data_6FSD
# 
_entry.id   6FSD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.307 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6FSD         
WWPDB D_1200008547 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6FSD 
_pdbx_database_status.recvd_initial_deposition_date   2018-02-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Knutsson, S.' 1  ?                   
'Engdahl, C.'  2  ?                   
'Kumari, R.'   3  ?                   
'Kindahl, T.'  4  ?                   
'Forsgren, N.' 5  ?                   
'Lindgren, C.' 6  ?                   
'Kitur, S.'    7  ?                   
'Kamau, L.'    8  ?                   
'Ekstrom, F.'  9  ?                   
'Linusson, A.' 10 0000-0003-0063-8912 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_id_ASTM           JMCMAR 
_citation.journal_id_CSD            0151 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            61 
_citation.language                  ? 
_citation.page_first                10545 
_citation.page_last                 10557 
_citation.title                     'Noncovalent Inhibitors of Mosquito Acetylcholinesterase 1 with Resistance-Breaking Potency.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.jmedchem.8b01060 
_citation.pdbx_database_id_PubMed   30339371 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Knutsson, S.' 1  ? 
primary 'Engdahl, C.'  2  ? 
primary 'Kumari, R.'   3  ? 
primary 'Forsgren, N.' 4  ? 
primary 'Lindgren, C.' 5  ? 
primary 'Kindahl, T.'  6  ? 
primary 'Kitur, S.'    7  ? 
primary 'Wachira, L.'  8  ? 
primary 'Kamau, L.'    9  ? 
primary 'Ekstrom, F.'  10 ? 
primary 'Linusson, A.' 11 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6FSD 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     78.013 
_cell.length_a_esd                 ? 
_cell.length_b                     110.327 
_cell.length_b_esd                 ? 
_cell.length_c                     227.261 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6FSD 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                                            60161.922 2   3.1.1.7 ? ? ? 
2 non-polymer syn '2-(4-phenylphenoxy)-~{N}-(3-piperidin-1-ylpropyl)ethanamide'   352.470   2   ?       ? ? ? 
3 non-polymer syn '2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXYL'                       164.200   1   ?       ? ? ? 
4 non-polymer syn '2-(2-METHOXYETHOXY)ETHANOL'                                    120.147   2   ?       ? ? ? 
5 non-polymer syn '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL' 252.305   1   ?       ? ? ? 
6 water       nat water                                                           18.015    165 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATGAP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATGAP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
1 545 THR n 
1 546 GLY n 
1 547 ALA n 
1 548 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   548 
_entity_src_gen.gene_src_common_name               Mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Ache 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HEK293F cells' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           32 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6FSD A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 6FSD B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6FSD ALA A 544 ? UNP P21836 ? ? 'expression tag' 544 1  
1 6FSD THR A 545 ? UNP P21836 ? ? 'expression tag' 545 2  
1 6FSD GLY A 546 ? UNP P21836 ? ? 'expression tag' 546 3  
1 6FSD ALA A 547 ? UNP P21836 ? ? 'expression tag' 547 4  
1 6FSD PRO A 548 ? UNP P21836 ? ? 'expression tag' 548 5  
2 6FSD ALA B 544 ? UNP P21836 ? ? 'expression tag' 544 6  
2 6FSD THR B 545 ? UNP P21836 ? ? 'expression tag' 545 7  
2 6FSD GLY B 546 ? UNP P21836 ? ? 'expression tag' 546 8  
2 6FSD ALA B 547 ? UNP P21836 ? ? 'expression tag' 547 9  
2 6FSD PRO B 548 ? UNP P21836 ? ? 'expression tag' 548 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PG non-polymer         . '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL' ?          'C11 H24 O6'     252.305 
ALA 'L-peptide linking' y ALANINE                                                         ?          'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                        ?          'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                      ?          'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                 ?          'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                        ?          'C3 H7 N O2 S'   121.158 
E5H non-polymer         . '2-(4-phenylphenoxy)-~{N}-(3-piperidin-1-ylpropyl)ethanamide'   ?          'C22 H28 N2 O2'  352.470 
GLN 'L-peptide linking' y GLUTAMINE                                                       ?          'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                 ?          'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                         ?          'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                       ?          'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                           ?          'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                      ?          'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                         ?          'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                          ?          'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                      ?          'C5 H11 N O2 S'  149.211 
PG0 non-polymer         . '2-(2-METHOXYETHOXY)ETHANOL'                                    'PEG 6000' 'C5 H12 O3'      120.147 
PHE 'L-peptide linking' y PHENYLALANINE                                                   ?          'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                         ?          'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                          ?          'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                       ?          'C4 H9 N O3'     119.119 
TOE non-polymer         . '2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXYL'                       ?          'C7 H16 O4'      164.200 
TRP 'L-peptide linking' y TRYPTOPHAN                                                      ?          'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                        ?          'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                          ?          'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6FSD 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.58 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         65.67 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 750, Hepes' 
_exptl_crystal_grow.pdbx_pH_range   6.8-7.4 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-11-11 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal monochromator' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'MAX II BEAMLINE I911-3' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I911-3 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
# 
_reflns.B_iso_Wilson_estimate            47.96 
_reflns.entry_id                         6FSD 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.7 
_reflns.d_resolution_low                 39.58 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       51940 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.6 
_reflns.pdbx_Rmerge_I_obs                0.07983 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            18.22 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.08736 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.7 
_reflns_shell.d_res_low                   2.796 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         4.02 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5210 
_reflns_shell.percent_possible_all        97 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.5594 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.6129 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.957 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6FSD 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.700 
_refine.ls_d_res_low                             39.578 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     51940 
_refine.ls_number_reflns_R_free                  1035 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    95 
_refine.ls_percent_reflns_R_free                 1.99 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1915 
_refine.ls_R_factor_R_free                       0.2342 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1906 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      1J06 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.48 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.36 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8336 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         86 
_refine_hist.number_atoms_solvent             165 
_refine_hist.number_atoms_total               8587 
_refine_hist.d_res_high                       2.700 
_refine_hist.d_res_low                        39.578 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  ? 8672  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.037  ? 11830 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 17.137 ? 5107  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.058  ? 1264  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 1550  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.7000 2.8423  . . 147 7289 97.00 . . . 0.3524 . 0.2755 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8423 3.0203  . . 155 7272 96.00 . . . 0.3263 . 0.2500 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0203 3.2534  . . 158 7275 96.00 . . . 0.3147 . 0.2434 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2534 3.5806  . . 136 7293 96.00 . . . 0.2784 . 0.2061 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5806 4.0983  . . 147 7247 95.00 . . . 0.2242 . 0.1780 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0983 5.1616  . . 142 7239 94.00 . . . 0.1654 . 0.1519 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1616 39.5818 . . 150 7288 91.00 . . . 0.1896 . 0.1686 . . . . . . . . . . 
# 
_struct.entry_id                     6FSD 
_struct.title                        
'Mus musculus acetylcholinesterase in complex with 2-(4-Biphenylyloxy)-N-[3-(1-piperidinyl)propyl]-acetamide hydrochloride (10)' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6FSD 
_struct_keywords.text            'Inhibitor, hydrolase, acetylcholinesterase, protein binding' 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 2 ? 
G N N 5 ? 
H N N 4 ? 
I N N 6 ? 
J N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P3  AA3 LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P4  AA4 GLY A 135 ? GLU A 142 ? GLY A 135 GLU A 142 1 ? 8  
HELX_P HELX_P5  AA5 VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P6  AA6 ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P7  AA7 ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P8  AA8 SER A 203 ? SER A 215 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P9  AA9 LEU A 216 ? ARG A 219 ? LEU A 216 ARG A 219 5 ? 4  
HELX_P HELX_P10 AB1 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P11 AB2 ASP A 266 ? ARG A 274 ? ASP A 266 ARG A 274 1 ? 9  
HELX_P HELX_P12 AB3 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P13 AB4 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P14 AB5 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P15 AB6 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P16 AB7 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P17 AB8 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P18 AB9 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P19 AC1 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P20 AC2 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P21 AC3 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P22 AC4 GLY A 456 ? ASN A 464 ? GLY A 456 ASN A 464 5 ? 9  
HELX_P HELX_P23 AC5 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P24 AC6 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P25 AC7 ARG A 534 ? SER A 541 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P26 AC8 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P27 AC9 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P28 AD1 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P29 AD2 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P30 AD3 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P31 AD4 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P32 AD5 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P33 AD6 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P34 AD7 SER B 203 ? LEU B 214 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P35 AD8 SER B 215 ? LEU B 221 ? SER B 215 LEU B 221 5 ? 7  
HELX_P HELX_P36 AD9 ALA B 241 ? VAL B 255 ? ALA B 241 VAL B 255 1 ? 15 
HELX_P HELX_P37 AE1 ASP B 266 ? THR B 275 ? ASP B 266 THR B 275 1 ? 10 
HELX_P HELX_P38 AE2 PRO B 277 ? ASP B 283 ? PRO B 277 ASP B 283 1 ? 7  
HELX_P HELX_P39 AE3 HIS B 284 ? LEU B 289 ? HIS B 284 LEU B 289 5 ? 6  
HELX_P HELX_P40 AE4 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P41 AE5 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P42 AE6 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P43 AE7 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P44 AE8 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P45 AE9 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P46 AF1 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P47 AF2 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P48 AF3 GLY B 456 ? ASN B 464 ? GLY B 456 ASN B 464 5 ? 9  
HELX_P HELX_P49 AF4 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P50 AF5 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P51 AF6 ARG B 534 ? SER B 541 ? ARG B 534 SER B 541 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 69  SG ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf2 disulf ? ? A CYS 257 SG ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.063 ? 
disulf3 disulf ? ? A CYS 409 SG ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf4 disulf ? ? B CYS 69  SG ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.063 ? 
disulf5 disulf ? ? B CYS 257 SG ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.101 ? 
disulf6 disulf ? ? B CYS 409 SG ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.070 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 1.56 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 9.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
AA6 ? 2  ? 
AA7 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
AA6 1  2  ? parallel      
AA7 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA1 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA1 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AA2 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AA2 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AA2 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AA2 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AA2 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AA2 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AA2 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AA2 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AA2 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AA2 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AA2 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AA3 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AA3 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
AA4 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
AA4 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
AA4 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
AA5 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
AA5 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
AA5 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
AA5 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
AA5 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
AA5 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
AA5 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
AA5 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
AA5 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
AA5 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
AA5 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
AA6 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
AA6 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
AA7 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
AA7 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA1 2  3  N GLN A 16  ? N GLN A 16  O LEU A 60  ? O LEU A 60  
AA2 1  2  N ILE A 20  ? N ILE A 20  O ALA A 31  ? O ALA A 31  
AA2 2  3  N PHE A 32  ? N PHE A 32  O VAL A 101 ? O VAL A 101 
AA2 3  4  N ASN A 100 ? N ASN A 100 O SER A 148 ? O SER A 148 
AA2 4  5  O VAL A 147 ? O VAL A 147 N LEU A 115 ? N LEU A 115 
AA2 5  6  N VAL A 114 ? N VAL A 114 O SER A 196 ? O SER A 196 
AA2 6  7  N GLY A 201 ? N GLY A 201 O GLN A 228 ? O GLN A 228 
AA2 7  8  N LEU A 227 ? N LEU A 227 O LEU A 327 ? O LEU A 327 
AA2 8  9  N VAL A 330 ? N VAL A 330 O PHE A 430 ? O PHE A 430 
AA2 9  10 N ILE A 429 ? N ILE A 429 O LEU A 513 ? O LEU A 513 
AA2 10 11 N TYR A 510 ? N TYR A 510 O ARG A 521 ? O ARG A 521 
AA3 1  2  N VAL A 68  ? N VAL A 68  O SER A 93  ? O SER A 93  
AA4 1  2  N VAL B 10  ? N VAL B 10  O LEU B 17  ? O LEU B 17  
AA4 2  3  N GLN B 16  ? N GLN B 16  O LEU B 60  ? O LEU B 60  
AA5 1  2  N LEU B 22  ? N LEU B 22  O VAL B 29  ? O VAL B 29  
AA5 2  3  N PHE B 32  ? N PHE B 32  O VAL B 101 ? O VAL B 101 
AA5 3  4  N ASN B 100 ? N ASN B 100 O SER B 148 ? O SER B 148 
AA5 4  5  O VAL B 147 ? O VAL B 147 N LEU B 115 ? N LEU B 115 
AA5 5  6  N THR B 112 ? N THR B 112 O ASP B 193 ? O ASP B 193 
AA5 6  7  N GLY B 201 ? N GLY B 201 O GLN B 228 ? O GLN B 228 
AA5 7  8  N LEU B 227 ? N LEU B 227 O LEU B 327 ? O LEU B 327 
AA5 8  9  N VAL B 330 ? N VAL B 330 O PHE B 430 ? O PHE B 430 
AA5 9  10 N ILE B 429 ? N ILE B 429 O LEU B 513 ? O LEU B 513 
AA5 10 11 N TYR B 510 ? N TYR B 510 O ARG B 521 ? O ARG B 521 
AA6 1  2  N VAL B 68  ? N VAL B 68  O SER B 93  ? O SER B 93  
AA7 1  2  N VAL B 239 ? N VAL B 239 O VAL B 303 ? O VAL B 303 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A E5H 601 ? 6 'binding site for residue E5H A 601' 
AC2 Software A TOE 602 ? 4 'binding site for residue TOE A 602' 
AC3 Software A PG0 603 ? 4 'binding site for residue PG0 A 603' 
AC4 Software B E5H 601 ? 5 'binding site for residue E5H B 601' 
AC5 Software B 1PG 602 ? 8 'binding site for residue 1PG B 602' 
AC6 Software B PG0 603 ? 5 'binding site for residue PG0 B 603' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 TYR A 72  ? TYR A 72  . ? 1_555 ? 
2  AC1 6 TYR A 124 ? TYR A 124 . ? 1_555 ? 
3  AC1 6 TRP A 286 ? TRP A 286 . ? 1_555 ? 
4  AC1 6 PHE A 295 ? PHE A 295 . ? 1_555 ? 
5  AC1 6 TYR A 337 ? TYR A 337 . ? 1_555 ? 
6  AC1 6 PHE A 338 ? PHE A 338 . ? 1_555 ? 
7  AC2 4 VAL A 330 ? VAL A 330 . ? 1_555 ? 
8  AC2 4 TYR A 428 ? TYR A 428 . ? 1_555 ? 
9  AC2 4 LEU A 524 ? LEU A 524 . ? 1_555 ? 
10 AC2 4 ARG A 525 ? ARG A 525 . ? 1_555 ? 
11 AC3 4 GLN A 413 ? GLN A 413 . ? 1_555 ? 
12 AC3 4 ARG A 417 ? ARG A 417 . ? 1_555 ? 
13 AC3 4 ALA A 420 ? ALA A 420 . ? 1_555 ? 
14 AC3 4 ARG A 534 ? ARG A 534 . ? 1_555 ? 
15 AC4 5 TYR B 124 ? TYR B 124 . ? 1_555 ? 
16 AC4 5 TRP B 286 ? TRP B 286 . ? 1_555 ? 
17 AC4 5 PHE B 295 ? PHE B 295 . ? 1_555 ? 
18 AC4 5 TYR B 337 ? TYR B 337 . ? 1_555 ? 
19 AC4 5 PHE B 338 ? PHE B 338 . ? 1_555 ? 
20 AC5 8 LEU A 380 ? LEU A 380 . ? 1_555 ? 
21 AC5 8 HIS A 381 ? HIS A 381 . ? 1_555 ? 
22 AC5 8 GLN A 527 ? GLN A 527 . ? 1_555 ? 
23 AC5 8 PHE A 531 ? PHE A 531 . ? 1_555 ? 
24 AC5 8 HIS B 381 ? HIS B 381 . ? 1_555 ? 
25 AC5 8 GLN B 527 ? GLN B 527 . ? 1_555 ? 
26 AC5 8 PHE B 531 ? PHE B 531 . ? 1_555 ? 
27 AC5 8 PHE B 535 ? PHE B 535 . ? 1_555 ? 
28 AC6 5 LEU B 214 ? LEU B 214 . ? 1_555 ? 
29 AC6 5 LEU B 216 ? LEU B 216 . ? 1_555 ? 
30 AC6 5 ARG B 219 ? ARG B 219 . ? 1_555 ? 
31 AC6 5 GLY B 319 ? GLY B 319 . ? 1_555 ? 
32 AC6 5 ASP B 320 ? ASP B 320 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6FSD 
_atom_sites.fract_transf_matrix[1][1]   0.012818 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009064 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004400 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLU A 1 1   ? 31.409  13.933  55.514  1.00 71.40  ? 1   GLU A N     1 
ATOM   2    C CA    . GLU A 1 1   ? 30.001  14.266  55.311  1.00 69.58  ? 1   GLU A CA    1 
ATOM   3    C C     . GLU A 1 1   ? 29.423  14.994  56.518  1.00 72.36  ? 1   GLU A C     1 
ATOM   4    O O     . GLU A 1 1   ? 30.146  15.677  57.250  1.00 75.54  ? 1   GLU A O     1 
ATOM   5    C CB    . GLU A 1 1   ? 29.205  12.999  55.045  1.00 64.12  ? 1   GLU A CB    1 
ATOM   6    C CG    . GLU A 1 1   ? 30.043  11.885  54.470  1.00 58.18  ? 1   GLU A CG    1 
ATOM   7    C CD    . GLU A 1 1   ? 29.254  10.606  54.338  1.00 62.12  ? 1   GLU A CD    1 
ATOM   8    O OE1   . GLU A 1 1   ? 28.102  10.546  54.844  1.00 58.43  ? 1   GLU A OE1   1 
ATOM   9    O OE2   . GLU A 1 1   ? 29.789  9.658   53.729  1.00 62.31  ? 1   GLU A OE2   1 
ATOM   10   N N     . GLY A 1 2   ? 28.118  14.844  56.731  1.00 66.38  ? 2   GLY A N     1 
ATOM   11   C CA    . GLY A 1 2   ? 27.513  15.368  57.937  1.00 57.75  ? 2   GLY A CA    1 
ATOM   12   C C     . GLY A 1 2   ? 26.244  16.137  57.672  1.00 62.10  ? 2   GLY A C     1 
ATOM   13   O O     . GLY A 1 2   ? 25.149  15.650  57.971  1.00 59.48  ? 2   GLY A O     1 
ATOM   14   N N     . ARG A 1 3   ? 26.384  17.342  57.110  1.00 69.56  ? 3   ARG A N     1 
ATOM   15   C CA    . ARG A 1 3   ? 25.262  18.209  56.773  1.00 66.04  ? 3   ARG A CA    1 
ATOM   16   C C     . ARG A 1 3   ? 24.899  18.155  55.300  1.00 66.16  ? 3   ARG A C     1 
ATOM   17   O O     . ARG A 1 3   ? 24.141  19.006  54.836  1.00 71.69  ? 3   ARG A O     1 
ATOM   18   C CB    . ARG A 1 3   ? 25.565  19.660  57.144  1.00 64.25  ? 3   ARG A CB    1 
ATOM   19   C CG    . ARG A 1 3   ? 25.864  19.901  58.611  1.00 73.51  ? 3   ARG A CG    1 
ATOM   20   C CD    . ARG A 1 3   ? 24.631  19.751  59.494  1.00 69.31  ? 3   ARG A CD    1 
ATOM   21   N NE    . ARG A 1 3   ? 24.972  19.998  60.897  1.00 66.70  ? 3   ARG A NE    1 
ATOM   22   C CZ    . ARG A 1 3   ? 24.182  19.695  61.926  1.00 68.06  ? 3   ARG A CZ    1 
ATOM   23   N NH1   . ARG A 1 3   ? 22.997  19.126  61.715  1.00 63.97  ? 3   ARG A NH1   1 
ATOM   24   N NH2   . ARG A 1 3   ? 24.578  19.953  63.171  1.00 70.77  ? 3   ARG A NH2   1 
ATOM   25   N N     . GLU A 1 4   ? 25.428  17.195  54.557  1.00 64.50  ? 4   GLU A N     1 
ATOM   26   C CA    . GLU A 1 4   ? 25.184  17.118  53.127  1.00 63.26  ? 4   GLU A CA    1 
ATOM   27   C C     . GLU A 1 4   ? 23.884  16.375  52.841  1.00 61.68  ? 4   GLU A C     1 
ATOM   28   O O     . GLU A 1 4   ? 23.299  15.733  53.712  1.00 59.30  ? 4   GLU A O     1 
ATOM   29   C CB    . GLU A 1 4   ? 26.350  16.426  52.429  1.00 67.25  ? 4   GLU A CB    1 
ATOM   30   C CG    . GLU A 1 4   ? 27.699  16.945  52.864  1.00 72.46  ? 4   GLU A CG    1 
ATOM   31   C CD    . GLU A 1 4   ? 28.697  16.939  51.735  1.00 77.96  ? 4   GLU A CD    1 
ATOM   32   O OE1   . GLU A 1 4   ? 28.838  15.879  51.078  1.00 78.51  ? 4   GLU A OE1   1 
ATOM   33   O OE2   . GLU A 1 4   ? 29.316  18.003  51.491  1.00 78.33  ? 4   GLU A OE2   1 
ATOM   34   N N     . ASP A 1 5   ? 23.427  16.477  51.602  1.00 59.98  ? 5   ASP A N     1 
ATOM   35   C CA    . ASP A 1 5   ? 22.248  15.731  51.200  1.00 52.77  ? 5   ASP A CA    1 
ATOM   36   C C     . ASP A 1 5   ? 22.632  14.263  51.165  1.00 58.33  ? 5   ASP A C     1 
ATOM   37   O O     . ASP A 1 5   ? 23.482  13.880  50.352  1.00 58.85  ? 5   ASP A O     1 
ATOM   38   C CB    . ASP A 1 5   ? 21.751  16.206  49.840  1.00 52.58  ? 5   ASP A CB    1 
ATOM   39   C CG    . ASP A 1 5   ? 20.463  15.510  49.392  1.00 56.51  ? 5   ASP A CG    1 
ATOM   40   O OD1   . ASP A 1 5   ? 20.030  14.528  50.034  1.00 57.15  ? 5   ASP A OD1   1 
ATOM   41   O OD2   . ASP A 1 5   ? 19.882  15.951  48.368  1.00 56.03  ? 5   ASP A OD2   1 
ATOM   42   N N     . PRO A 1 6   ? 22.070  13.414  52.028  1.00 61.80  ? 6   PRO A N     1 
ATOM   43   C CA    . PRO A 1 6   ? 22.486  12.003  52.036  1.00 61.73  ? 6   PRO A CA    1 
ATOM   44   C C     . PRO A 1 6   ? 22.163  11.249  50.752  1.00 51.93  ? 6   PRO A C     1 
ATOM   45   O O     . PRO A 1 6   ? 22.680  10.143  50.562  1.00 54.36  ? 6   PRO A O     1 
ATOM   46   C CB    . PRO A 1 6   ? 21.724  11.424  53.238  1.00 54.37  ? 6   PRO A CB    1 
ATOM   47   C CG    . PRO A 1 6   ? 20.544  12.338  53.395  1.00 53.83  ? 6   PRO A CG    1 
ATOM   48   C CD    . PRO A 1 6   ? 21.068  13.697  53.068  1.00 53.59  ? 6   PRO A CD    1 
ATOM   49   N N     . GLN A 1 7   ? 21.338  11.783  49.866  1.00 53.33  ? 7   GLN A N     1 
ATOM   50   C CA    . GLN A 1 7   ? 21.034  11.048  48.641  1.00 59.24  ? 7   GLN A CA    1 
ATOM   51   C C     . GLN A 1 7   ? 21.908  11.460  47.462  1.00 53.82  ? 7   GLN A C     1 
ATOM   52   O O     . GLN A 1 7   ? 21.786  10.871  46.391  1.00 56.76  ? 7   GLN A O     1 
ATOM   53   C CB    . GLN A 1 7   ? 19.540  11.182  48.308  1.00 58.73  ? 7   GLN A CB    1 
ATOM   54   C CG    . GLN A 1 7   ? 18.671  10.497  49.412  1.00 69.01  ? 7   GLN A CG    1 
ATOM   55   C CD    . GLN A 1 7   ? 17.319  11.167  49.695  1.00 68.02  ? 7   GLN A CD    1 
ATOM   56   O OE1   . GLN A 1 7   ? 17.137  12.363  49.439  1.00 65.66  ? 7   GLN A OE1   1 
ATOM   57   N NE2   . GLN A 1 7   ? 16.374  10.392  50.256  1.00 57.81  ? 7   GLN A NE2   1 
ATOM   58   N N     . LEU A 1 8   ? 22.832  12.398  47.654  1.00 54.03  ? 8   LEU A N     1 
ATOM   59   C CA    . LEU A 1 8   ? 23.743  12.849  46.612  1.00 51.76  ? 8   LEU A CA    1 
ATOM   60   C C     . LEU A 1 8   ? 25.128  12.230  46.720  1.00 52.23  ? 8   LEU A C     1 
ATOM   61   O O     . LEU A 1 8   ? 26.034  12.640  45.986  1.00 53.67  ? 8   LEU A O     1 
ATOM   62   C CB    . LEU A 1 8   ? 23.864  14.377  46.647  1.00 51.47  ? 8   LEU A CB    1 
ATOM   63   C CG    . LEU A 1 8   ? 22.604  15.142  46.266  1.00 48.77  ? 8   LEU A CG    1 
ATOM   64   C CD1   . LEU A 1 8   ? 22.875  16.630  46.159  1.00 50.88  ? 8   LEU A CD1   1 
ATOM   65   C CD2   . LEU A 1 8   ? 22.059  14.540  44.980  1.00 47.94  ? 8   LEU A CD2   1 
ATOM   66   N N     . LEU A 1 9   ? 25.331  11.272  47.617  1.00 49.33  ? 9   LEU A N     1 
ATOM   67   C CA    . LEU A 1 9   ? 26.657  10.711  47.838  1.00 49.70  ? 9   LEU A CA    1 
ATOM   68   C C     . LEU A 1 9   ? 26.657  9.258   47.395  1.00 46.61  ? 9   LEU A C     1 
ATOM   69   O O     . LEU A 1 9   ? 25.766  8.493   47.769  1.00 47.25  ? 9   LEU A O     1 
ATOM   70   C CB    . LEU A 1 9   ? 27.087  10.861  49.303  1.00 45.11  ? 9   LEU A CB    1 
ATOM   71   C CG    . LEU A 1 9   ? 26.802  12.251  49.905  1.00 54.07  ? 9   LEU A CG    1 
ATOM   72   C CD1   . LEU A 1 9   ? 26.944  12.242  51.430  1.00 65.51  ? 9   LEU A CD1   1 
ATOM   73   C CD2   . LEU A 1 9   ? 27.661  13.365  49.333  1.00 50.45  ? 9   LEU A CD2   1 
ATOM   74   N N     . VAL A 1 10  ? 27.638  8.896   46.568  1.00 42.08  ? 10  VAL A N     1 
ATOM   75   C CA    . VAL A 1 10  ? 27.693  7.601   45.899  1.00 38.47  ? 10  VAL A CA    1 
ATOM   76   C C     . VAL A 1 10  ? 29.156  7.178   45.836  1.00 39.30  ? 10  VAL A C     1 
ATOM   77   O O     . VAL A 1 10  ? 30.052  8.022   45.736  1.00 42.52  ? 10  VAL A O     1 
ATOM   78   C CB    . VAL A 1 10  ? 27.048  7.697   44.481  1.00 42.67  ? 10  VAL A CB    1 
ATOM   79   C CG1   . VAL A 1 10  ? 27.327  6.459   43.613  1.00 38.82  ? 10  VAL A CG1   1 
ATOM   80   C CG2   . VAL A 1 10  ? 25.558  7.937   44.593  1.00 41.00  ? 10  VAL A CG2   1 
ATOM   81   N N     . ARG A 1 11  ? 29.408  5.869   45.919  1.00 35.39  ? 11  ARG A N     1 
ATOM   82   C CA    . ARG A 1 11  ? 30.748  5.333   45.708  1.00 39.62  ? 11  ARG A CA    1 
ATOM   83   C C     . ARG A 1 11  ? 30.817  4.617   44.362  1.00 43.07  ? 11  ARG A C     1 
ATOM   84   O O     . ARG A 1 11  ? 29.882  3.907   43.978  1.00 41.79  ? 11  ARG A O     1 
ATOM   85   C CB    . ARG A 1 11  ? 31.173  4.365   46.822  1.00 40.45  ? 11  ARG A CB    1 
ATOM   86   C CG    . ARG A 1 11  ? 32.621  3.895   46.674  1.00 40.44  ? 11  ARG A CG    1 
ATOM   87   C CD    . ARG A 1 11  ? 33.134  3.146   47.868  1.00 41.59  ? 11  ARG A CD    1 
ATOM   88   N NE    . ARG A 1 11  ? 33.636  4.037   48.910  1.00 46.88  ? 11  ARG A NE    1 
ATOM   89   C CZ    . ARG A 1 11  ? 34.902  4.437   49.022  1.00 49.58  ? 11  ARG A CZ    1 
ATOM   90   N NH1   . ARG A 1 11  ? 35.260  5.249   50.014  1.00 46.56  ? 11  ARG A NH1   1 
ATOM   91   N NH2   . ARG A 1 11  ? 35.808  4.044   48.136  1.00 51.25  ? 11  ARG A NH2   1 
ATOM   92   N N     . VAL A 1 12  ? 31.925  4.822   43.642  1.00 39.58  ? 12  VAL A N     1 
ATOM   93   C CA    . VAL A 1 12  ? 32.260  4.058   42.443  1.00 44.54  ? 12  VAL A CA    1 
ATOM   94   C C     . VAL A 1 12  ? 33.667  3.508   42.636  1.00 43.86  ? 12  VAL A C     1 
ATOM   95   O O     . VAL A 1 12  ? 34.364  3.863   43.583  1.00 46.96  ? 12  VAL A O     1 
ATOM   96   C CB    . VAL A 1 12  ? 32.188  4.889   41.136  1.00 42.90  ? 12  VAL A CB    1 
ATOM   97   C CG1   . VAL A 1 12  ? 30.778  5.423   40.867  1.00 38.79  ? 12  VAL A CG1   1 
ATOM   98   C CG2   . VAL A 1 12  ? 33.203  6.026   41.195  1.00 45.71  ? 12  VAL A CG2   1 
ATOM   99   N N     . ARG A 1 13  ? 34.096  2.673   41.688  1.00 38.77  ? 13  ARG A N     1 
ATOM   100  C CA    . ARG A 1 13  ? 35.333  1.914   41.834  1.00 38.37  ? 13  ARG A CA    1 
ATOM   101  C C     . ARG A 1 13  ? 36.545  2.780   42.151  1.00 39.35  ? 13  ARG A C     1 
ATOM   102  O O     . ARG A 1 13  ? 37.553  2.265   42.646  1.00 43.43  ? 13  ARG A O     1 
ATOM   103  C CB    . ARG A 1 13  ? 35.566  1.115   40.551  1.00 44.30  ? 13  ARG A CB    1 
ATOM   104  C CG    . ARG A 1 13  ? 36.898  0.439   40.453  1.00 44.31  ? 13  ARG A CG    1 
ATOM   105  C CD    . ARG A 1 13  ? 37.017  -0.589  41.504  1.00 44.67  ? 13  ARG A CD    1 
ATOM   106  N NE    . ARG A 1 13  ? 38.266  -1.322  41.419  1.00 44.64  ? 13  ARG A NE    1 
ATOM   107  C CZ    . ARG A 1 13  ? 39.384  -0.918  42.000  1.00 45.92  ? 13  ARG A CZ    1 
ATOM   108  N NH1   . ARG A 1 13  ? 39.397  0.226   42.670  1.00 38.94  ? 13  ARG A NH1   1 
ATOM   109  N NH2   . ARG A 1 13  ? 40.484  -1.654  41.901  1.00 51.03  ? 13  ARG A NH2   1 
ATOM   110  N N     . GLY A 1 14  ? 36.476  4.078   41.905  1.00 39.91  ? 14  GLY A N     1 
ATOM   111  C CA    . GLY A 1 14  ? 37.652  4.904   42.067  1.00 42.79  ? 14  GLY A CA    1 
ATOM   112  C C     . GLY A 1 14  ? 37.571  5.807   43.276  1.00 49.05  ? 14  GLY A C     1 
ATOM   113  O O     . GLY A 1 14  ? 38.554  6.461   43.649  1.00 50.56  ? 14  GLY A O     1 
ATOM   114  N N     . GLY A 1 15  ? 36.396  5.878   43.884  1.00 45.04  ? 15  GLY A N     1 
ATOM   115  C CA    . GLY A 1 15  ? 36.236  6.695   45.063  1.00 45.62  ? 15  GLY A CA    1 
ATOM   116  C C     . GLY A 1 15  ? 34.793  7.099   45.289  1.00 45.84  ? 15  GLY A C     1 
ATOM   117  O O     . GLY A 1 15  ? 33.859  6.529   44.717  1.00 44.83  ? 15  GLY A O     1 
ATOM   118  N N     . GLN A 1 16  ? 34.646  8.088   46.163  1.00 45.28  ? 16  GLN A N     1 
ATOM   119  C CA    . GLN A 1 16  ? 33.370  8.672   46.536  1.00 46.78  ? 16  GLN A CA    1 
ATOM   120  C C     . GLN A 1 16  ? 33.080  9.898   45.682  1.00 43.23  ? 16  GLN A C     1 
ATOM   121  O O     . GLN A 1 16  ? 33.988  10.658  45.328  1.00 46.78  ? 16  GLN A O     1 
ATOM   122  C CB    . GLN A 1 16  ? 33.377  9.059   48.026  1.00 43.35  ? 16  GLN A CB    1 
ATOM   123  C CG    . GLN A 1 16  ? 32.900  7.960   48.938  1.00 45.35  ? 16  GLN A CG    1 
ATOM   124  C CD    . GLN A 1 16  ? 33.151  8.255   50.402  1.00 52.53  ? 16  GLN A CD    1 
ATOM   125  O OE1   . GLN A 1 16  ? 34.262  8.629   50.793  1.00 52.78  ? 16  GLN A OE1   1 
ATOM   126  N NE2   . GLN A 1 16  ? 32.115  8.087   51.222  1.00 45.66  ? 16  GLN A NE2   1 
ATOM   127  N N     . LEU A 1 17  ? 31.802  10.106  45.377  1.00 38.98  ? 17  LEU A N     1 
ATOM   128  C CA    . LEU A 1 17  ? 31.377  11.274  44.619  1.00 43.29  ? 17  LEU A CA    1 
ATOM   129  C C     . LEU A 1 17  ? 30.206  11.949  45.290  1.00 42.89  ? 17  LEU A C     1 
ATOM   130  O O     . LEU A 1 17  ? 29.338  11.289  45.867  1.00 47.35  ? 17  LEU A O     1 
ATOM   131  C CB    . LEU A 1 17  ? 30.942  10.929  43.185  1.00 43.10  ? 17  LEU A CB    1 
ATOM   132  C CG    . LEU A 1 17  ? 31.784  9.950   42.416  1.00 40.89  ? 17  LEU A CG    1 
ATOM   133  C CD1   . LEU A 1 17  ? 30.950  9.445   41.277  1.00 41.98  ? 17  LEU A CD1   1 
ATOM   134  C CD2   . LEU A 1 17  ? 33.061  10.660  41.983  1.00 49.83  ? 17  LEU A CD2   1 
ATOM   135  N N     . ARG A 1 18  ? 30.168  13.263  45.168  1.00 42.55  ? 18  ARG A N     1 
ATOM   136  C CA    . ARG A 1 18  ? 29.047  14.057  45.643  1.00 47.33  ? 18  ARG A CA    1 
ATOM   137  C C     . ARG A 1 18  ? 28.376  14.645  44.407  1.00 46.01  ? 18  ARG A C     1 
ATOM   138  O O     . ARG A 1 18  ? 28.966  15.484  43.717  1.00 41.46  ? 18  ARG A O     1 
ATOM   139  C CB    . ARG A 1 18  ? 29.510  15.141  46.619  1.00 43.65  ? 18  ARG A CB    1 
ATOM   140  C CG    . ARG A 1 18  ? 28.406  16.044  47.120  1.00 49.09  ? 18  ARG A CG    1 
ATOM   141  C CD    . ARG A 1 18  ? 28.907  16.980  48.213  1.00 57.30  ? 18  ARG A CD    1 
ATOM   142  N NE    . ARG A 1 18  ? 30.156  17.624  47.818  1.00 66.37  ? 18  ARG A NE    1 
ATOM   143  C CZ    . ARG A 1 18  ? 31.327  17.441  48.425  1.00 66.34  ? 18  ARG A CZ    1 
ATOM   144  N NH1   . ARG A 1 18  ? 31.416  16.638  49.482  1.00 57.17  ? 18  ARG A NH1   1 
ATOM   145  N NH2   . ARG A 1 18  ? 32.413  18.068  47.973  1.00 62.81  ? 18  ARG A NH2   1 
ATOM   146  N N     . GLY A 1 19  ? 27.163  14.184  44.119  1.00 43.31  ? 19  GLY A N     1 
ATOM   147  C CA    . GLY A 1 19  ? 26.356  14.751  43.063  1.00 46.01  ? 19  GLY A CA    1 
ATOM   148  C C     . GLY A 1 19  ? 25.618  16.015  43.476  1.00 48.08  ? 19  GLY A C     1 
ATOM   149  O O     . GLY A 1 19  ? 25.891  16.645  44.500  1.00 46.16  ? 19  GLY A O     1 
ATOM   150  N N     . ILE A 1 20  ? 24.645  16.377  42.644  1.00 44.08  ? 20  ILE A N     1 
ATOM   151  C CA    . ILE A 1 20  ? 23.908  17.622  42.791  1.00 43.49  ? 20  ILE A CA    1 
ATOM   152  C C     . ILE A 1 20  ? 22.451  17.382  42.425  1.00 47.64  ? 20  ILE A C     1 
ATOM   153  O O     . ILE A 1 20  ? 22.137  16.604  41.513  1.00 50.96  ? 20  ILE A O     1 
ATOM   154  C CB    . ILE A 1 20  ? 24.513  18.732  41.916  1.00 45.52  ? 20  ILE A CB    1 
ATOM   155  C CG1   . ILE A 1 20  ? 23.872  20.064  42.249  1.00 41.88  ? 20  ILE A CG1   1 
ATOM   156  C CG2   . ILE A 1 20  ? 24.330  18.411  40.424  1.00 44.73  ? 20  ILE A CG2   1 
ATOM   157  C CD1   . ILE A 1 20  ? 24.608  21.199  41.647  1.00 42.99  ? 20  ILE A CD1   1 
ATOM   158  N N     . ARG A 1 21  ? 21.563  18.062  43.127  1.00 41.46  ? 21  ARG A N     1 
ATOM   159  C CA    . ARG A 1 21  ? 20.134  17.898  42.936  1.00 46.75  ? 21  ARG A CA    1 
ATOM   160  C C     . ARG A 1 21  ? 19.650  19.040  42.052  1.00 49.79  ? 21  ARG A C     1 
ATOM   161  O O     . ARG A 1 21  ? 19.622  20.195  42.485  1.00 51.99  ? 21  ARG A O     1 
ATOM   162  C CB    . ARG A 1 21  ? 19.426  17.875  44.286  1.00 47.16  ? 21  ARG A CB    1 
ATOM   163  C CG    . ARG A 1 21  ? 17.928  17.771  44.221  1.00 50.76  ? 21  ARG A CG    1 
ATOM   164  C CD    . ARG A 1 21  ? 17.315  18.300  45.499  1.00 54.19  ? 21  ARG A CD    1 
ATOM   165  N NE    . ARG A 1 21  ? 16.164  19.136  45.188  1.00 67.01  ? 21  ARG A NE    1 
ATOM   166  C CZ    . ARG A 1 21  ? 14.954  18.977  45.711  1.00 64.48  ? 21  ARG A CZ    1 
ATOM   167  N NH1   . ARG A 1 21  ? 14.736  18.010  46.593  1.00 65.06  ? 21  ARG A NH1   1 
ATOM   168  N NH2   . ARG A 1 21  ? 13.966  19.790  45.344  1.00 63.17  ? 21  ARG A NH2   1 
ATOM   169  N N     . LEU A 1 22  ? 19.297  18.718  40.811  1.00 47.71  ? 22  LEU A N     1 
ATOM   170  C CA    . LEU A 1 22  ? 18.836  19.691  39.829  1.00 51.43  ? 22  LEU A CA    1 
ATOM   171  C C     . LEU A 1 22  ? 17.316  19.663  39.735  1.00 51.07  ? 22  LEU A C     1 
ATOM   172  O O     . LEU A 1 22  ? 16.675  18.652  40.024  1.00 52.30  ? 22  LEU A O     1 
ATOM   173  C CB    . LEU A 1 22  ? 19.445  19.413  38.446  1.00 45.77  ? 22  LEU A CB    1 
ATOM   174  C CG    . LEU A 1 22  ? 20.964  19.487  38.315  1.00 46.28  ? 22  LEU A CG    1 
ATOM   175  C CD1   . LEU A 1 22  ? 21.392  18.976  36.977  1.00 41.71  ? 22  LEU A CD1   1 
ATOM   176  C CD2   . LEU A 1 22  ? 21.446  20.895  38.497  1.00 47.99  ? 22  LEU A CD2   1 
ATOM   177  N N     . LYS A 1 23  ? 16.746  20.787  39.304  1.00 50.97  ? 23  LYS A N     1 
ATOM   178  C CA    . LYS A 1 23  ? 15.315  20.885  39.048  1.00 54.59  ? 23  LYS A CA    1 
ATOM   179  C C     . LYS A 1 23  ? 15.027  20.579  37.584  1.00 57.91  ? 23  LYS A C     1 
ATOM   180  O O     . LYS A 1 23  ? 15.558  21.242  36.691  1.00 60.08  ? 23  LYS A O     1 
ATOM   181  C CB    . LYS A 1 23  ? 14.789  22.276  39.397  1.00 58.07  ? 23  LYS A CB    1 
ATOM   182  C CG    . LYS A 1 23  ? 13.255  22.413  39.249  1.00 70.97  ? 23  LYS A CG    1 
ATOM   183  C CD    . LYS A 1 23  ? 12.512  21.935  40.536  1.00 76.18  ? 23  LYS A CD    1 
ATOM   184  C CE    . LYS A 1 23  ? 11.481  20.797  40.327  1.00 74.62  ? 23  LYS A CE    1 
ATOM   185  N NZ    . LYS A 1 23  ? 10.811  20.335  41.605  1.00 74.41  ? 23  LYS A NZ    1 
ATOM   186  N N     . ALA A 1 24  ? 14.215  19.568  37.335  1.00 59.17  ? 24  ALA A N     1 
ATOM   187  C CA    . ALA A 1 24  ? 13.493  19.454  36.078  1.00 58.00  ? 24  ALA A CA    1 
ATOM   188  C C     . ALA A 1 24  ? 12.120  20.066  36.266  1.00 61.14  ? 24  ALA A C     1 
ATOM   189  O O     . ALA A 1 24  ? 11.705  20.317  37.392  1.00 63.69  ? 24  ALA A O     1 
ATOM   190  C CB    . ALA A 1 24  ? 13.398  17.991  35.664  1.00 55.83  ? 24  ALA A CB    1 
ATOM   191  N N     . PRO A 1 25  ? 11.383  20.344  35.193  1.00 62.10  ? 25  PRO A N     1 
ATOM   192  C CA    . PRO A 1 25  ? 10.105  21.048  35.377  1.00 60.11  ? 25  PRO A CA    1 
ATOM   193  C C     . PRO A 1 25  ? 9.114   20.309  36.246  1.00 60.16  ? 25  PRO A C     1 
ATOM   194  O O     . PRO A 1 25  ? 8.268   20.949  36.878  1.00 63.25  ? 25  PRO A O     1 
ATOM   195  C CB    . PRO A 1 25  ? 9.586   21.199  33.946  1.00 61.80  ? 25  PRO A CB    1 
ATOM   196  C CG    . PRO A 1 25  ? 10.814  21.244  33.142  1.00 63.36  ? 25  PRO A CG    1 
ATOM   197  C CD    . PRO A 1 25  ? 11.723  20.234  33.770  1.00 61.32  ? 25  PRO A CD    1 
ATOM   198  N N     . GLY A 1 26  ? 9.182   18.988  36.301  1.00 57.66  ? 26  GLY A N     1 
ATOM   199  C CA    . GLY A 1 26  ? 8.211   18.264  37.091  1.00 56.68  ? 26  GLY A CA    1 
ATOM   200  C C     . GLY A 1 26  ? 8.794   17.566  38.302  1.00 64.26  ? 26  GLY A C     1 
ATOM   201  O O     . GLY A 1 26  ? 8.270   16.533  38.728  1.00 66.26  ? 26  GLY A O     1 
ATOM   202  N N     . GLY A 1 27  ? 9.865   18.101  38.877  1.00 58.51  ? 27  GLY A N     1 
ATOM   203  C CA    . GLY A 1 27  ? 10.497  17.434  39.985  1.00 59.28  ? 27  GLY A CA    1 
ATOM   204  C C     . GLY A 1 27  ? 12.003  17.391  39.860  1.00 60.62  ? 27  GLY A C     1 
ATOM   205  O O     . GLY A 1 27  ? 12.575  17.666  38.800  1.00 59.03  ? 27  GLY A O     1 
ATOM   206  N N     . PRO A 1 28  ? 12.675  17.039  40.951  1.00 57.72  ? 28  PRO A N     1 
ATOM   207  C CA    . PRO A 1 28  ? 14.137  17.054  40.958  1.00 55.25  ? 28  PRO A CA    1 
ATOM   208  C C     . PRO A 1 28  ? 14.715  15.814  40.296  1.00 53.14  ? 28  PRO A C     1 
ATOM   209  O O     . PRO A 1 28  ? 14.049  14.791  40.123  1.00 53.70  ? 28  PRO A O     1 
ATOM   210  C CB    . PRO A 1 28  ? 14.464  17.074  42.451  1.00 50.80  ? 28  PRO A CB    1 
ATOM   211  C CG    . PRO A 1 28  ? 13.385  16.222  43.012  1.00 51.40  ? 28  PRO A CG    1 
ATOM   212  C CD    . PRO A 1 28  ? 12.139  16.582  42.241  1.00 48.44  ? 28  PRO A CD    1 
ATOM   213  N N     . VAL A 1 29  ? 15.989  15.925  39.928  1.00 46.82  ? 29  VAL A N     1 
ATOM   214  C CA    . VAL A 1 29  ? 16.753  14.797  39.422  1.00 47.96  ? 29  VAL A CA    1 
ATOM   215  C C     . VAL A 1 29  ? 18.109  14.830  40.103  1.00 45.68  ? 29  VAL A C     1 
ATOM   216  O O     . VAL A 1 29  ? 18.572  15.874  40.570  1.00 47.49  ? 29  VAL A O     1 
ATOM   217  C CB    . VAL A 1 29  ? 16.924  14.803  37.870  1.00 46.56  ? 29  VAL A CB    1 
ATOM   218  C CG1   . VAL A 1 29  ? 15.599  14.900  37.183  1.00 42.07  ? 29  VAL A CG1   1 
ATOM   219  C CG2   . VAL A 1 29  ? 17.844  15.927  37.423  1.00 43.87  ? 29  VAL A CG2   1 
ATOM   220  N N     . SER A 1 30  ? 18.741  13.664  40.155  1.00 45.40  ? 30  SER A N     1 
ATOM   221  C CA    . SER A 1 30  ? 20.107  13.543  40.642  1.00 46.84  ? 30  SER A CA    1 
ATOM   222  C C     . SER A 1 30  ? 21.060  13.687  39.466  1.00 49.34  ? 30  SER A C     1 
ATOM   223  O O     . SER A 1 30  ? 20.841  13.077  38.412  1.00 50.58  ? 30  SER A O     1 
ATOM   224  C CB    . SER A 1 30  ? 20.319  12.191  41.323  1.00 47.72  ? 30  SER A CB    1 
ATOM   225  O OG    . SER A 1 30  ? 19.451  12.021  42.434  1.00 54.07  ? 30  SER A OG    1 
ATOM   226  N N     . ALA A 1 31  ? 22.113  14.483  39.637  1.00 46.20  ? 31  ALA A N     1 
ATOM   227  C CA    . ALA A 1 31  ? 23.128  14.613  38.599  1.00 46.34  ? 31  ALA A CA    1 
ATOM   228  C C     . ALA A 1 31  ? 24.503  14.388  39.202  1.00 48.09  ? 31  ALA A C     1 
ATOM   229  O O     . ALA A 1 31  ? 24.834  14.973  40.239  1.00 50.40  ? 31  ALA A O     1 
ATOM   230  C CB    . ALA A 1 31  ? 23.072  15.984  37.917  1.00 43.72  ? 31  ALA A CB    1 
ATOM   231  N N     . PHE A 1 32  ? 25.300  13.548  38.549  1.00 44.54  ? 32  PHE A N     1 
ATOM   232  C CA    . PHE A 1 32  ? 26.708  13.347  38.885  1.00 42.77  ? 32  PHE A CA    1 
ATOM   233  C C     . PHE A 1 32  ? 27.532  13.734  37.658  1.00 45.49  ? 32  PHE A C     1 
ATOM   234  O O     . PHE A 1 32  ? 27.713  12.926  36.742  1.00 43.55  ? 32  PHE A O     1 
ATOM   235  C CB    . PHE A 1 32  ? 26.948  11.911  39.319  1.00 43.14  ? 32  PHE A CB    1 
ATOM   236  C CG    . PHE A 1 32  ? 26.128  11.511  40.516  1.00 47.62  ? 32  PHE A CG    1 
ATOM   237  C CD1   . PHE A 1 32  ? 24.842  11.027  40.358  1.00 44.50  ? 32  PHE A CD1   1 
ATOM   238  C CD2   . PHE A 1 32  ? 26.635  11.651  41.803  1.00 44.49  ? 32  PHE A CD2   1 
ATOM   239  C CE1   . PHE A 1 32  ? 24.086  10.665  41.448  1.00 42.31  ? 32  PHE A CE1   1 
ATOM   240  C CE2   . PHE A 1 32  ? 25.877  11.301  42.896  1.00 45.01  ? 32  PHE A CE2   1 
ATOM   241  C CZ    . PHE A 1 32  ? 24.599  10.805  42.715  1.00 46.30  ? 32  PHE A CZ    1 
ATOM   242  N N     . LEU A 1 33  ? 28.023  14.973  37.648  1.00 43.80  ? 33  LEU A N     1 
ATOM   243  C CA    . LEU A 1 33  ? 28.673  15.570  36.492  1.00 42.34  ? 33  LEU A CA    1 
ATOM   244  C C     . LEU A 1 33  ? 30.188  15.602  36.664  1.00 45.77  ? 33  LEU A C     1 
ATOM   245  O O     . LEU A 1 33  ? 30.697  15.946  37.739  1.00 44.08  ? 33  LEU A O     1 
ATOM   246  C CB    . LEU A 1 33  ? 28.146  16.987  36.277  1.00 41.16  ? 33  LEU A CB    1 
ATOM   247  C CG    . LEU A 1 33  ? 26.626  17.097  36.229  1.00 40.53  ? 33  LEU A CG    1 
ATOM   248  C CD1   . LEU A 1 33  ? 26.218  18.548  36.147  1.00 41.15  ? 33  LEU A CD1   1 
ATOM   249  C CD2   . LEU A 1 33  ? 26.067  16.307  35.065  1.00 37.97  ? 33  LEU A CD2   1 
ATOM   250  N N     . GLY A 1 34  ? 30.903  15.256  35.593  1.00 41.20  ? 34  GLY A N     1 
ATOM   251  C CA    . GLY A 1 34  ? 32.353  15.320  35.593  1.00 39.54  ? 34  GLY A CA    1 
ATOM   252  C C     . GLY A 1 34  ? 33.052  14.204  36.343  1.00 45.28  ? 34  GLY A C     1 
ATOM   253  O O     . GLY A 1 34  ? 34.091  14.441  36.978  1.00 45.13  ? 34  GLY A O     1 
ATOM   254  N N     . ILE A 1 35  ? 32.503  12.996  36.312  1.00 43.97  ? 35  ILE A N     1 
ATOM   255  C CA    . ILE A 1 35  ? 33.210  11.847  36.889  1.00 39.78  ? 35  ILE A CA    1 
ATOM   256  C C     . ILE A 1 35  ? 34.354  11.469  35.961  1.00 43.09  ? 35  ILE A C     1 
ATOM   257  O O     . ILE A 1 35  ? 34.129  11.270  34.757  1.00 43.69  ? 35  ILE A O     1 
ATOM   258  C CB    . ILE A 1 35  ? 32.260  10.673  37.063  1.00 37.43  ? 35  ILE A CB    1 
ATOM   259  C CG1   . ILE A 1 35  ? 31.000  11.085  37.810  1.00 36.44  ? 35  ILE A CG1   1 
ATOM   260  C CG2   . ILE A 1 35  ? 32.974  9.528   37.729  1.00 39.77  ? 35  ILE A CG2   1 
ATOM   261  C CD1   . ILE A 1 35  ? 29.891  10.095  37.638  1.00 37.81  ? 35  ILE A CD1   1 
ATOM   262  N N     . PRO A 1 36  ? 35.577  11.365  36.446  1.00 44.08  ? 36  PRO A N     1 
ATOM   263  C CA    . PRO A 1 36  ? 36.668  10.947  35.565  1.00 41.76  ? 36  PRO A CA    1 
ATOM   264  C C     . PRO A 1 36  ? 36.588  9.453   35.330  1.00 43.01  ? 36  PRO A C     1 
ATOM   265  O O     . PRO A 1 36  ? 36.274  8.687   36.239  1.00 45.33  ? 36  PRO A O     1 
ATOM   266  C CB    . PRO A 1 36  ? 37.920  11.321  36.363  1.00 48.30  ? 36  PRO A CB    1 
ATOM   267  C CG    . PRO A 1 36  ? 37.475  11.184  37.805  1.00 41.76  ? 36  PRO A CG    1 
ATOM   268  C CD    . PRO A 1 36  ? 36.032  11.640  37.819  1.00 44.15  ? 36  PRO A CD    1 
ATOM   269  N N     . PHE A 1 37  ? 36.853  9.032   34.092  1.00 45.00  ? 37  PHE A N     1 
ATOM   270  C CA    . PHE A 1 37  ? 36.853  7.610   33.783  1.00 39.34  ? 37  PHE A CA    1 
ATOM   271  C C     . PHE A 1 37  ? 38.163  7.160   33.154  1.00 41.33  ? 37  PHE A C     1 
ATOM   272  O O     . PHE A 1 37  ? 38.289  5.988   32.786  1.00 45.53  ? 37  PHE A O     1 
ATOM   273  C CB    . PHE A 1 37  ? 35.647  7.226   32.905  1.00 40.67  ? 37  PHE A CB    1 
ATOM   274  C CG    . PHE A 1 37  ? 35.662  7.810   31.511  1.00 44.38  ? 37  PHE A CG    1 
ATOM   275  C CD1   . PHE A 1 37  ? 36.303  7.143   30.468  1.00 41.44  ? 37  PHE A CD1   1 
ATOM   276  C CD2   . PHE A 1 37  ? 35.002  8.998   31.230  1.00 43.17  ? 37  PHE A CD2   1 
ATOM   277  C CE1   . PHE A 1 37  ? 36.324  7.666   29.205  1.00 38.50  ? 37  PHE A CE1   1 
ATOM   278  C CE2   . PHE A 1 37  ? 35.016  9.513   29.941  1.00 40.83  ? 37  PHE A CE2   1 
ATOM   279  C CZ    . PHE A 1 37  ? 35.681  8.844   28.939  1.00 38.15  ? 37  PHE A CZ    1 
ATOM   280  N N     . ALA A 1 38  ? 39.162  8.034   33.081  1.00 40.51  ? 38  ALA A N     1 
ATOM   281  C CA    . ALA A 1 38  ? 40.438  7.670   32.482  1.00 41.01  ? 38  ALA A CA    1 
ATOM   282  C C     . ALA A 1 38  ? 41.526  8.537   33.092  1.00 43.45  ? 38  ALA A C     1 
ATOM   283  O O     . ALA A 1 38  ? 41.255  9.613   33.634  1.00 41.97  ? 38  ALA A O     1 
ATOM   284  C CB    . ALA A 1 38  ? 40.420  7.837   30.950  1.00 41.05  ? 38  ALA A CB    1 
ATOM   285  N N     . GLU A 1 39  ? 42.764  8.064   33.002  1.00 41.63  ? 39  GLU A N     1 
ATOM   286  C CA    . GLU A 1 39  ? 43.868  8.954   33.298  1.00 41.30  ? 39  GLU A CA    1 
ATOM   287  C C     . GLU A 1 39  ? 43.920  10.045  32.232  1.00 47.74  ? 39  GLU A C     1 
ATOM   288  O O     . GLU A 1 39  ? 43.662  9.773   31.048  1.00 46.41  ? 39  GLU A O     1 
ATOM   289  C CB    . GLU A 1 39  ? 45.187  8.195   33.362  1.00 43.90  ? 39  GLU A CB    1 
ATOM   290  C CG    . GLU A 1 39  ? 45.415  7.496   34.716  1.00 56.25  ? 39  GLU A CG    1 
ATOM   291  C CD    . GLU A 1 39  ? 45.433  8.469   35.907  1.00 55.06  ? 39  GLU A CD    1 
ATOM   292  O OE1   . GLU A 1 39  ? 46.346  9.323   35.991  1.00 57.95  ? 39  GLU A OE1   1 
ATOM   293  O OE2   . GLU A 1 39  ? 44.515  8.398   36.749  1.00 52.11  ? 39  GLU A OE2   1 
ATOM   294  N N     . PRO A 1 40  ? 44.194  11.288  32.617  1.00 46.12  ? 40  PRO A N     1 
ATOM   295  C CA    . PRO A 1 40  ? 44.182  12.386  31.653  1.00 45.43  ? 40  PRO A CA    1 
ATOM   296  C C     . PRO A 1 40  ? 45.139  12.114  30.512  1.00 46.77  ? 40  PRO A C     1 
ATOM   297  O O     . PRO A 1 40  ? 46.359  12.044  30.719  1.00 47.81  ? 40  PRO A O     1 
ATOM   298  C CB    . PRO A 1 40  ? 44.639  13.586  32.489  1.00 45.54  ? 40  PRO A CB    1 
ATOM   299  C CG    . PRO A 1 40  ? 44.252  13.216  33.863  1.00 40.52  ? 40  PRO A CG    1 
ATOM   300  C CD    . PRO A 1 40  ? 44.493  11.762  33.972  1.00 39.15  ? 40  PRO A CD    1 
ATOM   301  N N     . PRO A 1 41  ? 44.631  11.953  29.301  1.00 47.85  ? 41  PRO A N     1 
ATOM   302  C CA    . PRO A 1 41  ? 45.507  11.554  28.191  1.00 46.75  ? 41  PRO A CA    1 
ATOM   303  C C     . PRO A 1 41  ? 46.326  12.735  27.683  1.00 46.44  ? 41  PRO A C     1 
ATOM   304  O O     . PRO A 1 41  ? 46.177  13.219  26.564  1.00 45.59  ? 41  PRO A O     1 
ATOM   305  C CB    . PRO A 1 41  ? 44.503  11.023  27.165  1.00 42.52  ? 41  PRO A CB    1 
ATOM   306  C CG    . PRO A 1 41  ? 43.309  11.877  27.373  1.00 41.86  ? 41  PRO A CG    1 
ATOM   307  C CD    . PRO A 1 41  ? 43.253  12.211  28.845  1.00 43.13  ? 41  PRO A CD    1 
ATOM   308  N N     . VAL A 1 42  ? 47.225  13.219  28.539  1.00 44.23  ? 42  VAL A N     1 
ATOM   309  C CA    . VAL A 1 42  ? 48.044  14.395  28.258  1.00 42.98  ? 42  VAL A CA    1 
ATOM   310  C C     . VAL A 1 42  ? 49.499  13.967  28.130  1.00 47.08  ? 42  VAL A C     1 
ATOM   311  O O     . VAL A 1 42  ? 49.825  12.788  28.301  1.00 50.53  ? 42  VAL A O     1 
ATOM   312  C CB    . VAL A 1 42  ? 47.885  15.470  29.350  1.00 40.82  ? 42  VAL A CB    1 
ATOM   313  C CG1   . VAL A 1 42  ? 46.426  15.832  29.541  1.00 42.37  ? 42  VAL A CG1   1 
ATOM   314  C CG2   . VAL A 1 42  ? 48.443  14.977  30.650  1.00 39.31  ? 42  VAL A CG2   1 
ATOM   315  N N     . GLY A 1 43  ? 50.378  14.917  27.817  1.00 45.59  ? 43  GLY A N     1 
ATOM   316  C CA    . GLY A 1 43  ? 51.796  14.647  27.670  1.00 46.02  ? 43  GLY A CA    1 
ATOM   317  C C     . GLY A 1 43  ? 52.144  13.434  26.827  1.00 54.17  ? 43  GLY A C     1 
ATOM   318  O O     . GLY A 1 43  ? 51.752  13.349  25.657  1.00 51.55  ? 43  GLY A O     1 
ATOM   319  N N     . SER A 1 44  ? 52.880  12.481  27.414  1.00 57.55  ? 44  SER A N     1 
ATOM   320  C CA    . SER A 1 44  ? 53.265  11.272  26.695  1.00 53.98  ? 44  SER A CA    1 
ATOM   321  C C     . SER A 1 44  ? 52.072  10.392  26.373  1.00 55.73  ? 44  SER A C     1 
ATOM   322  O O     . SER A 1 44  ? 52.205  9.460   25.567  1.00 57.41  ? 44  SER A O     1 
ATOM   323  C CB    . SER A 1 44  ? 54.269  10.460  27.506  1.00 55.04  ? 44  SER A CB    1 
ATOM   324  O OG    . SER A 1 44  ? 53.620  9.838   28.604  1.00 57.50  ? 44  SER A OG    1 
ATOM   325  N N     . ARG A 1 45  ? 50.921  10.659  26.983  1.00 49.70  ? 45  ARG A N     1 
ATOM   326  C CA    . ARG A 1 45  ? 49.718  9.900   26.692  1.00 54.13  ? 45  ARG A CA    1 
ATOM   327  C C     . ARG A 1 45  ? 48.922  10.452  25.506  1.00 49.47  ? 45  ARG A C     1 
ATOM   328  O O     . ARG A 1 45  ? 48.012  9.770   25.027  1.00 48.27  ? 45  ARG A O     1 
ATOM   329  C CB    . ARG A 1 45  ? 48.846  9.821   27.957  1.00 53.84  ? 45  ARG A CB    1 
ATOM   330  C CG    . ARG A 1 45  ? 49.034  8.520   28.723  1.00 60.14  ? 45  ARG A CG    1 
ATOM   331  C CD    . ARG A 1 45  ? 48.645  7.332   27.808  1.00 65.42  ? 45  ARG A CD    1 
