1 
ATOM   9125  N  N     . VAL D 3  301 ? -14.092 48.840  68.238 1.00 57.52  ? 302 VAL C N     1 
ATOM   9126  C  CA    . VAL D 3  301 ? -14.150 50.192  67.708 1.00 55.43  ? 302 VAL C CA    1 
ATOM   9127  C  C     . VAL D 3  301 ? -14.653 51.135  68.789 1.00 64.93  ? 302 VAL C C     1 
ATOM   9128  O  O     . VAL D 3  301 ? -15.639 50.841  69.472 1.00 68.35  ? 302 VAL C O     1 
ATOM   9129  C  CB    . VAL D 3  301 ? -15.041 50.233  66.455 1.00 53.43  ? 302 VAL C CB    1 
ATOM   9130  C  CG1   . VAL D 3  301 ? -15.548 51.645  66.205 1.00 49.46  ? 302 VAL C CG1   1 
ATOM   9131  C  CG2   . VAL D 3  301 ? -14.283 49.703  65.259 1.00 71.73  ? 302 VAL C CG2   1 
ATOM   9132  N  N     . ARG D 3  302 ? -13.968 52.269  68.965 1.00 66.72  ? 303 ARG C N     1 
ATOM   9133  C  CA    . ARG D 3  302 ? -14.401 53.266  69.956 1.00 55.50  ? 303 ARG C CA    1 
ATOM   9134  C  C     . ARG D 3  302 ? -14.012 54.660  69.452 1.00 59.82  ? 303 ARG C C     1 
ATOM   9135  O  O     . ARG D 3  302 ? -12.847 55.054  69.557 1.00 66.24  ? 303 ARG C O     1 
ATOM   9136  C  CB    . ARG D 3  302 ? -13.792 52.971  71.322 1.00 56.53  ? 303 ARG C CB    1 
ATOM   9137  C  CG    . ARG D 3  302 ? -14.253 53.911  72.449 1.00 54.26  ? 303 ARG C CG    1 
ATOM   9138  C  CD    . ARG D 3  302 ? -13.664 53.501  73.801 1.00 57.31  ? 303 ARG C CD    1 
ATOM   9139  N  NE    . ARG D 3  302 ? -13.899 54.505  74.842 1.00 58.86  ? 303 ARG C NE    1 
ATOM   9140  C  CZ    . ARG D 3  302 ? -14.996 54.581  75.589 1.00 61.17  ? 303 ARG C CZ    1 
ATOM   9141  N  NH1   . ARG D 3  302 ? -15.986 53.715  75.409 1.00 71.64  ? 303 ARG C NH1   1 
ATOM   9142  N  NH2   . ARG D 3  302 ? -15.102 55.534  76.507 1.00 63.17  ? 303 ARG C NH2   1 
ATOM   9143  N  N     . VAL D 3  303 ? -14.986 55.398  68.916 1.00 63.48  ? 304 VAL C N     1 
ATOM   9144  C  CA    . VAL D 3  303 ? -14.807 56.778  68.476 1.00 53.38  ? 304 VAL C CA    1 
ATOM   9145  C  C     . VAL D 3  303 ? -15.556 57.680  69.455 1.00 55.13  ? 304 VAL C C     1 
ATOM   9146  O  O     . VAL D 3  303 ? -16.758 57.504  69.677 1.00 66.47  ? 304 VAL C O     1 
ATOM   9147  C  CB    . VAL D 3  303 ? -15.280 56.991  67.025 1.00 50.92  ? 304 VAL C CB    1 
ATOM   9148  C  CG1   . VAL D 3  303 ? -14.944 58.373  66.555 1.00 52.96  ? 304 VAL C CG1   1 
ATOM   9149  C  CG2   . VAL D 3  303 ? -14.609 56.031  66.091 1.00 52.51  ? 304 VAL C CG2   1 
ATOM   9150  N  N     . VAL D 3  304 ? -14.838 58.629  70.057 1.00 57.69  ? 305 VAL C N     1 
ATOM   9151  C  CA    . VAL D 3  304 ? -15.364 59.483  71.115 1.00 63.68  ? 305 VAL C CA    1 
ATOM   9152  C  C     . VAL D 3  304 ? -15.430 60.924  70.618 1.00 69.92  ? 305 VAL C C     1 
ATOM   9153  O  O     . VAL D 3  304 ? -14.428 61.474  70.149 1.00 81.98  ? 305 VAL C O     1 
ATOM   9154  C  CB    . VAL D 3  304 ? -14.509 59.407  72.396 1.00 58.79  ? 305 VAL C CB    1 
ATOM   9155  C  CG1   . VAL D 3  304 ? -15.121 60.273  73.480 1.00 55.13  ? 305 VAL C CG1   1 
ATOM   9156  C  CG2   . VAL D 3  304 ? -14.384 57.979  72.848 1.00 62.04  ? 305 VAL C CG2   1 
ATOM   9157  N  N     . ILE D 3  305 ? -16.602 61.540  70.764 1.00 64.07  ? 306 ILE C N     1 
ATOM   9158  C  CA    . ILE D 3  305 ? -16.855 62.923  70.371 1.00 67.29  ? 306 ILE C CA    1 
ATOM   9159  C  C     . ILE D 3  305 ? -17.273 63.671  71.633 1.00 71.26  ? 306 ILE C C     1 
ATOM   9160  O  O     . ILE D 3  305 ? -18.404 63.498  72.105 1.00 70.83  ? 306 ILE C O     1 
ATOM   9161  C  CB    . ILE D 3  305 ? -17.944 63.022  69.293 1.00 68.61  ? 306 ILE C CB    1 
ATOM   9162  C  CG1   . ILE D 3  305 ? -17.599 62.173  68.075 1.00 71.50  ? 306 ILE C CG1   1 
ATOM   9163  C  CG2   . ILE D 3  305 ? -18.192 64.456  68.882 1.00 65.54  ? 306 ILE C CG2   1 
ATOM   9164  C  CD1   . ILE D 3  305 ? -18.786 61.399  67.574 1.00 65.38  ? 306 ILE C CD1   1 
ATOM   9165  N  N     . ASP D 3  306 ? -16.367 64.485  72.186 1.00 73.17  ? 307 ASP C N     1 
ATOM   9166  C  CA    . ASP D 3  306 ? -16.634 65.235  73.415 1.00 79.71  ? 307 ASP C CA    1 
ATOM   9167  C  C     . ASP D 3  306 ? -17.464 66.484  73.151 1.00 79.13  ? 307 ASP C C     1 
ATOM   9168  O  O     . ASP D 3  306 ? -17.219 67.211  72.189 1.00 77.38  ? 307 ASP C O     1 
ATOM   9169  C  CB    . ASP D 3  306 ? -15.324 65.642  74.090 1.00 87.00  ? 307 ASP C CB    1 
ATOM   9170  C  CG    . ASP D 3  306 ? -14.700 64.520  74.864 1.00 93.65  ? 307 ASP C CG    1 
ATOM   9171  O  OD1   . ASP D 3  306 ? -15.449 63.620  75.305 1.00 108.75 ? 307 ASP C OD1   1 
ATOM   9172  O  OD2   . ASP D 3  306 ? -13.463 64.548  75.036 1.00 99.54  ? 307 ASP C OD2   1 
ATOM   9173  N  N     . VAL D 3  307 ? -18.398 66.776  74.053 1.00 79.15  ? 308 VAL C N     1 
ATOM   9174  C  CA    . VAL D 3  307 ? -19.519 67.666  73.760 1.00 77.73  ? 308 VAL C CA    1 
ATOM   9175  C  C     . VAL D 3  307 ? -19.530 68.850  74.721 1.00 87.09  ? 308 VAL C C     1 
ATOM   9176  O  O     . VAL D 3  307 ? -19.551 68.669  75.944 1.00 87.40  ? 308 VAL C O     1 
ATOM   9177  C  CB    . VAL D 3  307 ? -20.850 66.900  73.808 1.00 72.10  ? 308 VAL C CB    1 
ATOM   9178  C  CG1   . VAL D 3  307 ? -21.982 67.816  74.233 1.00 71.54  ? 308 VAL C CG1   1 
ATOM   9179  C  CG2   . VAL D 3  307 ? -21.121 66.282  72.456 1.00 66.94  ? 308 VAL C CG2   1 
ATOM   9180  N  N     . ARG D 3  308 ? -19.595 70.054  74.155 1.00 87.66  ? 309 ARG C N     1 
ATOM   9181  C  CA    . ARG D 3  308 ? -19.433 71.288  74.916 1.00 85.17  ? 309 ARG C CA    1 
ATOM   9182  C  C     . ARG D 3  308 ? -20.414 71.370  76.074 1.00 85.63  ? 309 ARG C C     1 
ATOM   9183  O  O     . ARG D 3  308 ? -21.593 71.035  75.939 1.00 85.87  ? 309 ARG C O     1 
ATOM   9184  C  CB    . ARG D 3  308 ? -19.593 72.492  73.995 1.00 89.33  ? 309 ARG C CB    1 
ATOM   9185  C  CG    . ARG D 3  308 ? -19.219 73.790  74.655 1.00 99.20  ? 309 ARG C CG    1 
ATOM   9186  C  CD    . ARG D 3  308 ? -18.866 74.848  73.606 1.00 107.19 ? 309 ARG C CD    1 
ATOM   9187  N  NE    . ARG D 3  308 ? -19.861 74.960  72.538 1.00 109.99 ? 309 ARG C NE    1 
ATOM   9188  C  CZ    . ARG D 3  308 ? -21.176 75.084  72.734 1.00 102.68 ? 309 ARG C CZ    1 
ATOM   9189  N  NH1   . ARG D 3  308 ? -21.699 75.088  73.959 1.00 99.95  ? 309 ARG C NH1   1 
ATOM   9190  N  NH2   . ARG D 3  308 ? -21.990 75.185  71.695 1.00 94.04  ? 309 ARG C NH2   1 
ATOM   9191  N  N     . LYS D 3  309 ? -19.915 71.829  77.218 1.00 89.35  ? 310 LYS C N     1 
ATOM   9192  C  CA    . LYS D 3  309 ? -20.695 71.754  78.443 1.00 86.62  ? 310 LYS C CA    1 
ATOM   9193  C  C     . LYS D 3  309 ? -22.003 72.520  78.293 1.00 89.61  ? 310 LYS C C     1 
ATOM   9194  O  O     . LYS D 3  309 ? -22.027 73.646  77.778 1.00 102.84 ? 310 LYS C O     1 
ATOM   9195  C  CB    . LYS D 3  309 ? -19.880 72.268  79.633 1.00 86.22  ? 310 LYS C CB    1 
ATOM   9196  C  CG    . LYS D 3  309 ? -20.556 72.031  80.962 1.00 84.64  ? 310 LYS C CG    1 
ATOM   9197  C  CD    . LYS D 3  309 ? -19.678 72.482  82.107 1.00 91.35  ? 310 LYS C CD    1 
ATOM   9198  C  CE    . LYS D 3  309 ? -20.504 72.716  83.356 1.00 101.53 ? 310 LYS C CE    1 
ATOM   9199  N  NZ    . LYS D 3  309 ? -21.955 72.840  83.032 1.00 112.13 ? 310 LYS C NZ    1 
ATOM   9200  N  N     . ASP D 3  310 ? -23.093 71.869  78.713 1.00 87.26  ? 311 ASP C N     1 
ATOM   9201  C  CA    . ASP D 3  310 ? -24.484 72.324  78.662 1.00 90.41  ? 311 ASP C CA    1 
ATOM   9202  C  C     . ASP D 3  310 ? -25.042 72.460  77.243 1.00 94.29  ? 311 ASP C C     1 
ATOM   9203  O  O     . ASP D 3  310 ? -26.161 72.955  77.081 1.00 98.98  ? 311 ASP C O     1 
ATOM   9204  C  CB    . ASP D 3  310 ? -24.693 73.632  79.441 1.00 100.37 ? 311 ASP C CB    1 
ATOM   9205  C  CG    . ASP D 3  310 ? -24.569 73.439  80.938 1.00 100.83 ? 311 ASP C CG    1 
ATOM   9206  O  OD1   . ASP D 3  310 ? -25.376 72.682  81.524 1.00 100.99 ? 311 ASP C OD1   1 
ATOM   9207  O  OD2   . ASP D 3  310 ? -23.645 74.041  81.523 1.00 106.94 ? 311 ASP C OD2   1 
ATOM   9208  N  N     . ALA D 3  311 ? -24.305 72.036  76.223 1.00 99.33  ? 312 ALA C N     1 
ATOM   9209  C  CA    . ALA D 3  311 ? -24.902 71.873  74.907 1.00 92.32  ? 312 ALA C CA    1 
ATOM   9210  C  C     . ALA D 3  311 ? -25.666 70.552  74.859 1.00 84.96  ? 312 ALA C C     1 
ATOM   9211  O  O     . ALA D 3  311 ? -25.456 69.664  75.686 1.00 102.89 ? 312 ALA C O     1 
ATOM   9212  C  CB    . ALA D 3  311 ? -23.848 71.926  73.797 1.00 87.68  ? 312 ALA C CB    1 
ATOM   9213  N  N     . ASN D 3  312 ? -26.569 70.428  73.897 1.00 76.45  ? 313 ASN C N     1 
ATOM   9214  C  CA    . ASN D 3  312 ? -27.397 69.234  73.829 1.00 79.73  ? 313 ASN C CA    1 
ATOM   9215  C  C     . ASN D 3  312 ? -26.744 68.235  72.894 1.00 80.22  ? 313 ASN C C     1 
ATOM   9216  O  O     . ASN D 3  312 ? -26.333 68.576  71.782 1.00 89.50  ? 313 ASN C O     1 
ATOM   9217  C  CB    . ASN D 3  312 ? -28.822 69.549  73.385 1.00 75.11  ? 313 ASN C CB    1 
ATOM   9218  C  CG    . ASN D 3  312 ? -29.695 68.310  73.308 1.00 67.56  ? 313 ASN C CG    1 
ATOM   9219  O  OD1   . ASN D 3  312 ? -29.329 67.305  72.700 1.00 71.33  ? 313 ASN C OD1   1 
ATOM   9220  N  ND2   . ASN D 3  312 ? -30.857 68.378  73.928 1.00 67.00  ? 313 ASN C ND2   1 
ATOM   9221  N  N     . ALA D 3  313 ? -26.654 67.000  73.357 1.00 71.95  ? 314 ALA C N     1 
ATOM   9222  C  CA    . ALA D 3  313 ? -25.782 66.035  72.719 1.00 67.90  ? 314 ALA C CA    1 
ATOM   9223  C  C     . ALA D 3  313 ? -26.521 65.082  71.811 1.00 71.57  ? 314 ALA C C     1 
ATOM   9224  O  O     . ALA D 3  313 ? -25.961 64.639  70.803 1.00 84.68  ? 314 ALA C O     1 
ATOM   9225  C  CB    . ALA D 3  313 ? -25.013 65.243  73.774 1.00 72.25  ? 314 ALA C CB    1 
ATOM   9226  N  N     . SER D 3  314 ? -27.762 64.756  72.159 1.00 64.90  ? 315 SER C N     1 
ATOM   9227  C  CA    . SER D 3  314 ? -28.648 64.108  71.208 1.00 74.47  ? 315 SER C CA    1 
ATOM   9228  C  C     . SER D 3  314 ? -28.725 64.920  69.932 1.00 81.56  ? 315 SER C C     1 
ATOM   9229  O  O     . SER D 3  314 ? -28.542 64.392  68.828 1.00 86.68  ? 315 SER C O     1 
ATOM   9230  C  CB    . SER D 3  314 ? -30.024 63.949  71.836 1.00 83.68  ? 315 SER C CB    1 
ATOM   9231  O  OG    . SER D 3  314 ? -29.907 63.285  73.079 1.00 85.06  ? 315 SER C OG    1 
ATOM   9232  N  N     . VAL D 3  315 ? -28.984 66.220  70.077 1.00 77.96  ? 316 VAL C N     1 
ATOM   9233  C  CA    . VAL D 3  315 ? -29.056 67.118  68.929 1.00 72.17  ? 316 VAL C CA    1 
ATOM   9234  C  C     . VAL D 3  315 ? -27.768 67.072  68.126 1.00 74.74  ? 316 VAL C C     1 
ATOM   9235  O  O     . VAL D 3  315 ? -27.794 67.045  66.891 1.00 92.31  ? 316 VAL C O     1 
ATOM   9236  C  CB    . VAL D 3  315 ? -29.381 68.549  69.392 1.00 64.56  ? 316 VAL C CB    1 
ATOM   9237  C  CG1   . VAL D 3  315 ? -28.769 69.543  68.418 1.00 63.04  ? 316 VAL C CG1   1 
ATOM   9238  C  CG2   . VAL D 3  315 ? -30.883 68.729  69.478 1.00 62.79  ? 316 VAL C CG2   1 
ATOM   9239  N  N     . ILE D 3  316 ? -26.617 67.091  68.796 1.00 63.22  ? 317 ILE C N     1 
ATOM   9240  C  CA    . ILE D 3  316 ? -25.374 66.971  68.032 1.00 61.44  ? 317 ILE C CA    1 
ATOM   9241  C  C     . ILE D 3  316 ? -25.339 65.646  67.303 1.00 62.87  ? 317 ILE C C     1 
ATOM   9242  O  O     . ILE D 3  316 ? -24.948 65.570  66.133 1.00 68.94  ? 317 ILE C O     1 
ATOM   9243  C  CB    . ILE D 3  316 ? -24.133 67.108  68.925 1.00 59.31  ? 317 ILE C CB    1 
ATOM   9244  C  CG1   . ILE D 3  316 ? -24.091 68.480  69.565 1.00 66.20  ? 317 ILE C CG1   1 
ATOM   9245  C  CG2   . ILE D 3  316 ? -22.889 66.893  68.075 1.00 58.49  ? 317 ILE C CG2   1 
ATOM   9246  C  CD1   . ILE D 3  316 ? -23.289 68.496  70.816 1.00 71.35  ? 317 ILE C CD1   1 
ATOM   9247  N  N     . LEU D 3  317 ? -25.694 64.571  68.004 1.00 61.48  ? 318 LEU C N     1 
ATOM   9248  C  CA    . LEU D 3  317 ? -25.675 63.250  67.391 1.00 63.02  ? 318 LEU C CA    1 
ATOM   9249  C  C     . LEU D 3  317 ? -26.524 63.240  66.134 1.00 69.08  ? 318 LEU C C     1 
ATOM   9250  O  O     . LEU D 3  317 ? -26.057 62.851  65.059 1.00 78.19  ? 318 LEU C O     1 
ATOM   9251  C  CB    . LEU D 3  317 ? -26.166 62.196  68.391 1.00 65.60  ? 318 LEU C CB    1 
ATOM   9252  C  CG    . LEU D 3  317 ? -26.052 60.750  67.914 1.00 62.78  ? 318 LEU C CG    1 
ATOM   9253  C  CD1   . LEU D 3  317 ? -24.663 60.493  67.370 1.00 59.77  ? 318 LEU C CD1   1 
ATOM   9254  C  CD2   . LEU D 3  317 ? -26.354 59.819  69.059 1.00 62.48  ? 318 LEU C CD2   1 
ATOM   9255  N  N     . ASN D 3  318 ? -27.768 63.701  66.253 1.00 69.55  ? 319 ASN C N     1 
ATOM   9256  C  CA    . ASN D 3  318 ? -28.693 63.744  65.127 1.00 68.73  ? 319 ASN C CA    1 
ATOM   9257  C  C     . ASN D 3  318 ? -28.081 64.436  63.926 1.00 68.38  ? 319 ASN C C     1 
ATOM   9258  O  O     . ASN D 3  318 ? -28.223 63.978  62.790 1.00 72.31  ? 319 ASN C O     1 
ATOM   9259  C  CB    . ASN D 3  318 ? -29.973 64.457  65.549 1.00 83.62  ? 319 ASN C CB    1 
ATOM   9260  C  CG    . ASN D 3  318 ? -31.053 63.506  65.921 1.00 100.46 ? 319 ASN C CG    1 
ATOM   9261  O  OD1   . ASN D 3  318 ? -30.858 62.294  65.869 1.00 107.13 ? 319 ASN C OD1   1 
ATOM   9262  N  ND2   . ASN D 3  318 ? -32.209 64.038  66.300 1.00 105.71 ? 319 ASN C ND2   1 
ATOM   9263  N  N     . ASN D 3  319 ? -27.418 65.564  64.158 1.00 65.83  ? 320 ASN C N     1 
ATOM   9264  C  CA    . ASN D 3  319 ? -26.748 66.271  63.072 1.00 65.82  ? 320 ASN C CA    1 
ATOM   9265  C  C     . ASN D 3  319 ? -25.662 65.416  62.438 1.00 64.93  ? 320 ASN C C     1 
ATOM   9266  O  O     . ASN D 3  319 ? -25.535 65.366  61.211 1.00 70.09  ? 320 ASN C O     1 
ATOM   9267  C  CB    . ASN D 3  319 ? -26.160 67.586  63.583 1.00 64.51  ? 320 ASN C CB    1 
ATOM   9268  C  CG    . ASN D 3  319 ? -27.214 68.553  64.015 1.00 80.83  ? 320 ASN C CG    1 
ATOM   9269  O  OD1   . ASN D 3  319 ? -28.404 68.348  63.752 1.00 81.13  ? 320 ASN C OD1   1 
ATOM   9270  N  ND2   . ASN D 3  319 ? -26.791 69.627  64.677 1.00 84.63  ? 320 ASN C ND2   1 
ATOM   9271  N  N     . LEU D 3  320 ? -24.851 64.756  63.262 1.00 60.33  ? 321 LEU C N     1 
ATOM   9272  C  CA    . LEU D 3  320 ? -23.788 63.915  62.721 1.00 62.91  ? 321 LEU C CA    1 
ATOM   9273  C  C     . LEU D 3  320 ? -24.356 62.853  61.786 1.00 65.45  ? 321 LEU C C     1 
ATOM   9274  O  O     . LEU D 3  320 ? -23.745 62.521  60.760 1.00 64.84  ? 321 LEU C O     1 
ATOM   9275  C  CB    . LEU D 3  320 ? -22.980 63.284  63.857 1.00 61.77  ? 321 LEU C CB    1 
ATOM   9276  C  CG    . LEU D 3  320 ? -22.071 64.232  64.643 1.00 65.18  ? 321 LEU C CG    1 
ATOM   9277  C  CD1   . LEU D 3  320 ? -21.477 63.535  65.837 1.00 69.06  ? 321 LEU C CD1   1 
ATOM   9278  C  CD2   . LEU D 3  320 ? -20.960 64.732  63.753 1.00 65.54  ? 321 LEU C CD2   1 
ATOM   9279  N  N     . TYR D 3  321 ? -25.552 62.344  62.094 1.00 62.52  ? 322 TYR C N     1 
ATOM   9280  C  CA    . TYR D 3  321 ? -26.216 61.398  61.204 1.00 64.00  ? 322 TYR C CA    1 
ATOM   9281  C  C     . TYR D 3  321 ? -26.588 62.028  59.872 1.00 66.50  ? 322 TYR C C     1 
ATOM   9282  O  O     . TYR D 3  321 ? -26.660 61.324  58.854 1.00 73.49  ? 322 TYR C O     1 
ATOM   9283  C  CB    . TYR D 3  321 ? -27.469 60.859  61.878 1.00 65.09  ? 322 TYR C CB    1 
ATOM   9284  C  CG    . TYR D 3  321 ? -27.209 59.846  62.949 1.00 66.67  ? 322 TYR C CG    1 
ATOM   9285  C  CD1   . TYR D 3  321 ? -26.198 58.905  62.828 1.00 72.33  ? 322 TYR C CD1   1 
ATOM   9286  C  CD2   . TYR D 3  321 ? -27.976 59.834  64.089 1.00 72.06  ? 322 TYR C CD2   1 
ATOM   9287  C  CE1   . TYR D 3  321 ? -25.982 57.969  63.817 1.00 74.53  ? 322 TYR C CE1   1 
ATOM   9288  C  CE2   . TYR D 3  321 ? -27.767 58.920  65.071 1.00 70.92  ? 322 TYR C CE2   1 
ATOM   9289  C  CZ    . TYR D 3  321 ? -26.780 57.988  64.942 1.00 72.67  ? 322 TYR C CZ    1 
ATOM   9290  O  OH    . TYR D 3  321 ? -26.623 57.094  65.971 1.00 78.06  ? 322 TYR C OH    1 
ATOM   9291  N  N     . LYS D 3  322 ? -26.873 63.332  59.856 1.00 61.41  ? 323 LYS C N     1 
ATOM   9292  C  CA    . LYS D 3  322 ? -27.268 64.026  58.634 1.00 59.83  ? 323 LYS C CA    1 
ATOM   9293  C  C     . LYS D 3  322 ? -26.077 64.400  57.771 1.00 63.74  ? 323 LYS C C     1 
ATOM   9294  O  O     . LYS D 3  322 ? -26.189 64.443  56.536 1.00 78.22  ? 323 LYS C O     1 
ATOM   9295  C  CB    . LYS D 3  322 ? -28.028 65.300  58.976 1.00 57.43  ? 323 LYS C CB    1 
ATOM   9296  C  CG    . LYS D 3  322 ? -29.454 65.126  59.425 1.00 58.81  ? 323 LYS C CG    1 
ATOM   9297  C  CD    . LYS D 3  322 ? -29.995 66.521  59.673 1.00 73.19  ? 323 LYS C CD    1 
ATOM   9298  C  CE    . LYS D 3  322 ? -30.873 66.674  60.881 1.00 84.01  ? 323 LYS C CE    1 
ATOM   9299  N  NZ    . LYS D 3  322 ? -31.022 68.148  61.052 1.00 84.76  ? 323 LYS C NZ    1 
ATOM   9300  N  N     . GLN D 3  323 ? -24.937 64.670  58.390 1.00 65.10  ? 324 GLN C N     1 
ATOM   9301  C  CA    . GLN D 3  323 ? -23.835 65.331  57.719 1.00 65.89  ? 324 GLN C CA    1 
ATOM   9302  C  C     . GLN D 3  323 ? -22.603 64.464  57.532 1.00 77.92  ? 324 GLN C C     1 
ATOM   9303  O  O     . GLN D 3  323 ? -21.626 64.951  56.953 1.00 82.88  ? 324 GLN C O     1 
ATOM   9304  C  CB    . GLN D 3  323 ? -23.462 66.591  58.496 1.00 75.85  ? 324 GLN C CB    1 
ATOM   9305  C  CG    . GLN D 3  323 ? -24.640 67.491  58.739 1.00 82.53  ? 324 GLN C CG    1 
ATOM   9306  C  CD    . GLN D 3  323 ? -24.247 68.719  59.514 1.00 83.64  ? 324 GLN C CD    1 
ATOM   9307  O  OE1   . GLN D 3  323 ? -24.790 68.991  60.592 1.00 95.29  ? 324 GLN C OE1   1 
ATOM   9308  N  NE2   . GLN D 3  323 ? -23.285 69.476  58.972 1.00 77.77  ? 324 GLN C NE2   1 
ATOM   9309  N  N     . THR D 3  324 ? -22.594 63.230  58.008 1.00 77.04  ? 325 THR C N     1 
ATOM   9310  C  CA    . THR D 3  324 ? -21.407 62.383  57.980 1.00 69.27  ? 325 THR C CA    1 
ATOM   9311  C  C     . THR D 3  324 ? -21.802 60.969  57.658 1.00 63.74  ? 325 THR C C     1 
ATOM   9312  O  O     . THR D 3  324 ? -22.987 60.598  57.792 1.00 62.58  ? 325 THR C O     1 
ATOM   9313  C  CB    . THR D 3  324 ? -20.639 62.455  59.316 1.00 70.25  ? 325 THR C CB    1 
ATOM   9314  O  OG1   . THR D 3  324 ? -21.300 61.686  60.322 1.00 63.06  ? 325 THR C OG1   1 
ATOM   9315  C  CG2   . THR D 3  324 ? -20.483 63.894  59.814 1.00 78.44  ? 325 THR C CG2   1 
ATOM   9316  N  N     . PRO D 3  325 ? -20.868 60.092  57.244 1.00 59.73  ? 326 PRO C N     1 
ATOM   9317  C  CA    . PRO D 3  325 ? -21.227 58.704  56.919 1.00 57.05  ? 326 PRO C CA    1 
ATOM   9318  C  C     . PRO D 3  325 ? -21.656 57.878  58.129 1.00 57.00  ? 326 PRO C C     1 
ATOM   9319  O  O     . PRO D 3  325 ? -21.999 56.703  57.960 1.00 63.45  ? 326 PRO C O     1 
ATOM   9320  C  CB    . PRO D 3  325 ? -19.969 58.135  56.273 1.00 53.44  ? 326 PRO C CB    1 
ATOM   9321  C  CG    . PRO D 3  325 ? -18.981 59.203  56.176 1.00 56.43  ? 326 PRO C CG    1 
ATOM   9322  C  CD    . PRO D 3  325 ? -19.463 60.419  56.902 1.00 58.38  ? 326 PRO C CD    1 
ATOM   9323  N  N     . LEU D 3  326 ? -21.683 58.474  59.326 1.00 56.95  ? 327 LEU C N     1 
ATOM   9324  C  CA    . LEU D 3  326 ? -22.185 57.847  60.549 1.00 53.91  ? 327 LEU C CA    1 
ATOM   9325  C  C     . LEU D 3  326 ? -23.594 57.239  60.387 1.00 58.74  ? 327 LEU C C     1 
ATOM   9326  O  O     . LEU D 3  326 ? -23.886 56.195  60.973 1.00 67.54  ? 327 LEU C O     1 
ATOM   9327  C  CB    . LEU D 3  326 ? -22.169 58.893  61.665 1.00 52.95  ? 327 LEU C CB    1 
ATOM   9328  C  CG    . LEU D 3  326 ? -21.831 58.554  63.115 1.00 57.05  ? 327 LEU C CG    1 
ATOM   9329  C  CD1   . LEU D 3  326 ? -20.553 57.830  63.225 1.00 58.97  ? 327 LEU C CD1   1 
ATOM   9330  C  CD2   . LEU D 3  326 ? -21.742 59.811  63.908 1.00 59.18  ? 327 LEU C CD2   1 
ATOM   9331  N  N     . GLN D 3  327 ? -24.504 57.882  59.652 1.00 57.66  ? 328 GLN C N     1 
ATOM   9332  C  CA    . GLN D 3  327 ? -25.667 57.194  59.070 1.00 54.61  ? 328 GLN C CA    1 
ATOM   9333  C  C     . GLN D 3  327 ? -25.430 57.115  57.568 1.00 56.00  ? 328 GLN C C     1 
ATOM   9334  O  O     . GLN D 3  327 ? -24.939 58.068  56.990 1.00 53.00  ? 328 GLN C O     1 
ATOM   9335  C  CB    . GLN D 3  327 ? -27.009 57.877  59.369 1.00 54.32  ? 328 GLN C CB    1 
ATOM   9336  C  CG    . GLN D 3  327 ? -28.156 57.343  58.514 1.00 68.22  ? 328 GLN C CG    1 
ATOM   9337  C  CD    . GLN D 3  327 ? -29.558 57.750  58.955 1.00 77.15  ? 328 GLN C CD    1 
ATOM   9338  O  OE1   . GLN D 3  327 ? -29.762 58.303  60.040 1.00 71.42  ? 328 GLN C OE1   1 
ATOM   9339  N  NE2   . GLN D 3  327 ? -30.535 57.482  58.094 1.00 80.02  ? 328 GLN C NE2   1 
ATOM   9340  N  N     . THR D 3  328 ? -25.700 55.960  56.940 1.00 58.24  ? 329 THR C N     1 
ATOM   9341  C  CA    . THR D 3  328 ? -25.356 55.678  55.531 1.00 59.15  ? 329 THR C CA    1 
ATOM   9342  C  C     . THR D 3  328 ? -26.397 54.717  54.959 1.00 63.48  ? 329 THR C C     1 
ATOM   9343  O  O     . THR D 3  328 ? -26.866 53.836  55.672 1.00 67.14  ? 329 THR C O     1 
ATOM   9344  C  CB    . THR D 3  328 ? -23.970 54.985  55.401 1.00 59.70  ? 329 THR C CB    1 
ATOM   9345  O  OG1   . THR D 3  328 ? -22.940 55.844  55.893 1.00 71.93  ? 329 THR C OG1   1 
ATOM   9346  C  CG2   . THR D 3  328 ? -23.654 54.621  53.968 1.00 60.01  ? 329 THR C CG2   1 
ATOM   9347  N  N     . SER D 3  329 ? -26.744 54.829  53.681 1.00 56.78  ? 330 SER C N     1 
ATOM   9348  C  CA    . SER D 3  329 ? -27.648 53.815  53.150 1.00 52.81  ? 330 SER C CA    1 
ATOM   9349  C  C     . SER D 3  329 ? -26.910 52.790  52.291 1.00 53.88  ? 330 SER C C     1 
ATOM   9350  O  O     . SER D 3  329 ? -25.817 53.046  51.765 1.00 65.68  ? 330 SER C O     1 
ATOM   9351  C  CB    . SER D 3  329 ? -28.808 54.419  52.371 1.00 54.18  ? 330 SER C CB    1 
ATOM   9352  O  OG    . SER D 3  329 ? -28.353 55.042  51.179 1.00 83.01  ? 330 SER C OG    1 
ATOM   9353  N  N     . PHE D 3  330 ? -27.537 51.616  52.157 1.00 49.65  ? 331 PHE C N     1 
ATOM   9354  C  CA    . PHE D 3  330 ? -27.029 50.530  51.326 1.00 46.18  ? 331 PHE C CA    1 
ATOM   9355  C  C     . PHE D 3  330 ? -28.063 50.293  50.222 1.00 56.08  ? 331 PHE C C     1 
ATOM   9356  O  O     . PHE D 3  330 ? -29.217 49.913  50.502 1.00 60.16  ? 331 PHE C O     1 
ATOM   9357  C  CB    . PHE D 3  330 ? -26.827 49.244  52.134 1.00 54.24  ? 331 PHE C CB    1 
ATOM   9358  C  CG    . PHE D 3  330 ? -26.268 48.103  51.323 1.00 58.18  ? 331 PHE C CG    1 
ATOM   9359  C  CD1   . PHE D 3  330 ? -27.092 47.374  50.488 1.00 53.90  ? 331 PHE C CD1   1 
ATOM   9360  C  CD2   . PHE D 3  330 ? -24.932 47.777  51.385 1.00 47.70  ? 331 PHE C CD2   1 
ATOM   9361  C  CE1   . PHE D 3  330 ? -26.594 46.346  49.732 1.00 58.75  ? 331 PHE C CE1   1 
ATOM   9362  C  CE2   . PHE D 3  330 ? -24.427 46.748  50.633 1.00 44.92  ? 331 PHE C CE2   1 
ATOM   9363  C  CZ    . PHE D 3  330 ? -25.256 46.032  49.799 1.00 58.96  ? 331 PHE C CZ    1 
ATOM   9364  N  N     . GLY D 3  331 ? -27.661 50.499  48.971 1.00 50.93  ? 332 GLY C N     1 
ATOM   9365  C  CA    . GLY D 3  331 ? -28.586 50.327  47.867 1.00 48.58  ? 332 GLY C CA    1 
ATOM   9366  C  C     . GLY D 3  331 ? -28.649 48.919  47.314 1.00 54.11  ? 332 GLY C C     1 
ATOM   9367  O  O     . GLY D 3  331 ? -27.779 48.532  46.529 1.00 55.31  ? 332 GLY C O     1 
ATOM   9368  N  N     . VAL D 3  332 ? -29.671 48.144  47.684 1.00 44.78  ? 333 VAL C N     1 
ATOM   9369  C  CA    . VAL D 3  332 ? -29.755 46.766  47.214 1.00 40.10  ? 333 VAL C CA    1 
ATOM   9370  C  C     . VAL D 3  332 ? -30.149 46.750  45.742 1.00 48.57  ? 333 VAL C C     1 
ATOM   9371  O  O     . VAL D 3  332 ? -31.115 47.402  45.322 1.00 57.57  ? 333 VAL C O     1 
ATOM   9372  C  CB    . VAL D 3  332 ? -30.749 45.944  48.048 1.00 36.41  ? 333 VAL C CB    1 
ATOM   9373  C  CG1   . VAL D 3  332 ? -30.741 44.523  47.563 1.00 49.56  ? 333 VAL C CG1   1 
ATOM   9374  C  CG2   . VAL D 3  332 ? -30.380 45.987  49.523 1.00 35.93  ? 333 VAL C CG2   1 
ATOM   9375  N  N     . ASN D 3  333 ? -29.395 45.969  44.958 1.00 52.19  ? 334 ASN C N     1 
ATOM   9376  C  CA    . ASN D 3  333 ? -29.627 45.687  43.541 1.00 53.24  ? 334 ASN C CA    1 
ATOM   9377  C  C     . ASN D 3  333 ? -29.106 44.258  43.360 1.00 53.96  ? 334 ASN C C     1 
ATOM   9378  O  O     . ASN D 3  333 ? -27.894 44.072  43.270 1.00 53.94  ? 334 ASN C O     1 
ATOM   9379  C  CB    . ASN D 3  333 ? -28.851 46.674  42.671 1.00 53.23  ? 334 ASN C CB    1 
ATOM   9380  C  CG    . ASN D 3  333 ? -29.234 46.616  41.202 1.00 65.47  ? 334 ASN C CG    1 
ATOM   9381  O  OD1   . ASN D 3  333 ? -30.402 46.492  40.873 1.00 69.89  ? 334 ASN C OD1   1 
ATOM   9382  N  ND2   . ASN D 3  333 ? -28.249 46.711  40.312 1.00 67.72  ? 334 ASN C ND2   1 
ATOM   9383  N  N     . MET D 3  334 ? -29.979 43.245  43.364 1.00 52.45  ? 335 MET C N     1 
ATOM   9384  C  CA    . MET D 3  334 ? -29.497 41.857  43.450 1.00 52.50  ? 335 MET C CA    1 
ATOM   9385  C  C     . MET D 3  334 ? -29.418 41.211  42.068 1.00 66.16  ? 335 MET C C     1 