ATOM   332  N NE    . ARG A 1 45  ? 49.003  6.018   28.351  1.00 72.93  ? 45  ARG A NE    1 
ATOM   333  C CZ    . ARG A 1 45  ? 50.080  5.310   28.007  1.00 74.30  ? 45  ARG A CZ    1 
ATOM   334  N NH1   . ARG A 1 45  ? 50.301  4.126   28.576  1.00 83.91  ? 45  ARG A NH1   1 
ATOM   335  N NH2   . ARG A 1 45  ? 50.925  5.766   27.088  1.00 71.85  ? 45  ARG A NH2   1 
ATOM   336  N N     . ARG A 1 46  ? 49.256  11.641  25.000  1.00 50.84  ? 46  ARG A N     1 
ATOM   337  C CA    . ARG A 1 46  ? 48.605  12.163  23.800  1.00 48.69  ? 46  ARG A CA    1 
ATOM   338  C C     . ARG A 1 46  ? 48.714  11.178  22.645  1.00 47.00  ? 46  ARG A C     1 
ATOM   339  O O     . ARG A 1 46  ? 49.804  10.668  22.350  1.00 47.79  ? 46  ARG A O     1 
ATOM   340  C CB    . ARG A 1 46  ? 49.220  13.499  23.395  1.00 44.69  ? 46  ARG A CB    1 
ATOM   341  C CG    . ARG A 1 46  ? 48.620  14.065  22.135  1.00 44.68  ? 46  ARG A CG    1 
ATOM   342  C CD    . ARG A 1 46  ? 49.384  15.282  21.649  1.00 43.84  ? 46  ARG A CD    1 
ATOM   343  N NE    . ARG A 1 46  ? 48.954  16.511  22.296  1.00 43.44  ? 46  ARG A NE    1 
ATOM   344  C CZ    . ARG A 1 46  ? 49.545  17.682  22.101  1.00 45.34  ? 46  ARG A CZ    1 
ATOM   345  N NH1   . ARG A 1 46  ? 50.580  17.759  21.280  1.00 45.12  ? 46  ARG A NH1   1 
ATOM   346  N NH2   . ARG A 1 46  ? 49.105  18.773  22.716  1.00 40.40  ? 46  ARG A NH2   1 
ATOM   347  N N     . PHE A 1 47  ? 47.564  10.917  22.009  1.00 42.00  ? 47  PHE A N     1 
ATOM   348  C CA    . PHE A 1 47  ? 47.378  9.902   20.967  1.00 44.20  ? 47  PHE A CA    1 
ATOM   349  C C     . PHE A 1 47  ? 47.386  8.477   21.505  1.00 44.39  ? 47  PHE A C     1 
ATOM   350  O O     . PHE A 1 47  ? 47.156  7.541   20.741  1.00 43.92  ? 47  PHE A O     1 
ATOM   351  C CB    . PHE A 1 47  ? 48.434  9.973   19.846  1.00 43.70  ? 47  PHE A CB    1 
ATOM   352  C CG    . PHE A 1 47  ? 48.717  11.353  19.348  1.00 41.71  ? 47  PHE A CG    1 
ATOM   353  C CD1   . PHE A 1 47  ? 47.728  12.109  18.762  1.00 41.01  ? 47  PHE A CD1   1 
ATOM   354  C CD2   . PHE A 1 47  ? 49.984  11.884  19.453  1.00 42.10  ? 47  PHE A CD2   1 
ATOM   355  C CE1   . PHE A 1 47  ? 48.000  13.376  18.303  1.00 42.40  ? 47  PHE A CE1   1 
ATOM   356  C CE2   . PHE A 1 47  ? 50.261  13.147  19.002  1.00 42.67  ? 47  PHE A CE2   1 
ATOM   357  C CZ    . PHE A 1 47  ? 49.271  13.897  18.425  1.00 40.40  ? 47  PHE A CZ    1 
ATOM   358  N N     . MET A 1 48  ? 47.659  8.279   22.792  1.00 48.61  ? 48  MET A N     1 
ATOM   359  C CA    . MET A 1 48  ? 47.689  6.898   23.248  1.00 45.95  ? 48  MET A CA    1 
ATOM   360  C C     . MET A 1 48  ? 46.295  6.436   23.623  1.00 43.62  ? 48  MET A C     1 
ATOM   361  O O     . MET A 1 48  ? 45.396  7.258   23.829  1.00 41.95  ? 48  MET A O     1 
ATOM   362  C CB    . MET A 1 48  ? 48.625  6.755   24.442  1.00 49.67  ? 48  MET A CB    1 
ATOM   363  C CG    . MET A 1 48  ? 50.096  6.867   24.112  1.00 54.99  ? 48  MET A CG    1 
ATOM   364  S SD    . MET A 1 48  ? 50.562  5.701   22.815  1.00 69.14  ? 48  MET A SD    1 
ATOM   365  C CE    . MET A 1 48  ? 50.980  4.266   23.786  1.00 58.95  ? 48  MET A CE    1 
ATOM   366  N N     . PRO A 1 49  ? 46.077  5.122   23.686  1.00 44.80  ? 49  PRO A N     1 
ATOM   367  C CA    . PRO A 1 49  ? 44.823  4.609   24.233  1.00 41.52  ? 49  PRO A CA    1 
ATOM   368  C C     . PRO A 1 49  ? 44.635  5.071   25.672  1.00 40.16  ? 49  PRO A C     1 
ATOM   369  O O     . PRO A 1 49  ? 45.617  5.335   26.385  1.00 48.46  ? 49  PRO A O     1 
ATOM   370  C CB    . PRO A 1 49  ? 44.998  3.089   24.162  1.00 38.84  ? 49  PRO A CB    1 
ATOM   371  C CG    . PRO A 1 49  ? 45.954  2.877   23.090  1.00 41.59  ? 49  PRO A CG    1 
ATOM   372  C CD    . PRO A 1 49  ? 46.893  4.054   23.094  1.00 45.65  ? 49  PRO A CD    1 
ATOM   373  N N     . PRO A 1 50  ? 43.395  5.170   26.126  1.00 39.42  ? 50  PRO A N     1 
ATOM   374  C CA    . PRO A 1 50  ? 43.161  5.701   27.471  1.00 45.17  ? 50  PRO A CA    1 
ATOM   375  C C     . PRO A 1 50  ? 43.492  4.652   28.523  1.00 44.91  ? 50  PRO A C     1 
ATOM   376  O O     . PRO A 1 50  ? 43.121  3.486   28.382  1.00 47.65  ? 50  PRO A O     1 
ATOM   377  C CB    . PRO A 1 50  ? 41.668  6.036   27.454  1.00 47.17  ? 50  PRO A CB    1 
ATOM   378  C CG    . PRO A 1 50  ? 41.079  5.064   26.461  1.00 36.44  ? 50  PRO A CG    1 
ATOM   379  C CD    . PRO A 1 50  ? 42.159  4.677   25.505  1.00 40.35  ? 50  PRO A CD    1 
ATOM   380  N N     . GLU A 1 51  ? 44.227  5.068   29.572  1.00 47.69  ? 51  GLU A N     1 
ATOM   381  C CA    . GLU A 1 51  ? 44.298  4.121   30.681  1.00 48.37  ? 51  GLU A CA    1 
ATOM   382  C C     . GLU A 1 51  ? 43.165  4.364   31.678  1.00 43.48  ? 51  GLU A C     1 
ATOM   383  O O     . GLU A 1 51  ? 42.736  5.504   31.874  1.00 43.54  ? 51  GLU A O     1 
ATOM   384  C CB    . GLU A 1 51  ? 45.628  4.239   31.419  1.00 55.22  ? 51  GLU A CB    1 
ATOM   385  C CG    . GLU A 1 51  ? 46.850  4.687   30.619  1.00 59.38  ? 51  GLU A CG    1 
ATOM   386  C CD    . GLU A 1 51  ? 48.005  5.134   31.547  1.00 76.67  ? 51  GLU A CD    1 
ATOM   387  O OE1   . GLU A 1 51  ? 47.911  4.924   32.789  1.00 81.84  ? 51  GLU A OE1   1 
ATOM   388  O OE2   . GLU A 1 51  ? 48.997  5.717   31.047  1.00 75.10  ? 51  GLU A OE2   1 
ATOM   389  N N     . PRO A 1 52  ? 42.686  3.307   32.328  1.00 44.00  ? 52  PRO A N     1 
ATOM   390  C CA    . PRO A 1 52  ? 41.694  3.463   33.411  1.00 44.05  ? 52  PRO A CA    1 
ATOM   391  C C     . PRO A 1 52  ? 42.115  4.456   34.490  1.00 39.34  ? 52  PRO A C     1 
ATOM   392  O O     . PRO A 1 52  ? 43.291  4.591   34.819  1.00 39.35  ? 52  PRO A O     1 
ATOM   393  C CB    . PRO A 1 52  ? 41.583  2.052   33.985  1.00 42.13  ? 52  PRO A CB    1 
ATOM   394  C CG    . PRO A 1 52  ? 41.914  1.160   32.793  1.00 45.52  ? 52  PRO A CG    1 
ATOM   395  C CD    . PRO A 1 52  ? 42.959  1.897   32.009  1.00 43.82  ? 52  PRO A CD    1 
ATOM   396  N N     . LYS A 1 53  ? 41.124  5.155   35.037  1.00 40.99  ? 53  LYS A N     1 
ATOM   397  C CA    . LYS A 1 53  ? 41.375  6.191   36.034  1.00 46.39  ? 53  LYS A CA    1 
ATOM   398  C C     . LYS A 1 53  ? 41.824  5.576   37.362  1.00 47.51  ? 53  LYS A C     1 
ATOM   399  O O     . LYS A 1 53  ? 41.186  4.661   37.896  1.00 44.52  ? 53  LYS A O     1 
ATOM   400  C CB    . LYS A 1 53  ? 40.115  7.048   36.237  1.00 46.43  ? 53  LYS A CB    1 
ATOM   401  C CG    . LYS A 1 53  ? 40.203  8.122   37.342  1.00 45.35  ? 53  LYS A CG    1 
ATOM   402  C CD    . LYS A 1 53  ? 41.381  9.044   37.123  1.00 43.84  ? 53  LYS A CD    1 
ATOM   403  C CE    . LYS A 1 53  ? 41.434  10.194  38.107  1.00 36.93  ? 53  LYS A CE    1 
ATOM   404  N NZ    . LYS A 1 53  ? 42.737  10.907  37.914  1.00 37.87  ? 53  LYS A NZ    1 
ATOM   405  N N     . ARG A 1 54  ? 42.938  6.071   37.877  1.00 48.24  ? 54  ARG A N     1 
ATOM   406  C CA    . ARG A 1 54  ? 43.423  5.622   39.165  1.00 48.85  ? 54  ARG A CA    1 
ATOM   407  C C     . ARG A 1 54  ? 42.477  6.099   40.270  1.00 49.36  ? 54  ARG A C     1 
ATOM   408  O O     . ARG A 1 54  ? 41.946  7.212   40.195  1.00 50.46  ? 54  ARG A O     1 
ATOM   409  C CB    . ARG A 1 54  ? 44.850  6.131   39.397  1.00 46.61  ? 54  ARG A CB    1 
ATOM   410  C CG    . ARG A 1 54  ? 45.866  5.427   38.521  1.00 50.62  ? 54  ARG A CG    1 
ATOM   411  C CD    . ARG A 1 54  ? 47.304  5.593   39.007  1.00 60.48  ? 54  ARG A CD    1 
ATOM   412  N NE    . ARG A 1 54  ? 48.148  6.275   38.021  1.00 77.26  ? 54  ARG A NE    1 
ATOM   413  C CZ    . ARG A 1 54  ? 48.512  5.774   36.835  1.00 83.58  ? 54  ARG A CZ    1 
ATOM   414  N NH1   . ARG A 1 54  ? 48.114  4.562   36.452  1.00 84.39  ? 54  ARG A NH1   1 
ATOM   415  N NH2   . ARG A 1 54  ? 49.277  6.496   36.019  1.00 79.61  ? 54  ARG A NH2   1 
ATOM   416  N N     . PRO A 1 55  ? 42.205  5.262   41.274  1.00 46.76  ? 55  PRO A N     1 
ATOM   417  C CA    . PRO A 1 55  ? 41.321  5.679   42.372  1.00 46.86  ? 55  PRO A CA    1 
ATOM   418  C C     . PRO A 1 55  ? 41.852  6.897   43.109  1.00 45.87  ? 55  PRO A C     1 
ATOM   419  O O     . PRO A 1 55  ? 43.059  7.090   43.243  1.00 47.01  ? 55  PRO A O     1 
ATOM   420  C CB    . PRO A 1 55  ? 41.294  4.450   43.280  1.00 43.02  ? 55  PRO A CB    1 
ATOM   421  C CG    . PRO A 1 55  ? 41.493  3.316   42.327  1.00 48.23  ? 55  PRO A CG    1 
ATOM   422  C CD    . PRO A 1 55  ? 42.462  3.814   41.295  1.00 43.07  ? 55  PRO A CD    1 
ATOM   423  N N     . TRP A 1 56  ? 40.929  7.727   43.579  1.00 44.39  ? 56  TRP A N     1 
ATOM   424  C CA    . TRP A 1 56  ? 41.251  8.965   44.269  1.00 46.14  ? 56  TRP A CA    1 
ATOM   425  C C     . TRP A 1 56  ? 40.811  8.870   45.727  1.00 54.62  ? 56  TRP A C     1 
ATOM   426  O O     . TRP A 1 56  ? 40.048  7.975   46.116  1.00 53.60  ? 56  TRP A O     1 
ATOM   427  C CB    . TRP A 1 56  ? 40.568  10.155  43.588  1.00 46.23  ? 56  TRP A CB    1 
ATOM   428  C CG    . TRP A 1 56  ? 39.093  10.017  43.627  1.00 48.50  ? 56  TRP A CG    1 
ATOM   429  C CD1   . TRP A 1 56  ? 38.258  10.416  44.632  1.00 51.55  ? 56  TRP A CD1   1 
ATOM   430  C CD2   . TRP A 1 56  ? 38.266  9.404   42.638  1.00 49.36  ? 56  TRP A CD2   1 
ATOM   431  N NE1   . TRP A 1 56  ? 36.961  10.096  44.324  1.00 50.08  ? 56  TRP A NE1   1 
ATOM   432  C CE2   . TRP A 1 56  ? 36.938  9.473   43.104  1.00 49.96  ? 56  TRP A CE2   1 
ATOM   433  C CE3   . TRP A 1 56  ? 38.514  8.820   41.392  1.00 48.20  ? 56  TRP A CE3   1 
ATOM   434  C CZ2   . TRP A 1 56  ? 35.865  8.972   42.373  1.00 49.12  ? 56  TRP A CZ2   1 
ATOM   435  C CZ3   . TRP A 1 56  ? 37.448  8.322   40.669  1.00 48.13  ? 56  TRP A CZ3   1 
ATOM   436  C CH2   . TRP A 1 56  ? 36.138  8.400   41.162  1.00 49.95  ? 56  TRP A CH2   1 
ATOM   437  N N     . SER A 1 57  ? 41.282  9.815   46.540  1.00 51.44  ? 57  SER A N     1 
ATOM   438  C CA    . SER A 1 57  ? 40.948  9.823   47.956  1.00 57.65  ? 57  SER A CA    1 
ATOM   439  C C     . SER A 1 57  ? 40.013  10.978  48.275  1.00 55.61  ? 57  SER A C     1 
ATOM   440  O O     . SER A 1 57  ? 40.014  12.009  47.595  1.00 55.24  ? 57  SER A O     1 
ATOM   441  C CB    . SER A 1 57  ? 42.200  9.917   48.838  1.00 61.71  ? 57  SER A CB    1 
ATOM   442  O OG    . SER A 1 57  ? 42.953  11.076  48.532  1.00 72.54  ? 57  SER A OG    1 
ATOM   443  N N     . GLY A 1 58  ? 39.230  10.803  49.326  1.00 46.70  ? 58  GLY A N     1 
ATOM   444  C CA    . GLY A 1 58  ? 38.268  11.823  49.626  1.00 46.17  ? 58  GLY A CA    1 
ATOM   445  C C     . GLY A 1 58  ? 37.084  11.766  48.682  1.00 48.76  ? 58  GLY A C     1 
ATOM   446  O O     . GLY A 1 58  ? 36.920  10.856  47.868  1.00 52.90  ? 58  GLY A O     1 
ATOM   447  N N     . VAL A 1 59  ? 36.242  12.778  48.811  1.00 48.96  ? 59  VAL A N     1 
ATOM   448  C CA    . VAL A 1 59  ? 35.015  12.872  48.033  1.00 49.42  ? 59  VAL A CA    1 
ATOM   449  C C     . VAL A 1 59  ? 35.290  13.764  46.837  1.00 47.69  ? 59  VAL A C     1 
ATOM   450  O O     . VAL A 1 59  ? 35.529  14.966  46.991  1.00 48.96  ? 59  VAL A O     1 
ATOM   451  C CB    . VAL A 1 59  ? 33.856  13.428  48.863  1.00 48.79  ? 59  VAL A CB    1 
ATOM   452  C CG1   . VAL A 1 59  ? 32.594  13.447  48.014  1.00 43.05  ? 59  VAL A CG1   1 
ATOM   453  C CG2   . VAL A 1 59  ? 33.683  12.626  50.169  1.00 44.83  ? 59  VAL A CG2   1 
ATOM   454  N N     . LEU A 1 60  ? 35.260  13.184  45.645  1.00 46.64  ? 60  LEU A N     1 
ATOM   455  C CA    . LEU A 1 60  ? 35.337  13.994  44.441  1.00 47.87  ? 60  LEU A CA    1 
ATOM   456  C C     . LEU A 1 60  ? 34.040  14.779  44.263  1.00 49.03  ? 60  LEU A C     1 
ATOM   457  O O     . LEU A 1 60  ? 32.935  14.237  44.411  1.00 45.52  ? 60  LEU A O     1 
ATOM   458  C CB    . LEU A 1 60  ? 35.597  13.109  43.229  1.00 48.11  ? 60  LEU A CB    1 
ATOM   459  C CG    . LEU A 1 60  ? 35.879  13.857  41.930  1.00 47.83  ? 60  LEU A CG    1 
ATOM   460  C CD1   . LEU A 1 60  ? 37.278  13.544  41.422  1.00 47.85  ? 60  LEU A CD1   1 
ATOM   461  C CD2   . LEU A 1 60  ? 34.863  13.481  40.904  1.00 43.61  ? 60  LEU A CD2   1 
ATOM   462  N N     . ASP A 1 61  ? 34.163  16.065  43.963  1.00 45.54  ? 61  ASP A N     1 
ATOM   463  C CA    . ASP A 1 61  ? 32.976  16.841  43.650  1.00 48.73  ? 61  ASP A CA    1 
ATOM   464  C C     . ASP A 1 61  ? 32.514  16.572  42.215  1.00 46.28  ? 61  ASP A C     1 
ATOM   465  O O     . ASP A 1 61  ? 33.292  16.698  41.262  1.00 46.93  ? 61  ASP A O     1 
ATOM   466  C CB    . ASP A 1 61  ? 33.232  18.326  43.846  1.00 46.57  ? 61  ASP A CB    1 
ATOM   467  C CG    . ASP A 1 61  ? 31.969  19.130  43.669  1.00 56.81  ? 61  ASP A CG    1 
ATOM   468  O OD1   . ASP A 1 61  ? 31.573  19.338  42.491  1.00 53.49  ? 61  ASP A OD1   1 
ATOM   469  O OD2   . ASP A 1 61  ? 31.351  19.497  44.708  1.00 61.09  ? 61  ASP A OD2   1 
ATOM   470  N N     . ALA A 1 62  ? 31.241  16.220  42.069  1.00 42.82  ? 62  ALA A N     1 
ATOM   471  C CA    . ALA A 1 62  ? 30.644  15.794  40.812  1.00 40.44  ? 62  ALA A CA    1 
ATOM   472  C C     . ALA A 1 62  ? 29.405  16.620  40.526  1.00 42.65  ? 62  ALA A C     1 
ATOM   473  O O     . ALA A 1 62  ? 28.338  16.096  40.195  1.00 42.37  ? 62  ALA A O     1 
ATOM   474  C CB    . ALA A 1 62  ? 30.296  14.311  40.840  1.00 36.13  ? 62  ALA A CB    1 
ATOM   475  N N     . THR A 1 63  ? 29.544  17.937  40.660  1.00 45.96  ? 63  THR A N     1 
ATOM   476  C CA    . THR A 1 63  ? 28.423  18.861  40.558  1.00 45.09  ? 63  THR A CA    1 
ATOM   477  C C     . THR A 1 63  ? 28.504  19.823  39.383  1.00 47.90  ? 63  THR A C     1 
ATOM   478  O O     . THR A 1 63  ? 27.535  20.548  39.148  1.00 48.57  ? 63  THR A O     1 
ATOM   479  C CB    . THR A 1 63  ? 28.297  19.697  41.837  1.00 47.70  ? 63  THR A CB    1 
ATOM   480  O OG1   . THR A 1 63  ? 29.373  20.635  41.879  1.00 48.88  ? 63  THR A OG1   1 
ATOM   481  C CG2   . THR A 1 63  ? 28.367  18.809  43.077  1.00 43.06  ? 63  THR A CG2   1 
ATOM   482  N N     . THR A 1 64  ? 29.622  19.875  38.657  1.00 48.13  ? 64  THR A N     1 
ATOM   483  C CA    . THR A 1 64  ? 29.743  20.748  37.500  1.00 46.86  ? 64  THR A CA    1 
ATOM   484  C C     . THR A 1 64  ? 30.363  19.990  36.335  1.00 48.64  ? 64  THR A C     1 
ATOM   485  O O     . THR A 1 64  ? 31.111  19.029  36.526  1.00 49.31  ? 64  THR A O     1 
ATOM   486  C CB    . THR A 1 64  ? 30.606  21.969  37.787  1.00 48.20  ? 64  THR A CB    1 
ATOM   487  O OG1   . THR A 1 64  ? 31.967  21.550  37.931  1.00 51.96  ? 64  THR A OG1   1 
ATOM   488  C CG2   . THR A 1 64  ? 30.144  22.665  39.048  1.00 50.88  ? 64  THR A CG2   1 
ATOM   489  N N     . PHE A 1 65  ? 30.065  20.451  35.126  1.00 46.32  ? 65  PHE A N     1 
ATOM   490  C CA    . PHE A 1 65  ? 30.623  19.826  33.940  1.00 43.66  ? 65  PHE A CA    1 
ATOM   491  C C     . PHE A 1 65  ? 32.123  20.073  33.861  1.00 44.85  ? 65  PHE A C     1 
ATOM   492  O O     . PHE A 1 65  ? 32.601  21.171  34.157  1.00 47.12  ? 65  PHE A O     1 
ATOM   493  C CB    . PHE A 1 65  ? 29.949  20.375  32.685  1.00 44.58  ? 65  PHE A CB    1 
ATOM   494  C CG    . PHE A 1 65  ? 28.571  19.844  32.451  1.00 41.40  ? 65  PHE A CG    1 
ATOM   495  C CD1   . PHE A 1 65  ? 28.355  18.485  32.302  1.00 40.50  ? 65  PHE A CD1   1 
ATOM   496  C CD2   . PHE A 1 65  ? 27.497  20.707  32.340  1.00 41.24  ? 65  PHE A CD2   1 
ATOM   497  C CE1   . PHE A 1 65  ? 27.082  17.993  32.068  1.00 39.99  ? 65  PHE A CE1   1 
ATOM   498  C CE2   . PHE A 1 65  ? 26.223  20.222  32.118  1.00 41.79  ? 65  PHE A CE2   1 
ATOM   499  C CZ    . PHE A 1 65  ? 26.014  18.859  31.985  1.00 38.64  ? 65  PHE A CZ    1 
ATOM   500  N N     . GLN A 1 66  ? 32.860  19.054  33.418  1.00 42.01  ? 66  GLN A N     1 
ATOM   501  C CA    . GLN A 1 66  ? 34.305  19.133  33.289  1.00 41.08  ? 66  GLN A CA    1 
ATOM   502  C C     . GLN A 1 66  ? 34.710  19.706  31.930  1.00 41.81  ? 66  GLN A C     1 
ATOM   503  O O     . GLN A 1 66  ? 33.875  20.058  31.097  1.00 42.49  ? 66  GLN A O     1 
ATOM   504  C CB    . GLN A 1 66  ? 34.927  17.759  33.510  1.00 41.43  ? 66  GLN A CB    1 
ATOM   505  C CG    . GLN A 1 66  ? 35.330  17.487  34.952  1.00 48.76  ? 66  GLN A CG    1 
ATOM   506  C CD    . GLN A 1 66  ? 36.616  18.216  35.366  1.00 51.74  ? 66  GLN A CD    1 
ATOM   507  O OE1   . GLN A 1 66  ? 37.158  19.037  34.612  1.00 49.06  ? 66  GLN A OE1   1 
ATOM   508  N NE2   . GLN A 1 66  ? 37.113  17.903  36.564  1.00 43.98  ? 66  GLN A NE2   1 
ATOM   509  N N     . ASN A 1 67  ? 36.017  19.802  31.704  1.00 41.54  ? 67  ASN A N     1 
ATOM   510  C CA    . ASN A 1 67  ? 36.536  20.343  30.453  1.00 40.92  ? 67  ASN A CA    1 
ATOM   511  C C     . ASN A 1 67  ? 36.000  19.586  29.246  1.00 38.95  ? 67  ASN A C     1 
ATOM   512  O O     . ASN A 1 67  ? 35.768  18.379  29.292  1.00 38.61  ? 67  ASN A O     1 
ATOM   513  C CB    . ASN A 1 67  ? 38.062  20.282  30.440  1.00 41.33  ? 67  ASN A CB    1 
ATOM   514  C CG    . ASN A 1 67  ? 38.674  21.000  31.616  1.00 43.69  ? 67  ASN A CG    1 
ATOM   515  O OD1   . ASN A 1 67  ? 38.211  22.074  32.024  1.00 43.28  ? 67  ASN A OD1   1 
ATOM   516  N ND2   . ASN A 1 67  ? 39.717  20.411  32.175  1.00 44.49  ? 67  ASN A ND2   1 
ATOM   517  N N     . VAL A 1 68  ? 35.809  20.298  28.160  1.00 39.29  ? 68  VAL A N     1 
ATOM   518  C CA    . VAL A 1 68  ? 35.498  19.616  26.915  1.00 38.93  ? 68  VAL A CA    1 
ATOM   519  C C     . VAL A 1 68  ? 36.795  19.406  26.155  1.00 38.73  ? 68  VAL A C     1 
ATOM   520  O O     . VAL A 1 68  ? 37.745  20.188  26.267  1.00 38.27  ? 68  VAL A O     1 
ATOM   521  C CB    . VAL A 1 68  ? 34.448  20.375  26.080  1.00 42.16  ? 68  VAL A CB    1 
ATOM   522  C CG1   . VAL A 1 68  ? 33.642  21.300  26.962  1.00 37.84  ? 68  VAL A CG1   1 
ATOM   523  C CG2   . VAL A 1 68  ? 35.077  21.074  24.912  1.00 36.43  ? 68  VAL A CG2   1 
ATOM   524  N N     . CYS A 1 69  ? 36.842  18.312  25.401  1.00 40.80  ? 69  CYS A N     1 
ATOM   525  C CA    . CYS A 1 69  ? 38.075  17.910  24.745  1.00 39.52  ? 69  CYS A CA    1 
ATOM   526  C C     . CYS A 1 69  ? 38.523  18.958  23.731  1.00 40.89  ? 69  CYS A C     1 
ATOM   527  O O     . CYS A 1 69  ? 37.710  19.678  23.143  1.00 38.60  ? 69  CYS A O     1 
ATOM   528  C CB    . CYS A 1 69  ? 37.881  16.554  24.098  1.00 36.35  ? 69  CYS A CB    1 
ATOM   529  S SG    . CYS A 1 69  ? 37.612  15.279  25.355  1.00 46.54  ? 69  CYS A SG    1 
ATOM   530  N N     . TYR A 1 70  ? 39.842  19.065  23.569  1.00 38.73  ? 70  TYR A N     1 
ATOM   531  C CA    . TYR A 1 70  ? 40.409  20.139  22.767  1.00 43.29  ? 70  TYR A CA    1 
ATOM   532  C C     . TYR A 1 70  ? 39.967  20.006  21.310  1.00 43.31  ? 70  TYR A C     1 
ATOM   533  O O     . TYR A 1 70  ? 40.065  18.929  20.717  1.00 44.28  ? 70  TYR A O     1 
ATOM   534  C CB    . TYR A 1 70  ? 41.933  20.130  22.879  1.00 42.33  ? 70  TYR A CB    1 
ATOM   535  C CG    . TYR A 1 70  ? 42.498  21.521  22.986  1.00 45.28  ? 70  TYR A CG    1 
ATOM   536  C CD1   . TYR A 1 70  ? 42.872  22.046  24.219  1.00 47.76  ? 70  TYR A CD1   1 
ATOM   537  C CD2   . TYR A 1 70  ? 42.620  22.327  21.860  1.00 45.44  ? 70  TYR A CD2   1 
ATOM   538  C CE1   . TYR A 1 70  ? 43.379  23.335  24.326  1.00 47.69  ? 70  TYR A CE1   1 
ATOM   539  C CE2   . TYR A 1 70  ? 43.119  23.611  21.949  1.00 46.30  ? 70  TYR A CE2   1 
ATOM   540  C CZ    . TYR A 1 70  ? 43.497  24.113  23.183  1.00 54.32  ? 70  TYR A CZ    1 
ATOM   541  O OH    . TYR A 1 70  ? 43.994  25.402  23.274  1.00 64.47  ? 70  TYR A OH    1 
ATOM   542  N N     . GLN A 1 71  ? 39.452  21.095  20.738  1.00 42.27  ? 71  GLN A N     1 
ATOM   543  C CA    . GLN A 1 71  ? 38.757  20.954  19.467  1.00 44.79  ? 71  GLN A CA    1 
ATOM   544  C C     . GLN A 1 71  ? 38.634  22.291  18.750  1.00 47.27  ? 71  GLN A C     1 
ATOM   545  O O     . GLN A 1 71  ? 38.726  23.361  19.355  1.00 46.87  ? 71  GLN A O     1 
ATOM   546  C CB    . GLN A 1 71  ? 37.368  20.342  19.666  1.00 41.61  ? 71  GLN A CB    1 
ATOM   547  C CG    . GLN A 1 71  ? 36.399  21.235  20.388  1.00 38.88  ? 71  GLN A CG    1 
ATOM   548  C CD    . GLN A 1 71  ? 35.109  20.524  20.731  1.00 40.33  ? 71  GLN A CD    1 
ATOM   549  O OE1   . GLN A 1 71  ? 34.031  20.933  20.313  1.00 41.33  ? 71  GLN A OE1   1 
ATOM   550  N NE2   . GLN A 1 71  ? 35.214  19.446  21.501  1.00 38.64  ? 71  GLN A NE2   1 
ATOM   551  N N     . TYR A 1 72  ? 38.420  22.196  17.436  1.00 51.98  ? 72  TYR A N     1 
ATOM   552  C CA    . TYR A 1 72  ? 38.115  23.357  16.612  1.00 51.10  ? 72  TYR A CA    1 
ATOM   553  C C     . TYR A 1 72  ? 36.829  24.022  17.091  1.00 50.43  ? 72  TYR A C     1 
ATOM   554  O O     . TYR A 1 72  ? 35.877  23.353  17.492  1.00 52.65  ? 72  TYR A O     1 
ATOM   555  C CB    . TYR A 1 72  ? 37.991  22.919  15.147  1.00 51.91  ? 72  TYR A CB    1 
ATOM   556  C CG    . TYR A 1 72  ? 37.607  24.022  14.174  1.00 61.30  ? 72  TYR A CG    1 
ATOM   557  C CD1   . TYR A 1 72  ? 36.286  24.466  14.078  1.00 61.03  ? 72  TYR A CD1   1 
ATOM   558  C CD2   . TYR A 1 72  ? 38.555  24.604  13.341  1.00 59.15  ? 72  TYR A CD2   1 
ATOM   559  C CE1   . TYR A 1 72  ? 35.923  25.469  13.210  1.00 65.83  ? 72  TYR A CE1   1 
ATOM   560  C CE2   . TYR A 1 72  ? 38.197  25.607  12.453  1.00 70.98  ? 72  TYR A CE2   1 
ATOM   561  C CZ    . TYR A 1 72  ? 36.875  26.037  12.392  1.00 74.65  ? 72  TYR A CZ    1 
ATOM   562  O OH    . TYR A 1 72  ? 36.499  27.039  11.517  1.00 74.19  ? 72  TYR A OH    1 
ATOM   563  N N     . VAL A 1 73  ? 36.796  25.346  17.050  1.00 54.63  ? 73  VAL A N     1 
ATOM   564  C CA    . VAL A 1 73  ? 35.611  26.110  17.421  1.00 56.98  ? 73  VAL A CA    1 
ATOM   565  C C     . VAL A 1 73  ? 35.083  26.856  16.201  1.00 66.14  ? 73  VAL A C     1 
ATOM   566  O O     . VAL A 1 73  ? 35.852  27.461  15.438  1.00 63.03  ? 73  VAL A O     1 
ATOM   567  C CB    . VAL A 1 73  ? 35.892  27.098  18.566  1.00 55.69  ? 73  VAL A CB    1 
ATOM   568  C CG1   . VAL A 1 73  ? 34.672  27.951  18.809  1.00 56.75  ? 73  VAL A CG1   1 
ATOM   569  C CG2   . VAL A 1 73  ? 36.303  26.355  19.826  1.00 49.99  ? 73  VAL A CG2   1 
ATOM   570  N N     . ASP A 1 74  ? 33.760  26.841  16.046  1.00 67.02  ? 74  ASP A N     1 
ATOM   571  C CA    . ASP A 1 74  ? 33.102  27.403  14.876  1.00 65.38  ? 74  ASP A CA    1 
ATOM   572  C C     . ASP A 1 74  ? 33.031  28.924  14.972  1.00 69.26  ? 74  ASP A C     1 
ATOM   573  O O     . ASP A 1 74  ? 32.567  29.472  15.973  1.00 68.64  ? 74  ASP A O     1 
ATOM   574  C CB    . ASP A 1 74  ? 31.701  26.819  14.736  1.00 63.29  ? 74  ASP A CB    1 
ATOM   575  C CG    . ASP A 1 74  ? 30.978  27.336  13.520  1.00 69.44  ? 74  ASP A CG    1 
ATOM   576  O OD1   . ASP A 1 74  ? 30.981  26.630  12.497  1.00 66.26  ? 74  ASP A OD1   1 
ATOM   577  O OD2   . ASP A 1 74  ? 30.405  28.448  13.590  1.00 74.52  ? 74  ASP A OD2   1 
ATOM   578  N N     . THR A 1 75  ? 33.464  29.601  13.904  1.00 77.30  ? 75  THR A N     1 
ATOM   579  C CA    . THR A 1 75  ? 33.631  31.049  13.881  1.00 75.46  ? 75  THR A CA    1 
ATOM   580  C C     . THR A 1 75  ? 32.989  31.678  12.659  1.00 73.40  ? 75  THR A C     1 
ATOM   581  O O     . THR A 1 75  ? 33.263  32.846  12.344  1.00 71.41  ? 75  THR A O     1 
ATOM   582  C CB    . THR A 1 75  ? 35.108  31.419  13.898  1.00 75.19  ? 75  THR A CB    1 
ATOM   583  O OG1   . THR A 1 75  ? 35.853  30.486  13.103  1.00 79.05  ? 75  THR A OG1   1 
ATOM   584  C CG2   . THR A 1 75  ? 35.643  31.494  15.322  1.00 70.61  ? 75  THR A CG2   1 
ATOM   585  N N     . LEU A 1 76  ? 32.190  30.914  11.904  1.00 69.22  ? 76  LEU A N     1 
ATOM   586  C CA    . LEU A 1 76  ? 31.625  31.430  10.668  1.00 70.89  ? 76  LEU A CA    1 
ATOM   587  C C     . LEU A 1 76  ? 30.406  32.320  10.902  1.00 70.65  ? 76  LEU A C     1 
ATOM   588  O O     . LEU A 1 76  ? 30.092  33.157  10.045  1.00 76.19  ? 76  LEU A O     1 
ATOM   589  C CB    . LEU A 1 76  ? 31.274  30.281  9.718   1.00 68.31  ? 76  LEU A CB    1 
ATOM   590  C CG    . LEU A 1 76  ? 30.485  30.650  8.458   1.00 72.36  ? 76  LEU A CG    1 
ATOM   591  C CD1   . LEU A 1 76  ? 31.326  31.455  7.422   1.00 73.17  ? 76  LEU A CD1   1 
ATOM   592  C CD2   . LEU A 1 76  ? 29.892  29.386  7.836   1.00 66.42  ? 76  LEU A CD2   1 
ATOM   593  N N     . TYR A 1 77  ? 29.709  32.179  12.021  1.00 67.57  ? 77  TYR A N     1 
ATOM   594  C CA    . TYR A 1 77  ? 28.637  33.107  12.393  1.00 66.07  ? 77  TYR A CA    1 
ATOM   595  C C     . TYR A 1 77  ? 28.767  33.438  13.867  1.00 67.89  ? 77  TYR A C     1 
ATOM   596  O O     . TYR A 1 77  ? 27.944  33.020  14.687  1.00 67.19  ? 77  TYR A O     1 
ATOM   597  C CB    . TYR A 1 77  ? 27.260  32.516  12.093  1.00 63.16  ? 77  TYR A CB    1 
ATOM   598  C CG    . TYR A 1 77  ? 26.974  32.237  10.633  1.00 65.34  ? 77  TYR A CG    1 
ATOM   599  C CD1   . TYR A 1 77  ? 26.752  33.273  9.746   1.00 61.26  ? 77  TYR A CD1   1 
ATOM   600  C CD2   . TYR A 1 77  ? 26.897  30.930  10.150  1.00 64.52  ? 77  TYR A CD2   1 
ATOM   601  C CE1   . TYR A 1 77  ? 26.472  33.027  8.428   1.00 61.06  ? 77  TYR A CE1   1 
ATOM   602  C CE2   . TYR A 1 77  ? 26.618  30.674  8.829   1.00 61.09  ? 77  TYR A CE2   1 
ATOM   603  C CZ    . TYR A 1 77  ? 26.407  31.733  7.973   1.00 62.51  ? 77  TYR A CZ    1 
ATOM   604  O OH    . TYR A 1 77  ? 26.133  31.517  6.646   1.00 66.45  ? 77  TYR A OH    1 
ATOM   605  N N     . PRO A 1 78  ? 29.812  34.173  14.246  1.00 70.96  ? 78  PRO A N     1 
ATOM   606  C CA    . PRO A 1 78  ? 30.012  34.491  15.667  1.00 67.69  ? 78  PRO A CA    1 
ATOM   607  C C     . PRO A 1 78  ? 28.766  35.090  16.305  1.00 62.40  ? 78  PRO A C     1 
ATOM   608  O O     . PRO A 1 78  ? 28.132  35.985  15.748  1.00 60.78  ? 78  PRO A O     1 
ATOM   609  C CB    . PRO A 1 78  ? 31.173  35.491  15.646  1.00 69.85  ? 78  PRO A CB    1 
ATOM   610  C CG    . PRO A 1 78  ? 31.640  35.585  14.200  1.00 69.51  ? 78  PRO A CG    1 
ATOM   611  C CD    . PRO A 1 78  ? 30.998  34.498  13.436  1.00 67.82  ? 78  PRO A CD    1 
ATOM   612  N N     . GLY A 1 79  ? 28.404  34.572  17.481  1.00 63.58  ? 79  GLY A N     1 
ATOM   613  C CA    . GLY A 1 79  ? 27.260  35.066  18.225  1.00 61.07  ? 79  GLY A CA    1 
ATOM   614  C C     . GLY A 1 79  ? 25.916  34.563  17.750  1.00 60.71  ? 79  GLY A C     1 
ATOM   615  O O     . GLY A 1 79  ? 24.906  34.791  18.429  1.00 56.65  ? 79  GLY A O     1 
ATOM   616  N N     . PHE A 1 80  ? 25.866  33.888  16.610  1.00 58.47  ? 80  PHE A N     1 
ATOM   617  C CA    . PHE A 1 80  ? 24.621  33.333  16.109  1.00 56.14  ? 80  PHE A CA    1 
ATOM   618  C C     . PHE A 1 80  ? 24.290  32.073  16.893  1.00 52.61  ? 80  PHE A C     1 
ATOM   619  O O     . PHE A 1 80  ? 25.112  31.158  16.977  1.00 51.69  ? 80  PHE A O     1 
ATOM   620  C CB    . PHE A 1 80  ? 24.756  33.035  14.612  1.00 52.77  ? 80  PHE A CB    1 
ATOM   621  C CG    . PHE A 1 80  ? 23.611  32.273  14.032  1.00 51.61  ? 80  PHE A CG    1 
ATOM   622  C CD1   . PHE A 1 80  ? 22.306  32.719  14.188  1.00 53.63  ? 80  PHE A CD1   1 
ATOM   623  C CD2   . PHE A 1 80  ? 23.842  31.118  13.300  1.00 54.09  ? 80  PHE A CD2   1 
ATOM   624  C CE1   . PHE A 1 80  ? 21.245  32.011  13.636  1.00 56.21  ? 80  PHE A CE1   1 
ATOM   625  C CE2   . PHE A 1 80  ? 22.788  30.405  12.737  1.00 52.97  ? 80  PHE A CE2   1 
ATOM   626  C CZ    . PHE A 1 80  ? 21.487  30.853  12.901  1.00 51.96  ? 80  PHE A CZ    1 
ATOM   627  N N     . GLU A 1 81  ? 23.083  32.026  17.457  1.00 51.42  ? 81  GLU A N     1 
ATOM   628  C CA    . GLU A 1 81  ? 22.705  30.906  18.315  1.00 52.46  ? 81  GLU A CA    1 
ATOM   629  C C     . GLU A 1 81  ? 22.787  29.573  17.583  1.00 53.35  ? 81  GLU A C     1 
ATOM   630  O O     . GLU A 1 81  ? 23.209  28.564  18.163  1.00 49.94  ? 81  GLU A O     1 
ATOM   631  C CB    . GLU A 1 81  ? 21.300  31.127  18.863  1.00 58.19  ? 81  GLU A CB    1 
ATOM   632  C CG    . GLU A 1 81  ? 20.566  29.853  19.222  1.00 61.34  ? 81  GLU A CG    1 
ATOM   633  C CD    . GLU A 1 81  ? 19.340  30.123  20.078  1.00 79.26  ? 81  GLU A CD    1 
ATOM   634  O OE1   . GLU A 1 81  ? 19.329  31.159  20.788  1.00 86.20  ? 81  GLU A OE1   1 
ATOM   635  O OE2   . GLU A 1 81  ? 18.385  29.311  20.034  1.00 82.54  ? 81  GLU A OE2   1 
ATOM   636  N N     . GLY A 1 82  ? 22.392  29.548  16.307  1.00 53.68  ? 82  GLY A N     1 
ATOM   637  C CA    . GLY A 1 82  ? 22.375  28.311  15.544  1.00 51.44  ? 82  GLY A CA    1 
ATOM   638  C C     . GLY A 1 82  ? 23.720  27.619  15.436  1.00 50.68  ? 82  GLY A C     1 
ATOM   639  O O     . GLY A 1 82  ? 23.765  26.411  15.180  1.00 51.78  ? 82  GLY A O     1 
ATOM   640  N N     . THR A 1 83  ? 24.818  28.352  15.603  1.00 47.20  ? 83  THR A N     1 
ATOM   641  C CA    . THR A 1 83  ? 26.128  27.719  15.682  1.00 48.62  ? 83  THR A CA    1 
ATOM   642  C C     . THR A 1 83  ? 26.667  27.616  17.106  1.00 50.45  ? 83  THR A C     1 
ATOM   643  O O     . THR A 1 83  ? 27.372  26.654  17.416  1.00 49.47  ? 83  THR A O     1 
ATOM   644  C CB    . THR A 1 83  ? 27.151  28.474  14.822  1.00 50.95  ? 83  THR A CB    1 
ATOM   645  O OG1   . THR A 1 83  ? 27.242  29.829  15.271  1.00 54.17  ? 83  THR A OG1   1 
ATOM   646  C CG2   . THR A 1 83  ? 26.758  28.453  13.353  1.00 53.82  ? 83  THR A CG2   1 
ATOM   647  N N     . GLU A 1 84  ? 26.365  28.580  17.982  1.00 49.90  ? 84  GLU A N     1 
ATOM   648  C CA    . GLU A 1 84  ? 26.986  28.587  19.299  1.00 50.57  ? 84  GLU A CA    1 
ATOM   649  C C     . GLU A 1 84  ? 26.491  27.433  20.162  1.00 50.25  ? 84  GLU A C     1 
ATOM   650  O O     . GLU A 1 84  ? 27.251  26.912  20.986  1.00 49.20  ? 84  GLU A O     1 
ATOM   651  C CB    . GLU A 1 84  ? 26.728  29.915  20.014  1.00 52.98  ? 84  GLU A CB    1 
ATOM   652  C CG    . GLU A 1 84  ? 27.235  31.163  19.307  1.00 55.74  ? 84  GLU A CG    1 
ATOM   653  C CD    . GLU A 1 84  ? 28.734  31.386  19.423  1.00 62.02  ? 84  GLU A CD    1 
ATOM   654  O OE1   . GLU A 1 84  ? 29.432  30.512  19.989  1.00 58.11  ? 84  GLU A OE1   1 
ATOM   655  O OE2   . GLU A 1 84  ? 29.212  32.444  18.926  1.00 62.74  ? 84  GLU A OE2   1 
ATOM   656  N N     . MET A 1 85  ? 25.232  27.017  19.981  1.00 48.05  ? 85  MET A N     1 
ATOM   657  C CA    . MET A 1 85  ? 24.671  25.921  20.763  1.00 39.44  ? 85  MET A CA    1 
ATOM   658  C C     . MET A 1 85  ? 25.485  24.642  20.648  1.00 41.17  ? 85  MET A C     1 
ATOM   659  O O     . MET A 1 85  ? 25.404  23.802  21.547  1.00 45.05  ? 85  MET A O     1 
ATOM   660  C CB    . MET A 1 85  ? 23.221  25.647  20.342  1.00 39.24  ? 85  MET A CB    1 
ATOM   661  C CG    . MET A 1 85  ? 23.025  25.169  18.905  1.00 45.18  ? 85  MET A CG    1 
ATOM   662  S SD    . MET A 1 85  ? 21.292  24.993  18.403  1.00 56.87  ? 85  MET A SD    1 
ATOM   663  C CE    . MET A 1 85  ? 20.793  23.490  19.248  1.00 41.64  ? 85  MET A CE    1 
ATOM   664  N N     . TRP A 1 86  ? 26.266  24.473  19.576  1.00 38.31  ? 86  TRP A N     1 
ATOM   665  C CA    . TRP A 1 86  ? 27.115  23.301  19.405  1.00 37.40  ? 86  TRP A CA    1 
ATOM   666  C C     . TRP A 1 86  ? 28.549  23.553  19.828  1.00 39.48  ? 86  TRP A C     1 
ATOM   667  O O     . TRP A 1 86  ? 29.327  22.601  19.922  1.00 37.61  ? 86  TRP A O     1 
ATOM   668  C CB    . TRP A 1 86  ? 27.112  22.821  17.942  1.00 42.29  ? 86  TRP A CB    1 
ATOM   669  C CG    . TRP A 1 86  ? 25.753  22.698  17.351  1.00 41.15  ? 86  TRP A CG    1 
ATOM   670  C CD1   . TRP A 1 86  ? 25.151  23.574  16.512  1.00 42.76  ? 86  TRP A CD1   1 
ATOM   671  C CD2   . TRP A 1 86  ? 24.810  21.644  17.580  1.00 42.56  ? 86  TRP A CD2   1 
ATOM   672  N NE1   . TRP A 1 86  ? 23.890  23.135  16.197  1.00 46.21  ? 86  TRP A NE1   1 
ATOM   673  C CE2   . TRP A 1 86  ? 23.657  21.952  16.846  1.00 43.58  ? 86  TRP A CE2   1 
ATOM   674  C CE3   . TRP A 1 86  ? 24.829  20.474  18.347  1.00 42.80  ? 86  TRP A CE3   1 
ATOM   675  C CZ2   . TRP A 1 86  ? 22.534  21.130  16.846  1.00 45.18  ? 86  TRP A CZ2   1 
ATOM   676  C CZ3   . TRP A 1 86  ? 23.714  19.660  18.353  1.00 37.56  ? 86  TRP A CZ3   1 
ATOM   677  C CH2   . TRP A 1 86  ? 22.585  19.989  17.608  1.00 43.52  ? 86  TRP A CH2   1 
ATOM   678  N N     . ASN A 1 87  ? 28.912  24.795  20.096  1.00 40.34  ? 87  ASN A N     1 
ATOM   679  C CA    . ASN A 1 87  ? 30.272  25.109  20.479  1.00 42.44  ? 87  ASN A CA    1 
ATOM   680  C C     . ASN A 1 87  ? 30.540  24.713  21.932  1.00 45.04  ? 87  ASN A C     1 
ATOM   681  O O     . ASN A 1 87  ? 29.609  24.595  22.741  1.00 42.87  ? 87  ASN A O     1 
ATOM   682  C CB    . ASN A 1 87  ? 30.530  26.598  20.273  1.00 47.63  ? 87  ASN A CB    1 
ATOM   683  C CG    . ASN A 1 87  ? 30.875  26.959  18.824  1.00 50.98  ? 87  ASN A CG    1 
ATOM   684  O OD1   . ASN A 1 87  ? 31.437  26.158  18.072  1.00 49.79  ? 87  ASN A OD1   1 
ATOM   685  N ND2   . ASN A 1 87  ? 30.560  28.187  18.446  1.00 53.79  ? 87  ASN A ND2   1 
ATOM   686  N N     . PRO A 1 88  ? 31.808  24.492  22.284  1.00 43.29  ? 88  PRO A N     1 
ATOM   687  C CA    . PRO A 1 88  ? 32.152  24.126  23.666  1.00 42.41  ? 88  PRO A CA    1 
ATOM   688  C C     . PRO A 1 88  ? 31.628  25.129  24.673  1.00 45.05  ? 88  PRO A C     1 
ATOM   689  O O     . PRO A 1 88  ? 31.662  26.337  24.439  1.00 52.60  ? 88  PRO A O     1 
ATOM   690  C CB    . PRO A 1 88  ? 33.683  24.117  23.657  1.00 43.30  ? 88  PRO A CB    1 
ATOM   691  C CG    . PRO A 1 88  ? 34.039  23.810  22.262  1.00 42.21  ? 88  PRO A CG    1 
ATOM   692  C CD    . PRO A 1 88  ? 32.988  24.486  21.408  1.00 42.81  ? 88  PRO A CD    1 
ATOM   693  N N     . ASN A 1 89  ? 31.146  24.622  25.813  1.00 44.20  ? 89  ASN A N     1 
ATOM   694  C CA    . ASN A 1 89  ? 30.618  25.481  26.868  1.00 44.19  ? 89  ASN A CA    1 
ATOM   695  C C     . ASN A 1 89  ? 31.347  25.262  28.193  1.00 50.26  ? 89  ASN A C     1 
ATOM   696  O O     . ASN A 1 89  ? 30.807  25.567  29.265  1.00 52.93  ? 89  ASN A O     1 
ATOM   697  C CB    . ASN A 1 89  ? 29.111  25.279  27.021  1.00 41.79  ? 89  ASN A CB    1 
ATOM   698  C CG    . ASN A 1 89  ? 28.760  23.891  27.438  1.00 42.20  ? 89  ASN A CG    1 
ATOM   699  O OD1   . ASN A 1 89  ? 29.534  22.972  27.230  1.00 42.98  ? 89  ASN A OD1   1 
ATOM   700  N ND2   . ASN A 1 89  ? 27.599  23.724  28.060  1.00 43.30  ? 89  ASN A ND2   1 
ATOM   701  N N     . ARG A 1 90  ? 32.560  24.720  28.135  1.00 44.32  ? 90  ARG A N     1 
ATOM   702  C CA    . ARG A 1 90  ? 33.470  24.650  29.263  1.00 42.57  ? 90  ARG A CA    1 
ATOM   703  C C     . ARG A 1 90  ? 34.870  24.848  28.711  1.00 38.88  ? 90  ARG A C     1 
ATOM   704  O O     . ARG A 1 90  ? 35.067  24.946  27.500  1.00 43.91  ? 90  ARG A O     1 
ATOM   705  C CB    . ARG A 1 90  ? 33.349  23.327  30.036  1.00 39.46  ? 90  ARG A CB    1 
ATOM   706  C CG    . ARG A 1 90  ? 32.080  23.160  30.867  1.00 41.50  ? 90  ARG A CG    1 
ATOM   707  C CD    . ARG A 1 90  ? 32.161  23.911  32.209  1.00 50.46  ? 90  ARG A CD    1 
ATOM   708  N NE    . ARG A 1 90  ? 30.891  23.912  32.943  1.00 57.62  ? 90  ARG A NE    1 
ATOM   709  C CZ    . ARG A 1 90  ? 29.773  24.521  32.528  1.00 64.30  ? 90  ARG A CZ    1 
ATOM   710  N NH1   . ARG A 1 90  ? 29.751  25.184  31.369  1.00 61.54  ? 90  ARG A NH1   1 
ATOM   711  N NH2   . ARG A 1 90  ? 28.665  24.464  33.266  1.00 63.27  ? 90  ARG A NH2   1 
ATOM   712  N N     . GLU A 1 91  ? 35.846  24.923  29.604  1.00 37.51  ? 91  GLU A N     1 
ATOM   713  C CA    . GLU A 1 91  ? 37.222  25.143  29.187  1.00 38.92  ? 91  GLU A CA    1 
ATOM   714  C C     . GLU A 1 91  ? 37.706  24.013  28.272  1.00 42.91  ? 91  GLU A C     1 
ATOM   715  O O     . GLU A 1 91  ? 37.402  22.836  28.493  1.00 44.07  ? 91  GLU A O     1 
ATOM   716  C CB    . GLU A 1 91  ? 38.099  25.257  30.431  1.00 40.34  ? 91  GLU A CB    1 
ATOM   717  C CG    . GLU A 1 91  ? 39.548  25.586  30.199  1.00 43.59  ? 91  GLU A CG    1 
ATOM   718  C CD    . GLU A 1 91  ? 40.324  25.655  31.506  1.00 55.54  ? 91  GLU A CD    1 
ATOM   719  O OE1   . GLU A 1 91  ? 39.740  26.078  32.530  1.00 55.89  ? 91  GLU A OE1   1 
ATOM   720  O OE2   . GLU A 1 91  ? 41.514  25.267  31.520  1.00 62.06  ? 91  GLU A OE2   1 
ATOM   721  N N     . LEU A 1 92  ? 38.446  24.372  27.222  1.00 40.65  ? 92  LEU A N     1 
ATOM   722  C CA    . LEU A 1 92  ? 39.067  23.363  26.363  1.00 42.50  ? 92  LEU A CA    1 
ATOM   723  C C     . LEU A 1 92  ? 40.326  22.830  27.027  1.00 44.02  ? 92  LEU A C     1 
ATOM   724  O O     . LEU A 1 92  ? 41.175  23.609  27.463  1.00 48.44  ? 92  LEU A O     1 
ATOM   725  C CB    . LEU A 1 92  ? 39.428  23.921  24.984  1.00 37.92  ? 92  LEU A CB    1 
ATOM   726  C CG    . LEU A 1 92  ? 38.360  24.473  24.044  1.00 39.99  ? 92  LEU A CG    1 
ATOM   727  C CD1   . LEU A 1 92  ? 38.908  24.662  22.613  1.00 39.89  ? 92  LEU A CD1   1 
ATOM   728  C CD2   . LEU A 1 92  ? 37.177  23.568  24.082  1.00 42.62  ? 92  LEU A CD2   1 
ATOM   729  N N     . SER A 1 93  ? 40.459  21.507  27.086  1.00 40.65  ? 93  SER A N     1 
ATOM   730  C CA    . SER A 1 93  ? 41.644  20.910  27.683  1.00 42.22  ? 93  SER A CA    1 
ATOM   731  C C     . SER A 1 93  ? 41.807  19.503  27.138  1.00 40.92  ? 93  SER A C     1 
ATOM   732  O O     . SER A 1 93  ? 40.821  18.848  26.795  1.00 41.07  ? 93  SER A O     1 
ATOM   733  C CB    . SER A 1 93  ? 41.543  20.902  29.225  1.00 40.61  ? 93  SER A CB    1 
ATOM   734  O OG    . SER A 1 93  ? 42.489  20.026  29.810  1.00 35.15  ? 93  SER A OG    1 
ATOM   735  N N     . GLU A 1 94  ? 43.063  19.045  27.052  1.00 41.37  ? 94  GLU A N     1 
ATOM   736  C CA    . GLU A 1 94  ? 43.299  17.642  26.717  1.00 40.90  ? 94  GLU A CA    1 
ATOM   737  C C     . GLU A 1 94  ? 42.912  16.726  27.860  1.00 41.49  ? 94  GLU A C     1 
ATOM   738  O O     . GLU A 1 94  ? 42.678  15.532  27.636  1.00 41.94  ? 94  GLU A O     1 
ATOM   739  C CB    . GLU A 1 94  ? 44.761  17.401  26.350  1.00 39.62  ? 94  GLU A CB    1 
ATOM   740  C CG    . GLU A 1 94  ? 45.171  17.977  25.014  1.00 41.29  ? 94  GLU A CG    1 
ATOM   741  C CD    . GLU A 1 94  ? 46.594  17.638  24.670  1.00 42.90  ? 94  GLU A CD    1 
ATOM   742  O OE1   . GLU A 1 94  ? 46.830  16.651  23.953  1.00 44.33  ? 94  GLU A OE1   1 
ATOM   743  O OE2   . GLU A 1 94  ? 47.492  18.346  25.144  1.00 50.28  ? 94  GLU A OE2   1 
ATOM   744  N N     . ASP A 1 95  ? 42.863  17.267  29.075  1.00 40.75  ? 95  ASP A N     1 
ATOM   745  C CA    . ASP A 1 95  ? 42.330  16.601  30.262  1.00 41.75  ? 95  ASP A CA    1 
ATOM   746  C C     . ASP A 1 95  ? 40.821  16.743  30.183  1.00 41.99  ? 95  ASP A C     1 
ATOM   747  O O     . ASP A 1 95  ? 40.266  17.788  30.541  1.00 42.51  ? 95  ASP A O     1 
ATOM   748  C CB    . ASP A 1 95  ? 42.903  17.261  31.511  1.00 42.58  ? 95  ASP A CB    1 
ATOM   749  C CG    . ASP A 1 95  ? 42.467  16.619  32.805  1.00 43.72  ? 95  ASP A CG    1 
ATOM   750  O OD1   . ASP A 1 95  ? 41.416  15.952  32.896  1.00 42.96  ? 95  ASP A OD1   1 
ATOM   751  O OD2   . ASP A 1 95  ? 43.221  16.820  33.772  1.00 46.77  ? 95  ASP A OD2   1 
ATOM   752  N N     . CYS A 1 96  ? 40.152  15.705  29.695  1.00 36.88  ? 96  CYS A N     1 
ATOM   753  C CA    . CYS A 1 96  ? 38.758  15.872  29.313  1.00 35.51  ? 96  CYS A CA    1 
ATOM   754  C C     . CYS A 1 96  ? 37.951  14.591  29.352  1.00 34.89  ? 96  CYS A C     1 
ATOM   755  O O     . CYS A 1 96  ? 36.744  14.647  29.102  1.00 33.57  ? 96  CYS A O     1 
ATOM   756  C CB    . CYS A 1 96  ? 38.687  16.481  27.905  1.00 40.89  ? 96  CYS A CB    1 
ATOM   757  S SG    . CYS A 1 96  ? 39.251  15.392  26.557  1.00 40.52  ? 96  CYS A SG    1 
ATOM   758  N N     . LEU A 1 97  ? 38.565  13.447  29.653  1.00 37.83  ? 97  LEU A N     1 
ATOM   759  C CA    . LEU A 1 97  ? 37.884  12.155  29.698  1.00 37.24  ? 97  LEU A CA    1 
ATOM   760  C C     . LEU A 1 97  ? 37.080  12.062  31.000  1.00 41.22  ? 97  LEU A C     1 
ATOM   761  O O     . LEU A 1 97  ? 37.507  11.511  32.016  1.00 44.71  ? 97  LEU A O     1 
ATOM   762  C CB    . LEU A 1 97  ? 38.904  11.030  29.540  1.00 37.88  ? 97  LEU A CB    1 
ATOM   763  C CG    . LEU A 1 97  ? 39.661  11.099  28.188  1.00 43.19  ? 97  LEU A CG    1 
ATOM   764  C CD1   . LEU A 1 97  ? 40.533  9.878   27.905  1.00 42.51  ? 97  LEU A CD1   1 
ATOM   765  C CD2   . LEU A 1 97  ? 38.705  11.306  27.004  1.00 40.61  ? 97  LEU A CD2   1 
ATOM   766  N N     . TYR A 1 98  ? 35.888  12.645  30.968  1.00 37.79  ? 98  TYR A N     1 
ATOM   767  C CA    . TYR A 1 98  ? 34.963  12.616  32.083  1.00 36.24  ? 98  TYR A CA    1 
ATOM   768  C C     . TYR A 1 98  ? 33.599  12.249  31.537  1.00 37.47  ? 98  TYR A C     1 
ATOM   769  O O     . TYR A 1 98  ? 33.329  12.430  30.351  1.00 42.02  ? 98  TYR A O     1 
ATOM   770  C CB    . TYR A 1 98  ? 34.898  13.967  32.804  1.00 40.32  ? 98  TYR A CB    1 
ATOM   771  C CG    . TYR A 1 98  ? 36.231  14.443  33.361  1.00 43.71  ? 98  TYR A CG    1 
ATOM   772  C CD1   . TYR A 1 98  ? 36.580  14.215  34.697  1.00 43.51  ? 98  TYR A CD1   1 
ATOM   773  C CD2   . TYR A 1 98  ? 37.136  15.120  32.554  1.00 38.76  ? 98  TYR A CD2   1 
ATOM   774  C CE1   . TYR A 1 98  ? 37.792  14.643  35.200  1.00 42.02  ? 98  TYR A CE1   1 
ATOM   775  C CE2   . TYR A 1 98  ? 38.345  15.551  33.043  1.00 42.07  ? 98  TYR A CE2   1 
ATOM   776  C CZ    . TYR A 1 98  ? 38.674  15.313  34.371  1.00 47.03  ? 98  TYR A CZ    1 
ATOM   777  O OH    . TYR A 1 98  ? 39.894  15.748  34.846  1.00 46.60  ? 98  TYR A OH    1 
ATOM   778  N N     . LEU A 1 99  ? 32.739  11.710  32.390  1.00 38.22  ? 99  LEU A N     1 
ATOM   779  C CA    . LEU A 1 99  ? 31.390  11.360  31.977  1.00 37.44  ? 99  LEU A CA    1 
ATOM   780  C C     . LEU A 1 99  ? 30.403  11.867  33.014  1.00 42.82  ? 99  LEU A C     1 
ATOM   781  O O     . LEU A 1 99  ? 30.767  12.177  34.151  1.00 46.59  ? 99  LEU A O     1 
ATOM   782  C CB    . LEU A 1 99  ? 31.214  9.841   31.767  1.00 36.88  ? 99  LEU A CB    1 
ATOM   783  C CG    . LEU A 1 99  ? 31.469  8.824   32.889  1.00 40.67  ? 99  LEU A CG    1 
ATOM   784  C CD1   . LEU A 1 99  ? 30.325  8.789   33.885  1.00 37.23  ? 99  LEU A CD1   1 
ATOM   785  C CD2   . LEU A 1 99  ? 31.703  7.413   32.323  1.00 37.27  ? 99  LEU A CD2   1 
ATOM   786  N N     . ASN A 1 100 ? 29.136  11.906  32.620  1.00 38.78  ? 100 ASN A N     1 
ATOM   787  C CA    . ASN A 1 100 ? 28.072  12.449  33.440  1.00 39.08  ? 100 ASN A CA    1 
ATOM   788  C C     . ASN A 1 100 ? 26.969  11.416  33.611  1.00 40.44  ? 100 ASN A C     1 
ATOM   789  O O     . ASN A 1 100 ? 26.711  10.612  32.711  1.00 41.88  ? 100 ASN A O     1 
ATOM   790  C CB    . ASN A 1 100 ? 27.486  13.722  32.815  1.00 41.72  ? 100 ASN A CB    1 
ATOM   791  C CG    . ASN A 1 100 ? 28.548  14.610  32.187  1.00 45.05  ? 100 ASN A CG    1 
ATOM   792  O OD1   . ASN A 1 100 ? 29.385  15.194  32.886  1.00 44.90  ? 100 ASN A OD1   1 
ATOM   793  N ND2   . ASN A 1 100 ? 28.500  14.739  30.861  1.00 40.02  ? 100 ASN A ND2   1 
ATOM   794  N N     . VAL A 1 101 ? 26.308  11.447  34.775  1.00 41.98  ? 101 VAL A N     1 
ATOM   795  C CA    . VAL A 1 101 ? 25.175  10.573  35.058  1.00 38.93  ? 101 VAL A CA    1 
ATOM   796  C C     . VAL A 1 101 ? 24.013  11.404  35.575  1.00 37.81  ? 101 VAL A C     1 
ATOM   797  O O     . VAL A 1 101 ? 24.186  12.217  36.482  1.00 40.26  ? 101 VAL A O     1 
ATOM   798  C CB    . VAL A 1 101 ? 25.538  9.479   36.074  1.00 38.54  ? 101 VAL A CB    1 
ATOM   799  C CG1   . VAL A 1 101 ? 24.409  8.484   36.176  1.00 39.65  ? 101 VAL A CG1   1 
ATOM   800  C CG2   . VAL A 1 101 ? 26.825  8.796   35.666  1.00 36.46  ? 101 VAL A CG2   1 
ATOM   801  N N     . TRP A 1 102 ? 22.842  11.220  34.973  1.00 39.75  ? 102 TRP A N     1 
ATOM   802  C CA    . TRP A 1 102 ? 21.571  11.692  35.501  1.00 40.31  ? 102 TRP A CA    1 
ATOM   803  C C     . TRP A 1 102 ? 20.740  10.479  35.887  1.00 44.31  ? 102 TRP A C     1 
ATOM   804  O O     . TRP A 1 102 ? 20.676  9.503   35.132  1.00 42.87  ? 102 TRP A O     1 
ATOM   805  C CB    . TRP A 1 102 ? 20.778  12.515  34.477  1.00 41.95  ? 102 TRP A CB    1 
ATOM   806  C CG    . TRP A 1 102 ? 21.338  13.879  34.102  1.00 44.78  ? 102 TRP A CG    1 
ATOM   807  C CD1   . TRP A 1 102 ? 20.965  15.100  34.608  1.00 43.27  ? 102 TRP A CD1   1 
ATOM   808  C CD2   . TRP A 1 102 ? 22.335  14.149  33.114  1.00 42.26  ? 102 TRP A CD2   1 
ATOM   809  N NE1   . TRP A 1 102 ? 21.688  16.106  34.009  1.00 40.65  ? 102 TRP A NE1   1 
ATOM   810  C CE2   . TRP A 1 102 ? 22.538  15.547  33.091  1.00 44.91  ? 102 TRP A CE2   1 
ATOM   811  C CE3   . TRP A 1 102 ? 23.081  13.344  32.248  1.00 42.59  ? 102 TRP A CE3   1 
ATOM   812  C CZ2   . TRP A 1 102 ? 23.448  16.155  32.224  1.00 47.45  ? 102 TRP A CZ2   1 
ATOM   813  C CZ3   . TRP A 1 102 ? 23.988  13.950  31.394  1.00 44.89  ? 102 TRP A CZ3   1 
ATOM   814  C CH2   . TRP A 1 102 ? 24.161  15.344  31.388  1.00 42.51  ? 102 TRP A CH2   1 
ATOM   815  N N     . THR A 1 103 ? 20.114  10.535  37.059  1.00 45.54  ? 103 THR A N     1 
ATOM   816  C CA    . THR A 1 103 ? 19.185  9.520   37.537  1.00 43.82  ? 103 THR A CA    1 
ATOM   817  C C     . THR A 1 103 ? 17.979  10.223  38.132  1.00 43.12  ? 103 THR A C     1 
ATOM   818  O O     . THR A 1 103 ? 18.042  11.419  38.439  1.00 43.90  ? 103 THR A O     1 
ATOM   819  C CB    . THR A 1 103 ? 19.799  8.615   38.614  1.00 44.63  ? 103 THR A CB    1 
ATOM   820  O OG1   . THR A 1 103 ? 20.036  9.393   39.794  1.00 42.62  ? 103 THR A OG1   1 
ATOM   821  C CG2   . THR A 1 103 ? 21.099  7.986   38.145  1.00 40.58  ? 103 THR A CG2   1 
ATOM   822  N N     . PRO A 1 104 ? 16.874  9.513   38.315  1.00 40.84  ? 104 PRO A N     1 
ATOM   823  C CA    . PRO A 1 104 ? 15.774  10.052  39.135  1.00 48.15  ? 104 PRO A CA    1 
ATOM   824  C C     . PRO A 1 104 ? 16.213  10.484  40.530  1.00 48.03  ? 104 PRO A C     1 
ATOM   825  O O     . PRO A 1 104 ? 17.290  10.101  40.996  1.00 47.39  ? 104 PRO A O     1 
ATOM   826  C CB    . PRO A 1 104 ? 14.789  8.882   39.207  1.00 47.83  ? 104 PRO A CB    1 
ATOM   827  C CG    . PRO A 1 104 ? 15.036  8.124   37.944  1.00 45.82  ? 104 PRO A CG    1 
ATOM   828  C CD    . PRO A 1 104 ? 16.507  8.255   37.650  1.00 42.56  ? 104 PRO A CD    1 
ATOM   829  N N     . TYR A 1 105 ? 15.401  11.301  41.192  1.00 48.58  ? 105 TYR A N     1 
ATOM   830  C CA    . TYR A 1 105 ? 15.689  11.725  42.566  1.00 53.74  ? 105 TYR A CA    1 
ATOM   831  C C     . TYR A 1 105 ? 14.499  11.490  43.497  1.00 55.57  ? 105 TYR A C     1 
ATOM   832  O O     . TYR A 1 105 ? 13.437  12.089  43.323  1.00 58.32  ? 105 TYR A O     1 
ATOM   833  C CB    . TYR A 1 105 ? 16.071  13.198  42.616  1.00 52.73  ? 105 TYR A CB    1 
ATOM   834  C CG    . TYR A 1 105 ? 16.537  13.682  43.972  1.00 50.61  ? 105 TYR A CG    1 
ATOM   835  C CD1   . TYR A 1 105 ? 17.883  13.899  44.221  1.00 49.81  ? 105 TYR A CD1   1 
ATOM   836  C CD2   . TYR A 1 105 ? 15.626  13.941  45.003  1.00 52.88  ? 105 TYR A CD2   1 
ATOM   837  C CE1   . TYR A 1 105 ? 18.314  14.356  45.463  1.00 57.70  ? 105 TYR A CE1   1 
ATOM   838  C CE2   . TYR A 1 105 ? 16.046  14.406  46.239  1.00 50.91  ? 105 TYR A CE2   1 
ATOM   839  C CZ    . TYR A 1 105 ? 17.387  14.606  46.463  1.00 51.82  ? 105 TYR A CZ    1 
ATOM   840  O OH    . TYR A 1 105 ? 17.816  15.063  47.677  1.00 45.31  ? 105 TYR A OH    1 
ATOM   841  N N     . PRO A 1 106 ? 14.683  10.653  44.521  1.00 51.94  ? 106 PRO A N     1 
ATOM   842  C CA    . PRO A 1 106 ? 15.919  9.951   44.875  1.00 55.97  ? 106 PRO A CA    1 
ATOM   843  C C     . PRO A 1 106 ? 16.193  8.824   43.898  1.00 51.23  ? 106 PRO A C     1 
ATOM   844  O O     . PRO A 1 106 ? 15.265  8.474   43.172  1.00 53.54  ? 106 PRO A O     1 
ATOM   845  C CB    . PRO A 1 106 ? 15.622  9.416   46.280  1.00 53.05  ? 106 PRO A CB    1 
ATOM   846  C CG    . PRO A 1 106 ? 14.150  9.184   46.253  1.00 46.38  ? 106 PRO A CG    1 
ATOM   847  C CD    . PRO A 1 106 ? 13.564  10.278  45.402  1.00 52.21  ? 106 PRO A CD    1 
ATOM   848  N N     . ARG A 1 107 ? 17.416  8.287   43.882  1.00 49.46  ? 107 ARG A N     1 
ATOM   849  C CA    . ARG A 1 107 ? 17.811  7.325   42.861  1.00 48.65  ? 107 ARG A CA    1 
ATOM   850  C C     . ARG A 1 107 ? 16.850  6.137   42.840  1.00 48.62  ? 107 ARG A C     1 
ATOM   851  O O     . ARG A 1 107 ? 16.201  5.842   43.840  1.00 62.88  ? 107 ARG A O     1 
ATOM   852  C CB    . ARG A 1 107 ? 19.240  6.863   43.109  1.00 45.87  ? 107 ARG A CB    1 
ATOM   853  C CG    . ARG A 1 107 ? 20.239  8.007   43.181  1.00 47.80  ? 107 ARG A CG    1 
ATOM   854  C CD    . ARG A 1 107 ? 21.660  7.468   43.140  1.00 53.97  ? 107 ARG A CD    1 
ATOM   855  N NE    . ARG A 1 107 ? 21.990  6.644   44.309  1.00 51.59  ? 107 ARG A NE    1 
ATOM   856  C CZ    . ARG A 1 107 ? 22.438  7.146   45.453  1.00 48.43  ? 107 ARG A CZ    1 
ATOM   857  N NH1   . ARG A 1 107 ? 22.601  8.453   45.560  1.00 46.90  ? 107 ARG A NH1   1 
ATOM   858  N NH2   . ARG A 1 107 ? 22.726  6.353   46.482  1.00 52.49  ? 107 ARG A NH2   1 
ATOM   859  N N     . PRO A 1 108 ? 16.711  5.455   41.708  1.00 56.90  ? 108 PRO A N     1 
ATOM   860  C CA    . PRO A 1 108 ? 15.563  4.555   41.544  1.00 60.74  ? 108 PRO A CA    1 
ATOM   861  C C     . PRO A 1 108 ? 15.633  3.333   42.452  1.00 62.08  ? 108 PRO A C     1 
ATOM   862  O O     . PRO A 1 108 ? 16.674  2.985   43.016  1.00 59.38  ? 108 PRO A O     1 
ATOM   863  C CB    . PRO A 1 108 ? 15.625  4.163   40.058  1.00 53.20  ? 108 PRO A CB    1 
ATOM   864  C CG    . PRO A 1 108 ? 17.031  4.336   39.676  1.00 48.32  ? 108 PRO A CG    1 
ATOM   865  C CD    . PRO A 1 108 ? 17.540  5.503   40.486  1.00 53.13  ? 108 PRO A CD    1 
ATOM   866  N N     . ALA A 1 109 ? 14.472  2.688   42.583  1.00 65.87  ? 109 ALA A N     1 
ATOM   867  C CA    . ALA A 1 109 ? 14.287  1.571   43.513  1.00 67.11  ? 109 ALA A CA    1 
ATOM   868  C C     . ALA A 1 109 ? 14.750  0.251   42.903  1.00 67.23  ? 109 ALA A C     1 
ATOM   869  O O     . ALA A 1 109 ? 15.693  -0.379  43.395  1.00 61.88  ? 109 ALA A O     1 
ATOM   870  C CB    . ALA A 1 109 ? 12.812  1.492   43.920  1.00 69.99  ? 109 ALA A CB    1 
ATOM   871  N N     . SER A 1 110 ? 14.068  -0.192  41.842  1.00 62.84  ? 110 SER A N     1 
ATOM   872  C CA    . SER A 1 110 ? 14.509  -1.325  41.047  1.00 59.12  ? 110 SER A CA    1 
ATOM   873  C C     . SER A 1 110 ? 15.716  -0.927  40.202  1.00 59.19  ? 110 SER A C     1 
ATOM   874  O O     . SER A 1 110 ? 16.050  0.254   40.090  1.00 54.24  ? 110 SER A O     1 
ATOM   875  C CB    . SER A 1 110 ? 13.379  -1.810  40.137  1.00 61.38  ? 110 SER A CB    1 
ATOM   876  O OG    . SER A 1 110 ? 12.198  -2.111  40.855  1.00 61.59  ? 110 SER A OG    1 
ATOM   877  N N     . PRO A 1 111 ? 16.395  -1.900  39.594  1.00 59.49  ? 111 PRO A N     1 
ATOM   878  C CA    . PRO A 1 111 ? 17.408  -1.567  38.579  1.00 59.85  ? 111 PRO A CA    1 
ATOM   879  C C     . PRO A 1 111 ? 16.755  -0.971  37.336  1.00 54.69  ? 111 PRO A C     1 
ATOM   880  O O     . PRO A 1 111 ? 15.813  -1.541  36.784  1.00 58.41  ? 111 PRO A O     1 
ATOM   881  C CB    . PRO A 1 111 ? 18.067  -2.922  38.280  1.00 57.74  ? 111 PRO A CB    1 
ATOM   882  C CG    . PRO A 1 111 ? 17.799  -3.740  39.489  1.00 54.69  ? 111 PRO A CG    1 