ATOM   9386  O  O     . MET D 3  334 ? -30.253 40.399  41.696 1.00 74.97  ? 335 MET C O     1 
ATOM   9387  C  CB    . MET D 3  334 ? -30.379 41.009  44.358 1.00 49.85  ? 335 MET C CB    1 
ATOM   9388  C  CG    . MET D 3  334 ? -30.604 41.515  45.748 1.00 54.59  ? 335 MET C CG    1 
ATOM   9389  S  SD    . MET D 3  334 ? -30.771 40.168  46.926 1.00 54.04  ? 335 MET C SD    1 
ATOM   9390  C  CE    . MET D 3  334 ? -32.536 39.856  46.944 1.00 47.01  ? 335 MET C CE    1 
ATOM   9391  N  N     . ILE D 3  335 ? -28.348 41.501  41.329 1.00 75.55  ? 336 ILE C N     1 
ATOM   9392  C  CA    . ILE D 3  335 ? -28.144 40.905  40.015 1.00 68.91  ? 336 ILE C CA    1 
ATOM   9393  C  C     . ILE D 3  335 ? -27.028 39.868  40.110 1.00 62.43  ? 336 ILE C C     1 
ATOM   9394  O  O     . ILE D 3  335 ? -25.968 40.139  40.688 1.00 59.21  ? 336 ILE C O     1 
ATOM   9395  C  CB    . ILE D 3  335 ? -27.842 41.983  38.957 1.00 60.41  ? 336 ILE C CB    1 
ATOM   9396  C  CG1   . ILE D 3  335 ? -29.131 42.701  38.543 1.00 54.90  ? 336 ILE C CG1   1 
ATOM   9397  C  CG2   . ILE D 3  335 ? -27.217 41.371  37.727 1.00 60.06  ? 336 ILE C CG2   1 
ATOM   9398  C  CD1   . ILE D 3  335 ? -28.948 43.836  37.546 1.00 58.85  ? 336 ILE C CD1   1 
ATOM   9399  N  N     . ALA D 3  336 ? -27.280 38.668  39.564 1.00 55.12  ? 337 ALA C N     1 
ATOM   9400  C  CA    . ALA D 3  336 ? -26.337 37.557  39.601 1.00 52.02  ? 337 ALA C CA    1 
ATOM   9401  C  C     . ALA D 3  336 ? -26.467 36.752  38.304 1.00 68.96  ? 337 ALA C C     1 
ATOM   9402  O  O     . ALA D 3  336 ? -27.433 36.899  37.549 1.00 88.09  ? 337 ALA C O     1 
ATOM   9403  C  CB    . ALA D 3  336 ? -26.569 36.656  40.822 1.00 48.50  ? 337 ALA C CB    1 
ATOM   9404  N  N     . LEU D 3  337 ? -25.484 35.890  38.027 1.00 69.30  ? 338 LEU C N     1 
ATOM   9405  C  CA    . LEU D 3  337 ? -25.558 35.068  36.824 1.00 58.83  ? 338 LEU C CA    1 
ATOM   9406  C  C     . LEU D 3  337 ? -26.447 33.867  37.112 1.00 63.93  ? 338 LEU C C     1 
ATOM   9407  O  O     . LEU D 3  337 ? -26.194 33.099  38.051 1.00 68.91  ? 338 LEU C O     1 
ATOM   9408  C  CB    . LEU D 3  337 ? -24.172 34.637  36.349 1.00 57.69  ? 338 LEU C CB    1 
ATOM   9409  C  CG    . LEU D 3  337 ? -23.165 35.763  36.078 1.00 59.91  ? 338 LEU C CG    1 
ATOM   9410  C  CD1   . LEU D 3  337 ? -21.748 35.267  35.783 1.00 64.48  ? 338 LEU C CD1   1 
ATOM   9411  C  CD2   . LEU D 3  337 ? -23.624 36.634  34.940 1.00 65.71  ? 338 LEU C CD2   1 
ATOM   9412  N  N     . VAL D 3  338 ? -27.530 33.755  36.356 1.00 64.51  ? 339 VAL C N     1 
ATOM   9413  C  CA    . VAL D 3  338 ? -28.474 32.656  36.488 1.00 67.71  ? 339 VAL C CA    1 
ATOM   9414  C  C     . VAL D 3  338 ? -28.488 31.948  35.145 1.00 65.18  ? 339 VAL C C     1 
ATOM   9415  O  O     . VAL D 3  338 ? -28.918 32.523  34.134 1.00 75.42  ? 339 VAL C O     1 
ATOM   9416  C  CB    . VAL D 3  338 ? -29.877 33.126  36.883 1.00 63.41  ? 339 VAL C CB    1 
ATOM   9417  C  CG1   . VAL D 3  338 ? -30.818 31.945  36.885 1.00 66.69  ? 339 VAL C CG1   1 
ATOM   9418  C  CG2   . VAL D 3  338 ? -29.839 33.747  38.248 1.00 62.52  ? 339 VAL C CG2   1 
ATOM   9419  N  N     . ASN D 3  339 ? -27.998 30.716  35.133 1.00 59.19  ? 340 ASN C N     1 
ATOM   9420  C  CA    . ASN D 3  339 ? -27.789 29.968  33.908 1.00 61.12  ? 340 ASN C CA    1 
ATOM   9421  C  C     . ASN D 3  339 ? -26.898 30.750  32.934 1.00 71.25  ? 340 ASN C C     1 
ATOM   9422  O  O     . ASN D 3  339 ? -27.169 30.851  31.736 1.00 93.26  ? 340 ASN C O     1 
ATOM   9423  C  CB    . ASN D 3  339 ? -29.141 29.572  33.292 1.00 87.44  ? 340 ASN C CB    1 
ATOM   9424  C  CG    . ASN D 3  339 ? -29.905 28.560  34.167 1.00 106.46 ? 340 ASN C CG    1 
ATOM   9425  O  OD1   . ASN D 3  339 ? -29.296 27.637  34.728 1.00 122.03 ? 340 ASN C OD1   1 
ATOM   9426  N  ND2   . ASN D 3  339 ? -31.223 28.747  34.311 1.00 104.59 ? 340 ASN C ND2   1 
ATOM   9427  N  N     . GLY D 3  340 ? -25.811 31.308  33.478 1.00 67.88  ? 341 GLY C N     1 
ATOM   9428  C  CA    . GLY D 3  340 ? -24.786 31.989  32.714 1.00 71.51  ? 341 GLY C CA    1 
ATOM   9429  C  C     . GLY D 3  340 ? -25.133 33.372  32.208 1.00 74.80  ? 341 GLY C C     1 
ATOM   9430  O  O     . GLY D 3  340 ? -24.326 33.966  31.487 1.00 76.20  ? 341 GLY C O     1 
ATOM   9431  N  N     . ARG D 3  341 ? -26.300 33.912  32.547 1.00 72.19  ? 342 ARG C N     1 
ATOM   9432  C  CA    . ARG D 3  341 ? -26.628 35.257  32.108 1.00 71.82  ? 342 ARG C CA    1 
ATOM   9433  C  C     . ARG D 3  341 ? -27.192 36.103  33.246 1.00 69.82  ? 342 ARG C C     1 
ATOM   9434  O  O     . ARG D 3  341 ? -27.778 35.577  34.196 1.00 78.38  ? 342 ARG C O     1 
ATOM   9435  C  CB    . ARG D 3  341 ? -27.575 35.239  30.899 1.00 81.73  ? 342 ARG C CB    1 
ATOM   9436  C  CG    . ARG D 3  341 ? -28.932 34.596  31.032 1.00 95.12  ? 342 ARG C CG    1 
ATOM   9437  C  CD    . ARG D 3  341 ? -29.459 34.367  29.614 1.00 106.14 ? 342 ARG C CD    1 
ATOM   9438  N  NE    . ARG D 3  341 ? -28.831 33.189  29.016 1.00 119.12 ? 342 ARG C NE    1 
ATOM   9439  C  CZ    . ARG D 3  341 ? -28.871 32.864  27.726 1.00 125.89 ? 342 ARG C CZ    1 
ATOM   9440  N  NH1   . ARG D 3  341 ? -29.499 33.631  26.848 1.00 126.43 ? 342 ARG C NH1   1 
ATOM   9441  N  NH2   . ARG D 3  341 ? -28.270 31.755  27.318 1.00 124.48 ? 342 ARG C NH2   1 
ATOM   9442  N  N     . PRO D 3  342 ? -26.989 37.427  33.176 1.00 60.03  ? 343 PRO C N     1 
ATOM   9443  C  CA    . PRO D 3  342 ? -27.312 38.300  34.303 1.00 56.83  ? 343 PRO C CA    1 
ATOM   9444  C  C     . PRO D 3  342 ? -28.810 38.359  34.544 1.00 61.50  ? 343 PRO C C     1 
ATOM   9445  O  O     . PRO D 3  342 ? -29.598 38.426  33.601 1.00 73.94  ? 343 PRO C O     1 
ATOM   9446  C  CB    . PRO D 3  342 ? -26.782 39.658  33.844 1.00 50.88  ? 343 PRO C CB    1 
ATOM   9447  C  CG    . PRO D 3  342 ? -26.902 39.604  32.354 1.00 52.89  ? 343 PRO C CG    1 
ATOM   9448  C  CD    . PRO D 3  342 ? -26.580 38.197  31.989 1.00 55.34  ? 343 PRO C CD    1 
ATOM   9449  N  N     . LYS D 3  343 ? -29.208 38.383  35.821 1.00 59.00  ? 344 LYS C N     1 
ATOM   9450  C  CA    . LYS D 3  343 ? -30.630 38.440  36.133 1.00 65.92  ? 344 LYS C CA    1 
ATOM   9451  C  C     . LYS D 3  343 ? -30.866 39.130  37.475 1.00 62.68  ? 344 LYS C C     1 
ATOM   9452  O  O     . LYS D 3  343 ? -30.185 38.830  38.457 1.00 62.82  ? 344 LYS C O     1 
ATOM   9453  C  CB    . LYS D 3  343 ? -31.225 37.028  36.140 1.00 70.83  ? 344 LYS C CB    1 
ATOM   9454  C  CG    . LYS D 3  343 ? -32.730 36.963  35.946 1.00 83.27  ? 344 LYS C CG    1 
ATOM   9455  C  CD    . LYS D 3  343 ? -33.253 35.566  36.225 1.00 91.60  ? 344 LYS C CD    1 
ATOM   9456  C  CE    . LYS D 3  343 ? -34.758 35.455  35.967 1.00 99.47  ? 344 LYS C CE    1 
ATOM   9457  N  NZ    . LYS D 3  343 ? -35.619 36.262  36.884 1.00 99.19  ? 344 LYS C NZ    1 
ATOM   9458  N  N     . LEU D 3  344 ? -31.834 40.052  37.519 1.00 60.90  ? 345 LEU C N     1 
ATOM   9459  C  CA    . LEU D 3  344 ? -32.286 40.628  38.784 1.00 55.14  ? 345 LEU C CA    1 
ATOM   9460  C  C     . LEU D 3  344 ? -33.157 39.602  39.512 1.00 53.17  ? 345 LEU C C     1 
ATOM   9461  O  O     . LEU D 3  344 ? -34.145 39.114  38.950 1.00 58.41  ? 345 LEU C O     1 
ATOM   9462  C  CB    . LEU D 3  344 ? -33.069 41.926  38.540 1.00 49.50  ? 345 LEU C CB    1 
ATOM   9463  C  CG    . LEU D 3  344 ? -33.550 42.801  39.704 1.00 55.77  ? 345 LEU C CG    1 
ATOM   9464  C  CD1   . LEU D 3  344 ? -32.385 43.264  40.542 1.00 59.94  ? 345 LEU C CD1   1 
ATOM   9465  C  CD2   . LEU D 3  344 ? -34.366 43.983  39.211 1.00 55.83  ? 345 LEU C CD2   1 
ATOM   9466  N  N     . ILE D 3  345 ? -32.805 39.241  40.752 1.00 58.36  ? 346 ILE C N     1 
ATOM   9467  C  CA    . ILE D 3  345 ? -33.491 38.165  41.463 1.00 57.45  ? 346 ILE C CA    1 
ATOM   9468  C  C     . ILE D 3  345 ? -33.915 38.624  42.851 1.00 61.60  ? 346 ILE C C     1 
ATOM   9469  O  O     . ILE D 3  345 ? -33.189 39.356  43.532 1.00 60.12  ? 346 ILE C O     1 
ATOM   9470  C  CB    . ILE D 3  345 ? -32.616 36.894  41.587 1.00 52.35  ? 346 ILE C CB    1 
ATOM   9471  C  CG1   . ILE D 3  345 ? -31.313 37.208  42.336 1.00 54.85  ? 346 ILE C CG1   1 
ATOM   9472  C  CG2   . ILE D 3  345 ? -32.413 36.276  40.215 1.00 51.33  ? 346 ILE C CG2   1 
ATOM   9473  C  CD1   . ILE D 3  345 ? -30.295 36.092  42.362 1.00 55.89  ? 346 ILE C CD1   1 
ATOM   9474  N  N     . ASN D 3  346 ? -35.085 38.159  43.290 1.00 52.36  ? 347 ASN C N     1 
ATOM   9475  C  CA    . ASN D 3  346 ? -35.534 38.453  44.638 1.00 56.42  ? 347 ASN C CA    1 
ATOM   9476  C  C     . ASN D 3  346 ? -35.014 37.381  45.590 1.00 55.19  ? 347 ASN C C     1 
ATOM   9477  O  O     . ASN D 3  346 ? -34.294 36.464  45.202 1.00 75.92  ? 347 ASN C O     1 
ATOM   9478  C  CB    . ASN D 3  346 ? -37.052 38.598  44.695 1.00 74.19  ? 347 ASN C CB    1 
ATOM   9479  C  CG    . ASN D 3  346 ? -37.781 37.353  44.219 1.00 73.15  ? 347 ASN C CG    1 
ATOM   9480  O  OD1   . ASN D 3  346 ? -37.564 36.264  44.729 1.00 60.00  ? 347 ASN C OD1   1 
ATOM   9481  N  ND2   . ASN D 3  346 ? -38.675 37.518  43.274 1.00 71.19  ? 347 ASN C ND2   1 
ATOM   9482  N  N     . LEU D 3  347 ? -35.377 37.503  46.867 1.00 47.98  ? 348 LEU C N     1 
ATOM   9483  C  CA    . LEU D 3  347 ? -34.826 36.605  47.880 1.00 48.26  ? 348 LEU C CA    1 
ATOM   9484  C  C     . LEU D 3  347 ? -35.188 35.154  47.624 1.00 61.57  ? 348 LEU C C     1 
ATOM   9485  O  O     . LEU D 3  347 ? -34.496 34.244  48.103 1.00 74.77  ? 348 LEU C O     1 
ATOM   9486  C  CB    . LEU D 3  347 ? -35.317 36.988  49.275 1.00 45.71  ? 348 LEU C CB    1 
ATOM   9487  C  CG    . LEU D 3  347 ? -34.877 36.019  50.373 1.00 50.06  ? 348 LEU C CG    1 
ATOM   9488  C  CD1   . LEU D 3  347 ? -33.430 36.256  50.730 1.00 46.29  ? 348 LEU C CD1   1 
ATOM   9489  C  CD2   . LEU D 3  347 ? -35.771 36.089  51.573 1.00 52.18  ? 348 LEU C CD2   1 
ATOM   9490  N  N     . LYS D 3  348 ? -36.259 34.908  46.897 1.00 53.81  ? 349 LYS C N     1 
ATOM   9491  C  CA    . LYS D 3  348 ? -36.681 33.532  46.745 1.00 52.01  ? 349 LYS C CA    1 
ATOM   9492  C  C     . LYS D 3  348 ? -35.962 32.865  45.595 1.00 53.16  ? 349 LYS C C     1 
ATOM   9493  O  O     . LYS D 3  348 ? -35.607 31.687  45.686 1.00 62.06  ? 349 LYS C O     1 
ATOM   9494  C  CB    . LYS D 3  348 ? -38.188 33.462  46.543 1.00 59.45  ? 349 LYS C CB    1 
ATOM   9495  C  CG    . LYS D 3  348 ? -38.712 32.057  46.402 1.00 49.94  ? 349 LYS C CG    1 
ATOM   9496  C  CD    . LYS D 3  348 ? -40.174 32.017  46.744 1.00 57.17  ? 349 LYS C CD    1 
ATOM   9497  C  CE    . LYS D 3  348 ? -40.787 30.673  46.424 1.00 60.96  ? 349 LYS C CE    1 
ATOM   9498  N  NZ    . LYS D 3  348 ? -42.210 30.635  46.851 1.00 59.29  ? 349 LYS C NZ    1 
ATOM   9499  N  N     . GLU D 3  349 ? -35.744 33.602  44.513 1.00 52.34  ? 350 GLU C N     1 
ATOM   9500  C  CA    . GLU D 3  349 ? -35.006 33.041  43.395 1.00 59.09  ? 350 GLU C CA    1 
ATOM   9501  C  C     . GLU D 3  349 ? -33.584 32.721  43.808 1.00 69.96  ? 350 GLU C C     1 
ATOM   9502  O  O     . GLU D 3  349 ? -33.031 31.690  43.414 1.00 70.86  ? 350 GLU C O     1 
ATOM   9503  C  CB    . GLU D 3  349 ? -35.023 34.011  42.224 1.00 55.00  ? 350 GLU C CB    1 
ATOM   9504  C  CG    . GLU D 3  349 ? -36.318 34.759  42.091 1.00 84.60  ? 350 GLU C CG    1 
ATOM   9505  C  CD    . GLU D 3  349 ? -36.509 35.299  40.691 1.00 96.22  ? 350 GLU C CD    1 
ATOM   9506  O  OE1   . GLU D 3  349 ? -35.935 34.705  39.745 1.00 103.74 ? 350 GLU C OE1   1 
ATOM   9507  O  OE2   . GLU D 3  349 ? -37.227 36.314  40.540 1.00 88.46  ? 350 GLU C OE2   1 
ATOM   9508  N  N     . ALA D 3  350 ? -32.981 33.598  44.608 1.00 60.49  ? 351 ALA C N     1 
ATOM   9509  C  CA    . ALA D 3  350 ? -31.668 33.340  45.181 1.00 52.36  ? 351 ALA C CA    1 
ATOM   9510  C  C     . ALA D 3  350 ? -31.635 31.997  45.888 1.00 57.56  ? 351 ALA C C     1 
ATOM   9511  O  O     . ALA D 3  350 ? -30.711 31.201  45.695 1.00 55.64  ? 351 ALA C O     1 
ATOM   9512  C  CB    . ALA D 3  350 ? -31.300 34.460  46.156 1.00 50.50  ? 351 ALA C CB    1 
ATOM   9513  N  N     . LEU D 3  351 ? -32.624 31.745  46.744 1.00 55.84  ? 352 LEU C N     1 
ATOM   9514  C  CA    . LEU D 3  351 ? -32.626 30.520  47.540 1.00 58.64  ? 352 LEU C CA    1 
ATOM   9515  C  C     . LEU D 3  351 ? -33.062 29.322  46.718 1.00 63.05  ? 352 LEU C C     1 
ATOM   9516  O  O     . LEU D 3  351 ? -32.559 28.208  46.913 1.00 60.49  ? 352 LEU C O     1 
ATOM   9517  C  CB    . LEU D 3  351 ? -33.541 30.667  48.752 1.00 58.43  ? 352 LEU C CB    1 
ATOM   9518  C  CG    . LEU D 3  351 ? -33.119 31.672  49.812 1.00 54.28  ? 352 LEU C CG    1 
ATOM   9519  C  CD1   . LEU D 3  351 ? -34.207 31.787  50.863 1.00 56.99  ? 352 LEU C CD1   1 
ATOM   9520  C  CD2   . LEU D 3  351 ? -31.810 31.248  50.434 1.00 47.54  ? 352 LEU C CD2   1 
ATOM   9521  N  N     . VAL D 3  352 ? -34.023 29.523  45.823 1.00 64.08  ? 353 VAL C N     1 
ATOM   9522  C  CA    . VAL D 3  352 ? -34.435 28.447  44.934 1.00 55.64  ? 353 VAL C CA    1 
ATOM   9523  C  C     . VAL D 3  352 ? -33.245 27.949  44.138 1.00 64.30  ? 353 VAL C C     1 
ATOM   9524  O  O     . VAL D 3  352 ? -32.970 26.747  44.074 1.00 76.82  ? 353 VAL C O     1 
ATOM   9525  C  CB    . VAL D 3  352 ? -35.555 28.924  43.998 1.00 50.50  ? 353 VAL C CB    1 
ATOM   9526  C  CG1   . VAL D 3  352 ? -35.586 28.036  42.781 1.00 60.35  ? 353 VAL C CG1   1 
ATOM   9527  C  CG2   . VAL D 3  352 ? -36.867 28.896  44.716 1.00 61.36  ? 353 VAL C CG2   1 
ATOM   9528  N  N     . HIS D 3  353 ? -32.520 28.877  43.519 1.00 53.71  ? 354 HIS C N     1 
ATOM   9529  C  CA    . HIS D 3  353 ? -31.435 28.512  42.619 1.00 54.76  ? 354 HIS C CA    1 
ATOM   9530  C  C     . HIS D 3  353 ? -30.277 27.890  43.367 1.00 63.83  ? 354 HIS C C     1 
ATOM   9531  O  O     . HIS D 3  353 ? -29.550 27.060  42.811 1.00 69.17  ? 354 HIS C O     1 
ATOM   9532  C  CB    . HIS D 3  353 ? -30.965 29.745  41.865 1.00 53.16  ? 354 HIS C CB    1 
ATOM   9533  C  CG    . HIS D 3  353 ? -31.895 30.173  40.785 1.00 54.14  ? 354 HIS C CG    1 
ATOM   9534  N  ND1   . HIS D 3  353 ? -32.592 29.275  40.012 1.00 63.70  ? 354 HIS C ND1   1 
ATOM   9535  C  CD2   . HIS D 3  353 ? -32.240 31.403  40.343 1.00 58.24  ? 354 HIS C CD2   1 
ATOM   9536  C  CE1   . HIS D 3  353 ? -33.322 29.933  39.131 1.00 80.16  ? 354 HIS C CE1   1 
ATOM   9537  N  NE2   . HIS D 3  353 ? -33.127 31.227  39.312 1.00 66.99  ? 354 HIS C NE2   1 
ATOM   9538  N  N     . TYR D 3  354 ? -30.073 28.311  44.608 1.00 58.21  ? 355 TYR C N     1 
ATOM   9539  C  CA    . TYR D 3  354 ? -29.117 27.641  45.475 1.00 52.66  ? 355 TYR C CA    1 
ATOM   9540  C  C     . TYR D 3  354 ? -29.577 26.233  45.817 1.00 59.43  ? 355 TYR C C     1 
ATOM   9541  O  O     . TYR D 3  354 ? -28.821 25.271  45.667 1.00 69.68  ? 355 TYR C O     1 
ATOM   9542  C  CB    . TYR D 3  354 ? -28.899 28.448  46.750 1.00 53.38  ? 355 TYR C CB    1 
ATOM   9543  C  CG    . TYR D 3  354 ? -27.992 27.707  47.670 1.00 53.50  ? 355 TYR C CG    1 
ATOM   9544  C  CD1   . TYR D 3  354 ? -26.659 27.548  47.347 1.00 56.45  ? 355 TYR C CD1   1 
ATOM   9545  C  CD2   . TYR D 3  354 ? -28.468 27.122  48.829 1.00 58.72  ? 355 TYR C CD2   1 
ATOM   9546  C  CE1   . TYR D 3  354 ? -25.816 26.859  48.161 1.00 59.92  ? 355 TYR C CE1   1 
ATOM   9547  C  CE2   . TYR D 3  354 ? -27.632 26.427  49.651 1.00 60.80  ? 355 TYR C CE2   1 
ATOM   9548  C  CZ    . TYR D 3  354 ? -26.305 26.302  49.314 1.00 61.36  ? 355 TYR C CZ    1 
ATOM   9549  O  OH    . TYR D 3  354 ? -25.457 25.604  50.132 1.00 66.70  ? 355 TYR C OH    1 
ATOM   9550  N  N     . LEU D 3  355 ? -30.806 26.094  46.312 1.00 55.81  ? 356 LEU C N     1 
ATOM   9551  C  CA    . LEU D 3  355 ? -31.250 24.776  46.763 1.00 62.29  ? 356 LEU C CA    1 
ATOM   9552  C  C     . LEU D 3  355 ? -31.241 23.761  45.627 1.00 67.37  ? 356 LEU C C     1 
ATOM   9553  O  O     . LEU D 3  355 ? -30.967 22.574  45.853 1.00 74.58  ? 356 LEU C O     1 
ATOM   9554  C  CB    . LEU D 3  355 ? -32.632 24.862  47.403 1.00 55.03  ? 356 LEU C CB    1 
ATOM   9555  C  CG    . LEU D 3  355 ? -33.262 23.532  47.814 1.00 54.14  ? 356 LEU C CG    1 
ATOM   9556  C  CD1   . LEU D 3  355 ? -32.376 22.742  48.784 1.00 51.16  ? 356 LEU C CD1   1 
ATOM   9557  C  CD2   . LEU D 3  355 ? -34.614 23.799  48.417 1.00 58.10  ? 356 LEU C CD2   1 
ATOM   9558  N  N     A GLU D 3  356 ? -31.540 24.196  44.403 0.50 66.51  ? 357 GLU C N     1 
ATOM   9559  N  N     B GLU D 3  356 ? -31.530 24.209  44.407 0.50 66.81  ? 357 GLU C N     1 
ATOM   9560  C  CA    A GLU D 3  356 ? -31.459 23.305  43.247 0.50 66.60  ? 357 GLU C CA    1 
ATOM   9561  C  CA    B GLU D 3  356 ? -31.459 23.316  43.259 0.50 60.40  ? 357 GLU C CA    1 
ATOM   9562  C  C     A GLU D 3  356 ? -30.010 22.924  42.958 0.50 60.61  ? 357 GLU C C     1 
ATOM   9563  C  C     B GLU D 3  356 ? -30.016 22.934  42.947 0.50 58.07  ? 357 GLU C C     1 
ATOM   9564  O  O     A GLU D 3  356 ? -29.716 21.763  42.640 0.50 62.05  ? 357 GLU C O     1 
ATOM   9565  O  O     B GLU D 3  356 ? -29.742 21.794  42.546 0.50 64.00  ? 357 GLU C O     1 
ATOM   9566  C  CB    A GLU D 3  356 ? -32.153 23.985  42.052 0.50 65.46  ? 357 GLU C CB    1 
ATOM   9567  C  CB    B GLU D 3  356 ? -32.130 23.967  42.053 0.50 63.30  ? 357 GLU C CB    1 
ATOM   9568  C  CG    A GLU D 3  356 ? -31.832 23.564  40.565 0.50 70.93  ? 357 GLU C CG    1 
ATOM   9569  C  CG    B GLU D 3  356 ? -33.671 23.859  42.029 0.50 64.48  ? 357 GLU C CG    1 
ATOM   9570  C  CD    A GLU D 3  356 ? -32.281 22.158  40.154 0.50 76.59  ? 357 GLU C CD    1 
ATOM   9571  C  CD    B GLU D 3  356 ? -34.222 22.492  42.475 0.50 60.19  ? 357 GLU C CD    1 
ATOM   9572  O  OE1   A GLU D 3  356 ? -33.183 22.015  39.293 0.50 77.71  ? 357 GLU C OE1   1 
ATOM   9573  O  OE1   B GLU D 3  356 ? -33.706 21.432  42.046 0.50 47.79  ? 357 GLU C OE1   1 
ATOM   9574  O  OE2   A GLU D 3  356 ? -31.694 21.186  40.666 0.50 76.21  ? 357 GLU C OE2   1 
ATOM   9575  O  OE2   B GLU D 3  356 ? -35.190 22.487  43.264 0.50 68.65  ? 357 GLU C OE2   1 
ATOM   9576  N  N     . HIS D 3  357 ? -29.081 23.869  43.144 1.00 51.81  ? 358 HIS C N     1 
ATOM   9577  C  CA    . HIS D 3  357 ? -27.654 23.548  43.046 1.00 55.43  ? 358 HIS C CA    1 
ATOM   9578  C  C     . HIS D 3  357 ? -27.248 22.482  44.058 1.00 58.57  ? 358 HIS C C     1 
ATOM   9579  O  O     . HIS D 3  357 ? -26.465 21.584  43.741 1.00 62.60  ? 358 HIS C O     1 
ATOM   9580  C  CB    . HIS D 3  357 ? -26.821 24.819  43.240 1.00 51.95  ? 358 HIS C CB    1 
ATOM   9581  C  CG    . HIS D 3  357 ? -25.332 24.625  43.128 1.00 54.09  ? 358 HIS C CG    1 
ATOM   9582  N  ND1   . HIS D 3  357 ? -24.728 24.097  42.009 1.00 59.06  ? 358 HIS C ND1   1 
ATOM   9583  C  CD2   . HIS D 3  357 ? -24.326 24.927  43.987 1.00 55.64  ? 358 HIS C CD2   1 
ATOM   9584  C  CE1   . HIS D 3  357 ? -23.418 24.072  42.185 1.00 57.56  ? 358 HIS C CE1   1 
ATOM   9585  N  NE2   . HIS D 3  357 ? -23.147 24.569  43.378 1.00 54.37  ? 358 HIS C NE2   1 
ATOM   9586  N  N     . GLN D 3  358 ? -27.755 22.562  45.283 1.00 60.16  ? 359 GLN C N     1 
ATOM   9587  C  CA    . GLN D 3  358 ? -27.350 21.578  46.280 1.00 60.63  ? 359 GLN C CA    1 
ATOM   9588  C  C     . GLN D 3  358 ? -27.904 20.201  45.955 1.00 67.75  ? 359 GLN C C     1 
ATOM   9589  O  O     . GLN D 3  358 ? -27.249 19.191  46.224 1.00 72.27  ? 359 GLN C O     1 
ATOM   9590  C  CB    . GLN D 3  358 ? -27.777 22.010  47.671 1.00 57.24  ? 359 GLN C CB    1 
ATOM   9591  C  CG    . GLN D 3  358 ? -27.046 23.233  48.156 1.00 67.54  ? 359 GLN C CG    1 
ATOM   9592  C  CD    . GLN D 3  358 ? -25.543 23.083  48.079 1.00 81.67  ? 359 GLN C CD    1 
ATOM   9593  O  OE1   . GLN D 3  358 ? -24.925 22.450  48.935 1.00 94.36  ? 359 GLN C OE1   1 
ATOM   9594  N  NE2   . GLN D 3  358 ? -24.946 23.661  47.051 1.00 71.46  ? 359 GLN C NE2   1 
ATOM   9595  N  N     . LYS D 3  359 ? -29.099 20.130  45.376 1.00 66.53  ? 360 LYS C N     1 
ATOM   9596  C  CA    . LYS D 3  359 ? -29.643 18.831  44.993 1.00 64.99  ? 360 LYS C CA    1 
ATOM   9597  C  C     . LYS D 3  359 ? -28.801 18.186  43.896 1.00 60.52  ? 360 LYS C C     1 
ATOM   9598  O  O     . LYS D 3  359 ? -28.449 17.003  43.986 1.00 74.64  ? 360 LYS C O     1 
ATOM   9599  C  CB    . LYS D 3  359 ? -31.115 18.992  44.605 1.00 63.83  ? 360 LYS C CB    1 
ATOM   9600  C  CG    . LYS D 3  359 ? -31.991 19.160  45.855 1.00 61.34  ? 360 LYS C CG    1 
ATOM   9601  C  CD    . LYS D 3  359 ? -33.276 19.941  45.613 1.00 67.10  ? 360 LYS C CD    1 
ATOM   9602  C  CE    . LYS D 3  359 ? -34.341 19.098  44.966 1.00 83.11  ? 360 LYS C CE    1 
ATOM   9603  N  NZ    . LYS D 3  359 ? -35.514 19.929  44.580 1.00 82.99  ? 360 LYS C NZ    1 
ATOM   9604  N  N     . THR D 3  360 ? -28.419 18.969  42.884 1.00 56.35  ? 361 THR C N     1 
ATOM   9605  C  CA    . THR D 3  360 ? -27.508 18.496  41.843 1.00 59.80  ? 361 THR C CA    1 
ATOM   9606  C  C     . THR D 3  360 ? -26.182 18.027  42.423 1.00 59.62  ? 361 THR C C     1 
ATOM   9607  O  O     . THR D 3  360 ? -25.671 16.973  42.040 1.00 70.17  ? 361 THR C O     1 
ATOM   9608  C  CB    . THR D 3  360 ? -27.246 19.605  40.814 1.00 67.47  ? 361 THR C CB    1 
ATOM   9609  O  OG1   . THR D 3  360 ? -28.458 19.968  40.155 1.00 79.78  ? 361 THR C OG1   1 
ATOM   9610  C  CG2   . THR D 3  360 ? -26.237 19.153  39.780 1.00 68.38  ? 361 THR C CG2   1 
ATOM   9611  N  N     . VAL D 3  361 ? -25.565 18.835  43.291 1.00 57.27  ? 362 VAL C N     1 
ATOM   9612  C  CA    . VAL D 3  361 ? -24.249 18.480  43.836 1.00 58.48  ? 362 VAL C CA    1 
ATOM   9613  C  C     . VAL D 3  361 ? -24.311 17.143  44.549 1.00 66.76  ? 362 VAL C C     1 
ATOM   9614  O  O     . VAL D 3  361 ? -23.410 16.303  44.421 1.00 59.34  ? 362 VAL C O     1 
ATOM   9615  C  CB    . VAL D 3  361 ? -23.738 19.572  44.794 1.00 55.97  ? 362 VAL C CB    1 
ATOM   9616  C  CG1   . VAL D 3  361 ? -22.827 18.941  45.846 1.00 64.88  ? 362 VAL C CG1   1 
ATOM   9617  C  CG2   . VAL D 3  361 ? -22.995 20.623  44.043 1.00 64.90  ? 362 VAL C CG2   1 
ATOM   9618  N  N     . VAL D 3  362 ? -25.357 16.942  45.341 1.00 68.44  ? 363 VAL C N     1 
ATOM   9619  C  CA    . VAL D 3  362 ? -25.425 15.765  46.199 1.00 78.02  ? 363 VAL C CA    1 
ATOM   9620  C  C     . VAL D 3  362 ? -25.774 14.528  45.391 1.00 75.41  ? 363 VAL C C     1 
ATOM   9621  O  O     . VAL D 3  362 ? -25.270 13.433  45.658 1.00 69.82  ? 363 VAL C O     1 
ATOM   9622  C  CB    . VAL D 3  362 ? -26.431 15.994  47.342 1.00 69.26  ? 363 VAL C CB    1 
ATOM   9623  C  CG1   . VAL D 3  362 ? -26.932 14.675  47.833 1.00 78.50  ? 363 VAL C CG1   1 
ATOM   9624  C  CG2   . VAL D 3  362 ? -25.774 16.714  48.487 1.00 62.64  ? 363 VAL C CG2   1 
ATOM   9625  N  N     . ARG D 3  363 ? -26.669 14.670  44.418 1.00 62.00  ? 364 ARG C N     1 
ATOM   9626  C  CA    . ARG D 3  363 ? -26.978 13.550  43.540 1.00 70.60  ? 364 ARG C CA    1 
ATOM   9627  C  C     . ARG D 3  363 ? -25.747 13.122  42.772 1.00 73.74  ? 364 ARG C C     1 
ATOM   9628  O  O     . ARG D 3  363 ? -25.389 11.940  42.752 1.00 84.54  ? 364 ARG C O     1 
ATOM   9629  C  CB    . ARG D 3  363 ? -28.091 13.920  42.571 1.00 71.80  ? 364 ARG C CB    1 
ATOM   9630  C  CG    . ARG D 3  363 ? -28.442 12.788  41.618 1.00 77.33  ? 364 ARG C CG    1 
ATOM   9631  C  CD    . ARG D 3  363 ? -29.644 13.111  40.758 1.00 90.23  ? 364 ARG C CD    1 
ATOM   9632  N  NE    . ARG D 3  363 ? -30.765 13.592  41.557 1.00 96.92  ? 364 ARG C NE    1 
ATOM   9633  C  CZ    . ARG D 3  363 ? -31.146 14.861  41.602 1.00 111.69 ? 364 ARG C CZ    1 
ATOM   9634  N  NH1   . ARG D 3  363 ? -32.177 15.226  42.346 1.00 125.76 ? 364 ARG C NH1   1 
ATOM   9635  N  NH2   . ARG D 3  363 ? -30.503 15.766  40.884 1.00 102.17 ? 364 ARG C NH2   1 
ATOM   9636  N  N     . ARG D 3  364 ? -25.091 14.082  42.121 1.00 68.97  ? 365 ARG C N     1 
ATOM   9637  C  CA    . ARG D 3  364 ? -23.936 13.771  41.291 1.00 76.85  ? 365 ARG C CA    1 
ATOM   9638  C  C     . ARG D 3  364 ? -22.833 13.114  42.085 1.00 81.57  ? 365 ARG C C     1 
ATOM   9639  O  O     . ARG D 3  364 ? -22.029 12.354  41.526 1.00 91.58  ? 365 ARG C O     1 
ATOM   9640  C  CB    . ARG D 3  364 ? -23.379 15.043  40.653 1.00 71.69  ? 365 ARG C CB    1 
ATOM   9641  C  CG    . ARG D 3  364 ? -24.217 15.596  39.527 1.00 65.36  ? 365 ARG C CG    1 
ATOM   9642  C  CD    . ARG D 3  364 ? -23.598 16.850  38.960 1.00 63.08  ? 365 ARG C CD    1 
ATOM   9643  N  NE    . ARG D 3  364 ? -22.276 16.613  38.389 1.00 65.02  ? 365 ARG C NE    1 
ATOM   9644  C  CZ    . ARG D 3  364 ? -21.794 17.272  37.340 1.00 75.24  ? 365 ARG C CZ    1 
ATOM   9645  N  NH1   . ARG D 3  364 ? -22.537 18.200  36.740 1.00 93.63  ? 365 ARG C NH1   1 
ATOM   9646  N  NH2   . ARG D 3  364 ? -20.579 16.994  36.879 1.00 68.34  ? 365 ARG C NH2   1 