ATOM   883  C CD    . PRO A 1 111 ? 16.429  -3.329  39.937  1.00 56.11  ? 111 PRO A CD    1 
ATOM   884  N N     . THR A 1 112 ? 17.269  0.186   36.889  1.00 50.49  ? 112 THR A N     1 
ATOM   885  C CA    . THR A 1 112 ? 16.587  0.921   35.835  1.00 51.97  ? 112 THR A CA    1 
ATOM   886  C C     . THR A 1 112 ? 17.409  0.913   34.539  1.00 49.58  ? 112 THR A C     1 
ATOM   887  O O     . THR A 1 112 ? 18.642  0.996   34.601  1.00 48.44  ? 112 THR A O     1 
ATOM   888  C CB    . THR A 1 112 ? 16.335  2.358   36.316  1.00 52.78  ? 112 THR A CB    1 
ATOM   889  O OG1   . THR A 1 112 ? 15.659  2.306   37.576  1.00 50.32  ? 112 THR A OG1   1 
ATOM   890  C CG2   . THR A 1 112 ? 15.485  3.179   35.309  1.00 54.31  ? 112 THR A CG2   1 
ATOM   891  N N     . PRO A 1 113 ? 16.772  0.755   33.369  1.00 45.64  ? 113 PRO A N     1 
ATOM   892  C CA    . PRO A 1 113 ? 17.531  0.677   32.113  1.00 47.39  ? 113 PRO A CA    1 
ATOM   893  C C     . PRO A 1 113 ? 18.339  1.938   31.861  1.00 44.41  ? 113 PRO A C     1 
ATOM   894  O O     . PRO A 1 113 ? 17.899  3.051   32.169  1.00 43.02  ? 113 PRO A O     1 
ATOM   895  C CB    . PRO A 1 113 ? 16.450  0.506   31.044  1.00 51.49  ? 113 PRO A CB    1 
ATOM   896  C CG    . PRO A 1 113 ? 15.253  0.068   31.744  1.00 50.86  ? 113 PRO A CG    1 
ATOM   897  C CD    . PRO A 1 113 ? 15.329  0.581   33.149  1.00 49.21  ? 113 PRO A CD    1 
ATOM   898  N N     . VAL A 1 114 ? 19.513  1.751   31.264  1.00 39.96  ? 114 VAL A N     1 
ATOM   899  C CA    . VAL A 1 114 ? 20.512  2.799   31.107  1.00 42.95  ? 114 VAL A CA    1 
ATOM   900  C C     . VAL A 1 114 ? 20.576  3.262   29.652  1.00 44.44  ? 114 VAL A C     1 
ATOM   901  O O     . VAL A 1 114 ? 20.550  2.449   28.719  1.00 46.80  ? 114 VAL A O     1 
ATOM   902  C CB    . VAL A 1 114 ? 21.884  2.298   31.586  1.00 44.71  ? 114 VAL A CB    1 
ATOM   903  C CG1   . VAL A 1 114 ? 22.926  3.408   31.495  1.00 44.72  ? 114 VAL A CG1   1 
ATOM   904  C CG2   . VAL A 1 114 ? 21.771  1.778   32.996  1.00 45.38  ? 114 VAL A CG2   1 
ATOM   905  N N     . LEU A 1 115 ? 20.659  4.573   29.466  1.00 43.73  ? 115 LEU A N     1 
ATOM   906  C CA    . LEU A 1 115 ? 20.842  5.205   28.167  1.00 44.27  ? 115 LEU A CA    1 
ATOM   907  C C     . LEU A 1 115 ? 22.211  5.861   28.153  1.00 44.05  ? 115 LEU A C     1 
ATOM   908  O O     . LEU A 1 115 ? 22.488  6.737   28.978  1.00 43.58  ? 115 LEU A O     1 
ATOM   909  C CB    . LEU A 1 115 ? 19.770  6.258   27.906  1.00 44.19  ? 115 LEU A CB    1 
ATOM   910  C CG    . LEU A 1 115 ? 18.362  5.811   27.545  1.00 45.27  ? 115 LEU A CG    1 
ATOM   911  C CD1   . LEU A 1 115 ? 17.458  7.038   27.395  1.00 42.41  ? 115 LEU A CD1   1 
ATOM   912  C CD2   . LEU A 1 115 ? 18.432  5.040   26.259  1.00 43.58  ? 115 LEU A CD2   1 
ATOM   913  N N     . ILE A 1 116 ? 23.058  5.456   27.216  1.00 44.50  ? 116 ILE A N     1 
ATOM   914  C CA    . ILE A 1 116 ? 24.365  6.074   27.034  1.00 44.50  ? 116 ILE A CA    1 
ATOM   915  C C     . ILE A 1 116 ? 24.316  6.909   25.766  1.00 41.86  ? 116 ILE A C     1 
ATOM   916  O O     . ILE A 1 116 ? 24.034  6.376   24.687  1.00 41.60  ? 116 ILE A O     1 
ATOM   917  C CB    . ILE A 1 116 ? 25.476  5.024   26.955  1.00 40.35  ? 116 ILE A CB    1 
ATOM   918  C CG1   . ILE A 1 116 ? 25.408  4.134   28.186  1.00 40.58  ? 116 ILE A CG1   1 
ATOM   919  C CG2   . ILE A 1 116 ? 26.824  5.697   26.799  1.00 38.51  ? 116 ILE A CG2   1 
ATOM   920  C CD1   . ILE A 1 116 ? 26.532  3.170   28.288  1.00 40.83  ? 116 ILE A CD1   1 
ATOM   921  N N     . TRP A 1 117 ? 24.606  8.206   25.888  1.00 38.07  ? 117 TRP A N     1 
ATOM   922  C CA    . TRP A 1 117 ? 24.643  9.124   24.753  1.00 39.30  ? 117 TRP A CA    1 
ATOM   923  C C     . TRP A 1 117 ? 26.069  9.346   24.251  1.00 40.13  ? 117 TRP A C     1 
ATOM   924  O O     . TRP A 1 117 ? 26.968  9.654   25.039  1.00 44.79  ? 117 TRP A O     1 
ATOM   925  C CB    . TRP A 1 117 ? 24.022  10.463  25.136  1.00 40.85  ? 117 TRP A CB    1 
ATOM   926  C CG    . TRP A 1 117 ? 24.177  11.545  24.084  1.00 44.10  ? 117 TRP A CG    1 
ATOM   927  C CD1   . TRP A 1 117 ? 25.025  12.621  24.122  1.00 40.40  ? 117 TRP A CD1   1 
ATOM   928  C CD2   . TRP A 1 117 ? 23.449  11.655  22.858  1.00 37.86  ? 117 TRP A CD2   1 
ATOM   929  N NE1   . TRP A 1 117 ? 24.863  13.385  22.999  1.00 39.07  ? 117 TRP A NE1   1 
ATOM   930  C CE2   . TRP A 1 117 ? 23.902  12.815  22.207  1.00 38.33  ? 117 TRP A CE2   1 
ATOM   931  C CE3   . TRP A 1 117 ? 22.455  10.886  22.250  1.00 40.40  ? 117 TRP A CE3   1 
ATOM   932  C CZ2   . TRP A 1 117 ? 23.400  13.224  20.968  1.00 41.34  ? 117 TRP A CZ2   1 
ATOM   933  C CZ3   . TRP A 1 117 ? 21.949  11.294  21.014  1.00 42.16  ? 117 TRP A CZ3   1 
ATOM   934  C CH2   . TRP A 1 117 ? 22.427  12.452  20.390  1.00 40.56  ? 117 TRP A CH2   1 
ATOM   935  N N     . ILE A 1 118 ? 26.267  9.219   22.938  1.00 38.93  ? 118 ILE A N     1 
ATOM   936  C CA    . ILE A 1 118 ? 27.544  9.525   22.288  1.00 39.10  ? 118 ILE A CA    1 
ATOM   937  C C     . ILE A 1 118 ? 27.308  10.689  21.338  1.00 42.37  ? 118 ILE A C     1 
ATOM   938  O O     . ILE A 1 118 ? 26.664  10.517  20.292  1.00 43.68  ? 118 ILE A O     1 
ATOM   939  C CB    . ILE A 1 118 ? 28.116  8.330   21.519  1.00 37.32  ? 118 ILE A CB    1 
ATOM   940  C CG1   . ILE A 1 118 ? 28.108  7.075   22.369  1.00 37.57  ? 118 ILE A CG1   1 
ATOM   941  C CG2   . ILE A 1 118 ? 29.541  8.617   21.096  1.00 34.84  ? 118 ILE A CG2   1 
ATOM   942  C CD1   . ILE A 1 118 ? 28.578  5.874   21.598  1.00 37.43  ? 118 ILE A CD1   1 
ATOM   943  N N     . TYR A 1 119 ? 27.858  11.859  21.663  1.00 40.21  ? 119 TYR A N     1 
ATOM   944  C CA    . TYR A 1 119 ? 27.581  13.034  20.847  1.00 39.01  ? 119 TYR A CA    1 
ATOM   945  C C     . TYR A 1 119 ? 28.213  12.932  19.456  1.00 39.16  ? 119 TYR A C     1 
ATOM   946  O O     . TYR A 1 119 ? 29.125  12.140  19.200  1.00 37.68  ? 119 TYR A O     1 
ATOM   947  C CB    . TYR A 1 119 ? 28.066  14.310  21.531  1.00 37.02  ? 119 TYR A CB    1 
ATOM   948  C CG    . TYR A 1 119 ? 29.528  14.326  21.956  1.00 40.64  ? 119 TYR A CG    1 
ATOM   949  C CD1   . TYR A 1 119 ? 30.570  14.458  21.016  1.00 36.85  ? 119 TYR A CD1   1 
ATOM   950  C CD2   . TYR A 1 119 ? 29.865  14.274  23.316  1.00 33.99  ? 119 TYR A CD2   1 
ATOM   951  C CE1   . TYR A 1 119 ? 31.907  14.507  21.436  1.00 37.80  ? 119 TYR A CE1   1 
ATOM   952  C CE2   . TYR A 1 119 ? 31.166  14.317  23.739  1.00 32.58  ? 119 TYR A CE2   1 
ATOM   953  C CZ    . TYR A 1 119 ? 32.192  14.424  22.820  1.00 39.35  ? 119 TYR A CZ    1 
ATOM   954  O OH    . TYR A 1 119 ? 33.492  14.450  23.301  1.00 37.88  ? 119 TYR A OH    1 
ATOM   955  N N     . GLY A 1 120 ? 27.696  13.761  18.551  1.00 39.62  ? 120 GLY A N     1 
ATOM   956  C CA    . GLY A 1 120 ? 28.266  13.958  17.238  1.00 39.58  ? 120 GLY A CA    1 
ATOM   957  C C     . GLY A 1 120 ? 29.137  15.197  17.179  1.00 39.06  ? 120 GLY A C     1 
ATOM   958  O O     . GLY A 1 120 ? 29.508  15.783  18.200  1.00 43.11  ? 120 GLY A O     1 
ATOM   959  N N     . GLY A 1 121 ? 29.464  15.607  15.962  1.00 44.75  ? 121 GLY A N     1 
ATOM   960  C CA    . GLY A 1 121 ? 30.335  16.746  15.747  1.00 39.24  ? 121 GLY A CA    1 
ATOM   961  C C     . GLY A 1 121 ? 31.413  16.371  14.763  1.00 37.35  ? 121 GLY A C     1 
ATOM   962  O O     . GLY A 1 121 ? 32.551  16.837  14.866  1.00 36.23  ? 121 GLY A O     1 
ATOM   963  N N     . GLY A 1 122 ? 31.062  15.485  13.832  1.00 32.51  ? 122 GLY A N     1 
ATOM   964  C CA    . GLY A 1 122 ? 31.969  15.042  12.789  1.00 36.74  ? 122 GLY A CA    1 
ATOM   965  C C     . GLY A 1 122 ? 33.328  14.542  13.238  1.00 39.07  ? 122 GLY A C     1 
ATOM   966  O O     . GLY A 1 122 ? 34.276  14.564  12.446  1.00 37.71  ? 122 GLY A O     1 
ATOM   967  N N     . PHE A 1 123 ? 33.445  14.092  14.494  1.00 36.47  ? 123 PHE A N     1 
ATOM   968  C CA    . PHE A 1 123 ? 34.677  13.567  15.089  1.00 36.50  ? 123 PHE A CA    1 
ATOM   969  C C     . PHE A 1 123 ? 35.742  14.640  15.328  1.00 36.80  ? 123 PHE A C     1 
ATOM   970  O O     . PHE A 1 123 ? 36.882  14.308  15.678  1.00 37.89  ? 123 PHE A O     1 
ATOM   971  C CB    . PHE A 1 123 ? 35.281  12.421  14.255  1.00 34.85  ? 123 PHE A CB    1 
ATOM   972  C CG    . PHE A 1 123 ? 34.460  11.147  14.276  1.00 36.55  ? 123 PHE A CG    1 
ATOM   973  C CD1   . PHE A 1 123 ? 34.384  10.368  15.428  1.00 33.06  ? 123 PHE A CD1   1 
ATOM   974  C CD2   . PHE A 1 123 ? 33.770  10.730  13.146  1.00 36.05  ? 123 PHE A CD2   1 
ATOM   975  C CE1   . PHE A 1 123 ? 33.630  9.210   15.466  1.00 32.35  ? 123 PHE A CE1   1 
ATOM   976  C CE2   . PHE A 1 123 ? 33.016  9.563   13.164  1.00 37.25  ? 123 PHE A CE2   1 
ATOM   977  C CZ    . PHE A 1 123 ? 32.942  8.802   14.337  1.00 38.62  ? 123 PHE A CZ    1 
ATOM   978  N N     . TYR A 1 124 ? 35.407  15.919  15.173  1.00 36.17  ? 124 TYR A N     1 
ATOM   979  C CA    . TYR A 1 124 ? 36.353  17.007  15.395  1.00 37.48  ? 124 TYR A CA    1 
ATOM   980  C C     . TYR A 1 124 ? 35.863  17.959  16.476  1.00 38.82  ? 124 TYR A C     1 
ATOM   981  O O     . TYR A 1 124 ? 36.574  18.910  16.819  1.00 43.54  ? 124 TYR A O     1 
ATOM   982  C CB    . TYR A 1 124 ? 36.615  17.798  14.082  1.00 39.98  ? 124 TYR A CB    1 
ATOM   983  C CG    . TYR A 1 124 ? 35.394  18.564  13.591  1.00 40.89  ? 124 TYR A CG    1 
ATOM   984  C CD1   . TYR A 1 124 ? 35.164  19.874  13.983  1.00 41.44  ? 124 TYR A CD1   1 
ATOM   985  C CD2   . TYR A 1 124 ? 34.454  17.960  12.771  1.00 40.76  ? 124 TYR A CD2   1 
ATOM   986  C CE1   . TYR A 1 124 ? 34.033  20.560  13.569  1.00 40.23  ? 124 TYR A CE1   1 
ATOM   987  C CE2   . TYR A 1 124 ? 33.325  18.641  12.353  1.00 41.49  ? 124 TYR A CE2   1 
ATOM   988  C CZ    . TYR A 1 124 ? 33.117  19.939  12.763  1.00 41.84  ? 124 TYR A CZ    1 
ATOM   989  O OH    . TYR A 1 124 ? 31.984  20.614  12.364  1.00 49.00  ? 124 TYR A OH    1 
ATOM   990  N N     . SER A 1 125 ? 34.676  17.728  17.024  1.00 36.82  ? 125 SER A N     1 
ATOM   991  C CA    . SER A 1 125 ? 34.028  18.675  17.918  1.00 37.20  ? 125 SER A CA    1 
ATOM   992  C C     . SER A 1 125 ? 33.013  17.910  18.749  1.00 36.07  ? 125 SER A C     1 
ATOM   993  O O     . SER A 1 125 ? 32.755  16.730  18.508  1.00 34.03  ? 125 SER A O     1 
ATOM   994  C CB    . SER A 1 125 ? 33.344  19.800  17.134  1.00 36.53  ? 125 SER A CB    1 
ATOM   995  O OG    . SER A 1 125 ? 32.371  19.260  16.239  1.00 39.91  ? 125 SER A OG    1 
ATOM   996  N N     . GLY A 1 126 ? 32.413  18.610  19.708  1.00 32.52  ? 126 GLY A N     1 
ATOM   997  C CA    . GLY A 1 126 ? 31.368  18.011  20.511  1.00 36.41  ? 126 GLY A CA    1 
ATOM   998  C C     . GLY A 1 126 ? 31.730  17.921  21.977  1.00 37.77  ? 126 GLY A C     1 
ATOM   999  O O     . GLY A 1 126 ? 32.905  17.932  22.337  1.00 39.87  ? 126 GLY A O     1 
ATOM   1000 N N     . ALA A 1 127 ? 30.718  17.843  22.830  1.00 37.42  ? 127 ALA A N     1 
ATOM   1001 C CA    . ALA A 1 127 ? 30.894  17.764  24.272  1.00 38.56  ? 127 ALA A CA    1 
ATOM   1002 C C     . ALA A 1 127 ? 29.643  17.126  24.851  1.00 37.41  ? 127 ALA A C     1 
ATOM   1003 O O     . ALA A 1 127 ? 28.562  17.219  24.264  1.00 39.14  ? 127 ALA A O     1 
ATOM   1004 C CB    . ALA A 1 127 ? 31.128  19.145  24.890  1.00 36.79  ? 127 ALA A CB    1 
ATOM   1005 N N     . ALA A 1 128 ? 29.794  16.457  25.987  1.00 37.32  ? 128 ALA A N     1 
ATOM   1006 C CA    . ALA A 1 128 ? 28.622  15.851  26.610  1.00 38.96  ? 128 ALA A CA    1 
ATOM   1007 C C     . ALA A 1 128 ? 27.844  16.843  27.458  1.00 38.04  ? 128 ALA A C     1 
ATOM   1008 O O     . ALA A 1 128 ? 26.745  16.515  27.922  1.00 39.00  ? 128 ALA A O     1 
ATOM   1009 C CB    . ALA A 1 128 ? 29.030  14.641  27.449  1.00 36.88  ? 128 ALA A CB    1 
ATOM   1010 N N     . SER A 1 129 ? 28.368  18.060  27.592  1.00 38.72  ? 129 SER A N     1 
ATOM   1011 C CA    . SER A 1 129 ? 27.899  19.085  28.510  1.00 39.07  ? 129 SER A CA    1 
ATOM   1012 C C     . SER A 1 129 ? 27.113  20.209  27.829  1.00 42.57  ? 129 SER A C     1 
ATOM   1013 O O     . SER A 1 129 ? 26.786  21.208  28.490  1.00 37.79  ? 129 SER A O     1 
ATOM   1014 C CB    . SER A 1 129 ? 29.099  19.671  29.253  1.00 36.46  ? 129 SER A CB    1 
ATOM   1015 O OG    . SER A 1 129 ? 30.018  20.304  28.385  1.00 35.07  ? 129 SER A OG    1 
ATOM   1016 N N     . LEU A 1 130 ? 26.831  20.089  26.524  1.00 39.25  ? 130 LEU A N     1 
ATOM   1017 C CA    . LEU A 1 130 ? 25.982  21.059  25.843  1.00 36.24  ? 130 LEU A CA    1 
ATOM   1018 C C     . LEU A 1 130 ? 24.550  20.977  26.362  1.00 40.39  ? 130 LEU A C     1 
ATOM   1019 O O     . LEU A 1 130 ? 24.098  19.949  26.868  1.00 44.84  ? 130 LEU A O     1 
ATOM   1020 C CB    . LEU A 1 130 ? 25.976  20.820  24.342  1.00 38.56  ? 130 LEU A CB    1 
ATOM   1021 C CG    . LEU A 1 130 ? 27.330  20.656  23.662  1.00 38.78  ? 130 LEU A CG    1 
ATOM   1022 C CD1   . LEU A 1 130 ? 27.100  20.670  22.205  1.00 37.46  ? 130 LEU A CD1   1 
ATOM   1023 C CD2   . LEU A 1 130 ? 28.296  21.755  24.050  1.00 39.91  ? 130 LEU A CD2   1 
ATOM   1024 N N     . ASP A 1 131 ? 23.822  22.078  26.224  1.00 41.47  ? 131 ASP A N     1 
ATOM   1025 C CA    . ASP A 1 131 ? 22.463  22.091  26.749  1.00 36.21  ? 131 ASP A CA    1 
ATOM   1026 C C     . ASP A 1 131 ? 21.563  21.089  26.032  1.00 41.98  ? 131 ASP A C     1 
ATOM   1027 O O     . ASP A 1 131 ? 20.734  20.447  26.679  1.00 46.27  ? 131 ASP A O     1 
ATOM   1028 C CB    . ASP A 1 131 ? 21.868  23.488  26.666  1.00 39.09  ? 131 ASP A CB    1 
ATOM   1029 C CG    . ASP A 1 131 ? 22.464  24.432  27.673  1.00 45.30  ? 131 ASP A CG    1 
ATOM   1030 O OD1   . ASP A 1 131 ? 23.273  23.993  28.509  1.00 52.10  ? 131 ASP A OD1   1 
ATOM   1031 O OD2   . ASP A 1 131 ? 22.116  25.622  27.642  1.00 54.82  ? 131 ASP A OD2   1 
ATOM   1032 N N     . VAL A 1 132 ? 21.687  20.931  24.707  1.00 41.72  ? 132 VAL A N     1 
ATOM   1033 C CA    . VAL A 1 132 ? 20.777  20.005  24.029  1.00 40.12  ? 132 VAL A CA    1 
ATOM   1034 C C     . VAL A 1 132 ? 20.984  18.556  24.428  1.00 38.12  ? 132 VAL A C     1 
ATOM   1035 O O     . VAL A 1 132 ? 20.152  17.711  24.085  1.00 39.97  ? 132 VAL A O     1 
ATOM   1036 C CB    . VAL A 1 132 ? 20.865  20.045  22.492  1.00 38.43  ? 132 VAL A CB    1 
ATOM   1037 C CG1   . VAL A 1 132 ? 20.149  21.261  21.975  1.00 43.63  ? 132 VAL A CG1   1 
ATOM   1038 C CG2   . VAL A 1 132 ? 22.293  20.010  22.052  1.00 36.55  ? 132 VAL A CG2   1 
ATOM   1039 N N     . TYR A 1 133 ? 22.071  18.230  25.120  1.00 35.81  ? 133 TYR A N     1 
ATOM   1040 C CA    . TYR A 1 133 ? 22.271  16.874  25.608  1.00 41.78  ? 133 TYR A CA    1 
ATOM   1041 C C     . TYR A 1 133 ? 21.947  16.723  27.111  1.00 42.65  ? 133 TYR A C     1 
ATOM   1042 O O     . TYR A 1 133 ? 22.399  15.760  27.733  1.00 39.48  ? 133 TYR A O     1 
ATOM   1043 C CB    . TYR A 1 133 ? 23.707  16.421  25.326  1.00 40.65  ? 133 TYR A CB    1 
ATOM   1044 C CG    . TYR A 1 133 ? 24.204  16.586  23.905  1.00 38.89  ? 133 TYR A CG    1 
ATOM   1045 C CD1   . TYR A 1 133 ? 23.356  16.423  22.816  1.00 41.03  ? 133 TYR A CD1   1 
ATOM   1046 C CD2   . TYR A 1 133 ? 25.534  16.909  23.657  1.00 37.75  ? 133 TYR A CD2   1 
ATOM   1047 C CE1   . TYR A 1 133 ? 23.816  16.571  21.516  1.00 38.38  ? 133 TYR A CE1   1 
ATOM   1048 C CE2   . TYR A 1 133 ? 26.002  17.061  22.379  1.00 38.27  ? 133 TYR A CE2   1 
ATOM   1049 C CZ    . TYR A 1 133 ? 25.143  16.890  21.297  1.00 41.19  ? 133 TYR A CZ    1 
ATOM   1050 O OH    . TYR A 1 133 ? 25.613  17.047  19.999  1.00 33.08  ? 133 TYR A OH    1 
ATOM   1051 N N     . ASP A 1 134 ? 21.182  17.658  27.687  1.00 41.19  ? 134 ASP A N     1 
ATOM   1052 C CA    . ASP A 1 134 ? 20.835  17.658  29.104  1.00 45.18  ? 134 ASP A CA    1 
ATOM   1053 C C     . ASP A 1 134 ? 19.905  16.496  29.440  1.00 46.06  ? 134 ASP A C     1 
ATOM   1054 O O     . ASP A 1 134 ? 18.798  16.390  28.896  1.00 43.70  ? 134 ASP A O     1 
ATOM   1055 C CB    . ASP A 1 134 ? 20.175  18.987  29.462  1.00 44.46  ? 134 ASP A CB    1 
ATOM   1056 C CG    . ASP A 1 134 ? 19.827  19.120  30.946  1.00 49.99  ? 134 ASP A CG    1 
ATOM   1057 O OD1   . ASP A 1 134 ? 20.028  18.199  31.771  1.00 50.60  ? 134 ASP A OD1   1 
ATOM   1058 O OD2   . ASP A 1 134 ? 19.330  20.204  31.286  1.00 54.08  ? 134 ASP A OD2   1 
ATOM   1059 N N     . GLY A 1 135 ? 20.334  15.664  30.386  1.00 43.42  ? 135 GLY A N     1 
ATOM   1060 C CA    . GLY A 1 135 ? 19.620  14.456  30.721  1.00 44.97  ? 135 GLY A CA    1 
ATOM   1061 C C     . GLY A 1 135 ? 18.528  14.592  31.750  1.00 44.39  ? 135 GLY A C     1 
ATOM   1062 O O     . GLY A 1 135 ? 17.823  13.617  32.017  1.00 42.86  ? 135 GLY A O     1 
ATOM   1063 N N     . ARG A 1 136 ? 18.345  15.779  32.324  1.00 44.68  ? 136 ARG A N     1 
ATOM   1064 C CA    . ARG A 1 136 ? 17.437  15.899  33.452  1.00 44.40  ? 136 ARG A CA    1 
ATOM   1065 C C     . ARG A 1 136 ? 16.003  15.555  33.065  1.00 50.48  ? 136 ARG A C     1 
ATOM   1066 O O     . ARG A 1 136 ? 15.268  14.990  33.886  1.00 51.97  ? 136 ARG A O     1 
ATOM   1067 C CB    . ARG A 1 136 ? 17.526  17.301  34.056  1.00 44.44  ? 136 ARG A CB    1 
ATOM   1068 C CG    . ARG A 1 136 ? 16.837  18.388  33.269  1.00 49.24  ? 136 ARG A CG    1 
ATOM   1069 C CD    . ARG A 1 136 ? 17.059  19.739  33.921  1.00 48.92  ? 136 ARG A CD    1 
ATOM   1070 N NE    . ARG A 1 136 ? 18.467  20.126  33.916  1.00 44.37  ? 136 ARG A NE    1 
ATOM   1071 C CZ    . ARG A 1 136 ? 18.991  21.026  34.744  1.00 49.12  ? 136 ARG A CZ    1 
ATOM   1072 N NH1   . ARG A 1 136 ? 20.279  21.327  34.683  1.00 53.19  ? 136 ARG A NH1   1 
ATOM   1073 N NH2   . ARG A 1 136 ? 18.231  21.617  35.654  1.00 49.59  ? 136 ARG A NH2   1 
ATOM   1074 N N     . PHE A 1 137 ? 15.592  15.843  31.819  1.00 47.60  ? 137 PHE A N     1 
ATOM   1075 C CA    . PHE A 1 137 ? 14.202  15.603  31.430  1.00 42.54  ? 137 PHE A CA    1 
ATOM   1076 C C     . PHE A 1 137 ? 13.927  14.122  31.230  1.00 45.35  ? 137 PHE A C     1 
ATOM   1077 O O     . PHE A 1 137 ? 12.893  13.611  31.680  1.00 46.22  ? 137 PHE A O     1 
ATOM   1078 C CB    . PHE A 1 137 ? 13.862  16.379  30.166  1.00 45.55  ? 137 PHE A CB    1 
ATOM   1079 C CG    . PHE A 1 137 ? 14.202  17.825  30.251  1.00 51.76  ? 137 PHE A CG    1 
ATOM   1080 C CD1   . PHE A 1 137 ? 13.416  18.692  30.998  1.00 50.59  ? 137 PHE A CD1   1 
ATOM   1081 C CD2   . PHE A 1 137 ? 15.323  18.328  29.599  1.00 50.45  ? 137 PHE A CD2   1 
ATOM   1082 C CE1   . PHE A 1 137 ? 13.731  20.038  31.080  1.00 51.36  ? 137 PHE A CE1   1 
ATOM   1083 C CE2   . PHE A 1 137 ? 15.649  19.676  29.688  1.00 48.29  ? 137 PHE A CE2   1 
ATOM   1084 C CZ    . PHE A 1 137 ? 14.848  20.530  30.432  1.00 49.86  ? 137 PHE A CZ    1 
ATOM   1085 N N     . LEU A 1 138 ? 14.823  13.417  30.540  1.00 44.55  ? 138 LEU A N     1 
ATOM   1086 C CA    . LEU A 1 138 ? 14.632  11.985  30.371  1.00 44.96  ? 138 LEU A CA    1 
ATOM   1087 C C     . LEU A 1 138 ? 14.665  11.281  31.722  1.00 50.58  ? 138 LEU A C     1 
ATOM   1088 O O     . LEU A 1 138 ? 13.879  10.361  31.973  1.00 54.31  ? 138 LEU A O     1 
ATOM   1089 C CB    . LEU A 1 138 ? 15.689  11.423  29.414  1.00 43.93  ? 138 LEU A CB    1 
ATOM   1090 C CG    . LEU A 1 138 ? 15.449  11.563  27.903  1.00 45.69  ? 138 LEU A CG    1 
ATOM   1091 C CD1   . LEU A 1 138 ? 16.695  11.247  27.115  1.00 41.78  ? 138 LEU A CD1   1 
ATOM   1092 C CD2   . LEU A 1 138 ? 14.333  10.649  27.451  1.00 46.73  ? 138 LEU A CD2   1 
ATOM   1093 N N     . ALA A 1 139 ? 15.540  11.732  32.624  1.00 47.65  ? 139 ALA A N     1 
ATOM   1094 C CA    . ALA A 1 139 ? 15.633  11.109  33.940  1.00 49.77  ? 139 ALA A CA    1 
ATOM   1095 C C     . ALA A 1 139 ? 14.411  11.419  34.798  1.00 51.97  ? 139 ALA A C     1 
ATOM   1096 O O     . ALA A 1 139 ? 13.955  10.563  35.561  1.00 51.97  ? 139 ALA A O     1 
ATOM   1097 C CB    . ALA A 1 139 ? 16.910  11.563  34.652  1.00 47.06  ? 139 ALA A CB    1 
ATOM   1098 N N     . GLN A 1 140 ? 13.877  12.641  34.705  1.00 53.41  ? 140 GLN A N     1 
ATOM   1099 C CA    . GLN A 1 140 ? 12.752  13.016  35.557  1.00 52.10  ? 140 GLN A CA    1 
ATOM   1100 C C     . GLN A 1 140 ? 11.454  12.412  35.057  1.00 55.46  ? 140 GLN A C     1 
ATOM   1101 O O     . GLN A 1 140 ? 10.692  11.833  35.837  1.00 61.44  ? 140 GLN A O     1 
ATOM   1102 C CB    . GLN A 1 140 ? 12.607  14.534  35.633  1.00 52.78  ? 140 GLN A CB    1 
ATOM   1103 C CG    . GLN A 1 140 ? 11.817  15.023  36.849  1.00 56.28  ? 140 GLN A CG    1 
ATOM   1104 C CD    . GLN A 1 140 ? 10.326  14.761  36.735  1.00 58.40  ? 140 GLN A CD    1 
ATOM   1105 O OE1   . GLN A 1 140 ? 9.719   15.003  35.688  1.00 61.23  ? 140 GLN A OE1   1 
ATOM   1106 N NE2   . GLN A 1 140 ? 9.731   14.255  37.808  1.00 55.50  ? 140 GLN A NE2   1 
ATOM   1107 N N     . VAL A 1 141 ? 11.182  12.551  33.762  1.00 51.76  ? 141 VAL A N     1 
ATOM   1108 C CA    . VAL A 1 141 ? 9.868   12.192  33.249  1.00 52.41  ? 141 VAL A CA    1 
ATOM   1109 C C     . VAL A 1 141 ? 9.782   10.705  32.954  1.00 52.72  ? 141 VAL A C     1 
ATOM   1110 O O     . VAL A 1 141 ? 8.739   10.083  33.172  1.00 54.01  ? 141 VAL A O     1 
ATOM   1111 C CB    . VAL A 1 141 ? 9.548   13.034  32.008  1.00 51.21  ? 141 VAL A CB    1 
ATOM   1112 C CG1   . VAL A 1 141 ? 8.153   12.728  31.523  1.00 52.10  ? 141 VAL A CG1   1 
ATOM   1113 C CG2   . VAL A 1 141 ? 9.689   14.489  32.336  1.00 46.66  ? 141 VAL A CG2   1 
ATOM   1114 N N     . GLU A 1 142 ? 10.856  10.116  32.442  1.00 52.65  ? 142 GLU A N     1 
ATOM   1115 C CA    . GLU A 1 142 ? 10.883  8.696   32.127  1.00 51.04  ? 142 GLU A CA    1 
ATOM   1116 C C     . GLU A 1 142 ? 11.604  7.871   33.168  1.00 50.88  ? 142 GLU A C     1 
ATOM   1117 O O     . GLU A 1 142 ? 11.660  6.646   33.033  1.00 57.16  ? 142 GLU A O     1 
ATOM   1118 C CB    . GLU A 1 142 ? 11.560  8.448   30.779  1.00 52.28  ? 142 GLU A CB    1 
ATOM   1119 C CG    . GLU A 1 142 ? 10.838  9.047   29.618  1.00 56.47  ? 142 GLU A CG    1 
ATOM   1120 C CD    . GLU A 1 142 ? 9.480   8.420   29.427  1.00 62.11  ? 142 GLU A CD    1 
ATOM   1121 O OE1   . GLU A 1 142 ? 9.272   7.292   29.931  1.00 63.78  ? 142 GLU A OE1   1 
ATOM   1122 O OE2   . GLU A 1 142 ? 8.612   9.058   28.789  1.00 65.52  ? 142 GLU A OE2   1 
ATOM   1123 N N     . GLY A 1 143 ? 12.204  8.506   34.165  1.00 48.50  ? 143 GLY A N     1 
ATOM   1124 C CA    . GLY A 1 143 ? 12.909  7.759   35.180  1.00 47.13  ? 143 GLY A CA    1 
ATOM   1125 C C     . GLY A 1 143 ? 14.130  7.028   34.689  1.00 49.86  ? 143 GLY A C     1 
ATOM   1126 O O     . GLY A 1 143 ? 14.606  6.114   35.366  1.00 54.40  ? 143 GLY A O     1 
ATOM   1127 N N     . ALA A 1 144 ? 14.652  7.399   33.526  1.00 51.04  ? 144 ALA A N     1 
ATOM   1128 C CA    . ALA A 1 144 ? 15.803  6.715   32.959  1.00 48.78  ? 144 ALA A CA    1 
ATOM   1129 C C     . ALA A 1 144 ? 17.071  7.077   33.723  1.00 47.00  ? 144 ALA A C     1 
ATOM   1130 O O     . ALA A 1 144 ? 17.151  8.104   34.398  1.00 46.51  ? 144 ALA A O     1 
ATOM   1131 C CB    . ALA A 1 144 ? 15.964  7.082   31.485  1.00 42.98  ? 144 ALA A CB    1 
ATOM   1132 N N     . VAL A 1 145 ? 18.069  6.211   33.626  1.00 43.50  ? 145 VAL A N     1 
ATOM   1133 C CA    . VAL A 1 145 ? 19.431  6.576   33.980  1.00 42.10  ? 145 VAL A CA    1 
ATOM   1134 C C     . VAL A 1 145 ? 20.130  6.939   32.675  1.00 43.90  ? 145 VAL A C     1 
ATOM   1135 O O     . VAL A 1 145 ? 20.155  6.146   31.727  1.00 42.78  ? 145 VAL A O     1 
ATOM   1136 C CB    . VAL A 1 145 ? 20.151  5.445   34.734  1.00 44.09  ? 145 VAL A CB    1 
ATOM   1137 C CG1   . VAL A 1 145 ? 21.630  5.797   34.991  1.00 39.60  ? 145 VAL A CG1   1 
ATOM   1138 C CG2   . VAL A 1 145 ? 19.435  5.161   36.069  1.00 50.63  ? 145 VAL A CG2   1 
ATOM   1139 N N     . LEU A 1 146 ? 20.650  8.152   32.600  1.00 41.98  ? 146 LEU A N     1 
ATOM   1140 C CA    . LEU A 1 146 ? 21.291  8.636   31.393  1.00 42.21  ? 146 LEU A CA    1 
ATOM   1141 C C     . LEU A 1 146 ? 22.758  8.928   31.664  1.00 44.43  ? 146 LEU A C     1 
ATOM   1142 O O     . LEU A 1 146 ? 23.097  9.589   32.656  1.00 44.51  ? 146 LEU A O     1 
ATOM   1143 C CB    . LEU A 1 146 ? 20.588  9.878   30.869  1.00 40.09  ? 146 LEU A CB    1 
ATOM   1144 C CG    . LEU A 1 146 ? 20.909  9.962   29.408  1.00 46.61  ? 146 LEU A CG    1 
ATOM   1145 C CD1   . LEU A 1 146 ? 19.736  10.354  28.659  1.00 44.65  ? 146 LEU A CD1   1 
ATOM   1146 C CD2   . LEU A 1 146 ? 22.065  10.864  29.166  1.00 44.86  ? 146 LEU A CD2   1 
ATOM   1147 N N     . VAL A 1 147 ? 23.621  8.450   30.776  1.00 38.60  ? 147 VAL A N     1 
ATOM   1148 C CA    . VAL A 1 147 ? 25.058  8.625   30.906  1.00 39.19  ? 147 VAL A CA    1 
ATOM   1149 C C     . VAL A 1 147 ? 25.577  9.185   29.602  1.00 41.44  ? 147 VAL A C     1 
ATOM   1150 O O     . VAL A 1 147 ? 25.263  8.650   28.534  1.00 44.31  ? 147 VAL A O     1 
ATOM   1151 C CB    . VAL A 1 147 ? 25.767  7.299   31.212  1.00 41.38  ? 147 VAL A CB    1 
ATOM   1152 C CG1   . VAL A 1 147 ? 27.280  7.497   31.178  1.00 38.23  ? 147 VAL A CG1   1 
ATOM   1153 C CG2   . VAL A 1 147 ? 25.287  6.739   32.531  1.00 39.72  ? 147 VAL A CG2   1 
ATOM   1154 N N     . SER A 1 148 ? 26.391  10.226  29.679  1.00 36.48  ? 148 SER A N     1 
ATOM   1155 C CA    . SER A 1 148 ? 27.053  10.727  28.488  1.00 38.12  ? 148 SER A CA    1 
ATOM   1156 C C     . SER A 1 148 ? 28.509  10.983  28.814  1.00 38.54  ? 148 SER A C     1 
ATOM   1157 O O     . SER A 1 148 ? 28.825  11.459  29.902  1.00 40.39  ? 148 SER A O     1 
ATOM   1158 C CB    . SER A 1 148 ? 26.390  11.992  27.972  1.00 40.36  ? 148 SER A CB    1 
ATOM   1159 O OG    . SER A 1 148 ? 26.370  13.000  28.957  1.00 43.46  ? 148 SER A OG    1 
ATOM   1160 N N     . MET A 1 149 ? 29.394  10.652  27.878  1.00 38.86  ? 149 MET A N     1 
ATOM   1161 C CA    . MET A 1 149 ? 30.833  10.755  28.080  1.00 37.31  ? 149 MET A CA    1 
ATOM   1162 C C     . MET A 1 149 ? 31.468  11.723  27.084  1.00 38.13  ? 149 MET A C     1 
ATOM   1163 O O     . MET A 1 149 ? 30.922  12.006  26.015  1.00 36.38  ? 149 MET A O     1 
ATOM   1164 C CB    . MET A 1 149 ? 31.511  9.385   27.931  1.00 39.28  ? 149 MET A CB    1 
ATOM   1165 C CG    . MET A 1 149 ? 31.906  9.022   26.473  1.00 38.75  ? 149 MET A CG    1 
ATOM   1166 S SD    . MET A 1 149 ? 30.518  8.429   25.503  1.00 41.93  ? 149 MET A SD    1 
ATOM   1167 C CE    . MET A 1 149 ? 30.303  6.784   26.180  1.00 33.87  ? 149 MET A CE    1 
ATOM   1168 N N     . ASN A 1 150 ? 32.644  12.217  27.451  1.00 37.44  ? 150 ASN A N     1 
ATOM   1169 C CA    . ASN A 1 150 ? 33.518  12.931  26.536  1.00 32.18  ? 150 ASN A CA    1 
ATOM   1170 C C     . ASN A 1 150 ? 34.469  11.925  25.907  1.00 36.77  ? 150 ASN A C     1 
ATOM   1171 O O     . ASN A 1 150 ? 35.039  11.085  26.600  1.00 38.87  ? 150 ASN A O     1 
ATOM   1172 C CB    . ASN A 1 150 ? 34.322  14.014  27.260  1.00 30.99  ? 150 ASN A CB    1 
ATOM   1173 C CG    . ASN A 1 150 ? 33.493  15.233  27.624  1.00 34.86  ? 150 ASN A CG    1 
ATOM   1174 O OD1   . ASN A 1 150 ? 32.308  15.309  27.305  1.00 35.67  ? 150 ASN A OD1   1 
ATOM   1175 N ND2   . ASN A 1 150 ? 34.117  16.195  28.302  1.00 31.25  ? 150 ASN A ND2   1 
ATOM   1176 N N     . TYR A 1 151 ? 34.648  12.003  24.602  1.00 39.79  ? 151 TYR A N     1 
ATOM   1177 C CA    . TYR A 1 151 ? 35.695  11.235  23.954  1.00 39.06  ? 151 TYR A CA    1 
ATOM   1178 C C     . TYR A 1 151 ? 36.561  12.214  23.193  1.00 39.55  ? 151 TYR A C     1 
ATOM   1179 O O     . TYR A 1 151 ? 36.109  13.305  22.842  1.00 42.65  ? 151 TYR A O     1 
ATOM   1180 C CB    . TYR A 1 151 ? 35.127  10.146  23.035  1.00 39.04  ? 151 TYR A CB    1 
ATOM   1181 C CG    . TYR A 1 151 ? 34.171  10.649  21.983  1.00 39.31  ? 151 TYR A CG    1 
ATOM   1182 C CD1   . TYR A 1 151 ? 32.825  10.875  22.284  1.00 36.52  ? 151 TYR A CD1   1 
ATOM   1183 C CD2   . TYR A 1 151 ? 34.605  10.878  20.680  1.00 37.65  ? 151 TYR A CD2   1 
ATOM   1184 C CE1   . TYR A 1 151 ? 31.947  11.326  21.318  1.00 36.89  ? 151 TYR A CE1   1 
ATOM   1185 C CE2   . TYR A 1 151 ? 33.733  11.327  19.709  1.00 37.18  ? 151 TYR A CE2   1 
ATOM   1186 C CZ    . TYR A 1 151 ? 32.415  11.562  20.028  1.00 38.06  ? 151 TYR A CZ    1 
ATOM   1187 O OH    . TYR A 1 151 ? 31.570  12.010  19.042  1.00 36.82  ? 151 TYR A OH    1 
ATOM   1188 N N     . ARG A 1 152 ? 37.819  11.849  22.992  1.00 37.74  ? 152 ARG A N     1 
ATOM   1189 C CA    . ARG A 1 152 ? 38.739  12.737  22.298  1.00 37.60  ? 152 ARG A CA    1 
ATOM   1190 C C     . ARG A 1 152 ? 38.381  12.852  20.815  1.00 40.96  ? 152 ARG A C     1 
ATOM   1191 O O     . ARG A 1 152 ? 38.033  11.865  20.154  1.00 40.61  ? 152 ARG A O     1 
ATOM   1192 C CB    . ARG A 1 152 ? 40.168  12.238  22.472  1.00 37.18  ? 152 ARG A CB    1 
ATOM   1193 C CG    . ARG A 1 152 ? 40.779  12.597  23.803  1.00 40.11  ? 152 ARG A CG    1 
ATOM   1194 C CD    . ARG A 1 152 ? 42.143  11.964  23.937  1.00 40.94  ? 152 ARG A CD    1 
ATOM   1195 N NE    . ARG A 1 152 ? 42.020  10.533  24.162  1.00 39.22  ? 152 ARG A NE    1 
ATOM   1196 C CZ    . ARG A 1 152 ? 43.036  9.684   24.133  1.00 37.69  ? 152 ARG A CZ    1 
ATOM   1197 N NH1   . ARG A 1 152 ? 44.263  10.112  23.879  1.00 40.51  ? 152 ARG A NH1   1 
ATOM   1198 N NH2   . ARG A 1 152 ? 42.816  8.404   24.354  1.00 39.66  ? 152 ARG A NH2   1 
ATOM   1199 N N     . VAL A 1 153 ? 38.469  14.070  20.287  1.00 41.22  ? 153 VAL A N     1 
ATOM   1200 C CA    . VAL A 1 153 ? 38.099  14.340  18.905  1.00 38.09  ? 153 VAL A CA    1 
ATOM   1201 C C     . VAL A 1 153 ? 39.312  14.868  18.148  1.00 38.99  ? 153 VAL A C     1 
ATOM   1202 O O     . VAL A 1 153 ? 40.355  15.179  18.727  1.00 37.68  ? 153 VAL A O     1 
ATOM   1203 C CB    . VAL A 1 153 ? 36.921  15.321  18.803  1.00 36.82  ? 153 VAL A CB    1 
ATOM   1204 C CG1   . VAL A 1 153 ? 35.660  14.647  19.237  1.00 34.49  ? 153 VAL A CG1   1 
ATOM   1205 C CG2   . VAL A 1 153 ? 37.192  16.578  19.635  1.00 36.12  ? 153 VAL A CG2   1 
ATOM   1206 N N     . GLY A 1 154 ? 39.155  14.958  16.826  1.00 36.80  ? 154 GLY A N     1 
ATOM   1207 C CA    . GLY A 1 154 ? 40.200  15.557  16.016  1.00 38.33  ? 154 GLY A CA    1 
ATOM   1208 C C     . GLY A 1 154 ? 41.479  14.749  16.067  1.00 41.08  ? 154 GLY A C     1 
ATOM   1209 O O     . GLY A 1 154 ? 41.462  13.517  16.171  1.00 41.86  ? 154 GLY A O     1 
ATOM   1210 N N     . THR A 1 155 ? 42.615  15.451  16.002  1.00 42.04  ? 155 THR A N     1 
ATOM   1211 C CA    . THR A 1 155 ? 43.903  14.763  16.036  1.00 42.52  ? 155 THR A CA    1 
ATOM   1212 C C     . THR A 1 155 ? 44.077  13.974  17.326  1.00 45.40  ? 155 THR A C     1 
ATOM   1213 O O     . THR A 1 155 ? 44.565  12.840  17.301  1.00 51.38  ? 155 THR A O     1 
ATOM   1214 C CB    . THR A 1 155 ? 45.067  15.748  15.885  1.00 44.28  ? 155 THR A CB    1 
ATOM   1215 O OG1   . THR A 1 155 ? 45.062  16.680  16.975  1.00 41.47  ? 155 THR A OG1   1 
ATOM   1216 C CG2   . THR A 1 155 ? 45.016  16.475  14.544  1.00 39.16  ? 155 THR A CG2   1 
ATOM   1217 N N     . PHE A 1 156 ? 43.675  14.550  18.463  1.00 43.99  ? 156 PHE A N     1 
ATOM   1218 C CA    . PHE A 1 156 ? 43.900  13.894  19.749  1.00 39.84  ? 156 PHE A CA    1 
ATOM   1219 C C     . PHE A 1 156 ? 43.135  12.583  19.856  1.00 40.94  ? 156 PHE A C     1 
ATOM   1220 O O     . PHE A 1 156 ? 43.606  11.632  20.491  1.00 43.96  ? 156 PHE A O     1 
ATOM   1221 C CB    . PHE A 1 156 ? 43.509  14.854  20.865  1.00 40.87  ? 156 PHE A CB    1 
ATOM   1222 C CG    . PHE A 1 156 ? 44.014  16.249  20.638  1.00 44.64  ? 156 PHE A CG    1 
ATOM   1223 C CD1   . PHE A 1 156 ? 45.270  16.626  21.089  1.00 42.86  ? 156 PHE A CD1   1 
ATOM   1224 C CD2   . PHE A 1 156 ? 43.255  17.174  19.927  1.00 44.87  ? 156 PHE A CD2   1 
ATOM   1225 C CE1   . PHE A 1 156 ? 45.748  17.899  20.859  1.00 40.86  ? 156 PHE A CE1   1 
ATOM   1226 C CE2   . PHE A 1 156 ? 43.727  18.449  19.699  1.00 42.27  ? 156 PHE A CE2   1 
ATOM   1227 C CZ    . PHE A 1 156 ? 44.975  18.810  20.166  1.00 42.57  ? 156 PHE A CZ    1 
ATOM   1228 N N     . GLY A 1 157 ? 41.974  12.500  19.222  1.00 40.27  ? 157 GLY A N     1 
ATOM   1229 C CA    . GLY A 1 157 ? 41.191  11.289  19.290  1.00 39.65  ? 157 GLY A CA    1 
ATOM   1230 C C     . GLY A 1 157 ? 41.385  10.326  18.142  1.00 41.15  ? 157 GLY A C     1 
ATOM   1231 O O     . GLY A 1 157 ? 41.035  9.147   18.279  1.00 41.42  ? 157 GLY A O     1 
ATOM   1232 N N     . PHE A 1 158 ? 41.919  10.791  16.995  1.00 39.60  ? 158 PHE A N     1 
ATOM   1233 C CA    . PHE A 1 158 ? 41.906  9.946   15.809  1.00 37.95  ? 158 PHE A CA    1 
ATOM   1234 C C     . PHE A 1 158 ? 43.109  10.070  14.883  1.00 40.09  ? 158 PHE A C     1 
ATOM   1235 O O     . PHE A 1 158 ? 43.144  9.362   13.875  1.00 38.99  ? 158 PHE A O     1 
ATOM   1236 C CB    . PHE A 1 158 ? 40.618  10.192  15.013  1.00 37.07  ? 158 PHE A CB    1 
ATOM   1237 C CG    . PHE A 1 158 ? 39.387  9.908   15.797  1.00 35.81  ? 158 PHE A CG    1 
ATOM   1238 C CD1   . PHE A 1 158 ? 38.928  8.612   15.936  1.00 37.80  ? 158 PHE A CD1   1 
ATOM   1239 C CD2   . PHE A 1 158 ? 38.715  10.927  16.446  1.00 38.33  ? 158 PHE A CD2   1 
ATOM   1240 C CE1   . PHE A 1 158 ? 37.802  8.334   16.695  1.00 40.96  ? 158 PHE A CE1   1 
ATOM   1241 C CE2   . PHE A 1 158 ? 37.585  10.663  17.213  1.00 39.98  ? 158 PHE A CE2   1 
ATOM   1242 C CZ    . PHE A 1 158 ? 37.130  9.365   17.342  1.00 39.68  ? 158 PHE A CZ    1 
ATOM   1243 N N     . LEU A 1 159 ? 44.096  10.905  15.180  1.00 39.05  ? 159 LEU A N     1 
ATOM   1244 C CA    . LEU A 1 159 ? 45.301  10.907  14.362  1.00 38.30  ? 159 LEU A CA    1 
ATOM   1245 C C     . LEU A 1 159 ? 46.011  9.574   14.530  1.00 38.85  ? 159 LEU A C     1 
ATOM   1246 O O     . LEU A 1 159 ? 46.371  9.192   15.640  1.00 47.63  ? 159 LEU A O     1 
ATOM   1247 C CB    . LEU A 1 159 ? 46.217  12.060  14.753  1.00 39.53  ? 159 LEU A CB    1 
ATOM   1248 C CG    . LEU A 1 159 ? 47.572  12.221  14.047  1.00 42.45  ? 159 LEU A CG    1 
ATOM   1249 C CD1   . LEU A 1 159 ? 48.052  13.681  14.097  1.00 40.53  ? 159 LEU A CD1   1 
ATOM   1250 C CD2   . LEU A 1 159 ? 48.636  11.313  14.657  1.00 40.69  ? 159 LEU A CD2   1 
ATOM   1251 N N     . ALA A 1 160 ? 46.232  8.875   13.439  1.00 43.77  ? 160 ALA A N     1 
ATOM   1252 C CA    . ALA A 1 160 ? 46.815  7.544   13.485  1.00 44.33  ? 160 ALA A CA    1 
ATOM   1253 C C     . ALA A 1 160 ? 47.968  7.420   12.499  1.00 46.83  ? 160 ALA A C     1 
ATOM   1254 O O     . ALA A 1 160 ? 47.898  7.908   11.365  1.00 44.50  ? 160 ALA A O     1 
ATOM   1255 C CB    . ALA A 1 160 ? 45.769  6.475   13.166  1.00 43.54  ? 160 ALA A CB    1 
ATOM   1256 N N     . LEU A 1 161 ? 49.034  6.771   12.949  1.00 48.95  ? 161 LEU A N     1 
ATOM   1257 C CA    . LEU A 1 161 ? 50.046  6.195   12.075  1.00 46.11  ? 161 LEU A CA    1 
ATOM   1258 C C     . LEU A 1 161 ? 49.829  4.695   12.127  1.00 47.21  ? 161 LEU A C     1 
ATOM   1259 O O     . LEU A 1 161 ? 50.482  4.006   12.922  1.00 49.54  ? 161 LEU A O     1 
ATOM   1260 C CB    . LEU A 1 161 ? 51.453  6.565   12.540  1.00 45.85  ? 161 LEU A CB    1 
ATOM   1261 C CG    . LEU A 1 161 ? 51.703  8.049   12.333  1.00 48.84  ? 161 LEU A CG    1 
ATOM   1262 C CD1   . LEU A 1 161 ? 53.151  8.361   12.559  1.00 56.36  ? 161 LEU A CD1   1 
ATOM   1263 C CD2   . LEU A 1 161 ? 51.314  8.423   10.926  1.00 51.75  ? 161 LEU A CD2   1 
ATOM   1264 N N     . PRO A 1 162 ? 48.904  4.142   11.332  1.00 44.41  ? 162 PRO A N     1 
ATOM   1265 C CA    . PRO A 1 162 ? 48.423  2.780   11.601  1.00 45.32  ? 162 PRO A CA    1 
ATOM   1266 C C     . PRO A 1 162 ? 49.570  1.784   11.697  1.00 50.61  ? 162 PRO A C     1 
ATOM   1267 O O     . PRO A 1 162 ? 50.566  1.881   10.979  1.00 48.11  ? 162 PRO A O     1 
ATOM   1268 C CB    . PRO A 1 162 ? 47.501  2.486   10.414  1.00 42.33  ? 162 PRO A CB    1 
ATOM   1269 C CG    . PRO A 1 162 ? 47.040  3.846   9.949   1.00 41.66  ? 162 PRO A CG    1 
ATOM   1270 C CD    . PRO A 1 162 ? 48.202  4.768   10.195  1.00 42.53  ? 162 PRO A CD    1 
ATOM   1271 N N     . GLY A 1 163 ? 49.455  0.864   12.657  1.00 53.49  ? 163 GLY A N     1 
ATOM   1272 C CA    . GLY A 1 163 ? 50.494  -0.097  12.920  1.00 45.14  ? 163 GLY A CA    1 
ATOM   1273 C C     . GLY A 1 163 ? 51.578  0.369   13.865  1.00 46.81  ? 163 GLY A C     1 
ATOM   1274 O O     . GLY A 1 163 ? 52.340  -0.463  14.353  1.00 49.76  ? 163 GLY A O     1 
ATOM   1275 N N     . SER A 1 164 ? 51.686  1.669   14.126  1.00 49.96  ? 164 SER A N     1 
ATOM   1276 C CA    . SER A 1 164 ? 52.620  2.130   15.141  1.00 52.25  ? 164 SER A CA    1 
ATOM   1277 C C     . SER A 1 164 ? 52.051  1.863   16.524  1.00 53.42  ? 164 SER A C     1 
ATOM   1278 O O     . SER A 1 164 ? 50.882  1.513   16.692  1.00 54.64  ? 164 SER A O     1 
ATOM   1279 C CB    . SER A 1 164 ? 52.907  3.620   15.006  1.00 50.47  ? 164 SER A CB    1 
ATOM   1280 O OG    . SER A 1 164 ? 51.828  4.369   15.526  1.00 47.77  ? 164 SER A OG    1 
ATOM   1281 N N     . ARG A 1 165 ? 52.883  2.050   17.536  1.00 55.03  ? 165 ARG A N     1 
ATOM   1282 C CA    . ARG A 1 165 ? 52.396  1.816   18.877  1.00 60.91  ? 165 ARG A CA    1 
ATOM   1283 C C     . ARG A 1 165 ? 52.133  3.101   19.651  1.00 64.70  ? 165 ARG A C     1 
ATOM   1284 O O     . ARG A 1 165 ? 51.401  3.062   20.653  1.00 64.32  ? 165 ARG A O     1 
ATOM   1285 C CB    . ARG A 1 165 ? 53.367  0.898   19.641  1.00 65.53  ? 165 ARG A CB    1 
ATOM   1286 C CG    . ARG A 1 165 ? 54.610  1.546   20.197  1.00 69.88  ? 165 ARG A CG    1 
ATOM   1287 C CD    . ARG A 1 165 ? 54.786  1.101   21.654  1.00 75.78  ? 165 ARG A CD    1 
ATOM   1288 N NE    . ARG A 1 165 ? 55.794  1.879   22.370  1.00 81.82  ? 165 ARG A NE    1 
ATOM   1289 C CZ    . ARG A 1 165 ? 55.554  3.030   22.992  1.00 81.66  ? 165 ARG A CZ    1 
ATOM   1290 N NH1   . ARG A 1 165 ? 54.335  3.558   22.991  1.00 76.03  ? 165 ARG A NH1   1 
ATOM   1291 N NH2   . ARG A 1 165 ? 56.538  3.660   23.613  1.00 90.38  ? 165 ARG A NH2   1 
ATOM   1292 N N     . GLU A 1 166 ? 52.654  4.240   19.182  1.00 59.21  ? 166 GLU A N     1 
ATOM   1293 C CA    . GLU A 1 166 ? 52.420  5.520   19.832  1.00 59.17  ? 166 GLU A CA    1 
ATOM   1294 C C     . GLU A 1 166 ? 51.270  6.293   19.218  1.00 55.86  ? 166 GLU A C     1 
ATOM   1295 O O     . GLU A 1 166 ? 50.952  7.383   19.700  1.00 61.04  ? 166 GLU A O     1 
ATOM   1296 C CB    . GLU A 1 166 ? 53.678  6.386   19.804  1.00 62.42  ? 166 GLU A CB    1 
ATOM   1297 C CG    . GLU A 1 166 ? 54.938  5.673   20.232  1.00 64.88  ? 166 GLU A CG    1 
ATOM   1298 C CD    . GLU A 1 166 ? 55.597  4.947   19.067  1.00 73.33  ? 166 GLU A CD    1 
ATOM   1299 O OE1   . GLU A 1 166 ? 54.871  4.403   18.192  1.00 66.84  ? 166 GLU A OE1   1 
ATOM   1300 O OE2   . GLU A 1 166 ? 56.846  4.944   19.010  1.00 77.39  ? 166 GLU A OE2   1 
ATOM   1301 N N     . ALA A 1 167 ? 50.640  5.759   18.182  1.00 49.92  ? 167 ALA A N     1 
ATOM   1302 C CA    . ALA A 1 167 ? 49.470  6.376   17.578  1.00 48.72  ? 167 ALA A CA    1 
ATOM   1303 C C     . ALA A 1 167 ? 48.678  5.315   16.839  1.00 48.54  ? 167 ALA A C     1 
ATOM   1304 O O     . ALA A 1 167 ? 48.549  5.382   15.609  1.00 48.07  ? 167 ALA A O     1 
ATOM   1305 C CB    . ALA A 1 167 ? 49.858  7.492   16.608  1.00 49.11  ? 167 ALA A CB    1 
ATOM   1306 N N     . PRO A 1 168 ? 48.134  4.329   17.549  1.00 45.69  ? 168 PRO A N     1 
ATOM   1307 C CA    . PRO A 1 168 ? 47.450  3.219   16.866  1.00 43.86  ? 168 PRO A CA    1 
ATOM   1308 C C     . PRO A 1 168 ? 46.182  3.629   16.147  1.00 44.25  ? 168 PRO A C     1 
ATOM   1309 O O     . PRO A 1 168 ? 45.686  2.856   15.314  1.00 47.32  ? 168 PRO A O     1 
ATOM   1310 C CB    . PRO A 1 168 ? 47.129  2.263   18.009  1.00 43.89  ? 168 PRO A CB    1 
ATOM   1311 C CG    . PRO A 1 168 ? 46.903  3.218   19.186  1.00 47.16  ? 168 PRO A CG    1 
ATOM   1312 C CD    . PRO A 1 168 ? 47.940  4.290   19.008  1.00 48.65  ? 168 PRO A CD    1 
ATOM   1313 N N     . GLY A 1 169 ? 45.637  4.798   16.458  1.00 44.89  ? 169 GLY A N     1 
ATOM   1314 C CA    . GLY A 1 169 ? 44.372  5.231   15.913  1.00 42.05  ? 169 GLY A CA    1 
ATOM   1315 C C     . GLY A 1 169 ? 43.185  4.753   16.726  1.00 42.03  ? 169 GLY A C     1 
ATOM   1316 O O     . GLY A 1 169 ? 43.283  3.865   17.571  1.00 47.63  ? 169 GLY A O     1 
ATOM   1317 N N     . ASN A 1 170 ? 42.048  5.378   16.457  1.00 37.84  ? 170 ASN A N     1 
ATOM   1318 C CA    . ASN A 1 170 ? 40.757  5.083   17.070  1.00 40.91  ? 170 ASN A CA    1 
ATOM   1319 C C     . ASN A 1 170 ? 40.731  5.285   18.590  1.00 39.98  ? 170 ASN A C     1 
ATOM   1320 O O     . ASN A 1 170 ? 39.767  4.869   19.235  1.00 36.40  ? 170 ASN A O     1 
ATOM   1321 C CB    . ASN A 1 170 ? 40.291  3.665   16.732  1.00 37.50  ? 170 ASN A CB    1 
ATOM   1322 C CG    . ASN A 1 170 ? 40.202  3.419   15.228  1.00 46.20  ? 170 ASN A CG    1 
ATOM   1323 O OD1   . ASN A 1 170 ? 39.659  4.230   14.470  1.00 43.23  ? 170 ASN A OD1   1 
ATOM   1324 N ND2   . ASN A 1 170 ? 40.737  2.292   14.792  1.00 46.00  ? 170 ASN A ND2   1 
ATOM   1325 N N     . VAL A 1 171 ? 41.733  5.952   19.177  1.00 36.67  ? 171 VAL A N     1 
ATOM   1326 C CA    . VAL A 1 171 ? 41.762  6.112   20.626  1.00 38.69  ? 171 VAL A CA    1 
ATOM   1327 C C     . VAL A 1 171 ? 40.512  6.803   21.140  1.00 42.95  ? 171 VAL A C     1 
ATOM   1328 O O     . VAL A 1 171 ? 40.115  6.590   22.297  1.00 39.06  ? 171 VAL A O     1 
ATOM   1329 C CB    . VAL A 1 171 ? 43.021  6.867   21.097  1.00 36.10  ? 171 VAL A CB    1 
ATOM   1330 C CG1   . VAL A 1 171 ? 44.240  6.224   20.518  1.00 40.67  ? 171 VAL A CG1   1 
ATOM   1331 C CG2   . VAL A 1 171 ? 42.949  8.345   20.743  1.00 37.40  ? 171 VAL A CG2   1 
ATOM   1332 N N     . GLY A 1 172 ? 39.850  7.597   20.298  1.00 40.65  ? 172 GLY A N     1 
ATOM   1333 C CA    . GLY A 1 172 ? 38.623  8.235   20.732  1.00 38.77  ? 172 GLY A CA    1 
ATOM   1334 C C     . GLY A 1 172 ? 37.463  7.273   20.810  1.00 38.74  ? 172 GLY A C     1 
ATOM   1335 O O     . GLY A 1 172 ? 36.545  7.473   21.604  1.00 39.69  ? 172 GLY A O     1 
ATOM   1336 N N     . LEU A 1 173 ? 37.464  6.235   19.970  1.00 40.42  ? 173 LEU A N     1 
ATOM   1337 C CA    . LEU A 1 173 ? 36.488  5.168   20.159  1.00 40.32  ? 173 LEU A CA    1 
ATOM   1338 C C     . LEU A 1 173 ? 36.829  4.334   21.396  1.00 42.02  ? 173 LEU A C     1 
ATOM   1339 O O     . LEU A 1 173 ? 35.927  3.862   22.099  1.00 41.68  ? 173 LEU A O     1 
ATOM   1340 C CB    . LEU A 1 173 ? 36.406  4.298   18.904  1.00 37.37  ? 173 LEU A CB    1 
ATOM   1341 C CG    . LEU A 1 173 ? 35.837  4.978   17.645  1.00 42.73  ? 173 LEU A CG    1 
ATOM   1342 C CD1   . LEU A 1 173 ? 35.925  4.101   16.397  1.00 36.71  ? 173 LEU A CD1   1 
ATOM   1343 C CD2   . LEU A 1 173 ? 34.395  5.415   17.874  1.00 41.99  ? 173 LEU A CD2   1 
ATOM   1344 N N     . LEU A 1 174 ? 38.121  4.167   21.688  1.00 39.92  ? 174 LEU A N     1 
ATOM   1345 C CA    . LEU A 1 174 ? 38.520  3.492   22.913  1.00 38.88  ? 174 LEU A CA    1 
ATOM   1346 C C     . LEU A 1 174 ? 38.064  4.285   24.133  1.00 44.28  ? 174 LEU A C     1 
ATOM   1347 O O     . LEU A 1 174 ? 37.517  3.715   25.084  1.00 44.59  ? 174 LEU A O     1 
ATOM   1348 C CB    . LEU A 1 174 ? 40.033  3.276   22.911  1.00 35.82  ? 174 LEU A CB    1 
ATOM   1349 C CG    . LEU A 1 174 ? 40.528  2.375   21.767  1.00 38.92  ? 174 LEU A CG    1 
ATOM   1350 C CD1   . LEU A 1 174 ? 42.021  2.199   21.795  1.00 38.39  ? 174 LEU A CD1   1 
ATOM   1351 C CD2   . LEU A 1 174 ? 39.859  1.028   21.790  1.00 36.35  ? 174 LEU A CD2   1 
ATOM   1352 N N     . ASP A 1 175 ? 38.249  5.610   24.104  1.00 46.23  ? 175 ASP A N     1 
ATOM   1353 C CA    . ASP A 1 175 ? 37.665  6.480   25.119  1.00 40.69  ? 175 ASP A CA    1 
ATOM   1354 C C     . ASP A 1 175 ? 36.197  6.123   25.353  1.00 43.54  ? 175 ASP A C     1 
ATOM   1355 O O     . ASP A 1 175 ? 35.752  5.942   26.497  1.00 40.71  ? 175 ASP A O     1 
ATOM   1356 C CB    . ASP A 1 175 ? 37.799  7.950   24.689  1.00 39.95  ? 175 ASP A CB    1 
ATOM   1357 C CG    . ASP A 1 175 ? 39.250  8.476   24.736  1.00 43.09  ? 175 ASP A CG    1 
ATOM   1358 O OD1   . ASP A 1 175 ? 40.150  7.799   25.270  1.00 45.59  ? 175 ASP A OD1   1 
ATOM   1359 O OD2   . ASP A 1 175 ? 39.488  9.608   24.266  1.00 41.47  ? 175 ASP A OD2   1 
ATOM   1360 N N     . GLN A 1 176 ? 35.429  6.001   24.266  1.00 43.45  ? 176 GLN A N     1 
ATOM   1361 C CA    . GLN A 1 176 ? 34.013  5.691   24.418  1.00 43.38  ? 176 GLN A CA    1 
ATOM   1362 C C     . GLN A 1 176 ? 33.834  4.344   25.087  1.00 42.55  ? 176 GLN A C     1 
ATOM   1363 O O     . GLN A 1 176 ? 33.021  4.198   26.005  1.00 43.69  ? 176 GLN A O     1 
ATOM   1364 C CB    . GLN A 1 176 ? 33.312  5.712   23.066  1.00 35.23  ? 176 GLN A CB    1 
ATOM   1365 C CG    . GLN A 1 176 ? 33.304  7.074   22.418  1.00 39.87  ? 176 GLN A CG    1 
ATOM   1366 C CD    . GLN A 1 176 ? 32.695  7.049   21.019  1.00 42.36  ? 176 GLN A CD    1 
ATOM   1367 O OE1   . GLN A 1 176 ? 32.118  6.046   20.597  1.00 39.48  ? 176 GLN A OE1   1 
ATOM   1368 N NE2   . GLN A 1 176 ? 32.817  8.157   20.301  1.00 38.77  ? 176 GLN A NE2   1 
ATOM   1369 N N     . ARG A 1 177 ? 34.608  3.356   24.654  1.00 40.83  ? 177 ARG A N     1 
ATOM   1370 C CA    . ARG A 1 177 ? 34.430  2.009   25.160  1.00 41.28  ? 177 ARG A CA    1 
ATOM   1371 C C     . ARG A 1 177 ? 34.792  1.931   26.634  1.00 42.53  ? 177 ARG A C     1 
ATOM   1372 O O     . ARG A 1 177 ? 34.126  1.226   27.401  1.00 40.56  ? 177 ARG A O     1 
ATOM   1373 C CB    . ARG A 1 177 ? 35.272  1.047   24.337  1.00 42.08  ? 177 ARG A CB    1 
ATOM   1374 C CG    . ARG A 1 177 ? 35.139  -0.371  24.768  1.00 43.69  ? 177 ARG A CG    1 
ATOM   1375 C CD    . ARG A 1 177 ? 36.269  -1.165  24.228  1.00 40.92  ? 177 ARG A CD    1 
ATOM   1376 N NE    . ARG A 1 177 ? 36.017  -1.535  22.852  1.00 43.38  ? 177 ARG A NE    1 
ATOM   1377 C CZ    . ARG A 1 177 ? 36.974  -1.954  22.044  1.00 47.43  ? 177 ARG A CZ    1 
ATOM   1378 N NH1   . ARG A 1 177 ? 38.217  -2.026  22.528  1.00 50.40  ? 177 ARG A NH1   1 
ATOM   1379 N NH2   . ARG A 1 177 ? 36.693  -2.307  20.790  1.00 36.44  ? 177 ARG A NH2   1 
ATOM   1380 N N     . LEU A 1 178 ? 35.834  2.665   27.047  1.00 40.54  ? 178 LEU A N     1 
ATOM   1381 C CA    . LEU A 1 178 ? 36.212  2.691   28.451  1.00 36.96  ? 178 LEU A CA    1 
ATOM   1382 C C     . LEU A 1 178 ? 35.088  3.240   29.304  1.00 39.93  ? 178 LEU A C     1 
ATOM   1383 O O     . LEU A 1 178 ? 34.846  2.754   30.413  1.00 44.72  ? 178 LEU A O     1 
ATOM   1384 C CB    . LEU A 1 178 ? 37.469  3.521   28.650  1.00 39.27  ? 178 LEU A CB    1 
ATOM   1385 C CG    . LEU A 1 178 ? 37.900  3.671   30.114  1.00 36.38  ? 178 LEU A CG    1 
ATOM   1386 C CD1   . LEU A 1 178 ? 38.144  2.325   30.727  1.00 35.73  ? 178 LEU A CD1   1 
ATOM   1387 C CD2   . LEU A 1 178 ? 39.153  4.499   30.177  1.00 40.80  ? 178 LEU A CD2   1 
ATOM   1388 N N     . ALA A 1 179 ? 34.387  4.255   28.810  1.00 40.67  ? 179 ALA A N     1 
ATOM   1389 C CA    . ALA A 1 179 ? 33.195  4.700   29.517  1.00 39.06  ? 179 ALA A CA    1 
ATOM   1390 C C     . ALA A 1 179 ? 32.132  3.610   29.538  1.00 41.79  ? 179 ALA A C     1 
ATOM   1391 O O     . ALA A 1 179 ? 31.433  3.445   30.542  1.00 45.47  ? 179 ALA A O     1 
ATOM   1392 C CB    . ALA A 1 179 ? 32.647  5.982   28.897  1.00 36.72  ? 179 ALA A CB    1 
ATOM   1393 N N     . LEU A 1 180 ? 32.004  2.838   28.453  1.00 39.97  ? 180 LEU A N     1 
ATOM   1394 C CA    . LEU A 1 180 ? 31.030  1.749   28.454  1.00 43.47  ? 180 LEU A CA    1 
ATOM   1395 C C     . LEU A 1 180 ? 31.348  0.730   29.549  1.00 45.12  ? 180 LEU A C     1 
ATOM   1396 O O     . LEU A 1 180 ? 30.471  0.356   30.336  1.00 43.76  ? 180 LEU A O     1 
ATOM   1397 C CB    . LEU A 1 180 ? 30.972  1.077   27.083  1.00 40.44  ? 180 LEU A CB    1 
ATOM   1398 C CG    . LEU A 1 180 ? 30.516  1.961   25.917  1.00 44.44  ? 180 LEU A CG    1 
ATOM   1399 C CD1   . LEU A 1 180 ? 30.318  1.145   24.639  1.00 39.97  ? 180 LEU A CD1   1 
ATOM   1400 C CD2   . LEU A 1 180 ? 29.257  2.727   26.254  1.00 38.77  ? 180 LEU A CD2   1 
ATOM   1401 N N     . GLN A 1 181 ? 32.604  0.285   29.619  1.00 43.86  ? 181 GLN A N     1 
ATOM   1402 C CA    . GLN A 1 181 ? 33.038  -0.580  30.712  1.00 44.15  ? 181 GLN A CA    1 
ATOM   1403 C C     . GLN A 1 181 ? 32.746  0.057   32.062  1.00 46.31  ? 181 GLN A C     1 
ATOM   1404 O O     . GLN A 1 181 ? 32.170  -0.584  32.952  1.00 45.75  ? 181 GLN A O     1 
ATOM   1405 C CB    . GLN A 1 181 ? 34.528  -0.879  30.587  1.00 42.15  ? 181 GLN A CB    1 
ATOM   1406 C CG    . GLN A 1 181 ? 34.912  -1.627  29.325  1.00 43.89  ? 181 GLN A CG    1 
ATOM   1407 C CD    . GLN A 1 181 ? 36.414  -1.618  29.124  1.00 49.69  ? 181 GLN A CD    1 
ATOM   1408 O OE1   . GLN A 1 181 ? 36.908  -1.575  27.996  1.00 51.18  ? 181 GLN A OE1   1 
ATOM   1409 N NE2   . GLN A 1 181 ? 37.154  -1.643  30.225  1.00 54.88  ? 181 GLN A NE2   1 
ATOM   1410 N N     . TRP A 1 182 ? 33.145  1.322   32.233  1.00 43.66  ? 182 TRP A N     1 
ATOM   1411 C CA    . TRP A 1 182 ? 32.840  2.031   33.468  1.00 40.24  ? 182 TRP A CA    1 
ATOM   1412 C C     . TRP A 1 182 ? 31.366  1.934   33.810  1.00 43.24  ? 182 TRP A C     1 
ATOM   1413 O O     . TRP A 1 182 ? 31.003  1.794   34.983  1.00 48.06  ? 182 TRP A O     1 
ATOM   1414 C CB    . TRP A 1 182 ? 33.242  3.489   33.354  1.00 38.59  ? 182 TRP A CB    1 
ATOM   1415 C CG    . TRP A 1 182 ? 33.098  4.269   34.627  1.00 38.48  ? 182 TRP A CG    1 
ATOM   1416 C CD1   . TRP A 1 182 ? 34.094  4.591   35.490  1.00 36.13  ? 182 TRP A CD1   1 
ATOM   1417 C CD2   . TRP A 1 182 ? 31.900  4.858   35.159  1.00 38.63  ? 182 TRP A CD2   1 
ATOM   1418 N NE1   . TRP A 1 182 ? 33.603  5.342   36.526  1.00 38.72  ? 182 TRP A NE1   1 
ATOM   1419 C CE2   . TRP A 1 182 ? 32.257  5.516   36.355  1.00 37.15  ? 182 TRP A CE2   1 
ATOM   1420 C CE3   . TRP A 1 182 ? 30.562  4.888   34.745  1.00 39.47  ? 182 TRP A CE3   1 
ATOM   1421 C CZ2   . TRP A 1 182 ? 31.331  6.196   37.150  1.00 36.58  ? 182 TRP A CZ2   1 
ATOM   1422 C CZ3   . TRP A 1 182 ? 29.638  5.568   35.535  1.00 42.64  ? 182 TRP A CZ3   1 
ATOM   1423 C CH2   . TRP A 1 182 ? 30.031  6.210   36.735  1.00 39.00  ? 182 TRP A CH2   1 
ATOM   1424 N N     . VAL A 1 183 ? 30.493  1.997   32.806  1.00 41.21  ? 183 VAL A N     1 
ATOM   1425 C CA    . VAL A 1 183 ? 29.077  1.837   33.104  1.00 43.37  ? 183 VAL A CA    1 
ATOM   1426 C C     . VAL A 1 183 ? 28.781  0.413   33.572  1.00 43.21  ? 183 VAL A C     1 
ATOM   1427 O O     . VAL A 1 183 ? 28.053  0.211   34.552  1.00 41.42  ? 183 VAL A O     1 
ATOM   1428 C CB    . VAL A 1 183 ? 28.225  2.247   31.896  1.00 41.59  ? 183 VAL A CB    1 
ATOM   1429 C CG1   . VAL A 1 183 ? 26.783  1.787   32.078  1.00 38.01  ? 183 VAL A CG1   1 
ATOM   1430 C CG2   . VAL A 1 183 ? 28.269  3.738   31.772  1.00 41.70  ? 183 VAL A CG2   1 
ATOM   1431 N N     . GLN A 1 184 ? 29.365  -0.588  32.910  1.00 41.12  ? 184 GLN A N     1 
ATOM   1432 C CA    . GLN A 1 184 ? 29.172  -1.972  33.335  1.00 42.15  ? 184 GLN A CA    1 
ATOM   1433 C C     . GLN A 1 184 ? 29.520  -2.149  34.810  1.00 44.49  ? 184 GLN A C     1 
ATOM   1434 O O     . GLN A 1 184 ? 28.761  -2.758  35.571  1.00 42.22  ? 184 GLN A O     1 
ATOM   1435 C CB    . GLN A 1 184 ? 30.016  -2.915  32.476  1.00 38.01  ? 184 GLN A CB    1 
ATOM   1436 C CG    . GLN A 1 184 ? 29.424  -3.170  31.125  1.00 45.20  ? 184 GLN A CG    1 
ATOM   1437 C CD    . GLN A 1 184 ? 28.052  -3.794  31.213  1.00 51.12  ? 184 GLN A CD    1 
ATOM   1438 O OE1   . GLN A 1 184 ? 27.898  -4.906  31.730  1.00 54.62  ? 184 GLN A OE1   1 
ATOM   1439 N NE2   . GLN A 1 184 ? 27.039  -3.084  30.713  1.00 46.70  ? 184 GLN A NE2   1 
ATOM   1440 N N     . GLU A 1 185 ? 30.655  -1.595  35.236  1.00 40.04  ? 185 GLU A N     1 
ATOM   1441 C CA    . GLU A 1 185 ? 31.116  -1.854  36.590  1.00 46.17  ? 185 GLU A CA    1 
ATOM   1442 C C     . GLU A 1 185 ? 30.368  -1.024  37.627  1.00 48.54  ? 185 GLU A C     1 
ATOM   1443 O O     . GLU A 1 185 ? 30.064  -1.521  38.716  1.00 46.53  ? 185 GLU A O     1 
ATOM   1444 C CB    . GLU A 1 185 ? 32.618  -1.595  36.702  1.00 47.37  ? 185 GLU A CB    1 
ATOM   1445 C CG    . GLU A 1 185 ? 33.126  -1.734  38.142  1.00 49.41  ? 185 GLU A CG    1 
ATOM   1446 C CD    . GLU A 1 185 ? 34.626  -1.953  38.221  1.00 55.59  ? 185 GLU A CD    1 
ATOM   1447 O OE1   . GLU A 1 185 ? 35.104  -2.526  39.237  1.00 55.48  ? 185 GLU A OE1   1 
ATOM   1448 O OE2   . GLU A 1 185 ? 35.322  -1.553  37.263  1.00 51.78  ? 185 GLU A OE2   1 
ATOM   1449 N N     . ASN A 1 186 ? 30.051  0.233   37.310  1.00 48.77  ? 186 ASN A N     1 
ATOM   1450 C CA    . ASN A 1 186 ? 29.676  1.194   38.334  1.00 41.21  ? 186 ASN A CA    1 
ATOM   1451 C C     . ASN A 1 186 ? 28.238  1.676   38.269  1.00 43.03  ? 186 ASN A C     1 
ATOM   1452 O O     . ASN A 1 186 ? 27.761  2.225   39.263  1.00 45.82  ? 186 ASN A O     1 
ATOM   1453 C CB    . ASN A 1 186 ? 30.598  2.413   38.267  1.00 38.25  ? 186 ASN A CB    1 
ATOM   1454 C CG    . ASN A 1 186 ? 32.048  2.036   38.433  1.00 44.83  ? 186 ASN A CG    1 
ATOM   1455 O OD1   . ASN A 1 186 ? 32.499  1.760   39.551  1.00 48.04  ? 186 ASN A OD1   1 
ATOM   1456 N ND2   . ASN A 1 186 ? 32.798  2.022   37.328  1.00 41.72  ? 186 ASN A ND2   1 
ATOM   1457 N N     . ILE A 1 187 ? 27.536  1.504   37.144  1.00 43.03  ? 187 ILE A N     1 
ATOM   1458 C CA    . ILE A 1 187 ? 26.222  2.131   37.020  1.00 41.67  ? 187 ILE A CA    1 
ATOM   1459 C C     . ILE A 1 187 ? 25.243  1.582   38.052  1.00 42.96  ? 187 ILE A C     1 
ATOM   1460 O O     . ILE A 1 187 ? 24.246  2.241   38.378  1.00 43.24  ? 187 ILE A O     1 
ATOM   1461 C CB    . ILE A 1 187 ? 25.658  1.985   35.588  1.00 38.35  ? 187 ILE A CB    1 
ATOM   1462 C CG1   . ILE A 1 187 ? 24.562  3.032   35.322  1.00 39.61  ? 187 ILE A CG1   1 
ATOM   1463 C CG2   . ILE A 1 187 ? 25.080  0.601   35.362  1.00 39.97  ? 187 ILE A CG2   1 
ATOM   1464 C CD1   . ILE A 1 187 ? 25.007  4.484   35.460  1.00 35.41  ? 187 ILE A CD1   1 
ATOM   1465 N N     . ALA A 1 188 ? 25.521  0.403   38.609  1.00 41.29  ? 188 ALA A N     1 
ATOM   1466 C CA    . ALA A 1 188 ? 24.620  -0.142  39.619  1.00 43.86  ? 188 ALA A CA    1 
ATOM   1467 C C     . ALA A 1 188 ? 24.595  0.718   40.884  1.00 41.96  ? 188 ALA A C     1 
ATOM   1468 O O     . ALA A 1 188 ? 23.558  0.807   41.538  1.00 42.65  ? 188 ALA A O     1 
ATOM   1469 C CB    . ALA A 1 188 ? 24.992  -1.589  39.935  1.00 37.32  ? 188 ALA A CB    1 
ATOM   1470 N N     . ALA A 1 189 ? 25.687  1.407   41.217  1.00 38.31  ? 189 ALA A N     1 
ATOM   1471 C CA    . ALA A 1 189 ? 25.659  2.297   42.374  1.00 36.69  ? 189 ALA A CA    1 
ATOM   1472 C C     . ALA A 1 189 ? 24.681  3.456   42.222  1.00 44.08  ? 189 ALA A C     1 
ATOM   1473 O O     . ALA A 1 189 ? 24.454  4.188   43.191  1.00 49.85  ? 189 ALA A O     1 
ATOM   1474 C CB    . ALA A 1 189 ? 27.052  2.860   42.649  1.00 35.90  ? 189 ALA A CB    1 
ATOM   1475 N N     . PHE A 1 190 ? 24.114  3.667   41.040  1.00 46.99  ? 190 PHE A N     1 
ATOM   1476 C CA    . PHE A 1 190 ? 23.172  4.754   40.827  1.00 45.73  ? 190 PHE A CA    1 
ATOM   1477 C C     . PHE A 1 190 ? 21.759  4.246   40.601  1.00 46.09  ? 190 PHE A C     1 
ATOM   1478 O O     . PHE A 1 190 ? 20.836  5.058   40.470  1.00 48.01  ? 190 PHE A O     1 
ATOM   1479 C CB    . PHE A 1 190 ? 23.609  5.614   39.632  1.00 42.94  ? 190 PHE A CB    1 
ATOM   1480 C CG    . PHE A 1 190 ? 24.986  6.201   39.768  1.00 40.30  ? 190 PHE A CG    1 
ATOM   1481 C CD1   . PHE A 1 190 ? 26.105  5.441   39.505  1.00 41.73  ? 190 PHE A CD1   1 
ATOM   1482 C CD2   . PHE A 1 190 ? 25.157  7.522   40.128  1.00 42.46  ? 190 PHE A CD2   1 
ATOM   1483 C CE1   . PHE A 1 190 ? 27.365  5.983   39.621  1.00 40.31  ? 190 PHE A CE1   1 
ATOM   1484 C CE2   . PHE A 1 190 ? 26.416  8.071   40.229  1.00 40.47  ? 190 PHE A CE2   1 
ATOM   1485 C CZ    . PHE A 1 190 ? 27.518  7.301   39.977  1.00 38.93  ? 190 PHE A CZ    1 
ATOM   1486 N N     . GLY A 1 191 ? 21.566  2.930   40.559  1.00 36.62  ? 191 GLY A N     1 
ATOM   1487 C CA    . GLY A 1 191 ? 20.286  2.352   40.258  1.00 35.66  ? 191 GLY A CA    1 
ATOM   1488 C C     . GLY A 1 191 ? 20.174  1.864   38.842  1.00 49.94  ? 191 GLY A C     1 
ATOM   1489 O O     . GLY A 1 191 ? 19.171  1.229   38.495  1.00 55.15  ? 191 GLY A O     1 
ATOM   1490 N N     . GLY A 1 192 ? 21.169  2.152   38.010  1.00 47.76  ? 192 GLY A N     1 
ATOM   1491 C CA    . GLY A 1 192 ? 21.130  1.689   36.645  1.00 45.63  ? 192 GLY A CA    1 
ATOM   1492 C C     . GLY A 1 192 ? 21.405  0.203   36.561  1.00 48.65  ? 192 GLY A C     1 
ATOM   1493 O O     . GLY A 1 192 ? 22.111  -0.373  37.385  1.00 46.45  ? 192 GLY A O     1 
ATOM   1494 N N     . ASP A 1 193 ? 20.843  -0.411  35.528  1.00 49.14  ? 193 ASP A N     1 
ATOM   1495 C CA    . ASP A 1 193 ? 20.862  -1.846  35.301  1.00 46.52  ? 193 ASP A CA    1 
ATOM   1496 C C     . ASP A 1 193 ? 21.897  -2.153  34.220  1.00 51.83  ? 193 ASP A C     1 
ATOM   1497 O O     . ASP A 1 193 ? 21.597  -2.014  33.021  1.00 49.61  ? 193 ASP A O     1 
ATOM   1498 C CB    . ASP A 1 193 ? 19.458  -2.290  34.872  1.00 49.13  ? 193 ASP A CB    1 
ATOM   1499 C CG    . ASP A 1 193 ? 19.355  -3.761  34.529  1.00 49.14  ? 193 ASP A CG    1 
ATOM   1500 O OD1   . ASP A 1 193 ? 20.382  -4.479  34.463  1.00 47.62  ? 193 ASP A OD1   1 
ATOM   1501 O OD2   . ASP A 1 193 ? 18.201  -4.187  34.295  1.00 44.07  ? 193 ASP A OD2   1 
ATOM   1502 N N     . PRO A 1 194 ? 23.113  -2.580  34.575  1.00 49.29  ? 194 PRO A N     1 
ATOM   1503 C CA    . PRO A 1 194 ? 24.130  -2.839  33.544  1.00 46.18  ? 194 PRO A CA    1 
ATOM   1504 C C     . PRO A 1 194 ? 23.736  -3.923  32.556  1.00 50.45  ? 194 PRO A C     1 
ATOM   1505 O O     . PRO A 1 194 ? 24.442  -4.120  31.555  1.00 49.26  ? 194 PRO A O     1 
ATOM   1506 C CB    . PRO A 1 194 ? 25.367  -3.247  34.357  1.00 43.55  ? 194 PRO A CB    1 
ATOM   1507 C CG    . PRO A 1 194 ? 24.845  -3.691  35.634  1.00 39.65  ? 194 PRO A CG    1 
ATOM   1508 C CD    . PRO A 1 194 ? 23.599  -2.904  35.916  1.00 38.16  ? 194 PRO A CD    1 
ATOM   1509 N N     . MET A 1 195 ? 22.635  -4.629  32.807  1.00 51.27  ? 195 MET A N     1 
ATOM   1510 C CA    . MET A 1 195 ? 22.138  -5.637  31.887  1.00 51.07  ? 195 MET A CA    1 
ATOM   1511 C C     . MET A 1 195 ? 21.123  -5.093  30.899  1.00 51.58  ? 195 MET A C     1 
ATOM   1512 O O     . MET A 1 195 ? 20.614  -5.864  30.080  1.00 57.11  ? 195 MET A O     1 
ATOM   1513 C CB    . MET A 1 195 ? 21.526  -6.792  32.669  1.00 52.98  ? 195 MET A CB    1 
ATOM   1514 C CG    . MET A 1 195 ? 22.483  -7.387  33.660  1.00 56.23  ? 195 MET A CG    1 
ATOM   1515 S SD    . MET A 1 195 ? 22.187  -9.131  33.939  1.00 71.34  ? 195 MET A SD    1 
ATOM   1516 C CE    . MET A 1 195 ? 23.671  -9.807  33.212  1.00 67.24  ? 195 MET A CE    1 
ATOM   1517 N N     . SER A 1 196 ? 20.819  -3.782  30.943  1.00 50.47  ? 196 SER A N     1 
ATOM   1518 C CA    . SER A 1 196 ? 19.935  -3.139  29.957  1.00 50.53  ? 196 SER A CA    1 
ATOM   1519 C C     . SER A 1 196 ? 20.556  -1.782  29.587  1.00 50.54  ? 196 SER A C     1 
ATOM   1520 O O     . SER A 1 196 ? 20.134  -0.722  30.066  1.00 52.86  ? 196 SER A O     1 
ATOM   1521 C CB    . SER A 1 196 ? 18.513  -2.993  30.505  1.00 49.94  ? 196 SER A CB    1 
ATOM   1522 O OG    . SER A 1 196 ? 17.571  -2.672  29.493  1.00 50.32  ? 196 SER A OG    1 
ATOM   1523 N N     . VAL A 1 197 ? 21.578  -1.814  28.734  1.00 44.47  ? 197 VAL A N     1 
ATOM   1524 C CA    . VAL A 1 197 ? 22.301  -0.614  28.311  1.00 45.64  ? 197 VAL A CA    1 
ATOM   1525 C C     . VAL A 1 197 ? 22.052  -0.375  26.821  1.00 47.18  ? 197 VAL A C     1 
ATOM   1526 O O     . VAL A 1 197 ? 22.370  -1.230  25.978  1.00 48.45  ? 197 VAL A O     1 
ATOM   1527 C CB    . VAL A 1 197 ? 23.804  -0.732  28.598  1.00 47.48  ? 197 VAL A CB    1 
ATOM   1528 C CG1   . VAL A 1 197 ? 24.556  0.365   27.883  1.00 42.36  ? 197 VAL A CG1   1 
ATOM   1529 C CG2   . VAL A 1 197 ? 24.073  -0.691  30.098  1.00 43.78  ? 197 VAL A CG2   1 
ATOM   1530 N N     . THR A 1 198 ? 21.496  0.791   26.498  1.00 45.57  ? 198 THR A N     1 
ATOM   1531 C CA    . THR A 1 198 ? 21.165  1.183   25.129  1.00 42.70  ? 198 THR A CA    1 
ATOM   1532 C C     . THR A 1 198 ? 22.037  2.365   24.729  1.00 42.27  ? 198 THR A C     1 
ATOM   1533 O O     . THR A 1 198 ? 21.948  3.433   25.350  1.00 46.14  ? 198 THR A O     1 
ATOM   1534 C CB    . THR A 1 198 ? 19.691  1.572   25.018  1.00 42.53  ? 198 THR A CB    1 
ATOM   1535 O OG1   . THR A 1 198 ? 18.867  0.408   25.050  1.00 49.28  ? 198 THR A OG1   1 
ATOM   1536 C CG2   . THR A 1 198 ? 19.437  2.294   23.745  1.00 46.81  ? 198 THR A CG2   1 
ATOM   1537 N N     . LEU A 1 199 ? 22.878  2.176   23.709  1.00 38.21  ? 199 LEU A N     1 
ATOM   1538 C CA    . LEU A 1 199 ? 23.633  3.280   23.113  1.00 40.13  ? 199 LEU A CA    1 
ATOM   1539 C C     . LEU A 1 199 ? 22.758  4.104   22.170  1.00 41.70  ? 199 LEU A C     1 
ATOM   1540 O O     . LEU A 1 199 ? 21.976  3.557   21.390  1.00 41.90  ? 199 LEU A O     1 
ATOM   1541 C CB    . LEU A 1 199 ? 24.832  2.765   22.318  1.00 36.29  ? 199 LEU A CB    1 
ATOM   1542 C CG    . LEU A 1 199 ? 25.797  1.833   23.036  1.00 41.88  ? 199 LEU A CG    1 
ATOM   1543 C CD1   . LEU A 1 199 ? 27.050  1.618   22.206  1.00 37.14  ? 199 LEU A CD1   1 
ATOM   1544 C CD2   . LEU A 1 199 ? 26.139  2.390   24.406  1.00 42.42  ? 199 LEU A CD2   1 
ATOM   1545 N N     . PHE A 1 200 ? 22.909  5.423   22.220  1.00 37.62  ? 200 PHE A N     1 
ATOM   1546 C CA    . PHE A 1 200 ? 22.275  6.244   21.209  1.00 36.90  ? 200 PHE A CA    1 
ATOM   1547 C C     . PHE A 1 200 ? 23.121  7.480   20.979  1.00 39.83  ? 200 PHE A C     1 
ATOM   1548 O O     . PHE A 1 200 ? 23.726  8.009   21.912  1.00 37.93  ? 200 PHE A O     1 
ATOM   1549 C CB    . PHE A 1 200 ? 20.823  6.597   21.568  1.00 38.35  ? 200 PHE A CB    1 
ATOM   1550 C CG    . PHE A 1 200 ? 20.652  7.625   22.653  1.00 38.45  ? 200 PHE A CG    1 
ATOM   1551 C CD1   . PHE A 1 200 ? 19.763  8.678   22.473  1.00 37.01  ? 200 PHE A CD1   1 
ATOM   1552 C CD2   . PHE A 1 200 ? 21.281  7.494   23.886  1.00 41.10  ? 200 PHE A CD2   1 
ATOM   1553 C CE1   . PHE A 1 200 ? 19.561  9.633   23.480  1.00 41.76  ? 200 PHE A CE1   1 
ATOM   1554 C CE2   . PHE A 1 200 ? 21.083  8.438   24.906  1.00 40.73  ? 200 PHE A CE2   1 
ATOM   1555 C CZ    . PHE A 1 200 ? 20.225  9.510   24.702  1.00 38.82  ? 200 PHE A CZ    1 
ATOM   1556 N N     . GLY A 1 201 ? 23.186  7.899   19.715  1.00 39.32  ? 201 GLY A N     1 
ATOM   1557 C CA    . GLY A 1 201 ? 24.018  9.008   19.286  1.00 38.43  ? 201 GLY A CA    1 
ATOM   1558 C C     . GLY A 1 201 ? 23.594  9.515   17.922  1.00 43.23  ? 201 GLY A C     1 
ATOM   1559 O O     . GLY A 1 201 ? 22.811  8.886   17.202  1.00 42.90  ? 201 GLY A O     1 
ATOM   1560 N N     . GLU A 1 202 ? 24.139  10.675  17.569  1.00 42.17  ? 202 GLU A N     1 
ATOM   1561 C CA    . GLU A 1 202 ? 23.763  11.382  16.361  1.00 37.88  ? 202 GLU A CA    1 
ATOM   1562 C C     . GLU A 1 202 ? 25.013  11.809  15.614  1.00 38.84  ? 202 GLU A C     1 
ATOM   1563 O O     . GLU A 1 202 ? 26.040  12.120  16.223  1.00 37.55  ? 202 GLU A O     1 
ATOM   1564 C CB    . GLU A 1 202 ? 22.893  12.590  16.686  1.00 38.46  ? 202 GLU A CB    1 
ATOM   1565 C CG    . GLU A 1 202 ? 22.298  13.278  15.488  1.00 41.93  ? 202 GLU A CG    1 
ATOM   1566 C CD    . GLU A 1 202 ? 23.148  14.430  15.007  1.00 44.84  ? 202 GLU A CD    1 
ATOM   1567 O OE1   . GLU A 1 202 ? 24.178  14.715  15.652  1.00 45.98  ? 202 GLU A OE1   1 
ATOM   1568 O OE2   . GLU A 1 202 ? 22.781  15.057  13.991  1.00 44.00  ? 202 GLU A OE2   1 
ATOM   1569 N N     . SER A 1 203 ? 24.909  11.806  14.275  1.00 40.61  ? 203 SER A N     1 
ATOM   1570 C CA    . SER A 1 203 ? 25.989  12.197  13.356  1.00 39.13  ? 203 SER A CA    1 
ATOM   1571 C C     . SER A 1 203 ? 27.185  11.289  13.624  1.00 38.13  ? 203 SER A C     1 
ATOM   1572 O O     . SER A 1 203 ? 27.025  10.056  13.544  1.00 37.43  ? 203 SER A O     1 
ATOM   1573 C CB    . SER A 1 203 ? 26.228  13.704  13.493  1.00 40.86  ? 203 SER A CB    1 
ATOM   1574 O OG    . SER A 1 203 ? 27.262  14.172  12.644  1.00 45.02  ? 203 SER A OG    1 
ATOM   1575 N N     . ALA A 1 204 ? 28.374  11.819  13.930  1.00 36.32  ? 204 ALA A N     1 
ATOM   1576 C CA    . ALA A 1 204 ? 29.493  10.964  14.312  1.00 37.17  ? 204 ALA A CA    1 
ATOM   1577 C C     . ALA A 1 204 ? 29.159  10.085  15.508  1.00 41.28  ? 204 ALA A C     1 
ATOM   1578 O O     . ALA A 1 204 ? 29.789  9.037   15.701  1.00 40.56  ? 204 ALA A O     1 
ATOM   1579 C CB    . ALA A 1 204 ? 30.725  11.808  14.642  1.00 34.68  ? 204 ALA A CB    1 
ATOM   1580 N N     . GLY A 1 205 ? 28.200  10.501  16.334  1.00 40.72  ? 205 GLY A N     1 
ATOM   1581 C CA    . GLY A 1 205 ? 27.829  9.683   17.466  1.00 38.22  ? 205 GLY A CA    1 
ATOM   1582 C C     . GLY A 1 205 ? 27.109  8.434   17.021  1.00 37.01  ? 205 GLY A C     1 
ATOM   1583 O O     . GLY A 1 205 ? 27.430  7.333   17.462  1.00 39.50  ? 205 GLY A O     1 
ATOM   1584 N N     . ALA A 1 206 ? 26.128  8.592   16.135  1.00 38.18  ? 206 ALA A N     1 
ATOM   1585 C CA    . ALA A 1 206 ? 25.489  7.430   15.521  1.00 40.07  ? 206 ALA A CA    1 
ATOM   1586 C C     . ALA A 1 206 ? 26.519  6.530   14.840  1.00 38.61  ? 206 ALA A C     1 
ATOM   1587 O O     . ALA A 1 206 ? 26.521  5.311   15.048  1.00 39.42  ? 206 ALA A O     1 
ATOM   1588 C CB    . ALA A 1 206 ? 24.413  7.881   14.532  1.00 38.08  ? 206 ALA A CB    1 
ATOM   1589 N N     . ALA A 1 207 ? 27.420  7.116   14.041  1.00 38.23  ? 207 ALA A N     1 
ATOM   1590 C CA    . ALA A 1 207 ? 28.508  6.329   13.460  1.00 38.97  ? 207 ALA A CA    1 
ATOM   1591 C C     . ALA A 1 207 ? 29.275  5.575   14.535  1.00 40.05  ? 207 ALA A C     1 
ATOM   1592 O O     . ALA A 1 207 ? 29.675  4.422   14.334  1.00 42.98  ? 207 ALA A O     1 
ATOM   1593 C CB    . ALA A 1 207 ? 29.468  7.223   12.673  1.00 33.56  ? 207 ALA A CB    1 
ATOM   1594 N N     . SER A 1 208 ? 29.497  6.219   15.683  1.00 39.05  ? 208 SER A N     1 
ATOM   1595 C CA    . SER A 1 208 ? 30.236  5.582   16.768  1.00 38.04  ? 208 SER A CA    1 
ATOM   1596 C C     . SER A 1 208 ? 29.470  4.383   17.316  1.00 39.72  ? 208 SER A C     1 
ATOM   1597 O O     . SER A 1 208 ? 30.012  3.282   17.431  1.00 40.57  ? 208 SER A O     1 
ATOM   1598 C CB    . SER A 1 208 ? 30.518  6.604   17.866  1.00 35.59  ? 208 SER A CB    1 
ATOM   1599 O OG    . SER A 1 208 ? 31.625  7.398   17.508  1.00 38.90  ? 208 SER A OG    1 
ATOM   1600 N N     . VAL A 1 209 ? 28.202  4.588   17.667  1.00 37.99  ? 209 VAL A N     1 
ATOM   1601 C CA    . VAL A 1 209 ? 27.336  3.474   18.013  1.00 34.97  ? 209 VAL A CA    1 
ATOM   1602 C C     . VAL A 1 209 ? 27.498  2.362   16.995  1.00 43.55  ? 209 VAL A C     1 
ATOM   1603 O O     . VAL A 1 209 ? 27.705  1.191   17.348  1.00 45.00  ? 209 VAL A O     1 
ATOM   1604 C CB    . VAL A 1 209 ? 25.878  3.944   18.097  1.00 34.82  ? 209 VAL A CB    1 
ATOM   1605 C CG1   . VAL A 1 209 ? 24.983  2.763   18.262  1.00 32.02  ? 209 VAL A CG1   1 
ATOM   1606 C CG2   . VAL A 1 209 ? 25.719  4.958   19.231  1.00 41.26  ? 209 VAL A CG2   1 
ATOM   1607 N N     . GLY A 1 210 ? 27.432  2.720   15.702  1.00 42.47  ? 210 GLY A N     1 
ATOM   1608 C CA    . GLY A 1 210 ? 27.624  1.732   14.655  1.00 37.24  ? 210 GLY A CA    1 
ATOM   1609 C C     . GLY A 1 210 ? 28.926  0.970   14.793  1.00 39.19  ? 210 GLY A C     1 
ATOM   1610 O O     . GLY A 1 210 ? 28.962  -0.247  14.624  1.00 43.33  ? 210 GLY A O     1 
ATOM   1611 N N     . MET A 1 211 ? 30.009  1.661   15.121  1.00 38.74  ? 211 MET A N     1 
ATOM   1612 C CA    . MET A 1 211 ? 31.280  0.955   15.177  1.00 42.02  ? 211 MET A CA    1 
ATOM   1613 C C     . MET A 1 211 ? 31.433  0.094   16.418  1.00 43.96  ? 211 MET A C     1 
ATOM   1614 O O     . MET A 1 211 ? 32.207  -0.874  16.387  1.00 43.29  ? 211 MET A O     1 
ATOM   1615 C CB    . MET A 1 211 ? 32.423  1.945   15.066  1.00 43.07  ? 211 MET A CB    1 
ATOM   1616 C CG    . MET A 1 211 ? 32.561  2.424   13.643  1.00 45.87  ? 211 MET A CG    1 
ATOM   1617 S SD    . MET A 1 211 ? 33.461  3.955   13.628  1.00 57.98  ? 211 MET A SD    1 
ATOM   1618 C CE    . MET A 1 211 ? 32.734  4.704   12.188  1.00 43.47  ? 211 MET A CE    1 
ATOM   1619 N N     . HIS A 1 212 ? 30.717  0.418   17.502  1.00 42.51  ? 212 HIS A N     1 
ATOM   1620 C CA    . HIS A 1 212 ? 30.687  -0.479  18.647  1.00 41.07  ? 212 HIS A CA    1 
ATOM   1621 C C     . HIS A 1 212 ? 29.894  -1.731  18.337  1.00 42.59  ? 212 HIS A C     1 
ATOM   1622 O O     . HIS A 1 212 ? 30.125  -2.773  18.958  1.00 47.27  ? 212 HIS A O     1 
ATOM   1623 C CB    . HIS A 1 212 ? 30.076  0.208   19.869  1.00 46.04  ? 212 HIS A CB    1 
ATOM   1624 C CG    . HIS A 1 212 ? 30.904  1.322   20.415  1.00 39.49  ? 212 HIS A CG    1 
ATOM   1625 N ND1   . HIS A 1 212 ? 32.187  1.133   20.881  1.00 37.27  ? 212 HIS A ND1   1 
ATOM   1626 C CD2   . HIS A 1 212 ? 30.630  2.636   20.572  1.00 36.66  ? 212 HIS A CD2   1 
ATOM   1627 C CE1   . HIS A 1 212 ? 32.673  2.289   21.291  1.00 39.09  ? 212 HIS A CE1   1 
ATOM   1628 N NE2   . HIS A 1 212 ? 31.747  3.217   21.118  1.00 40.69  ? 212 HIS A NE2   1 
ATOM   1629 N N     . ILE A 1 213 ? 28.922  -1.632  17.432  1.00 39.07  ? 213 ILE A N     1 
ATOM   1630 C CA    . ILE A 1 213 ? 28.213  -2.814  16.972  1.00 37.60  ? 213 ILE A CA    1 
ATOM   1631 C C     . ILE A 1 213 ? 29.147  -3.708  16.180  1.00 41.36  ? 213 ILE A C     1 
ATOM   1632 O O     . ILE A 1 213 ? 29.041  -4.933  16.241  1.00 49.49  ? 213 ILE A O     1 
ATOM   1633 C CB    . ILE A 1 213 ? 26.982  -2.395  16.149  1.00 40.51  ? 213 ILE A CB    1 
ATOM   1634 C CG1   . ILE A 1 213 ? 26.019  -1.592  17.027  1.00 39.31  ? 213 ILE A CG1   1 
ATOM   1635 C CG2   . ILE A 1 213 ? 26.306  -3.598  15.492  1.00 38.42  ? 213 ILE A CG2   1 
ATOM   1636 C CD1   . ILE A 1 213 ? 24.744  -1.174  16.335  1.00 37.45  ? 213 ILE A CD1   1 
ATOM   1637 N N     . LEU A 1 214 ? 30.093  -3.132  15.455  1.00 43.11  ? 214 LEU A N     1 
ATOM   1638 C CA    . LEU A 1 214 ? 30.948  -3.907  14.566  1.00 45.30  ? 214 LEU A CA    1 
ATOM   1639 C C     . LEU A 1 214 ? 32.283  -4.278  15.187  1.00 46.96  ? 214 LEU A C     1 
ATOM   1640 O O     . LEU A 1 214 ? 33.090  -4.941  14.526  1.00 46.23  ? 214 LEU A O     1 
ATOM   1641 C CB    . LEU A 1 214 ? 31.201  -3.143  13.267  1.00 40.29  ? 214 LEU A CB    1 
ATOM   1642 C CG    . LEU A 1 214 ? 29.948  -2.702  12.526  1.00 45.59  ? 214 LEU A CG    1 
ATOM   1643 C CD1   . LEU A 1 214 ? 30.306  -2.183  11.148  1.00 47.01  ? 214 LEU A CD1   1 
ATOM   1644 C CD2   . LEU A 1 214 ? 28.992  -3.863  12.427  1.00 46.94  ? 214 LEU A CD2   1 
ATOM   1645 N N     . SER A 1 215 ? 32.550  -3.854  16.418  1.00 45.87  ? 215 SER A N     1 
ATOM   1646 C CA    . SER A 1 215 ? 33.818  -4.146  17.082  1.00 48.06  ? 215 SER A CA    1 
ATOM   1647 C C     . SER A 1 215 ? 33.558  -5.130  18.213  1.00 47.92  ? 215 SER A C     1 
ATOM   1648 O O     . SER A 1 215 ? 32.915  -4.778  19.206  1.00 46.51  ? 215 SER A O     1 
ATOM   1649 C CB    . SER A 1 215 ? 34.471  -2.875  17.608  1.00 44.34  ? 215 SER A CB    1 
ATOM   1650 O OG    . SER A 1 215 ? 35.833  -3.116  17.876  1.00 43.54  ? 215 SER A OG    1 
ATOM   1651 N N     . LEU A 1 216 ? 34.080  -6.350  18.066  1.00 52.34  ? 216 LEU A N     1 
ATOM   1652 C CA    . LEU A 1 216 ? 33.790  -7.435  19.008  1.00 51.41  ? 216 LEU A CA    1 
ATOM   1653 C C     . LEU A 1 216 ? 33.978  -7.050  20.470  1.00 47.07  ? 216 LEU A C     1 
ATOM   1654 O O     . LEU A 1 216 ? 33.065  -7.316  21.271  1.00 46.48  ? 216 LEU A O     1 
ATOM   1655 C CB    . LEU A 1 216 ? 34.634  -8.677  18.671  1.00 52.90  ? 216 LEU A CB    1 
ATOM   1656 C CG    . LEU A 1 216 ? 34.725  -9.155  17.210  1.00 62.18  ? 216 LEU A CG    1 
ATOM   1657 C CD1   . LEU A 1 216 ? 35.237  -10.596 17.131  1.00 64.09  ? 216 LEU A CD1   1 
ATOM   1658 C CD2   . LEU A 1 216 ? 33.408  -9.008  16.439  1.00 63.09  ? 216 LEU A CD2   1 
ATOM   1659 N N     . PRO A 1 217 ? 35.085  -6.431  20.891  1.00 45.48  ? 217 PRO A N     1 
ATOM   1660 C CA    . PRO A 1 217 ? 35.228  -6.128  22.328  1.00 42.58  ? 217 PRO A CA    1 
ATOM   1661 C C     . PRO A 1 217 ? 34.145  -5.212  22.870  1.00 43.22  ? 217 PRO A C     1 
ATOM   1662 O O     . PRO A 1 217 ? 33.919  -5.211  24.077  1.00 45.18  ? 217 PRO A O     1 
ATOM   1663 C CB    . PRO A 1 217 ? 36.615  -5.474  22.426  1.00 36.03  ? 217 PRO A CB    1 
ATOM   1664 C CG    . PRO A 1 217 ? 37.342  -5.951  21.246  1.00 43.64  ? 217 PRO A CG    1 
ATOM   1665 C CD    . PRO A 1 217 ? 36.305  -6.080  20.144  1.00 43.94  ? 217 PRO A CD    1 
ATOM   1666 N N     . SER A 1 218 ? 33.458  -4.440  22.031  1.00 46.33  ? 218 SER A N     1 
ATOM   1667 C CA    . SER A 1 218 ? 32.432  -3.533  22.528  1.00 44.59  ? 218 SER A CA    1 
ATOM   1668 C C     . SER A 1 218 ? 31.075  -4.201  22.646  1.00 45.21  ? 218 SER A C     1 
ATOM   1669 O O     . SER A 1 218 ? 30.192  -3.670  23.322  1.00 44.10  ? 218 SER A O     1 
ATOM   1670 C CB    . SER A 1 218 ? 32.308  -2.303  21.615  1.00 42.47  ? 218 SER A CB    1 
ATOM   1671 O OG    . SER A 1 218 ? 33.536  -1.587  21.536  1.00 42.35  ? 218 SER A OG    1 
ATOM   1672 N N     . ARG A 1 219 ? 30.894  -5.356  22.016  1.00 48.04  ? 219 ARG A N     1 
ATOM   1673 C CA    . ARG A 1 219 ? 29.569  -5.944  21.900  1.00 49.38  ? 219 ARG A CA    1 
ATOM   1674 C C     . ARG A 1 219 ? 29.097  -6.581  23.195  1.00 48.71  ? 219 ARG A C     1 
ATOM   1675 O O     . ARG A 1 219 ? 27.903  -6.852  23.339  1.00 52.07  ? 219 ARG A O     1 
ATOM   1676 C CB    . ARG A 1 219 ? 29.562  -6.959  20.754  1.00 52.84  ? 219 ARG A CB    1 
ATOM   1677 C CG    . ARG A 1 219 ? 30.134  -6.382  19.446  1.00 51.84  ? 219 ARG A CG    1 
ATOM   1678 C CD    . ARG A 1 219 ? 30.208  -7.406  18.317  1.00 55.07  ? 219 ARG A CD    1 
ATOM   1679 N NE    . ARG A 1 219 ? 28.959  -7.469  17.567  1.00 67.29  ? 219 ARG A NE    1 
ATOM   1680 C CZ    . ARG A 1 219 ? 28.207  -8.556  17.428  1.00 74.17  ? 219 ARG A CZ    1 
ATOM   1681 N NH1   . ARG A 1 219 ? 28.580  -9.704  17.987  1.00 67.56  ? 219 ARG A NH1   1 
ATOM   1682 N NH2   . ARG A 1 219 ? 27.080  -8.492  16.719  1.00 74.68  ? 219 ARG A NH2   1 
ATOM   1683 N N     . SER A 1 220 ? 29.998  -6.805  24.139  1.00 49.65  ? 220 SER A N     1 
ATOM   1684 C CA    . SER A 1 220 ? 29.650  -7.266  25.470  1.00 48.23  ? 220 SER A CA    1 
ATOM   1685 C C     . SER A 1 220 ? 29.354  -6.126  26.430  1.00 51.16  ? 220 SER A C     1 
ATOM   1686 O O     . SER A 1 220 ? 29.292  -6.364  27.638  1.00 51.79  ? 220 SER A O     1 
ATOM   1687 C CB    . SER A 1 220 ? 30.791  -8.096  26.026  1.00 52.69  ? 220 SER A CB    1 
ATOM   1688 O OG    . SER A 1 220 ? 32.010  -7.413  25.790  1.00 54.26  ? 220 SER A OG    1 
ATOM   1689 N N     . LEU A 1 221 ? 29.192  -4.894  25.927  1.00 49.15  ? 221 LEU A N     1 
ATOM   1690 C CA    . LEU A 1 221 ? 29.023  -3.721  26.774  1.00 43.15  ? 221 LEU A CA    1 
ATOM   1691 C C     . LEU A 1 221 ? 27.681  -3.033  26.605  1.00 43.38  ? 221 LEU A C     1 
ATOM   1692 O O     . LEU A 1 221 ? 27.405  -2.078  27.343  1.00 43.13  ? 221 LEU A O     1 
ATOM   1693 C CB    . LEU A 1 221 ? 30.133  -2.704  26.508  1.00 41.81  ? 221 LEU A CB    1 
ATOM   1694 C CG    . LEU A 1 221 ? 31.545  -3.242  26.692  1.00 45.89  ? 221 LEU A CG    1 
ATOM   1695 C CD1   . LEU A 1 221 ? 32.504  -2.208  26.193  1.00 47.72  ? 221 LEU A CD1   1 
ATOM   1696 C CD2   . LEU A 1 221 ? 31.819  -3.565  28.146  1.00 39.78  ? 221 LEU A CD2   1 
ATOM   1697 N N     . PHE A 1 222 ? 26.843  -3.482  25.669  1.00 42.74  ? 222 PHE A N     1 
ATOM   1698 C CA    . PHE A 1 222 ? 25.531  -2.882  25.449  1.00 41.68  ? 222 PHE A CA    1 
ATOM   1699 C C     . PHE A 1 222 ? 24.616  -3.923  24.813  1.00 43.02  ? 222 PHE A C     1 
ATOM   1700 O O     . PHE A 1 222 ? 25.058  -5.000  24.408  1.00 39.48  ? 222 PHE A O     1 
ATOM   1701 C CB    . PHE A 1 222 ? 25.642  -1.634  24.575  1.00 40.82  ? 222 PHE A CB    1 
ATOM   1702 C CG    . PHE A 1 222 ? 26.119  -1.912  23.190  1.00 37.56  ? 222 PHE A CG    1 
ATOM   1703 C CD1   . PHE A 1 222 ? 27.456  -2.130  22.936  1.00 41.82  ? 222 PHE A CD1   1 
ATOM   1704 C CD2   . PHE A 1 222 ? 25.230  -1.958  22.136  1.00 39.29  ? 222 PHE A CD2   1 
ATOM   1705 C CE1   . PHE A 1 222 ? 27.907  -2.374  21.639  1.00 42.26  ? 222 PHE A CE1   1 
ATOM   1706 C CE2   . PHE A 1 222 ? 25.679  -2.207  20.848  1.00 40.93  ? 222 PHE A CE2   1 
ATOM   1707 C CZ    . PHE A 1 222 ? 27.021  -2.408  20.607  1.00 38.84  ? 222 PHE A CZ    1 
ATOM   1708 N N     . HIS A 1 223 ? 23.326  -3.581  24.718  1.00 41.22  ? 223 HIS A N     1 
ATOM   1709 C CA    . HIS A 1 223 ? 22.319  -4.532  24.251  1.00 41.77  ? 223 HIS A CA    1 
ATOM   1710 C C     . HIS A 1 223 ? 21.479  -3.998  23.098  1.00 53.04  ? 223 HIS A C     1 
ATOM   1711 O O     . HIS A 1 223 ? 21.151  -4.744  22.167  1.00 54.41  ? 223 HIS A O     1 
ATOM   1712 C CB    . HIS A 1 223 ? 21.424  -4.926  25.446  1.00 50.68  ? 223 HIS A CB    1 
ATOM   1713 C CG    . HIS A 1 223 ? 22.208  -5.344  26.662  1.00 50.73  ? 223 HIS A CG    1 
ATOM   1714 N ND1   . HIS A 1 223 ? 22.554  -4.468  27.669  1.00 45.37  ? 223 HIS A ND1   1 
ATOM   1715 C CD2   . HIS A 1 223 ? 22.764  -6.533  26.994  1.00 40.79  ? 223 HIS A CD2   1 
ATOM   1716 C CE1   . HIS A 1 223 ? 23.273  -5.105  28.572  1.00 47.62  ? 223 HIS A CE1   1 
ATOM   1717 N NE2   . HIS A 1 223 ? 23.416  -6.359  28.185  1.00 44.07  ? 223 HIS A NE2   1 
ATOM   1718 N N     . ARG A 1 224 ? 21.140  -2.718  23.120  1.00 51.13  ? 224 ARG A N     1 
ATOM   1719 C CA    . ARG A 1 224 ? 20.372  -2.110  22.057  1.00 49.44  ? 224 ARG A CA    1 
ATOM   1720 C C     . ARG A 1 224 ? 21.105  -0.865  21.573  1.00 52.24  ? 224 ARG A C     1 
ATOM   1721 O O     . ARG A 1 224 ? 21.947  -0.309  22.287  1.00 51.43  ? 224 ARG A O     1 
ATOM   1722 C CB    . ARG A 1 224 ? 18.963  -1.788  22.547  1.00 49.00  ? 224 ARG A CB    1 
ATOM   1723 C CG    . ARG A 1 224 ? 18.077  -2.987  22.503  1.00 50.66  ? 224 ARG A CG    1 
ATOM   1724 C CD    . ARG A 1 224 ? 16.759  -2.728  23.161  1.00 49.82  ? 224 ARG A CD    1 
ATOM   1725 N NE    . ARG A 1 224 ? 16.924  -2.681  24.599  1.00 60.12  ? 224 ARG A NE    1 
ATOM   1726 C CZ    . ARG A 1 224 ? 17.156  -3.751  25.355  1.00 59.16  ? 224 ARG A CZ    1 
ATOM   1727 N NH1   . ARG A 1 224 ? 17.245  -4.958  24.809  1.00 59.50  ? 224 ARG A NH1   1 
ATOM   1728 N NH2   . ARG A 1 224 ? 17.304  -3.611  26.659  1.00 57.06  ? 224 ARG A NH2   1 
ATOM   1729 N N     . ALA A 1 225 ? 20.797  -0.437  20.343  1.00 46.56  ? 225 ALA A N     1 
ATOM   1730 C CA    . ALA A 1 225 ? 21.470  0.713   19.759  1.00 42.70  ? 225 ALA A CA    1 
ATOM   1731 C C     . ALA A 1 225 ? 20.487  1.578   18.985  1.00 44.18  ? 225 ALA A C     1 
ATOM   1732 O O     . ALA A 1 225 ? 19.530  1.082   18.390  1.00 44.48  ? 225 ALA A O     1 
ATOM   1733 C CB    . ALA A 1 225 ? 22.600  0.286   18.842  1.00 41.46  ? 225 ALA A CB    1 
ATOM   1734 N N     . VAL A 1 226 ? 20.728  2.885   19.025  1.00 41.60  ? 226 VAL A N     1 
ATOM   1735 C CA    . VAL A 1 226 ? 19.992  3.872   18.246  1.00 39.34  ? 226 VAL A CA    1 
ATOM   1736 C C     . VAL A 1 226 ? 21.005  4.674   17.447  1.00 40.66  ? 226 VAL A C     1 
ATOM   1737 O O     . VAL A 1 226 ? 21.987  5.162   18.009  1.00 42.38  ? 226 VAL A O     1 
ATOM   1738 C CB    . VAL A 1 226 ? 19.167  4.817   19.135  1.00 42.09  ? 226 VAL A CB    1 
ATOM   1739 C CG1   . VAL A 1 226 ? 18.587  5.948   18.295  1.00 48.08  ? 226 VAL A CG1   1 
ATOM   1740 C CG2   . VAL A 1 226 ? 18.089  4.068   19.873  1.00 39.93  ? 226 VAL A CG2   1 
ATOM   1741 N N     . LEU A 1 227 ? 20.778  4.804   16.142  1.00 41.96  ? 227 LEU A N     1 
ATOM   1742 C CA    . LEU A 1 227 ? 21.670  5.572   15.275  1.00 38.70  ? 227 LEU A CA    1 
ATOM   1743 C C     . LEU A 1 227 ? 20.870  6.688   14.618  1.00 39.59  ? 227 LEU A C     1 
ATOM   1744 O O     . LEU A 1 227 ? 20.046  6.428   13.737  1.00 41.70  ? 227 LEU A O     1 
ATOM   1745 C CB    . LEU A 1 227 ? 22.335  4.678   14.235  1.00 38.72  ? 227 LEU A CB    1 
ATOM   1746 C CG    . LEU A 1 227 ? 23.444  3.777   14.776  1.00 40.23  ? 227 LEU A CG    1 
ATOM   1747 C CD1   . LEU A 1 227 ? 22.841  2.527   15.366  1.00 43.41  ? 227 LEU A CD1   1 
ATOM   1748 C CD2   . LEU A 1 227 ? 24.395  3.417   13.678  1.00 38.03  ? 227 LEU A CD2   1 
ATOM   1749 N N     . GLN A 1 228 ? 21.102  7.931   15.049  1.00 40.87  ? 228 GLN A N     1 
ATOM   1750 C CA    . GLN A 1 228 ? 20.372  9.090   14.538  1.00 40.21  ? 228 GLN A CA    1 
ATOM   1751 C C     . GLN A 1 228 ? 21.260  9.816   13.535  1.00 39.49  ? 228 GLN A C     1 
ATOM   1752 O O     . GLN A 1 228 ? 22.287  10.393  13.916  1.00 37.46  ? 228 GLN A O     1 
ATOM   1753 C CB    . GLN A 1 228 ? 19.954  10.026  15.672  1.00 39.30  ? 228 GLN A CB    1 
ATOM   1754 C CG    . GLN A 1 228 ? 19.331  9.291   16.846  1.00 43.27  ? 228 GLN A CG    1 
ATOM   1755 C CD    . GLN A 1 228 ? 18.940  10.176  18.041  1.00 40.74  ? 228 GLN A CD    1 
ATOM   1756 O OE1   . GLN A 1 228 ? 18.623  9.661   19.098  1.00 41.71  ? 228 GLN A OE1   1 
ATOM   1757 N NE2   . GLN A 1 228 ? 18.939  11.492  17.863  1.00 40.73  ? 228 GLN A NE2   1 
ATOM   1758 N N     . SER A 1 229 ? 20.868  9.759   12.250  1.00 36.74  ? 229 SER A N     1 
ATOM   1759 C CA    . SER A 1 229 ? 21.495  10.523  11.159  1.00 34.19  ? 229 SER A CA    1 
ATOM   1760 C C     . SER A 1 229 ? 22.994  10.256  11.039  1.00 33.41  ? 229 SER A C     1 
ATOM   1761 O O     . SER A 1 229 ? 23.790  11.176  10.851  1.00 31.28  ? 229 SER A O     1 
ATOM   1762 C CB    . SER A 1 229 ? 21.242  12.022  11.308  1.00 32.96  ? 229 SER A CB    1 
ATOM   1763 O OG    . SER A 1 229 ? 19.898  12.282  11.653  1.00 37.21  ? 229 SER A OG    1 
ATOM   1764 N N     . GLY A 1 230 ? 23.384  8.989   11.119  1.00 33.44  ? 230 GLY A N     1 
ATOM   1765 C CA    . GLY A 1 230 ? 24.788  8.643   11.074  1.00 33.21  ? 230 GLY A CA    1 
ATOM   1766 C C     . GLY A 1 230 ? 24.972  7.145   11.004  1.00 37.85  ? 230 GLY A C     1 
ATOM   1767 O O     . GLY A 1 230 ? 24.129  6.390   11.501  1.00 40.25  ? 230 GLY A O     1 
ATOM   1768 N N     . THR A 1 231 ? 26.078  6.703   10.413  1.00 35.65  ? 231 THR A N     1 
ATOM   1769 C CA    . THR A 1 231 ? 26.298  5.309   10.065  1.00 37.43  ? 231 THR A CA    1 
ATOM   1770 C C     . THR A 1 231 ? 27.789  5.057   10.066  1.00 39.27  ? 231 THR A C     1 
ATOM   1771 O O     . THR A 1 231 ? 28.564  5.966   9.758   1.00 37.35  ? 231 THR A O     1 
ATOM   1772 C CB    . THR A 1 231 ? 25.735  4.974   8.679   1.00 41.38  ? 231 THR A CB    1 
ATOM   1773 O OG1   . THR A 1 231 ? 26.004  6.061   7.771   1.00 44.91  ? 231 THR A OG1   1 
ATOM   1774 C CG2   . THR A 1 231 ? 24.259  4.715   8.756   1.00 38.68  ? 231 THR A CG2   1 
ATOM   1775 N N     . PRO A 1 232 ? 28.225  3.852   10.399  1.00 40.51  ? 232 PRO A N     1 
ATOM   1776 C CA    . PRO A 1 232 ? 29.662  3.576   10.335  1.00 39.05  ? 232 PRO A CA    1 
ATOM   1777 C C     . PRO A 1 232 ? 30.075  3.373   8.884   1.00 43.19  ? 232 PRO A C     1 
ATOM   1778 O O     . PRO A 1 232 ? 31.190  3.726   8.477   1.00 42.00  ? 232 PRO A O     1 
ATOM   1779 C CB    . PRO A 1 232 ? 29.814  2.319   11.204  1.00 38.27  ? 232 PRO A CB    1 
ATOM   1780 C CG    . PRO A 1 232 ? 28.502  1.636   11.082  1.00 37.18  ? 232 PRO A CG    1 
ATOM   1781 C CD    . PRO A 1 232 ? 27.456  2.699   10.899  1.00 38.15  ? 232 PRO A CD    1 
ATOM   1782 N N     . ASN A 1 233 ? 29.164  2.828   8.083   1.00 40.63  ? 233 ASN A N     1 
ATOM   1783 C CA    . ASN A 1 233 ? 29.336  2.862   6.647   1.00 44.06  ? 233 ASN A CA    1 
ATOM   1784 C C     . ASN A 1 233 ? 29.099  4.287   6.147   1.00 48.30  ? 233 ASN A C     1 
ATOM   1785 O O     . ASN A 1 233 ? 28.586  5.157   6.867   1.00 43.55  ? 233 ASN A O     1 
ATOM   1786 C CB    . ASN A 1 233 ? 28.372  1.888   5.976   1.00 43.19  ? 233 ASN A CB    1 
ATOM   1787 C CG    . ASN A 1 233 ? 26.948  2.109   6.424   1.00 46.18  ? 233 ASN A CG    1 
ATOM   1788 O OD1   . ASN A 1 233 ? 26.685  2.187   7.624   1.00 45.71  ? 233 ASN A OD1   1 
ATOM   1789 N ND2   . ASN A 1 233 ? 26.030  2.263   5.476   1.00 44.63  ? 233 ASN A ND2   1 
ATOM   1790 N N     . GLY A 1 234 ? 29.460  4.521   4.887   1.00 46.91  ? 234 GLY A N     1 
ATOM   1791 C CA    . GLY A 1 234 ? 29.274  5.822   4.287   1.00 42.18  ? 234 GLY A CA    1 
ATOM   1792 C C     . GLY A 1 234 ? 30.609  6.451   3.957   1.00 42.11  ? 234 GLY A C     1 
ATOM   1793 O O     . GLY A 1 234 ? 31.669  5.891   4.238   1.00 43.13  ? 234 GLY A O     1 
ATOM   1794 N N     . PRO A 1 235 ? 30.587  7.634   3.344   1.00 40.61  ? 235 PRO A N     1 
ATOM   1795 C CA    . PRO A 1 235 ? 31.828  8.220   2.823   1.00 36.12  ? 235 PRO A CA    1 
ATOM   1796 C C     . PRO A 1 235 ? 32.663  9.028   3.802   1.00 42.01  ? 235 PRO A C     1 
ATOM   1797 O O     . PRO A 1 235 ? 33.813  9.349   3.471   1.00 38.93  ? 235 PRO A O     1 
ATOM   1798 C CB    . PRO A 1 235 ? 31.322  9.122   1.690   1.00 37.23  ? 235 PRO A CB    1 
ATOM   1799 C CG    . PRO A 1 235 ? 29.927  9.501   2.095   1.00 41.32  ? 235 PRO A CG    1 
ATOM   1800 C CD    . PRO A 1 235 ? 29.379  8.350   2.899   1.00 42.69  ? 235 PRO A CD    1 
ATOM   1801 N N     . TRP A 1 236 ? 32.161  9.377   4.987   1.00 43.11  ? 236 TRP A N     1 
ATOM   1802 C CA    . TRP A 1 236 ? 32.913  10.293  5.828   1.00 40.23  ? 236 TRP A CA    1 
ATOM   1803 C C     . TRP A 1 236 ? 33.378  9.716   7.149   1.00 42.21  ? 236 TRP A C     1 
ATOM   1804 O O     . TRP A 1 236 ? 34.308  10.272  7.737   1.00 44.83  ? 236 TRP A O     1 
ATOM   1805 C CB    . TRP A 1 236 ? 32.091  11.550  6.105   1.00 38.02  ? 236 TRP A CB    1 
ATOM   1806 C CG    . TRP A 1 236 ? 30.771  11.270  6.699   1.00 41.98  ? 236 TRP A CG    1 
ATOM   1807 C CD1   . TRP A 1 236 ? 29.580  11.170  6.042   1.00 42.77  ? 236 TRP A CD1   1 
ATOM   1808 C CD2   . TRP A 1 236 ? 30.484  11.067  8.089   1.00 42.25  ? 236 TRP A CD2   1 
ATOM   1809 N NE1   . TRP A 1 236 ? 28.564  10.926  6.938   1.00 43.04  ? 236 TRP A NE1   1 
ATOM   1810 C CE2   . TRP A 1 236 ? 29.093  10.852  8.201   1.00 41.40  ? 236 TRP A CE2   1 
ATOM   1811 C CE3   . TRP A 1 236 ? 31.264  11.054  9.247   1.00 39.28  ? 236 TRP A CE3   1 
ATOM   1812 C CZ2   . TRP A 1 236 ? 28.466  10.619  9.430   1.00 37.23  ? 236 TRP A CZ2   1 
ATOM   1813 C CZ3   . TRP A 1 236 ? 30.634  10.824  10.471  1.00 42.40  ? 236 TRP A CZ3   1 
ATOM   1814 C CH2   . TRP A 1 236 ? 29.248  10.612  10.548  1.00 38.50  ? 236 TRP A CH2   1 
ATOM   1815 N N     . ALA A 1 237 ? 32.789  8.612   7.613   1.00 45.86  ? 237 ALA A N     1 
ATOM   1816 C CA    . ALA A 1 237 ? 33.002  8.113   8.974   1.00 41.21  ? 237 ALA A CA    1 
ATOM   1817 C C     . ALA A 1 237 ? 34.302  7.342   9.163   1.00 42.06  ? 237 ALA A C     1 
ATOM   1818 O O     . ALA A 1 237 ? 34.717  7.142   10.309  1.00 43.32  ? 237 ALA A O     1 
ATOM   1819 C CB    . ALA A 1 237 ? 31.842  7.210   9.393   1.00 36.23  ? 237 ALA A CB    1 
ATOM   1820 N N     . THR A 1 238 ? 34.946  6.881   8.093   1.00 41.98  ? 238 THR A N     1 
ATOM   1821 C CA    . THR A 1 238 ? 36.174  6.114   8.230   1.00 39.07  ? 238 THR A CA    1 
ATOM   1822 C C     . THR A 1 238 ? 37.155  6.498   7.136   1.00 41.39  ? 238 THR A C     1 
ATOM   1823 O O     . THR A 1 238 ? 36.806  7.145   6.147   1.00 41.79  ? 238 THR A O     1 
ATOM   1824 C CB    . THR A 1 238 ? 35.914  4.616   8.159   1.00 40.91  ? 238 THR A CB    1 
ATOM   1825 O OG1   . THR A 1 238 ? 35.280  4.328   6.912   1.00 49.60  ? 238 THR A OG1   1 
ATOM   1826 C CG2   . THR A 1 238 ? 35.007  4.168   9.286   1.00 42.84  ? 238 THR A CG2   1 
ATOM   1827 N N     . VAL A 1 239 ? 38.404  6.091   7.332   1.00 40.71  ? 239 VAL A N     1 
ATOM   1828 C CA    . VAL A 1 239 ? 39.443  6.223   6.323   1.00 35.37  ? 239 VAL A CA    1 
ATOM   1829 C C     . VAL A 1 239 ? 40.288  4.959   6.363   1.00 39.85  ? 239 VAL A C     1 
ATOM   1830 O O     . VAL A 1 239 ? 40.494  4.353   7.420   1.00 44.49  ? 239 VAL A O     1 
ATOM   1831 C CB    . VAL A 1 239 ? 40.328  7.477   6.517   1.00 34.12  ? 239 VAL A CB    1 
ATOM   1832 C CG1   . VAL A 1 239 ? 39.545  8.738   6.198   1.00 28.99  ? 239 VAL A CG1   1 
ATOM   1833 C CG2   . VAL A 1 239 ? 40.917  7.530   7.945   1.00 39.38  ? 239 VAL A CG2   1 
ATOM   1834 N N     . SER A 1 240 ? 40.740  4.537   5.193   1.00 40.52  ? 240 SER A N     1 
ATOM   1835 C CA    . SER A 1 240 ? 41.762  3.507   5.094   1.00 40.61  ? 240 SER A CA    1 
ATOM   1836 C C     . SER A 1 240 ? 42.943  3.829   5.999   1.00 39.02  ? 240 SER A C     1 
ATOM   1837 O O     . SER A 1 240 ? 43.152  4.991   6.361   1.00 38.31  ? 240 SER A O     1 
ATOM   1838 C CB    . SER A 1 240 ? 42.262  3.429   3.664   1.00 33.85  ? 240 SER A CB    1 
ATOM   1839 O OG    . SER A 1 240 ? 42.936  4.651   3.402   1.00 39.96  ? 240 SER A OG    1 
ATOM   1840 N N     . ALA A 1 241 ? 43.752  2.823   6.325   1.00 40.65  ? 241 ALA A N     1 
ATOM   1841 C CA    . ALA A 1 241 ? 44.995  3.096   7.041   1.00 42.10  ? 241 ALA A CA    1 
ATOM   1842 C C     . ALA A 1 241 ? 45.917  3.989   6.225   1.00 43.83  ? 241 ALA A C     1 
ATOM   1843 O O     . ALA A 1 241 ? 46.572  4.889   6.770   1.00 45.01  ? 241 ALA A O     1 
ATOM   1844 C CB    . ALA A 1 241 ? 45.699  1.791   7.388   1.00 39.17  ? 241 ALA A CB    1 
ATOM   1845 N N     . GLY A 1 242 ? 45.988  3.756   4.912   1.00 43.94  ? 242 GLY A N     1 
ATOM   1846 C CA    . GLY A 1 242 ? 46.916  4.521   4.104   1.00 39.47  ? 242 GLY A CA    1 
ATOM   1847 C C     . GLY A 1 242 ? 46.545  5.982   4.078   1.00 41.64  ? 242 GLY A C     1 
ATOM   1848 O O     . GLY A 1 242 ? 47.407  6.860   4.190   1.00 44.02  ? 242 GLY A O     1 
ATOM   1849 N N     . GLU A 1 243 ? 45.250  6.262   3.960   1.00 38.71  ? 243 GLU A N     1 
ATOM   1850 C CA    . GLU A 1 243 ? 44.829  7.652   3.923   1.00 40.39  ? 243 GLU A CA    1 
ATOM   1851 C C     . GLU A 1 243 ? 45.050  8.318   5.276   1.00 44.58  ? 243 GLU A C     1 
ATOM   1852 O O     . GLU A 1 243 ? 45.553  9.447   5.334   1.00 42.54  ? 243 GLU A O     1 
ATOM   1853 C CB    . GLU A 1 243 ? 43.371  7.744   3.468   1.00 39.11  ? 243 GLU A CB    1 
ATOM   1854 C CG    . GLU A 1 243 ? 42.743  9.123   3.629   1.00 46.04  ? 243 GLU A CG    1 
ATOM   1855 C CD    . GLU A 1 243 ? 43.348  10.205  2.730   1.00 47.08  ? 243 GLU A CD    1 
ATOM   1856 O OE1   . GLU A 1 243 ? 42.748  11.309  2.656   1.00 46.35  ? 243 GLU A OE1   1 
ATOM   1857 O OE2   . GLU A 1 243 ? 44.417  9.980   2.116   1.00 43.82  ? 243 GLU A OE2   1 
ATOM   1858 N N     . ALA A 1 244 ? 44.714  7.613   6.370   1.00 41.61  ? 244 ALA A N     1 
ATOM   1859 C CA    . ALA A 1 244 ? 45.000  8.109   7.715   1.00 40.33  ? 244 ALA A CA    1 
ATOM   1860 C C     . ALA A 1 244 ? 46.478  8.390   7.884   1.00 41.55  ? 244 ALA A C     1 
ATOM   1861 O O     . ALA A 1 244 ? 46.865  9.448   8.396   1.00 42.03  ? 244 ALA A O     1 
ATOM   1862 C CB    . ALA A 1 244 ? 44.544  7.103   8.771   1.00 42.23  ? 244 ALA A CB    1 
ATOM   1863 N N     . ARG A 1 245 ? 47.326  7.450   7.460   1.00 42.81  ? 245 ARG A N     1 
ATOM   1864 C CA    . ARG A 1 245 ? 48.760  7.690   7.556   1.00 43.60  ? 245 ARG A CA    1 
ATOM   1865 C C     . ARG A 1 245 ? 49.138  8.940   6.784   1.00 47.54  ? 245 ARG A C     1 
ATOM   1866 O O     . ARG A 1 245 ? 49.948  9.753   7.251   1.00 45.85  ? 245 ARG A O     1 
ATOM   1867 C CB    . ARG A 1 245 ? 49.552  6.490   7.042   1.00 40.25  ? 245 ARG A CB    1 
ATOM   1868 C CG    . ARG A 1 245 ? 51.060  6.766   7.018   1.00 40.03  ? 245 ARG A CG    1 
ATOM   1869 C CD    . ARG A 1 245 ? 51.889  5.513   6.846   1.00 38.07  ? 245 ARG A CD    1 
ATOM   1870 N NE    . ARG A 1 245 ? 51.836  4.650   8.022   1.00 45.27  ? 245 ARG A NE    1 
ATOM   1871 C CZ    . ARG A 1 245 ? 52.644  4.788   9.068   1.00 48.80  ? 245 ARG A CZ    1 
ATOM   1872 N NH1   . ARG A 1 245 ? 53.561  5.745   9.069   1.00 52.91  ? 245 ARG A NH1   1 
ATOM   1873 N NH2   . ARG A 1 245 ? 52.542  3.976   10.110  1.00 49.51  ? 245 ARG A NH2   1 
ATOM   1874 N N     . ARG A 1 246 ? 48.527  9.119   5.610   1.00 46.02  ? 246 ARG A N     1 
ATOM   1875 C CA    . ARG A 1 246 ? 48.845  10.253  4.757   1.00 43.74  ? 246 ARG A CA    1 
ATOM   1876 C C     . ARG A 1 246 ? 48.582  11.567  5.477   1.00 45.11  ? 246 ARG A C     1 
ATOM   1877 O O     . ARG A 1 246 ? 49.440  12.454  5.518   1.00 45.63  ? 246 ARG A O     1 
ATOM   1878 C CB    . ARG A 1 246 ? 48.022  10.157  3.483   1.00 45.24  ? 246 ARG A CB    1 
ATOM   1879 C CG    . ARG A 1 246 ? 48.555  10.968  2.348   1.00 45.59  ? 246 ARG A CG    1 
ATOM   1880 C CD    . ARG A 1 246 ? 47.426  11.406  1.447   1.00 37.07  ? 246 ARG A CD    1 
ATOM   1881 N NE    . ARG A 1 246 ? 47.248  12.845  1.594   1.00 44.83  ? 246 ARG A NE    1 
ATOM   1882 C CZ    . ARG A 1 246 ? 46.099  13.429  1.905   1.00 45.43  ? 246 ARG A CZ    1 
ATOM   1883 N NH1   . ARG A 1 246 ? 45.001  12.699  2.081   1.00 44.18  ? 246 ARG A NH1   1 
ATOM   1884 N NH2   . ARG A 1 246 ? 46.049  14.747  2.009   1.00 43.05  ? 246 ARG A NH2   1 
ATOM   1885 N N     . ARG A 1 247 ? 47.404  11.698  6.078   1.00 44.43  ? 247 ARG A N     1 
ATOM   1886 C CA    . ARG A 1 247 ? 47.065  12.950  6.737   1.00 41.52  ? 247 ARG A CA    1 
ATOM   1887 C C     . ARG A 1 247 ? 47.887  13.196  7.971   1.00 43.83  ? 247 ARG A C     1 
ATOM   1888 O O     . ARG A 1 247 ? 48.176  14.351  8.298   1.00 48.04  ? 247 ARG A O     1 
ATOM   1889 C CB    . ARG A 1 247 ? 45.626  12.933  7.131   1.00 41.45  ? 247 ARG A CB    1 
ATOM   1890 C CG    . ARG A 1 247 ? 44.829  12.314  6.068   1.00 41.05  ? 247 ARG A CG    1 
ATOM   1891 C CD    . ARG A 1 247 ? 43.424  12.791  6.233   1.00 37.13  ? 247 ARG A CD    1 
ATOM   1892 N NE    . ARG A 1 247 ? 42.580  12.406  5.157   1.00 42.96  ? 247 ARG A NE    1 
ATOM   1893 C CZ    . ARG A 1 247 ? 41.267  12.213  5.304   1.00 45.03  ? 247 ARG A CZ    1 
ATOM   1894 N NH1   . ARG A 1 247 ? 40.657  12.363  6.486   1.00 43.37  ? 247 ARG A NH1   1 
ATOM   1895 N NH2   . ARG A 1 247 ? 40.529  11.877  4.260   1.00 38.45  ? 247 ARG A NH2   1 
ATOM   1896 N N     . ALA A 1 248 ? 48.214  12.146  8.707   1.00 46.00  ? 248 ALA A N     1 
ATOM   1897 C CA    . ALA A 1 248 ? 48.998  12.371  9.908   1.00 46.22  ? 248 ALA A CA    1 
ATOM   1898 C C     . ALA A 1 248 ? 50.381  12.888  9.546   1.00 46.43  ? 248 ALA A C     1 
ATOM   1899 O O     . ALA A 1 248 ? 50.886  13.833  10.166  1.00 49.63  ? 248 ALA A O     1 
ATOM   1900 C CB    . ALA A 1 248 ? 49.075  11.086  10.729  1.00 46.50  ? 248 ALA A CB    1 
ATOM   1901 N N     . THR A 1 249 ? 50.989  12.305  8.518   1.00 45.59  ? 249 THR A N     1 
ATOM   1902 C CA    . THR A 1 249 ? 52.282  12.787  8.046   1.00 50.88  ? 249 THR A CA    1 
ATOM   1903 C C     . THR A 1 249 ? 52.203  14.233  7.568   1.00 48.75  ? 249 THR A C     1 
ATOM   1904 O O     . THR A 1 249 ? 53.062  15.059  7.901   1.00 49.78  ? 249 THR A O     1 
ATOM   1905 C CB    . THR A 1 249 ? 52.775  11.889  6.920   1.00 51.75  ? 249 THR A CB    1 
ATOM   1906 O OG1   . THR A 1 249 ? 52.717  10.525  7.358   1.00 49.27  ? 249 THR A OG1   1 
ATOM   1907 C CG2   . THR A 1 249 ? 54.189  12.264  6.554   1.00 53.32  ? 249 THR A CG2   1 
ATOM   1908 N N     . LEU A 1 250 ? 51.187  14.553  6.768   1.00 45.88  ? 250 LEU A N     1 
ATOM   1909 C CA    . LEU A 1 250 ? 51.077  15.909  6.248   1.00 50.07  ? 250 LEU A CA    1 
ATOM   1910 C C     . LEU A 1 250 ? 50.931  16.905  7.386   1.00 48.17  ? 250 LEU A C     1 
ATOM   1911 O O     . LEU A 1 250 ? 51.629  17.925  7.426   1.00 51.35  ? 250 LEU A O     1 
ATOM   1912 C CB    . LEU A 1 250 ? 49.904  16.015  5.267   1.00 47.16  ? 250 LEU A CB    1 
ATOM   1913 C CG    . LEU A 1 250 ? 49.682  17.408  4.662   1.00 43.26  ? 250 LEU A CG    1 
ATOM   1914 C CD1   . LEU A 1 250 ? 50.943  17.943  4.058   1.00 39.06  ? 250 LEU A CD1   1 
ATOM   1915 C CD2   . LEU A 1 250 ? 48.570  17.407  3.645   1.00 31.67  ? 250 LEU A CD2   1 
ATOM   1916 N N     . LEU A 1 251 ? 50.051  16.605  8.344   1.00 49.46  ? 251 LEU A N     1 
ATOM   1917 C CA    . LEU A 1 251 ? 49.838  17.522  9.460   1.00 47.05  ? 251 LEU A CA    1 
ATOM   1918 C C     . LEU A 1 251 ? 51.102  17.711  10.279  1.00 46.59  ? 251 LEU A C     1 
ATOM   1919 O O     . LEU A 1 251 ? 51.366  18.815  10.765  1.00 48.57  ? 251 LEU A O     1 
ATOM   1920 C CB    . LEU A 1 251 ? 48.705  17.025  10.346  1.00 44.98  ? 251 LEU A CB    1 
ATOM   1921 C CG    . LEU A 1 251 ? 48.512  17.785  11.599  1.00 48.47  ? 251 LEU A CG    1 
ATOM   1922 C CD1   . LEU A 1 251 ? 47.137  18.185  11.733  1.00 51.22  ? 251 LEU A CD1   1 
ATOM   1923 C CD2   . LEU A 1 251 ? 48.945  16.981  12.755  1.00 45.13  ? 251 LEU A CD2   1 
ATOM   1924 N N     . ALA A 1 252 ? 51.907  16.659  10.415  1.00 47.66  ? 252 ALA A N     1 
ATOM   1925 C CA    . ALA A 1 252 ? 53.175  16.774  11.126  1.00 52.19  ? 252 ALA A CA    1 
ATOM   1926 C C     . ALA A 1 252 ? 54.161  17.708  10.421  1.00 52.49  ? 252 ALA A C     1 
ATOM   1927 O O     . ALA A 1 252 ? 54.948  18.391  11.087  1.00 51.93  ? 252 ALA A O     1 
ATOM   1928 C CB    . ALA A 1 252 ? 53.784  15.389  11.308  1.00 51.35  ? 252 ALA A CB    1 
ATOM   1929 N N     . ARG A 1 253 ? 54.154  17.756  9.087   1.00 49.58  ? 253 ARG A N     1 
ATOM   1930 C CA    . ARG A 1 253 ? 54.991  18.749  8.419   1.00 53.47  ? 253 ARG A CA    1 
ATOM   1931 C C     . ARG A 1 253 ? 54.403  20.141  8.550   1.00 53.26  ? 253 ARG A C     1 
ATOM   1932 O O     . ARG A 1 253 ? 55.136  21.106  8.802   1.00 51.01  ? 253 ARG A O     1 
ATOM   1933 C CB    . ARG A 1 253 ? 55.182  18.399  6.958   1.00 50.50  ? 253 ARG A CB    1 
ATOM   1934 C CG    . ARG A 1 253 ? 55.287  16.936  6.742   1.00 59.86  ? 253 ARG A CG    1 
ATOM   1935 C CD    . ARG A 1 253 ? 55.978  16.632  5.404   1.00 73.12  ? 253 ARG A CD    1 
ATOM   1936 N NE    . ARG A 1 253 ? 55.291  17.162  4.238   1.00 78.45  ? 253 ARG A NE    1 
ATOM   1937 C CZ    . ARG A 1 253 ? 54.521  16.424  3.435   1.00 81.68  ? 253 ARG A CZ    1 
ATOM   1938 N NH1   . ARG A 1 253 ? 53.937  16.980  2.379   1.00 76.86  ? 253 ARG A NH1   1 
ATOM   1939 N NH2   . ARG A 1 253 ? 54.305  15.131  3.687   1.00 73.99  ? 253 ARG A NH2   1 
ATOM   1940 N N     . LEU A 1 254 ? 53.080  20.256  8.401   1.00 49.24  ? 254 LEU A N     1 
ATOM   1941 C CA    . LEU A 1 254 ? 52.423  21.549  8.544   1.00 47.29  ? 254 LEU A CA    1 
ATOM   1942 C C     . LEU A 1 254 ? 52.737  22.207  9.876   1.00 50.39  ? 254 LEU A C     1 
ATOM   1943 O O     . LEU A 1 254 ? 52.722  23.437  9.971   1.00 55.56  ? 254 LEU A O     1 
ATOM   1944 C CB    . LEU A 1 254 ? 50.915  21.400  8.382   1.00 46.96  ? 254 LEU A CB    1 
ATOM   1945 C CG    . LEU A 1 254 ? 50.477  20.909  7.000   1.00 50.99  ? 254 LEU A CG    1 
ATOM   1946 C CD1   . LEU A 1 254 ? 48.955  20.863  6.891   1.00 48.50  ? 254 LEU A CD1   1 
ATOM   1947 C CD2   . LEU A 1 254 ? 51.081  21.792  5.927   1.00 40.77  ? 254 LEU A CD2   1 
ATOM   1948 N N     . VAL A 1 255 ? 53.023  21.421  10.916  1.00 52.07  ? 255 VAL A N     1 
ATOM   1949 C CA    . VAL A 1 255 ? 53.453  21.992  12.190  1.00 56.41  ? 255 VAL A CA    1 
ATOM   1950 C C     . VAL A 1 255 ? 54.939  21.815  12.427  1.00 56.60  ? 255 VAL A C     1 
ATOM   1951 O O     . VAL A 1 255 ? 55.439  22.227  13.479  1.00 57.65  ? 255 VAL A O     1 
ATOM   1952 C CB    . VAL A 1 255 ? 52.665  21.422  13.390  1.00 47.85  ? 255 VAL A CB    1 
ATOM   1953 C CG1   . VAL A 1 255 ? 51.180  21.595  13.171  1.00 45.92  ? 255 VAL A CG1   1 
ATOM   1954 C CG2   . VAL A 1 255 ? 53.039  19.972  13.667  1.00 45.54  ? 255 VAL A CG2   1 
ATOM   1955 N N     . GLY A 1 256 ? 55.653  21.188  11.499  1.00 53.43  ? 256 GLY A N     1 
ATOM   1956 C CA    . GLY A 1 256 ? 57.099  21.191  11.540  1.00 54.89  ? 256 GLY A CA    1 
ATOM   1957 C C     . GLY A 1 256 ? 57.764  19.967  12.126  1.00 50.50  ? 256 GLY A C     1 
ATOM   1958 O O     . GLY A 1 256 ? 58.442  20.094  13.135  1.00 60.21  ? 256 GLY A O     1 
ATOM   1959 N N     . CYS A 1 257 ? 57.631  18.798  11.509  1.00 53.84  ? 257 CYS A N     1 
ATOM   1960 C CA    . CYS A 1 257 ? 58.260  17.613  12.067  1.00 56.37  ? 257 CYS A CA    1 
ATOM   1961 C C     . CYS A 1 257 ? 58.986  16.751  11.022  1.00 60.22  ? 257 CYS A C     1 
ATOM   1962 O O     . CYS A 1 257 ? 58.384  15.937  10.326  1.00 57.41  ? 257 CYS A O     1 
ATOM   1963 C CB    . CYS A 1 257 ? 57.202  16.800  12.817  1.00 58.38  ? 257 CYS A CB    1 
ATOM   1964 S SG    . CYS A 1 257 ? 56.439  17.679  14.289  1.00 67.15  ? 257 CYS A SG    1 
ATOM   1965 N N     . ASN A 1 265 ? 60.578  6.859   10.335  1.00 69.48  ? 265 ASN A N     1 
ATOM   1966 C CA    . ASN A 1 265 ? 60.248  6.127   11.558  1.00 71.94  ? 265 ASN A CA    1 
ATOM   1967 C C     . ASN A 1 265 ? 59.157  6.892   12.334  1.00 66.62  ? 265 ASN A C     1 
ATOM   1968 O O     . ASN A 1 265 ? 59.264  8.095   12.571  1.00 63.14  ? 265 ASN A O     1 
ATOM   1969 C CB    . ASN A 1 265 ? 61.521  5.910   12.403  1.00 80.55  ? 265 ASN A CB    1 
ATOM   1970 C CG    . ASN A 1 265 ? 61.295  5.021   13.651  1.00 78.18  ? 265 ASN A CG    1 
ATOM   1971 O OD1   . ASN A 1 265 ? 60.539  5.376   14.552  1.00 76.55  ? 265 ASN A OD1   1 
ATOM   1972 N ND2   . ASN A 1 265 ? 62.003  3.890   13.718  1.00 80.90  ? 265 ASN A ND2   1 
ATOM   1973 N N     . ASP A 1 266 ? 58.096  6.175   12.711  1.00 63.49  ? 266 ASP A N     1 
ATOM   1974 C CA    . ASP A 1 266 ? 56.929  6.819   13.304  1.00 58.19  ? 266 ASP A CA    1 
ATOM   1975 C C     . ASP A 1 266 ? 57.225  7.395   14.683  1.00 63.24  ? 266 ASP A C     1 
ATOM   1976 O O     . ASP A 1 266 ? 56.573  8.361   15.096  1.00 61.98  ? 266 ASP A O     1 
ATOM   1977 C CB    . ASP A 1 266 ? 55.772  5.828   13.415  1.00 55.36  ? 266 ASP A CB    1 
ATOM   1978 C CG    . ASP A 1 266 ? 55.180  5.441   12.069  1.00 55.80  ? 266 ASP A CG    1 
ATOM   1979 O OD1   . ASP A 1 266 ? 55.360  6.186   11.079  1.00 52.99  ? 266 ASP A OD1   1 
ATOM   1980 O OD2   . ASP A 1 266 ? 54.504  4.388   12.016  1.00 52.73  ? 266 ASP A OD2   1 
ATOM   1981 N N     . THR A 1 267 ? 58.184  6.818   15.412  1.00 64.22  ? 267 THR A N     1 
ATOM   1982 C CA    . THR A 1 267 ? 58.408  7.222   16.796  1.00 59.64  ? 267 THR A CA    1 
ATOM   1983 C C     . THR A 1 267 ? 58.902  8.659   16.892  1.00 60.06  ? 267 THR A C     1 
ATOM   1984 O O     . THR A 1 267 ? 58.405  9.436   17.715  1.00 57.46  ? 267 THR A O     1 