ATOM   9647  N  N     . ARG D 3  365 ? -22.766 13.415  43.373 1.00 75.75  ? 366 ARG C N     1 
ATOM   9648  C  CA    . ARG D 3  365 ? -21.721 12.859  44.208 1.00 73.28  ? 366 ARG C CA    1 
ATOM   9649  C  C     . ARG D 3  365 ? -22.045 11.432  44.577 1.00 86.59  ? 366 ARG C C     1 
ATOM   9650  O  O     . ARG D 3  365 ? -21.168 10.564  44.560 1.00 100.70 ? 366 ARG C O     1 
ATOM   9651  C  CB    . ARG D 3  365 ? -21.557 13.694  45.463 1.00 55.29  ? 366 ARG C CB    1 
ATOM   9652  C  CG    . ARG D 3  365 ? -20.867 12.949  46.558 1.00 55.16  ? 366 ARG C CG    1 
ATOM   9653  C  CD    . ARG D 3  365 ? -20.869 13.729  47.832 1.00 59.17  ? 366 ARG C CD    1 
ATOM   9654  N  NE    . ARG D 3  365 ? -22.153 13.665  48.519 1.00 58.95  ? 366 ARG C NE    1 
ATOM   9655  C  CZ    . ARG D 3  365 ? -22.340 14.077  49.769 1.00 59.77  ? 366 ARG C CZ    1 
ATOM   9656  N  NH1   . ARG D 3  365 ? -21.318 14.577  50.457 1.00 68.93  ? 366 ARG C NH1   1 
ATOM   9657  N  NH2   . ARG D 3  365 ? -23.540 13.989  50.333 1.00 59.30  ? 366 ARG C NH2   1 
ATOM   9658  N  N     . THR D 3  366 ? -23.306 11.187  44.923 1.00 73.40  ? 367 THR C N     1 
ATOM   9659  C  CA    . THR D 3  366 ? -23.735 9.834   45.230 1.00 61.24  ? 367 THR C CA    1 
ATOM   9660  C  C     . THR D 3  366 ? -23.524 8.934   44.028 1.00 62.19  ? 367 THR C C     1 
ATOM   9661  O  O     . THR D 3  366 ? -22.925 7.861   44.149 1.00 82.37  ? 367 THR C O     1 
ATOM   9662  C  CB    . THR D 3  366 ? -25.192 9.839   45.701 1.00 63.80  ? 367 THR C CB    1 
ATOM   9663  O  OG1   . THR D 3  366 ? -25.340 10.723  46.817 1.00 60.07  ? 367 THR C OG1   1 
ATOM   9664  C  CG2   . THR D 3  366 ? -25.608 8.470   46.138 1.00 65.25  ? 367 THR C CG2   1 
ATOM   9665  N  N     . GLN D 3  367 ? -23.929 9.398   42.847 1.00 62.53  ? 368 GLN C N     1 
ATOM   9666  C  CA    . GLN D 3  367 ? -23.730 8.617   41.630 1.00 69.07  ? 368 GLN C CA    1 
ATOM   9667  C  C     . GLN D 3  367 ? -22.265 8.275   41.406 1.00 71.37  ? 368 GLN C C     1 
ATOM   9668  O  O     . GLN D 3  367 ? -21.933 7.184   40.918 1.00 68.77  ? 368 GLN C O     1 
ATOM   9669  C  CB    . GLN D 3  367 ? -24.271 9.380   40.425 1.00 75.19  ? 368 GLN C CB    1 
ATOM   9670  C  CG    . GLN D 3  367 ? -25.750 9.617   40.509 1.00 76.32  ? 368 GLN C CG    1 
ATOM   9671  C  CD    . GLN D 3  367 ? -26.260 10.363  39.319 1.00 81.85  ? 368 GLN C CD    1 
ATOM   9672  O  OE1   . GLN D 3  367 ? -25.496 11.033  38.620 1.00 92.78  ? 368 GLN C OE1   1 
ATOM   9673  N  NE2   . GLN D 3  367 ? -27.557 10.249  39.063 1.00 80.05  ? 368 GLN C NE2   1 
ATOM   9674  N  N     . TYR D 3  368 ? -21.374 9.202   41.732 1.00 73.41  ? 369 TYR C N     1 
ATOM   9675  C  CA    . TYR D 3  368 ? -19.955 8.963   41.514 1.00 72.78  ? 369 TYR C CA    1 
ATOM   9676  C  C     . TYR D 3  368 ? -19.388 8.053   42.580 1.00 81.50  ? 369 TYR C C     1 
ATOM   9677  O  O     . TYR D 3  368 ? -18.419 7.325   42.335 1.00 91.70  ? 369 TYR C O     1 
ATOM   9678  C  CB    . TYR D 3  368 ? -19.195 10.288  41.498 1.00 68.14  ? 369 TYR C CB    1 
ATOM   9679  C  CG    . TYR D 3  368 ? -17.719 10.182  41.832 1.00 69.12  ? 369 TYR C CG    1 
ATOM   9680  C  CD1   . TYR D 3  368 ? -17.283 9.998   43.149 1.00 72.33  ? 369 TYR C CD1   1 
ATOM   9681  C  CD2   . TYR D 3  368 ? -16.763 10.314  40.837 1.00 68.28  ? 369 TYR C CD2   1 
ATOM   9682  C  CE1   . TYR D 3  368 ? -15.959 9.894   43.444 1.00 71.98  ? 369 TYR C CE1   1 
ATOM   9683  C  CE2   . TYR D 3  368 ? -15.426 10.235  41.130 1.00 69.54  ? 369 TYR C CE2   1 
ATOM   9684  C  CZ    . TYR D 3  368 ? -15.030 10.024  42.433 1.00 72.99  ? 369 TYR C CZ    1 
ATOM   9685  O  OH    . TYR D 3  368 ? -13.689 9.941   42.725 1.00 78.16  ? 369 TYR C OH    1 
ATOM   9686  N  N     . ASN D 3  369 ? -19.916 8.160   43.789 1.00 91.56  ? 370 ASN C N     1 
ATOM   9687  C  CA    . ASN D 3  369 ? -19.569 7.192   44.811 1.00 92.12  ? 370 ASN C CA    1 
ATOM   9688  C  C     . ASN D 3  369 ? -19.991 5.803   44.378 1.00 86.98  ? 370 ASN C C     1 
ATOM   9689  O  O     . ASN D 3  369 ? -19.223 4.845   44.515 1.00 88.43  ? 370 ASN C O     1 
ATOM   9690  C  CB    . ASN D 3  369 ? -20.215 7.579   46.134 1.00 96.15  ? 370 ASN C CB    1 
ATOM   9691  C  CG    . ASN D 3  369 ? -19.453 8.673   46.842 1.00 90.11  ? 370 ASN C CG    1 
ATOM   9692  O  OD1   . ASN D 3  369 ? -18.221 8.721   46.789 1.00 88.95  ? 370 ASN C OD1   1 
ATOM   9693  N  ND2   . ASN D 3  369 ? -20.179 9.559   47.515 1.00 86.96  ? 370 ASN C ND2   1 
ATOM   9694  N  N     . LEU D 3  370 ? -21.201 5.683   43.830 1.00 83.53  ? 371 LEU C N     1 
ATOM   9695  C  CA    . LEU D 3  370 ? -21.672 4.409   43.302 1.00 85.41  ? 371 LEU C CA    1 
ATOM   9696  C  C     . LEU D 3  370 ? -20.694 3.856   42.281 1.00 77.93  ? 371 LEU C C     1 
ATOM   9697  O  O     . LEU D 3  370 ? -20.141 2.765   42.451 1.00 73.22  ? 371 LEU C O     1 
ATOM   9698  C  CB    . LEU D 3  370 ? -23.053 4.587   42.669 1.00 82.25  ? 371 LEU C CB    1 
ATOM   9699  C  CG    . LEU D 3  370 ? -23.907 3.331   42.715 1.00 66.59  ? 371 LEU C CG    1 
ATOM   9700  C  CD1   . LEU D 3  370 ? -23.895 2.784   44.122 1.00 64.17  ? 371 LEU C CD1   1 
ATOM   9701  C  CD2   . LEU D 3  370 ? -25.315 3.675   42.294 1.00 66.49  ? 371 LEU C CD2   1 
ATOM   9702  N  N     . ARG D 3  371 ? -20.454 4.626   41.222 1.00 80.31  ? 372 ARG C N     1 
ATOM   9703  C  CA    . ARG D 3  371 ? -19.694 4.141   40.075 1.00 83.92  ? 372 ARG C CA    1 
ATOM   9704  C  C     . ARG D 3  371 ? -18.329 3.611   40.476 1.00 90.75  ? 372 ARG C C     1 
ATOM   9705  O  O     . ARG D 3  371 ? -17.877 2.583   39.957 1.00 97.22  ? 372 ARG C O     1 
ATOM   9706  C  CB    . ARG D 3  371 ? -19.530 5.260   39.049 1.00 83.98  ? 372 ARG C CB    1 
ATOM   9707  C  CG    . ARG D 3  371 ? -20.802 5.634   38.362 1.00 93.61  ? 372 ARG C CG    1 
ATOM   9708  C  CD    . ARG D 3  371 ? -20.513 6.458   37.133 1.00 86.48  ? 372 ARG C CD    1 
ATOM   9709  N  NE    . ARG D 3  371 ? -19.368 7.347   37.322 1.00 87.15  ? 372 ARG C NE    1 
ATOM   9710  C  CZ    . ARG D 3  371 ? -19.459 8.657   37.530 1.00 87.81  ? 372 ARG C CZ    1 
ATOM   9711  N  NH1   . ARG D 3  371 ? -20.651 9.240   37.576 1.00 72.47  ? 372 ARG C NH1   1 
ATOM   9712  N  NH2   . ARG D 3  371 ? -18.355 9.384   37.684 1.00 86.76  ? 372 ARG C NH2   1 
ATOM   9713  N  N     . LYS D 3  372 ? -17.637 4.316   41.359 1.00 88.27  ? 373 LYS C N     1 
ATOM   9714  C  CA    . LYS D 3  372 ? -16.313 3.872   41.770 1.00 80.56  ? 373 LYS C CA    1 
ATOM   9715  C  C     . LYS D 3  372 ? -16.383 2.795   42.835 1.00 76.19  ? 373 LYS C C     1 
ATOM   9716  O  O     . LYS D 3  372 ? -15.384 2.108   43.073 1.00 77.95  ? 373 LYS C O     1 
ATOM   9717  C  CB    . LYS D 3  372 ? -15.490 5.055   42.268 1.00 74.55  ? 373 LYS C CB    1 
ATOM   9718  C  CG    . LYS D 3  372 ? -15.526 6.238   41.320 1.00 83.63  ? 373 LYS C CG    1 
ATOM   9719  C  CD    . LYS D 3  372 ? -14.329 6.255   40.377 1.00 97.92  ? 373 LYS C CD    1 
ATOM   9720  C  CE    . LYS D 3  372 ? -14.727 6.794   39.007 1.00 96.86  ? 373 LYS C CE    1 
ATOM   9721  N  NZ    . LYS D 3  372 ? -13.624 7.584   38.391 1.00 92.93  ? 373 LYS C NZ    1 
ATOM   9722  N  N     . ALA D 3  373 ? -17.529 2.647   43.493 1.00 71.28  ? 374 ALA C N     1 
ATOM   9723  C  CA    . ALA D 3  373 ? -17.731 1.513   44.384 1.00 69.58  ? 374 ALA C CA    1 
ATOM   9724  C  C     . ALA D 3  373 ? -17.938 0.246   43.573 1.00 69.90  ? 374 ALA C C     1 
ATOM   9725  O  O     . ALA D 3  373 ? -17.166 -0.714  43.679 1.00 87.06  ? 374 ALA C O     1 
ATOM   9726  C  CB    . ALA D 3  373 ? -18.926 1.766   45.307 1.00 68.77  ? 374 ALA C CB    1 
ATOM   9727  N  N     . LYS D 3  374 ? -18.984 0.250   42.749 1.00 63.69  ? 375 LYS C N     1 
ATOM   9728  C  CA    . LYS D 3  374 ? -19.257 -0.834  41.817 1.00 58.62  ? 375 LYS C CA    1 
ATOM   9729  C  C     . LYS D 3  374 ? -18.010 -1.245  41.050 1.00 59.16  ? 375 LYS C C     1 
ATOM   9730  O  O     . LYS D 3  374 ? -17.701 -2.434  40.935 1.00 53.32  ? 375 LYS C O     1 
ATOM   9731  C  CB    . LYS D 3  374 ? -20.371 -0.403  40.863 1.00 57.77  ? 375 LYS C CB    1 
ATOM   9732  C  CG    . LYS D 3  374 ? -21.724 -0.342  41.522 1.00 60.50  ? 375 LYS C CG    1 
ATOM   9733  C  CD    . LYS D 3  374 ? -22.790 -0.814  40.562 1.00 71.04  ? 375 LYS C CD    1 
ATOM   9734  C  CE    . LYS D 3  374 ? -24.178 -0.525  41.088 1.00 85.50  ? 375 LYS C CE    1 
ATOM   9735  N  NZ    . LYS D 3  374 ? -25.090 -0.100  39.992 1.00 94.27  ? 375 LYS C NZ    1 
ATOM   9736  N  N     . ASP D 3  375 ? -17.292 -0.270  40.499 1.00 61.08  ? 376 ASP C N     1 
ATOM   9737  C  CA    . ASP D 3  375 ? -15.987 -0.535  39.899 1.00 65.26  ? 376 ASP C CA    1 
ATOM   9738  C  C     . ASP D 3  375 ? -15.097 -1.351  40.824 1.00 66.06  ? 376 ASP C C     1 
ATOM   9739  O  O     . ASP D 3  375 ? -14.498 -2.351  40.412 1.00 77.82  ? 376 ASP C O     1 
ATOM   9740  C  CB    . ASP D 3  375 ? -15.295 0.785   39.551 1.00 72.86  ? 376 ASP C CB    1 
ATOM   9741  C  CG    . ASP D 3  375 ? -15.622 1.268   38.166 1.00 82.44  ? 376 ASP C CG    1 
ATOM   9742  O  OD1   . ASP D 3  375 ? -16.512 0.670   37.522 1.00 89.16  ? 376 ASP C OD1   1 
ATOM   9743  O  OD2   . ASP D 3  375 ? -14.983 2.246   37.725 1.00 84.22  ? 376 ASP C OD2   1 
ATOM   9744  N  N     . ARG D 3  376 ? -14.969 -0.921  42.072 1.00 61.48  ? 377 ARG C N     1 
ATOM   9745  C  CA    . ARG D 3  376 ? -14.056 -1.603  42.984 1.00 60.62  ? 377 ARG C CA    1 
ATOM   9746  C  C     . ARG D 3  376 ? -14.600 -2.938  43.465 1.00 70.45  ? 377 ARG C C     1 
ATOM   9747  O  O     . ARG D 3  376 ? -13.821 -3.873  43.686 1.00 73.25  ? 377 ARG C O     1 
ATOM   9748  C  CB    . ARG D 3  376 ? -13.739 -0.722  44.187 1.00 57.13  ? 377 ARG C CB    1 
ATOM   9749  C  CG    . ARG D 3  376 ? -12.944 -1.420  45.260 1.00 52.64  ? 377 ARG C CG    1 
ATOM   9750  C  CD    . ARG D 3  376 ? -11.493 -1.512  44.891 1.00 54.38  ? 377 ARG C CD    1 
ATOM   9751  N  NE    . ARG D 3  376 ? -10.722 -2.065  45.993 1.00 63.56  ? 377 ARG C NE    1 
ATOM   9752  C  CZ    . ARG D 3  376 ? -9.485  -2.533  45.874 1.00 73.42  ? 377 ARG C CZ    1 
ATOM   9753  N  NH1   . ARG D 3  376 ? -8.878  -2.520  44.693 1.00 69.67  ? 377 ARG C NH1   1 
ATOM   9754  N  NH2   . ARG D 3  376 ? -8.857  -3.023  46.934 1.00 76.95  ? 377 ARG C NH2   1 
ATOM   9755  N  N     . ALA D 3  377 ? -15.913 -3.043  43.666 1.00 70.39  ? 378 ALA C N     1 
ATOM   9756  C  CA    . ALA D 3  377 ? -16.519 -4.341  43.925 1.00 63.06  ? 378 ALA C CA    1 
ATOM   9757  C  C     . ALA D 3  377 ? -16.106 -5.333  42.848 1.00 69.39  ? 378 ALA C C     1 
ATOM   9758  O  O     . ALA D 3  377 ? -15.703 -6.464  43.139 1.00 70.42  ? 378 ALA C O     1 
ATOM   9759  C  CB    . ALA D 3  377 ? -18.041 -4.219  43.972 1.00 55.58  ? 378 ALA C CB    1 
ATOM   9760  N  N     . HIS D 3  378 ? -16.190 -4.910  41.587 1.00 68.43  ? 379 HIS C N     1 
ATOM   9761  C  CA    . HIS D 3  378 ? -15.798 -5.761  40.470 1.00 61.26  ? 379 HIS C CA    1 
ATOM   9762  C  C     . HIS D 3  378 ? -14.359 -6.245  40.624 1.00 72.89  ? 379 HIS C C     1 
ATOM   9763  O  O     . HIS D 3  378 ? -14.073 -7.431  40.446 1.00 89.24  ? 379 HIS C O     1 
ATOM   9764  C  CB    . HIS D 3  378 ? -15.980 -5.003  39.159 1.00 65.59  ? 379 HIS C CB    1 
ATOM   9765  C  CG    . HIS D 3  378 ? -15.824 -5.863  37.946 1.00 62.54  ? 379 HIS C CG    1 
ATOM   9766  N  ND1   . HIS D 3  378 ? -16.784 -6.769  37.550 1.00 63.84  ? 379 HIS C ND1   1 
ATOM   9767  C  CD2   . HIS D 3  378 ? -14.820 -5.955  37.039 1.00 64.03  ? 379 HIS C CD2   1 
ATOM   9768  C  CE1   . HIS D 3  378 ? -16.382 -7.375  36.446 1.00 76.09  ? 379 HIS C CE1   1 
ATOM   9769  N  NE2   . HIS D 3  378 ? -15.194 -6.901  36.116 1.00 69.36  ? 379 HIS C NE2   1 
ATOM   9770  N  N     . ILE D 3  379 ? -13.436 -5.347  40.972 1.00 70.40  ? 380 ILE C N     1 
ATOM   9771  C  CA    . ILE D 3  379 ? -12.040 -5.751  41.103 1.00 56.97  ? 380 ILE C CA    1 
ATOM   9772  C  C     . ILE D 3  379 ? -11.864 -6.706  42.278 1.00 61.99  ? 380 ILE C C     1 
ATOM   9773  O  O     . ILE D 3  379 ? -11.079 -7.655  42.202 1.00 67.25  ? 380 ILE C O     1 
ATOM   9774  C  CB    . ILE D 3  379 ? -11.126 -4.517  41.228 1.00 51.76  ? 380 ILE C CB    1 
ATOM   9775  C  CG1   . ILE D 3  379 ? -11.201 -3.662  39.958 1.00 53.06  ? 380 ILE C CG1   1 
ATOM   9776  C  CG2   . ILE D 3  379 ? -9.687  -4.958  41.447 1.00 49.67  ? 380 ILE C CG2   1 