ATOM   1985 C CB    . THR A 1 267 ? 59.395  6.278   17.472  1.00 59.11  ? 267 THR A CB    1 
ATOM   1986 O OG1   . THR A 1 267 ? 58.839  4.959   17.507  1.00 59.85  ? 267 THR A OG1   1 
ATOM   1987 C CG2   . THR A 1 267 ? 59.652  6.741   18.877  1.00 52.23  ? 267 THR A CG2   1 
ATOM   1988 N N     . GLU A 1 268 ? 59.900  9.031   16.078  1.00 62.28  ? 268 GLU A N     1 
ATOM   1989 C CA    . GLU A 1 268 ? 60.409  10.402  16.127  1.00 60.30  ? 268 GLU A CA    1 
ATOM   1990 C C     . GLU A 1 268 ? 59.313  11.394  15.805  1.00 58.31  ? 268 GLU A C     1 
ATOM   1991 O O     . GLU A 1 268 ? 59.238  12.475  16.408  1.00 56.95  ? 268 GLU A O     1 
ATOM   1992 C CB    . GLU A 1 268 ? 61.567  10.617  15.147  1.00 64.57  ? 268 GLU A CB    1 
ATOM   1993 C CG    . GLU A 1 268 ? 62.805  9.767   15.334  1.00 78.03  ? 268 GLU A CG    1 
ATOM   1994 C CD    . GLU A 1 268 ? 62.714  8.483   14.554  1.00 87.67  ? 268 GLU A CD    1 
ATOM   1995 O OE1   . GLU A 1 268 ? 63.640  8.152   13.792  1.00 92.55  ? 268 GLU A OE1   1 
ATOM   1996 O OE2   . GLU A 1 268 ? 61.691  7.799   14.719  1.00 88.84  ? 268 GLU A OE2   1 
ATOM   1997 N N     . LEU A 1 269 ? 58.466  11.052  14.838  1.00 59.15  ? 269 LEU A N     1 
ATOM   1998 C CA    . LEU A 1 269 ? 57.471  11.997  14.363  1.00 56.53  ? 269 LEU A CA    1 
ATOM   1999 C C     . LEU A 1 269 ? 56.406  12.235  15.428  1.00 57.48  ? 269 LEU A C     1 
ATOM   2000 O O     . LEU A 1 269 ? 56.076  13.381  15.750  1.00 58.58  ? 269 LEU A O     1 
ATOM   2001 C CB    . LEU A 1 269 ? 56.839  11.490  13.071  1.00 55.46  ? 269 LEU A CB    1 
ATOM   2002 C CG    . LEU A 1 269 ? 55.765  12.411  12.524  1.00 54.90  ? 269 LEU A CG    1 
ATOM   2003 C CD1   . LEU A 1 269 ? 56.144  12.848  11.131  1.00 56.08  ? 269 LEU A CD1   1 
ATOM   2004 C CD2   . LEU A 1 269 ? 54.449  11.686  12.551  1.00 54.54  ? 269 LEU A CD2   1 
ATOM   2005 N N     . ILE A 1 270 ? 55.867  11.149  15.983  1.00 58.18  ? 270 ILE A N     1 
ATOM   2006 C CA    . ILE A 1 270 ? 54.894  11.272  17.061  1.00 49.66  ? 270 ILE A CA    1 
ATOM   2007 C C     . ILE A 1 270 ? 55.515  11.984  18.239  1.00 52.15  ? 270 ILE A C     1 
ATOM   2008 O O     . ILE A 1 270 ? 54.889  12.854  18.848  1.00 53.07  ? 270 ILE A O     1 
ATOM   2009 C CB    . ILE A 1 270 ? 54.357  9.894   17.462  1.00 51.00  ? 270 ILE A CB    1 
ATOM   2010 C CG1   . ILE A 1 270 ? 53.597  9.284   16.292  1.00 55.15  ? 270 ILE A CG1   1 
ATOM   2011 C CG2   . ILE A 1 270 ? 53.478  10.021  18.693  1.00 52.33  ? 270 ILE A CG2   1 
ATOM   2012 C CD1   . ILE A 1 270 ? 53.387  7.803   16.436  1.00 60.63  ? 270 ILE A CD1   1 
ATOM   2013 N N     . ALA A 1 271 ? 56.759  11.634  18.575  1.00 56.12  ? 271 ALA A N     1 
ATOM   2014 C CA    . ALA A 1 271 ? 57.461  12.353  19.631  1.00 51.55  ? 271 ALA A CA    1 
ATOM   2015 C C     . ALA A 1 271 ? 57.421  13.850  19.375  1.00 54.44  ? 271 ALA A C     1 
ATOM   2016 O O     . ALA A 1 271 ? 57.215  14.635  20.306  1.00 56.90  ? 271 ALA A O     1 
ATOM   2017 C CB    . ALA A 1 271 ? 58.903  11.858  19.752  1.00 44.82  ? 271 ALA A CB    1 
ATOM   2018 N N     . CYS A 1 272 ? 57.573  14.265  18.107  1.00 60.10  ? 272 CYS A N     1 
ATOM   2019 C CA    . CYS A 1 272 ? 57.539  15.688  17.774  1.00 54.75  ? 272 CYS A CA    1 
ATOM   2020 C C     . CYS A 1 272 ? 56.146  16.261  17.968  1.00 51.90  ? 272 CYS A C     1 
ATOM   2021 O O     . CYS A 1 272 ? 55.983  17.289  18.632  1.00 51.94  ? 272 CYS A O     1 
ATOM   2022 C CB    . CYS A 1 272 ? 58.009  15.923  16.338  1.00 54.27  ? 272 CYS A CB    1 
ATOM   2023 S SG    . CYS A 1 272 ? 57.858  17.685  15.786  1.00 73.33  ? 272 CYS A SG    1 
ATOM   2024 N N     . LEU A 1 273 ? 55.128  15.615  17.386  1.00 49.41  ? 273 LEU A N     1 
ATOM   2025 C CA    . LEU A 1 273 ? 53.755  16.086  17.551  1.00 49.78  ? 273 LEU A CA    1 
ATOM   2026 C C     . LEU A 1 273 ? 53.395  16.240  19.027  1.00 53.74  ? 273 LEU A C     1 
ATOM   2027 O O     . LEU A 1 273 ? 52.695  17.184  19.412  1.00 53.27  ? 273 LEU A O     1 
ATOM   2028 C CB    . LEU A 1 273 ? 52.780  15.133  16.859  1.00 46.88  ? 273 LEU A CB    1 
ATOM   2029 C CG    . LEU A 1 273 ? 52.686  15.226  15.330  1.00 50.96  ? 273 LEU A CG    1 
ATOM   2030 C CD1   . LEU A 1 273 ? 51.864  14.092  14.732  1.00 42.95  ? 273 LEU A CD1   1 
ATOM   2031 C CD2   . LEU A 1 273 ? 52.122  16.581  14.907  1.00 50.89  ? 273 LEU A CD2   1 
ATOM   2032 N N     . ARG A 1 274 ? 53.886  15.337  19.878  1.00 51.39  ? 274 ARG A N     1 
ATOM   2033 C CA    . ARG A 1 274 ? 53.560  15.430  21.291  1.00 50.22  ? 274 ARG A CA    1 
ATOM   2034 C C     . ARG A 1 274 ? 54.138  16.677  21.943  1.00 52.19  ? 274 ARG A C     1 
ATOM   2035 O O     . ARG A 1 274 ? 53.702  17.036  23.043  1.00 48.54  ? 274 ARG A O     1 
ATOM   2036 C CB    . ARG A 1 274 ? 54.028  14.181  22.031  1.00 45.41  ? 274 ARG A CB    1 
ATOM   2037 C CG    . ARG A 1 274 ? 53.012  13.077  21.996  1.00 49.08  ? 274 ARG A CG    1 
ATOM   2038 C CD    . ARG A 1 274 ? 53.326  12.042  23.031  1.00 52.58  ? 274 ARG A CD    1 
ATOM   2039 N NE    . ARG A 1 274 ? 54.415  11.208  22.573  1.00 54.17  ? 274 ARG A NE    1 
ATOM   2040 C CZ    . ARG A 1 274 ? 54.231  9.984   22.104  1.00 64.70  ? 274 ARG A CZ    1 
ATOM   2041 N NH1   . ARG A 1 274 ? 52.997  9.461   22.065  1.00 56.95  ? 274 ARG A NH1   1 
ATOM   2042 N NH2   . ARG A 1 274 ? 55.281  9.291   21.675  1.00 68.02  ? 274 ARG A NH2   1 
ATOM   2043 N N     . THR A 1 275 ? 55.071  17.359  21.286  1.00 51.82  ? 275 THR A N     1 
ATOM   2044 C CA    . THR A 1 275 ? 55.585  18.636  21.766  1.00 52.69  ? 275 THR A CA    1 
ATOM   2045 C C     . THR A 1 275 ? 54.811  19.835  21.229  1.00 52.63  ? 275 THR A C     1 
ATOM   2046 O O     . THR A 1 275 ? 55.124  20.967  21.596  1.00 51.84  ? 275 THR A O     1 
ATOM   2047 C CB    . THR A 1 275 ? 57.055  18.788  21.377  1.00 53.07  ? 275 THR A CB    1 
ATOM   2048 O OG1   . THR A 1 275 ? 57.140  19.039  19.966  1.00 53.53  ? 275 THR A OG1   1 
ATOM   2049 C CG2   . THR A 1 275 ? 57.831  17.527  21.720  1.00 49.00  ? 275 THR A CG2   1 
ATOM   2050 N N     . ARG A 1 276 ? 53.843  19.630  20.389  1.00 54.38  ? 276 ARG A N     1 
ATOM   2051 C CA    . ARG A 1 276 ? 53.257  20.874  19.909  1.00 52.83  ? 276 ARG A CA    1 
ATOM   2052 C C     . ARG A 1 276 ? 52.079  21.293  20.792  1.00 50.29  ? 276 ARG A C     1 
ATOM   2053 O O     . ARG A 1 276 ? 51.348  20.439  21.310  1.00 45.78  ? 276 ARG A O     1 
ATOM   2054 C CB    . ARG A 1 276 ? 52.800  20.719  18.457  1.00 53.03  ? 276 ARG A CB    1 
ATOM   2055 C CG    . ARG A 1 276 ? 53.922  20.298  17.497  1.00 53.00  ? 276 ARG A CG    1 
ATOM   2056 C CD    . ARG A 1 276 ? 55.009  21.365  17.391  1.00 56.70  ? 276 ARG A CD    1 
ATOM   2057 N NE    . ARG A 1 276 ? 54.465  22.610  16.854  1.00 66.00  ? 276 ARG A NE    1 
ATOM   2058 C CZ    . ARG A 1 276 ? 54.920  23.831  17.142  1.00 73.05  ? 276 ARG A CZ    1 
ATOM   2059 N NH1   . ARG A 1 276 ? 55.934  23.993  17.990  1.00 67.82  ? 276 ARG A NH1   1 
ATOM   2060 N NH2   . ARG A 1 276 ? 54.350  24.897  16.584  1.00 76.52  ? 276 ARG A NH2   1 
ATOM   2061 N N     . PRO A 1 277 ? 51.875  22.590  20.990  1.00 50.14  ? 277 PRO A N     1 
ATOM   2062 C CA    . PRO A 1 277 ? 50.682  23.034  21.713  1.00 46.31  ? 277 PRO A CA    1 
ATOM   2063 C C     . PRO A 1 277 ? 49.426  22.522  21.028  1.00 47.65  ? 277 PRO A C     1 
ATOM   2064 O O     . PRO A 1 277 ? 49.343  22.487  19.797  1.00 52.29  ? 277 PRO A O     1 
ATOM   2065 C CB    . PRO A 1 277 ? 50.772  24.561  21.644  1.00 48.87  ? 277 PRO A CB    1 
ATOM   2066 C CG    . PRO A 1 277 ? 52.168  24.864  21.229  1.00 46.91  ? 277 PRO A CG    1 
ATOM   2067 C CD    . PRO A 1 277 ? 52.637  23.717  20.431  1.00 49.01  ? 277 PRO A CD    1 
ATOM   2068 N N     . ALA A 1 278 ? 48.444  22.119  21.836  1.00 42.63  ? 278 ALA A N     1 
ATOM   2069 C CA    . ALA A 1 278 ? 47.210  21.569  21.283  1.00 45.63  ? 278 ALA A CA    1 
ATOM   2070 C C     . ALA A 1 278 ? 46.588  22.498  20.245  1.00 48.66  ? 278 ALA A C     1 
ATOM   2071 O O     . ALA A 1 278 ? 46.044  22.041  19.234  1.00 46.42  ? 278 ALA A O     1 
ATOM   2072 C CB    . ALA A 1 278 ? 46.212  21.282  22.398  1.00 43.14  ? 278 ALA A CB    1 
ATOM   2073 N N     . GLN A 1 279 ? 46.671  23.806  20.467  1.00 50.62  ? 279 GLN A N     1 
ATOM   2074 C CA    . GLN A 1 279 ? 46.057  24.721  19.518  1.00 47.94  ? 279 GLN A CA    1 
ATOM   2075 C C     . GLN A 1 279 ? 46.750  24.677  18.167  1.00 50.50  ? 279 GLN A C     1 
ATOM   2076 O O     . GLN A 1 279 ? 46.096  24.890  17.141  1.00 52.51  ? 279 GLN A O     1 
ATOM   2077 C CB    . GLN A 1 279 ? 46.064  26.140  20.066  1.00 45.51  ? 279 GLN A CB    1 
ATOM   2078 C CG    . GLN A 1 279 ? 45.062  27.034  19.396  1.00 49.54  ? 279 GLN A CG    1 
ATOM   2079 C CD    . GLN A 1 279 ? 43.637  26.553  19.595  1.00 55.52  ? 279 GLN A CD    1 
ATOM   2080 O OE1   . GLN A 1 279 ? 43.150  26.411  20.733  1.00 51.73  ? 279 GLN A OE1   1 
ATOM   2081 N NE2   . GLN A 1 279 ? 42.952  26.305  18.485  1.00 50.09  ? 279 GLN A NE2   1 
ATOM   2082 N N     . ASP A 1 280 ? 48.057  24.403  18.134  1.00 48.40  ? 280 ASP A N     1 
ATOM   2083 C CA    . ASP A 1 280 ? 48.742  24.326  16.848  1.00 47.04  ? 280 ASP A CA    1 
ATOM   2084 C C     . ASP A 1 280 ? 48.172  23.200  16.002  1.00 52.92  ? 280 ASP A C     1 
ATOM   2085 O O     . ASP A 1 280 ? 48.020  23.346  14.783  1.00 60.47  ? 280 ASP A O     1 
ATOM   2086 C CB    . ASP A 1 280 ? 50.245  24.127  17.033  1.00 51.84  ? 280 ASP A CB    1 
ATOM   2087 C CG    . ASP A 1 280 ? 50.974  25.406  17.446  1.00 62.52  ? 280 ASP A CG    1 
ATOM   2088 O OD1   . ASP A 1 280 ? 50.321  26.417  17.803  1.00 55.97  ? 280 ASP A OD1   1 
ATOM   2089 O OD2   . ASP A 1 280 ? 52.226  25.392  17.434  1.00 69.92  ? 280 ASP A OD2   1 
ATOM   2090 N N     . LEU A 1 281 ? 47.850  22.064  16.625  1.00 48.32  ? 281 LEU A N     1 
ATOM   2091 C CA    . LEU A 1 281 ? 47.295  20.967  15.848  1.00 48.76  ? 281 LEU A CA    1 
ATOM   2092 C C     . LEU A 1 281 ? 45.874  21.279  15.384  1.00 50.07  ? 281 LEU A C     1 
ATOM   2093 O O     . LEU A 1 281 ? 45.532  21.037  14.218  1.00 48.82  ? 281 LEU A O     1 
ATOM   2094 C CB    . LEU A 1 281 ? 47.351  19.666  16.644  1.00 44.29  ? 281 LEU A CB    1 
ATOM   2095 C CG    . LEU A 1 281 ? 48.658  19.239  17.309  1.00 42.01  ? 281 LEU A CG    1 
ATOM   2096 C CD1   . LEU A 1 281 ? 48.373  17.938  17.956  1.00 40.73  ? 281 LEU A CD1   1 
ATOM   2097 C CD2   . LEU A 1 281 ? 49.842  19.081  16.375  1.00 40.77  ? 281 LEU A CD2   1 
ATOM   2098 N N     . VAL A 1 282 ? 45.039  21.823  16.272  1.00 45.98  ? 282 VAL A N     1 
ATOM   2099 C CA    . VAL A 1 282 ? 43.699  22.242  15.868  1.00 47.42  ? 282 VAL A CA    1 
ATOM   2100 C C     . VAL A 1 282 ? 43.790  23.209  14.695  1.00 51.25  ? 282 VAL A C     1 
ATOM   2101 O O     . VAL A 1 282 ? 43.108  23.050  13.672  1.00 47.15  ? 282 VAL A O     1 
ATOM   2102 C CB    . VAL A 1 282 ? 42.949  22.863  17.063  1.00 45.71  ? 282 VAL A CB    1 
ATOM   2103 C CG1   . VAL A 1 282 ? 41.693  23.556  16.612  1.00 44.64  ? 282 VAL A CG1   1 
ATOM   2104 C CG2   . VAL A 1 282 ? 42.581  21.790  18.050  1.00 45.44  ? 282 VAL A CG2   1 
ATOM   2105 N N     . ASP A 1 283 ? 44.690  24.193  14.811  1.00 51.23  ? 283 ASP A N     1 
ATOM   2106 C CA    . ASP A 1 283 ? 44.812  25.249  13.809  1.00 52.05  ? 283 ASP A CA    1 
ATOM   2107 C C     . ASP A 1 283 ? 45.068  24.702  12.407  1.00 52.12  ? 283 ASP A C     1 
ATOM   2108 O O     . ASP A 1 283 ? 44.609  25.294  11.426  1.00 54.38  ? 283 ASP A O     1 
ATOM   2109 C CB    . ASP A 1 283 ? 45.926  26.228  14.208  1.00 53.81  ? 283 ASP A CB    1 
ATOM   2110 C CG    . ASP A 1 283 ? 45.469  27.262  15.251  1.00 57.08  ? 283 ASP A CG    1 
ATOM   2111 O OD1   . ASP A 1 283 ? 44.336  27.138  15.761  1.00 55.87  ? 283 ASP A OD1   1 
ATOM   2112 O OD2   . ASP A 1 283 ? 46.244  28.201  15.560  1.00 57.27  ? 283 ASP A OD2   1 
ATOM   2113 N N     . HIS A 1 284 ? 45.783  23.585  12.284  1.00 50.40  ? 284 HIS A N     1 
ATOM   2114 C CA    . HIS A 1 284 ? 46.139  23.032  10.984  1.00 50.53  ? 284 HIS A CA    1 
ATOM   2115 C C     . HIS A 1 284 ? 45.329  21.792  10.628  1.00 52.64  ? 284 HIS A C     1 
ATOM   2116 O O     . HIS A 1 284 ? 45.606  21.146  9.612   1.00 53.42  ? 284 HIS A O     1 
ATOM   2117 C CB    . HIS A 1 284 ? 47.633  22.712  10.944  1.00 51.34  ? 284 HIS A CB    1 
ATOM   2118 C CG    . HIS A 1 284 ? 48.507  23.927  10.904  1.00 56.96  ? 284 HIS A CG    1 
ATOM   2119 N ND1   . HIS A 1 284 ? 49.021  24.516  12.042  1.00 58.05  ? 284 HIS A ND1   1 
ATOM   2120 C CD2   . HIS A 1 284 ? 48.949  24.673  9.861   1.00 59.15  ? 284 HIS A CD2   1 
ATOM   2121 C CE1   . HIS A 1 284 ? 49.747  25.567  11.700  1.00 65.18  ? 284 HIS A CE1   1 
ATOM   2122 N NE2   . HIS A 1 284 ? 49.720  25.685  10.382  1.00 63.35  ? 284 HIS A NE2   1 
ATOM   2123 N N     . GLU A 1 285 ? 44.318  21.458  11.425  1.00 53.38  ? 285 GLU A N     1 
ATOM   2124 C CA    . GLU A 1 285 ? 43.633  20.183  11.259  1.00 48.01  ? 285 GLU A CA    1 
ATOM   2125 C C     . GLU A 1 285 ? 42.906  20.107  9.917   1.00 49.40  ? 285 GLU A C     1 
ATOM   2126 O O     . GLU A 1 285 ? 42.935  19.069  9.245   1.00 48.12  ? 285 GLU A O     1 
ATOM   2127 C CB    . GLU A 1 285 ? 42.687  19.982  12.434  1.00 44.85  ? 285 GLU A CB    1 
ATOM   2128 C CG    . GLU A 1 285 ? 41.678  18.902  12.299  1.00 49.32  ? 285 GLU A CG    1 
ATOM   2129 C CD    . GLU A 1 285 ? 40.842  18.755  13.571  1.00 54.70  ? 285 GLU A CD    1 
ATOM   2130 O OE1   . GLU A 1 285 ? 41.024  19.567  14.507  1.00 51.79  ? 285 GLU A OE1   1 
ATOM   2131 O OE2   . GLU A 1 285 ? 39.990  17.840  13.638  1.00 55.40  ? 285 GLU A OE2   1 
ATOM   2132 N N     . TRP A 1 286 ? 42.284  21.199  9.485   1.00 48.72  ? 286 TRP A N     1 
ATOM   2133 C CA    . TRP A 1 286 ? 41.525  21.141  8.243   1.00 46.05  ? 286 TRP A CA    1 
ATOM   2134 C C     . TRP A 1 286 ? 42.396  21.214  6.993   1.00 48.87  ? 286 TRP A C     1 
ATOM   2135 O O     . TRP A 1 286 ? 41.898  20.946  5.895   1.00 45.80  ? 286 TRP A O     1 
ATOM   2136 C CB    . TRP A 1 286 ? 40.492  22.260  8.212   1.00 49.22  ? 286 TRP A CB    1 
ATOM   2137 C CG    . TRP A 1 286 ? 39.389  22.064  9.209   1.00 61.77  ? 286 TRP A CG    1 
ATOM   2138 C CD1   . TRP A 1 286 ? 39.312  22.585  10.486  1.00 60.10  ? 286 TRP A CD1   1 
ATOM   2139 C CD2   . TRP A 1 286 ? 38.199  21.282  9.027   1.00 63.90  ? 286 TRP A CD2   1 
ATOM   2140 N NE1   . TRP A 1 286 ? 38.145  22.176  11.094  1.00 55.91  ? 286 TRP A NE1   1 
ATOM   2141 C CE2   . TRP A 1 286 ? 37.447  21.376  10.224  1.00 59.52  ? 286 TRP A CE2   1 
ATOM   2142 C CE3   . TRP A 1 286 ? 37.697  20.507  7.970   1.00 56.24  ? 286 TRP A CE3   1 
ATOM   2143 C CZ2   . TRP A 1 286 ? 36.225  20.734  10.381  1.00 57.12  ? 286 TRP A CZ2   1 
ATOM   2144 C CZ3   . TRP A 1 286 ? 36.478  19.872  8.130   1.00 50.15  ? 286 TRP A CZ3   1 
ATOM   2145 C CH2   . TRP A 1 286 ? 35.756  19.992  9.319   1.00 57.78  ? 286 TRP A CH2   1 
ATOM   2146 N N     . HIS A 1 287 ? 43.679  21.548  7.120   1.00 50.71  ? 287 HIS A N     1 
ATOM   2147 C CA    . HIS A 1 287 ? 44.516  21.690  5.933   1.00 49.72  ? 287 HIS A CA    1 
ATOM   2148 C C     . HIS A 1 287 ? 44.914  20.358  5.312   1.00 43.00  ? 287 HIS A C     1 
ATOM   2149 O O     . HIS A 1 287 ? 45.577  20.356  4.280   1.00 44.69  ? 287 HIS A O     1 
ATOM   2150 C CB    . HIS A 1 287 ? 45.794  22.469  6.259   1.00 49.83  ? 287 HIS A CB    1 
ATOM   2151 C CG    . HIS A 1 287 ? 45.553  23.840  6.801   1.00 52.97  ? 287 HIS A CG    1 
ATOM   2152 N ND1   . HIS A 1 287 ? 46.388  24.426  7.730   1.00 55.51  ? 287 HIS A ND1   1 
ATOM   2153 C CD2   . HIS A 1 287 ? 44.577  24.742  6.547   1.00 54.87  ? 287 HIS A CD2   1 
ATOM   2154 C CE1   . HIS A 1 287 ? 45.932  25.628  8.033   1.00 52.55  ? 287 HIS A CE1   1 
ATOM   2155 N NE2   . HIS A 1 287 ? 44.832  25.843  7.332   1.00 59.59  ? 287 HIS A NE2   1 
ATOM   2156 N N     . VAL A 1 288 ? 44.568  19.226  5.910   1.00 46.48  ? 288 VAL A N     1 
ATOM   2157 C CA    . VAL A 1 288 ? 45.040  17.951  5.394   1.00 43.03  ? 288 VAL A CA    1 
ATOM   2158 C C     . VAL A 1 288 ? 43.963  17.222  4.603   1.00 40.66  ? 288 VAL A C     1 
ATOM   2159 O O     . VAL A 1 288 ? 44.150  16.060  4.255   1.00 42.63  ? 288 VAL A O     1 
ATOM   2160 C CB    . VAL A 1 288 ? 45.587  17.055  6.525   1.00 43.88  ? 288 VAL A CB    1 
ATOM   2161 C CG1   . VAL A 1 288 ? 46.655  17.794  7.335   1.00 44.27  ? 288 VAL A CG1   1 
ATOM   2162 C CG2   . VAL A 1 288 ? 44.461  16.556  7.409   1.00 35.17  ? 288 VAL A CG2   1 
ATOM   2163 N N     . LEU A 1 289 ? 42.831  17.865  4.330   1.00 41.75  ? 289 LEU A N     1 
ATOM   2164 C CA    . LEU A 1 289 ? 41.819  17.139  3.567   1.00 45.62  ? 289 LEU A CA    1 
ATOM   2165 C C     . LEU A 1 289 ? 42.220  17.074  2.091   1.00 50.58  ? 289 LEU A C     1 
ATOM   2166 O O     . LEU A 1 289 ? 42.740  18.045  1.543   1.00 47.59  ? 289 LEU A O     1 
ATOM   2167 C CB    . LEU A 1 289 ? 40.444  17.793  3.708   1.00 48.03  ? 289 LEU A CB    1 
ATOM   2168 C CG    . LEU A 1 289 ? 39.635  17.442  4.962   1.00 48.02  ? 289 LEU A CG    1 
ATOM   2169 C CD1   . LEU A 1 289 ? 38.429  18.353  5.120   1.00 48.18  ? 289 LEU A CD1   1 
ATOM   2170 C CD2   . LEU A 1 289 ? 39.181  16.003  4.897   1.00 45.48  ? 289 LEU A CD2   1 
ATOM   2171 N N     . PRO A 1 290 ? 42.009  15.933  1.439   1.00 49.52  ? 290 PRO A N     1 
ATOM   2172 C CA    . PRO A 1 290 ? 42.538  15.759  0.081   1.00 52.79  ? 290 PRO A CA    1 
ATOM   2173 C C     . PRO A 1 290 ? 41.917  16.678  -0.962  1.00 56.23  ? 290 PRO A C     1 
ATOM   2174 O O     . PRO A 1 290 ? 42.586  17.010  -1.948  1.00 52.50  ? 290 PRO A O     1 
ATOM   2175 C CB    . PRO A 1 290 ? 42.234  14.283  -0.216  1.00 54.63  ? 290 PRO A CB    1 
ATOM   2176 C CG    . PRO A 1 290 ? 41.114  13.929  0.729   1.00 51.36  ? 290 PRO A CG    1 
ATOM   2177 C CD    . PRO A 1 290 ? 41.413  14.695  1.965   1.00 51.73  ? 290 PRO A CD    1 
ATOM   2178 N N     . GLN A 1 291 ? 40.662  17.082  -0.798  1.00 55.99  ? 291 GLN A N     1 
ATOM   2179 C CA    . GLN A 1 291 ? 39.986  17.907  -1.782  1.00 50.39  ? 291 GLN A CA    1 
ATOM   2180 C C     . GLN A 1 291 ? 39.217  18.995  -1.056  1.00 50.70  ? 291 GLN A C     1 
ATOM   2181 O O     . GLN A 1 291 ? 39.057  18.966  0.163   1.00 55.77  ? 291 GLN A O     1 
ATOM   2182 C CB    . GLN A 1 291 ? 39.038  17.078  -2.651  1.00 49.85  ? 291 GLN A CB    1 
ATOM   2183 C CG    . GLN A 1 291 ? 39.705  15.924  -3.379  1.00 51.80  ? 291 GLN A CG    1 
ATOM   2184 C CD    . GLN A 1 291 ? 39.546  14.599  -2.658  1.00 59.60  ? 291 GLN A CD    1 
ATOM   2185 O OE1   . GLN A 1 291 ? 38.718  14.459  -1.742  1.00 60.06  ? 291 GLN A OE1   1 
ATOM   2186 N NE2   . GLN A 1 291 ? 40.339  13.610  -3.067  1.00 58.31  ? 291 GLN A NE2   1 
ATOM   2187 N N     . GLU A 1 292 ? 38.775  19.987  -1.817  1.00 54.56  ? 292 GLU A N     1 
ATOM   2188 C CA    . GLU A 1 292 ? 37.773  20.901  -1.305  1.00 52.36  ? 292 GLU A CA    1 
ATOM   2189 C C     . GLU A 1 292 ? 36.494  20.120  -1.042  1.00 50.24  ? 292 GLU A C     1 
ATOM   2190 O O     . GLU A 1 292 ? 35.947  19.499  -1.952  1.00 51.59  ? 292 GLU A O     1 
ATOM   2191 C CB    . GLU A 1 292 ? 37.550  22.050  -2.290  1.00 53.48  ? 292 GLU A CB    1 
ATOM   2192 C CG    . GLU A 1 292 ? 38.831  22.833  -2.596  1.00 64.86  ? 292 GLU A CG    1 
ATOM   2193 C CD    . GLU A 1 292 ? 38.558  24.309  -2.807  1.00 82.11  ? 292 GLU A CD    1 
ATOM   2194 O OE1   . GLU A 1 292 ? 37.434  24.622  -3.268  1.00 71.55  ? 292 GLU A OE1   1 
ATOM   2195 O OE2   . GLU A 1 292 ? 39.454  25.140  -2.500  1.00 85.96  ? 292 GLU A OE2   1 
ATOM   2196 N N     . SER A 1 293 ? 36.049  20.091  0.206   1.00 48.68  ? 293 SER A N     1 
ATOM   2197 C CA    . SER A 1 293 ? 34.928  19.221  0.506   1.00 46.68  ? 293 SER A CA    1 
ATOM   2198 C C     . SER A 1 293 ? 34.059  19.873  1.551   1.00 43.03  ? 293 SER A C     1 
ATOM   2199 O O     . SER A 1 293 ? 34.498  20.781  2.256   1.00 47.34  ? 293 SER A O     1 
ATOM   2200 C CB    . SER A 1 293 ? 35.420  17.858  0.964   1.00 44.84  ? 293 SER A CB    1 
ATOM   2201 O OG    . SER A 1 293 ? 36.603  18.036  1.702   1.00 47.90  ? 293 SER A OG    1 
ATOM   2202 N N     . ILE A 1 294 ? 32.803  19.468  1.578   1.00 41.49  ? 294 ILE A N     1 
ATOM   2203 C CA    . ILE A 1 294 ? 31.965  19.638  2.752   1.00 44.08  ? 294 ILE A CA    1 
ATOM   2204 C C     . ILE A 1 294 ? 31.600  18.236  3.215   1.00 46.91  ? 294 ILE A C     1 
ATOM   2205 O O     . ILE A 1 294 ? 31.626  17.290  2.419   1.00 45.28  ? 294 ILE A O     1 
ATOM   2206 C CB    . ILE A 1 294 ? 30.707  20.491  2.498   1.00 41.65  ? 294 ILE A CB    1 
ATOM   2207 C CG1   . ILE A 1 294 ? 29.909  19.950  1.324   1.00 41.24  ? 294 ILE A CG1   1 
ATOM   2208 C CG2   . ILE A 1 294 ? 31.080  21.929  2.281   1.00 41.35  ? 294 ILE A CG2   1 
ATOM   2209 C CD1   . ILE A 1 294 ? 28.518  20.494  1.292   1.00 40.75  ? 294 ILE A CD1   1 
ATOM   2210 N N     . PHE A 1 295 ? 31.319  18.096  4.518   1.00 45.96  ? 295 PHE A N     1 
ATOM   2211 C CA    . PHE A 1 295 ? 30.977  16.806  5.124   1.00 40.37  ? 295 PHE A CA    1 
ATOM   2212 C C     . PHE A 1 295 ? 32.152  15.836  5.066   1.00 39.30  ? 295 PHE A C     1 
ATOM   2213 O O     . PHE A 1 295 ? 31.988  14.645  4.815   1.00 41.58  ? 295 PHE A O     1 
ATOM   2214 C CB    . PHE A 1 295 ? 29.736  16.191  4.473   1.00 41.10  ? 295 PHE A CB    1 
ATOM   2215 C CG    . PHE A 1 295 ? 28.772  15.588  5.458   1.00 43.41  ? 295 PHE A CG    1 
ATOM   2216 C CD1   . PHE A 1 295 ? 27.417  15.874  5.389   1.00 41.16  ? 295 PHE A CD1   1 
ATOM   2217 C CD2   . PHE A 1 295 ? 29.223  14.739  6.459   1.00 42.12  ? 295 PHE A CD2   1 
ATOM   2218 C CE1   . PHE A 1 295 ? 26.536  15.322  6.287   1.00 41.57  ? 295 PHE A CE1   1 
ATOM   2219 C CE2   . PHE A 1 295 ? 28.341  14.180  7.362   1.00 39.66  ? 295 PHE A CE2   1 
ATOM   2220 C CZ    . PHE A 1 295 ? 26.995  14.477  7.282   1.00 39.13  ? 295 PHE A CZ    1 
ATOM   2221 N N     . ARG A 1 296 ? 33.346  16.350  5.287   1.00 40.36  ? 296 ARG A N     1 
ATOM   2222 C CA    . ARG A 1 296 ? 34.550  15.539  5.283   1.00 39.30  ? 296 ARG A CA    1 
ATOM   2223 C C     . ARG A 1 296 ? 35.410  16.035  6.422   1.00 43.94  ? 296 ARG A C     1 
ATOM   2224 O O     . ARG A 1 296 ? 35.526  17.240  6.660   1.00 42.79  ? 296 ARG A O     1 
ATOM   2225 C CB    . ARG A 1 296 ? 35.337  15.631  3.967   1.00 39.40  ? 296 ARG A CB    1 
ATOM   2226 C CG    . ARG A 1 296 ? 34.676  14.969  2.788   1.00 40.85  ? 296 ARG A CG    1 
ATOM   2227 C CD    . ARG A 1 296 ? 34.552  13.484  2.984   1.00 41.93  ? 296 ARG A CD    1 
ATOM   2228 N NE    . ARG A 1 296 ? 34.076  12.833  1.772   1.00 45.63  ? 296 ARG A NE    1 
ATOM   2229 C CZ    . ARG A 1 296 ? 32.794  12.703  1.452   1.00 43.37  ? 296 ARG A CZ    1 
ATOM   2230 N NH1   . ARG A 1 296 ? 31.848  13.185  2.255   1.00 41.51  ? 296 ARG A NH1   1 
ATOM   2231 N NH2   . ARG A 1 296 ? 32.463  12.094  0.330   1.00 39.29  ? 296 ARG A NH2   1 
ATOM   2232 N N     . PHE A 1 297 ? 35.995  15.107  7.135   1.00 43.31  ? 297 PHE A N     1 
ATOM   2233 C CA    . PHE A 1 297 ? 36.639  15.456  8.376   1.00 39.79  ? 297 PHE A CA    1 
ATOM   2234 C C     . PHE A 1 297 ? 38.002  14.798  8.388   1.00 43.59  ? 297 PHE A C     1 
ATOM   2235 O O     . PHE A 1 297 ? 38.170  13.679  7.880   1.00 36.94  ? 297 PHE A O     1 
ATOM   2236 C CB    . PHE A 1 297 ? 35.763  15.036  9.527   1.00 39.36  ? 297 PHE A CB    1 
ATOM   2237 C CG    . PHE A 1 297 ? 34.318  15.410  9.337   1.00 36.99  ? 297 PHE A CG    1 
ATOM   2238 C CD1   . PHE A 1 297 ? 33.921  16.731  9.380   1.00 38.61  ? 297 PHE A CD1   1 
ATOM   2239 C CD2   . PHE A 1 297 ? 33.363  14.446  9.109   1.00 33.82  ? 297 PHE A CD2   1 
ATOM   2240 C CE1   . PHE A 1 297 ? 32.594  17.076  9.209   1.00 40.56  ? 297 PHE A CE1   1 
ATOM   2241 C CE2   . PHE A 1 297 ? 32.036  14.795  8.940   1.00 36.36  ? 297 PHE A CE2   1 
ATOM   2242 C CZ    . PHE A 1 297 ? 31.651  16.105  8.989   1.00 34.76  ? 297 PHE A CZ    1 
ATOM   2243 N N     . SER A 1 298 ? 38.976  15.527  8.930   1.00 40.77  ? 298 SER A N     1 
ATOM   2244 C CA    . SER A 1 298 ? 40.364  15.176  8.684   1.00 39.44  ? 298 SER A CA    1 
ATOM   2245 C C     . SER A 1 298 ? 40.744  13.898  9.407   1.00 41.66  ? 298 SER A C     1 
ATOM   2246 O O     . SER A 1 298 ? 41.372  13.008  8.822   1.00 45.29  ? 298 SER A O     1 
ATOM   2247 C CB    . SER A 1 298 ? 41.264  16.332  9.093   1.00 41.61  ? 298 SER A CB    1 
ATOM   2248 O OG    . SER A 1 298 ? 41.343  17.254  8.022   1.00 45.15  ? 298 SER A OG    1 
ATOM   2249 N N     . PHE A 1 299 ? 40.342  13.771  10.664  1.00 41.29  ? 299 PHE A N     1 
ATOM   2250 C CA    . PHE A 1 299 ? 40.778  12.677  11.520  1.00 40.52  ? 299 PHE A CA    1 
ATOM   2251 C C     . PHE A 1 299 ? 39.542  12.003  12.090  1.00 41.11  ? 299 PHE A C     1 
ATOM   2252 O O     . PHE A 1 299 ? 38.853  12.570  12.948  1.00 39.36  ? 299 PHE A O     1 
ATOM   2253 C CB    . PHE A 1 299 ? 41.724  13.198  12.598  1.00 35.87  ? 299 PHE A CB    1 
ATOM   2254 C CG    . PHE A 1 299 ? 42.978  13.774  12.027  1.00 35.71  ? 299 PHE A CG    1 
ATOM   2255 C CD1   . PHE A 1 299 ? 44.035  12.955  11.684  1.00 36.71  ? 299 PHE A CD1   1 
ATOM   2256 C CD2   . PHE A 1 299 ? 43.079  15.115  11.768  1.00 36.61  ? 299 PHE A CD2   1 
ATOM   2257 C CE1   . PHE A 1 299 ? 45.183  13.472  11.130  1.00 35.77  ? 299 PHE A CE1   1 
ATOM   2258 C CE2   . PHE A 1 299 ? 44.233  15.636  11.210  1.00 36.65  ? 299 PHE A CE2   1 
ATOM   2259 C CZ    . PHE A 1 299 ? 45.282  14.818  10.901  1.00 34.56  ? 299 PHE A CZ    1 
ATOM   2260 N N     . VAL A 1 300 ? 39.255  10.810  11.578  1.00 36.97  ? 300 VAL A N     1 
ATOM   2261 C CA    . VAL A 1 300 ? 38.063  10.037  11.909  1.00 36.71  ? 300 VAL A CA    1 
ATOM   2262 C C     . VAL A 1 300 ? 38.525  8.607   12.195  1.00 37.63  ? 300 VAL A C     1 
ATOM   2263 O O     . VAL A 1 300 ? 39.718  8.306   12.031  1.00 37.38  ? 300 VAL A O     1 
ATOM   2264 C CB    . VAL A 1 300 ? 37.027  10.113  10.764  1.00 38.45  ? 300 VAL A CB    1 
ATOM   2265 C CG1   . VAL A 1 300 ? 36.598  11.554  10.486  1.00 33.24  ? 300 VAL A CG1   1 
ATOM   2266 C CG2   . VAL A 1 300 ? 37.570  9.466   9.488   1.00 38.01  ? 300 VAL A CG2   1 
ATOM   2267 N N     . PRO A 1 301 ? 37.650  7.705   12.638  1.00 38.69  ? 301 PRO A N     1 
ATOM   2268 C CA    . PRO A 1 301 ? 38.051  6.302   12.792  1.00 38.20  ? 301 PRO A CA    1 
ATOM   2269 C C     . PRO A 1 301 ? 38.774  5.743   11.572  1.00 41.30  ? 301 PRO A C     1 
ATOM   2270 O O     . PRO A 1 301 ? 38.304  5.849   10.434  1.00 39.90  ? 301 PRO A O     1 
ATOM   2271 C CB    . PRO A 1 301 ? 36.716  5.589   13.022  1.00 37.67  ? 301 PRO A CB    1 
ATOM   2272 C CG    . PRO A 1 301 ? 35.890  6.583   13.707  1.00 38.54  ? 301 PRO A CG    1 
ATOM   2273 C CD    . PRO A 1 301 ? 36.320  7.947   13.226  1.00 40.89  ? 301 PRO A CD    1 
ATOM   2274 N N     . VAL A 1 302 ? 39.917  5.117   11.822  1.00 42.33  ? 302 VAL A N     1 
ATOM   2275 C CA    . VAL A 1 302 ? 40.689  4.439   10.789  1.00 42.89  ? 302 VAL A CA    1 
ATOM   2276 C C     . VAL A 1 302 ? 40.349  2.952   10.792  1.00 43.80  ? 302 VAL A C     1 
ATOM   2277 O O     . VAL A 1 302 ? 40.199  2.337   11.853  1.00 42.89  ? 302 VAL A O     1 
ATOM   2278 C CB    . VAL A 1 302 ? 42.197  4.672   11.003  1.00 42.50  ? 302 VAL A CB    1 
ATOM   2279 C CG1   . VAL A 1 302 ? 42.642  4.079   12.315  1.00 39.07  ? 302 VAL A CG1   1 
ATOM   2280 C CG2   . VAL A 1 302 ? 42.995  4.092   9.847   1.00 44.35  ? 302 VAL A CG2   1 
ATOM   2281 N N     . VAL A 1 303 ? 40.222  2.370   9.595   1.00 48.00  ? 303 VAL A N     1 
ATOM   2282 C CA    . VAL A 1 303 ? 40.080  0.923   9.418   1.00 46.91  ? 303 VAL A CA    1 
ATOM   2283 C C     . VAL A 1 303 ? 41.425  0.270   9.709   1.00 45.02  ? 303 VAL A C     1 
ATOM   2284 O O     . VAL A 1 303 ? 42.296  0.201   8.842   1.00 46.40  ? 303 VAL A O     1 
ATOM   2285 C CB    . VAL A 1 303 ? 39.578  0.576   8.003   1.00 38.64  ? 303 VAL A CB    1 
ATOM   2286 C CG1   . VAL A 1 303 ? 39.395  -0.904  7.856   1.00 42.96  ? 303 VAL A CG1   1 
ATOM   2287 C CG2   . VAL A 1 303 ? 38.266  1.274   7.720   1.00 38.76  ? 303 VAL A CG2   1 
ATOM   2288 N N     . ASP A 1 304 ? 41.615  -0.189  10.938  1.00 50.20  ? 304 ASP A N     1 
ATOM   2289 C CA    . ASP A 1 304 ? 42.934  -0.556  11.428  1.00 49.83  ? 304 ASP A CA    1 
ATOM   2290 C C     . ASP A 1 304 ? 43.174  -2.053  11.442  1.00 51.61  ? 304 ASP A C     1 
ATOM   2291 O O     . ASP A 1 304 ? 44.279  -2.479  11.786  1.00 54.79  ? 304 ASP A O     1 
ATOM   2292 C CB    . ASP A 1 304 ? 43.154  0.013   12.845  1.00 48.66  ? 304 ASP A CB    1 
ATOM   2293 C CG    . ASP A 1 304 ? 42.089  -0.447  13.855  1.00 53.48  ? 304 ASP A CG    1 
ATOM   2294 O OD1   . ASP A 1 304 ? 41.081  -1.050  13.421  1.00 55.18  ? 304 ASP A OD1   1 
ATOM   2295 O OD2   . ASP A 1 304 ? 42.245  -0.191  15.082  1.00 51.56  ? 304 ASP A OD2   1 
ATOM   2296 N N     . GLY A 1 305 ? 42.178  -2.860  11.080  1.00 47.25  ? 305 GLY A N     1 
ATOM   2297 C CA    . GLY A 1 305 ? 42.299  -4.283  11.311  1.00 50.05  ? 305 GLY A CA    1 
ATOM   2298 C C     . GLY A 1 305 ? 42.347  -4.669  12.773  1.00 55.42  ? 305 GLY A C     1 
ATOM   2299 O O     . GLY A 1 305 ? 42.749  -5.788  13.092  1.00 59.26  ? 305 GLY A O     1 
ATOM   2300 N N     . ASP A 1 306 ? 41.955  -3.767  13.676  1.00 54.44  ? 306 ASP A N     1 
ATOM   2301 C CA    . ASP A 1 306 ? 41.912  -4.033  15.111  1.00 51.73  ? 306 ASP A CA    1 
ATOM   2302 C C     . ASP A 1 306 ? 40.531  -3.697  15.666  1.00 51.84  ? 306 ASP A C     1 
ATOM   2303 O O     . ASP A 1 306 ? 39.681  -4.588  15.793  1.00 52.27  ? 306 ASP A O     1 
ATOM   2304 C CB    . ASP A 1 306 ? 42.997  -3.232  15.832  1.00 53.27  ? 306 ASP A CB    1 
ATOM   2305 C CG    . ASP A 1 306 ? 42.994  -3.463  17.329  1.00 57.54  ? 306 ASP A CG    1 
ATOM   2306 O OD1   . ASP A 1 306 ? 42.662  -4.601  17.733  1.00 56.15  ? 306 ASP A OD1   1 
ATOM   2307 O OD2   . ASP A 1 306 ? 43.318  -2.510  18.091  1.00 59.44  ? 306 ASP A OD2   1 
ATOM   2308 N N     . PHE A 1 307 ? 40.292  -2.421  15.996  1.00 47.21  ? 307 PHE A N     1 
ATOM   2309 C CA    . PHE A 1 307 ? 38.936  -1.997  16.323  1.00 44.48  ? 307 PHE A CA    1 
ATOM   2310 C C     . PHE A 1 307 ? 37.980  -2.336  15.187  1.00 49.08  ? 307 PHE A C     1 
ATOM   2311 O O     . PHE A 1 307 ? 36.902  -2.901  15.405  1.00 47.76  ? 307 PHE A O     1 
ATOM   2312 C CB    . PHE A 1 307 ? 38.904  -0.505  16.613  1.00 41.75  ? 307 PHE A CB    1 
ATOM   2313 C CG    . PHE A 1 307 ? 37.696  -0.074  17.392  1.00 41.31  ? 307 PHE A CG    1 
ATOM   2314 C CD1   . PHE A 1 307 ? 36.496  0.172   16.762  1.00 41.84  ? 307 PHE A CD1   1 
ATOM   2315 C CD2   . PHE A 1 307 ? 37.766  0.088   18.771  1.00 43.14  ? 307 PHE A CD2   1 
ATOM   2316 C CE1   . PHE A 1 307 ? 35.389  0.566   17.493  1.00 44.14  ? 307 PHE A CE1   1 
ATOM   2317 C CE2   . PHE A 1 307 ? 36.666  0.487   19.498  1.00 38.05  ? 307 PHE A CE2   1 
ATOM   2318 C CZ    . PHE A 1 307 ? 35.479  0.718   18.868  1.00 37.59  ? 307 PHE A CZ    1 
ATOM   2319 N N     . LEU A 1 308 ? 38.365  -2.006  13.962  1.00 48.98  ? 308 LEU A N     1 
ATOM   2320 C CA    . LEU A 1 308 ? 37.605  -2.371  12.775  1.00 52.33  ? 308 LEU A CA    1 
ATOM   2321 C C     . LEU A 1 308 ? 38.371  -3.477  12.057  1.00 52.29  ? 308 LEU A C     1 
ATOM   2322 O O     . LEU A 1 308 ? 39.422  -3.225  11.461  1.00 52.36  ? 308 LEU A O     1 
ATOM   2323 C CB    . LEU A 1 308 ? 37.379  -1.149  11.887  1.00 49.47  ? 308 LEU A CB    1 
ATOM   2324 C CG    . LEU A 1 308 ? 36.448  -0.121  12.534  1.00 47.48  ? 308 LEU A CG    1 
ATOM   2325 C CD1   . LEU A 1 308 ? 36.303  1.110   11.663  1.00 45.21  ? 308 LEU A CD1   1 
ATOM   2326 C CD2   . LEU A 1 308 ? 35.086  -0.740  12.793  1.00 45.02  ? 308 LEU A CD2   1 
ATOM   2327 N N     . SER A 1 309 ? 37.856  -4.708  12.133  1.00 51.88  ? 309 SER A N     1 
ATOM   2328 C CA    . SER A 1 309 ? 38.566  -5.836  11.540  1.00 54.20  ? 309 SER A CA    1 
ATOM   2329 C C     . SER A 1 309 ? 38.596  -5.735  10.021  1.00 56.57  ? 309 SER A C     1 
ATOM   2330 O O     . SER A 1 309 ? 39.527  -6.240  9.382   1.00 54.60  ? 309 SER A O     1 
ATOM   2331 C CB    . SER A 1 309 ? 37.922  -7.151  11.974  1.00 53.85  ? 309 SER A CB    1 
ATOM   2332 O OG    . SER A 1 309 ? 36.609  -7.271  11.459  1.00 58.95  ? 309 SER A OG    1 
ATOM   2333 N N     . ASP A 1 310 ? 37.587  -5.096  9.438   1.00 52.91  ? 310 ASP A N     1 
ATOM   2334 C CA    . ASP A 1 310 ? 37.534  -4.779  8.026   1.00 48.79  ? 310 ASP A CA    1 
ATOM   2335 C C     . ASP A 1 310 ? 36.737  -3.485  7.894   1.00 51.72  ? 310 ASP A C     1 
ATOM   2336 O O     . ASP A 1 310 ? 36.355  -2.877  8.899   1.00 52.48  ? 310 ASP A O     1 
ATOM   2337 C CB    . ASP A 1 310 ? 36.923  -5.950  7.247   1.00 52.62  ? 310 ASP A CB    1 
ATOM   2338 C CG    . ASP A 1 310 ? 37.277  -5.931  5.758   1.00 58.06  ? 310 ASP A CG    1 
ATOM   2339 O OD1   . ASP A 1 310 ? 37.538  -4.837  5.194   1.00 55.00  ? 310 ASP A OD1   1 
ATOM   2340 O OD2   . ASP A 1 310 ? 37.279  -7.024  5.152   1.00 59.00  ? 310 ASP A OD2   1 
ATOM   2341 N N     . THR A 1 311 ? 36.476  -3.057  6.656   1.00 49.23  ? 311 THR A N     1 
ATOM   2342 C CA    . THR A 1 311 ? 35.666  -1.869  6.445   1.00 48.33  ? 311 THR A CA    1 
ATOM   2343 C C     . THR A 1 311 ? 34.260  -2.087  6.994   1.00 49.35  ? 311 THR A C     1 
ATOM   2344 O O     . THR A 1 311 ? 33.746  -3.209  6.981   1.00 49.14  ? 311 THR A O     1 
ATOM   2345 C CB    . THR A 1 311 ? 35.556  -1.527  4.965   1.00 49.04  ? 311 THR A CB    1 
ATOM   2346 O OG1   . THR A 1 311 ? 34.678  -2.471  4.349   1.00 48.75  ? 311 THR A OG1   1 
ATOM   2347 C CG2   . THR A 1 311 ? 36.914  -1.558  4.292   1.00 42.86  ? 311 THR A CG2   1 
ATOM   2348 N N     . PRO A 1 312 ? 33.615  -1.030  7.481   1.00 50.10  ? 312 PRO A N     1 
ATOM   2349 C CA    . PRO A 1 312 ? 32.222  -1.170  7.927   1.00 51.01  ? 312 PRO A CA    1 
ATOM   2350 C C     . PRO A 1 312 ? 31.300  -1.754  6.871   1.00 51.23  ? 312 PRO A C     1 
ATOM   2351 O O     . PRO A 1 312 ? 30.414  -2.541  7.220   1.00 51.94  ? 312 PRO A O     1 
ATOM   2352 C CB    . PRO A 1 312 ? 31.843  0.267   8.298   1.00 47.24  ? 312 PRO A CB    1 
ATOM   2353 C CG    . PRO A 1 312 ? 33.126  0.861   8.735   1.00 46.06  ? 312 PRO A CG    1 
ATOM   2354 C CD    . PRO A 1 312 ? 34.182  0.277   7.843   1.00 48.09  ? 312 PRO A CD    1 
ATOM   2355 N N     . GLU A 1 313 ? 31.480  -1.405  5.590   1.00 53.52  ? 313 GLU A N     1 
ATOM   2356 C CA    . GLU A 1 313 ? 30.633  -1.981  4.542   1.00 52.44  ? 313 GLU A CA    1 
ATOM   2357 C C     . GLU A 1 313 ? 30.816  -3.488  4.449   1.00 53.56  ? 313 GLU A C     1 
ATOM   2358 O O     . GLU A 1 313 ? 29.834  -4.231  4.361   1.00 55.51  ? 313 GLU A O     1 
ATOM   2359 C CB    . GLU A 1 313 ? 30.913  -1.324  3.189   1.00 49.34  ? 313 GLU A CB    1 
ATOM   2360 C CG    . GLU A 1 313 ? 30.463  0.133   3.083   1.00 58.76  ? 313 GLU A CG    1 
ATOM   2361 C CD    . GLU A 1 313 ? 31.494  1.127   3.624   1.00 70.60  ? 313 GLU A CD    1 
ATOM   2362 O OE1   . GLU A 1 313 ? 32.277  0.766   4.544   1.00 63.64  ? 313 GLU A OE1   1 
ATOM   2363 O OE2   . GLU A 1 313 ? 31.506  2.282   3.137   1.00 70.32  ? 313 GLU A OE2   1 
ATOM   2364 N N     . ALA A 1 314 ? 32.063  -3.956  4.478   1.00 49.92  ? 314 ALA A N     1 
ATOM   2365 C CA    . ALA A 1 314 ? 32.321  -5.388  4.548   1.00 39.37  ? 314 ALA A CA    1 
ATOM   2366 C C     . ALA A 1 314 ? 31.615  -6.009  5.742   1.00 48.81  ? 314 ALA A C     1 
ATOM   2367 O O     . ALA A 1 314 ? 30.806  -6.929  5.593   1.00 54.60  ? 314 ALA A O     1 
ATOM   2368 C CB    . ALA A 1 314 ? 33.823  -5.638  4.620   1.00 37.34  ? 314 ALA A CB    1 
ATOM   2369 N N     . LEU A 1 315 ? 31.892  -5.489  6.944   1.00 51.95  ? 315 LEU A N     1 
ATOM   2370 C CA    . LEU A 1 315 ? 31.352  -6.084  8.168   1.00 51.78  ? 315 LEU A CA    1 
ATOM   2371 C C     . LEU A 1 315 ? 29.834  -6.025  8.185   1.00 53.33  ? 315 LEU A C     1 
ATOM   2372 O O     . LEU A 1 315 ? 29.171  -6.960  8.646   1.00 58.09  ? 315 LEU A O     1 
ATOM   2373 C CB    . LEU A 1 315 ? 31.921  -5.376  9.399   1.00 49.00  ? 315 LEU A CB    1 
ATOM   2374 C CG    . LEU A 1 315 ? 33.447  -5.282  9.510   1.00 52.90  ? 315 LEU A CG    1 
ATOM   2375 C CD1   . LEU A 1 315 ? 33.839  -4.398  10.663  1.00 46.96  ? 315 LEU A CD1   1 
ATOM   2376 C CD2   . LEU A 1 315 ? 34.073  -6.652  9.663   1.00 48.95  ? 315 LEU A CD2   1 
ATOM   2377 N N     . ILE A 1 316 ? 29.267  -4.925  7.703   1.00 53.69  ? 316 ILE A N     1 
ATOM   2378 C CA    . ILE A 1 316 ? 27.820  -4.825  7.607   1.00 55.19  ? 316 ILE A CA    1 
ATOM   2379 C C     . ILE A 1 316 ? 27.288  -5.851  6.617   1.00 59.39  ? 316 ILE A C     1 
ATOM   2380 O O     . ILE A 1 316 ? 26.285  -6.527  6.876   1.00 61.40  ? 316 ILE A O     1 
ATOM   2381 C CB    . ILE A 1 316 ? 27.431  -3.394  7.208   1.00 54.02  ? 316 ILE A CB    1 
ATOM   2382 C CG1   . ILE A 1 316 ? 27.491  -2.485  8.422   1.00 49.02  ? 316 ILE A CG1   1 
ATOM   2383 C CG2   . ILE A 1 316 ? 26.061  -3.372  6.621   1.00 53.20  ? 316 ILE A CG2   1 
ATOM   2384 C CD1   . ILE A 1 316 ? 26.405  -2.801  9.405   1.00 56.23  ? 316 ILE A CD1   1 
ATOM   2385 N N     . ASN A 1 317 ? 27.968  -6.003  5.478   1.00 56.94  ? 317 ASN A N     1 
ATOM   2386 C CA    . ASN A 1 317 ? 27.443  -6.834  4.405   1.00 57.98  ? 317 ASN A CA    1 
ATOM   2387 C C     . ASN A 1 317 ? 27.451  -8.311  4.747   1.00 59.43  ? 317 ASN A C     1 
ATOM   2388 O O     . ASN A 1 317 ? 26.792  -9.084  4.048   1.00 63.46  ? 317 ASN A O     1 
ATOM   2389 C CB    . ASN A 1 317 ? 28.239  -6.618  3.113   1.00 61.06  ? 317 ASN A CB    1 
ATOM   2390 C CG    . ASN A 1 317 ? 27.838  -5.335  2.364   1.00 64.88  ? 317 ASN A CG    1 
ATOM   2391 O OD1   . ASN A 1 317 ? 27.024  -4.526  2.838   1.00 64.24  ? 317 ASN A OD1   1 
ATOM   2392 N ND2   . ASN A 1 317 ? 28.434  -5.142  1.195   1.00 61.59  ? 317 ASN A ND2   1 
ATOM   2393 N N     . THR A 1 318 ? 28.162  -8.725  5.794   1.00 57.67  ? 318 THR A N     1 
ATOM   2394 C CA    . THR A 1 318 ? 28.359  -10.152 6.022   1.00 56.92  ? 318 THR A CA    1 
ATOM   2395 C C     . THR A 1 318 ? 28.036  -10.583 7.452   1.00 59.46  ? 318 THR A C     1 
ATOM   2396 O O     . THR A 1 318 ? 27.633  -11.725 7.682   1.00 58.97  ? 318 THR A O     1 
ATOM   2397 C CB    . THR A 1 318 ? 29.803  -10.546 5.673   1.00 55.63  ? 318 THR A CB    1 
ATOM   2398 O OG1   . THR A 1 318 ? 30.694  -10.013 6.653   1.00 54.74  ? 318 THR A OG1   1 
ATOM   2399 C CG2   . THR A 1 318 ? 30.209  -9.992  4.316   1.00 53.20  ? 318 THR A CG2   1 
ATOM   2400 N N     . GLY A 1 319 ? 28.203  -9.691  8.421   1.00 60.84  ? 319 GLY A N     1 
ATOM   2401 C CA    . GLY A 1 319 ? 28.049  -10.080 9.806   1.00 58.10  ? 319 GLY A CA    1 
ATOM   2402 C C     . GLY A 1 319 ? 26.667  -10.627 10.121  1.00 61.79  ? 319 GLY A C     1 
ATOM   2403 O O     . GLY A 1 319 ? 25.691  -10.435 9.391   1.00 60.18  ? 319 GLY A O     1 
ATOM   2404 N N     . ASP A 1 320 ? 26.604  -11.327 11.251  1.00 64.36  ? 320 ASP A N     1 
ATOM   2405 C CA    . ASP A 1 320 ? 25.377  -11.903 11.780  1.00 61.14  ? 320 ASP A CA    1 
ATOM   2406 C C     . ASP A 1 320 ? 24.842  -10.987 12.871  1.00 67.46  ? 320 ASP A C     1 
ATOM   2407 O O     . ASP A 1 320 ? 25.569  -10.668 13.818  1.00 71.05  ? 320 ASP A O     1 
ATOM   2408 C CB    . ASP A 1 320 ? 25.652  -13.295 12.348  1.00 66.41  ? 320 ASP A CB    1 
ATOM   2409 C CG    . ASP A 1 320 ? 24.393  -13.995 12.813  1.00 72.89  ? 320 ASP A CG    1 
ATOM   2410 O OD1   . ASP A 1 320 ? 23.320  -13.707 12.250  1.00 74.59  ? 320 ASP A OD1   1 
ATOM   2411 O OD2   . ASP A 1 320 ? 24.473  -14.838 13.733  1.00 77.96  ? 320 ASP A OD2   1 
ATOM   2412 N N     . PHE A 1 321 ? 23.581  -10.571 12.744  1.00 66.26  ? 321 PHE A N     1 
ATOM   2413 C CA    . PHE A 1 321 ? 23.012  -9.531  13.599  1.00 65.41  ? 321 PHE A CA    1 
ATOM   2414 C C     . PHE A 1 321 ? 21.641  -9.919  14.137  1.00 69.01  ? 321 PHE A C     1 
ATOM   2415 O O     . PHE A 1 321 ? 20.759  -9.067  14.267  1.00 68.02  ? 321 PHE A O     1 
ATOM   2416 C CB    . PHE A 1 321 ? 22.870  -8.196  12.860  1.00 64.38  ? 321 PHE A CB    1 
ATOM   2417 C CG    . PHE A 1 321 ? 24.138  -7.669  12.270  1.00 61.20  ? 321 PHE A CG    1 
ATOM   2418 C CD1   . PHE A 1 321 ? 25.158  -7.212  13.082  1.00 57.68  ? 321 PHE A CD1   1 
ATOM   2419 C CD2   . PHE A 1 321 ? 24.292  -7.600  10.892  1.00 59.77  ? 321 PHE A CD2   1 
ATOM   2420 C CE1   . PHE A 1 321 ? 26.312  -6.721  12.538  1.00 53.64  ? 321 PHE A CE1   1 
ATOM   2421 C CE2   . PHE A 1 321 ? 25.449  -7.105  10.340  1.00 59.02  ? 321 PHE A CE2   1 
ATOM   2422 C CZ    . PHE A 1 321 ? 26.462  -6.668  11.166  1.00 57.41  ? 321 PHE A CZ    1 
ATOM   2423 N N     . GLN A 1 322 ? 21.433  -11.191 14.486  1.00 71.04  ? 322 GLN A N     1 
ATOM   2424 C CA    . GLN A 1 322 ? 20.108  -11.594 14.962  1.00 69.96  ? 322 GLN A CA    1 
ATOM   2425 C C     . GLN A 1 322 ? 19.830  -11.121 16.372  1.00 67.08  ? 322 GLN A C     1 
ATOM   2426 O O     . GLN A 1 322 ? 18.667  -10.918 16.740  1.00 72.57  ? 322 GLN A O     1 
ATOM   2427 C CB    . GLN A 1 322 ? 19.964  -13.097 14.886  1.00 71.24  ? 322 GLN A CB    1 
ATOM   2428 C CG    . GLN A 1 322 ? 20.632  -13.611 13.659  1.00 81.29  ? 322 GLN A CG    1 
ATOM   2429 C CD    . GLN A 1 322 ? 20.191  -15.001 13.308  1.00 84.19  ? 322 GLN A CD    1 
ATOM   2430 O OE1   . GLN A 1 322 ? 19.329  -15.196 12.461  1.00 87.89  ? 322 GLN A OE1   1 
ATOM   2431 N NE2   . GLN A 1 322 ? 20.757  -15.980 13.986  1.00 85.99  ? 322 GLN A NE2   1 
ATOM   2432 N N     . ASP A 1 323 ? 20.868  -10.942 17.179  1.00 64.72  ? 323 ASP A N     1 
ATOM   2433 C CA    . ASP A 1 323 ? 20.668  -10.438 18.528  1.00 70.61  ? 323 ASP A CA    1 
ATOM   2434 C C     . ASP A 1 323 ? 20.513  -8.923  18.571  1.00 70.79  ? 323 ASP A C     1 
ATOM   2435 O O     . ASP A 1 323 ? 20.278  -8.374  19.653  1.00 69.51  ? 323 ASP A O     1 
ATOM   2436 C CB    . ASP A 1 323 ? 21.829  -10.882 19.425  1.00 71.61  ? 323 ASP A CB    1 
ATOM   2437 C CG    . ASP A 1 323 ? 23.200  -10.460 18.887  1.00 78.81  ? 323 ASP A CG    1 
ATOM   2438 O OD1   . ASP A 1 323 ? 23.393  -10.437 17.646  1.00 75.06  ? 323 ASP A OD1   1 
ATOM   2439 O OD2   . ASP A 1 323 ? 24.092  -10.156 19.717  1.00 83.60  ? 323 ASP A OD2   1 
ATOM   2440 N N     . LEU A 1 324 ? 20.628  -8.231  17.439  1.00 71.38  ? 324 LEU A N     1 
ATOM   2441 C CA    . LEU A 1 324 ? 20.643  -6.776  17.448  1.00 64.86  ? 324 LEU A CA    1 
ATOM   2442 C C     . LEU A 1 324 ? 19.239  -6.214  17.297  1.00 59.08  ? 324 LEU A C     1 
ATOM   2443 O O     . LEU A 1 324 ? 18.433  -6.706  16.505  1.00 59.33  ? 324 LEU A O     1 
ATOM   2444 C CB    . LEU A 1 324 ? 21.542  -6.228  16.343  1.00 58.92  ? 324 LEU A CB    1 
ATOM   2445 C CG    . LEU A 1 324 ? 22.061  -4.832  16.683  1.00 55.84  ? 324 LEU A CG    1 
ATOM   2446 C CD1   . LEU A 1 324 ? 22.970  -4.893  17.880  1.00 50.71  ? 324 LEU A CD1   1 
ATOM   2447 C CD2   . LEU A 1 324 ? 22.797  -4.257  15.494  1.00 59.93  ? 324 LEU A CD2   1 
ATOM   2448 N N     . GLN A 1 325 ? 18.954  -5.181  18.080  1.00 56.86  ? 325 GLN A N     1 
ATOM   2449 C CA    . GLN A 1 325 ? 17.744  -4.390  17.935  1.00 54.89  ? 325 GLN A CA    1 
ATOM   2450 C C     . GLN A 1 325 ? 18.156  -2.927  17.857  1.00 55.73  ? 325 GLN A C     1 
ATOM   2451 O O     . GLN A 1 325 ? 18.786  -2.409  18.788  1.00 54.21  ? 325 GLN A O     1 
ATOM   2452 C CB    . GLN A 1 325 ? 16.796  -4.633  19.102  1.00 54.25  ? 325 GLN A CB    1 
ATOM   2453 C CG    . GLN A 1 325 ? 16.558  -6.089  19.351  1.00 62.18  ? 325 GLN A CG    1 
ATOM   2454 C CD    . GLN A 1 325 ? 15.687  -6.331  20.559  1.00 62.78  ? 325 GLN A CD    1 
ATOM   2455 O OE1   . GLN A 1 325 ? 14.533  -6.749  20.426  1.00 62.40  ? 325 GLN A OE1   1 
ATOM   2456 N NE2   . GLN A 1 325 ? 16.231  -6.068  21.751  1.00 58.99  ? 325 GLN A NE2   1 
ATOM   2457 N N     . VAL A 1 326 ? 17.809  -2.267  16.749  1.00 49.11  ? 326 VAL A N     1 
ATOM   2458 C CA    . VAL A 1 326 ? 18.261  -0.916  16.448  1.00 45.52  ? 326 VAL A CA    1 
ATOM   2459 C C     . VAL A 1 326 ? 17.073  -0.040  16.101  1.00 47.26  ? 326 VAL A C     1 
ATOM   2460 O O     . VAL A 1 326 ? 16.102  -0.484  15.480  1.00 49.32  ? 326 VAL A O     1 
ATOM   2461 C CB    . VAL A 1 326 ? 19.266  -0.874  15.273  1.00 47.56  ? 326 VAL A CB    1 
ATOM   2462 C CG1   . VAL A 1 326 ? 20.655  -1.271  15.709  1.00 49.72  ? 326 VAL A CG1   1 
ATOM   2463 C CG2   . VAL A 1 326 ? 18.784  -1.772  14.126  1.00 48.73  ? 326 VAL A CG2   1 
ATOM   2464 N N     . LEU A 1 327 ? 17.173  1.225   16.474  1.00 45.63  ? 327 LEU A N     1 
ATOM   2465 C CA    . LEU A 1 327 ? 16.324  2.275   15.940  1.00 45.70  ? 327 LEU A CA    1 
ATOM   2466 C C     . LEU A 1 327 ? 17.208  3.204   15.116  1.00 44.98  ? 327 LEU A C     1 
ATOM   2467 O O     . LEU A 1 327 ? 18.257  3.636   15.602  1.00 45.09  ? 327 LEU A O     1 
ATOM   2468 C CB    . LEU A 1 327 ? 15.627  3.015   17.075  1.00 41.96  ? 327 LEU A CB    1 
ATOM   2469 C CG    . LEU A 1 327 ? 14.588  4.018   16.621  1.00 48.98  ? 327 LEU A CG    1 
ATOM   2470 C CD1   . LEU A 1 327 ? 13.287  3.655   17.274  1.00 55.00  ? 327 LEU A CD1   1 
ATOM   2471 C CD2   . LEU A 1 327 ? 15.011  5.409   17.002  1.00 46.97  ? 327 LEU A CD2   1 
ATOM   2472 N N     . VAL A 1 328 ? 16.819  3.475   13.858  1.00 46.24  ? 328 VAL A N     1 
ATOM   2473 C CA    . VAL A 1 328 ? 17.603  4.299   12.934  1.00 41.54  ? 328 VAL A CA    1 
ATOM   2474 C C     . VAL A 1 328 ? 16.691  5.287   12.232  1.00 40.57  ? 328 VAL A C     1 
ATOM   2475 O O     . VAL A 1 328 ? 15.529  4.994   11.945  1.00 43.59  ? 328 VAL A O     1 
ATOM   2476 C CB    . VAL A 1 328 ? 18.348  3.472   11.864  1.00 43.35  ? 328 VAL A CB    1 
ATOM   2477 C CG1   . VAL A 1 328 ? 19.280  2.450   12.508  1.00 45.57  ? 328 VAL A CG1   1 
ATOM   2478 C CG2   . VAL A 1 328 ? 17.361  2.818   10.903  1.00 33.95  ? 328 VAL A CG2   1 
ATOM   2479 N N     . GLY A 1 329 ? 17.227  6.452   11.917  1.00 41.67  ? 329 GLY A N     1 
ATOM   2480 C CA    . GLY A 1 329 ? 16.414  7.403   11.184  1.00 41.43  ? 329 GLY A CA    1 
ATOM   2481 C C     . GLY A 1 329 ? 17.210  8.625   10.801  1.00 41.94  ? 329 GLY A C     1 
ATOM   2482 O O     . GLY A 1 329 ? 18.414  8.721   11.064  1.00 43.17  ? 329 GLY A O     1 
ATOM   2483 N N     . VAL A 1 330 ? 16.502  9.571   10.178  1.00 38.65  ? 330 VAL A N     1 
ATOM   2484 C CA    . VAL A 1 330 ? 17.106  10.719  9.517   1.00 34.62  ? 330 VAL A CA    1 
ATOM   2485 C C     . VAL A 1 330 ? 16.171  11.900  9.706   1.00 35.64  ? 330 VAL A C     1 
ATOM   2486 O O     . VAL A 1 330 ? 14.983  11.743  9.990   1.00 37.23  ? 330 VAL A O     1 
ATOM   2487 C CB    . VAL A 1 330 ? 17.352  10.475  7.997   1.00 43.54  ? 330 VAL A CB    1 
ATOM   2488 C CG1   . VAL A 1 330 ? 18.289  9.292   7.748   1.00 39.43  ? 330 VAL A CG1   1 
ATOM   2489 C CG2   . VAL A 1 330 ? 16.030  10.260  7.255   1.00 39.66  ? 330 VAL A CG2   1 
ATOM   2490 N N     . VAL A 1 331 ? 16.715  13.101  9.540   1.00 35.95  ? 331 VAL A N     1 
ATOM   2491 C CA    . VAL A 1 331 ? 15.847  14.270  9.500   1.00 37.73  ? 331 VAL A CA    1 
ATOM   2492 C C     . VAL A 1 331 ? 15.536  14.580  8.044   1.00 45.05  ? 331 VAL A C     1 
ATOM   2493 O O     . VAL A 1 331 ? 16.125  13.997  7.118   1.00 42.53  ? 331 VAL A O     1 
ATOM   2494 C CB    . VAL A 1 331 ? 16.459  15.493  10.195  1.00 38.04  ? 331 VAL A CB    1 
ATOM   2495 C CG1   . VAL A 1 331 ? 16.732  15.193  11.681  1.00 42.17  ? 331 VAL A CG1   1 
ATOM   2496 C CG2   . VAL A 1 331 ? 17.704  15.921  9.480   1.00 41.22  ? 331 VAL A CG2   1 
ATOM   2497 N N     . LYS A 1 332 ? 14.598  15.501  7.840   1.00 41.68  ? 332 LYS A N     1 
ATOM   2498 C CA    . LYS A 1 332 ? 14.083  15.739  6.502   1.00 44.66  ? 332 LYS A CA    1 
ATOM   2499 C C     . LYS A 1 332 ? 15.156  16.315  5.583   1.00 42.22  ? 332 LYS A C     1 
ATOM   2500 O O     . LYS A 1 332 ? 15.311  15.862  4.448   1.00 36.36  ? 332 LYS A O     1 
ATOM   2501 C CB    . LYS A 1 332 ? 12.872  16.661  6.588   1.00 44.88  ? 332 LYS A CB    1 
ATOM   2502 C CG    . LYS A 1 332 ? 12.345  17.104  5.261   1.00 45.04  ? 332 LYS A CG    1 
ATOM   2503 C CD    . LYS A 1 332 ? 10.858  16.920  5.203   1.00 51.84  ? 332 LYS A CD    1 
ATOM   2504 C CE    . LYS A 1 332 ? 10.548  15.574  4.537   1.00 63.28  ? 332 LYS A CE    1 
ATOM   2505 N NZ    . LYS A 1 332 ? 9.084   15.177  4.521   1.00 61.75  ? 332 LYS A NZ    1 
ATOM   2506 N N     . ASP A 1 333 ? 15.942  17.264  6.081   1.00 44.56  ? 333 ASP A N     1 
ATOM   2507 C CA    . ASP A 1 333 ? 16.889  18.033  5.281   1.00 41.21  ? 333 ASP A CA    1 
ATOM   2508 C C     . ASP A 1 333 ? 18.298  17.860  5.844   1.00 42.85  ? 333 ASP A C     1 
ATOM   2509 O O     . ASP A 1 333 ? 18.890  18.800  6.391   1.00 46.44  ? 333 ASP A O     1 
ATOM   2510 C CB    . ASP A 1 333 ? 16.465  19.465  5.268   1.00 42.41  ? 333 ASP A CB    1 
ATOM   2511 C CG    . ASP A 1 333 ? 15.065  19.638  4.717   1.00 46.24  ? 333 ASP A CG    1 
ATOM   2512 O OD1   . ASP A 1 333 ? 14.114  19.772  5.535   1.00 45.09  ? 333 ASP A OD1   1 
ATOM   2513 O OD2   . ASP A 1 333 ? 14.928  19.626  3.463   1.00 42.49  ? 333 ASP A OD2   1 
ATOM   2514 N N     . GLU A 1 334 ? 18.843  16.653  5.685   1.00 41.71  ? 334 GLU A N     1 
ATOM   2515 C CA    . GLU A 1 334 ? 20.140  16.326  6.269   1.00 39.97  ? 334 GLU A CA    1 
ATOM   2516 C C     . GLU A 1 334 ? 21.264  17.211  5.732   1.00 44.46  ? 334 GLU A C     1 
ATOM   2517 O O     . GLU A 1 334 ? 22.205  17.531  6.471   1.00 46.01  ? 334 GLU A O     1 
ATOM   2518 C CB    . GLU A 1 334 ? 20.470  14.855  6.010   1.00 39.00  ? 334 GLU A CB    1 
ATOM   2519 C CG    . GLU A 1 334 ? 19.624  13.863  6.766   1.00 38.24  ? 334 GLU A CG    1 
ATOM   2520 C CD    . GLU A 1 334 ? 19.977  13.808  8.249   1.00 43.29  ? 334 GLU A CD    1 
ATOM   2521 O OE1   . GLU A 1 334 ? 19.186  13.217  9.022   1.00 41.18  ? 334 GLU A OE1   1 
ATOM   2522 O OE2   . GLU A 1 334 ? 21.034  14.362  8.638   1.00 42.09  ? 334 GLU A OE2   1 
ATOM   2523 N N     . GLY A 1 335 ? 21.190  17.623  4.462   1.00 37.55  ? 335 GLY A N     1 
ATOM   2524 C CA    . GLY A 1 335 ? 22.325  18.279  3.856   1.00 38.70  ? 335 GLY A CA    1 
ATOM   2525 C C     . GLY A 1 335 ? 22.320  19.793  3.830   1.00 43.44  ? 335 GLY A C     1 
ATOM   2526 O O     . GLY A 1 335 ? 23.369  20.397  3.583   1.00 48.06  ? 335 GLY A O     1 
ATOM   2527 N N     . SER A 1 336 ? 21.166  20.422  4.068   1.00 40.31  ? 336 SER A N     1 
ATOM   2528 C CA    . SER A 1 336 ? 21.080  21.879  3.956   1.00 40.53  ? 336 SER A CA    1 
ATOM   2529 C C     . SER A 1 336 ? 22.099  22.582  4.842   1.00 43.48  ? 336 SER A C     1 
ATOM   2530 O O     . SER A 1 336 ? 22.711  23.571  4.424   1.00 45.61  ? 336 SER A O     1 
ATOM   2531 C CB    . SER A 1 336 ? 19.676  22.354  4.312   1.00 41.97  ? 336 SER A CB    1 
ATOM   2532 O OG    . SER A 1 336 ? 19.329  21.996  5.644   1.00 46.14  ? 336 SER A OG    1 
ATOM   2533 N N     . TYR A 1 337 ? 22.281  22.090  6.072   1.00 42.83  ? 337 TYR A N     1 
ATOM   2534 C CA    . TYR A 1 337 ? 23.207  22.698  7.026   1.00 46.38  ? 337 TYR A CA    1 
ATOM   2535 C C     . TYR A 1 337 ? 24.602  22.851  6.436   1.00 47.22  ? 337 TYR A C     1 
ATOM   2536 O O     . TYR A 1 337 ? 25.248  23.889  6.602   1.00 47.59  ? 337 TYR A O     1 
ATOM   2537 C CB    . TYR A 1 337 ? 23.248  21.832  8.288   1.00 46.87  ? 337 TYR A CB    1 
ATOM   2538 C CG    . TYR A 1 337 ? 23.851  22.441  9.531   1.00 51.52  ? 337 TYR A CG    1 
ATOM   2539 C CD1   . TYR A 1 337 ? 23.204  22.332  10.752  1.00 53.00  ? 337 TYR A CD1   1 
ATOM   2540 C CD2   . TYR A 1 337 ? 25.086  23.068  9.504   1.00 59.94  ? 337 TYR A CD2   1 
ATOM   2541 C CE1   . TYR A 1 337 ? 23.750  22.868  11.904  1.00 57.29  ? 337 TYR A CE1   1 
ATOM   2542 C CE2   . TYR A 1 337 ? 25.648  23.617  10.646  1.00 60.42  ? 337 TYR A CE2   1 
ATOM   2543 C CZ    . TYR A 1 337 ? 24.980  23.513  11.846  1.00 65.21  ? 337 TYR A CZ    1 
ATOM   2544 O OH    . TYR A 1 337 ? 25.554  24.051  12.990  1.00 64.74  ? 337 TYR A OH    1 
ATOM   2545 N N     . PHE A 1 338 ? 25.076  21.830  5.725   1.00 50.36  ? 338 PHE A N     1 
ATOM   2546 C CA    . PHE A 1 338 ? 26.467  21.780  5.300   1.00 48.47  ? 338 PHE A CA    1 
ATOM   2547 C C     . PHE A 1 338 ? 26.763  22.689  4.120   1.00 50.37  ? 338 PHE A C     1 
ATOM   2548 O O     . PHE A 1 338 ? 27.936  23.000  3.871   1.00 49.69  ? 338 PHE A O     1 
ATOM   2549 C CB    . PHE A 1 338 ? 26.839  20.336  4.977   1.00 44.13  ? 338 PHE A CB    1 
ATOM   2550 C CG    . PHE A 1 338 ? 26.782  19.444  6.167   1.00 50.41  ? 338 PHE A CG    1 
ATOM   2551 C CD1   . PHE A 1 338 ? 25.606  18.784  6.501   1.00 50.60  ? 338 PHE A CD1   1 
ATOM   2552 C CD2   . PHE A 1 338 ? 27.890  19.310  7.001   1.00 52.01  ? 338 PHE A CD2   1 
ATOM   2553 C CE1   . PHE A 1 338 ? 25.546  17.985  7.631   1.00 45.59  ? 338 PHE A CE1   1 
ATOM   2554 C CE2   . PHE A 1 338 ? 27.837  18.511  8.110   1.00 46.51  ? 338 PHE A CE2   1 
ATOM   2555 C CZ    . PHE A 1 338 ? 26.666  17.843  8.424   1.00 45.52  ? 338 PHE A CZ    1 
ATOM   2556 N N     . LEU A 1 339 ? 25.730  23.142  3.411   1.00 50.00  ? 339 LEU A N     1 
ATOM   2557 C CA    . LEU A 1 339 ? 25.960  23.926  2.209   1.00 47.64  ? 339 LEU A CA    1 
ATOM   2558 C C     . LEU A 1 339 ? 26.649  25.250  2.512   1.00 52.44  ? 339 LEU A C     1 
ATOM   2559 O O     . LEU A 1 339 ? 27.468  25.707  1.703   1.00 51.68  ? 339 LEU A O     1 
ATOM   2560 C CB    . LEU A 1 339 ? 24.640  24.148  1.499   1.00 47.18  ? 339 LEU A CB    1 
ATOM   2561 C CG    . LEU A 1 339 ? 24.006  22.801  1.178   1.00 50.34  ? 339 LEU A CG    1 
ATOM   2562 C CD1   . LEU A 1 339 ? 22.736  23.013  0.378   1.00 48.72  ? 339 LEU A CD1   1 
ATOM   2563 C CD2   . LEU A 1 339 ? 24.989  21.918  0.421   1.00 48.15  ? 339 LEU A CD2   1 
ATOM   2564 N N     . VAL A 1 340 ? 26.373  25.857  3.679   1.00 51.04  ? 340 VAL A N     1 
ATOM   2565 C CA    . VAL A 1 340 ? 26.846  27.212  3.971   1.00 51.86  ? 340 VAL A CA    1 
ATOM   2566 C C     . VAL A 1 340 ? 28.267  27.182  4.512   1.00 50.61  ? 340 VAL A C     1 
ATOM   2567 O O     . VAL A 1 340 ? 28.827  28.218  4.877   1.00 52.58  ? 340 VAL A O     1 
ATOM   2568 C CB    . VAL A 1 340 ? 25.912  27.942  4.947   1.00 48.76  ? 340 VAL A CB    1 
ATOM   2569 C CG1   . VAL A 1 340 ? 24.510  28.008  4.375   1.00 52.35  ? 340 VAL A CG1   1 
ATOM   2570 C CG2   . VAL A 1 340 ? 25.906  27.240  6.265   1.00 50.21  ? 340 VAL A CG2   1 
ATOM   2571 N N     . TYR A 1 341 ? 28.869  26.003  4.535   1.00 49.00  ? 341 TYR A N     1 
ATOM   2572 C CA    . TYR A 1 341 ? 30.237  25.842  5.004   1.00 53.09  ? 341 TYR A CA    1 
ATOM   2573 C C     . TYR A 1 341 ? 31.204  25.485  3.881   1.00 59.17  ? 341 TYR A C     1 
ATOM   2574 O O     . TYR A 1 341 ? 32.180  24.770  4.117   1.00 62.27  ? 341 TYR A O     1 
ATOM   2575 C CB    . TYR A 1 341 ? 30.314  24.767  6.085   1.00 58.26  ? 341 TYR A CB    1 
ATOM   2576 C CG    . TYR A 1 341 ? 29.809  25.182  7.431   1.00 57.47  ? 341 TYR A CG    1 
ATOM   2577 C CD1   . TYR A 1 341 ? 28.460  25.142  7.727   1.00 55.90  ? 341 TYR A CD1   1 
ATOM   2578 C CD2   . TYR A 1 341 ? 30.690  25.590  8.418   1.00 63.12  ? 341 TYR A CD2   1 
ATOM   2579 C CE1   . TYR A 1 341 ? 27.999  25.516  8.970   1.00 63.15  ? 341 TYR A CE1   1 
ATOM   2580 C CE2   . TYR A 1 341 ? 30.245  25.960  9.655   1.00 62.51  ? 341 TYR A CE2   1 
ATOM   2581 C CZ    . TYR A 1 341 ? 28.896  25.923  9.931   1.00 64.77  ? 341 TYR A CZ    1 
ATOM   2582 O OH    . TYR A 1 341 ? 28.436  26.294  11.172  1.00 70.32  ? 341 TYR A OH    1 
ATOM   2583 N N     . GLY A 1 342 ? 30.958  25.955  2.657   1.00 58.62  ? 342 GLY A N     1 
ATOM   2584 C CA    . GLY A 1 342 ? 31.879  25.610  1.591   1.00 54.65  ? 342 GLY A CA    1 
ATOM   2585 C C     . GLY A 1 342 ? 31.353  25.689  0.171   1.00 59.16  ? 342 GLY A C     1 
ATOM   2586 O O     . GLY A 1 342 ? 32.133  25.944  -0.755  1.00 60.75  ? 342 GLY A O     1 
ATOM   2587 N N     . VAL A 1 343 ? 30.059  25.471  -0.041  1.00 54.71  ? 343 VAL A N     1 
ATOM   2588 C CA    . VAL A 1 343 ? 29.550  25.596  -1.406  1.00 55.24  ? 343 VAL A CA    1 
ATOM   2589 C C     . VAL A 1 343 ? 29.267  27.067  -1.696  1.00 55.30  ? 343 VAL A C     1 
ATOM   2590 O O     . VAL A 1 343 ? 28.415  27.671  -1.027  1.00 55.07  ? 343 VAL A O     1 
ATOM   2591 C CB    . VAL A 1 343 ? 28.304  24.731  -1.644  1.00 51.06  ? 343 VAL A CB    1 
ATOM   2592 C CG1   . VAL A 1 343 ? 27.917  24.806  -3.102  1.00 49.98  ? 343 VAL A CG1   1 
ATOM   2593 C CG2   . VAL A 1 343 ? 28.564  23.273  -1.235  1.00 50.73  ? 343 VAL A CG2   1 
ATOM   2594 N N     . PRO A 1 344 ? 29.943  27.678  -2.681  1.00 59.84  ? 344 PRO A N     1 
ATOM   2595 C CA    . PRO A 1 344 ? 29.685  29.095  -2.988  1.00 56.70  ? 344 PRO A CA    1 
ATOM   2596 C C     . PRO A 1 344 ? 28.282  29.318  -3.546  1.00 53.48  ? 344 PRO A C     1 
ATOM   2597 O O     . PRO A 1 344 ? 27.795  28.557  -4.386  1.00 54.26  ? 344 PRO A O     1 
ATOM   2598 C CB    . PRO A 1 344 ? 30.767  29.436  -4.025  1.00 52.08  ? 344 PRO A CB    1 
ATOM   2599 C CG    . PRO A 1 344 ? 31.789  28.321  -3.930  1.00 47.00  ? 344 PRO A CG    1 
ATOM   2600 C CD    . PRO A 1 344 ? 30.994  27.116  -3.553  1.00 53.39  ? 344 PRO A CD    1 
ATOM   2601 N N     . GLY A 1 345 ? 27.643  30.391  -3.077  1.00 49.12  ? 345 GLY A N     1 
ATOM   2602 C CA    . GLY A 1 345 ? 26.253  30.686  -3.360  1.00 47.16  ? 345 GLY A CA    1 
ATOM   2603 C C     . GLY A 1 345 ? 25.342  30.509  -2.165  1.00 52.46  ? 345 GLY A C     1 
ATOM   2604 O O     . GLY A 1 345 ? 24.200  30.985  -2.190  1.00 52.74  ? 345 GLY A O     1 
ATOM   2605 N N     . PHE A 1 346 ? 25.816  29.859  -1.107  1.00 58.19  ? 346 PHE A N     1 
ATOM   2606 C CA    . PHE A 1 346 ? 24.986  29.526  0.041   1.00 57.00  ? 346 PHE A CA    1 
ATOM   2607 C C     . PHE A 1 346 ? 25.372  30.373  1.245   1.00 55.57  ? 346 PHE A C     1 
ATOM   2608 O O     . PHE A 1 346 ? 26.560  30.598  1.506   1.00 54.30  ? 346 PHE A O     1 
ATOM   2609 C CB    . PHE A 1 346 ? 25.093  28.035  0.366   1.00 51.33  ? 346 PHE A CB    1 
ATOM   2610 C CG    . PHE A 1 346 ? 24.528  27.155  -0.715  1.00 51.91  ? 346 PHE A CG    1 
ATOM   2611 C CD1   . PHE A 1 346 ? 25.318  26.751  -1.790  1.00 50.52  ? 346 PHE A CD1   1 
ATOM   2612 C CD2   . PHE A 1 346 ? 23.201  26.761  -0.679  1.00 49.18  ? 346 PHE A CD2   1 
ATOM   2613 C CE1   . PHE A 1 346 ? 24.798  25.954  -2.801  1.00 47.83  ? 346 PHE A CE1   1 
ATOM   2614 C CE2   . PHE A 1 346 ? 22.672  25.960  -1.687  1.00 50.06  ? 346 PHE A CE2   1 
ATOM   2615 C CZ    . PHE A 1 346 ? 23.478  25.554  -2.752  1.00 48.28  ? 346 PHE A CZ    1 
ATOM   2616 N N     . SER A 1 347 ? 24.349  30.867  1.945   1.00 54.31  ? 347 SER A N     1 
ATOM   2617 C CA    . SER A 1 347 ? 24.512  31.588  3.198   1.00 59.20  ? 347 SER A CA    1 
ATOM   2618 C C     . SER A 1 347 ? 23.288  31.356  4.073   1.00 60.44  ? 347 SER A C     1 
ATOM   2619 O O     . SER A 1 347 ? 22.204  31.015  3.589   1.00 63.77  ? 347 SER A O     1 
ATOM   2620 C CB    . SER A 1 347 ? 24.706  33.091  2.978   1.00 58.77  ? 347 SER A CB    1 
ATOM   2621 O OG    . SER A 1 347 ? 24.860  33.756  4.225   1.00 62.57  ? 347 SER A OG    1 
ATOM   2622 N N     . LYS A 1 348 ? 23.467  31.554  5.377   1.00 58.14  ? 348 LYS A N     1 
ATOM   2623 C CA    . LYS A 1 348 ? 22.310  31.560  6.257   1.00 60.46  ? 348 LYS A CA    1 
ATOM   2624 C C     . LYS A 1 348 ? 21.491  32.830  6.111   1.00 60.99  ? 348 LYS A C     1 
ATOM   2625 O O     . LYS A 1 348 ? 20.368  32.885  6.622   1.00 61.62  ? 348 LYS A O     1 
ATOM   2626 C CB    . LYS A 1 348 ? 22.743  31.396  7.720   1.00 58.72  ? 348 LYS A CB    1 
ATOM   2627 C CG    . LYS A 1 348 ? 22.983  32.701  8.468   1.00 58.68  ? 348 LYS A CG    1 
ATOM   2628 C CD    . LYS A 1 348 ? 23.293  32.429  9.937   1.00 58.73  ? 348 LYS A CD    1 
ATOM   2629 C CE    . LYS A 1 348 ? 23.571  33.699  10.735  1.00 56.10  ? 348 LYS A CE    1 
ATOM   2630 N NZ    . LYS A 1 348 ? 22.351  34.468  11.105  1.00 59.79  ? 348 LYS A NZ    1 
ATOM   2631 N N     . ASP A 1 349 ? 22.012  33.834  5.407   1.00 60.76  ? 349 ASP A N     1 
ATOM   2632 C CA    . ASP A 1 349 ? 21.475  35.183  5.478   1.00 61.08  ? 349 ASP A CA    1 
ATOM   2633 C C     . ASP A 1 349 ? 20.685  35.617  4.258   1.00 63.19  ? 349 ASP A C     1 
ATOM   2634 O O     . ASP A 1 349 ? 19.764  36.422  4.409   1.00 66.92  ? 349 ASP A O     1 
ATOM   2635 C CB    . ASP A 1 349 ? 22.606  36.178  5.737   1.00 58.04  ? 349 ASP A CB    1 
ATOM   2636 C CG    . ASP A 1 349 ? 23.175  36.038  7.139   1.00 66.55  ? 349 ASP A CG    1 
ATOM   2637 O OD1   . ASP A 1 349 ? 22.382  35.886  8.111   1.00 58.66  ? 349 ASP A OD1   1 
ATOM   2638 O OD2   . ASP A 1 349 ? 24.417  36.060  7.262   1.00 68.86  ? 349 ASP A OD2   1 
ATOM   2639 N N     . ASN A 1 350 ? 21.017  35.126  3.061   1.00 62.21  ? 350 ASN A N     1 
ATOM   2640 C CA    . ASN A 1 350 ? 20.152  35.289  1.906   1.00 55.79  ? 350 ASN A CA    1 
ATOM   2641 C C     . ASN A 1 350 ? 19.463  33.946  1.665   1.00 59.52  ? 350 ASN A C     1 
ATOM   2642 O O     . ASN A 1 350 ? 19.548  33.029  2.494   1.00 59.89  ? 350 ASN A O     1 
ATOM   2643 C CB    . ASN A 1 350 ? 20.938  35.840  0.699   1.00 52.45  ? 350 ASN A CB    1 
ATOM   2644 C CG    . ASN A 1 350 ? 22.019  34.902  0.192   1.00 55.56  ? 350 ASN A CG    1 
ATOM   2645 O OD1   . ASN A 1 350 ? 21.794  33.704  0.064   1.00 61.93  ? 350 ASN A OD1   1 
ATOM   2646 N ND2   . ASN A 1 350 ? 23.195  35.451  -0.136  1.00 48.46  ? 350 ASN A ND2   1 
ATOM   2647 N N     . GLU A 1 351 ? 18.758  33.816  0.542   1.00 56.15  ? 351 GLU A N     1 
ATOM   2648 C CA    . GLU A 1 351 ? 17.958  32.623  0.293   1.00 54.31  ? 351 GLU A CA    1 
ATOM   2649 C C     . GLU A 1 351 ? 18.696  31.573  -0.530  1.00 48.06  ? 351 GLU A C     1 
ATOM   2650 O O     . GLU A 1 351 ? 18.123  30.522  -0.847  1.00 42.80  ? 351 GLU A O     1 
ATOM   2651 C CB    . GLU A 1 351 ? 16.634  33.015  -0.366  1.00 54.40  ? 351 GLU A CB    1 
ATOM   2652 C CG    . GLU A 1 351 ? 15.601  33.524  0.635   1.00 54.59  ? 351 GLU A CG    1 
ATOM   2653 C CD    . GLU A 1 351 ? 14.565  32.455  0.970   1.00 68.42  ? 351 GLU A CD    1 
ATOM   2654 O OE1   . GLU A 1 351 ? 14.373  32.119  2.171   1.00 70.29  ? 351 GLU A OE1   1 
ATOM   2655 O OE2   . GLU A 1 351 ? 13.954  31.930  0.013   1.00 71.87  ? 351 GLU A OE2   1 
ATOM   2656 N N     . SER A 1 352 ? 19.958  31.833  -0.862  1.00 49.10  ? 352 SER A N     1 
ATOM   2657 C CA    . SER A 1 352 ? 20.869  30.830  -1.414  1.00 50.28  ? 352 SER A CA    1 
ATOM   2658 C C     . SER A 1 352 ? 20.387  30.275  -2.747  1.00 48.83  ? 352 SER A C     1 
ATOM   2659 O O     . SER A 1 352 ? 20.662  29.124  -3.077  1.00 49.57  ? 352 SER A O     1 
ATOM   2660 C CB    . SER A 1 352 ? 21.099  29.679  -0.424  1.00 51.35  ? 352 SER A CB    1 
ATOM   2661 O OG    . SER A 1 352 ? 21.673  30.144  0.794   1.00 51.78  ? 352 SER A OG    1 
ATOM   2662 N N     . LEU A 1 353 ? 19.654  31.065  -3.524  1.00 50.17  ? 353 LEU A N     1 
ATOM   2663 C CA    . LEU A 1 353 ? 19.337  30.647  -4.885  1.00 51.13  ? 353 LEU A CA    1 
ATOM   2664 C C     . LEU A 1 353 ? 20.619  30.618  -5.699  1.00 49.95  ? 353 LEU A C     1 
ATOM   2665 O O     . LEU A 1 353 ? 21.391  31.579  -5.686  1.00 52.77  ? 353 LEU A O     1 
ATOM   2666 C CB    . LEU A 1 353 ? 18.314  31.583  -5.526  1.00 50.03  ? 353 LEU A CB    1 
ATOM   2667 C CG    . LEU A 1 353 ? 17.051  31.839  -4.709  1.00 50.49  ? 353 LEU A CG    1 
ATOM   2668 C CD1   . LEU A 1 353 ? 15.980  32.581  -5.507  1.00 48.50  ? 353 LEU A CD1   1 
ATOM   2669 C CD2   . LEU A 1 353 ? 16.542  30.522  -4.169  1.00 50.30  ? 353 LEU A CD2   1 
ATOM   2670 N N     . ILE A 1 354 ? 20.876  29.503  -6.368  1.00 46.48  ? 354 ILE A N     1 
ATOM   2671 C CA    . ILE A 1 354 ? 22.148  29.304  -7.037  1.00 50.38  ? 354 ILE A CA    1 
ATOM   2672 C C     . ILE A 1 354 ? 21.916  29.104  -8.535  1.00 52.13  ? 354 ILE A C     1 
ATOM   2673 O O     . ILE A 1 354 ? 20.793  28.920  -9.003  1.00 49.57  ? 354 ILE A O     1 
ATOM   2674 C CB    . ILE A 1 354 ? 22.939  28.126  -6.443  1.00 47.25  ? 354 ILE A CB    1 
ATOM   2675 C CG1   . ILE A 1 354 ? 22.052  26.886  -6.332  1.00 43.93  ? 354 ILE A CG1   1 
ATOM   2676 C CG2   . ILE A 1 354 ? 23.504  28.513  -5.130  1.00 45.91  ? 354 ILE A CG2   1 
ATOM   2677 C CD1   . ILE A 1 354 ? 22.800  25.598  -6.541  1.00 43.57  ? 354 ILE A CD1   1 
ATOM   2678 N N     . SER A 1 355 ? 23.007  29.140  -9.284  1.00 47.07  ? 355 SER A N     1 
ATOM   2679 C CA    . SER A 1 355 ? 22.954  28.917  -10.715 1.00 48.01  ? 355 SER A CA    1 
ATOM   2680 C C     . SER A 1 355 ? 23.350  27.482  -11.040 1.00 48.77  ? 355 SER A C     1 
ATOM   2681 O O     . SER A 1 355 ? 23.968  26.776  -10.237 1.00 50.23  ? 355 SER A O     1 
ATOM   2682 C CB    . SER A 1 355 ? 23.872  29.895  -11.439 1.00 46.28  ? 355 SER A CB    1 
ATOM   2683 O OG    . SER A 1 355 ? 25.225  29.639  -11.116 1.00 51.11  ? 355 SER A OG    1 
ATOM   2684 N N     . ARG A 1 356 ? 22.955  27.056  -12.234 1.00 44.61  ? 356 ARG A N     1 
ATOM   2685 C CA    . ARG A 1 356 ? 23.410  25.785  -12.768 1.00 44.39  ? 356 ARG A CA    1 
ATOM   2686 C C     . ARG A 1 356 ? 24.915  25.648  -12.617 1.00 47.33  ? 356 ARG A C     1 
ATOM   2687 O O     . ARG A 1 356 ? 25.418  24.586  -12.234 1.00 49.01  ? 356 ARG A O     1 
ATOM   2688 C CB    . ARG A 1 356 ? 22.993  25.687  -14.235 1.00 48.31  ? 356 ARG A CB    1 
ATOM   2689 C CG    . ARG A 1 356 ? 23.234  24.358  -14.887 1.00 51.28  ? 356 ARG A CG    1 
ATOM   2690 C CD    . ARG A 1 356 ? 22.004  23.489  -14.841 1.00 50.34  ? 356 ARG A CD    1 
ATOM   2691 N NE    . ARG A 1 356 ? 22.309  22.185  -15.411 1.00 53.59  ? 356 ARG A NE    1 
ATOM   2692 C CZ    . ARG A 1 356 ? 21.789  21.042  -14.982 1.00 53.64  ? 356 ARG A CZ    1 
ATOM   2693 N NH1   . ARG A 1 356 ? 20.929  21.041  -13.969 1.00 47.14  ? 356 ARG A NH1   1 
ATOM   2694 N NH2   . ARG A 1 356 ? 22.138  19.903  -15.568 1.00 56.70  ? 356 ARG A NH2   1 
ATOM   2695 N N     . ALA A 1 357 ? 25.655  26.720  -12.893 1.00 47.26  ? 357 ALA A N     1 
ATOM   2696 C CA    . ALA A 1 357 ? 27.103  26.637  -12.760 1.00 45.29  ? 357 ALA A CA    1 
ATOM   2697 C C     . ALA A 1 357 ? 27.476  26.349  -11.321 1.00 48.33  ? 357 ALA A C     1 
ATOM   2698 O O     . ALA A 1 357 ? 28.296  25.468  -11.043 1.00 51.87  ? 357 ALA A O     1 
ATOM   2699 C CB    . ALA A 1 357 ? 27.755  27.927  -13.243 1.00 39.15  ? 357 ALA A CB    1 
ATOM   2700 N N     . GLN A 1 358 ? 26.835  27.051  -10.384 1.00 44.58  ? 358 GLN A N     1 
ATOM   2701 C CA    . GLN A 1 358 ? 27.134  26.857  -8.971  1.00 51.11  ? 358 GLN A CA    1 
ATOM   2702 C C     . GLN A 1 358 ? 26.699  25.484  -8.476  1.00 48.10  ? 358 GLN A C     1 
ATOM   2703 O O     . GLN A 1 358 ? 27.299  24.951  -7.540  1.00 45.25  ? 358 GLN A O     1 
ATOM   2704 C CB    . GLN A 1 358 ? 26.474  27.960  -8.150  1.00 48.86  ? 358 GLN A CB    1 
ATOM   2705 C CG    . GLN A 1 358 ? 26.965  29.321  -8.547  1.00 45.86  ? 358 GLN A CG    1 
ATOM   2706 C CD    . GLN A 1 358 ? 26.442  30.400  -7.661  1.00 46.45  ? 358 GLN A CD    1 
ATOM   2707 O OE1   . GLN A 1 358 ? 25.238  30.656  -7.621  1.00 47.31  ? 358 GLN A OE1   1 
ATOM   2708 N NE2   . GLN A 1 358 ? 27.345  31.056  -6.939  1.00 47.41  ? 358 GLN A NE2   1 
ATOM   2709 N N     . PHE A 1 359 ? 25.669  24.900  -9.086  1.00 48.41  ? 359 PHE A N     1 
ATOM   2710 C CA    . PHE A 1 359 ? 25.282  23.545  -8.729  1.00 45.13  ? 359 PHE A CA    1 
ATOM   2711 C C     . PHE A 1 359 ? 26.335  22.545  -9.183  1.00 47.14  ? 359 PHE A C     1 
ATOM   2712 O O     . PHE A 1 359 ? 26.648  21.588  -8.465  1.00 47.38  ? 359 PHE A O     1 
ATOM   2713 C CB    . PHE A 1 359 ? 23.923  23.231  -9.340  1.00 41.15  ? 359 PHE A CB    1 
ATOM   2714 C CG    . PHE A 1 359 ? 23.476  21.811  -9.150  1.00 45.23  ? 359 PHE A CG    1 
ATOM   2715 C CD1   . PHE A 1 359 ? 23.488  20.920  -10.205 1.00 45.89  ? 359 PHE A CD1   1 
ATOM   2716 C CD2   . PHE A 1 359 ? 23.010  21.372  -7.926  1.00 47.11  ? 359 PHE A CD2   1 
ATOM   2717 C CE1   . PHE A 1 359 ? 23.062  19.611  -10.038 1.00 48.09  ? 359 PHE A CE1   1 
ATOM   2718 C CE2   . PHE A 1 359 ? 22.579  20.063  -7.758  1.00 46.45  ? 359 PHE A CE2   1 
ATOM   2719 C CZ    . PHE A 1 359 ? 22.611  19.183  -8.811  1.00 42.79  ? 359 PHE A CZ    1 
ATOM   2720 N N     . LEU A 1 360 ? 26.901  22.752  -10.369 1.00 47.86  ? 360 LEU A N     1 
ATOM   2721 C CA    . LEU A 1 360 ? 27.935  21.851  -10.854 1.00 45.74  ? 360 LEU A CA    1 
ATOM   2722 C C     . LEU A 1 360 ? 29.175  21.943  -9.986  1.00 44.86  ? 360 LEU A C     1 
ATOM   2723 O O     . LEU A 1 360 ? 29.741  20.921  -9.591  1.00 49.00  ? 360 LEU A O     1 
ATOM   2724 C CB    . LEU A 1 360 ? 28.266  22.170  -12.310 1.00 47.74  ? 360 LEU A CB    1 
ATOM   2725 C CG    . LEU A 1 360 ? 27.034  22.053  -13.203 1.00 50.15  ? 360 LEU A CG    1 
ATOM   2726 C CD1   . LEU A 1 360 ? 27.283  22.477  -14.648 1.00 49.57  ? 360 LEU A CD1   1 
ATOM   2727 C CD2   . LEU A 1 360 ? 26.538  20.638  -13.146 1.00 50.08  ? 360 LEU A CD2   1 
ATOM   2728 N N     . ALA A 1 361 ? 29.616  23.164  -9.686  1.00 44.64  ? 361 ALA A N     1 
ATOM   2729 C CA    . ALA A 1 361 ? 30.739  23.342  -8.770  1.00 48.64  ? 361 ALA A CA    1 
ATOM   2730 C C     . ALA A 1 361 ? 30.456  22.698  -7.415  1.00 45.73  ? 361 ALA A C     1 
ATOM   2731 O O     . ALA A 1 361 ? 31.332  22.049  -6.834  1.00 47.68  ? 361 ALA A O     1 
ATOM   2732 C CB    . ALA A 1 361 ? 31.049  24.830  -8.604  1.00 44.62  ? 361 ALA A CB    1 
ATOM   2733 N N     . GLY A 1 362 ? 29.230  22.853  -6.910  1.00 43.06  ? 362 GLY A N     1 
ATOM   2734 C CA    . GLY A 1 362 ? 28.878  22.277  -5.625  1.00 46.30  ? 362 GLY A CA    1 
ATOM   2735 C C     . GLY A 1 362 ? 28.889  20.760  -5.615  1.00 50.14  ? 362 GLY A C     1 
ATOM   2736 O O     . GLY A 1 362 ? 29.207  20.148  -4.589  1.00 46.20  ? 362 GLY A O     1 
ATOM   2737 N N     . VAL A 1 363 ? 28.552  20.133  -6.747  1.00 47.55  ? 363 VAL A N     1 
ATOM   2738 C CA    . VAL A 1 363 ? 28.496  18.675  -6.786  1.00 46.34  ? 363 VAL A CA    1 
ATOM   2739 C C     . VAL A 1 363 ? 29.888  18.091  -6.642  1.00 47.54  ? 363 VAL A C     1 
ATOM   2740 O O     . VAL A 1 363 ? 30.060  17.006  -6.067  1.00 47.49  ? 363 VAL A O     1 
ATOM   2741 C CB    . VAL A 1 363 ? 27.790  18.202  -8.072  1.00 45.28  ? 363 VAL A CB    1 
ATOM   2742 C CG1   . VAL A 1 363 ? 28.113  16.754  -8.388  1.00 40.54  ? 363 VAL A CG1   1 
ATOM   2743 C CG2   . VAL A 1 363 ? 26.280  18.391  -7.938  1.00 45.05  ? 363 VAL A CG2   1 
ATOM   2744 N N     . ARG A 1 364 ? 30.905  18.806  -7.123  1.00 47.13  ? 364 ARG A N     1 
ATOM   2745 C CA    . ARG A 1 364 ? 32.282  18.358  -6.971  1.00 47.47  ? 364 ARG A CA    1 
ATOM   2746 C C     . ARG A 1 364 ? 32.803  18.607  -5.575  1.00 50.60  ? 364 ARG A C     1 
ATOM   2747 O O     . ARG A 1 364 ? 33.756  17.942  -5.149  1.00 50.08  ? 364 ARG A O     1 
ATOM   2748 C CB    . ARG A 1 364 ? 33.190  19.081  -7.954  1.00 45.58  ? 364 ARG A CB    1 
ATOM   2749 C CG    . ARG A 1 364 ? 32.680  18.989  -9.343  1.00 50.81  ? 364 ARG A CG    1 
ATOM   2750 C CD    . ARG A 1 364 ? 33.143  17.644  -9.991  1.00 61.86  ? 364 ARG A CD    1 
ATOM   2751 N NE    . ARG A 1 364 ? 34.591  17.480  -9.979  1.00 79.48  ? 364 ARG A NE    1 
ATOM   2752 C CZ    . ARG A 1 364 ? 35.265  16.733  -10.874 1.00 69.94  ? 364 ARG A CZ    1 
ATOM   2753 N NH1   . ARG A 1 364 ? 34.640  16.081  -11.849 1.00 65.94  ? 364 ARG A NH1   1 
ATOM   2754 N NH2   . ARG A 1 364 ? 36.594  16.630  -10.835 1.00 83.86  ? 364 ARG A NH2   1 
ATOM   2755 N N     . ILE A 1 365 ? 32.232  19.579  -4.870  1.00 48.96  ? 365 ILE A N     1 
ATOM   2756 C CA    . ILE A 1 365 ? 32.630  19.776  -3.486  1.00 48.35  ? 365 ILE A CA    1 
ATOM   2757 C C     . ILE A 1 365 ? 31.882  18.807  -2.585  1.00 46.53  ? 365 ILE A C     1 
ATOM   2758 O O     . ILE A 1 365 ? 32.465  18.221  -1.667  1.00 45.95  ? 365 ILE A O     1 
ATOM   2759 C CB    . ILE A 1 365 ? 32.421  21.244  -3.078  1.00 47.60  ? 365 ILE A CB    1 
ATOM   2760 C CG1   . ILE A 1 365 ? 33.475  22.114  -3.766  1.00 40.34  ? 365 ILE A CG1   1 
ATOM   2761 C CG2   . ILE A 1 365 ? 32.492  21.391  -1.549  1.00 44.32  ? 365 ILE A CG2   1 
ATOM   2762 C CD1   . ILE A 1 365 ? 33.173  23.577  -3.751  1.00 38.95  ? 365 ILE A CD1   1 
ATOM   2763 N N     . GLY A 1 366 ? 30.598  18.575  -2.875  1.00 47.37  ? 366 GLY A N     1 
ATOM   2764 C CA    . GLY A 1 366 ? 29.814  17.642  -2.085  1.00 47.88  ? 366 GLY A CA    1 
ATOM   2765 C C     . GLY A 1 366 ? 30.181  16.186  -2.316  1.00 49.88  ? 366 GLY A C     1 
ATOM   2766 O O     . GLY A 1 366 ? 30.073  15.364  -1.402  1.00 51.59  ? 366 GLY A O     1 
ATOM   2767 N N     . VAL A 1 367 ? 30.610  15.839  -3.523  1.00 46.50  ? 367 VAL A N     1 
ATOM   2768 C CA    . VAL A 1 367 ? 31.084  14.485  -3.787  1.00 46.47  ? 367 VAL A CA    1 
ATOM   2769 C C     . VAL A 1 367 ? 32.564  14.567  -4.147  1.00 48.67  ? 367 VAL A C     1 
ATOM   2770 O O     . VAL A 1 367 ? 32.931  14.263  -5.293  1.00 43.52  ? 367 VAL A O     1 
ATOM   2771 C CB    . VAL A 1 367 ? 30.272  13.811  -4.905  1.00 43.38  ? 367 VAL A CB    1 
ATOM   2772 C CG1   . VAL A 1 367 ? 30.536  12.319  -4.918  1.00 40.32  ? 367 VAL A CG1   1 
ATOM   2773 C CG2   . VAL A 1 367 ? 28.794  14.086  -4.728  1.00 39.91  ? 367 VAL A CG2   1 
ATOM   2774 N N     . PRO A 1 368 ? 33.445  14.944  -3.206  1.00 47.87  ? 368 PRO A N     1 
ATOM   2775 C CA    . PRO A 1 368 ? 34.833  15.257  -3.582  1.00 47.24  ? 368 PRO A CA    1 
ATOM   2776 C C     . PRO A 1 368 ? 35.589  14.095  -4.183  1.00 48.53  ? 368 PRO A C     1 
ATOM   2777 O O     . PRO A 1 368 ? 36.636  14.309  -4.801  1.00 51.64  ? 368 PRO A O     1 
ATOM   2778 C CB    . PRO A 1 368 ? 35.459  15.707  -2.256  1.00 45.02  ? 368 PRO A CB    1 
ATOM   2779 C CG    . PRO A 1 368 ? 34.640  15.055  -1.224  1.00 43.63  ? 368 PRO A CG    1 
ATOM   2780 C CD    . PRO A 1 368 ? 33.246  15.085  -1.754  1.00 43.88  ? 368 PRO A CD    1 
ATOM   2781 N N     . GLN A 1 369 ? 35.099  12.876  -4.035  1.00 49.42  ? 369 GLN A N     1 
ATOM   2782 C CA    . GLN A 1 369 ? 35.801  11.713  -4.548  1.00 51.91  ? 369 GLN A CA    1 
ATOM   2783 C C     . GLN A 1 369 ? 35.319  11.300  -5.934  1.00 52.79  ? 369 GLN A C     1 
ATOM   2784 O O     . GLN A 1 369 ? 35.759  10.267  -6.445  1.00 55.62  ? 369 GLN A O     1 
ATOM   2785 C CB    . GLN A 1 369 ? 35.655  10.544  -3.560  1.00 50.74  ? 369 GLN A CB    1 
ATOM   2786 C CG    . GLN A 1 369 ? 34.281  9.848   -3.566  1.00 51.67  ? 369 GLN A CG    1 
ATOM   2787 C CD    . GLN A 1 369 ? 33.215  10.549  -2.706  1.00 52.62  ? 369 GLN A CD    1 
ATOM   2788 O OE1   . GLN A 1 369 ? 33.362  11.714  -2.326  1.00 50.81  ? 369 GLN A OE1   1 
ATOM   2789 N NE2   . GLN A 1 369 ? 32.133  9.827   -2.400  1.00 51.11  ? 369 GLN A NE2   1 
ATOM   2790 N N     . ALA A 1 370 ? 34.435  12.075  -6.555  1.00 53.04  ? 370 ALA A N     1 
ATOM   2791 C CA    . ALA A 1 370 ? 33.804  11.665  -7.805  1.00 53.04  ? 370 ALA A CA    1 
ATOM   2792 C C     . ALA A 1 370 ? 34.654  12.061  -8.997  1.00 52.21  ? 370 ALA A C     1 
ATOM   2793 O O     . ALA A 1 370 ? 35.079  13.216  -9.115  1.00 57.60  ? 370 ALA A O     1 
ATOM   2794 C CB    . ALA A 1 370 ? 32.413  12.281  -7.957  1.00 47.32  ? 370 ALA A CB    1 
ATOM   2795 N N     . SER A 1 371 ? 34.879  11.098  -9.884  1.00 56.88  ? 371 SER A N     1 
ATOM   2796 C CA    . SER A 1 371 ? 35.405  11.358  -11.214 1.00 57.80  ? 371 SER A CA    1 
ATOM   2797 C C     . SER A 1 371 ? 34.462  12.268  -11.998 1.00 56.08  ? 371 SER A C     1 
ATOM   2798 O O     . SER A 1 371 ? 33.284  12.440  -11.664 1.00 53.70  ? 371 SER A O     1 
ATOM   2799 C CB    . SER A 1 371 ? 35.581  10.051  -11.979 1.00 57.16  ? 371 SER A CB    1 
ATOM   2800 O OG    . SER A 1 371 ? 34.335  9.365   -12.084 1.00 59.01  ? 371 SER A OG    1 
ATOM   2801 N N     . ASP A 1 372 ? 35.002  12.834  -13.080 1.00 59.85  ? 372 ASP A N     1 
ATOM   2802 C CA    . ASP A 1 372 ? 34.192  13.672  -13.958 1.00 58.42  ? 372 ASP A CA    1 
ATOM   2803 C C     . ASP A 1 372 ? 32.926  12.940  -14.398 1.00 57.23  ? 372 ASP A C     1 
ATOM   2804 O O     . ASP A 1 372 ? 31.836  13.523  -14.417 1.00 55.76  ? 372 ASP A O     1 
ATOM   2805 C CB    . ASP A 1 372 ? 35.017  14.122  -15.169 1.00 57.98  ? 372 ASP A CB    1 
ATOM   2806 C CG    . ASP A 1 372 ? 35.990  15.261  -14.845 1.00 61.90  ? 372 ASP A CG    1 
ATOM   2807 O OD1   . ASP A 1 372 ? 36.419  15.410  -13.684 1.00 60.93  ? 372 ASP A OD1   1 
ATOM   2808 O OD2   . ASP A 1 372 ? 36.341  16.015  -15.776 1.00 73.35  ? 372 ASP A OD2   1 
ATOM   2809 N N     . LEU A 1 373 ? 33.037  11.646  -14.711 1.00 52.64  ? 373 LEU A N     1 
ATOM   2810 C CA    . LEU A 1 373 ? 31.850  10.920  -15.146 1.00 55.18  ? 373 LEU A CA    1 
ATOM   2811 C C     . LEU A 1 373 ? 30.874  10.727  -13.993 1.00 54.81  ? 373 LEU A C     1 
ATOM   2812 O O     . LEU A 1 373 ? 29.681  11.023  -14.122 1.00 51.60  ? 373 LEU A O     1 
ATOM   2813 C CB    . LEU A 1 373 ? 32.219  9.570   -15.770 1.00 54.66  ? 373 LEU A CB    1 
ATOM   2814 C CG    . LEU A 1 373 ? 30.994  8.847   -16.357 1.00 55.95  ? 373 LEU A CG    1 
ATOM   2815 C CD1   . LEU A 1 373 ? 30.108  9.788   -17.196 1.00 55.21  ? 373 LEU A CD1   1 
ATOM   2816 C CD2   . LEU A 1 373 ? 31.382  7.618   -17.180 1.00 55.38  ? 373 LEU A CD2   1 
ATOM   2817 N N     . ALA A 1 374 ? 31.364  10.228  -12.855 1.00 59.27  ? 374 ALA A N     1 
ATOM   2818 C CA    . ALA A 1 374 ? 30.481  10.028  -11.708 1.00 55.66  ? 374 ALA A CA    1 
ATOM   2819 C C     . ALA A 1 374 ? 29.814  11.334  -11.300 1.00 48.96  ? 374 ALA A C     1 
ATOM   2820 O O     . ALA A 1 374 ? 28.613  11.363  -11.010 1.00 45.32  ? 374 ALA A O     1 
ATOM   2821 C CB    . ALA A 1 374 ? 31.260  9.422   -10.541 1.00 52.56  ? 374 ALA A CB    1 
ATOM   2822 N N     . ALA A 1 375 ? 30.573  12.431  -11.305 1.00 48.58  ? 375 ALA A N     1 
ATOM   2823 C CA    . ALA A 1 375 ? 29.979  13.730  -11.022 1.00 46.26  ? 375 ALA A CA    1 
ATOM   2824 C C     . ALA A 1 375 ? 28.852  14.041  -12.000 1.00 52.09  ? 375 ALA A C     1 
ATOM   2825 O O     . ALA A 1 375 ? 27.820  14.604  -11.613 1.00 50.19  ? 375 ALA A O     1 
ATOM   2826 C CB    . ALA A 1 375 ? 31.054  14.815  -11.061 1.00 45.59  ? 375 ALA A CB    1 
ATOM   2827 N N     . GLU A 1 376 ? 29.018  13.663  -13.272 1.00 56.69  ? 376 GLU A N     1 
ATOM   2828 C CA    . GLU A 1 376 ? 27.953  13.874  -14.248 1.00 56.73  ? 376 GLU A CA    1 
ATOM   2829 C C     . GLU A 1 376 ? 26.699  13.110  -13.848 1.00 52.48  ? 376 GLU A C     1 
ATOM   2830 O O     . GLU A 1 376 ? 25.627  13.703  -13.691 1.00 56.17  ? 376 GLU A O     1 
ATOM   2831 C CB    . GLU A 1 376 ? 28.422  13.477  -15.650 1.00 62.17  ? 376 GLU A CB    1 
ATOM   2832 C CG    . GLU A 1 376 ? 28.534  14.653  -16.615 1.00 66.69  ? 376 GLU A CG    1 
ATOM   2833 C CD    . GLU A 1 376 ? 27.217  14.964  -17.330 1.00 76.15  ? 376 GLU A CD    1 
ATOM   2834 O OE1   . GLU A 1 376 ? 26.930  14.326  -18.378 1.00 71.70  ? 376 GLU A OE1   1 
ATOM   2835 O OE2   . GLU A 1 376 ? 26.460  15.834  -16.826 1.00 69.11  ? 376 GLU A OE2   1 
ATOM   2836 N N     . ALA A 1 377 ? 26.821  11.796  -13.641 1.00 47.82  ? 377 ALA A N     1 
ATOM   2837 C CA    . ALA A 1 377 ? 25.679  10.987  -13.220 1.00 50.99  ? 377 ALA A CA    1 
ATOM   2838 C C     . ALA A 1 377 ? 24.868  11.659  -12.112 1.00 53.01  ? 377 ALA A C     1 
ATOM   2839 O O     . ALA A 1 377 ? 23.633  11.731  -12.191 1.00 52.37  ? 377 ALA A O     1 
ATOM   2840 C CB    . ALA A 1 377 ? 26.155  9.605   -12.769 1.00 44.76  ? 377 ALA A CB    1 
ATOM   2841 N N     . VAL A 1 378 ? 25.559  12.190  -11.090 1.00 48.48  ? 378 VAL A N     1 
ATOM   2842 C CA    . VAL A 1 378 ? 24.887  12.879  -9.984  1.00 47.95  ? 378 VAL A CA    1 
ATOM   2843 C C     . VAL A 1 378 ? 24.108  14.075  -10.506 1.00 47.45  ? 378 VAL A C     1 
ATOM   2844 O O     . VAL A 1 378 ? 22.947  14.300  -10.142 1.00 46.59  ? 378 VAL A O     1 
ATOM   2845 C CB    . VAL A 1 378 ? 25.911  13.304  -8.913  1.00 46.63  ? 378 VAL A CB    1 
ATOM   2846 C CG1   . VAL A 1 378 ? 25.264  14.203  -7.859  1.00 41.53  ? 378 VAL A CG1   1 
ATOM   2847 C CG2   . VAL A 1 378 ? 26.544  12.085  -8.267  1.00 42.37  ? 378 VAL A CG2   1 
ATOM   2848 N N     . VAL A 1 379 ? 24.741  14.860  -11.375 1.00 48.36  ? 379 VAL A N     1 
ATOM   2849 C CA    . VAL A 1 379 ? 24.073  16.028  -11.935 1.00 49.84  ? 379 VAL A CA    1 
ATOM   2850 C C     . VAL A 1 379 ? 22.855  15.621  -12.750 1.00 52.80  ? 379 VAL A C     1 
ATOM   2851 O O     . VAL A 1 379 ? 21.807  16.280  -12.689 1.00 51.24  ? 379 VAL A O     1 
ATOM   2852 C CB    . VAL A 1 379 ? 25.052  16.846  -12.780 1.00 46.87  ? 379 VAL A CB    1 
ATOM   2853 C CG1   . VAL A 1 379 ? 24.326  18.009  -13.379 1.00 48.11  ? 379 VAL A CG1   1 
ATOM   2854 C CG2   . VAL A 1 379 ? 26.195  17.300  -11.924 1.00 47.79  ? 379 VAL A CG2   1 
ATOM   2855 N N     . LEU A 1 380 ? 22.968  14.540  -13.536 1.00 52.43  ? 380 LEU A N     1 
ATOM   2856 C CA    . LEU A 1 380 ? 21.826  14.136  -14.349 1.00 54.56  ? 380 LEU A CA    1 
ATOM   2857 C C     . LEU A 1 380 ? 20.713  13.591  -13.483 1.00 51.61  ? 380 LEU A C     1 
ATOM   2858 O O     . LEU A 1 380 ? 19.538  13.896  -13.714 1.00 53.54  ? 380 LEU A O     1 
ATOM   2859 C CB    . LEU A 1 380 ? 22.198  13.106  -15.426 1.00 61.55  ? 380 LEU A CB    1 
ATOM   2860 C CG    . LEU A 1 380 ? 23.115  13.433  -16.613 1.00 61.37  ? 380 LEU A CG    1 
ATOM   2861 C CD1   . LEU A 1 380 ? 22.876  14.825  -17.185 1.00 57.56  ? 380 LEU A CD1   1 
ATOM   2862 C CD2   . LEU A 1 380 ? 24.569  13.191  -16.327 1.00 65.71  ? 380 LEU A CD2   1 
ATOM   2863 N N     . HIS A 1 381 ? 21.059  12.806  -12.467 1.00 54.25  ? 381 HIS A N     1 
ATOM   2864 C CA    . HIS A 1 381 ? 20.013  12.234  -11.631 1.00 56.50  ? 381 HIS A CA    1 
ATOM   2865 C C     . HIS A 1 381 ? 19.281  13.301  -10.827 1.00 49.39  ? 381 HIS A C     1 
ATOM   2866 O O     . HIS A 1 381 ? 18.071  13.188  -10.618 1.00 52.33  ? 381 HIS A O     1 
ATOM   2867 C CB    . HIS A 1 381 ? 20.591  11.168  -10.711 1.00 52.98  ? 381 HIS A CB    1 
ATOM   2868 C CG    . HIS A 1 381 ? 19.548  10.307  -10.080 1.00 60.88  ? 381 HIS A CG    1 
ATOM   2869 N ND1   . HIS A 1 381 ? 18.882  10.671  -8.926  1.00 62.58  ? 381 HIS A ND1   1 
ATOM   2870 C CD2   . HIS A 1 381 ? 19.039  9.107   -10.447 1.00 68.36  ? 381 HIS A CD2   1 
ATOM   2871 C CE1   . HIS A 1 381 ? 18.018  9.725   -8.599  1.00 64.67  ? 381 HIS A CE1   1 
ATOM   2872 N NE2   . HIS A 1 381 ? 18.090  8.767   -9.508  1.00 74.82  ? 381 HIS A NE2   1 
ATOM   2873 N N     . TYR A 1 382 ? 19.964  14.363  -10.421 1.00 46.33  ? 382 TYR A N     1 
ATOM   2874 C CA    . TYR A 1 382 ? 19.346  15.326  -9.522  1.00 47.08  ? 382 TYR A CA    1 
ATOM   2875 C C     . TYR A 1 382 ? 18.809  16.565  -10.220 1.00 49.21  ? 382 TYR A C     1 
ATOM   2876 O O     . TYR A 1 382 ? 18.117  17.357  -9.575  1.00 49.15  ? 382 TYR A O     1 
ATOM   2877 C CB    . TYR A 1 382 ? 20.331  15.746  -8.425  1.00 45.79  ? 382 TYR A CB    1 
ATOM   2878 C CG    . TYR A 1 382 ? 20.426  14.741  -7.295  1.00 43.65  ? 382 TYR A CG    1 
ATOM   2879 C CD1   . TYR A 1 382 ? 21.330  13.691  -7.346  1.00 40.28  ? 382 TYR A CD1   1 
ATOM   2880 C CD2   . TYR A 1 382 ? 19.605  14.847  -6.172  1.00 47.74  ? 382 TYR A CD2   1 
ATOM   2881 C CE1   . TYR A 1 382 ? 21.414  12.765  -6.312  1.00 46.58  ? 382 TYR A CE1   1 
ATOM   2882 C CE2   . TYR A 1 382 ? 19.686  13.926  -5.114  1.00 43.24  ? 382 TYR A CE2   1 
ATOM   2883 C CZ    . TYR A 1 382 ? 20.590  12.888  -5.193  1.00 45.23  ? 382 TYR A CZ    1 
ATOM   2884 O OH    . TYR A 1 382 ? 20.672  11.975  -4.166  1.00 42.68  ? 382 TYR A OH    1 
ATOM   2885 N N     . THR A 1 383 ? 19.091  16.751  -11.507 1.00 49.02  ? 383 THR A N     1 
ATOM   2886 C CA    . THR A 1 383 ? 18.478  17.847  -12.241 1.00 43.39  ? 383 THR A CA    1 
ATOM   2887 C C     . THR A 1 383 ? 16.987  17.599  -12.406 1.00 45.80  ? 383 THR A C     1 
ATOM   2888 O O     . THR A 1 383 ? 16.562  16.465  -12.618 1.00 51.91  ? 383 THR A O     1 
ATOM   2889 C CB    . THR A 1 383 ? 19.129  17.977  -13.607 1.00 48.68  ? 383 THR A CB    1 
ATOM   2890 O OG1   . THR A 1 383 ? 20.516  18.297  -13.441 1.00 50.25  ? 383 THR A OG1   1 
ATOM   2891 C CG2   . THR A 1 383 ? 18.432  19.041  -14.452 1.00 46.22  ? 383 THR A CG2   1 
ATOM   2892 N N     . ASP A 1 384 ? 16.186  18.656  -12.287 1.00 44.96  ? 384 ASP A N     1 
ATOM   2893 C CA    . ASP A 1 384 ? 14.788  18.615  -12.717 1.00 54.62  ? 384 ASP A CA    1 
ATOM   2894 C C     . ASP A 1 384 ? 14.737  19.076  -14.176 1.00 58.78  ? 384 ASP A C     1 
ATOM   2895 O O     . ASP A 1 384 ? 14.851  20.271  -14.474 1.00 55.50  ? 384 ASP A O     1 
ATOM   2896 C CB    . ASP A 1 384 ? 13.909  19.473  -11.815 1.00 57.63  ? 384 ASP A CB    1 
ATOM   2897 C CG    . ASP A 1 384 ? 12.588  19.851  -12.464 1.00 67.76  ? 384 ASP A CG    1 
ATOM   2898 O OD1   . ASP A 1 384 ? 12.017  19.025  -13.223 1.00 63.40  ? 384 ASP A OD1   1 
ATOM   2899 O OD2   . ASP A 1 384 ? 12.129  20.993  -12.219 1.00 67.99  ? 384 ASP A OD2   1 
ATOM   2900 N N     . TRP A 1 385 ? 14.567  18.131  -15.099 1.00 54.63  ? 385 TRP A N     1 
ATOM   2901 C CA    . TRP A 1 385 ? 14.752  18.483  -16.500 1.00 55.91  ? 385 TRP A CA    1 
ATOM   2902 C C     . TRP A 1 385 ? 13.614  19.315  -17.072 1.00 57.12  ? 385 TRP A C     1 
ATOM   2903 O O     . TRP A 1 385 ? 13.738  19.781  -18.203 1.00 63.30  ? 385 TRP A O     1 
ATOM   2904 C CB    . TRP A 1 385 ? 14.986  17.223  -17.312 1.00 51.73  ? 385 TRP A CB    1 
ATOM   2905 C CG    . TRP A 1 385 ? 16.257  16.622  -16.889 1.00 51.41  ? 385 TRP A CG    1 
ATOM   2906 C CD1   . TRP A 1 385 ? 16.430  15.620  -15.993 1.00 49.75  ? 385 TRP A CD1   1 
ATOM   2907 C CD2   . TRP A 1 385 ? 17.558  17.023  -17.299 1.00 48.29  ? 385 TRP A CD2   1 
ATOM   2908 N NE1   . TRP A 1 385 ? 17.764  15.348  -15.834 1.00 49.37  ? 385 TRP A NE1   1 
ATOM   2909 C CE2   . TRP A 1 385 ? 18.481  16.205  -16.620 1.00 47.90  ? 385 TRP A CE2   1 
ATOM   2910 C CE3   . TRP A 1 385 ? 18.035  17.993  -18.176 1.00 47.51  ? 385 TRP A CE3   1 
ATOM   2911 C CZ2   . TRP A 1 385 ? 19.853  16.324  -16.790 1.00 50.48  ? 385 TRP A CZ2   1 
ATOM   2912 C CZ3   . TRP A 1 385 ? 19.401  18.116  -18.346 1.00 49.99  ? 385 TRP A CZ3   1 
ATOM   2913 C CH2   . TRP A 1 385 ? 20.295  17.285  -17.657 1.00 54.03  ? 385 TRP A CH2   1 
ATOM   2914 N N     . LEU A 1 386 ? 12.551  19.561  -16.307 1.00 58.56  ? 386 LEU A N     1 
ATOM   2915 C CA    . LEU A 1 386 ? 11.530  20.539  -16.669 1.00 61.22  ? 386 LEU A CA    1 
ATOM   2916 C C     . LEU A 1 386 ? 11.872  21.962  -16.232 1.00 63.60  ? 386 LEU A C     1 
ATOM   2917 O O     . LEU A 1 386 ? 11.289  22.919  -16.755 1.00 66.09  ? 386 LEU A O     1 
ATOM   2918 C CB    . LEU A 1 386 ? 10.183  20.134  -16.054 1.00 62.62  ? 386 LEU A CB    1 
ATOM   2919 C CG    . LEU A 1 386 ? 9.466   18.988  -16.775 1.00 59.89  ? 386 LEU A CG    1 
ATOM   2920 C CD1   . LEU A 1 386 ? 8.541   18.205  -15.864 1.00 48.79  ? 386 LEU A CD1   1 
ATOM   2921 C CD2   . LEU A 1 386 ? 8.697   19.550  -17.968 1.00 57.46  ? 386 LEU A CD2   1 
ATOM   2922 N N     . HIS A 1 387 ? 12.768  22.126  -15.262 1.00 61.85  ? 387 HIS A N     1 
ATOM   2923 C CA    . HIS A 1 387 ? 13.206  23.444  -14.796 1.00 63.39  ? 387 HIS A CA    1 
ATOM   2924 C C     . HIS A 1 387 ? 14.690  23.358  -14.454 1.00 60.23  ? 387 HIS A C     1 
ATOM   2925 O O     . HIS A 1 387 ? 15.103  23.682  -13.335 1.00 64.00  ? 387 HIS A O     1 
ATOM   2926 C CB    . HIS A 1 387 ? 12.414  23.908  -13.565 1.00 68.96  ? 387 HIS A CB    1 
ATOM   2927 C CG    . HIS A 1 387 ? 10.950  24.150  -13.796 1.00 75.00  ? 387 HIS A CG    1 
ATOM   2928 N ND1   . HIS A 1 387 ? 10.050  23.135  -14.050 1.00 75.12  ? 387 HIS A ND1   1 
ATOM   2929 C CD2   . HIS A 1 387 ? 10.220  25.292  -13.747 1.00 76.45  ? 387 HIS A CD2   1 
ATOM   2930 C CE1   . HIS A 1 387 ? 8.837   23.644  -14.182 1.00 73.19  ? 387 HIS A CE1   1 
ATOM   2931 N NE2   . HIS A 1 387 ? 8.912   24.951  -14.003 1.00 75.70  ? 387 HIS A NE2   1 
ATOM   2932 N N     . PRO A 1 388 ? 15.527  22.933  -15.402 1.00 55.39  ? 388 PRO A N     1 
ATOM   2933 C CA    . PRO A 1 388 ? 16.929  22.625  -15.071 1.00 53.66  ? 388 PRO A CA    1 
ATOM   2934 C C     . PRO A 1 388 ? 17.756  23.834  -14.657 1.00 52.30  ? 388 PRO A C     1 
ATOM   2935 O O     . PRO A 1 388 ? 18.962  23.728  -14.405 1.00 53.22  ? 388 PRO A O     1 
ATOM   2936 C CB    . PRO A 1 388 ? 17.460  22.010  -16.371 1.00 53.02  ? 388 PRO A CB    1 
ATOM   2937 C CG    . PRO A 1 388 ? 16.656  22.648  -17.413 1.00 50.26  ? 388 PRO A CG    1 
ATOM   2938 C CD    . PRO A 1 388 ? 15.278  22.830  -16.848 1.00 57.45  ? 388 PRO A CD    1 
ATOM   2939 N N     . GLU A 1 389 ? 17.130  24.997  -14.588 1.00 51.83  ? 389 GLU A N     1 
ATOM   2940 C CA    . GLU A 1 389 ? 17.843  26.172  -14.115 1.00 49.63  ? 389 GLU A CA    1 
ATOM   2941 C C     . GLU A 1 389 ? 17.052  26.981  -13.100 1.00 46.95  ? 389 GLU A C     1 
ATOM   2942 O O     . GLU A 1 389 ? 17.440  28.120  -12.833 1.00 49.16  ? 389 GLU A O     1 
ATOM   2943 C CB    . GLU A 1 389 ? 18.244  27.081  -15.286 1.00 57.81  ? 389 GLU A CB    1 
ATOM   2944 C CG    . GLU A 1 389 ? 18.645  26.337  -16.529 1.00 57.79  ? 389 GLU A CG    1 
ATOM   2945 C CD    . GLU A 1 389 ? 19.847  26.939  -17.227 1.00 63.04  ? 389 GLU A CD    1 
ATOM   2946 O OE1   . GLU A 1 389 ? 19.923  26.806  -18.463 1.00 71.95  ? 389 GLU A OE1   1 
ATOM   2947 O OE2   . GLU A 1 389 ? 20.722  27.521  -16.550 1.00 65.51  ? 389 GLU A OE2   1 
ATOM   2948 N N     . ASP A 1 390 ? 15.946  26.454  -12.539 1.00 47.77  ? 390 ASP A N     1 
ATOM   2949 C CA    . ASP A 1 390 ? 15.288  27.164  -11.444 1.00 49.15  ? 390 ASP A CA    1 
ATOM   2950 C C     . ASP A 1 390 ? 16.275  27.206  -10.285 1.00 51.26  ? 390 ASP A C     1 
ATOM   2951 O O     . ASP A 1 390 ? 16.674  26.162  -9.757  1.00 50.73  ? 390 ASP A O     1 
ATOM   2952 C CB    . ASP A 1 390 ? 13.973  26.507  -11.017 1.00 49.92  ? 390 ASP A CB    1 
ATOM   2953 C CG    . ASP A 1 390 ? 13.152  27.384  -10.069 1.00 57.75  ? 390 ASP A CG    1 
ATOM   2954 O OD1   . ASP A 1 390 ? 11.905  27.312  -10.096 1.00 63.81  ? 390 ASP A OD1   1 
ATOM   2955 O OD2   . ASP A 1 390 ? 13.732  28.154  -9.276  1.00 64.03  ? 390 ASP A OD2   1 
ATOM   2956 N N     . PRO A 1 391 ? 16.719  28.394  -9.892  1.00 49.96  ? 391 PRO A N     1 
ATOM   2957 C CA    . PRO A 1 391 ? 17.691  28.475  -8.803  1.00 52.82  ? 391 PRO A CA    1 
ATOM   2958 C C     . PRO A 1 391 ? 17.151  27.964  -7.487  1.00 53.15  ? 391 PRO A C     1 
ATOM   2959 O O     . PRO A 1 391 ? 17.935  27.491  -6.657  1.00 53.14  ? 391 PRO A O     1 
ATOM   2960 C CB    . PRO A 1 391 ? 18.000  29.975  -8.738  1.00 53.81  ? 391 PRO A CB    1 
ATOM   2961 C CG    . PRO A 1 391 ? 16.749  30.612  -9.208  1.00 55.75  ? 391 PRO A CG    1 
ATOM   2962 C CD    . PRO A 1 391 ? 16.256  29.724  -10.312 1.00 53.16  ? 391 PRO A CD    1 
ATOM   2963 N N     . THR A 1 392 ? 15.841  28.054  -7.252  1.00 50.96  ? 392 THR A N     1 
ATOM   2964 C CA    . THR A 1 392 ? 15.327  27.493  -6.012  1.00 51.25  ? 392 THR A CA    1 
ATOM   2965 C C     . THR A 1 392 ? 15.470  25.986  -6.017  1.00 53.49  ? 392 THR A C     1 
ATOM   2966 O O     . THR A 1 392 ? 15.873  25.388  -5.010  1.00 52.49  ? 392 THR A O     1 
ATOM   2967 C CB    . THR A 1 392 ? 13.877  27.903  -5.781  1.00 48.97  ? 392 THR A CB    1 
ATOM   2968 O OG1   . THR A 1 392 ? 13.843  29.240  -5.265  1.00 51.91  ? 392 THR A OG1   1 
ATOM   2969 C CG2   . THR A 1 392 ? 13.221  26.994  -4.771  1.00 41.34  ? 392 THR A CG2   1 
ATOM   2970 N N     . HIS A 1 393 ? 15.200  25.356  -7.150  1.00 52.20  ? 393 HIS A N     1 
ATOM   2971 C CA    . HIS A 1 393 ? 15.273  23.903  -7.151  1.00 53.80  ? 393 HIS A CA    1 
ATOM   2972 C C     . HIS A 1 393 ? 16.706  23.393  -7.216  1.00 53.29  ? 393 HIS A C     1 
ATOM   2973 O O     . HIS A 1 393 ? 16.983  22.302  -6.708  1.00 56.76  ? 393 HIS A O     1 
ATOM   2974 C CB    . HIS A 1 393 ? 14.461  23.312  -8.302  1.00 59.14  ? 393 HIS A CB    1 
ATOM   2975 C CG    . HIS A 1 393 ? 14.807  21.881  -8.575  1.00 78.42  ? 393 HIS A CG    1 
ATOM   2976 N ND1   . HIS A 1 393 ? 15.811  21.517  -9.446  1.00 77.52  ? 393 HIS A ND1   1 
ATOM   2977 C CD2   . HIS A 1 393 ? 14.357  20.727  -8.023  1.00 81.54  ? 393 HIS A CD2   1 
ATOM   2978 C CE1   . HIS A 1 393 ? 15.935  20.202  -9.461  1.00 78.77  ? 393 HIS A CE1   1 
ATOM   2979 N NE2   . HIS A 1 393 ? 15.058  19.700  -8.610  1.00 96.25  ? 393 HIS A NE2   1 
ATOM   2980 N N     . LEU A 1 394 ? 17.634  24.153  -7.805  1.00 45.95  ? 394 LEU A N     1 
ATOM   2981 C CA    . LEU A 1 394 ? 19.029  23.720  -7.774  1.00 46.71  ? 394 LEU A CA    1 
ATOM   2982 C C     . LEU A 1 394 ? 19.618  23.851  -6.373  1.00 49.69  ? 394 LEU A C     1 
ATOM   2983 O O     . LEU A 1 394 ? 20.528  23.101  -5.999  1.00 44.45  ? 394 LEU A O     1 
ATOM   2984 C CB    . LEU A 1 394 ? 19.854  24.527  -8.767  1.00 44.48  ? 394 LEU A CB    1 
ATOM   2985 C CG    . LEU A 1 394 ? 19.647  24.099  -10.217 1.00 51.14  ? 394 LEU A CG    1 
ATOM   2986 C CD1   . LEU A 1 394 ? 19.645  25.306  -11.109 1.00 46.74  ? 394 LEU A CD1   1 
ATOM   2987 C CD2   . LEU A 1 394 ? 20.670  23.050  -10.676 1.00 53.97  ? 394 LEU A CD2   1 
ATOM   2988 N N     . ARG A 1 395 ? 19.111  24.801  -5.594  1.00 46.62  ? 395 ARG A N     1 
ATOM   2989 C CA    . ARG A 1 395 ? 19.510  24.912  -4.208  1.00 43.73  ? 395 ARG A CA    1 
ATOM   2990 C C     . ARG A 1 395 ? 19.044  23.691  -3.422  1.00 48.92  ? 395 ARG A C     1 
ATOM   2991 O O     . ARG A 1 395 ? 19.839  23.053  -2.719  1.00 46.49  ? 395 ARG A O     1 
ATOM   2992 C CB    . ARG A 1 395 ? 18.954  26.218  -3.635  1.00 48.46  ? 395 ARG A CB    1 
ATOM   2993 C CG    . ARG A 1 395 ? 19.137  26.421  -2.130  1.00 42.20  ? 395 ARG A CG    1 
ATOM   2994 C CD    . ARG A 1 395 ? 17.792  26.318  -1.452  1.00 40.38  ? 395 ARG A CD    1 
ATOM   2995 N NE    . ARG A 1 395 ? 17.064  27.581  -1.360  1.00 41.78  ? 395 ARG A NE    1 
ATOM   2996 C CZ    . ARG A 1 395 ? 15.740  27.670  -1.200  1.00 44.32  ? 395 ARG A CZ    1 
ATOM   2997 N NH1   . ARG A 1 395 ? 14.993  26.575  -1.131  1.00 38.32  ? 395 ARG A NH1   1 
ATOM   2998 N NH2   . ARG A 1 395 ? 15.156  28.860  -1.122  1.00 46.53  ? 395 ARG A NH2   1 
ATOM   2999 N N     . ASP A 1 396 ? 17.764  23.323  -3.556  1.00 46.91  ? 396 ASP A N     1 
ATOM   3000 C CA    . ASP A 1 396 ? 17.265  22.157  -2.833  1.00 40.80  ? 396 ASP A CA    1 
ATOM   3001 C C     . ASP A 1 396 ? 17.912  20.877  -3.335  1.00 43.46  ? 396 ASP A C     1 
ATOM   3002 O O     . ASP A 1 396 ? 18.096  19.934  -2.561  1.00 43.04  ? 396 ASP A O     1 
ATOM   3003 C CB    . ASP A 1 396 ? 15.743  22.051  -2.947  1.00 35.42  ? 396 ASP A CB    1 
ATOM   3004 C CG    . ASP A 1 396 ? 15.007  23.289  -2.413  1.00 46.68  ? 396 ASP A CG    1 
ATOM   3005 O OD1   . ASP A 1 396 ? 15.638  24.185  -1.801  1.00 45.29  ? 396 ASP A OD1   1 
ATOM   3006 O OD2   . ASP A 1 396 ? 13.771  23.363  -2.589  1.00 45.33  ? 396 ASP A OD2   1 
ATOM   3007 N N     . ALA A 1 397 ? 18.257  20.821  -4.625  1.00 47.11  ? 397 ALA A N     1 
ATOM   3008 C CA    . ALA A 1 397 ? 18.930  19.640  -5.149  1.00 45.68  ? 397 ALA A CA    1 
ATOM   3009 C C     . ALA A 1 397 ? 20.334  19.521  -4.588  1.00 44.51  ? 397 ALA A C     1 
ATOM   3010 O O     . ALA A 1 397 ? 20.758  18.424  -4.210  1.00 44.12  ? 397 ALA A O     1 
ATOM   3011 C CB    . ALA A 1 397 ? 18.969  19.675  -6.673  1.00 46.05  ? 397 ALA A CB    1 
ATOM   3012 N N     . MET A 1 398 ? 21.071  20.638  -4.535  1.00 41.09  ? 398 MET A N     1 
ATOM   3013 C CA    . MET A 1 398 ? 22.361  20.643  -3.853  1.00 43.60  ? 398 MET A CA    1 
ATOM   3014 C C     . MET A 1 398 ? 22.221  20.145  -2.415  1.00 44.57  ? 398 MET A C     1 
ATOM   3015 O O     . MET A 1 398 ? 23.013  19.315  -1.954  1.00 39.91  ? 398 MET A O     1 
ATOM   3016 C CB    . MET A 1 398 ? 22.962  22.045  -3.875  1.00 42.12  ? 398 MET A CB    1 
ATOM   3017 C CG    . MET A 1 398 ? 24.434  22.084  -3.512  1.00 43.54  ? 398 MET A CG    1 
ATOM   3018 S SD    . MET A 1 398 ? 25.505  21.277  -4.734  1.00 49.80  ? 398 MET A SD    1 
ATOM   3019 C CE    . MET A 1 398 ? 25.998  19.785  -3.887  1.00 43.29  ? 398 MET A CE    1 
ATOM   3020 N N     . SER A 1 399 ? 21.207  20.627  -1.700  1.00 42.19  ? 399 SER A N     1 
ATOM   3021 C CA    . SER A 1 399 ? 20.947  20.108  -0.366  1.00 42.15  ? 399 SER A CA    1 
ATOM   3022 C C     . SER A 1 399 ? 20.676  18.609  -0.403  1.00 42.32  ? 399 SER A C     1 
ATOM   3023 O O     . SER A 1 399 ? 21.175  17.860  0.445   1.00 41.88  ? 399 SER A O     1 
ATOM   3024 C CB    . SER A 1 399 ? 19.779  20.869  0.261   1.00 40.59  ? 399 SER A CB    1 
ATOM   3025 O OG    . SER A 1 399 ? 19.331  20.246  1.441   1.00 40.84  ? 399 SER A OG    1 
ATOM   3026 N N     . ALA A 1 400 ? 19.921  18.149  -1.402  1.00 42.81  ? 400 ALA A N     1 
ATOM   3027 C CA    . ALA A 1 400 ? 19.558  16.736  -1.459  1.00 40.77  ? 400 ALA A CA    1 
ATOM   3028 C C     . ALA A 1 400 ? 20.751  15.867  -1.824  1.00 40.47  ? 400 ALA A C     1 
ATOM   3029 O O     . ALA A 1 400 ? 20.849  14.726  -1.372  1.00 40.28  ? 400 ALA A O     1 
ATOM   3030 C CB    . ALA A 1 400 ? 18.418  16.517  -2.453  1.00 43.30  ? 400 ALA A CB    1 
ATOM   3031 N N     . VAL A 1 401 ? 21.661  16.370  -2.658  1.00 42.90  ? 401 VAL A N     1 
ATOM   3032 C CA    . VAL A 1 401 ? 22.838  15.576  -3.005  1.00 42.69  ? 401 VAL A CA    1 
ATOM   3033 C C     . VAL A 1 401 ? 23.648  15.274  -1.755  1.00 42.90  ? 401 VAL A C     1 
ATOM   3034 O O     . VAL A 1 401 ? 23.988  14.120  -1.473  1.00 42.60  ? 401 VAL A O     1 
ATOM   3035 C CB    . VAL A 1 401 ? 23.698  16.294  -4.063  1.00 42.04  ? 401 VAL A CB    1 
ATOM   3036 C CG1   . VAL A 1 401 ? 25.008  15.551  -4.246  1.00 41.14  ? 401 VAL A CG1   1 
ATOM   3037 C CG2   . VAL A 1 401 ? 22.954  16.397  -5.384  1.00 40.07  ? 401 VAL A CG2   1 
ATOM   3038 N N     . VAL A 1 402 ? 23.952  16.316  -0.979  1.00 41.49  ? 402 VAL A N     1 
ATOM   3039 C CA    . VAL A 1 402 ? 24.814  16.167  0.183   1.00 41.62  ? 402 VAL A CA    1 
ATOM   3040 C C     . VAL A 1 402 ? 24.127  15.328  1.250   1.00 45.44  ? 402 VAL A C     1 
ATOM   3041 O O     . VAL A 1 402 ? 24.738  14.423  1.832   1.00 44.99  ? 402 VAL A O     1 
ATOM   3042 C CB    . VAL A 1 402 ? 25.223  17.549  0.719   1.00 43.82  ? 402 VAL A CB    1 
ATOM   3043 C CG1   . VAL A 1 402 ? 25.972  17.403  2.008   1.00 43.74  ? 402 VAL A CG1   1 
ATOM   3044 C CG2   . VAL A 1 402 ? 26.091  18.272  -0.290  1.00 39.78  ? 402 VAL A CG2   1 
ATOM   3045 N N     . GLY A 1 403 ? 22.846  15.600  1.512   1.00 43.88  ? 403 GLY A N     1 
ATOM   3046 C CA    . GLY A 1 403 ? 22.125  14.813  2.501   1.00 40.39  ? 403 GLY A CA    1 
ATOM   3047 C C     . GLY A 1 403 ? 22.060  13.344  2.137   1.00 40.43  ? 403 GLY A C     1 
ATOM   3048 O O     . GLY A 1 403 ? 22.350  12.473  2.959   1.00 40.68  ? 403 GLY A O     1 
ATOM   3049 N N     . ASP A 1 404 ? 21.696  13.055  0.886   1.00 42.58  ? 404 ASP A N     1 
ATOM   3050 C CA    . ASP A 1 404 ? 21.555  11.678  0.426   1.00 42.44  ? 404 ASP A CA    1 
ATOM   3051 C C     . ASP A 1 404 ? 22.883  10.940  0.473   1.00 43.40  ? 404 ASP A C     1 
ATOM   3052 O O     . ASP A 1 404 ? 22.958  9.790   0.923   1.00 45.42  ? 404 ASP A O     1 
ATOM   3053 C CB    . ASP A 1 404 ? 21.006  11.659  -0.999  1.00 39.95  ? 404 ASP A CB    1 
ATOM   3054 C CG    . ASP A 1 404 ? 19.579  12.130  -1.082  1.00 42.86  ? 404 ASP A CG    1 
ATOM   3055 O OD1   . ASP A 1 404 ? 18.944  12.342  -0.020  1.00 42.02  ? 404 ASP A OD1   1 
ATOM   3056 O OD2   . ASP A 1 404 ? 19.083  12.273  -2.221  1.00 50.10  ? 404 ASP A OD2   1 
ATOM   3057 N N     . HIS A 1 405 ? 23.941  11.581  -0.013  1.00 40.60  ? 405 HIS A N     1 
ATOM   3058 C CA    . HIS A 1 405 ? 25.220  10.898  -0.144  1.00 43.48  ? 405 HIS A CA    1 
ATOM   3059 C C     . HIS A 1 405 ? 25.833  10.595  1.226   1.00 42.84  ? 405 HIS A C     1 
ATOM   3060 O O     . HIS A 1 405 ? 26.437  9.534   1.429   1.00 42.71  ? 405 HIS A O     1 
ATOM   3061 C CB    . HIS A 1 405 ? 26.147  11.755  -1.011  1.00 38.55  ? 405 HIS A CB    1 
ATOM   3062 C CG    . HIS A 1 405 ? 27.550  11.256  -1.084  1.00 36.96  ? 405 HIS A CG    1 
ATOM   3063 N ND1   . HIS A 1 405 ? 27.859  9.926   -1.252  1.00 39.72  ? 405 HIS A ND1   1 
ATOM   3064 C CD2   . HIS A 1 405 ? 28.732  11.912  -1.020  1.00 39.45  ? 405 HIS A CD2   1 
ATOM   3065 C CE1   . HIS A 1 405 ? 29.171  9.783   -1.301  1.00 41.10  ? 405 HIS A CE1   1 
ATOM   3066 N NE2   . HIS A 1 405 ? 29.725  10.973  -1.160  1.00 40.02  ? 405 HIS A NE2   1 
ATOM   3067 N N     . ASN A 1 406 ? 25.664  11.495  2.185   1.00 40.66  ? 406 ASN A N     1 
ATOM   3068 C CA    . ASN A 1 406 ? 26.347  11.337  3.462   1.00 43.37  ? 406 ASN A CA    1 
ATOM   3069 C C     . ASN A 1 406 ? 25.499  10.701  4.562   1.00 39.92  ? 406 ASN A C     1 
ATOM   3070 O O     . ASN A 1 406 ? 26.073  10.113  5.473   1.00 37.73  ? 406 ASN A O     1 
ATOM   3071 C CB    . ASN A 1 406 ? 26.883  12.687  3.948   1.00 39.99  ? 406 ASN A CB    1 
ATOM   3072 C CG    . ASN A 1 406 ? 27.993  13.221  3.064   1.00 43.37  ? 406 ASN A CG    1 
ATOM   3073 O OD1   . ASN A 1 406 ? 29.065  12.616  2.960   1.00 41.29  ? 406 ASN A OD1   1 
ATOM   3074 N ND2   . ASN A 1 406 ? 27.746  14.366  2.426   1.00 43.30  ? 406 ASN A ND2   1 
ATOM   3075 N N     . VAL A 1 407 ? 24.168  10.773  4.505   1.00 38.88  ? 407 VAL A N     1 
ATOM   3076 C CA    . VAL A 1 407 ? 23.360  10.244  5.597   1.00 35.79  ? 407 VAL A CA    1 
ATOM   3077 C C     . VAL A 1 407 ? 22.228  9.351   5.102   1.00 39.47  ? 407 VAL A C     1 
ATOM   3078 O O     . VAL A 1 407 ? 22.221  8.149   5.387   1.00 40.85  ? 407 VAL A O     1 
ATOM   3079 C CB    . VAL A 1 407 ? 22.802  11.388  6.474   1.00 41.03  ? 407 VAL A CB    1 
ATOM   3080 C CG1   . VAL A 1 407 ? 22.012  10.821  7.637   1.00 37.15  ? 407 VAL A CG1   1 
ATOM   3081 C CG2   . VAL A 1 407 ? 23.919  12.284  6.988   1.00 34.77  ? 407 VAL A CG2   1 
ATOM   3082 N N     . VAL A 1 408 ? 21.262  9.929   4.363   1.00 44.58  ? 408 VAL A N     1 
ATOM   3083 C CA    . VAL A 1 408 ? 20.025  9.217   3.990   1.00 42.79  ? 408 VAL A CA    1 
ATOM   3084 C C     . VAL A 1 408 ? 20.310  7.888   3.303   1.00 43.05  ? 408 VAL A C     1 
ATOM   3085 O O     . VAL A 1 408 ? 19.557  6.925   3.474   1.00 47.65  ? 408 VAL A O     1 
ATOM   3086 C CB    . VAL A 1 408 ? 19.109  10.078  3.094   1.00 37.02  ? 408 VAL A CB    1 