ATOM   9777  C  CD1   . ILE D 3  379 ? -10.755 -4.401  38.713 1.00 47.73  ? 380 ILE C CD1   1 
ATOM   9778  N  N     . LEU D 3  380 ? -12.581 -6.473  43.383 1.00 62.59  ? 381 LEU C N     1 
ATOM   9779  C  CA    . LEU D 3  380 ? -12.461 -7.369  44.534 1.00 61.28  ? 381 LEU C CA    1 
ATOM   9780  C  C     . LEU D 3  380 ? -13.067 -8.740  44.248 1.00 66.94  ? 381 LEU C C     1 
ATOM   9781  O  O     . LEU D 3  380 ? -12.596 -9.755  44.781 1.00 75.64  ? 381 LEU C O     1 
ATOM   9782  C  CB    . LEU D 3  380 ? -13.102 -6.751  45.776 1.00 62.04  ? 381 LEU C CB    1 
ATOM   9783  C  CG    . LEU D 3  380 ? -12.357 -5.548  46.364 1.00 70.70  ? 381 LEU C CG    1 
ATOM   9784  C  CD1   . LEU D 3  380 ? -13.163 -4.839  47.451 1.00 66.55  ? 381 LEU C CD1   1 
ATOM   9785  C  CD2   . LEU D 3  380 ? -11.010 -5.998  46.903 1.00 77.81  ? 381 LEU C CD2   1 
ATOM   9786  N  N     . GLU D 3  381 ? -14.116 -8.795  43.428 1.00 64.61  ? 382 GLU C N     1 
ATOM   9787  C  CA    . GLU D 3  381 ? -14.636 -10.089 43.014 1.00 68.56  ? 382 GLU C CA    1 
ATOM   9788  C  C     . GLU D 3  381 ? -13.582 -10.889 42.263 1.00 68.24  ? 382 GLU C C     1 
ATOM   9789  O  O     . GLU D 3  381 ? -13.436 -12.093 42.481 1.00 75.81  ? 382 GLU C O     1 
ATOM   9790  C  CB    . GLU D 3  381 ? -15.895 -9.889  42.184 1.00 64.37  ? 382 GLU C CB    1 
ATOM   9791  C  CG    . GLU D 3  381 ? -17.040 -9.537  43.072 1.00 63.74  ? 382 GLU C CG    1 
ATOM   9792  C  CD    . GLU D 3  381 ? -18.205 -8.936  42.359 1.00 71.58  ? 382 GLU C CD    1 
ATOM   9793  O  OE1   . GLU D 3  381 ? -18.210 -8.932  41.112 1.00 78.69  ? 382 GLU C OE1   1 
ATOM   9794  O  OE2   . GLU D 3  381 ? -19.119 -8.463  43.060 1.00 70.29  ? 382 GLU C OE2   1 
ATOM   9795  N  N     . GLY D 3  382 ? -12.823 -10.236 41.389 1.00 62.86  ? 383 GLY C N     1 
ATOM   9796  C  CA    . GLY D 3  382 ? -11.723 -10.923 40.732 1.00 64.64  ? 383 GLY C CA    1 
ATOM   9797  C  C     . GLY D 3  382 ? -10.698 -11.459 41.714 1.00 67.41  ? 383 GLY C C     1 
ATOM   9798  O  O     . GLY D 3  382 ? -10.324 -12.632 41.663 1.00 68.24  ? 383 GLY C O     1 
ATOM   9799  N  N     . LEU D 3  383 ? -10.247 -10.610 42.640 1.00 66.71  ? 384 LEU C N     1 
ATOM   9800  C  CA    . LEU D 3  383 ? -9.214  -11.025 43.585 1.00 62.84  ? 384 LEU C CA    1 
ATOM   9801  C  C     . LEU D 3  383 ? -9.694  -12.163 44.483 1.00 65.34  ? 384 LEU C C     1 
ATOM   9802  O  O     . LEU D 3  383 ? -8.918  -13.063 44.843 1.00 71.70  ? 384 LEU C O     1 
ATOM   9803  C  CB    . LEU D 3  383 ? -8.745  -9.818  44.402 1.00 62.56  ? 384 LEU C CB    1 
ATOM   9804  C  CG    . LEU D 3  383 ? -8.142  -8.604  43.679 1.00 61.95  ? 384 LEU C CG    1 
ATOM   9805  C  CD1   . LEU D 3  383 ? -7.666  -7.567  44.669 1.00 66.68  ? 384 LEU C CD1   1 
ATOM   9806  C  CD2   . LEU D 3  383 ? -7.020  -8.998  42.751 1.00 63.99  ? 384 LEU C CD2   1 
ATOM   9807  N  N     . ARG D 3  384 ? -10.979 -12.162 44.826 1.00 58.86  ? 385 ARG C N     1 
ATOM   9808  C  CA    . ARG D 3  384 ? -11.547 -13.264 45.599 1.00 63.61  ? 385 ARG C CA    1 
ATOM   9809  C  C     . ARG D 3  384 ? -11.594 -14.562 44.802 1.00 64.76  ? 385 ARG C C     1 
ATOM   9810  O  O     . ARG D 3  384 ? -11.334 -15.635 45.351 1.00 67.15  ? 385 ARG C O     1 
ATOM   9811  C  CB    . ARG D 3  384 ? -12.956 -12.904 46.086 1.00 63.01  ? 385 ARG C CB    1 
ATOM   9812  C  CG    . ARG D 3  384 ? -13.010 -11.924 47.241 1.00 61.83  ? 385 ARG C CG    1 
ATOM   9813  C  CD    . ARG D 3  384 ? -14.336 -11.204 47.231 1.00 65.57  ? 385 ARG C CD    1 
ATOM   9814  N  NE    . ARG D 3  384 ? -15.380 -11.830 48.045 1.00 63.55  ? 385 ARG C NE    1 
ATOM   9815  C  CZ    . ARG D 3  384 ? -16.469 -12.414 47.552 1.00 64.72  ? 385 ARG C CZ    1 
ATOM   9816  N  NH1   . ARG D 3  384 ? -16.665 -12.485 46.244 1.00 61.90  ? 385 ARG C NH1   1 
ATOM   9817  N  NH2   . ARG D 3  384 ? -17.369 -12.929 48.374 1.00 75.36  ? 385 ARG C NH2   1 
ATOM   9818  N  N     . ILE D 3  385 ? -11.944 -14.504 43.519 1.00 65.13  ? 386 ILE C N     1 
ATOM   9819  C  CA    . ILE D 3  385 ? -11.843 -15.701 42.681 1.00 62.97  ? 386 ILE C CA    1 
ATOM   9820  C  C     . ILE D 3  385 ? -10.410 -16.207 42.680 1.00 61.66  ? 386 ILE C C     1 
ATOM   9821  O  O     . ILE D 3  385 ? -10.154 -17.394 42.924 1.00 57.85  ? 386 ILE C O     1 
ATOM   9822  C  CB    . ILE D 3  385 ? -12.365 -15.433 41.250 1.00 58.40  ? 386 ILE C CB    1 
ATOM   9823  C  CG1   . ILE D 3  385 ? -13.876 -15.236 41.257 1.00 55.77  ? 386 ILE C CG1   1 
ATOM   9824  C  CG2   . ILE D 3  385 ? -12.041 -16.600 40.336 1.00 55.35  ? 386 ILE C CG2   1 
ATOM   9825  C  CD1   . ILE D 3  385 ? -14.412 -14.484 40.065 1.00 55.77  ? 386 ILE C CD1   1 
ATOM   9826  N  N     . ALA D 3  386 ? -9.455  -15.305 42.440 1.00 57.76  ? 387 ALA C N     1 
ATOM   9827  C  CA    . ALA D 3  386 ? -8.051  -15.709 42.472 1.00 61.86  ? 387 ALA C CA    1 
ATOM   9828  C  C     . ALA D 3  386 ? -7.691  -16.360 43.803 1.00 64.25  ? 387 ALA C C     1 
ATOM   9829  O  O     . ALA D 3  386 ? -7.093  -17.441 43.839 1.00 71.87  ? 387 ALA C O     1 
ATOM   9830  C  CB    . ALA D 3  386 ? -7.150  -14.512 42.189 1.00 64.48  ? 387 ALA C CB    1 
ATOM   9831  N  N     . LEU D 3  387 ? -8.070  -15.730 44.915 1.00 61.38  ? 388 LEU C N     1 
ATOM   9832  C  CA    . LEU D 3  387 ? -7.675  -16.254 46.223 1.00 58.69  ? 388 LEU C CA    1 
ATOM   9833  C  C     . LEU D 3  387 ? -8.328  -17.597 46.519 1.00 59.70  ? 388 LEU C C     1 
ATOM   9834  O  O     . LEU D 3  387 ? -7.716  -18.459 47.163 1.00 76.26  ? 388 LEU C O     1 
ATOM   9835  C  CB    . LEU D 3  387 ? -8.006  -15.238 47.318 1.00 58.75  ? 388 LEU C CB    1 
ATOM   9836  C  CG    . LEU D 3  387 ? -7.139  -13.979 47.320 1.00 58.27  ? 388 LEU C CG    1 
ATOM   9837  C  CD1   . LEU D 3  387 ? -7.584  -13.063 48.424 1.00 59.94  ? 388 LEU C CD1   1 
ATOM   9838  C  CD2   . LEU D 3  387 ? -5.671  -14.337 47.477 1.00 53.36  ? 388 LEU C CD2   1 
ATOM   9839  N  N     . ASP D 3  388 ? -9.553  -17.797 46.037 1.00 58.52  ? 389 ASP C N     1 
ATOM   9840  C  CA    . ASP D 3  388 ? -10.269 -19.060 46.206 1.00 65.40  ? 389 ASP C CA    1 
ATOM   9841  C  C     . ASP D 3  388 ? -9.608  -20.211 45.464 1.00 63.58  ? 389 ASP C C     1 
ATOM   9842  O  O     . ASP D 3  388 ? -9.787  -21.377 45.846 1.00 65.96  ? 389 ASP C O     1 
ATOM   9843  C  CB    . ASP D 3  388 ? -11.697 -18.921 45.696 1.00 64.81  ? 389 ASP C CB    1 
ATOM   9844  C  CG    . ASP D 3  388 ? -12.599 -18.257 46.676 1.00 72.35  ? 389 ASP C CG    1 
ATOM   9845  O  OD1   . ASP D 3  388 ? -12.263 -18.222 47.875 1.00 72.16  ? 389 ASP C OD1   1 
ATOM   9846  O  OD2   . ASP D 3  388 ? -13.668 -17.784 46.243 1.00 79.62  ? 389 ASP C OD2   1 
ATOM   9847  N  N     . HIS D 3  389 ? -8.908  -19.928 44.371 1.00 56.76  ? 390 HIS C N     1 
ATOM   9848  C  CA    . HIS D 3  389 ? -8.268  -20.961 43.550 1.00 56.67  ? 390 HIS C CA    1 
ATOM   9849  C  C     . HIS D 3  389 ? -6.843  -20.572 43.210 1.00 60.60  ? 390 HIS C C     1 
ATOM   9850  O  O     . HIS D 3  389 ? -6.421  -20.604 42.054 1.00 60.42  ? 390 HIS C O     1 
ATOM   9851  C  CB    . HIS D 3  389 ? -9.025  -21.217 42.244 1.00 57.12  ? 390 HIS C CB    1 
ATOM   9852  C  CG    . HIS D 3  389 ? -10.507 -21.310 42.395 1.00 73.84  ? 390 HIS C CG    1 
ATOM   9853  N  ND1   . HIS D 3  389 ? -11.114 -22.130 43.316 1.00 78.36  ? 390 HIS C ND1   1 
ATOM   9854  C  CD2   . HIS D 3  389 ? -11.507 -20.694 41.725 1.00 79.72  ? 390 HIS C CD2   1 
ATOM   9855  C  CE1   . HIS D 3  389 ? -12.426 -22.009 43.215 1.00 75.35  ? 390 HIS C CE1   1 
ATOM   9856  N  NE2   . HIS D 3  389 ? -12.691 -21.145 42.254 1.00 72.66  ? 390 HIS C NE2   1 
ATOM   9857  N  N     . ILE D 3  390 ? -6.068  -20.202 44.224 1.00 59.62  ? 391 ILE C N     1 
ATOM   9858  C  CA    . ILE D 3  390 ? -4.795  -19.534 43.973 1.00 56.65  ? 391 ILE C CA    1 
ATOM   9859  C  C     . ILE D 3  390 ? -3.819  -20.466 43.265 1.00 58.93  ? 391 ILE C C     1 
ATOM   9860  O  O     . ILE D 3  390 ? -3.039  -20.020 42.410 1.00 53.92  ? 391 ILE C O     1 
ATOM   9861  C  CB    . ILE D 3  390 ? -4.234  -18.922 45.283 1.00 54.05  ? 391 ILE C CB    1 
ATOM   9862  C  CG1   . ILE D 3  390 ? -3.055  -17.999 45.007 1.00 60.54  ? 391 ILE C CG1   1 
ATOM   9863  C  CG2   . ILE D 3  390 ? -3.865  -19.979 46.278 1.00 48.66  ? 391 ILE C CG2   1 
ATOM   9864  C  CD1   . ILE D 3  390 ? -3.418  -16.869 44.084 1.00 67.02  ? 391 ILE C CD1   1 
ATOM   9865  N  N     . ASP D 3  391 ? -3.876  -21.769 43.548 1.00 65.91  ? 392 ASP C N     1 
ATOM   9866  C  CA    . ASP D 3  391 ? -2.871  -22.663 42.973 1.00 70.22  ? 392 ASP C CA    1 
ATOM   9867  C  C     . ASP D 3  391 ? -3.009  -22.761 41.450 1.00 74.32  ? 392 ASP C C     1 
ATOM   9868  O  O     . ASP D 3  391 ? -2.013  -22.711 40.715 1.00 78.39  ? 392 ASP C O     1 
ATOM   9869  C  CB    . ASP D 3  391 ? -2.961  -24.042 43.632 1.00 76.18  ? 392 ASP C CB    1 
ATOM   9870  C  CG    . ASP D 3  391 ? -2.085  -24.159 44.859 1.00 102.69 ? 392 ASP C CG    1 
ATOM   9871  O  OD1   . ASP D 3  391 ? -0.993  -23.564 44.838 1.00 108.06 ? 392 ASP C OD1   1 
ATOM   9872  O  OD2   . ASP D 3  391 ? -2.486  -24.809 45.852 1.00 112.46 ? 392 ASP C OD2   1 
ATOM   9873  N  N     . GLU D 3  392 ? -4.241  -22.855 40.960 1.00 70.08  ? 393 GLU C N     1 
ATOM   9874  C  CA    . GLU D 3  392 ? -4.504  -22.876 39.520 1.00 66.41  ? 393 GLU C CA    1 
ATOM   9875  C  C     . GLU D 3  392 ? -4.125  -21.567 38.854 1.00 69.96  ? 393 GLU C C     1 
ATOM   9876  O  O     . GLU D 3  392 ? -3.657  -21.556 37.699 1.00 72.99  ? 393 GLU C O     1 
ATOM   9877  C  CB    . GLU D 3  392 ? -5.984  -23.125 39.260 1.00 65.45  ? 393 GLU C CB    1 
ATOM   9878  C  CG    . GLU D 3  392 ? -6.434  -24.504 39.512 1.00 64.86  ? 393 GLU C CG    1 
ATOM   9879  C  CD    . GLU D 3  392 ? -7.876  -24.649 39.129 1.00 69.79  ? 393 GLU C CD    1 
ATOM   9880  O  OE1   . GLU D 3  392 ? -8.725  -24.394 40.001 1.00 61.62  ? 393 GLU C OE1   1 
ATOM   9881  O  OE2   . GLU D 3  392 ? -8.165  -24.953 37.951 1.00 81.56  ? 393 GLU C OE2   1 
ATOM   9882  N  N     . ILE D 3  393 ? -4.423  -20.453 39.532 1.00 65.34  ? 394 ILE C N     1 
ATOM   9883  C  CA    . ILE D 3  393 ? -4.108  -19.134 38.993 1.00 70.29  ? 394 ILE C CA    1 
ATOM   9884  C  C     . ILE D 3  393 ? -2.617  -19.009 38.761 1.00 70.37  ? 394 ILE C C     1 
ATOM   9885  O  O     . ILE D 3  393 ? -2.171  -18.536 37.709 1.00 62.16  ? 394 ILE C O     1 
ATOM   9886  C  CB    . ILE D 3  393 ? -4.590  -18.039 39.955 1.00 66.88  ? 394 ILE C CB    1 
ATOM   9887  C  CG1   . ILE D 3  393 ? -6.122  -18.000 40.076 1.00 62.06  ? 394 ILE C CG1   1 
ATOM   9888  C  CG2   . ILE D 3  393 ? -3.977  -16.693 39.558 1.00 59.94  ? 394 ILE C CG2   1 
ATOM   9889  C  CD1   . ILE D 3  393 ? -6.810  -17.109 39.089 1.00 58.51  ? 394 ILE C CD1   1 
ATOM   9890  N  N     . ILE D 3  394 ? -1.821  -19.415 39.761 1.00 67.93  ? 395 ILE C N     1 
ATOM   9891  C  CA    . ILE D 3  394 ? -0.365  -19.345 39.625 1.00 66.29  ? 395 ILE C CA    1 
ATOM   9892  C  C     . ILE D 3  394 ? 0.094   -20.202 38.454 1.00 71.59  ? 395 ILE C C     1 
ATOM   9893  O  O     . ILE D 3  394 ? 0.933   -19.787 37.653 1.00 78.64  ? 395 ILE C O     1 
ATOM   9894  C  CB    . ILE D 3  394 ? 0.332   -19.779 40.922 1.00 72.50  ? 395 ILE C CB    1 
ATOM   9895  C  CG1   . ILE D 3  394 ? -0.121  -18.959 42.126 1.00 76.64  ? 395 ILE C CG1   1 
ATOM   9896  C  CG2   . ILE D 3  394 ? 1.801   -19.550 40.773 1.00 82.10  ? 395 ILE C CG2   1 
ATOM   9897  C  CD1   . ILE D 3  394 ? 0.120   -17.499 41.959 1.00 80.53  ? 395 ILE C CD1   1 
ATOM   9898  N  N     . SER D 3  395 ? -0.439  -21.424 38.352 1.00 77.00  ? 396 SER C N     1 
ATOM   9899  C  CA    . SER D 3  395 ? -0.069  -22.331 37.265 1.00 76.23  ? 396 SER C CA    1 
ATOM   9900  C  C     . SER D 3  395 ? -0.382  -21.730 35.907 1.00 81.99  ? 396 SER C C     1 
ATOM   9901  O  O     . SER D 3  395 ? 0.420   -21.818 34.969 1.00 87.03  ? 396 SER C O     1 
ATOM   9902  C  CB    . SER D 3  395 ? -0.811  -23.659 37.417 1.00 72.14  ? 396 SER C CB    1 
ATOM   9903  O  OG    . SER D 3  395 ? -0.306  -24.391 38.510 1.00 97.43  ? 396 SER C OG    1 
ATOM   9904  N  N     . THR D 3  396 ? -1.588  -21.181 35.766 1.00 76.55  ? 397 THR C N     1 
ATOM   9905  C  CA    . THR D 3  396 ? -1.979  -20.525 34.527 1.00 66.71  ? 397 THR C CA    1 
ATOM   9906  C  C     . THR D 3  396 ? -0.996  -19.427 34.139 1.00 66.40  ? 397 THR C C     1 