ATOM   3087 C CG1   . VAL A 1 408 ? 17.852  9.312   2.773   1.00 36.61  ? 408 VAL A CG1   1 
ATOM   3088 C CG2   . VAL A 1 408 ? 18.734  11.373  3.775   1.00 38.33  ? 408 VAL A CG2   1 
ATOM   3089 N N     . CYS A 1 409 ? 21.383  7.797   2.530   1.00 38.72  ? 409 CYS A N     1 
ATOM   3090 C CA    . CYS A 1 409 ? 21.582  6.542   1.814   1.00 42.86  ? 409 CYS A CA    1 
ATOM   3091 C C     . CYS A 1 409 ? 22.552  5.619   2.539   1.00 46.46  ? 409 CYS A C     1 
ATOM   3092 O O     . CYS A 1 409 ? 22.408  4.391   2.446   1.00 46.31  ? 409 CYS A O     1 
ATOM   3093 C CB    . CYS A 1 409 ? 22.037  6.805   0.370   1.00 48.19  ? 409 CYS A CB    1 
ATOM   3094 S SG    . CYS A 1 409 ? 20.707  7.545   -0.630  1.00 46.42  ? 409 CYS A SG    1 
ATOM   3095 N N     . PRO A 1 410 ? 23.549  6.139   3.262   1.00 45.16  ? 410 PRO A N     1 
ATOM   3096 C CA    . PRO A 1 410 ? 24.262  5.253   4.192   1.00 42.25  ? 410 PRO A CA    1 
ATOM   3097 C C     . PRO A 1 410 ? 23.361  4.668   5.252   1.00 42.53  ? 410 PRO A C     1 
ATOM   3098 O O     . PRO A 1 410 ? 23.571  3.514   5.642   1.00 42.83  ? 410 PRO A O     1 
ATOM   3099 C CB    . PRO A 1 410 ? 25.338  6.161   4.782   1.00 39.79  ? 410 PRO A CB    1 
ATOM   3100 C CG    . PRO A 1 410 ? 25.656  7.095   3.674   1.00 40.71  ? 410 PRO A CG    1 
ATOM   3101 C CD    . PRO A 1 410 ? 24.325  7.366   2.996   1.00 42.97  ? 410 PRO A CD    1 
ATOM   3102 N N     . VAL A 1 411 ? 22.348  5.408   5.715   1.00 43.15  ? 411 VAL A N     1 
ATOM   3103 C CA    . VAL A 1 411 ? 21.436  4.856   6.717   1.00 43.20  ? 411 VAL A CA    1 
ATOM   3104 C C     . VAL A 1 411 ? 20.490  3.853   6.076   1.00 45.64  ? 411 VAL A C     1 
ATOM   3105 O O     . VAL A 1 411 ? 20.283  2.752   6.602   1.00 46.17  ? 411 VAL A O     1 
ATOM   3106 C CB    . VAL A 1 411 ? 20.656  5.969   7.436   1.00 39.52  ? 411 VAL A CB    1 
ATOM   3107 C CG1   . VAL A 1 411 ? 19.584  5.367   8.309   1.00 31.21  ? 411 VAL A CG1   1 
ATOM   3108 C CG2   . VAL A 1 411 ? 21.580  6.816   8.251   1.00 37.33  ? 411 VAL A CG2   1 
ATOM   3109 N N     . ALA A 1 412 ? 19.888  4.224   4.938   1.00 46.64  ? 412 ALA A N     1 
ATOM   3110 C CA    . ALA A 1 412 ? 19.033  3.285   4.211   1.00 45.32  ? 412 ALA A CA    1 
ATOM   3111 C C     . ALA A 1 412 ? 19.772  1.989   3.926   1.00 44.02  ? 412 ALA A C     1 
ATOM   3112 O O     . ALA A 1 412 ? 19.238  0.896   4.143   1.00 43.27  ? 412 ALA A O     1 
ATOM   3113 C CB    . ALA A 1 412 ? 18.541  3.916   2.911   1.00 42.41  ? 412 ALA A CB    1 
ATOM   3114 N N     . GLN A 1 413 ? 21.018  2.097   3.469   1.00 43.39  ? 413 GLN A N     1 
ATOM   3115 C CA    . GLN A 1 413 ? 21.841  0.916   3.237   1.00 45.68  ? 413 GLN A CA    1 
ATOM   3116 C C     . GLN A 1 413 ? 21.997  0.082   4.515   1.00 49.79  ? 413 GLN A C     1 
ATOM   3117 O O     . GLN A 1 413 ? 21.810  -1.140  4.502   1.00 51.06  ? 413 GLN A O     1 
ATOM   3118 C CB    . GLN A 1 413 ? 23.187  1.369   2.658   1.00 45.33  ? 413 GLN A CB    1 
ATOM   3119 C CG    . GLN A 1 413 ? 24.320  0.379   2.697   1.00 47.95  ? 413 GLN A CG    1 
ATOM   3120 C CD    . GLN A 1 413 ? 24.287  -0.621  1.564   1.00 61.53  ? 413 GLN A CD    1 
ATOM   3121 O OE1   . GLN A 1 413 ? 23.327  -0.684  0.786   1.00 62.44  ? 413 GLN A OE1   1 
ATOM   3122 N NE2   . GLN A 1 413 ? 25.339  -1.430  1.472   1.00 69.91  ? 413 GLN A NE2   1 
ATOM   3123 N N     . LEU A 1 414 ? 22.303  0.728   5.643   1.00 51.54  ? 414 LEU A N     1 
ATOM   3124 C CA    . LEU A 1 414 ? 22.529  -0.024  6.873   1.00 49.23  ? 414 LEU A CA    1 
ATOM   3125 C C     . LEU A 1 414 ? 21.243  -0.691  7.354   1.00 51.40  ? 414 LEU A C     1 
ATOM   3126 O O     . LEU A 1 414 ? 21.249  -1.868  7.733   1.00 50.92  ? 414 LEU A O     1 
ATOM   3127 C CB    . LEU A 1 414 ? 23.107  0.892   7.951   1.00 49.53  ? 414 LEU A CB    1 
ATOM   3128 C CG    . LEU A 1 414 ? 23.426  0.228   9.297   1.00 51.90  ? 414 LEU A CG    1 
ATOM   3129 C CD1   . LEU A 1 414 ? 24.901  0.360   9.652   1.00 50.58  ? 414 LEU A CD1   1 
ATOM   3130 C CD2   . LEU A 1 414 ? 22.583  0.838   10.368  1.00 46.41  ? 414 LEU A CD2   1 
ATOM   3131 N N     . ALA A 1 415 ? 20.128  0.045   7.343   1.00 47.33  ? 415 ALA A N     1 
ATOM   3132 C CA    . ALA A 1 415 ? 18.849  -0.555  7.703   1.00 45.40  ? 415 ALA A CA    1 
ATOM   3133 C C     . ALA A 1 415 ? 18.539  -1.769  6.832   1.00 52.90  ? 415 ALA A C     1 
ATOM   3134 O O     . ALA A 1 415 ? 17.989  -2.765  7.313   1.00 56.52  ? 415 ALA A O     1 
ATOM   3135 C CB    . ALA A 1 415 ? 17.739  0.482   7.582   1.00 41.70  ? 415 ALA A CB    1 
ATOM   3136 N N     . GLY A 1 416 ? 18.905  -1.714  5.553   1.00 49.54  ? 416 GLY A N     1 
ATOM   3137 C CA    . GLY A 1 416 ? 18.599  -2.817  4.662   1.00 53.28  ? 416 GLY A CA    1 
ATOM   3138 C C     . GLY A 1 416 ? 19.440  -4.054  4.918   1.00 53.63  ? 416 GLY A C     1 
ATOM   3139 O O     . GLY A 1 416 ? 18.942  -5.176  4.822   1.00 57.52  ? 416 GLY A O     1 
ATOM   3140 N N     . ARG A 1 417 ? 20.726  -3.875  5.224   1.00 52.68  ? 417 ARG A N     1 
ATOM   3141 C CA    . ARG A 1 417 ? 21.569  -5.029  5.524   1.00 52.10  ? 417 ARG A CA    1 
ATOM   3142 C C     . ARG A 1 417 ? 21.199  -5.653  6.864   1.00 54.56  ? 417 ARG A C     1 
ATOM   3143 O O     . ARG A 1 417 ? 21.008  -6.870  6.961   1.00 57.40  ? 417 ARG A O     1 
ATOM   3144 C CB    . ARG A 1 417 ? 23.038  -4.633  5.520   1.00 50.36  ? 417 ARG A CB    1 
ATOM   3145 C CG    . ARG A 1 417 ? 23.480  -3.869  4.292   1.00 57.70  ? 417 ARG A CG    1 
ATOM   3146 C CD    . ARG A 1 417 ? 23.375  -4.704  3.033   1.00 63.59  ? 417 ARG A CD    1 
ATOM   3147 N NE    . ARG A 1 417 ? 23.804  -6.082  3.235   1.00 64.12  ? 417 ARG A NE    1 
ATOM   3148 C CZ    . ARG A 1 417 ? 24.091  -6.930  2.254   1.00 67.00  ? 417 ARG A CZ    1 
ATOM   3149 N NH1   . ARG A 1 417 ? 24.010  -6.539  0.980   1.00 64.79  ? 417 ARG A NH1   1 
ATOM   3150 N NH2   . ARG A 1 417 ? 24.471  -8.166  2.554   1.00 65.64  ? 417 ARG A NH2   1 
ATOM   3151 N N     . LEU A 1 418 ? 21.113  -4.844  7.919   1.00 49.94  ? 418 LEU A N     1 
ATOM   3152 C CA    . LEU A 1 418 ? 20.753  -5.405  9.214   1.00 55.99  ? 418 LEU A CA    1 
ATOM   3153 C C     . LEU A 1 418 ? 19.434  -6.157  9.127   1.00 58.77  ? 418 LEU A C     1 
ATOM   3154 O O     . LEU A 1 418 ? 19.305  -7.260  9.670   1.00 61.34  ? 418 LEU A O     1 
ATOM   3155 C CB    . LEU A 1 418 ? 20.675  -4.309  10.280  1.00 51.49  ? 418 LEU A CB    1 
ATOM   3156 C CG    . LEU A 1 418 ? 21.905  -3.417  10.470  1.00 51.17  ? 418 LEU A CG    1 
ATOM   3157 C CD1   . LEU A 1 418 ? 21.741  -2.535  11.662  1.00 43.43  ? 418 LEU A CD1   1 
ATOM   3158 C CD2   . LEU A 1 418 ? 23.176  -4.219  10.586  1.00 56.72  ? 418 LEU A CD2   1 
ATOM   3159 N N     . ALA A 1 419 ? 18.447  -5.586  8.433   1.00 56.09  ? 419 ALA A N     1 
ATOM   3160 C CA    . ALA A 1 419 ? 17.153  -6.251  8.323   1.00 58.02  ? 419 ALA A CA    1 
ATOM   3161 C C     . ALA A 1 419 ? 17.296  -7.582  7.600   1.00 60.26  ? 419 ALA A C     1 
ATOM   3162 O O     . ALA A 1 419 ? 16.825  -8.623  8.070   1.00 63.54  ? 419 ALA A O     1 
ATOM   3163 C CB    . ALA A 1 419 ? 16.152  -5.347  7.605   1.00 53.84  ? 419 ALA A CB    1 
ATOM   3164 N N     . ALA A 1 420 ? 17.988  -7.578  6.474   1.00 59.57  ? 420 ALA A N     1 
ATOM   3165 C CA    . ALA A 1 420 ? 18.221  -8.831  5.782   1.00 59.86  ? 420 ALA A CA    1 
ATOM   3166 C C     . ALA A 1 420 ? 19.113  -9.786  6.571   1.00 58.46  ? 420 ALA A C     1 
ATOM   3167 O O     . ALA A 1 420 ? 19.281  -10.934 6.151   1.00 54.35  ? 420 ALA A O     1 
ATOM   3168 C CB    . ALA A 1 420 ? 18.821  -8.543  4.400   1.00 58.41  ? 420 ALA A CB    1 
ATOM   3169 N N     . GLN A 1 421 ? 19.681  -9.369  7.703   1.00 58.75  ? 421 GLN A N     1 
ATOM   3170 C CA    . GLN A 1 421 ? 20.629  -10.246 8.379   1.00 57.96  ? 421 GLN A CA    1 
ATOM   3171 C C     . GLN A 1 421 ? 20.287  -10.434 9.847   1.00 61.06  ? 421 GLN A C     1 
ATOM   3172 O O     . GLN A 1 421 ? 21.174  -10.639 10.679  1.00 65.51  ? 421 GLN A O     1 
ATOM   3173 C CB    . GLN A 1 421 ? 22.056  -9.742  8.195   1.00 55.35  ? 421 GLN A CB    1 
ATOM   3174 C CG    . GLN A 1 421 ? 22.446  -9.809  6.732   1.00 60.42  ? 421 GLN A CG    1 
ATOM   3175 C CD    . GLN A 1 421 ? 23.797  -9.206  6.421   1.00 65.60  ? 421 GLN A CD    1 
ATOM   3176 O OE1   . GLN A 1 421 ? 23.976  -8.586  5.363   1.00 63.29  ? 421 GLN A OE1   1 
ATOM   3177 N NE2   . GLN A 1 421 ? 24.767  -9.408  7.317   1.00 63.63  ? 421 GLN A NE2   1 
ATOM   3178 N N     . GLY A 1 422 ? 19.002  -10.395 10.178  1.00 62.96  ? 422 GLY A N     1 
ATOM   3179 C CA    . GLY A 1 422 ? 18.515  -10.880 11.448  1.00 64.77  ? 422 GLY A CA    1 
ATOM   3180 C C     . GLY A 1 422 ? 18.107  -9.814  12.432  1.00 67.42  ? 422 GLY A C     1 
ATOM   3181 O O     . GLY A 1 422 ? 17.365  -10.118 13.379  1.00 71.56  ? 422 GLY A O     1 
ATOM   3182 N N     . ALA A 1 423 ? 18.565  -8.580  12.255  1.00 67.01  ? 423 ALA A N     1 
ATOM   3183 C CA    . ALA A 1 423 ? 18.328  -7.575  13.278  1.00 65.71  ? 423 ALA A CA    1 
ATOM   3184 C C     . ALA A 1 423 ? 16.885  -7.105  13.239  1.00 60.37  ? 423 ALA A C     1 
ATOM   3185 O O     . ALA A 1 423 ? 16.211  -7.174  12.207  1.00 64.28  ? 423 ALA A O     1 
ATOM   3186 C CB    . ALA A 1 423 ? 19.272  -6.390  13.100  1.00 61.45  ? 423 ALA A CB    1 
ATOM   3187 N N     . ARG A 1 424 ? 16.402  -6.653  14.386  1.00 54.98  ? 424 ARG A N     1 
ATOM   3188 C CA    . ARG A 1 424 ? 15.117  -5.977  14.458  1.00 60.05  ? 424 ARG A CA    1 
ATOM   3189 C C     . ARG A 1 424 ? 15.388  -4.488  14.261  1.00 60.27  ? 424 ARG A C     1 
ATOM   3190 O O     . ARG A 1 424 ? 16.060  -3.858  15.086  1.00 59.96  ? 424 ARG A O     1 
ATOM   3191 C CB    . ARG A 1 424 ? 14.409  -6.255  15.784  1.00 56.13  ? 424 ARG A CB    1 
ATOM   3192 C CG    . ARG A 1 424 ? 13.011  -5.649  15.858  1.00 58.09  ? 424 ARG A CG    1 
ATOM   3193 C CD    . ARG A 1 424 ? 12.416  -5.678  17.266  1.00 73.36  ? 424 ARG A CD    1 
ATOM   3194 N NE    . ARG A 1 424 ? 12.704  -6.923  17.976  1.00 81.76  ? 424 ARG A NE    1 
ATOM   3195 C CZ    . ARG A 1 424 ? 12.024  -8.054  17.803  1.00 85.54  ? 424 ARG A CZ    1 
ATOM   3196 N NH1   . ARG A 1 424 ? 11.018  -8.100  16.930  1.00 86.30  ? 424 ARG A NH1   1 
ATOM   3197 N NH2   . ARG A 1 424 ? 12.365  -9.143  18.487  1.00 74.56  ? 424 ARG A NH2   1 
ATOM   3198 N N     . VAL A 1 425 ? 14.890  -3.932  13.160  1.00 55.76  ? 425 VAL A N     1 
ATOM   3199 C CA    . VAL A 1 425 ? 15.150  -2.550  12.777  1.00 53.80  ? 425 VAL A CA    1 
ATOM   3200 C C     . VAL A 1 425 ? 13.852  -1.765  12.898  1.00 54.02  ? 425 VAL A C     1 
ATOM   3201 O O     . VAL A 1 425 ? 12.799  -2.226  12.444  1.00 56.89  ? 425 VAL A O     1 
ATOM   3202 C CB    . VAL A 1 425 ? 15.703  -2.465  11.342  1.00 52.99  ? 425 VAL A CB    1 
ATOM   3203 C CG1   . VAL A 1 425 ? 15.693  -1.020  10.848  1.00 51.28  ? 425 VAL A CG1   1 
ATOM   3204 C CG2   . VAL A 1 425 ? 17.091  -3.090  11.241  1.00 51.73  ? 425 VAL A CG2   1 
ATOM   3205 N N     . TYR A 1 426 ? 13.922  -0.587  13.509  1.00 50.91  ? 426 TYR A N     1 
ATOM   3206 C CA    . TYR A 1 426 ? 12.831  0.378   13.498  1.00 50.59  ? 426 TYR A CA    1 
ATOM   3207 C C     . TYR A 1 426 ? 13.336  1.664   12.865  1.00 46.67  ? 426 TYR A C     1 
ATOM   3208 O O     . TYR A 1 426 ? 14.376  2.185   13.275  1.00 47.53  ? 426 TYR A O     1 
ATOM   3209 C CB    . TYR A 1 426 ? 12.319  0.649   14.908  1.00 51.91  ? 426 TYR A CB    1 
ATOM   3210 C CG    . TYR A 1 426 ? 11.490  -0.462  15.493  1.00 55.62  ? 426 TYR A CG    1 
ATOM   3211 C CD1   . TYR A 1 426 ? 12.069  -1.460  16.275  1.00 56.88  ? 426 TYR A CD1   1 
ATOM   3212 C CD2   . TYR A 1 426 ? 10.122  -0.515  15.274  1.00 57.23  ? 426 TYR A CD2   1 
ATOM   3213 C CE1   . TYR A 1 426 ? 11.300  -2.488  16.820  1.00 59.05  ? 426 TYR A CE1   1 
ATOM   3214 C CE2   . TYR A 1 426 ? 9.346   -1.535  15.812  1.00 63.51  ? 426 TYR A CE2   1 
ATOM   3215 C CZ    . TYR A 1 426 ? 9.935   -2.518  16.582  1.00 63.89  ? 426 TYR A CZ    1 
ATOM   3216 O OH    . TYR A 1 426 ? 9.134   -3.511  17.103  1.00 66.45  ? 426 TYR A OH    1 
ATOM   3217 N N     . ALA A 1 427 ? 12.612  2.180   11.873  1.00 46.89  ? 427 ALA A N     1 
ATOM   3218 C CA    . ALA A 1 427 ? 13.106  3.296   11.073  1.00 46.43  ? 427 ALA A CA    1 
ATOM   3219 C C     . ALA A 1 427 ? 12.134  4.465   11.115  1.00 49.93  ? 427 ALA A C     1 
ATOM   3220 O O     . ALA A 1 427 ? 10.915  4.271   11.100  1.00 53.55  ? 427 ALA A O     1 
ATOM   3221 C CB    . ALA A 1 427 ? 13.357  2.878   9.625   1.00 41.48  ? 427 ALA A CB    1 
ATOM   3222 N N     . TYR A 1 428 ? 12.682  5.683   11.168  1.00 48.12  ? 428 TYR A N     1 
ATOM   3223 C CA    . TYR A 1 428 ? 11.882  6.899   11.248  1.00 47.24  ? 428 TYR A CA    1 
ATOM   3224 C C     . TYR A 1 428 ? 12.493  7.961   10.342  1.00 46.61  ? 428 TYR A C     1 
ATOM   3225 O O     . TYR A 1 428 ? 13.682  7.919   10.018  1.00 44.68  ? 428 TYR A O     1 
ATOM   3226 C CB    . TYR A 1 428 ? 11.794  7.452   12.692  1.00 42.15  ? 428 TYR A CB    1 
ATOM   3227 C CG    . TYR A 1 428 ? 13.107  8.050   13.159  1.00 44.25  ? 428 TYR A CG    1 
ATOM   3228 C CD1   . TYR A 1 428 ? 13.402  9.396   12.950  1.00 43.92  ? 428 TYR A CD1   1 
ATOM   3229 C CD2   . TYR A 1 428 ? 14.070  7.261   13.766  1.00 43.58  ? 428 TYR A CD2   1 
ATOM   3230 C CE1   . TYR A 1 428 ? 14.622  9.933   13.344  1.00 42.71  ? 428 TYR A CE1   1 
ATOM   3231 C CE2   . TYR A 1 428 ? 15.277  7.793   14.180  1.00 41.80  ? 428 TYR A CE2   1 
ATOM   3232 C CZ    . TYR A 1 428 ? 15.552  9.122   13.958  1.00 42.65  ? 428 TYR A CZ    1 
ATOM   3233 O OH    . TYR A 1 428 ? 16.761  9.644   14.361  1.00 44.24  ? 428 TYR A OH    1 
ATOM   3234 N N     . ILE A 1 429 ? 11.659  8.926   9.951   1.00 46.07  ? 429 ILE A N     1 
ATOM   3235 C CA    . ILE A 1 429 ? 12.102  10.216  9.440   1.00 41.30  ? 429 ILE A CA    1 
ATOM   3236 C C     . ILE A 1 429 ? 11.525  11.291  10.356  1.00 49.48  ? 429 ILE A C     1 
ATOM   3237 O O     . ILE A 1 429 ? 10.341  11.239  10.726  1.00 48.66  ? 429 ILE A O     1 
ATOM   3238 C CB    . ILE A 1 429 ? 11.683  10.438  7.974   1.00 45.40  ? 429 ILE A CB    1 
ATOM   3239 C CG1   . ILE A 1 429 ? 12.163  11.796  7.461   1.00 45.74  ? 429 ILE A CG1   1 
ATOM   3240 C CG2   . ILE A 1 429 ? 10.189  10.366  7.816   1.00 49.86  ? 429 ILE A CG2   1 
ATOM   3241 C CD1   . ILE A 1 429 ? 12.547  11.768  5.991   1.00 41.78  ? 429 ILE A CD1   1 
ATOM   3242 N N     . PHE A 1 430 ? 12.367  12.240  10.750  1.00 45.97  ? 430 PHE A N     1 
ATOM   3243 C CA    . PHE A 1 430 ? 11.976  13.314  11.648  1.00 45.59  ? 430 PHE A CA    1 
ATOM   3244 C C     . PHE A 1 430 ? 11.681  14.550  10.808  1.00 46.95  ? 430 PHE A C     1 
ATOM   3245 O O     . PHE A 1 430 ? 12.578  15.073  10.135  1.00 45.52  ? 430 PHE A O     1 
ATOM   3246 C CB    . PHE A 1 430 ? 13.087  13.581  12.661  1.00 43.03  ? 430 PHE A CB    1 
ATOM   3247 C CG    . PHE A 1 430 ? 12.743  14.611  13.676  1.00 44.18  ? 430 PHE A CG    1 
ATOM   3248 C CD1   . PHE A 1 430 ? 13.067  15.939  13.472  1.00 45.00  ? 430 PHE A CD1   1 
ATOM   3249 C CD2   . PHE A 1 430 ? 12.110  14.251  14.858  1.00 48.17  ? 430 PHE A CD2   1 
ATOM   3250 C CE1   . PHE A 1 430 ? 12.751  16.896  14.432  1.00 47.22  ? 430 PHE A CE1   1 
ATOM   3251 C CE2   . PHE A 1 430 ? 11.798  15.199  15.822  1.00 45.33  ? 430 PHE A CE2   1 
ATOM   3252 C CZ    . PHE A 1 430 ? 12.114  16.522  15.607  1.00 45.29  ? 430 PHE A CZ    1 
ATOM   3253 N N     . GLU A 1 431 ? 10.431  15.012  10.845  1.00 47.19  ? 431 GLU A N     1 
ATOM   3254 C CA    . GLU A 1 431 ? 9.960   16.010  9.898   1.00 46.11  ? 431 GLU A CA    1 
ATOM   3255 C C     . GLU A 1 431 ? 9.533   17.324  10.520  1.00 47.63  ? 431 GLU A C     1 
ATOM   3256 O O     . GLU A 1 431 ? 9.227   18.258  9.774   1.00 49.15  ? 431 GLU A O     1 
ATOM   3257 C CB    . GLU A 1 431 ? 8.768   15.471  9.093   1.00 47.35  ? 431 GLU A CB    1 
ATOM   3258 C CG    . GLU A 1 431 ? 9.092   14.347  8.141   1.00 51.62  ? 431 GLU A CG    1 
ATOM   3259 C CD    . GLU A 1 431 ? 7.865   13.858  7.376   1.00 57.39  ? 431 GLU A CD    1 
ATOM   3260 O OE1   . GLU A 1 431 ? 6.733   13.983  7.900   1.00 52.59  ? 431 GLU A OE1   1 
ATOM   3261 O OE2   . GLU A 1 431 ? 8.037   13.352  6.242   1.00 57.78  ? 431 GLU A OE2   1 
ATOM   3262 N N     . HIS A 1 432 ? 9.460   17.425  11.841  1.00 46.68  ? 432 HIS A N     1 
ATOM   3263 C CA    . HIS A 1 432 ? 8.978   18.643  12.473  1.00 46.75  ? 432 HIS A CA    1 
ATOM   3264 C C     . HIS A 1 432 ? 10.123  19.613  12.698  1.00 48.34  ? 432 HIS A C     1 
ATOM   3265 O O     . HIS A 1 432 ? 11.154  19.257  13.272  1.00 53.56  ? 432 HIS A O     1 
ATOM   3266 C CB    . HIS A 1 432 ? 8.300   18.370  13.811  1.00 48.33  ? 432 HIS A CB    1 
ATOM   3267 C CG    . HIS A 1 432 ? 8.135   19.606  14.633  1.00 49.58  ? 432 HIS A CG    1 
ATOM   3268 N ND1   . HIS A 1 432 ? 7.226   20.589  14.312  1.00 49.56  ? 432 HIS A ND1   1 
ATOM   3269 C CD2   . HIS A 1 432 ? 8.804   20.052  15.722  1.00 50.52  ? 432 HIS A CD2   1 
ATOM   3270 C CE1   . HIS A 1 432 ? 7.319   21.575  15.188  1.00 53.50  ? 432 HIS A CE1   1 
ATOM   3271 N NE2   . HIS A 1 432 ? 8.269   21.274  16.055  1.00 50.87  ? 432 HIS A NE2   1 
ATOM   3272 N N     . ARG A 1 433 ? 9.920   20.846  12.304  1.00 48.49  ? 433 ARG A N     1 
ATOM   3273 C CA    . ARG A 1 433 ? 10.947  21.859  12.408  1.00 46.83  ? 433 ARG A CA    1 
ATOM   3274 C C     . ARG A 1 433 ? 10.641  22.762  13.596  1.00 51.20  ? 433 ARG A C     1 
ATOM   3275 O O     . ARG A 1 433 ? 9.581   23.402  13.638  1.00 48.28  ? 433 ARG A O     1 
ATOM   3276 C CB    . ARG A 1 433 ? 10.993  22.646  11.108  1.00 44.44  ? 433 ARG A CB    1 
ATOM   3277 C CG    . ARG A 1 433 ? 11.916  23.789  11.169  1.00 49.50  ? 433 ARG A CG    1 
ATOM   3278 C CD    . ARG A 1 433 ? 11.586  24.789  10.109  1.00 47.08  ? 433 ARG A CD    1 
ATOM   3279 N NE    . ARG A 1 433 ? 12.081  26.105  10.440  1.00 53.19  ? 433 ARG A NE    1 
ATOM   3280 C CZ    . ARG A 1 433 ? 13.241  26.591  9.985   1.00 53.96  ? 433 ARG A CZ    1 
ATOM   3281 N NH1   . ARG A 1 433 ? 14.051  25.886  9.188   1.00 50.95  ? 433 ARG A NH1   1 
ATOM   3282 N NH2   . ARG A 1 433 ? 13.616  27.808  10.326  1.00 51.98  ? 433 ARG A NH2   1 
ATOM   3283 N N     . ALA A 1 434 ? 11.573  22.827  14.548  1.00 52.80  ? 434 ALA A N     1 
ATOM   3284 C CA    . ALA A 1 434 ? 11.325  23.516  15.807  1.00 47.06  ? 434 ALA A CA    1 
ATOM   3285 C C     . ALA A 1 434 ? 10.984  24.983  15.577  1.00 52.41  ? 434 ALA A C     1 
ATOM   3286 O O     . ALA A 1 434 ? 11.694  25.696  14.862  1.00 49.50  ? 434 ALA A O     1 
ATOM   3287 C CB    . ALA A 1 434 ? 12.546  23.404  16.707  1.00 48.59  ? 434 ALA A CB    1 
ATOM   3288 N N     . SER A 1 435 ? 9.898   25.437  16.205  1.00 53.10  ? 435 SER A N     1 
ATOM   3289 C CA    . SER A 1 435 ? 9.534   26.846  16.118  1.00 47.17  ? 435 SER A CA    1 
ATOM   3290 C C     . SER A 1 435 ? 10.671  27.749  16.568  1.00 47.52  ? 435 SER A C     1 
ATOM   3291 O O     . SER A 1 435 ? 10.821  28.852  16.044  1.00 47.85  ? 435 SER A O     1 
ATOM   3292 C CB    . SER A 1 435 ? 8.291   27.111  16.960  1.00 49.33  ? 435 SER A CB    1 
ATOM   3293 O OG    . SER A 1 435 ? 8.526   26.792  18.323  1.00 55.59  ? 435 SER A OG    1 
ATOM   3294 N N     . THR A 1 436 ? 11.485  27.292  17.525  1.00 52.57  ? 436 THR A N     1 
ATOM   3295 C CA    . THR A 1 436 ? 12.565  28.056  18.150  1.00 50.88  ? 436 THR A CA    1 
ATOM   3296 C C     . THR A 1 436 ? 13.818  28.175  17.293  1.00 52.69  ? 436 THR A C     1 
ATOM   3297 O O     . THR A 1 436 ? 14.813  28.727  17.766  1.00 56.21  ? 436 THR A O     1 
ATOM   3298 C CB    . THR A 1 436 ? 12.975  27.392  19.464  1.00 53.03  ? 436 THR A CB    1 
ATOM   3299 O OG1   . THR A 1 436 ? 13.536  26.094  19.180  1.00 53.00  ? 436 THR A OG1   1 
ATOM   3300 C CG2   . THR A 1 436 ? 11.772  27.238  20.383  1.00 52.75  ? 436 THR A CG2   1 
ATOM   3301 N N     . LEU A 1 437 ? 13.803  27.660  16.069  1.00 49.28  ? 437 LEU A N     1 
ATOM   3302 C CA    . LEU A 1 437 ? 15.034  27.428  15.329  1.00 49.19  ? 437 LEU A CA    1 
ATOM   3303 C C     . LEU A 1 437 ? 15.459  28.691  14.593  1.00 49.15  ? 437 LEU A C     1 
ATOM   3304 O O     . LEU A 1 437 ? 14.629  29.386  14.006  1.00 50.34  ? 437 LEU A O     1 
ATOM   3305 C CB    . LEU A 1 437 ? 14.831  26.256  14.370  1.00 50.13  ? 437 LEU A CB    1 
ATOM   3306 C CG    . LEU A 1 437 ? 15.836  25.941  13.277  1.00 49.23  ? 437 LEU A CG    1 
ATOM   3307 C CD1   . LEU A 1 437 ? 17.255  25.761  13.830  1.00 51.72  ? 437 LEU A CD1   1 
ATOM   3308 C CD2   . LEU A 1 437 ? 15.347  24.673  12.611  1.00 45.29  ? 437 LEU A CD2   1 
ATOM   3309 N N     . THR A 1 438 ? 16.756  29.003  14.652  1.00 49.37  ? 438 THR A N     1 
ATOM   3310 C CA    . THR A 1 438 ? 17.285  30.265  14.153  1.00 49.49  ? 438 THR A CA    1 
ATOM   3311 C C     . THR A 1 438 ? 17.938  30.160  12.777  1.00 52.98  ? 438 THR A C     1 
ATOM   3312 O O     . THR A 1 438 ? 18.415  31.173  12.257  1.00 52.95  ? 438 THR A O     1 
ATOM   3313 C CB    . THR A 1 438 ? 18.289  30.847  15.153  1.00 50.30  ? 438 THR A CB    1 
ATOM   3314 O OG1   . THR A 1 438 ? 19.393  29.949  15.312  1.00 56.34  ? 438 THR A OG1   1 
ATOM   3315 C CG2   . THR A 1 438 ? 17.641  31.020  16.480  1.00 50.43  ? 438 THR A CG2   1 
ATOM   3316 N N     . TRP A 1 439 ? 17.965  28.980  12.166  1.00 50.89  ? 439 TRP A N     1 
ATOM   3317 C CA    . TRP A 1 439 ? 18.440  28.883  10.794  1.00 49.92  ? 439 TRP A CA    1 
ATOM   3318 C C     . TRP A 1 439 ? 17.334  29.290  9.825   1.00 47.70  ? 439 TRP A C     1 
ATOM   3319 O O     . TRP A 1 439 ? 16.147  29.218  10.163  1.00 43.94  ? 439 TRP A O     1 
ATOM   3320 C CB    . TRP A 1 439 ? 18.909  27.459  10.488  1.00 51.99  ? 439 TRP A CB    1 
ATOM   3321 C CG    . TRP A 1 439 ? 20.193  27.082  11.143  1.00 48.64  ? 439 TRP A CG    1 
ATOM   3322 C CD1   . TRP A 1 439 ? 20.346  26.299  12.241  1.00 48.79  ? 439 TRP A CD1   1 
ATOM   3323 C CD2   . TRP A 1 439 ? 21.508  27.483  10.747  1.00 47.90  ? 439 TRP A CD2   1 
ATOM   3324 N NE1   . TRP A 1 439 ? 21.675  26.187  12.564  1.00 50.28  ? 439 TRP A NE1   1 
ATOM   3325 C CE2   . TRP A 1 439 ? 22.412  26.904  11.660  1.00 50.78  ? 439 TRP A CE2   1 
ATOM   3326 C CE3   . TRP A 1 439 ? 22.008  28.278  9.717   1.00 47.21  ? 439 TRP A CE3   1 
ATOM   3327 C CZ2   . TRP A 1 439 ? 23.791  27.088  11.570  1.00 51.23  ? 439 TRP A CZ2   1 
ATOM   3328 C CZ3   . TRP A 1 439 ? 23.375  28.460  9.625   1.00 52.67  ? 439 TRP A CZ3   1 
ATOM   3329 C CH2   . TRP A 1 439 ? 24.252  27.867  10.549  1.00 56.36  ? 439 TRP A CH2   1 
ATOM   3330 N N     . PRO A 1 440 ? 17.699  29.705  8.604   1.00 51.09  ? 440 PRO A N     1 
ATOM   3331 C CA    . PRO A 1 440 ? 16.688  30.104  7.618   1.00 41.09  ? 440 PRO A CA    1 
ATOM   3332 C C     . PRO A 1 440 ? 15.740  28.964  7.300   1.00 43.41  ? 440 PRO A C     1 
ATOM   3333 O O     . PRO A 1 440 ? 16.034  27.793  7.532   1.00 48.46  ? 440 PRO A O     1 
ATOM   3334 C CB    . PRO A 1 440 ? 17.525  30.491  6.394   1.00 42.98  ? 440 PRO A CB    1 
ATOM   3335 C CG    . PRO A 1 440 ? 18.804  29.784  6.565   1.00 45.68  ? 440 PRO A CG    1 
ATOM   3336 C CD    . PRO A 1 440 ? 19.060  29.803  8.038   1.00 51.59  ? 440 PRO A CD    1 
ATOM   3337 N N     . LEU A 1 441 ? 14.570  29.324  6.776   1.00 44.57  ? 441 LEU A N     1 
ATOM   3338 C CA    . LEU A 1 441 ? 13.557  28.311  6.505   1.00 44.65  ? 441 LEU A CA    1 
ATOM   3339 C C     . LEU A 1 441 ? 13.951  27.425  5.353   1.00 43.61  ? 441 LEU A C     1 
ATOM   3340 O O     . LEU A 1 441 ? 13.532  26.266  5.307   1.00 44.65  ? 441 LEU A O     1 
ATOM   3341 C CB    . LEU A 1 441 ? 12.197  28.936  6.222   1.00 41.32  ? 441 LEU A CB    1 
ATOM   3342 C CG    . LEU A 1 441 ? 11.715  29.694  7.458   1.00 63.26  ? 441 LEU A CG    1 
ATOM   3343 C CD1   . LEU A 1 441 ? 12.232  31.138  7.496   1.00 63.91  ? 441 LEU A CD1   1 
ATOM   3344 C CD2   . LEU A 1 441 ? 10.195  29.598  7.666   1.00 67.25  ? 441 LEU A CD2   1 
ATOM   3345 N N     . TRP A 1 442 ? 14.765  27.935  4.427   1.00 45.38  ? 442 TRP A N     1 
ATOM   3346 C CA    . TRP A 1 442 ? 15.102  27.127  3.269   1.00 45.06  ? 442 TRP A CA    1 
ATOM   3347 C C     . TRP A 1 442 ? 15.891  25.897  3.670   1.00 47.17  ? 442 TRP A C     1 
ATOM   3348 O O     . TRP A 1 442 ? 15.887  24.908  2.926   1.00 48.02  ? 442 TRP A O     1 
ATOM   3349 C CB    . TRP A 1 442 ? 15.863  27.950  2.223   1.00 44.26  ? 442 TRP A CB    1 
ATOM   3350 C CG    . TRP A 1 442 ? 17.271  28.341  2.561   1.00 44.66  ? 442 TRP A CG    1 
ATOM   3351 C CD1   . TRP A 1 442 ? 17.694  29.568  2.986   1.00 48.11  ? 442 TRP A CD1   1 
ATOM   3352 C CD2   . TRP A 1 442 ? 18.452  27.526  2.448   1.00 42.93  ? 442 TRP A CD2   1 
ATOM   3353 N NE1   . TRP A 1 442 ? 19.062  29.566  3.155   1.00 47.49  ? 442 TRP A NE1   1 
ATOM   3354 C CE2   . TRP A 1 442 ? 19.549  28.324  2.841   1.00 42.58  ? 442 TRP A CE2   1 
ATOM   3355 C CE3   . TRP A 1 442 ? 18.688  26.203  2.055   1.00 40.57  ? 442 TRP A CE3   1 
ATOM   3356 C CZ2   . TRP A 1 442 ? 20.857  27.840  2.870   1.00 41.63  ? 442 TRP A CZ2   1 
ATOM   3357 C CZ3   . TRP A 1 442 ? 19.995  25.724  2.076   1.00 41.59  ? 442 TRP A CZ3   1 
ATOM   3358 C CH2   . TRP A 1 442 ? 21.060  26.542  2.484   1.00 44.02  ? 442 TRP A CH2   1 
ATOM   3359 N N     . MET A 1 443 ? 16.541  25.926  4.839   1.00 44.28  ? 443 MET A N     1 
ATOM   3360 C CA    . MET A 1 443 ? 17.285  24.776  5.324   1.00 42.37  ? 443 MET A CA    1 
ATOM   3361 C C     . MET A 1 443 ? 16.385  23.678  5.871   1.00 46.19  ? 443 MET A C     1 
ATOM   3362 O O     . MET A 1 443 ? 16.887  22.590  6.181   1.00 43.65  ? 443 MET A O     1 
ATOM   3363 C CB    . MET A 1 443 ? 18.279  25.201  6.398   1.00 43.00  ? 443 MET A CB    1 
ATOM   3364 C CG    . MET A 1 443 ? 19.308  26.187  5.914   1.00 44.87  ? 443 MET A CG    1 
ATOM   3365 S SD    . MET A 1 443 ? 20.715  26.189  7.029   1.00 46.38  ? 443 MET A SD    1 
ATOM   3366 C CE    . MET A 1 443 ? 21.675  27.564  6.439   1.00 48.13  ? 443 MET A CE    1 
ATOM   3367 N N     . GLY A 1 444 ? 15.083  23.927  5.990   1.00 45.52  ? 444 GLY A N     1 
ATOM   3368 C CA    . GLY A 1 444 ? 14.163  22.854  6.355   1.00 43.14  ? 444 GLY A CA    1 
ATOM   3369 C C     . GLY A 1 444 ? 14.369  22.414  7.790   1.00 46.87  ? 444 GLY A C     1 
ATOM   3370 O O     . GLY A 1 444 ? 14.461  23.245  8.703   1.00 46.50  ? 444 GLY A O     1 
ATOM   3371 N N     . VAL A 1 445 ? 14.421  21.095  7.994   1.00 46.80  ? 445 VAL A N     1 
ATOM   3372 C CA    . VAL A 1 445 ? 14.769  20.460  9.268   1.00 42.73  ? 445 VAL A CA    1 
ATOM   3373 C C     . VAL A 1 445 ? 16.230  20.025  9.190   1.00 42.37  ? 445 VAL A C     1 
ATOM   3374 O O     . VAL A 1 445 ? 16.528  18.939  8.667   1.00 40.73  ? 445 VAL A O     1 
ATOM   3375 C CB    . VAL A 1 445 ? 13.852  19.263  9.567   1.00 42.79  ? 445 VAL A CB    1 
ATOM   3376 C CG1   . VAL A 1 445 ? 14.293  18.545  10.842  1.00 42.41  ? 445 VAL A CG1   1 
ATOM   3377 C CG2   . VAL A 1 445 ? 12.424  19.709  9.677   1.00 39.78  ? 445 VAL A CG2   1 
ATOM   3378 N N     . PRO A 1 446 ? 17.167  20.836  9.669   1.00 37.37  ? 446 PRO A N     1 
ATOM   3379 C CA    . PRO A 1 446 ? 18.584  20.541  9.456   1.00 36.82  ? 446 PRO A CA    1 
ATOM   3380 C C     . PRO A 1 446 ? 19.126  19.450  10.374  1.00 43.33  ? 446 PRO A C     1 
ATOM   3381 O O     . PRO A 1 446 ? 18.565  19.110  11.420  1.00 41.11  ? 446 PRO A O     1 
ATOM   3382 C CB    . PRO A 1 446 ? 19.274  21.875  9.745   1.00 35.24  ? 446 PRO A CB    1 
ATOM   3383 C CG    . PRO A 1 446 ? 18.187  22.887  9.823   1.00 38.04  ? 446 PRO A CG    1 
ATOM   3384 C CD    . PRO A 1 446 ? 16.957  22.182  10.212  1.00 38.87  ? 446 PRO A CD    1 
ATOM   3385 N N     . HIS A 1 447 ? 20.246  18.893  9.923   1.00 46.74  ? 447 HIS A N     1 
ATOM   3386 C CA    . HIS A 1 447 ? 21.061  17.915  10.627  1.00 39.47  ? 447 HIS A CA    1 
ATOM   3387 C C     . HIS A 1 447 ? 21.248  18.317  12.080  1.00 44.59  ? 447 HIS A C     1 
ATOM   3388 O O     . HIS A 1 447 ? 21.742  19.410  12.372  1.00 44.87  ? 447 HIS A O     1 
ATOM   3389 C CB    . HIS A 1 447 ? 22.417  17.829  9.920   1.00 39.65  ? 447 HIS A CB    1 
ATOM   3390 C CG    . HIS A 1 447 ? 23.256  16.661  10.319  1.00 40.41  ? 447 HIS A CG    1 
ATOM   3391 N ND1   . HIS A 1 447 ? 22.855  15.357  10.125  1.00 41.87  ? 447 HIS A ND1   1 
ATOM   3392 C CD2   . HIS A 1 447 ? 24.501  16.599  10.849  1.00 40.43  ? 447 HIS A CD2   1 
ATOM   3393 C CE1   . HIS A 1 447 ? 23.805  14.540  10.549  1.00 40.59  ? 447 HIS A CE1   1 
ATOM   3394 N NE2   . HIS A 1 447 ? 24.815  15.268  10.992  1.00 40.43  ? 447 HIS A NE2   1 
ATOM   3395 N N     . GLY A 1 448 ? 20.840  17.433  12.991  1.00 41.58  ? 448 GLY A N     1 
ATOM   3396 C CA    . GLY A 1 448 ? 21.033  17.634  14.404  1.00 39.37  ? 448 GLY A CA    1 
ATOM   3397 C C     . GLY A 1 448 ? 19.868  18.242  15.159  1.00 43.42  ? 448 GLY A C     1 
ATOM   3398 O O     . GLY A 1 448 ? 19.997  18.471  16.368  1.00 45.80  ? 448 GLY A O     1 
ATOM   3399 N N     . TYR A 1 449 ? 18.734  18.503  14.512  1.00 40.83  ? 449 TYR A N     1 
ATOM   3400 C CA    . TYR A 1 449 ? 17.673  19.273  15.153  1.00 41.52  ? 449 TYR A CA    1 
ATOM   3401 C C     . TYR A 1 449 ? 16.479  18.420  15.559  1.00 42.38  ? 449 TYR A C     1 
ATOM   3402 O O     . TYR A 1 449 ? 15.399  18.958  15.831  1.00 42.02  ? 449 TYR A O     1 
ATOM   3403 C CB    . TYR A 1 449 ? 17.262  20.448  14.264  1.00 40.18  ? 449 TYR A CB    1 
ATOM   3404 C CG    . TYR A 1 449 ? 18.267  21.560  14.434  1.00 44.45  ? 449 TYR A CG    1 
ATOM   3405 C CD1   . TYR A 1 449 ? 19.311  21.727  13.533  1.00 42.54  ? 449 TYR A CD1   1 
ATOM   3406 C CD2   . TYR A 1 449 ? 18.227  22.392  15.554  1.00 42.83  ? 449 TYR A CD2   1 
ATOM   3407 C CE1   . TYR A 1 449 ? 20.263  22.716  13.728  1.00 42.02  ? 449 TYR A CE1   1 
ATOM   3408 C CE2   . TYR A 1 449 ? 19.164  23.379  15.746  1.00 38.83  ? 449 TYR A CE2   1 
ATOM   3409 C CZ    . TYR A 1 449 ? 20.172  23.535  14.840  1.00 40.20  ? 449 TYR A CZ    1 
ATOM   3410 O OH    . TYR A 1 449 ? 21.096  24.517  15.037  1.00 46.47  ? 449 TYR A OH    1 
ATOM   3411 N N     . GLU A 1 450 ? 16.660  17.096  15.620  1.00 42.92  ? 450 GLU A N     1 
ATOM   3412 C CA    . GLU A 1 450 ? 15.775  16.238  16.397  1.00 41.72  ? 450 GLU A CA    1 
ATOM   3413 C C     . GLU A 1 450 ? 16.209  16.162  17.857  1.00 41.60  ? 450 GLU A C     1 
ATOM   3414 O O     . GLU A 1 450 ? 15.375  15.891  18.725  1.00 40.90  ? 450 GLU A O     1 
ATOM   3415 C CB    . GLU A 1 450 ? 15.746  14.832  15.795  1.00 37.22  ? 450 GLU A CB    1 
ATOM   3416 C CG    . GLU A 1 450 ? 16.935  13.981  16.151  1.00 41.07  ? 450 GLU A CG    1 
ATOM   3417 C CD    . GLU A 1 450 ? 18.133  14.237  15.290  1.00 42.66  ? 450 GLU A CD    1 
ATOM   3418 O OE1   . GLU A 1 450 ? 18.393  15.423  14.978  1.00 41.28  ? 450 GLU A OE1   1 
ATOM   3419 O OE2   . GLU A 1 450 ? 18.845  13.253  14.980  1.00 47.15  ? 450 GLU A OE2   1 
ATOM   3420 N N     . ILE A 1 451 ? 17.482  16.453  18.135  1.00 41.60  ? 451 ILE A N     1 
ATOM   3421 C CA    . ILE A 1 451 ? 18.100  16.077  19.403  1.00 43.11  ? 451 ILE A CA    1 
ATOM   3422 C C     . ILE A 1 451 ? 17.413  16.785  20.565  1.00 45.53  ? 451 ILE A C     1 
ATOM   3423 O O     . ILE A 1 451 ? 17.056  16.159  21.573  1.00 43.48  ? 451 ILE A O     1 
ATOM   3424 C CB    . ILE A 1 451 ? 19.609  16.380  19.363  1.00 40.06  ? 451 ILE A CB    1 
ATOM   3425 C CG1   . ILE A 1 451 ? 20.233  15.788  18.087  1.00 41.09  ? 451 ILE A CG1   1 
ATOM   3426 C CG2   . ILE A 1 451 ? 20.266  15.857  20.607  1.00 33.58  ? 451 ILE A CG2   1 
ATOM   3427 C CD1   . ILE A 1 451 ? 21.725  16.035  17.923  1.00 38.71  ? 451 ILE A CD1   1 
ATOM   3428 N N     . GLU A 1 452 ? 17.196  18.099  20.428  1.00 46.57  ? 452 GLU A N     1 
ATOM   3429 C CA    . GLU A 1 452 ? 16.504  18.861  21.458  1.00 46.03  ? 452 GLU A CA    1 
ATOM   3430 C C     . GLU A 1 452 ? 15.124  18.284  21.750  1.00 47.53  ? 452 GLU A C     1 
ATOM   3431 O O     . GLU A 1 452 ? 14.606  18.475  22.855  1.00 47.25  ? 452 GLU A O     1 
ATOM   3432 C CB    . GLU A 1 452 ? 16.426  20.352  21.056  1.00 45.20  ? 452 GLU A CB    1 
ATOM   3433 C CG    . GLU A 1 452 ? 15.745  20.665  19.714  1.00 45.34  ? 452 GLU A CG    1 
ATOM   3434 C CD    . GLU A 1 452 ? 16.176  22.009  19.113  1.00 51.01  ? 452 GLU A CD    1 
ATOM   3435 O OE1   . GLU A 1 452 ? 15.330  22.931  18.966  1.00 53.19  ? 452 GLU A OE1   1 
ATOM   3436 O OE2   . GLU A 1 452 ? 17.378  22.149  18.791  1.00 50.91  ? 452 GLU A OE2   1 
ATOM   3437 N N     . PHE A 1 453 ? 14.533  17.545  20.812  1.00 43.65  ? 453 PHE A N     1 
ATOM   3438 C CA    . PHE A 1 453 ? 13.239  16.940  21.096  1.00 45.96  ? 453 PHE A CA    1 
ATOM   3439 C C     . PHE A 1 453 ? 13.357  15.573  21.755  1.00 48.68  ? 453 PHE A C     1 
ATOM   3440 O O     . PHE A 1 453 ? 12.521  15.228  22.593  1.00 51.53  ? 453 PHE A O     1 
ATOM   3441 C CB    . PHE A 1 453 ? 12.414  16.833  19.817  1.00 45.98  ? 453 PHE A CB    1 
ATOM   3442 C CG    . PHE A 1 453 ? 11.962  18.156  19.295  1.00 47.10  ? 453 PHE A CG    1 
ATOM   3443 C CD1   . PHE A 1 453 ? 10.771  18.707  19.731  1.00 44.31  ? 453 PHE A CD1   1 
ATOM   3444 C CD2   . PHE A 1 453 ? 12.740  18.861  18.385  1.00 45.42  ? 453 PHE A CD2   1 
ATOM   3445 C CE1   . PHE A 1 453 ? 10.357  19.929  19.267  1.00 47.94  ? 453 PHE A CE1   1 
ATOM   3446 C CE2   . PHE A 1 453 ? 12.335  20.085  17.911  1.00 45.65  ? 453 PHE A CE2   1 
ATOM   3447 C CZ    . PHE A 1 453 ? 11.142  20.626  18.351  1.00 49.56  ? 453 PHE A CZ    1 
ATOM   3448 N N     . ILE A 1 454 ? 14.373  14.782  21.401  1.00 46.54  ? 454 ILE A N     1 
ATOM   3449 C CA    . ILE A 1 454 ? 14.543  13.482  22.039  1.00 44.08  ? 454 ILE A CA    1 
ATOM   3450 C C     . ILE A 1 454 ? 14.882  13.656  23.506  1.00 45.67  ? 454 ILE A C     1 
ATOM   3451 O O     . ILE A 1 454 ? 14.420  12.890  24.353  1.00 46.96  ? 454 ILE A O     1 
ATOM   3452 C CB    . ILE A 1 454 ? 15.624  12.652  21.334  1.00 43.88  ? 454 ILE A CB    1 
ATOM   3453 C CG1   . ILE A 1 454 ? 15.526  12.772  19.805  1.00 47.38  ? 454 ILE A CG1   1 
ATOM   3454 C CG2   . ILE A 1 454 ? 15.517  11.226  21.798  1.00 44.39  ? 454 ILE A CG2   1 
ATOM   3455 C CD1   . ILE A 1 454 ? 14.325  12.092  19.192  1.00 44.15  ? 454 ILE A CD1   1 
ATOM   3456 N N     . PHE A 1 455 ? 15.721  14.643  23.819  1.00 46.71  ? 455 PHE A N     1 
ATOM   3457 C CA    . PHE A 1 455 ? 16.130  14.943  25.183  1.00 45.02  ? 455 PHE A CA    1 
ATOM   3458 C C     . PHE A 1 455 ? 15.074  15.725  25.954  1.00 45.77  ? 455 PHE A C     1 
ATOM   3459 O O     . PHE A 1 455 ? 15.224  15.917  27.168  1.00 44.92  ? 455 PHE A O     1 
ATOM   3460 C CB    . PHE A 1 455 ? 17.456  15.704  25.160  1.00 41.23  ? 455 PHE A CB    1 
ATOM   3461 C CG    . PHE A 1 455 ? 18.657  14.808  25.056  1.00 41.05  ? 455 PHE A CG    1 
ATOM   3462 C CD1   . PHE A 1 455 ? 19.096  14.353  23.828  1.00 36.59  ? 455 PHE A CD1   1 
ATOM   3463 C CD2   . PHE A 1 455 ? 19.346  14.407  26.203  1.00 43.63  ? 455 PHE A CD2   1 
ATOM   3464 C CE1   . PHE A 1 455 ? 20.197  13.513  23.724  1.00 36.40  ? 455 PHE A CE1   1 
ATOM   3465 C CE2   . PHE A 1 455 ? 20.452  13.576  26.113  1.00 42.32  ? 455 PHE A CE2   1 
ATOM   3466 C CZ    . PHE A 1 455 ? 20.878  13.123  24.857  1.00 42.33  ? 455 PHE A CZ    1 
ATOM   3467 N N     . GLY A 1 456 ? 14.010  16.157  25.285  1.00 44.34  ? 456 GLY A N     1 
ATOM   3468 C CA    . GLY A 1 456 ? 12.885  16.753  25.971  1.00 47.49  ? 456 GLY A CA    1 
ATOM   3469 C C     . GLY A 1 456 ? 13.075  18.178  26.433  1.00 50.27  ? 456 GLY A C     1 
ATOM   3470 O O     . GLY A 1 456 ? 12.422  18.598  27.388  1.00 53.55  ? 456 GLY A O     1 
ATOM   3471 N N     . LEU A 1 457 ? 13.935  18.939  25.781  1.00 47.23  ? 457 LEU A N     1 
ATOM   3472 C CA    . LEU A 1 457 ? 14.081  20.348  26.115  1.00 47.25  ? 457 LEU A CA    1 
ATOM   3473 C C     . LEU A 1 457 ? 12.769  21.133  26.053  1.00 52.81  ? 457 LEU A C     1 
ATOM   3474 O O     . LEU A 1 457 ? 12.578  22.037  26.880  1.00 55.94  ? 457 LEU A O     1 
ATOM   3475 C CB    . LEU A 1 457 ? 15.130  21.000  25.213  1.00 44.64  ? 457 LEU A CB    1 
ATOM   3476 C CG    . LEU A 1 457 ? 16.536  20.955  25.818  1.00 45.37  ? 457 LEU A CG    1 
ATOM   3477 C CD1   . LEU A 1 457 ? 17.129  19.548  25.854  1.00 40.58  ? 457 LEU A CD1   1 
ATOM   3478 C CD2   . LEU A 1 457 ? 17.465  21.903  25.104  1.00 42.45  ? 457 LEU A CD2   1 
ATOM   3479 N N     . PRO A 1 458 ? 11.834  20.850  25.133  1.00 50.86  ? 458 PRO A N     1 
ATOM   3480 C CA    . PRO A 1 458 ? 10.607  21.664  25.094  1.00 54.06  ? 458 PRO A CA    1 
ATOM   3481 C C     . PRO A 1 458 ? 9.716   21.512  26.313  1.00 57.56  ? 458 PRO A C     1 
ATOM   3482 O O     . PRO A 1 458 ? 8.710   22.225  26.397  1.00 61.82  ? 458 PRO A O     1 
ATOM   3483 C CB    . PRO A 1 458 ? 9.890   21.168  23.830  1.00 54.67  ? 458 PRO A CB    1 
ATOM   3484 C CG    . PRO A 1 458 ? 10.936  20.574  23.010  1.00 55.34  ? 458 PRO A CG    1 
ATOM   3485 C CD    . PRO A 1 458 ? 11.869  19.930  23.987  1.00 53.78  ? 458 PRO A CD    1 
ATOM   3486 N N     . LEU A 1 459 ? 10.029  20.604  27.242  1.00 59.12  ? 459 LEU A N     1 
ATOM   3487 C CA    . LEU A 1 459 ? 9.325   20.530  28.520  1.00 57.42  ? 459 LEU A CA    1 
ATOM   3488 C C     . LEU A 1 459 ? 9.766   21.617  29.488  1.00 59.56  ? 459 LEU A C     1 
ATOM   3489 O O     . LEU A 1 459 ? 9.111   21.805  30.521  1.00 60.92  ? 459 LEU A O     1 
ATOM   3490 C CB    . LEU A 1 459 ? 9.533   19.164  29.177  1.00 51.50  ? 459 LEU A CB    1 
ATOM   3491 C CG    . LEU A 1 459 ? 8.574   18.015  28.860  1.00 53.30  ? 459 LEU A CG    1 
ATOM   3492 C CD1   . LEU A 1 459 ? 8.189   17.990  27.414  1.00 59.52  ? 459 LEU A CD1   1 
ATOM   3493 C CD2   . LEU A 1 459 ? 9.218   16.698  29.219  1.00 50.44  ? 459 LEU A CD2   1 
ATOM   3494 N N     . ASP A 1 460 ? 10.859  22.327  29.178  1.00 58.67  ? 460 ASP A N     1 
ATOM   3495 C CA    . ASP A 1 460 ? 11.325  23.469  29.955  1.00 60.54  ? 460 ASP A CA    1 
ATOM   3496 C C     . ASP A 1 460 ? 10.516  24.695  29.559  1.00 61.50  ? 460 ASP A C     1 
ATOM   3497 O O     . ASP A 1 460 ? 10.699  25.223  28.458  1.00 63.16  ? 460 ASP A O     1 
ATOM   3498 C CB    . ASP A 1 460 ? 12.815  23.717  29.721  1.00 57.13  ? 460 ASP A CB    1 
ATOM   3499 C CG    . ASP A 1 460 ? 13.415  24.651  30.745  1.00 64.51  ? 460 ASP A CG    1 
ATOM   3500 O OD1   . ASP A 1 460 ? 12.657  25.432  31.368  1.00 68.53  ? 460 ASP A OD1   1 
ATOM   3501 O OD2   . ASP A 1 460 ? 14.648  24.605  30.933  1.00 64.93  ? 460 ASP A OD2   1 
ATOM   3502 N N     . PRO A 1 461 ? 9.617   25.177  30.417  1.00 66.24  ? 461 PRO A N     1 
ATOM   3503 C CA    . PRO A 1 461 ? 8.718   26.259  29.984  1.00 64.61  ? 461 PRO A CA    1 
ATOM   3504 C C     . PRO A 1 461 ? 9.458   27.524  29.640  1.00 63.05  ? 461 PRO A C     1 
ATOM   3505 O O     . PRO A 1 461 ? 8.993   28.301  28.796  1.00 65.10  ? 461 PRO A O     1 
ATOM   3506 C CB    . PRO A 1 461 ? 7.794   26.453  31.189  1.00 61.73  ? 461 PRO A CB    1 
ATOM   3507 C CG    . PRO A 1 461 ? 7.894   25.162  31.946  1.00 66.59  ? 461 PRO A CG    1 
ATOM   3508 C CD    . PRO A 1 461 ? 9.322   24.736  31.786  1.00 63.20  ? 461 PRO A CD    1 
ATOM   3509 N N     . SER A 1 462 ? 10.612  27.735  30.242  1.00 57.70  ? 462 SER A N     1 
ATOM   3510 C CA    . SER A 1 462 ? 11.418  28.902  29.936  1.00 58.58  ? 462 SER A CA    1 
ATOM   3511 C C     . SER A 1 462 ? 12.035  28.856  28.568  1.00 64.92  ? 462 SER A C     1 
ATOM   3512 O O     . SER A 1 462 ? 12.850  29.736  28.281  1.00 66.15  ? 462 SER A O     1 
ATOM   3513 C CB    . SER A 1 462 ? 12.520  29.040  30.971  1.00 56.36  ? 462 SER A CB    1 
ATOM   3514 O OG    . SER A 1 462 ? 13.309  27.873  30.963  1.00 62.56  ? 462 SER A OG    1 
ATOM   3515 N N     . LEU A 1 463 ? 11.739  27.895  27.700  1.00 61.71  ? 463 LEU A N     1 
ATOM   3516 C CA    . LEU A 1 463 ? 12.402  27.811  26.414  1.00 57.63  ? 463 LEU A CA    1 
ATOM   3517 C C     . LEU A 1 463 ? 11.508  28.244  25.268  1.00 63.69  ? 463 LEU A C     1 
ATOM   3518 O O     . LEU A 1 463 ? 11.920  28.138  24.107  1.00 64.36  ? 463 LEU A O     1 
ATOM   3519 C CB    . LEU A 1 463 ? 12.918  26.392  26.171  1.00 58.51  ? 463 LEU A CB    1 
ATOM   3520 C CG    . LEU A 1 463 ? 14.192  26.033  26.943  1.00 57.99  ? 463 LEU A CG    1 
ATOM   3521 C CD1   . LEU A 1 463 ? 14.728  24.654  26.549  1.00 52.30  ? 463 LEU A CD1   1 
ATOM   3522 C CD2   . LEU A 1 463 ? 15.252  27.103  26.746  1.00 51.82  ? 463 LEU A CD2   1 
ATOM   3523 N N     . ASN A 1 464 ? 10.306  28.739  25.558  1.00 65.26  ? 464 ASN A N     1 
ATOM   3524 C CA    . ASN A 1 464 ? 9.466   29.389  24.552  1.00 66.89  ? 464 ASN A CA    1 
ATOM   3525 C C     . ASN A 1 464 ? 9.084   28.441  23.403  1.00 59.49  ? 464 ASN A C     1 
ATOM   3526 O O     . ASN A 1 464 ? 8.786   28.897  22.298  1.00 63.93  ? 464 ASN A O     1 
ATOM   3527 C CB    . ASN A 1 464 ? 10.142  30.671  23.999  1.00 63.70  ? 464 ASN A CB    1 
ATOM   3528 C CG    . ASN A 1 464 ? 10.308  31.786  25.072  1.00 72.92  ? 464 ASN A CG    1 
ATOM   3529 O OD1   . ASN A 1 464 ? 9.461   31.930  25.956  1.00 72.46  ? 464 ASN A OD1   1 
ATOM   3530 N ND2   . ASN A 1 464 ? 11.401  32.573  24.983  1.00 63.65  ? 464 ASN A ND2   1 
ATOM   3531 N N     . TYR A 1 465 ? 9.089   27.123  23.621  1.00 54.53  ? 465 TYR A N     1 
ATOM   3532 C CA    . TYR A 1 465 ? 8.512   26.211  22.640  1.00 51.19  ? 465 TYR A CA    1 
ATOM   3533 C C     . TYR A 1 465 ? 6.994   26.335  22.669  1.00 51.24  ? 465 TYR A C     1 
ATOM   3534 O O     . TYR A 1 465 ? 6.431   27.161  23.375  1.00 61.86  ? 465 TYR A O     1 
ATOM   3535 C CB    . TYR A 1 465 ? 8.922   24.765  22.911  1.00 55.11  ? 465 TYR A CB    1 
ATOM   3536 C CG    . TYR A 1 465 ? 10.353  24.393  22.553  1.00 54.83  ? 465 TYR A CG    1 
ATOM   3537 C CD1   . TYR A 1 465 ? 10.668  23.864  21.311  1.00 54.94  ? 465 TYR A CD1   1 
ATOM   3538 C CD2   . TYR A 1 465 ? 11.382  24.543  23.474  1.00 57.29  ? 465 TYR A CD2   1 
ATOM   3539 C CE1   . TYR A 1 465 ? 11.971  23.514  20.988  1.00 53.45  ? 465 TYR A CE1   1 
ATOM   3540 C CE2   . TYR A 1 465 ? 12.679  24.198  23.163  1.00 54.62  ? 465 TYR A CE2   1 
ATOM   3541 C CZ    . TYR A 1 465 ? 12.972  23.686  21.918  1.00 55.29  ? 465 TYR A CZ    1 
ATOM   3542 O OH    . TYR A 1 465 ? 14.272  23.343  21.606  1.00 52.64  ? 465 TYR A OH    1 
ATOM   3543 N N     . THR A 1 466 ? 6.316   25.503  21.894  1.00 54.17  ? 466 THR A N     1 
ATOM   3544 C CA    . THR A 1 466 ? 4.866   25.528  21.792  1.00 52.54  ? 466 THR A CA    1 
ATOM   3545 C C     . THR A 1 466 ? 4.307   24.324  22.518  1.00 56.71  ? 466 THR A C     1 
ATOM   3546 O O     . THR A 1 466 ? 5.021   23.353  22.767  1.00 60.58  ? 466 THR A O     1 
ATOM   3547 C CB    . THR A 1 466 ? 4.402   25.493  20.332  1.00 59.50  ? 466 THR A CB    1 
ATOM   3548 O OG1   . THR A 1 466 ? 4.450   24.142  19.843  1.00 60.74  ? 466 THR A OG1   1 
ATOM   3549 C CG2   . THR A 1 466 ? 5.295   26.358  19.477  1.00 56.14  ? 466 THR A CG2   1 
ATOM   3550 N N     . THR A 1 467 ? 3.012   24.375  22.830  1.00 55.52  ? 467 THR A N     1 
ATOM   3551 C CA    . THR A 1 467 ? 2.416   23.288  23.603  1.00 58.42  ? 467 THR A CA    1 
ATOM   3552 C C     . THR A 1 467 ? 2.511   21.960  22.856  1.00 61.81  ? 467 THR A C     1 
ATOM   3553 O O     . THR A 1 467 ? 2.901   20.940  23.438  1.00 62.14  ? 467 THR A O     1 
ATOM   3554 C CB    . THR A 1 467 ? 0.963   23.611  23.963  1.00 61.73  ? 467 THR A CB    1 
ATOM   3555 O OG1   . THR A 1 467 ? 0.924   24.802  24.754  1.00 62.43  ? 467 THR A OG1   1 
ATOM   3556 C CG2   . THR A 1 467 ? 0.345   22.472  24.779  1.00 59.90  ? 467 THR A CG2   1 
ATOM   3557 N N     . GLU A 1 468 ? 2.171   21.946  21.560  1.00 62.75  ? 468 GLU A N     1 
ATOM   3558 C CA    . GLU A 1 468 ? 2.268   20.688  20.822  1.00 63.35  ? 468 GLU A CA    1 
ATOM   3559 C C     . GLU A 1 468 ? 3.711   20.218  20.754  1.00 59.59  ? 468 GLU A C     1 
ATOM   3560 O O     . GLU A 1 468 ? 3.978   19.010  20.779  1.00 59.61  ? 468 GLU A O     1 
ATOM   3561 C CB    . GLU A 1 468 ? 1.688   20.809  19.407  1.00 67.10  ? 468 GLU A CB    1 
ATOM   3562 C CG    . GLU A 1 468 ? 0.383   21.555  19.282  1.00 67.73  ? 468 GLU A CG    1 
ATOM   3563 C CD    . GLU A 1 468 ? 0.616   23.035  19.128  1.00 76.48  ? 468 GLU A CD    1 
ATOM   3564 O OE1   . GLU A 1 468 ? 0.728   23.723  20.175  1.00 69.21  ? 468 GLU A OE1   1 
ATOM   3565 O OE2   . GLU A 1 468 ? 0.721   23.495  17.961  1.00 80.26  ? 468 GLU A OE2   1 
ATOM   3566 N N     . GLU A 1 469 ? 4.657   21.158  20.671  1.00 55.21  ? 469 GLU A N     1 
ATOM   3567 C CA    . GLU A 1 469 ? 6.060   20.775  20.747  1.00 54.75  ? 469 GLU A CA    1 
ATOM   3568 C C     . GLU A 1 469 ? 6.372   20.108  22.080  1.00 57.76  ? 469 GLU A C     1 
ATOM   3569 O O     . GLU A 1 469 ? 7.166   19.162  22.125  1.00 56.57  ? 469 GLU A O     1 
ATOM   3570 C CB    . GLU A 1 469 ? 6.949   21.993  20.503  1.00 51.62  ? 469 GLU A CB    1 
ATOM   3571 C CG    . GLU A 1 469 ? 6.900   22.459  19.056  1.00 54.44  ? 469 GLU A CG    1 
ATOM   3572 C CD    . GLU A 1 469 ? 7.901   23.544  18.731  1.00 54.52  ? 469 GLU A CD    1 
ATOM   3573 O OE1   . GLU A 1 469 ? 8.038   24.482  19.538  1.00 53.07  ? 469 GLU A OE1   1 
ATOM   3574 O OE2   . GLU A 1 469 ? 8.554   23.456  17.663  1.00 54.41  ? 469 GLU A OE2   1 
ATOM   3575 N N     . ARG A 1 470 ? 5.728   20.552  23.165  1.00 61.63  ? 470 ARG A N     1 
ATOM   3576 C CA    . ARG A 1 470 ? 5.850   19.855  24.444  1.00 60.24  ? 470 ARG A CA    1 
ATOM   3577 C C     . ARG A 1 470 ? 5.302   18.438  24.329  1.00 60.94  ? 470 ARG A C     1 
ATOM   3578 O O     . ARG A 1 470 ? 6.025   17.454  24.531  1.00 61.95  ? 470 ARG A O     1 
ATOM   3579 C CB    . ARG A 1 470 ? 5.125   20.634  25.547  1.00 59.94  ? 470 ARG A CB    1 
ATOM   3580 C CG    . ARG A 1 470 ? 5.635   20.366  26.971  1.00 70.80  ? 470 ARG A CG    1 
ATOM   3581 C CD    . ARG A 1 470 ? 4.604   20.700  28.085  1.00 74.46  ? 470 ARG A CD    1 
ATOM   3582 N NE    . ARG A 1 470 ? 3.530   19.706  28.148  1.00 79.89  ? 470 ARG A NE    1 
ATOM   3583 C CZ    . ARG A 1 470 ? 2.242   19.974  27.945  1.00 82.71  ? 470 ARG A CZ    1 
ATOM   3584 N NH1   . ARG A 1 470 ? 1.856   21.223  27.687  1.00 78.22  ? 470 ARG A NH1   1 
ATOM   3585 N NH2   . ARG A 1 470 ? 1.339   18.995  28.008  1.00 80.18  ? 470 ARG A NH2   1 
ATOM   3586 N N     . ILE A 1 471 ? 4.025   18.315  23.969  1.00 56.74  ? 471 ILE A N     1 
ATOM   3587 C CA    . ILE A 1 471 ? 3.416   16.996  23.849  1.00 55.10  ? 471 ILE A CA    1 
ATOM   3588 C C     . ILE A 1 471 ? 4.231   16.114  22.919  1.00 56.84  ? 471 ILE A C     1 
ATOM   3589 O O     . ILE A 1 471 ? 4.456   14.928  23.196  1.00 58.70  ? 471 ILE A O     1 
ATOM   3590 C CB    . ILE A 1 471 ? 1.961   17.137  23.376  1.00 54.69  ? 471 ILE A CB    1 
ATOM   3591 C CG1   . ILE A 1 471 ? 1.138   17.791  24.496  1.00 60.71  ? 471 ILE A CG1   1 
ATOM   3592 C CG2   . ILE A 1 471 ? 1.414   15.775  22.907  1.00 45.24  ? 471 ILE A CG2   1 
ATOM   3593 C CD1   . ILE A 1 471 ? 0.057   18.714  24.031  1.00 61.78  ? 471 ILE A CD1   1 
ATOM   3594 N N     . PHE A 1 472 ? 4.717   16.696  21.817  1.00 56.16  ? 472 PHE A N     1 
ATOM   3595 C CA    . PHE A 1 472 ? 5.478   15.941  20.828  1.00 52.93  ? 472 PHE A CA    1 
ATOM   3596 C C     . PHE A 1 472 ? 6.754   15.370  21.428  1.00 55.26  ? 472 PHE A C     1 
ATOM   3597 O O     . PHE A 1 472 ? 7.103   14.207  21.181  1.00 56.01  ? 472 PHE A O     1 
ATOM   3598 C CB    . PHE A 1 472 ? 5.792   16.851  19.646  1.00 55.80  ? 472 PHE A CB    1 
ATOM   3599 C CG    . PHE A 1 472 ? 6.598   16.209  18.567  1.00 50.32  ? 472 PHE A CG    1 
ATOM   3600 C CD1   . PHE A 1 472 ? 6.237   14.979  18.049  1.00 51.17  ? 472 PHE A CD1   1 
ATOM   3601 C CD2   . PHE A 1 472 ? 7.695   16.862  18.041  1.00 48.68  ? 472 PHE A CD2   1 
ATOM   3602 C CE1   . PHE A 1 472 ? 6.970   14.389  17.038  1.00 49.58  ? 472 PHE A CE1   1 
ATOM   3603 C CE2   . PHE A 1 472 ? 8.433   16.291  17.026  1.00 53.83  ? 472 PHE A CE2   1 
ATOM   3604 C CZ    . PHE A 1 472 ? 8.068   15.045  16.519  1.00 53.68  ? 472 PHE A CZ    1 
ATOM   3605 N N     . ALA A 1 473 ? 7.456   16.170  22.233  1.00 51.93  ? 473 ALA A N     1 
ATOM   3606 C CA    . ALA A 1 473 ? 8.707   15.706  22.821  1.00 51.22  ? 473 ALA A CA    1 
ATOM   3607 C C     . ALA A 1 473 ? 8.468   14.539  23.769  1.00 55.32  ? 473 ALA A C     1 
ATOM   3608 O O     . ALA A 1 473 ? 9.269   13.598  23.825  1.00 55.64  ? 473 ALA A O     1 
ATOM   3609 C CB    . ALA A 1 473 ? 9.399   16.863  23.535  1.00 49.01  ? 473 ALA A CB    1 
ATOM   3610 N N     . GLN A 1 474 ? 7.363   14.573  24.514  1.00 55.30  ? 474 GLN A N     1 
ATOM   3611 C CA    . GLN A 1 474 ? 7.041   13.456  25.388  1.00 55.38  ? 474 GLN A CA    1 
ATOM   3612 C C     . GLN A 1 474 ? 6.777   12.198  24.585  1.00 57.68  ? 474 GLN A C     1 
ATOM   3613 O O     . GLN A 1 474 ? 7.122   11.092  25.018  1.00 59.43  ? 474 GLN A O     1 
ATOM   3614 C CB    . GLN A 1 474 ? 5.826   13.791  26.242  1.00 60.69  ? 474 GLN A CB    1 
ATOM   3615 C CG    . GLN A 1 474 ? 5.937   15.110  26.982  1.00 63.17  ? 474 GLN A CG    1 
ATOM   3616 C CD    . GLN A 1 474 ? 4.622   15.504  27.594  1.00 67.79  ? 474 GLN A CD    1 
ATOM   3617 O OE1   . GLN A 1 474 ? 3.776   14.661  27.834  1.00 71.88  ? 474 GLN A OE1   1 
ATOM   3618 N NE2   . GLN A 1 474 ? 4.421   16.793  27.807  1.00 69.44  ? 474 GLN A NE2   1 
ATOM   3619 N N     . ARG A 1 475 ? 6.147   12.349  23.415  1.00 54.73  ? 475 ARG A N     1 
ATOM   3620 C CA    . ARG A 1 475 ? 5.910   11.194  22.560  1.00 55.08  ? 475 ARG A CA    1 
ATOM   3621 C C     . ARG A 1 475 ? 7.219   10.532  22.167  1.00 55.19  ? 475 ARG A C     1 
ATOM   3622 O O     . ARG A 1 475 ? 7.324   9.298   22.150  1.00 54.08  ? 475 ARG A O     1 
ATOM   3623 C CB    . ARG A 1 475 ? 5.125   11.612  21.321  1.00 57.60  ? 475 ARG A CB    1 
ATOM   3624 C CG    . ARG A 1 475 ? 3.774   10.944  21.208  1.00 59.89  ? 475 ARG A CG    1 
ATOM   3625 C CD    . ARG A 1 475 ? 3.013   11.454  20.012  1.00 55.86  ? 475 ARG A CD    1 
ATOM   3626 N NE    . ARG A 1 475 ? 3.477   10.792  18.803  1.00 59.38  ? 475 ARG A NE    1 
ATOM   3627 C CZ    . ARG A 1 475 ? 3.645   11.406  17.644  1.00 52.87  ? 475 ARG A CZ    1 
ATOM   3628 N NH1   . ARG A 1 475 ? 3.405   12.705  17.546  1.00 54.81  ? 475 ARG A NH1   1 
ATOM   3629 N NH2   . ARG A 1 475 ? 4.061   10.724  16.591  1.00 60.21  ? 475 ARG A NH2   1 
ATOM   3630 N N     . LEU A 1 476 ? 8.241   11.332  21.872  1.00 53.41  ? 476 LEU A N     1 
ATOM   3631 C CA    . LEU A 1 476 ? 9.476   10.742  21.381  1.00 54.52  ? 476 LEU A CA    1 
ATOM   3632 C C     . LEU A 1 476 ? 10.327  10.200  22.510  1.00 50.04  ? 476 LEU A C     1 
ATOM   3633 O O     . LEU A 1 476 ? 10.974  9.158   22.352  1.00 47.47  ? 476 LEU A O     1 
ATOM   3634 C CB    . LEU A 1 476 ? 10.264  11.755  20.564  1.00 54.26  ? 476 LEU A CB    1 
ATOM   3635 C CG    . LEU A 1 476 ? 9.449   12.345  19.428  1.00 51.63  ? 476 LEU A CG    1 
ATOM   3636 C CD1   . LEU A 1 476 ? 10.158  13.592  18.928  1.00 50.42  ? 476 LEU A CD1   1 
ATOM   3637 C CD2   . LEU A 1 476 ? 9.151   11.282  18.343  1.00 47.34  ? 476 LEU A CD2   1 