ATOM   9907  O  O     . THR D 3  396 ? -0.630  -19.297 32.971 1.00 68.64  ? 397 THR C O     1 
ATOM   9908  C  CB    . THR D 3  396 ? -3.385  -19.952 34.673 1.00 65.40  ? 397 THR C CB    1 
ATOM   9909  O  OG1   . THR D 3  396 ? -4.319  -20.999 34.993 1.00 66.94  ? 397 THR C OG1   1 
ATOM   9910  C  CG2   . THR D 3  396 ? -3.806  -19.267 33.392 1.00 56.18  ? 397 THR C CG2   1 
ATOM   9911  N  N     . ILE D 3  397 ? -0.554  -18.627 35.103 1.00 68.16  ? 398 ILE C N     1 
ATOM   9912  C  CA    . ILE D 3  397 ? 0.403   -17.552 34.817 1.00 68.08  ? 398 ILE C CA    1 
ATOM   9913  C  C     . ILE D 3  397 ? 1.761   -18.129 34.430 1.00 72.84  ? 398 ILE C C     1 
ATOM   9914  O  O     . ILE D 3  397 ? 2.367   -17.713 33.435 1.00 77.25  ? 398 ILE C O     1 
ATOM   9915  C  CB    . ILE D 3  397 ? 0.503   -16.565 36.004 1.00 59.73  ? 398 ILE C CB    1 
ATOM   9916  C  CG1   . ILE D 3  397 ? -0.772  -15.722 36.074 1.00 56.01  ? 398 ILE C CG1   1 
ATOM   9917  C  CG2   . ILE D 3  397 ? 1.709   -15.648 35.842 1.00 66.79  ? 398 ILE C CG2   1 
ATOM   9918  C  CD1   . ILE D 3  397 ? -1.020  -15.058 37.414 1.00 53.63  ? 398 ILE C CD1   1 
ATOM   9919  N  N     . ARG D 3  398 ? 2.261   -19.099 35.200 1.00 62.75  ? 399 ARG C N     1 
ATOM   9920  C  CA    . ARG D 3  398 ? 3.599   -19.621 34.930 1.00 60.61  ? 399 ARG C CA    1 
ATOM   9921  C  C     . ARG D 3  398 ? 3.690   -20.331 33.589 1.00 64.86  ? 399 ARG C C     1 
ATOM   9922  O  O     . ARG D 3  398 ? 4.772   -20.399 32.997 1.00 62.96  ? 399 ARG C O     1 
ATOM   9923  C  CB    . ARG D 3  398 ? 4.029   -20.570 36.034 1.00 55.30  ? 399 ARG C CB    1 
ATOM   9924  C  CG    . ARG D 3  398 ? 4.234   -19.932 37.355 1.00 55.28  ? 399 ARG C CG    1 
ATOM   9925  C  CD    . ARG D 3  398 ? 4.581   -21.015 38.294 1.00 70.04  ? 399 ARG C CD    1 
ATOM   9926  N  NE    . ARG D 3  398 ? 5.861   -21.618 37.951 1.00 75.29  ? 399 ARG C NE    1 
ATOM   9927  C  CZ    . ARG D 3  398 ? 6.229   -22.809 38.391 1.00 75.13  ? 399 ARG C CZ    1 
ATOM   9928  N  NH1   . ARG D 3  398 ? 7.409   -23.311 38.057 1.00 89.44  ? 399 ARG C NH1   1 
ATOM   9929  N  NH2   . ARG D 3  398 ? 5.396   -23.493 39.160 1.00 59.19  ? 399 ARG C NH2   1 
ATOM   9930  N  N     A GLU D 3  399 ? 2.574   -20.889 33.112 0.50 70.43  ? 400 GLU C N     1 
ATOM   9931  N  N     B GLU D 3  399 ? 2.579   -20.865 33.106 0.50 70.24  ? 400 GLU C N     1 
ATOM   9932  C  CA    A GLU D 3  399 ? 2.556   -21.608 31.841 0.50 69.90  ? 400 GLU C CA    1 
ATOM   9933  C  CA    B GLU D 3  399 ? 2.528   -21.593 31.850 0.50 74.95  ? 400 GLU C CA    1 
ATOM   9934  C  C     A GLU D 3  399 ? 2.594   -20.659 30.649 0.50 70.76  ? 400 GLU C C     1 
ATOM   9935  C  C     B GLU D 3  399 ? 2.185   -20.702 30.666 0.50 73.41  ? 400 GLU C C     1 
ATOM   9936  O  O     A GLU D 3  399 ? 2.990   -21.078 29.553 0.50 73.56  ? 400 GLU C O     1 
ATOM   9937  O  O     B GLU D 3  399 ? 1.848   -21.218 29.597 0.50 74.88  ? 400 GLU C O     1 
ATOM   9938  C  CB    A GLU D 3  399 ? 1.332   -22.538 31.786 0.50 63.63  ? 400 GLU C CB    1 
ATOM   9939  C  CB    B GLU D 3  399 ? 1.534   -22.739 31.967 0.50 66.90  ? 400 GLU C CB    1 
ATOM   9940  C  CG    A GLU D 3  399 ? 0.088   -21.970 31.081 0.50 56.90  ? 400 GLU C CG    1 
ATOM   9941  C  CG    B GLU D 3  399 ? 1.984   -23.816 32.924 0.50 66.81  ? 400 GLU C CG    1 
ATOM   9942  C  CD    A GLU D 3  399 ? -1.214  -22.753 31.316 0.50 56.53  ? 400 GLU C CD    1 
ATOM   9943  C  CD    B GLU D 3  399 ? 0.846   -24.650 33.425 0.50 71.03  ? 400 GLU C CD    1 
ATOM   9944  O  OE1   A GLU D 3  399 ? -1.205  -23.874 31.873 0.50 61.41  ? 400 GLU C OE1   1 
ATOM   9945  O  OE1   B GLU D 3  399 ? -0.306  -24.197 33.298 0.50 68.71  ? 400 GLU C OE1   1 
ATOM   9946  O  OE2   A GLU D 3  399 ? -2.265  -22.217 30.912 0.50 54.11  ? 400 GLU C OE2   1 
ATOM   9947  O  OE2   B GLU D 3  399 ? 1.102   -25.759 33.938 0.50 85.38  ? 400 GLU C OE2   1 
ATOM   9948  N  N     . SER D 3  400 ? 2.246   -19.386 30.842 1.00 72.40  ? 401 SER C N     1 
ATOM   9949  C  CA    . SER D 3  400 ? 2.167   -18.417 29.757 1.00 85.52  ? 401 SER C CA    1 
ATOM   9950  C  C     . SER D 3  400 ? 3.524   -17.761 29.548 1.00 93.92  ? 401 SER C C     1 
ATOM   9951  O  O     . SER D 3  400 ? 4.228   -17.440 30.505 1.00 89.84  ? 401 SER C O     1 
ATOM   9952  C  CB    . SER D 3  400 ? 1.132   -17.334 30.043 1.00 84.03  ? 401 SER C CB    1 
ATOM   9953  O  OG    . SER D 3  400 ? -0.009  -17.853 30.703 1.00 82.65  ? 401 SER C OG    1 
ATOM   9954  N  N     . ASP D 3  401 ? 3.862   -17.526 28.281 1.00 100.28 ? 402 ASP C N     1 
ATOM   9955  C  CA    . ASP D 3  401 ? 5.153   -16.945 27.957 1.00 95.28  ? 402 ASP C CA    1 
ATOM   9956  C  C     . ASP D 3  401 ? 5.133   -15.426 27.991 1.00 93.07  ? 402 ASP C C     1 
ATOM   9957  O  O     . ASP D 3  401 ? 6.192   -14.822 28.177 1.00 100.49 ? 402 ASP C O     1 
ATOM   9958  C  CB    . ASP D 3  401 ? 5.607   -17.455 26.590 1.00 99.65  ? 402 ASP C CB    1 
ATOM   9959  C  CG    . ASP D 3  401 ? 5.786   -18.961 26.565 1.00 122.28 ? 402 ASP C CG    1 
ATOM   9960  O  OD1   . ASP D 3  401 ? 6.571   -19.478 27.387 1.00 125.58 ? 402 ASP C OD1   1 
ATOM   9961  O  OD2   . ASP D 3  401 ? 5.122   -19.628 25.742 1.00 131.31 ? 402 ASP C OD2   1 
ATOM   9962  N  N     . THR D 3  402 ? 3.971   -14.799 27.844 1.00 81.77  ? 403 THR C N     1 
ATOM   9963  C  CA    . THR D 3  402 ? 3.869   -13.346 27.858 1.00 75.72  ? 403 THR C CA    1 
ATOM   9964  C  C     . THR D 3  402 ? 2.648   -12.909 28.646 1.00 79.41  ? 403 THR C C     1 
ATOM   9965  O  O     . THR D 3  402 ? 1.629   -13.601 28.672 1.00 83.33  ? 403 THR C O     1 
ATOM   9966  C  CB    . THR D 3  402 ? 3.747   -12.756 26.447 1.00 75.32  ? 403 THR C CB    1 
ATOM   9967  O  OG1   . THR D 3  402 ? 2.652   -13.387 25.777 1.00 86.15  ? 403 THR C OG1   1 
ATOM   9968  C  CG2   . THR D 3  402 ? 5.015   -12.964 25.664 1.00 83.43  ? 403 THR C CG2   1 
ATOM   9969  N  N     . ASP D 3  403 ? 2.751   -11.715 29.233 1.00 83.83  ? 404 ASP C N     1 
ATOM   9970  C  CA    . ASP D 3  403 ? 1.641   -11.126 29.980 1.00 88.56  ? 404 ASP C CA    1 
ATOM   9971  C  C     . ASP D 3  403 ? 0.326   -11.153 29.209 1.00 86.85  ? 404 ASP C C     1 
ATOM   9972  O  O     . ASP D 3  403 ? -0.740  -11.378 29.797 1.00 79.83  ? 404 ASP C O     1 
ATOM   9973  C  CB    . ASP D 3  403 ? 1.979   -9.681  30.355 1.00 101.83 ? 404 ASP C CB    1 
ATOM   9974  C  CG    . ASP D 3  403 ? 2.877   -9.579  31.551 1.00 110.96 ? 404 ASP C CG    1 
ATOM   9975  O  OD1   . ASP D 3  403 ? 3.427   -10.611 31.977 1.00 114.34 ? 404 ASP C OD1   1 
ATOM   9976  O  OD2   . ASP D 3  403 ? 3.044   -8.459  32.065 1.00 108.10 ? 404 ASP C OD2   1 
ATOM   9977  N  N     . LYS D 3  404 ? 0.371   -10.876 27.899 1.00 82.14  ? 405 LYS C N     1 
ATOM   9978  C  CA    . LYS D 3  404 ? -0.855  -10.888 27.100 1.00 79.75  ? 405 LYS C CA    1 
ATOM   9979  C  C     . LYS D 3  404 ? -1.481  -12.279 27.087 1.00 84.66  ? 405 LYS C C     1 
ATOM   9980  O  O     . LYS D 3  404 ? -2.698  -12.428 27.265 1.00 74.05  ? 405 LYS C O     1 
ATOM   9981  C  CB    . LYS D 3  404 ? -0.566  -10.410 25.672 1.00 84.97  ? 405 LYS C CB    1 
ATOM   9982  C  CG    . LYS D 3  404 ? -1.789  -10.293 24.743 1.00 86.93  ? 405 LYS C CG    1 
ATOM   9983  C  CD    . LYS D 3  404 ? -1.586  -9.233  23.657 1.00 90.64  ? 405 LYS C CD    1 
ATOM   9984  C  CE    . LYS D 3  404 ? -2.920  -8.781  23.077 1.00 99.52  ? 405 LYS C CE    1 
ATOM   9985  N  NZ    . LYS D 3  404 ? -3.273  -9.476  21.809 1.00 98.49  ? 405 LYS C NZ    1 
ATOM   9986  N  N     . VAL D 3  405 ? -0.660  -13.317 26.912 1.00 93.85  ? 406 VAL C N     1 
ATOM   9987  C  CA    . VAL D 3  405 ? -1.170  -14.684 26.962 1.00 83.86  ? 406 VAL C CA    1 
ATOM   9988  C  C     . VAL D 3  405 ? -1.751  -14.987 28.340 1.00 81.33  ? 406 VAL C C     1 
ATOM   9989  O  O     . VAL D 3  405 ? -2.851  -15.538 28.459 1.00 89.04  ? 406 VAL C O     1 
ATOM   9990  C  CB    . VAL D 3  405 ? -0.056  -15.673 26.570 1.00 76.34  ? 406 VAL C CB    1 
ATOM   9991  C  CG1   . VAL D 3  405 ? -0.506  -17.113 26.839 1.00 73.14  ? 406 VAL C CG1   1 
ATOM   9992  C  CG2   . VAL D 3  405 ? 0.325   -15.485 25.100 1.00 81.58  ? 406 VAL C CG2   1 
ATOM   9993  N  N     . ALA D 3  406 ? -1.030  -14.605 29.400 1.00 71.29  ? 407 ALA C N     1 
ATOM   9994  C  CA    . ALA D 3  406 ? -1.501  -14.873 30.762 1.00 61.39  ? 407 ALA C CA    1 
ATOM   9995  C  C     . ALA D 3  406 ? -2.837  -14.202 31.026 1.00 66.71  ? 407 ALA C C     1 
ATOM   9996  O  O     . ALA D 3  406 ? -3.710  -14.764 31.704 1.00 69.10  ? 407 ALA C O     1 
ATOM   9997  C  CB    . ALA D 3  406 ? -0.463  -14.407 31.779 1.00 58.93  ? 407 ALA C CB    1 
ATOM   9998  N  N     A MET D 3  407 ? -2.983  -12.966 30.541 0.50 67.73  ? 408 MET C N     1 
ATOM   9999  N  N     B MET D 3  407 ? -3.006  -12.988 30.509 0.50 68.07  ? 408 MET C N     1 
ATOM   10000 C  CA    A MET D 3  407 ? -4.250  -12.241 30.585 0.50 73.73  ? 408 MET C CA    1 
ATOM   10001 C  CA    B MET D 3  407 ? -4.265  -12.260 30.626 0.50 68.56  ? 408 MET C CA    1 
ATOM   10002 C  C     A MET D 3  407 ? -5.367  -13.047 29.944 0.50 72.09  ? 408 MET C C     1 
ATOM   10003 C  C     B MET D 3  407 ? -5.396  -13.005 29.926 0.50 69.67  ? 408 MET C C     1 
ATOM   10004 O  O     A MET D 3  407 ? -6.438  -13.245 30.529 0.50 72.26  ? 408 MET C O     1 
ATOM   10005 O  O     B MET D 3  407 ? -6.496  -13.155 30.472 0.50 73.20  ? 408 MET C O     1 
ATOM   10006 C  CB    A MET D 3  407 ? -4.106  -10.919 29.825 0.50 76.41  ? 408 MET C CB    1 
ATOM   10007 C  CB    B MET D 3  407 ? -4.085  -10.873 30.006 0.50 74.09  ? 408 MET C CB    1 
ATOM   10008 C  CG    A MET D 3  407 ? -3.502  -9.737  30.561 0.50 78.83  ? 408 MET C CG    1 
ATOM   10009 C  CG    B MET D 3  407 ? -4.685  -9.688  30.765 0.50 73.13  ? 408 MET C CG    1 
ATOM   10010 S  SD    A MET D 3  407 ? -4.733  -8.915  31.599 0.50 83.31  ? 408 MET C SD    1 
ATOM   10011 S  SD    B MET D 3  407 ? -4.961  -8.220  29.731 0.50 67.15  ? 408 MET C SD    1 
ATOM   10012 C  CE    A MET D 3  407 ? -5.478  -7.695  30.502 0.50 74.83  ? 408 MET C CE    1 
ATOM   10013 C  CE    B MET D 3  407 ? -3.447  -8.145  28.778 0.50 66.61  ? 408 MET C CE    1 
ATOM   10014 N  N     . GLU D 3  408 ? -5.141  -13.474 28.704 1.00 67.83  ? 409 GLU C N     1 
ATOM   10015 C  CA    . GLU D 3  408 ? -6.178  -14.147 27.941 1.00 67.89  ? 409 GLU C CA    1 
ATOM   10016 C  C     . GLU D 3  408 ? -6.489  -15.512 28.546 1.00 70.23  ? 409 GLU C C     1 
ATOM   10017 O  O     . GLU D 3  408 ? -7.653  -15.917 28.596 1.00 81.45  ? 409 GLU C O     1 
ATOM   10018 C  CB    . GLU D 3  408 ? -5.732  -14.204 26.475 1.00 70.75  ? 409 GLU C CB    1 
ATOM   10019 C  CG    . GLU D 3  408 ? -5.810  -12.803 25.782 1.00 83.17  ? 409 GLU C CG    1 
ATOM   10020 C  CD    . GLU D 3  408 ? -5.070  -12.695 24.452 1.00 96.42  ? 409 GLU C CD    1 
ATOM   10021 O  OE1   . GLU D 3  408 ? -4.860  -11.553 23.975 1.00 91.32  ? 409 GLU C OE1   1 
ATOM   10022 O  OE2   . GLU D 3  408 ? -4.697  -13.741 23.884 1.00 102.97 ? 409 GLU C OE2   1 
ATOM   10023 N  N     . SER D 3  409 ? -5.475  -16.201 29.086 1.00 59.88  ? 410 SER C N     1 
ATOM   10024 C  CA    . SER D 3  409 ? -5.714  -17.485 29.752 1.00 57.41  ? 410 SER C CA    1 
ATOM   10025 C  C     . SER D 3  409 ? -6.540  -17.313 31.020 1.00 59.33  ? 410 SER C C     1 
ATOM   10026 O  O     . SER D 3  409 ? -7.474  -18.083 31.276 1.00 65.33  ? 410 SER C O     1 
ATOM   10027 C  CB    . SER D 3  409 ? -4.389  -18.167 30.090 1.00 63.76  ? 410 SER C CB    1 
ATOM   10028 O  OG    . SER D 3  409 ? -3.686  -18.587 28.943 1.00 67.29  ? 410 SER C OG    1 
ATOM   10029 N  N     . LEU D 3  410 ? -6.179  -16.324 31.834 1.00 68.06  ? 411 LEU C N     1 
ATOM   10030 C  CA    . LEU D 3  410 ? -6.916  -16.039 33.059 1.00 62.14  ? 411 LEU C CA    1 
ATOM   10031 C  C     . LEU D 3  410 ? -8.378  -15.738 32.772 1.00 64.90  ? 411 LEU C C     1 
ATOM   10032 O  O     . LEU D 3  410 ? -9.278  -16.216 33.473 1.00 69.53  ? 411 LEU C O     1 
ATOM   10033 C  CB    . LEU D 3  410 ? -6.274  -14.858 33.774 1.00 57.76  ? 411 LEU C CB    1 
ATOM   10034 C  CG    . LEU D 3  410 ? -4.984  -15.199 34.498 1.00 61.05  ? 411 LEU C CG    1 
ATOM   10035 C  CD1   . LEU D 3  410 ? -4.181  -13.967 34.829 1.00 71.70  ? 411 LEU C CD1   1 
ATOM   10036 C  CD2   . LEU D 3  410 ? -5.385  -15.908 35.738 1.00 68.60  ? 411 LEU C CD2   1 
ATOM   10037 N  N     . GLN D 3  411 ? -8.630  -14.922 31.750 1.00 58.91  ? 412 GLN C N     1 
ATOM   10038 C  CA    . GLN D 3  411 ? -9.998  -14.563 31.404 1.00 59.55  ? 412 GLN C CA    1 
ATOM   10039 C  C     . GLN D 3  411 ? -10.780 -15.776 30.948 1.00 65.30  ? 412 GLN C C     1 
ATOM   10040 O  O     . GLN D 3  411 ? -11.963 -15.938 31.286 1.00 74.26  ? 412 GLN C O     1 
ATOM   10041 C  CB    . GLN D 3  411 ? -9.982  -13.518 30.302 1.00 62.75  ? 412 GLN C CB    1 
ATOM   10042 C  CG    . GLN D 3  411 ? -9.475  -12.178 30.724 1.00 68.75  ? 412 GLN C CG    1 
ATOM   10043 C  CD    . GLN D 3  411 ? -9.426  -11.220 29.559 1.00 73.90  ? 412 GLN C CD    1 
ATOM   10044 O  OE1   . GLN D 3  411 ? -10.466 -10.815 29.030 1.00 86.20  ? 412 GLN C OE1   1 
ATOM   10045 N  NE2   . GLN D 3  411 ? -8.216  -10.865 29.136 1.00 66.31  ? 412 GLN C NE2   1 
ATOM   10046 N  N     . GLN D 3  412 ? -10.115 -16.632 30.183 1.00 64.99  ? 413 GLN C N     1 
ATOM   10047 C  CA    . GLN D 3  412 ? -10.737 -17.808 29.602 1.00 64.88  ? 413 GLN C CA    1 
ATOM   10048 C  C     . GLN D 3  412 ? -11.050 -18.853 30.659 1.00 69.97  ? 413 GLN C C     1 
ATOM   10049 O  O     . GLN D 3  412 ? -12.180 -19.339 30.767 1.00 83.12  ? 413 GLN C O     1 
ATOM   10050 C  CB    . GLN D 3  412 ? -9.776  -18.370 28.572 1.00 74.77  ? 413 GLN C CB    1 
ATOM   10051 C  CG    . GLN D 3  412 ? -10.397 -19.077 27.485 1.00 83.61  ? 413 GLN C CG    1 
ATOM   10052 C  CD    . GLN D 3  412 ? -9.394  -19.926 26.808 1.00 96.94  ? 413 GLN C CD    1 
ATOM   10053 O  OE1   . GLN D 3  412 ? -8.297  -19.468 26.497 1.00 89.63  ? 413 GLN C OE1   1 
ATOM   10054 N  NE2   . GLN D 3  412 ? -9.730  -21.185 26.606 1.00 109.98 ? 413 GLN C NE2   1 
ATOM   10055 N  N     . ARG D 3  413 ? -10.036 -19.242 31.425 1.00 69.51  ? 414 ARG C N     1 
ATOM   10056 C  CA    . ARG D 3  413 ? -10.197 -20.337 32.366 1.00 61.02  ? 414 ARG C CA    1 
ATOM   10057 C  C     . ARG D 3  413 ? -11.167 -19.984 33.489 1.00 66.60  ? 414 ARG C C     1 
ATOM   10058 O  O     . ARG D 3  413 ? -11.977 -20.823 33.882 1.00 98.69  ? 414 ARG C O     1 
ATOM   10059 C  CB    . ARG D 3  413 ? -8.832  -20.771 32.913 1.00 56.77  ? 414 ARG C CB    1 
ATOM   10060 C  CG    . ARG D 3  413 ? -8.904  -22.092 33.681 1.00 57.70  ? 414 ARG C CG    1 
ATOM   10061 C  CD    . ARG D 3  413 ? -7.567  -22.808 33.789 1.00 64.84  ? 414 ARG C CD    1 
ATOM   10062 N  NE    . ARG D 3  413 ? -7.525  -23.697 34.951 1.00 85.26  ? 414 ARG C NE    1 
ATOM   10063 C  CZ    . ARG D 3  413 ? -6.451  -24.384 35.324 1.00 84.34  ? 414 ARG C CZ    1 
ATOM   10064 N  NH1   . ARG D 3  413 ? -6.487  -25.154 36.394 1.00 82.51  ? 414 ARG C NH1   1 
ATOM   10065 N  NH2   . ARG D 3  413 ? -5.331  -24.284 34.626 1.00 81.40  ? 414 ARG C NH2   1 
ATOM   10066 N  N     . PHE D 3  414 ? -11.133 -18.756 34.009 1.00 71.47  ? 415 PHE C N     1 
ATOM   10067 C  CA    . PHE D 3  414 ? -11.932 -18.439 35.197 1.00 69.76  ? 415 PHE C CA    1 
ATOM   10068 C  C     . PHE D 3  414 ? -13.026 -17.410 34.963 1.00 70.90  ? 415 PHE C C     1 
ATOM   10069 O  O     . PHE D 3  414 ? -13.606 -16.911 35.936 1.00 62.78  ? 415 PHE C O     1 
ATOM   10070 C  CB    . PHE D 3  414 ? -11.049 -17.960 36.346 1.00 70.05  ? 415 PHE C CB    1 
ATOM   10071 C  CG    . PHE D 3  414 ? -9.858  -18.814 36.579 1.00 56.72  ? 415 PHE C CG    1 
ATOM   10072 C  CD1   . PHE D 3  414 ? -8.712  -18.636 35.824 1.00 59.42  ? 415 PHE C CD1   1 
ATOM   10073 C  CD2   . PHE D 3  414 ? -9.879  -19.797 37.539 1.00 58.16  ? 415 PHE C CD2   1 
ATOM   10074 C  CE1   . PHE D 3  414 ? -7.601  -19.435 36.032 1.00 66.95  ? 415 PHE C CE1   1 
ATOM   10075 C  CE2   . PHE D 3  414 ? -8.781  -20.583 37.759 1.00 62.55  ? 415 PHE C CE2   1 
ATOM   10076 C  CZ    . PHE D 3  414 ? -7.638  -20.409 37.000 1.00 60.11  ? 415 PHE C CZ    1 
ATOM   10077 N  N     . LYS D 3  415 ? -13.320 -17.072 33.712 1.00 71.11  ? 416 LYS C N     1 
ATOM   10078 C  CA    . LYS D 3  415 ? -14.420 -16.166 33.386 1.00 65.34  ? 416 LYS C CA    1 
ATOM   10079 C  C     . LYS D 3  415 ? -14.218 -14.777 33.987 1.00 66.10  ? 416 LYS C C     1 
ATOM   10080 O  O     . LYS D 3  415 ? -15.162 -14.153 34.474 1.00 79.94  ? 416 LYS C O     1 
ATOM   10081 C  CB    . LYS D 3  415 ? -15.759 -16.744 33.831 1.00 64.32  ? 416 LYS C CB    1 
ATOM   10082 C  CG    . LYS D 3  415 ? -16.217 -17.916 33.035 1.00 68.77  ? 416 LYS C CG    1 
ATOM   10083 C  CD    . LYS D 3  415 ? -17.695 -18.139 33.274 1.00 70.48  ? 416 LYS C CD    1 
ATOM   10084 C  CE    . LYS D 3  415 ? -18.317 -18.925 32.140 1.00 89.57  ? 416 LYS C CE    1 
ATOM   10085 N  NZ    . LYS D 3  415 ? -19.716 -19.306 32.460 1.00 107.77 ? 416 LYS C NZ    1 
ATOM   10086 N  N     . LEU D 3  416 ? -12.985 -14.291 33.959 1.00 65.99  ? 417 LEU C N     1 
ATOM   10087 C  CA    . LEU D 3  416 ? -12.684 -12.967 34.481 1.00 67.02  ? 417 LEU C CA    1 
ATOM   10088 C  C     . LEU D 3  416 ? -12.761 -11.941 33.349 1.00 76.60  ? 417 LEU C C     1 
ATOM   10089 O  O     . LEU D 3  416 ? -12.495 -12.246 32.180 1.00 81.96  ? 417 LEU C O     1 
ATOM   10090 C  CB    . LEU D 3  416 ? -11.298 -12.942 35.132 1.00 65.08  ? 417 LEU C CB    1 
ATOM   10091 C  CG    . LEU D 3  416 ? -11.007 -14.017 36.194 1.00 62.31  ? 417 LEU C CG    1 
ATOM   10092 C  CD1   . LEU D 3  416 ? -9.514  -14.277 36.343 1.00 59.92  ? 417 LEU C CD1   1 
ATOM   10093 C  CD2   . LEU D 3  416 ? -11.595 -13.635 37.525 1.00 58.03  ? 417 LEU C CD2   1 
ATOM   10094 N  N     . SER D 3  417 ? -13.187 -10.728 33.706 1.00 69.83  ? 418 SER C N     1 
ATOM   10095 C  CA    . SER D 3  417 ? -13.121 -9.589  32.811 1.00 61.36  ? 418 SER C CA    1 
ATOM   10096 C  C     . SER D 3  417 ? -11.668 -9.187  32.609 1.00 64.91  ? 418 SER C C     1 
ATOM   10097 O  O     . SER D 3  417 ? -10.774 -9.590  33.356 1.00 65.95  ? 418 SER C O     1 
ATOM   10098 C  CB    . SER D 3  417 ? -13.887 -8.411  33.392 1.00 68.68  ? 418 SER C CB    1 
ATOM   10099 O  OG    . SER D 3  417 ? -13.174 -7.899  34.512 1.00 80.53  ? 418 SER C OG    1 
ATOM   10100 N  N     . GLU D 3  418 ? -11.439 -8.362  31.595 1.00 72.58  ? 419 GLU C N     1 
ATOM   10101 C  CA    . GLU D 3  418 ? -10.078 -7.907  31.342 1.00 66.35  ? 419 GLU C CA    1 
ATOM   10102 C  C     . GLU D 3  418 ? -9.532  -7.163  32.551 1.00 61.77  ? 419 GLU C C     1 
ATOM   10103 O  O     . GLU D 3  418 ? -8.404  -7.419  32.994 1.00 62.35  ? 419 GLU C O     1 
ATOM   10104 C  CB    . GLU D 3  418 ? -10.059 -7.057  30.077 1.00 75.37  ? 419 GLU C CB    1 
ATOM   10105 C  CG    . GLU D 3  418 ? -8.715  -6.539  29.668 1.00 96.10  ? 419 GLU C CG    1 
ATOM   10106 C  CD    . GLU D 3  418 ? -8.754  -5.909  28.306 1.00 102.89 ? 419 GLU C CD    1 
ATOM   10107 O  OE1   . GLU D 3  418 ? -9.623  -6.296  27.505 1.00 101.46 ? 419 GLU C OE1   1 
ATOM   10108 O  OE2   . GLU D 3  418 ? -7.918  -5.023  28.041 1.00 101.34 ? 419 GLU C OE2   1 
ATOM   10109 N  N     . LYS D 3  419 ? -10.343 -6.260  33.110 1.00 58.32  ? 420 LYS C N     1 
ATOM   10110 C  CA    . LYS D 3  419 ? -9.987  -5.544  34.330 1.00 58.40  ? 420 LYS C CA    1 
ATOM   10111 C  C     . LYS D 3  419 ? -9.612  -6.488  35.475 1.00 55.69  ? 420 LYS C C     1 
ATOM   10112 O  O     . LYS D 3  419 ? -8.581  -6.302  36.136 1.00 56.63  ? 420 LYS C O     1 
ATOM   10113 C  CB    . LYS D 3  419 ? -11.137 -4.612  34.722 1.00 53.98  ? 420 LYS C CB    1 
ATOM   10114 C  CG    . LYS D 3  419 ? -11.265 -3.445  33.745 1.00 62.16  ? 420 LYS C CG    1 
ATOM   10115 C  CD    . LYS D 3  419 ? -12.241 -2.340  34.161 1.00 67.48  ? 420 LYS C CD    1 
ATOM   10116 C  CE    . LYS D 3  419 ? -11.544 -0.966  34.189 1.00 85.97  ? 420 LYS C CE    1 
ATOM   10117 N  NZ    . LYS D 3  419 ? -12.433 0.178   33.790 1.00 103.89 ? 420 LYS C NZ    1 
ATOM   10118 N  N     . GLN D 3  420 ? -10.434 -7.512  35.724 1.00 52.59  ? 421 GLN C N     1 
ATOM   10119 C  CA    . GLN D 3  420 ? -10.138 -8.454  36.803 1.00 54.19  ? 421 GLN C CA    1 
ATOM   10120 C  C     . GLN D 3  420 ? -8.824  -9.194  36.554 1.00 58.99  ? 421 GLN C C     1 
ATOM   10121 O  O     . GLN D 3  420 ? -8.024  -9.381  37.480 1.00 52.38  ? 421 GLN C O     1 
ATOM   10122 C  CB    . GLN D 3  420 ? -11.290 -9.442  36.985 1.00 53.57  ? 421 GLN C CB    1 
ATOM   10123 C  CG    . GLN D 3  420 ? -12.520 -8.861  37.676 1.00 56.78  ? 421 GLN C CG    1 
ATOM   10124 C  CD    . GLN D 3  420 ? -13.774 -9.675  37.424 1.00 74.22  ? 421 GLN C CD    1 
ATOM   10125 O  OE1   . GLN D 3  420 ? -13.885 -10.363 36.413 1.00 86.38  ? 421 GLN C OE1   1 
ATOM   10126 N  NE2   . GLN D 3  420 ? -14.731 -9.597  38.344 1.00 79.97  ? 421 GLN C NE2   1 
ATOM   10127 N  N     . ALA D 3  421 ? -8.579  -9.634  35.319 1.00 62.73  ? 422 ALA C N     1 
ATOM   10128 C  CA    . ALA D 3  421 ? -7.337  -10.350 35.034 1.00 57.89  ? 422 ALA C CA    1 
ATOM   10129 C  C     . ALA D 3  421 ? -6.123  -9.448  35.229 1.00 59.53  ? 422 ALA C C     1 
ATOM   10130 O  O     . ALA D 3  421 ? -5.107  -9.872  35.793 1.00 55.22  ? 422 ALA C O     1 
ATOM   10131 C  CB    . ALA D 3  421 ? -7.372  -10.930 33.610 1.00 61.51  ? 422 ALA C CB    1 
ATOM   10132 N  N     . GLN D 3  422 ? -6.204  -8.212  34.728 1.00 63.26  ? 423 GLN C N     1 
ATOM   10133 C  CA    . GLN D 3  422 ? -5.132  -7.235  34.913 1.00 67.37  ? 423 GLN C CA    1 
ATOM   10134 C  C     . GLN D 3  422 ? -4.847  -7.009  36.391 1.00 61.32  ? 423 GLN C C     1 
ATOM   10135 O  O     . GLN D 3  422 ? -3.681  -6.942  36.807 1.00 64.07  ? 423 GLN C O     1 
ATOM   10136 C  CB    . GLN D 3  422 ? -5.502  -5.915  34.233 1.00 91.76  ? 423 GLN C CB    1 
ATOM   10137 C  CG    . GLN D 3  422 ? -4.323  -5.012  33.817 1.00 103.45 ? 423 GLN C CG    1 
ATOM   10138 C  CD    . GLN D 3  422 ? -3.615  -5.489  32.555 1.00 116.33 ? 423 GLN C CD    1 
ATOM   10139 O  OE1   . GLN D 3  422 ? -2.876  -6.469  32.581 1.00 110.95 ? 423 GLN C OE1   1 
ATOM   10140 N  NE2   . GLN D 3  422 ? -3.837  -4.791  31.445 1.00 123.97 ? 423 GLN C NE2   1 
ATOM   10141 N  N     . ALA D 3  423 ? -5.911  -6.865  37.193 1.00 55.41  ? 424 ALA C N     1 
ATOM   10142 C  CA    . ALA D 3  423 ? -5.756  -6.680  38.630 1.00 54.91  ? 424 ALA C CA    1 
ATOM   10143 C  C     . ALA D 3  423 ? -5.029  -7.854  39.263 1.00 59.48  ? 424 ALA C C     1 
ATOM   10144 O  O     . ALA D 3  423 ? -4.194  -7.673  40.168 1.00 60.11  ? 424 ALA C O     1 
ATOM   10145 C  CB    . ALA D 3  423 ? -7.122  -6.535  39.288 1.00 48.94  ? 424 ALA C CB    1 
ATOM   10146 N  N     . ILE D 3  424 ? -5.381  -9.071  38.837 1.00 60.50  ? 425 ILE C N     1 
ATOM   10147 C  CA    . ILE D 3  424 ? -4.767  -10.251 39.417 1.00 60.22  ? 425 ILE C CA    1 
ATOM   10148 C  C     . ILE D 3  424 ? -3.286  -10.299 39.067 1.00 60.58  ? 425 ILE C C     1 
ATOM   10149 O  O     . ILE D 3  424 ? -2.430  -10.533 39.927 1.00 56.02  ? 425 ILE C O     1 
ATOM   10150 C  CB    . ILE D 3  424 ? -5.489  -11.526 38.946 1.00 55.37  ? 425 ILE C CB    1 
ATOM   10151 C  CG1   . ILE D 3  424 ? -6.832  -11.692 39.652 1.00 54.83  ? 425 ILE C CG1   1 
ATOM   10152 C  CG2   . ILE D 3  424 ? -4.660  -12.744 39.301 1.00 55.62  ? 425 ILE C CG2   1 
ATOM   10153 C  CD1   . ILE D 3  424 ? -7.685  -12.802 39.089 1.00 56.39  ? 425 ILE C CD1   1 
ATOM   10154 N  N     . LEU D 3  425 ? -2.952  -10.052 37.798 1.00 60.41  ? 426 LEU C N     1 
ATOM   10155 C  CA    . LEU D 3  425 ? -1.545  -10.045 37.418 1.00 61.03  ? 426 LEU C CA    1 
ATOM   10156 C  C     . LEU D 3  425 ? -0.744  -8.979  38.150 1.00 63.22  ? 426 LEU C C     1 
ATOM   10157 O  O     . LEU D 3  425 ? 0.467   -9.146  38.308 1.00 65.24  ? 426 LEU C O     1 
ATOM   10158 C  CB    . LEU D 3  425 ? -1.413  -9.863  35.905 1.00 59.03  ? 426 LEU C CB    1 
ATOM   10159 C  CG    . LEU D 3  425 ? -1.850  -11.014 35.006 1.00 59.09  ? 426 LEU C CG    1 
ATOM   10160 C  CD1   . LEU D 3  425 ? -2.073  -10.515 33.613 1.00 58.64  ? 426 LEU C CD1   1 
ATOM   10161 C  CD2   . LEU D 3  425 ? -0.774  -12.050 34.993 1.00 67.51  ? 426 LEU C CD2   1 
ATOM   10162 N  N     . ASP D 3  426 ? -1.377  -7.889  38.596 1.00 63.66  ? 427 ASP C N     1 
ATOM   10163 C  CA    . ASP D 3  426 ? -0.702  -6.816  39.314 1.00 68.47  ? 427 ASP C CA    1 
ATOM   10164 C  C     . ASP D 3  426 ? -0.593  -7.072  40.799 1.00 78.58  ? 427 ASP C C     1 
ATOM   10165 O  O     . ASP D 3  426 ? 0.178   -6.382  41.480 1.00 86.93  ? 427 ASP C O     1 
ATOM   10166 C  CB    . ASP D 3  426 ? -1.445  -5.494  39.128 1.00 78.31  ? 427 ASP C CB    1 
ATOM   10167 C  CG    . ASP D 3  426 ? -1.110  -4.810  37.832 1.00 84.22  ? 427 ASP C CG    1 
ATOM   10168 O  OD1   . ASP