ATOM   3638 N N     . MET A 1 477 ? 10.360  10.913  23.640  1.00 50.28  ? 477 MET A N     1 
ATOM   3639 C CA    . MET A 1 477 ? 10.960  10.356  24.846  1.00 49.40  ? 477 MET A CA    1 
ATOM   3640 C C     . MET A 1 477 ? 10.370  8.996   25.162  1.00 49.57  ? 477 MET A C     1 
ATOM   3641 O O     . MET A 1 477 ? 11.107  8.054   25.479  1.00 51.63  ? 477 MET A O     1 
ATOM   3642 C CB    . MET A 1 477 ? 10.766  11.303  26.026  1.00 55.42  ? 477 MET A CB    1 
ATOM   3643 C CG    . MET A 1 477 ? 11.496  12.614  25.904  1.00 51.45  ? 477 MET A CG    1 
ATOM   3644 S SD    . MET A 1 477 ? 10.997  13.766  27.191  1.00 63.94  ? 477 MET A SD    1 
ATOM   3645 C CE    . MET A 1 477 ? 12.226  13.450  28.415  1.00 45.14  ? 477 MET A CE    1 
ATOM   3646 N N     . LYS A 1 478 ? 9.044   8.863   25.050  1.00 49.37  ? 478 LYS A N     1 
ATOM   3647 C CA    . LYS A 1 478 ? 8.412   7.569   25.269  1.00 56.01  ? 478 LYS A CA    1 
ATOM   3648 C C     . LYS A 1 478 ? 8.883   6.540   24.241  1.00 52.94  ? 478 LYS A C     1 
ATOM   3649 O O     . LYS A 1 478 ? 9.188   5.400   24.591  1.00 49.64  ? 478 LYS A O     1 
ATOM   3650 C CB    . LYS A 1 478 ? 6.887   7.688   25.241  1.00 55.48  ? 478 LYS A CB    1 
ATOM   3651 C CG    . LYS A 1 478 ? 6.276   8.115   26.598  1.00 68.18  ? 478 LYS A CG    1 
ATOM   3652 C CD    . LYS A 1 478 ? 6.154   6.916   27.611  1.00 72.50  ? 478 LYS A CD    1 
ATOM   3653 C CE    . LYS A 1 478 ? 5.996   7.316   29.104  1.00 70.90  ? 478 LYS A CE    1 
ATOM   3654 N NZ    . LYS A 1 478 ? 6.939   6.593   30.037  1.00 71.99  ? 478 LYS A NZ    1 
ATOM   3655 N N     . TYR A 1 479 ? 8.925   6.929   22.962  1.00 53.09  ? 479 TYR A N     1 
ATOM   3656 C CA    . TYR A 1 479 ? 9.419   6.030   21.915  1.00 51.78  ? 479 TYR A CA    1 
ATOM   3657 C C     . TYR A 1 479 ? 10.841  5.588   22.214  1.00 48.57  ? 479 TYR A C     1 
ATOM   3658 O O     . TYR A 1 479 ? 11.156  4.396   22.179  1.00 45.66  ? 479 TYR A O     1 
ATOM   3659 C CB    . TYR A 1 479 ? 9.372   6.728   20.551  1.00 49.70  ? 479 TYR A CB    1 
ATOM   3660 C CG    . TYR A 1 479 ? 8.009   6.924   19.942  1.00 51.02  ? 479 TYR A CG    1 
ATOM   3661 C CD1   . TYR A 1 479 ? 7.043   5.938   20.009  1.00 50.97  ? 479 TYR A CD1   1 
ATOM   3662 C CD2   . TYR A 1 479 ? 7.705   8.095   19.257  1.00 53.89  ? 479 TYR A CD2   1 
ATOM   3663 C CE1   . TYR A 1 479 ? 5.801   6.121   19.421  1.00 51.65  ? 479 TYR A CE1   1 
ATOM   3664 C CE2   . TYR A 1 479 ? 6.468   8.288   18.672  1.00 56.19  ? 479 TYR A CE2   1 
ATOM   3665 C CZ    . TYR A 1 479 ? 5.522   7.299   18.756  1.00 55.05  ? 479 TYR A CZ    1 
ATOM   3666 O OH    . TYR A 1 479 ? 4.295   7.506   18.174  1.00 56.03  ? 479 TYR A OH    1 
ATOM   3667 N N     . TRP A 1 480 ? 11.716  6.551   22.505  1.00 46.91  ? 480 TRP A N     1 
ATOM   3668 C CA    . TRP A 1 480 ? 13.124  6.246   22.728  1.00 47.42  ? 480 TRP A CA    1 
ATOM   3669 C C     . TRP A 1 480 ? 13.332  5.388   23.976  1.00 53.40  ? 480 TRP A C     1 
ATOM   3670 O O     . TRP A 1 480 ? 14.135  4.446   23.953  1.00 53.56  ? 480 TRP A O     1 
ATOM   3671 C CB    . TRP A 1 480 ? 13.922  7.545   22.823  1.00 45.44  ? 480 TRP A CB    1 
ATOM   3672 C CG    . TRP A 1 480 ? 14.713  7.867   21.611  1.00 44.57  ? 480 TRP A CG    1 
ATOM   3673 C CD1   . TRP A 1 480 ? 16.071  7.994   21.523  1.00 46.32  ? 480 TRP A CD1   1 
ATOM   3674 C CD2   . TRP A 1 480 ? 14.205  8.095   20.291  1.00 48.92  ? 480 TRP A CD2   1 
ATOM   3675 N NE1   . TRP A 1 480 ? 16.437  8.294   20.228  1.00 45.51  ? 480 TRP A NE1   1 
ATOM   3676 C CE2   . TRP A 1 480 ? 15.307  8.365   19.457  1.00 45.87  ? 480 TRP A CE2   1 
ATOM   3677 C CE3   . TRP A 1 480 ? 12.923  8.106   19.736  1.00 45.31  ? 480 TRP A CE3   1 
ATOM   3678 C CZ2   . TRP A 1 480 ? 15.161  8.640   18.115  1.00 44.50  ? 480 TRP A CZ2   1 
ATOM   3679 C CZ3   . TRP A 1 480 ? 12.787  8.375   18.424  1.00 42.42  ? 480 TRP A CZ3   1 
ATOM   3680 C CH2   . TRP A 1 480 ? 13.896  8.635   17.615  1.00 46.65  ? 480 TRP A CH2   1 
ATOM   3681 N N     . THR A 1 481 ? 12.623  5.680   25.077  1.00 52.21  ? 481 THR A N     1 
ATOM   3682 C CA    . THR A 1 481 ? 12.819  4.884   26.287  1.00 50.84  ? 481 THR A CA    1 
ATOM   3683 C C     . THR A 1 481 ? 12.142  3.517   26.198  1.00 54.44  ? 481 THR A C     1 
ATOM   3684 O O     . THR A 1 481 ? 12.697  2.525   26.686  1.00 58.40  ? 481 THR A O     1 
ATOM   3685 C CB    . THR A 1 481 ? 12.325  5.646   27.508  1.00 51.35  ? 481 THR A CB    1 
ATOM   3686 O OG1   . THR A 1 481 ? 10.960  6.028   27.308  1.00 57.20  ? 481 THR A OG1   1 
ATOM   3687 C CG2   . THR A 1 481 ? 13.167  6.885   27.718  1.00 46.74  ? 481 THR A CG2   1 
ATOM   3688 N N     . ASN A 1 482 ? 10.956  3.426   25.581  1.00 52.10  ? 482 ASN A N     1 
ATOM   3689 C CA    . ASN A 1 482 ? 10.355  2.109   25.386  1.00 48.43  ? 482 ASN A CA    1 
ATOM   3690 C C     . ASN A 1 482 ? 11.269  1.213   24.573  1.00 50.12  ? 482 ASN A C     1 
ATOM   3691 O O     . ASN A 1 482 ? 11.389  0.021   24.867  1.00 52.22  ? 482 ASN A O     1 
ATOM   3692 C CB    . ASN A 1 482 ? 8.991   2.204   24.713  1.00 47.32  ? 482 ASN A CB    1 
ATOM   3693 C CG    . ASN A 1 482 ? 7.951   2.851   25.592  1.00 58.67  ? 482 ASN A CG    1 
ATOM   3694 O OD1   . ASN A 1 482 ? 8.157   3.034   26.796  1.00 63.61  ? 482 ASN A OD1   1 
ATOM   3695 N ND2   . ASN A 1 482 ? 6.825   3.215   24.995  1.00 60.98  ? 482 ASN A ND2   1 
ATOM   3696 N N     . PHE A 1 483 ? 11.932  1.767   23.546  1.00 53.04  ? 483 PHE A N     1 
ATOM   3697 C CA    . PHE A 1 483 ? 12.904  0.968   22.801  1.00 49.58  ? 483 PHE A CA    1 
ATOM   3698 C C     . PHE A 1 483 ? 14.081  0.574   23.691  1.00 51.24  ? 483 PHE A C     1 
ATOM   3699 O O     . PHE A 1 483 ? 14.618  -0.538  23.573  1.00 45.42  ? 483 PHE A O     1 
ATOM   3700 C CB    . PHE A 1 483 ? 13.400  1.702   21.544  1.00 47.59  ? 483 PHE A CB    1 
ATOM   3701 C CG    . PHE A 1 483 ? 14.505  0.953   20.827  1.00 45.38  ? 483 PHE A CG    1 
ATOM   3702 C CD1   . PHE A 1 483 ? 14.213  -0.117  20.010  1.00 41.49  ? 483 PHE A CD1   1 
ATOM   3703 C CD2   . PHE A 1 483 ? 15.835  1.263   21.052  1.00 41.95  ? 483 PHE A CD2   1 
ATOM   3704 C CE1   . PHE A 1 483 ? 15.212  -0.834  19.433  1.00 42.10  ? 483 PHE A CE1   1 
ATOM   3705 C CE2   . PHE A 1 483 ? 16.831  0.544   20.467  1.00 39.72  ? 483 PHE A CE2   1 
ATOM   3706 C CZ    . PHE A 1 483 ? 16.519  -0.498  19.650  1.00 43.93  ? 483 PHE A CZ    1 
ATOM   3707 N N     . ALA A 1 484 ? 14.486  1.471   24.600  1.00 53.36  ? 484 ALA A N     1 
ATOM   3708 C CA    . ALA A 1 484 ? 15.575  1.163   25.524  1.00 51.48  ? 484 ALA A CA    1 
ATOM   3709 C C     . ALA A 1 484 ? 15.185  0.029   26.459  1.00 52.23  ? 484 ALA A C     1 
ATOM   3710 O O     . ALA A 1 484 ? 15.960  -0.913  26.672  1.00 49.38  ? 484 ALA A O     1 
ATOM   3711 C CB    . ALA A 1 484 ? 15.958  2.407   26.324  1.00 47.33  ? 484 ALA A CB    1 
ATOM   3712 N N     . ARG A 1 485 ? 13.967  0.095   27.009  1.00 51.40  ? 485 ARG A N     1 
ATOM   3713 C CA    . ARG A 1 485 ? 13.522  -0.930  27.949  1.00 54.36  ? 485 ARG A CA    1 
ATOM   3714 C C     . ARG A 1 485 ? 13.286  -2.270  27.266  1.00 54.27  ? 485 ARG A C     1 
ATOM   3715 O O     . ARG A 1 485 ? 13.719  -3.306  27.774  1.00 56.33  ? 485 ARG A O     1 
ATOM   3716 C CB    . ARG A 1 485 ? 12.251  -0.485  28.665  1.00 51.65  ? 485 ARG A CB    1 
ATOM   3717 C CG    . ARG A 1 485 ? 12.441  0.669   29.599  1.00 59.28  ? 485 ARG A CG    1 
ATOM   3718 C CD    . ARG A 1 485 ? 11.145  0.982   30.312  1.00 65.35  ? 485 ARG A CD    1 
ATOM   3719 N NE    . ARG A 1 485 ? 10.447  2.095   29.674  1.00 67.51  ? 485 ARG A NE    1 
ATOM   3720 C CZ    . ARG A 1 485 ? 10.491  3.350   30.117  1.00 68.65  ? 485 ARG A CZ    1 
ATOM   3721 N NH1   . ARG A 1 485 ? 11.205  3.637   31.208  1.00 60.50  ? 485 ARG A NH1   1 
ATOM   3722 N NH2   . ARG A 1 485 ? 9.826   4.312   29.469  1.00 64.84  ? 485 ARG A NH2   1 
ATOM   3723 N N     . THR A 1 486 ? 12.616  -2.270  26.110  1.00 56.49  ? 486 THR A N     1 
ATOM   3724 C CA    . THR A 1 486 ? 12.033  -3.479  25.545  1.00 51.27  ? 486 THR A CA    1 
ATOM   3725 C C     . THR A 1 486 ? 12.524  -3.862  24.150  1.00 58.43  ? 486 THR A C     1 
ATOM   3726 O O     . THR A 1 486 ? 12.182  -4.957  23.681  1.00 58.63  ? 486 THR A O     1 
ATOM   3727 C CB    . THR A 1 486 ? 10.506  -3.333  25.482  1.00 52.40  ? 486 THR A CB    1 
ATOM   3728 O OG1   . THR A 1 486 ? 10.165  -2.336  24.507  1.00 52.08  ? 486 THR A OG1   1 
ATOM   3729 C CG2   . THR A 1 486 ? 9.957   -2.919  26.837  1.00 43.85  ? 486 THR A CG2   1 
ATOM   3730 N N     . GLY A 1 487 ? 13.304  -3.020  23.468  1.00 57.39  ? 487 GLY A N     1 
ATOM   3731 C CA    . GLY A 1 487 ? 13.598  -3.289  22.069  1.00 56.91  ? 487 GLY A CA    1 
ATOM   3732 C C     . GLY A 1 487 ? 12.487  -2.905  21.116  1.00 55.95  ? 487 GLY A C     1 
ATOM   3733 O O     . GLY A 1 487 ? 12.556  -3.247  19.927  1.00 53.89  ? 487 GLY A O     1 
ATOM   3734 N N     . ASP A 1 488 ? 11.470  -2.201  21.609  1.00 51.95  ? 488 ASP A N     1 
ATOM   3735 C CA    . ASP A 1 488 ? 10.279  -1.848  20.863  1.00 57.12  ? 488 ASP A CA    1 
ATOM   3736 C C     . ASP A 1 488 ? 9.827   -0.460  21.296  1.00 56.48  ? 488 ASP A C     1 
ATOM   3737 O O     . ASP A 1 488 ? 9.534   -0.239  22.477  1.00 58.30  ? 488 ASP A O     1 
ATOM   3738 C CB    . ASP A 1 488 ? 9.183   -2.888  21.107  1.00 61.53  ? 488 ASP A CB    1 
ATOM   3739 C CG    . ASP A 1 488 ? 7.976   -2.716  20.190  1.00 65.80  ? 488 ASP A CG    1 
ATOM   3740 O OD1   . ASP A 1 488 ? 7.570   -1.570  19.893  1.00 66.73  ? 488 ASP A OD1   1 
ATOM   3741 O OD2   . ASP A 1 488 ? 7.414   -3.747  19.779  1.00 72.37  ? 488 ASP A OD2   1 
ATOM   3742 N N     . PRO A 1 489 ? 9.746   0.497   20.372  1.00 54.67  ? 489 PRO A N     1 
ATOM   3743 C CA    . PRO A 1 489 ? 9.291   1.837   20.748  1.00 52.88  ? 489 PRO A CA    1 
ATOM   3744 C C     . PRO A 1 489 ? 7.814   1.902   21.043  1.00 56.49  ? 489 PRO A C     1 
ATOM   3745 O O     . PRO A 1 489 ? 7.366   2.888   21.636  1.00 57.36  ? 489 PRO A O     1 
ATOM   3746 C CB    . PRO A 1 489 ? 9.641   2.679   19.518  1.00 54.69  ? 489 PRO A CB    1 
ATOM   3747 C CG    . PRO A 1 489 ? 9.522   1.705   18.388  1.00 56.71  ? 489 PRO A CG    1 
ATOM   3748 C CD    . PRO A 1 489 ? 10.034  0.394   18.932  1.00 58.50  ? 489 PRO A CD    1 
ATOM   3749 N N     . ASN A 1 490 ? 7.037   0.909   20.627  1.00 59.86  ? 490 ASN A N     1 
ATOM   3750 C CA    . ASN A 1 490 ? 5.602   0.958   20.849  1.00 62.59  ? 490 ASN A CA    1 
ATOM   3751 C C     . ASN A 1 490 ? 5.300   0.794   22.332  1.00 72.42  ? 490 ASN A C     1 
ATOM   3752 O O     . ASN A 1 490 ? 6.005   0.082   23.056  1.00 69.73  ? 490 ASN A O     1 
ATOM   3753 C CB    . ASN A 1 490 ? 4.901   -0.123  20.027  1.00 64.95  ? 490 ASN A CB    1 
ATOM   3754 C CG    . ASN A 1 490 ? 5.071   0.080   18.513  1.00 71.50  ? 490 ASN A CG    1 
ATOM   3755 O OD1   . ASN A 1 490 ? 4.387   0.913   17.911  1.00 71.48  ? 490 ASN A OD1   1 
ATOM   3756 N ND2   . ASN A 1 490 ? 5.970   -0.691  17.895  1.00 63.70  ? 490 ASN A ND2   1 
ATOM   3757 N N     . ASP A 1 491 ? 4.265   1.483   22.794  1.00 79.19  ? 491 ASP A N     1 
ATOM   3758 C CA    . ASP A 1 491 ? 3.909   1.393   24.201  1.00 85.25  ? 491 ASP A CA    1 
ATOM   3759 C C     . ASP A 1 491 ? 3.276   0.029   24.483  1.00 87.72  ? 491 ASP A C     1 
ATOM   3760 O O     . ASP A 1 491 ? 2.462   -0.452  23.691  1.00 87.14  ? 491 ASP A O     1 
ATOM   3761 C CB    . ASP A 1 491 ? 2.953   2.529   24.591  1.00 90.82  ? 491 ASP A CB    1 
ATOM   3762 C CG    . ASP A 1 491 ? 2.830   2.704   26.104  1.00 95.74  ? 491 ASP A CG    1 
ATOM   3763 O OD1   . ASP A 1 491 ? 1.964   2.029   26.700  1.00 99.46  ? 491 ASP A OD1   1 
ATOM   3764 O OD2   . ASP A 1 491 ? 3.589   3.511   26.698  1.00 88.20  ? 491 ASP A OD2   1 
ATOM   3765 N N     . PRO A 1 492 ? 3.652   -0.629  25.587  1.00 95.86  ? 492 PRO A N     1 
ATOM   3766 C CA    . PRO A 1 492 ? 3.049   -1.939  25.894  1.00 98.11  ? 492 PRO A CA    1 
ATOM   3767 C C     . PRO A 1 492 ? 1.532   -1.886  25.962  1.00 98.88  ? 492 PRO A C     1 
ATOM   3768 O O     . PRO A 1 492 ? 0.854   -2.805  25.488  1.00 93.29  ? 492 PRO A O     1 
ATOM   3769 C CB    . PRO A 1 492 ? 3.670   -2.312  27.254  1.00 100.33 ? 492 PRO A CB    1 
ATOM   3770 C CG    . PRO A 1 492 ? 4.812   -1.363  27.477  1.00 95.91  ? 492 PRO A CG    1 
ATOM   3771 C CD    . PRO A 1 492 ? 4.511   -0.132  26.682  1.00 94.54  ? 492 PRO A CD    1 
ATOM   3772 N N     . ARG A 1 493 ? 0.985   -0.816  26.543  1.00 101.86 ? 493 ARG A N     1 
ATOM   3773 C CA    . ARG A 1 493 ? -0.467  -0.615  26.621  1.00 102.49 ? 493 ARG A CA    1 
ATOM   3774 C C     . ARG A 1 493 ? -0.983  0.102   25.377  1.00 107.95 ? 493 ARG A C     1 
ATOM   3775 O O     . ARG A 1 493 ? -1.596  -0.521  24.502  1.00 105.56 ? 493 ARG A O     1 
ATOM   3776 C CB    . ARG A 1 493 ? -0.845  0.175   27.880  1.00 104.51 ? 493 ARG A CB    1 
ATOM   3777 C CG    . ARG A 1 493 ? -0.993  -0.636  29.183  1.00 107.88 ? 493 ARG A CG    1 
ATOM   3778 C CD    . ARG A 1 493 ? -0.205  0.064   30.335  1.00 107.81 ? 493 ARG A CD    1 
ATOM   3779 N NE    . ARG A 1 493 ? 1.223   0.154   30.044  1.00 108.55 ? 493 ARG A NE    1 
ATOM   3780 C CZ    . ARG A 1 493 ? 1.876   1.291   29.757  1.00 109.75 ? 493 ARG A CZ    1 
ATOM   3781 N NH1   . ARG A 1 493 ? 1.262   2.472   29.708  1.00 107.76 ? 493 ARG A NH1   1 
ATOM   3782 N NH2   . ARG A 1 493 ? 3.171   1.254   29.486  1.00 110.63 ? 493 ARG A NH2   1 
ATOM   3783 N N     . ASP A 1 494 ? -0.714  1.415   25.294  1.00 109.11 ? 494 ASP A N     1 
ATOM   3784 C CA    . ASP A 1 494 ? -1.339  2.369   24.379  1.00 102.43 ? 494 ASP A CA    1 
ATOM   3785 C C     . ASP A 1 494 ? -1.648  1.766   23.016  1.00 105.15 ? 494 ASP A C     1 
ATOM   3786 O O     . ASP A 1 494 ? -0.833  1.835   22.088  1.00 110.21 ? 494 ASP A O     1 
ATOM   3787 C CB    . ASP A 1 494 ? -0.443  3.600   24.232  1.00 99.44  ? 494 ASP A CB    1 
ATOM   3788 C CG    . ASP A 1 494 ? -1.143  4.745   23.544  1.00 103.33 ? 494 ASP A CG    1 
ATOM   3789 O OD1   . ASP A 1 494 ? -2.380  4.677   23.414  1.00 104.26 ? 494 ASP A OD1   1 
ATOM   3790 O OD2   . ASP A 1 494 ? -0.465  5.711   23.136  1.00 103.70 ? 494 ASP A OD2   1 
ATOM   3791 N N     . SER A 1 495 ? -2.826  1.152   22.904  1.00 107.15 ? 495 SER A N     1 
ATOM   3792 C CA    . SER A 1 495 ? -3.248  0.505   21.669  1.00 110.07 ? 495 SER A CA    1 
ATOM   3793 C C     . SER A 1 495 ? -4.053  1.428   20.769  1.00 104.88 ? 495 SER A C     1 
ATOM   3794 O O     . SER A 1 495 ? -4.223  1.114   19.586  1.00 106.59 ? 495 SER A O     1 
ATOM   3795 C CB    . SER A 1 495 ? -4.076  -0.749  21.978  1.00 110.30 ? 495 SER A CB    1 
ATOM   3796 O OG    . SER A 1 495 ? -3.405  -1.601  22.893  1.00 105.70 ? 495 SER A OG    1 
ATOM   3797 N N     . LYS A 1 496 ? -4.544  2.554   21.300  1.00 103.88 ? 496 LYS A N     1 
ATOM   3798 C CA    . LYS A 1 496 ? -5.286  3.510   20.482  1.00 104.82 ? 496 LYS A CA    1 
ATOM   3799 C C     . LYS A 1 496 ? -4.377  4.177   19.447  1.00 109.22 ? 496 LYS A C     1 
ATOM   3800 O O     . LYS A 1 496 ? -4.699  4.210   18.251  1.00 106.81 ? 496 LYS A O     1 
ATOM   3801 C CB    . LYS A 1 496 ? -5.957  4.555   21.379  1.00 94.75  ? 496 LYS A CB    1 
ATOM   3802 N N     . SER A 1 497 ? -3.233  4.708   19.886  1.00 108.45 ? 497 SER A N     1 
ATOM   3803 C CA    . SER A 1 497 ? -2.303  5.340   18.960  1.00 102.34 ? 497 SER A CA    1 
ATOM   3804 C C     . SER A 1 497 ? -1.720  4.301   17.998  1.00 96.07  ? 497 SER A C     1 
ATOM   3805 O O     . SER A 1 497 ? -1.571  3.126   18.350  1.00 94.21  ? 497 SER A O     1 
ATOM   3806 C CB    . SER A 1 497 ? -1.185  6.052   19.724  1.00 102.20 ? 497 SER A CB    1 
ATOM   3807 O OG    . SER A 1 497 ? -0.581  5.196   20.677  1.00 105.05 ? 497 SER A OG    1 
ATOM   3808 N N     . PRO A 1 498 ? -1.399  4.706   16.771  1.00 90.73  ? 498 PRO A N     1 
ATOM   3809 C CA    . PRO A 1 498 ? -0.965  3.731   15.763  1.00 84.90  ? 498 PRO A CA    1 
ATOM   3810 C C     . PRO A 1 498 ? 0.380   3.116   16.115  1.00 81.54  ? 498 PRO A C     1 
ATOM   3811 O O     . PRO A 1 498 ? 1.179   3.684   16.862  1.00 82.84  ? 498 PRO A O     1 
ATOM   3812 C CB    . PRO A 1 498 ? -0.883  4.559   14.480  1.00 77.35  ? 498 PRO A CB    1 
ATOM   3813 C CG    . PRO A 1 498 ? -0.698  5.970   14.958  1.00 76.55  ? 498 PRO A CG    1 
ATOM   3814 C CD    . PRO A 1 498 ? -1.437  6.082   16.246  1.00 81.32  ? 498 PRO A CD    1 
ATOM   3815 N N     . GLN A 1 499 ? 0.611   1.923   15.571  1.00 82.10  ? 499 GLN A N     1 
ATOM   3816 C CA    . GLN A 1 499 ? 1.804   1.135   15.854  1.00 77.53  ? 499 GLN A CA    1 
ATOM   3817 C C     . GLN A 1 499 ? 2.909   1.427   14.840  1.00 75.95  ? 499 GLN A C     1 
ATOM   3818 O O     . GLN A 1 499 ? 2.666   1.919   13.736  1.00 75.10  ? 499 GLN A O     1 
ATOM   3819 C CB    . GLN A 1 499 ? 1.490   -0.363  15.844  1.00 76.53  ? 499 GLN A CB    1 
ATOM   3820 C CG    . GLN A 1 499 ? 0.372   -0.772  16.767  1.00 77.92  ? 499 GLN A CG    1 
ATOM   3821 C CD    . GLN A 1 499 ? 0.623   -0.348  18.193  1.00 82.35  ? 499 GLN A CD    1 
ATOM   3822 O OE1   . GLN A 1 499 ? 1.379   -0.995  18.916  1.00 85.97  ? 499 GLN A OE1   1 
ATOM   3823 N NE2   . GLN A 1 499 ? -0.015  0.744   18.611  1.00 86.11  ? 499 GLN A NE2   1 
ATOM   3824 N N     . TRP A 1 500 ? 4.138   1.089   15.231  1.00 71.30  ? 500 TRP A N     1 
ATOM   3825 C CA    . TRP A 1 500 ? 5.341   1.367   14.453  1.00 61.98  ? 500 TRP A CA    1 
ATOM   3826 C C     . TRP A 1 500 ? 5.935   0.036   14.010  1.00 62.62  ? 500 TRP A C     1 
ATOM   3827 O O     . TRP A 1 500 ? 6.551   -0.668  14.823  1.00 66.89  ? 500 TRP A O     1 
ATOM   3828 C CB    . TRP A 1 500 ? 6.329   2.164   15.314  1.00 58.81  ? 500 TRP A CB    1 
ATOM   3829 C CG    . TRP A 1 500 ? 7.687   2.555   14.739  1.00 58.83  ? 500 TRP A CG    1 
ATOM   3830 C CD1   . TRP A 1 500 ? 8.315   2.046   13.629  1.00 57.10  ? 500 TRP A CD1   1 
ATOM   3831 C CD2   . TRP A 1 500 ? 8.588   3.526   15.292  1.00 52.86  ? 500 TRP A CD2   1 
ATOM   3832 N NE1   . TRP A 1 500 ? 9.543   2.643   13.466  1.00 53.76  ? 500 TRP A NE1   1 
ATOM   3833 C CE2   . TRP A 1 500 ? 9.730   3.556   14.473  1.00 51.46  ? 500 TRP A CE2   1 
ATOM   3834 C CE3   . TRP A 1 500 ? 8.531   4.379   16.399  1.00 50.84  ? 500 TRP A CE3   1 
ATOM   3835 C CZ2   . TRP A 1 500 ? 10.806  4.405   14.728  1.00 49.38  ? 500 TRP A CZ2   1 
ATOM   3836 C CZ3   . TRP A 1 500 ? 9.593   5.219   16.642  1.00 46.83  ? 500 TRP A CZ3   1 
ATOM   3837 C CH2   . TRP A 1 500 ? 10.716  5.227   15.812  1.00 44.59  ? 500 TRP A CH2   1 
ATOM   3838 N N     . PRO A 1 501 ? 5.755   -0.371  12.751  1.00 55.55  ? 501 PRO A N     1 
ATOM   3839 C CA    . PRO A 1 501 ? 6.226   -1.689  12.343  1.00 58.08  ? 501 PRO A CA    1 
ATOM   3840 C C     . PRO A 1 501 ? 7.734   -1.730  12.258  1.00 58.14  ? 501 PRO A C     1 
ATOM   3841 O O     . PRO A 1 501 ? 8.385   -0.720  11.934  1.00 59.99  ? 501 PRO A O     1 
ATOM   3842 C CB    . PRO A 1 501 ? 5.590   -1.875  10.952  1.00 60.11  ? 501 PRO A CB    1 
ATOM   3843 C CG    . PRO A 1 501 ? 5.427   -0.496  10.435  1.00 58.93  ? 501 PRO A CG    1 
ATOM   3844 C CD    . PRO A 1 501 ? 5.061   0.328   11.659  1.00 61.35  ? 501 PRO A CD    1 
ATOM   3845 N N     . PRO A 1 502 ? 8.348   -2.876  12.540  1.00 58.37  ? 502 PRO A N     1 
ATOM   3846 C CA    . PRO A 1 502 ? 9.746   -3.082  12.161  1.00 57.74  ? 502 PRO A CA    1 
ATOM   3847 C C     . PRO A 1 502 ? 9.958   -2.828  10.677  1.00 59.38  ? 502 PRO A C     1 
ATOM   3848 O O     . PRO A 1 502 ? 9.052   -3.004  9.865   1.00 61.53  ? 502 PRO A O     1 
ATOM   3849 C CB    . PRO A 1 502 ? 9.992   -4.551  12.515  1.00 54.69  ? 502 PRO A CB    1 
ATOM   3850 C CG    . PRO A 1 502 ? 9.097   -4.776  13.676  1.00 57.17  ? 502 PRO A CG    1 
ATOM   3851 C CD    . PRO A 1 502 ? 7.858   -3.941  13.429  1.00 57.07  ? 502 PRO A CD    1 
ATOM   3852 N N     . TYR A 1 503 ? 11.165  -2.392  10.334  1.00 59.84  ? 503 TYR A N     1 
ATOM   3853 C CA    . TYR A 1 503 ? 11.549  -2.237  8.941   1.00 55.10  ? 503 TYR A CA    1 
ATOM   3854 C C     . TYR A 1 503 ? 12.022  -3.573  8.393   1.00 57.74  ? 503 TYR A C     1 
ATOM   3855 O O     . TYR A 1 503 ? 12.867  -4.234  9.005   1.00 59.57  ? 503 TYR A O     1 
ATOM   3856 C CB    . TYR A 1 503 ? 12.655  -1.199  8.799   1.00 53.19  ? 503 TYR A CB    1 
ATOM   3857 C CG    . TYR A 1 503 ? 13.218  -1.115  7.398   1.00 55.73  ? 503 TYR A CG    1 
ATOM   3858 C CD1   . TYR A 1 503 ? 14.367  -1.824  7.040   1.00 56.90  ? 503 TYR A CD1   1 
ATOM   3859 C CD2   . TYR A 1 503 ? 12.602  -0.334  6.427   1.00 51.77  ? 503 TYR A CD2   1 
ATOM   3860 C CE1   . TYR A 1 503 ? 14.894  -1.744  5.752   1.00 55.87  ? 503 TYR A CE1   1 
ATOM   3861 C CE2   . TYR A 1 503 ? 13.119  -0.250  5.146   1.00 54.26  ? 503 TYR A CE2   1 
ATOM   3862 C CZ    . TYR A 1 503 ? 14.260  -0.957  4.807   1.00 56.53  ? 503 TYR A CZ    1 
ATOM   3863 O OH    . TYR A 1 503 ? 14.762  -0.877  3.518   1.00 57.04  ? 503 TYR A OH    1 
ATOM   3864 N N     . THR A 1 504 ? 11.494  -3.960  7.229   1.00 58.15  ? 504 THR A N     1 
ATOM   3865 C CA    . THR A 1 504 ? 11.794  -5.247  6.615   1.00 57.40  ? 504 THR A CA    1 
ATOM   3866 C C     . THR A 1 504 ? 12.242  -5.054  5.176   1.00 56.82  ? 504 THR A C     1 
ATOM   3867 O O     . THR A 1 504 ? 11.917  -4.055  4.530   1.00 57.39  ? 504 THR A O     1 
ATOM   3868 C CB    . THR A 1 504 ? 10.576  -6.175  6.645   1.00 57.22  ? 504 THR A CB    1 
ATOM   3869 O OG1   . THR A 1 504 ? 9.497   -5.556  5.935   1.00 60.41  ? 504 THR A OG1   1 
ATOM   3870 C CG2   . THR A 1 504 ? 10.136  -6.416  8.078   1.00 49.23  ? 504 THR A CG2   1 
ATOM   3871 N N     . THR A 1 505 ? 12.993  -6.037  4.676   1.00 56.87  ? 505 THR A N     1 
ATOM   3872 C CA    . THR A 1 505 ? 13.288  -6.087  3.245   1.00 61.03  ? 505 THR A CA    1 
ATOM   3873 C C     . THR A 1 505 ? 11.995  -6.059  2.429   1.00 57.02  ? 505 THR A C     1 
ATOM   3874 O O     . THR A 1 505 ? 11.863  -5.291  1.473   1.00 55.94  ? 505 THR A O     1 
ATOM   3875 C CB    . THR A 1 505 ? 14.108  -7.339  2.923   1.00 56.48  ? 505 THR A CB    1 
ATOM   3876 O OG1   . THR A 1 505 ? 15.090  -7.540  3.940   1.00 65.38  ? 505 THR A OG1   1 
ATOM   3877 C CG2   . THR A 1 505 ? 14.806  -7.188  1.590   1.00 54.10  ? 505 THR A CG2   1 
ATOM   3878 N N     . ALA A 1 506 ? 11.012  -6.858  2.838   1.00 62.01  ? 506 ALA A N     1 
ATOM   3879 C CA    . ALA A 1 506 ? 9.714   -6.964  2.188   1.00 56.43  ? 506 ALA A CA    1 
ATOM   3880 C C     . ALA A 1 506 ? 8.995   -5.635  2.086   1.00 58.48  ? 506 ALA A C     1 
ATOM   3881 O O     . ALA A 1 506 ? 8.882   -5.060  0.998   1.00 66.95  ? 506 ALA A O     1 
ATOM   3882 C CB    . ALA A 1 506 ? 8.816   -7.942  2.954   1.00 61.21  ? 506 ALA A CB    1 
ATOM   3883 N N     . ALA A 1 507 ? 8.473   -5.159  3.212   1.00 55.98  ? 507 ALA A N     1 
ATOM   3884 C CA    . ALA A 1 507 ? 7.540   -4.041  3.190   1.00 59.67  ? 507 ALA A CA    1 
ATOM   3885 C C     . ALA A 1 507 ? 8.216   -2.685  3.321   1.00 56.92  ? 507 ALA A C     1 
ATOM   3886 O O     . ALA A 1 507 ? 7.540   -1.667  3.144   1.00 55.81  ? 507 ALA A O     1 
ATOM   3887 C CB    . ALA A 1 507 ? 6.498   -4.206  4.299   1.00 58.83  ? 507 ALA A CB    1 
ATOM   3888 N N     . GLN A 1 508 ? 9.513   -2.659  3.632   1.00 55.90  ? 508 GLN A N     1 
ATOM   3889 C CA    . GLN A 1 508 ? 10.313  -1.436  3.749   1.00 58.02  ? 508 GLN A CA    1 
ATOM   3890 C C     . GLN A 1 508 ? 9.571   -0.316  4.476   1.00 55.73  ? 508 GLN A C     1 
ATOM   3891 O O     . GLN A 1 508 ? 9.452   0.813   3.993   1.00 54.22  ? 508 GLN A O     1 
ATOM   3892 C CB    . GLN A 1 508 ? 10.774  -0.968  2.377   1.00 58.48  ? 508 GLN A CB    1 
ATOM   3893 C CG    . GLN A 1 508 ? 11.308  -2.086  1.529   1.00 59.78  ? 508 GLN A CG    1 
ATOM   3894 C CD    . GLN A 1 508 ? 11.604  -1.623  0.133   1.00 66.38  ? 508 GLN A CD    1 
ATOM   3895 O OE1   . GLN A 1 508 ? 12.165  -0.545  -0.062  1.00 68.79  ? 508 GLN A OE1   1 
ATOM   3896 N NE2   . GLN A 1 508 ? 11.206  -2.416  -0.855  1.00 69.30  ? 508 GLN A NE2   1 
ATOM   3897 N N     . GLN A 1 509 ? 9.082   -0.628  5.666   1.00 56.70  ? 509 GLN A N     1 
ATOM   3898 C CA    . GLN A 1 509 ? 8.248   0.323   6.382   1.00 58.58  ? 509 GLN A CA    1 
ATOM   3899 C C     . GLN A 1 509 ? 9.065   1.192   7.326   1.00 55.77  ? 509 GLN A C     1 
ATOM   3900 O O     . GLN A 1 509 ? 10.080  0.766   7.882   1.00 55.24  ? 509 GLN A O     1 
ATOM   3901 C CB    . GLN A 1 509 ? 7.153   -0.397  7.155   1.00 58.48  ? 509 GLN A CB    1 
ATOM   3902 C CG    . GLN A 1 509 ? 5.927   -0.600  6.331   1.00 56.83  ? 509 GLN A CG    1 
ATOM   3903 C CD    . GLN A 1 509 ? 5.005   -1.591  6.952   1.00 61.98  ? 509 GLN A CD    1 
ATOM   3904 O OE1   . GLN A 1 509 ? 5.447   -2.561  7.570   1.00 60.56  ? 509 GLN A OE1   1 
ATOM   3905 N NE2   . GLN A 1 509 ? 3.707   -1.363  6.799   1.00 65.97  ? 509 GLN A NE2   1 
ATOM   3906 N N     . TYR A 1 510 ? 8.608   2.431   7.477   1.00 51.44  ? 510 TYR A N     1 
ATOM   3907 C CA    . TYR A 1 510 ? 9.189   3.398   8.386   1.00 49.15  ? 510 TYR A CA    1 
ATOM   3908 C C     . TYR A 1 510 ? 8.071   4.346   8.809   1.00 51.05  ? 510 TYR A C     1 
ATOM   3909 O O     . TYR A 1 510 ? 7.002   4.383   8.195   1.00 55.36  ? 510 TYR A O     1 
ATOM   3910 C CB    . TYR A 1 510 ? 10.375  4.129   7.733   1.00 45.35  ? 510 TYR A CB    1 
ATOM   3911 C CG    . TYR A 1 510 ? 9.990   5.125   6.657   1.00 51.36  ? 510 TYR A CG    1 
ATOM   3912 C CD1   . TYR A 1 510 ? 9.870   4.745   5.320   1.00 53.64  ? 510 TYR A CD1   1 
ATOM   3913 C CD2   . TYR A 1 510 ? 9.752   6.455   6.977   1.00 51.39  ? 510 TYR A CD2   1 
ATOM   3914 C CE1   . TYR A 1 510 ? 9.516   5.675   4.342   1.00 53.02  ? 510 TYR A CE1   1 
ATOM   3915 C CE2   . TYR A 1 510 ? 9.395   7.380   6.016   1.00 49.68  ? 510 TYR A CE2   1 
ATOM   3916 C CZ    . TYR A 1 510 ? 9.280   6.995   4.699   1.00 53.07  ? 510 TYR A CZ    1 
ATOM   3917 O OH    . TYR A 1 510 ? 8.923   7.954   3.768   1.00 53.96  ? 510 TYR A OH    1 
ATOM   3918 N N     . VAL A 1 511 ? 8.297   5.088   9.883   1.00 46.32  ? 511 VAL A N     1 
ATOM   3919 C CA    . VAL A 1 511 ? 7.280   6.001   10.374  1.00 49.69  ? 511 VAL A CA    1 
ATOM   3920 C C     . VAL A 1 511 ? 7.792   7.416   10.207  1.00 47.05  ? 511 VAL A C     1 
ATOM   3921 O O     . VAL A 1 511 ? 8.993   7.669   10.133  1.00 47.11  ? 511 VAL A O     1 
ATOM   3922 C CB    . VAL A 1 511 ? 6.875   5.743   11.850  1.00 54.69  ? 511 VAL A CB    1 
ATOM   3923 C CG1   . VAL A 1 511 ? 6.269   4.361   12.019  1.00 54.34  ? 511 VAL A CG1   1 
ATOM   3924 C CG2   . VAL A 1 511 ? 8.061   5.941   12.809  1.00 49.33  ? 511 VAL A CG2   1 
ATOM   3925 N N     . SER A 1 512 ? 6.862   8.349   10.148  1.00 48.07  ? 512 SER A N     1 
ATOM   3926 C CA    . SER A 1 512 ? 7.195   9.758   10.209  1.00 51.12  ? 512 SER A CA    1 
ATOM   3927 C C     . SER A 1 512 ? 7.000   10.250  11.641  1.00 52.40  ? 512 SER A C     1 
ATOM   3928 O O     . SER A 1 512 ? 6.051   9.857   12.320  1.00 53.62  ? 512 SER A O     1 
ATOM   3929 C CB    . SER A 1 512 ? 6.337   10.559  9.227   1.00 48.38  ? 512 SER A CB    1 
ATOM   3930 O OG    . SER A 1 512 ? 4.964   10.440  9.535   1.00 55.46  ? 512 SER A OG    1 
ATOM   3931 N N     . LEU A 1 513 ? 7.913   11.086  12.106  1.00 47.92  ? 513 LEU A N     1 
ATOM   3932 C CA    . LEU A 1 513 ? 7.823   11.686  13.429  1.00 47.27  ? 513 LEU A CA    1 
ATOM   3933 C C     . LEU A 1 513 ? 7.562   13.176  13.245  1.00 48.74  ? 513 LEU A C     1 
ATOM   3934 O O     . LEU A 1 513 ? 8.439   13.908  12.776  1.00 53.02  ? 513 LEU A O     1 
ATOM   3935 C CB    . LEU A 1 513 ? 9.105   11.445  14.227  1.00 44.95  ? 513 LEU A CB    1 
ATOM   3936 C CG    . LEU A 1 513 ? 9.501   9.997   14.488  1.00 42.62  ? 513 LEU A CG    1 
ATOM   3937 C CD1   . LEU A 1 513 ? 10.777  9.907   15.316  1.00 41.03  ? 513 LEU A CD1   1 
ATOM   3938 C CD2   . LEU A 1 513 ? 8.375   9.337   15.210  1.00 45.59  ? 513 LEU A CD2   1 
ATOM   3939 N N     . ASN A 1 514 ? 6.359   13.619  13.589  1.00 44.94  ? 514 ASN A N     1 
ATOM   3940 C CA    . ASN A 1 514 ? 6.018   15.038  13.548  1.00 47.12  ? 514 ASN A CA    1 
ATOM   3941 C C     . ASN A 1 514 ? 4.860   15.271  14.506  1.00 54.88  ? 514 ASN A C     1 
ATOM   3942 O O     . ASN A 1 514 ? 4.454   14.369  15.247  1.00 56.74  ? 514 ASN A O     1 
ATOM   3943 C CB    . ASN A 1 514 ? 5.655   15.494  12.133  1.00 51.75  ? 514 ASN A CB    1 
ATOM   3944 C CG    . ASN A 1 514 ? 4.669   14.548  11.451  1.00 58.19  ? 514 ASN A CG    1 
ATOM   3945 O OD1   . ASN A 1 514 ? 3.510   14.427  11.864  1.00 56.61  ? 514 ASN A OD1   1 
ATOM   3946 N ND2   . ASN A 1 514 ? 5.132   13.868  10.402  1.00 53.92  ? 514 ASN A ND2   1 
ATOM   3947 N N     . LEU A 1 515 ? 4.299   16.485  14.461  1.00 56.99  ? 515 LEU A N     1 
ATOM   3948 C CA    . LEU A 1 515 ? 3.245   16.872  15.394  1.00 53.03  ? 515 LEU A CA    1 
ATOM   3949 C C     . LEU A 1 515 ? 1.992   16.022  15.256  1.00 53.91  ? 515 LEU A C     1 
ATOM   3950 O O     . LEU A 1 515 ? 1.176   15.995  16.184  1.00 58.37  ? 515 LEU A O     1 
ATOM   3951 C CB    . LEU A 1 515 ? 2.904   18.342  15.199  1.00 49.05  ? 515 LEU A CB    1 
ATOM   3952 C CG    . LEU A 1 515 ? 4.079   19.234  15.581  1.00 53.79  ? 515 LEU A CG    1 
ATOM   3953 C CD1   . LEU A 1 515 ? 3.740   20.690  15.384  1.00 50.03  ? 515 LEU A CD1   1 
ATOM   3954 C CD2   . LEU A 1 515 ? 4.478   18.964  17.029  1.00 53.80  ? 515 LEU A CD2   1 
ATOM   3955 N N     . LYS A 1 516 ? 1.832   15.322  14.136  1.00 54.81  ? 516 LYS A N     1 
ATOM   3956 C CA    . LYS A 1 516 ? 0.708   14.456  13.818  1.00 55.03  ? 516 LYS A CA    1 
ATOM   3957 C C     . LYS A 1 516 ? 0.995   13.027  14.259  1.00 55.51  ? 516 LYS A C     1 
ATOM   3958 O O     . LYS A 1 516 ? 2.148   12.659  14.521  1.00 57.10  ? 516 LYS A O     1 
ATOM   3959 C CB    . LYS A 1 516 ? 0.418   14.526  12.319  1.00 56.12  ? 516 LYS A CB    1 
ATOM   3960 C CG    . LYS A 1 516 ? 0.062   15.949  11.883  1.00 60.10  ? 516 LYS A CG    1 
ATOM   3961 C CD    . LYS A 1 516 ? 0.227   16.213  10.390  1.00 68.03  ? 516 LYS A CD    1 
ATOM   3962 C CE    . LYS A 1 516 ? -0.779  15.451  9.516   1.00 77.25  ? 516 LYS A CE    1 
ATOM   3963 N NZ    . LYS A 1 516 ? -0.677  15.825  8.050   1.00 79.93  ? 516 LYS A NZ    1 
ATOM   3964 N N     . PRO A 1 517 ? -0.033  12.201  14.414  1.00 52.27  ? 517 PRO A N     1 
ATOM   3965 C CA    . PRO A 1 517 ? 0.219   10.829  14.853  1.00 52.42  ? 517 PRO A CA    1 
ATOM   3966 C C     . PRO A 1 517 ? 1.098   10.093  13.854  1.00 57.04  ? 517 PRO A C     1 
ATOM   3967 O O     . PRO A 1 517 ? 1.201   10.465  12.676  1.00 55.50  ? 517 PRO A O     1 
ATOM   3968 C CB    . PRO A 1 517 ? -1.184  10.216  14.943  1.00 50.12  ? 517 PRO A CB    1 
ATOM   3969 C CG    . PRO A 1 517 ? -2.080  11.370  15.163  1.00 42.78  ? 517 PRO A CG    1 
ATOM   3970 C CD    . PRO A 1 517 ? -1.468  12.531  14.427  1.00 48.95  ? 517 PRO A CD    1 
ATOM   3971 N N     . LEU A 1 518 ? 1.765   9.054   14.365  1.00 56.55  ? 518 LEU A N     1 
ATOM   3972 C CA    . LEU A 1 518 ? 2.619   8.166   13.586  1.00 55.46  ? 518 LEU A CA    1 
ATOM   3973 C C     . LEU A 1 518 ? 1.965   7.769   12.276  1.00 60.58  ? 518 LEU A C     1 
ATOM   3974 O O     . LEU A 1 518 ? 0.868   7.207   12.264  1.00 64.11  ? 518 LEU A O     1 
ATOM   3975 C CB    . LEU A 1 518 ? 2.932   6.904   14.385  1.00 57.04  ? 518 LEU A CB    1 
ATOM   3976 C CG    . LEU A 1 518 ? 4.239   6.806   15.156  1.00 55.55  ? 518 LEU A CG    1 
ATOM   3977 C CD1   . LEU A 1 518 ? 4.657   5.347   15.272  1.00 53.81  ? 518 LEU A CD1   1 
ATOM   3978 C CD2   . LEU A 1 518 ? 5.306   7.634   14.503  1.00 54.20  ? 518 LEU A CD2   1 
ATOM   3979 N N     . GLU A 1 519 ? 2.644   8.037   11.168  1.00 56.16  ? 519 GLU A N     1 
ATOM   3980 C CA    . GLU A 1 519 ? 2.144   7.661   9.859   1.00 56.34  ? 519 GLU A CA    1 
ATOM   3981 C C     . GLU A 1 519 ? 3.177   6.777   9.182   1.00 56.77  ? 519 GLU A C     1 
ATOM   3982 O O     . GLU A 1 519 ? 4.363   7.117   9.165   1.00 58.90  ? 519 GLU A O     1 
ATOM   3983 C CB    . GLU A 1 519 ? 1.842   8.905   9.043   1.00 56.72  ? 519 GLU A CB    1 
ATOM   3984 C CG    . GLU A 1 519 ? 1.685   8.660   7.578   1.00 64.31  ? 519 GLU A CG    1 
ATOM   3985 C CD    . GLU A 1 519 ? 1.690   9.963   6.828   1.00 72.35  ? 519 GLU A CD    1 
ATOM   3986 O OE1   . GLU A 1 519 ? 1.333   10.985  7.475   1.00 76.54  ? 519 GLU A OE1   1 
ATOM   3987 O OE2   . GLU A 1 519 ? 2.060   9.965   5.626   1.00 61.85  ? 519 GLU A OE2   1 
ATOM   3988 N N     . VAL A 1 520 ? 2.741   5.638   8.652   1.00 53.64  ? 520 VAL A N     1 
ATOM   3989 C CA    . VAL A 1 520 ? 3.651   4.616   8.143   1.00 54.12  ? 520 VAL A CA    1 
ATOM   3990 C C     . VAL A 1 520 ? 3.830   4.801   6.648   1.00 55.20  ? 520 VAL A C     1 
ATOM   3991 O O     . VAL A 1 520 ? 2.850   4.974   5.915   1.00 57.46  ? 520 VAL A O     1 
ATOM   3992 C CB    . VAL A 1 520 ? 3.132   3.203   8.442   1.00 55.30  ? 520 VAL A CB    1 
ATOM   3993 C CG1   . VAL A 1 520 ? 3.974   2.176   7.703   1.00 55.10  ? 520 VAL A CG1   1 
ATOM   3994 C CG2   . VAL A 1 520 ? 3.155   2.944   9.926   1.00 53.78  ? 520 VAL A CG2   1 
ATOM   3995 N N     . ARG A 1 521 ? 5.076   4.734   6.191   1.00 53.23  ? 521 ARG A N     1 
ATOM   3996 C CA    . ARG A 1 521 ? 5.393   4.869   4.782   1.00 54.14  ? 521 ARG A CA    1 
ATOM   3997 C C     . ARG A 1 521 ? 6.274   3.710   4.354   1.00 55.14  ? 521 ARG A C     1 
ATOM   3998 O O     . ARG A 1 521 ? 6.701   2.889   5.167   1.00 57.19  ? 521 ARG A O     1 
ATOM   3999 C CB    . ARG A 1 521 ? 6.086   6.200   4.486   1.00 52.70  ? 521 ARG A CB    1 
ATOM   4000 C CG    . ARG A 1 521 ? 5.299   7.391   4.943   1.00 55.92  ? 521 ARG A CG    1 
ATOM   4001 C CD    . ARG A 1 521 ? 5.965   8.682   4.550   1.00 51.59  ? 521 ARG A CD    1 
ATOM   4002 N NE    . ARG A 1 521 ? 5.397   9.790   5.309   1.00 50.89  ? 521 ARG A NE    1 
ATOM   4003 C CZ    . ARG A 1 521 ? 6.060   10.908  5.577   1.00 52.77  ? 521 ARG A CZ    1 
ATOM   4004 N NH1   . ARG A 1 521 ? 7.305   11.050  5.143   1.00 54.85  ? 521 ARG A NH1   1 
ATOM   4005 N NH2   . ARG A 1 521 ? 5.492   11.875  6.283   1.00 56.30  ? 521 ARG A NH2   1 
ATOM   4006 N N     . ARG A 1 522 ? 6.552   3.656   3.062   1.00 51.42  ? 522 ARG A N     1 
ATOM   4007 C CA    . ARG A 1 522 ? 7.357   2.587   2.504   1.00 56.22  ? 522 ARG A CA    1 
ATOM   4008 C C     . ARG A 1 522 ? 8.490   3.181   1.687   1.00 54.31  ? 522 ARG A C     1 
ATOM   4009 O O     . ARG A 1 522 ? 8.341   4.249   1.084   1.00 56.21  ? 522 ARG A O     1 
ATOM   4010 C CB    . ARG A 1 522 ? 6.503   1.643   1.645   1.00 65.09  ? 522 ARG A CB    1 
ATOM   4011 C CG    . ARG A 1 522 ? 5.445   0.885   2.439   1.00 62.23  ? 522 ARG A CG    1 
ATOM   4012 C CD    . ARG A 1 522 ? 4.687   -0.162  1.591   1.00 71.45  ? 522 ARG A CD    1 
ATOM   4013 N NE    . ARG A 1 522 ? 5.481   -0.898  0.599   1.00 81.04  ? 522 ARG A NE    1 
ATOM   4014 C CZ    . ARG A 1 522 ? 5.171   -2.128  0.202   1.00 81.98  ? 522 ARG A CZ    1 
ATOM   4015 N NH1   . ARG A 1 522 ? 4.104   -2.723  0.761   1.00 87.56  ? 522 ARG A NH1   1 
ATOM   4016 N NH2   . ARG A 1 522 ? 5.928   -2.753  -0.712  1.00 72.61  ? 522 ARG A NH2   1 
ATOM   4017 N N     . GLY A 1 523 ? 9.632   2.503   1.708   1.00 54.73  ? 523 GLY A N     1 
ATOM   4018 C CA    . GLY A 1 523 ? 10.776  2.899   0.913   1.00 51.54  ? 523 GLY A CA    1 
ATOM   4019 C C     . GLY A 1 523 ? 11.639  3.975   1.537   1.00 52.87  ? 523 GLY A C     1 
ATOM   4020 O O     . GLY A 1 523 ? 11.178  5.100   1.766   1.00 53.32  ? 523 GLY A O     1 
ATOM   4021 N N     . LEU A 1 524 ? 12.904  3.637   1.805   1.00 52.16  ? 524 LEU A N     1 
ATOM   4022 C CA    . LEU A 1 524 ? 13.875  4.581   2.363   1.00 49.19  ? 524 LEU A CA    1 
ATOM   4023 C C     . LEU A 1 524 ? 14.608  5.234   1.201   1.00 47.75  ? 524 LEU A C     1 
ATOM   4024 O O     . LEU A 1 524 ? 15.724  4.855   0.837   1.00 46.83  ? 524 LEU A O     1 
ATOM   4025 C CB    . LEU A 1 524 ? 14.846  3.874   3.304   1.00 47.74  ? 524 LEU A CB    1 
ATOM   4026 C CG    . LEU A 1 524 ? 14.263  2.958   4.386   1.00 51.45  ? 524 LEU A CG    1 
ATOM   4027 C CD1   . LEU A 1 524 ? 15.366  2.387   5.245   1.00 49.54  ? 524 LEU A CD1   1 
ATOM   4028 C CD2   . LEU A 1 524 ? 13.214  3.657   5.247   1.00 47.56  ? 524 LEU A CD2   1 
ATOM   4029 N N     . ARG A 1 525 ? 13.955  6.230   0.609   1.00 47.00  ? 525 ARG A N     1 
ATOM   4030 C CA    . ARG A 1 525 ? 14.454  6.882   -0.592  1.00 45.34  ? 525 ARG A CA    1 
ATOM   4031 C C     . ARG A 1 525 ? 14.983  5.836   -1.576  1.00 46.62  ? 525 ARG A C     1 
ATOM   4032 O O     . ARG A 1 525 ? 16.116  5.901   -2.062  1.00 47.06  ? 525 ARG A O     1 
ATOM   4033 C CB    . ARG A 1 525 ? 15.513  7.915   -0.227  1.00 45.63  ? 525 ARG A CB    1 
ATOM   4034 C CG    . ARG A 1 525 ? 15.998  8.767   -1.390  1.00 48.23  ? 525 ARG A CG    1 
ATOM   4035 C CD    . ARG A 1 525 ? 16.321  10.167  -0.953  1.00 44.55  ? 525 ARG A CD    1 
ATOM   4036 N NE    . ARG A 1 525 ? 15.114  10.868  -0.550  1.00 42.59  ? 525 ARG A NE    1 
ATOM   4037 C CZ    . ARG A 1 525 ? 15.117  11.978  0.170   1.00 41.51  ? 525 ARG A CZ    1 
ATOM   4038 N NH1   . ARG A 1 525 ? 16.261  12.516  0.579   1.00 33.16  ? 525 ARG A NH1   1 
ATOM   4039 N NH2   . ARG A 1 525 ? 13.970  12.541  0.486   1.00 50.50  ? 525 ARG A NH2   1 
ATOM   4040 N N     . ALA A 1 526 ? 14.136  4.841   -1.858  1.00 47.11  ? 526 ALA A N     1 
ATOM   4041 C CA    . ALA A 1 526 ? 14.619  3.596   -2.453  1.00 48.45  ? 526 ALA A CA    1 
ATOM   4042 C C     . ALA A 1 526 ? 15.253  3.821   -3.827  1.00 53.34  ? 526 ALA A C     1 
ATOM   4043 O O     . ALA A 1 526 ? 16.382  3.374   -4.067  1.00 52.61  ? 526 ALA A O     1 
ATOM   4044 C CB    . ALA A 1 526 ? 13.483  2.582   -2.527  1.00 49.23  ? 526 ALA A CB    1 
ATOM   4045 N N     . GLN A 1 527 ? 14.555  4.532   -4.736  1.00 48.40  ? 527 GLN A N     1 
ATOM   4046 C CA    . GLN A 1 527 ? 15.079  4.748   -6.090  1.00 48.90  ? 527 GLN A CA    1 
ATOM   4047 C C     . GLN A 1 527 ? 16.408  5.493   -6.074  1.00 46.94  ? 527 GLN A C     1 
ATOM   4048 O O     . GLN A 1 527 ? 17.374  5.073   -6.721  1.00 51.50  ? 527 GLN A O     1 
ATOM   4049 C CB    . GLN A 1 527 ? 14.072  5.521   -6.953  1.00 57.54  ? 527 GLN A CB    1 
ATOM   4050 C CG    . GLN A 1 527 ? 12.917  4.707   -7.552  1.00 53.92  ? 527 GLN A CG    1 
ATOM   4051 C CD    . GLN A 1 527 ? 13.389  3.615   -8.483  1.00 58.05  ? 527 GLN A CD    1 
ATOM   4052 O OE1   . GLN A 1 527 ? 13.154  2.434   -8.235  1.00 61.69  ? 527 GLN A OE1   1 
ATOM   4053 N NE2   . GLN A 1 527 ? 14.054  4.000   -9.562  1.00 59.86  ? 527 GLN A NE2   1 
ATOM   4054 N N     . THR A 1 528 ? 16.465  6.626   -5.373  1.00 47.46  ? 528 THR A N     1 
ATOM   4055 C CA    . THR A 1 528 ? 17.677  7.438   -5.365  1.00 45.91  ? 528 THR A CA    1 
ATOM   4056 C C     . THR A 1 528 ? 18.825  6.763   -4.622  1.00 48.87  ? 528 THR A C     1 
ATOM   4057 O O     . THR A 1 528 ? 19.990  7.015   -4.937  1.00 51.62  ? 528 THR A O     1 
ATOM   4058 C CB    . THR A 1 528 ? 17.403  8.788   -4.720  1.00 47.73  ? 528 THR A CB    1 
ATOM   4059 O OG1   . THR A 1 528 ? 16.270  9.395   -5.337  1.00 49.68  ? 528 THR A OG1   1 
ATOM   4060 C CG2   . THR A 1 528 ? 18.588  9.695   -4.878  1.00 48.01  ? 528 THR A CG2   1 
ATOM   4061 N N     . CYS A 1 529 ? 18.546  5.932   -3.618  1.00 45.14  ? 529 CYS A N     1 
ATOM   4062 C CA    . CYS A 1 529 ? 19.676  5.306   -2.947  1.00 46.81  ? 529 CYS A CA    1 
ATOM   4063 C C     . CYS A 1 529 ? 20.237  4.139   -3.747  1.00 46.65  ? 529 CYS A C     1 
ATOM   4064 O O     . CYS A 1 529 ? 21.404  3.771   -3.556  1.00 46.29  ? 529 CYS A O     1 
ATOM   4065 C CB    . CYS A 1 529 ? 19.298  4.877   -1.518  1.00 47.08  ? 529 CYS A CB    1 
ATOM   4066 S SG    . CYS A 1 529 ? 19.115  6.295   -0.328  1.00 61.87  ? 529 CYS A SG    1 
ATOM   4067 N N     . ALA A 1 530 ? 19.449  3.571   -4.659  1.00 48.18  ? 530 ALA A N     1 
ATOM   4068 C CA    . ALA A 1 530 ? 19.995  2.595   -5.599  1.00 46.94  ? 530 ALA A CA    1 
ATOM   4069 C C     . ALA A 1 530 ? 21.083  3.214   -6.452  1.00 48.02  ? 530 ALA A C     1 
ATOM   4070 O O     . ALA A 1 530 ? 22.060  2.545   -6.811  1.00 47.69  ? 530 ALA A O     1 
ATOM   4071 C CB    . ALA A 1 530 ? 18.896  2.044   -6.493  1.00 51.26  ? 530 ALA A CB    1 
ATOM   4072 N N     . PHE A 1 531 ? 20.928  4.491   -6.799  1.00 47.04  ? 531 PHE A N     1 
ATOM   4073 C CA    . PHE A 1 531 ? 22.005  5.175   -7.498  1.00 51.44  ? 531 PHE A CA    1 
ATOM   4074 C C     . PHE A 1 531 ? 23.244  5.261   -6.617  1.00 49.13  ? 531 PHE A C     1 
ATOM   4075 O O     . PHE A 1 531 ? 24.345  4.865   -7.024  1.00 49.89  ? 531 PHE A O     1 
ATOM   4076 C CB    . PHE A 1 531 ? 21.553  6.563   -7.937  1.00 47.76  ? 531 PHE A CB    1 
ATOM   4077 C CG    . PHE A 1 531 ? 22.674  7.432   -8.390  1.00 48.32  ? 531 PHE A CG    1 
ATOM   4078 C CD1   . PHE A 1 531 ? 23.143  7.350   -9.687  1.00 48.70  ? 531 PHE A CD1   1 
ATOM   4079 C CD2   . PHE A 1 531 ? 23.275  8.326   -7.513  1.00 45.02  ? 531 PHE A CD2   1 
ATOM   4080 C CE1   . PHE A 1 531 ? 24.177  8.152   -10.114 1.00 49.21  ? 531 PHE A CE1   1 
ATOM   4081 C CE2   . PHE A 1 531 ? 24.321  9.127   -7.930  1.00 46.63  ? 531 PHE A CE2   1 
ATOM   4082 C CZ    . PHE A 1 531 ? 24.769  9.047   -9.236  1.00 50.15  ? 531 PHE A CZ    1 
ATOM   4083 N N     . TRP A 1 532 ? 23.066  5.751   -5.391  1.00 46.87  ? 532 TRP A N     1 
ATOM   4084 C CA    . TRP A 1 532 ? 24.189  5.994   -4.493  1.00 46.70  ? 532 TRP A CA    1 
ATOM   4085 C C     . TRP A 1 532 ? 24.803  4.699   -3.982  1.00 48.16  ? 532 TRP A C     1 
ATOM   4086 O O     . TRP A 1 532 ? 26.025  4.611   -3.827  1.00 52.62  ? 532 TRP A O     1 
ATOM   4087 C CB    . TRP A 1 532 ? 23.734  6.846   -3.316  1.00 41.71  ? 532 TRP A CB    1 
ATOM   4088 C CG    . TRP A 1 532 ? 23.495  8.241   -3.660  1.00 38.49  ? 532 TRP A CG    1 
ATOM   4089 C CD1   . TRP A 1 532 ? 22.292  8.880   -3.727  1.00 39.39  ? 532 TRP A CD1   1 
ATOM   4090 C CD2   . TRP A 1 532 ? 24.490  9.207   -3.974  1.00 37.68  ? 532 TRP A CD2   1 
ATOM   4091 N NE1   . TRP A 1 532 ? 22.481  10.198  -4.070  1.00 40.93  ? 532 TRP A NE1   1 
ATOM   4092 C CE2   . TRP A 1 532 ? 23.822  10.423  -4.236  1.00 39.20  ? 532 TRP A CE2   1 
ATOM   4093 C CE3   . TRP A 1 532 ? 25.884  9.159   -4.084  1.00 37.17  ? 532 TRP A CE3   1 
ATOM   4094 C CZ2   . TRP A 1 532 ? 24.502  11.583  -4.600  1.00 39.26  ? 532 TRP A CZ2   1 
ATOM   4095 C CZ3   . TRP A 1 532 ? 26.561  10.312  -4.431  1.00 37.72  ? 532 TRP A CZ3   1 
ATOM   4096 C CH2   . TRP A 1 532 ? 25.871  11.510  -4.687  1.00 39.50  ? 532 TRP A CH2   1 
ATOM   4097 N N     . ASN A 1 533 ? 23.985  3.690   -3.692  1.00 45.92  ? 533 ASN A N     1 
ATOM   4098 C CA    . ASN A 1 533 ? 24.523  2.513   -3.030  1.00 49.42  ? 533 ASN A CA    1 
ATOM   4099 C C     . ASN A 1 533 ? 24.781  1.333   -3.959  1.00 48.88  ? 533 ASN A C     1 
ATOM   4100 O O     . ASN A 1 533 ? 25.532  0.431   -3.580  1.00 49.56  ? 533 ASN A O     1 
ATOM   4101 C CB    . ASN A 1 533 ? 23.598  2.079   -1.892  1.00 49.72  ? 533 ASN A CB    1 
ATOM   4102 C CG    . ASN A 1 533 ? 23.406  3.169   -0.859  1.00 49.79  ? 533 ASN A CG    1 
ATOM   4103 O OD1   . ASN A 1 533 ? 22.276  3.473   -0.469  1.00 51.05  ? 533 ASN A OD1   1 
ATOM   4104 N ND2   . ASN A 1 533 ? 24.509  3.774   -0.415  1.00 52.12  ? 533 ASN A ND2   1 
ATOM   4105 N N     . ARG A 1 534 ? 24.212  1.316   -5.163  1.00 52.08  ? 534 ARG A N     1 
ATOM   4106 C CA    . ARG A 1 534 ? 24.438  0.227   -6.104  1.00 47.94  ? 534 ARG A CA    1 
ATOM   4107 C C     . ARG A 1 534 ? 25.189  0.660   -7.350  1.00 55.68  ? 534 ARG A C     1 
ATOM   4108 O O     . ARG A 1 534 ? 26.166  0.009   -7.734  1.00 59.26  ? 534 ARG A O     1 
ATOM   4109 C CB    . ARG A 1 534 ? 23.107  -0.406  -6.510  1.00 50.33  ? 534 ARG A CB    1 
ATOM   4110 C CG    . ARG A 1 534 ? 22.355  -1.050  -5.378  1.00 50.95  ? 534 ARG A CG    1 
ATOM   4111 C CD    . ARG A 1 534 ? 21.011  -1.513  -5.854  1.00 53.95  ? 534 ARG A CD    1 
ATOM   4112 N NE    . ARG A 1 534 ? 20.174  -2.027  -4.779  1.00 55.53  ? 534 ARG A NE    1 
ATOM   4113 C CZ    . ARG A 1 534 ? 20.178  -3.288  -4.362  1.00 57.01  ? 534 ARG A CZ    1 
ATOM   4114 N NH1   . ARG A 1 534 ? 21.001  -4.169  -4.918  1.00 59.49  ? 534 ARG A NH1   1 
ATOM   4115 N NH2   . ARG A 1 534 ? 19.363  -3.664  -3.383  1.00 55.58  ? 534 ARG A NH2   1 
ATOM   4116 N N     . PHE A 1 535 ? 24.753  1.733   -8.015  1.00 55.64  ? 535 PHE A N     1 
ATOM   4117 C CA    . PHE A 1 535 ? 25.381  2.076   -9.287  1.00 53.35  ? 535 PHE A CA    1 
ATOM   4118 C C     . PHE A 1 535 ? 26.687  2.821   -9.078  1.00 56.63  ? 535 PHE A C     1 
ATOM   4119 O O     . PHE A 1 535 ? 27.717  2.440   -9.645  1.00 54.95  ? 535 PHE A O     1 
ATOM   4120 C CB    . PHE A 1 535 ? 24.443  2.907   -10.159 1.00 55.15  ? 535 PHE A CB    1 
ATOM   4121 C CG    . PHE A 1 535 ? 25.062  3.345   -11.458 1.00 52.33  ? 535 PHE A CG    1 
ATOM   4122 C CD1   . PHE A 1 535 ? 25.407  2.414   -12.433 1.00 50.58  ? 535 PHE A CD1   1 
ATOM   4123 C CD2   . PHE A 1 535 ? 25.293  4.684   -11.710 1.00 54.49  ? 535 PHE A CD2   1 
ATOM   4124 C CE1   . PHE A 1 535 ? 25.987  2.815   -13.619 1.00 48.24  ? 535 PHE A CE1   1 
ATOM   4125 C CE2   . PHE A 1 535 ? 25.852  5.095   -12.911 1.00 57.96  ? 535 PHE A CE2   1 
ATOM   4126 C CZ    . PHE A 1 535 ? 26.208  4.158   -13.862 1.00 51.04  ? 535 PHE A CZ    1 
ATOM   4127 N N     . LEU A 1 536 ? 26.664  3.883   -8.273  1.00 52.68  ? 536 LEU A N     1 
ATOM   4128 C CA    . LEU A 1 536 ? 27.855  4.711   -8.121  1.00 50.91  ? 536 LEU A CA    1 
ATOM   4129 C C     . LEU A 1 536 ? 29.111  3.921   -7.773  1.00 57.59  ? 536 LEU A C     1 
ATOM   4130 O O     . LEU A 1 536 ? 30.166  4.220   -8.358  1.00 56.21  ? 536 LEU A O     1 
ATOM   4131 C CB    . LEU A 1 536 ? 27.604  5.793   -7.071  1.00 57.03  ? 536 LEU A CB    1 
ATOM   4132 C CG    . LEU A 1 536 ? 28.769  6.770   -6.952  1.00 60.57  ? 536 LEU A CG    1 
ATOM   4133 C CD1   . LEU A 1 536 ? 28.778  7.640   -8.191  1.00 54.84  ? 536 LEU A CD1   1 
ATOM   4134 C CD2   . LEU A 1 536 ? 28.685  7.599   -5.664  1.00 51.92  ? 536 LEU A CD2   1 
ATOM   4135 N N     . PRO A 1 537 ? 29.086  2.929   -6.866  1.00 58.54  ? 537 PRO A N     1 
ATOM   4136 C CA    . PRO A 1 537 ? 30.325  2.178   -6.587  1.00 54.75  ? 537 PRO A CA    1 
ATOM   4137 C C     . PRO A 1 537 ? 30.912  1.509   -7.815  1.00 59.71  ? 537 PRO A C     1 
ATOM   4138 O O     . PRO A 1 537 ? 32.122  1.616   -8.057  1.00 60.29  ? 537 PRO A O     1 
ATOM   4139 C CB    . PRO A 1 537 ? 29.875  1.147   -5.546  1.00 54.72  ? 537 PRO A CB    1 
ATOM   4140 C CG    . PRO A 1 537 ? 28.671  1.721   -4.924  1.00 53.81  ? 537 PRO A CG    1 
ATOM   4141 C CD    . PRO A 1 537 ? 27.982  2.494   -5.989  1.00 54.43  ? 537 PRO A CD    1 
ATOM   4142 N N     . LYS A 1 538 ? 30.080  0.804   -8.590  1.00 60.13  ? 538 LYS A N     1 
ATOM   4143 C CA    . LYS A 1 538 ? 30.552  0.154   -9.812  1.00 63.75  ? 538 LYS A CA    1 
ATOM   4144 C C     . LYS A 1 538 ? 31.110  1.171   -10.814 1.00 62.69  ? 538 LYS A C     1 
ATOM   4145 O O     . LYS A 1 538 ? 32.124  0.911   -11.470 1.00 63.56  ? 538 LYS A O     1 
ATOM   4146 C CB    . LYS A 1 538 ? 29.417  -0.667  -10.432 1.00 60.91  ? 538 LYS A CB    1 
ATOM   4147 C CG    . LYS A 1 538 ? 28.716  -1.603  -9.456  1.00 59.35  ? 538 LYS A CG    1 
ATOM   4148 C CD    . LYS A 1 538 ? 29.346  -2.987  -9.459  1.00 67.11  ? 538 LYS A CD    1 
ATOM   4149 C CE    . LYS A 1 538 ? 29.197  -3.689  -8.100  1.00 75.67  ? 538 LYS A CE    1 
ATOM   4150 N NZ    . LYS A 1 538 ? 30.042  -3.101  -6.996  1.00 73.69  ? 538 LYS A NZ    1 
ATOM   4151 N N     . LEU A 1 539 ? 30.479  2.344   -10.927 1.00 60.86  ? 539 LEU A N     1 
ATOM   4152 C CA    . LEU A 1 539 ? 30.981  3.385   -11.825 1.00 59.06  ? 539 LEU A CA    1 
ATOM   4153 C C     . LEU A 1 539 ? 32.354  3.870   -11.394 1.00 64.21  ? 539 LEU A C     1 
ATOM   4154 O O     . LEU A 1 539 ? 33.217  4.135   -12.239 1.00 66.48  ? 539 LEU A O     1 
ATOM   4155 C CB    . LEU A 1 539 ? 30.000  4.560   -11.877 1.00 56.49  ? 539 LEU A CB    1 
ATOM   4156 C CG    . LEU A 1 539 ? 30.043  5.617   -12.991 1.00 61.58  ? 539 LEU A CG    1 
ATOM   4157 C CD1   . LEU A 1 539 ? 28.841  6.525   -12.858 1.00 58.52  ? 539 LEU A CD1   1 
ATOM   4158 C CD2   . LEU A 1 539 ? 31.332  6.460   -13.079 1.00 65.17  ? 539 LEU A CD2   1 
ATOM   4159 N N     . LEU A 1 540 ? 32.573  4.012   -10.085 1.00 70.65  ? 540 LEU A N     1 
ATOM   4160 C CA    . LEU A 1 540 ? 33.833  4.547   -9.575  1.00 71.43  ? 540 LEU A CA    1 
ATOM   4161 C C     . LEU A 1 540 ? 34.988  3.544   -9.612  1.00 75.21  ? 540 LEU A C     1 
ATOM   4162 O O     . LEU A 1 540 ? 36.122  3.933   -9.317  1.00 80.73  ? 540 LEU A O     1 
ATOM   4163 C CB    . LEU A 1 540 ? 33.643  5.091   -8.153  1.00 68.32  ? 540 LEU A CB    1 
ATOM   4164 C CG    . LEU A 1 540 ? 33.030  6.498   -8.034  1.00 67.50  ? 540 LEU A CG    1 
ATOM   4165 C CD1   . LEU A 1 540 ? 32.432  6.739   -6.644  1.00 53.56  ? 540 LEU A CD1   1 
ATOM   4166 C CD2   . LEU A 1 540 ? 34.054  7.591   -8.371  1.00 60.92  ? 540 LEU A CD2   1 
ATOM   4167 N N     . SER A 1 541 ? 34.750  2.277   -9.967  1.00 70.87  ? 541 SER A N     1 
ATOM   4168 C CA    . SER A 1 541 ? 35.834  1.410   -10.440 1.00 70.58  ? 541 SER A CA    1 
ATOM   4169 C C     . SER A 1 541 ? 35.856  1.449   -11.971 1.00 80.15  ? 541 SER A C     1 
ATOM   4170 O O     . SER A 1 541 ? 35.491  0.500   -12.677 1.00 81.40  ? 541 SER A O     1 
ATOM   4171 C CB    . SER A 1 541 ? 35.691  -0.006  -9.896  1.00 73.95  ? 541 SER A CB    1 
ATOM   4172 O OG    . SER A 1 541 ? 34.413  -0.549  -10.160 1.00 80.92  ? 541 SER A OG    1 
ATOM   4173 N N     . ALA A 1 542 ? 36.279  2.609   -12.471 1.00 78.87  ? 542 ALA A N     1 
ATOM   4174 C CA    . ALA A 1 542 ? 36.370  2.880   -13.893 1.00 64.90  ? 542 ALA A CA    1 
ATOM   4175 C C     . ALA A 1 542 ? 37.009  4.245   -14.079 1.00 63.90  ? 542 ALA A C     1 
ATOM   4176 O O     . ALA A 1 542 ? 36.579  5.223   -13.469 1.00 68.42  ? 542 ALA A O     1 
ATOM   4177 C CB    . ALA A 1 542 ? 35.001  2.827   -14.542 1.00 66.09  ? 542 ALA A CB    1 
ATOM   4178 N N     . GLU B 1 4   ? -17.076 5.658   -69.899 1.00 86.58  ? 4   GLU B N     1 
ATOM   4179 C CA    . GLU B 1 4   ? -15.808 6.369   -69.764 1.00 89.86  ? 4   GLU B CA    1 
ATOM   4180 C C     . GLU B 1 4   ? -15.962 7.682   -68.967 1.00 90.40  ? 4   GLU B C     1 
ATOM   4181 O O     . GLU B 1 4   ? -16.117 8.765   -69.549 1.00 88.97  ? 4   GLU B O     1 
ATOM   4182 C CB    . GLU B 1 4   ? -15.210 6.654   -71.146 1.00 89.78  ? 4   GLU B CB    1 
ATOM   4183 C CG    . GLU B 1 4   ? -13.689 6.863   -71.132 1.00 88.15  ? 4   GLU B CG    1 
ATOM   4184 C CD    . GLU B 1 4   ? -12.935 5.802   -70.315 1.00 89.07  ? 4   GLU B CD    1 
ATOM   4185 O OE1   . GLU B 1 4   ? -13.176 4.589   -70.515 1.00 89.77  ? 4   GLU B OE1   1 
ATOM   4186 O OE2   . GLU B 1 4   ? -12.091 6.181   -69.472 1.00 87.84  ? 4   GLU B OE2   1 
ATOM   4187 N N     . ASP B 1 5   ? -15.886 7.564   -67.628 1.00 88.64  ? 5   ASP B N     1 
ATOM   4188 C CA    . ASP B 1 5   ? -16.106 8.641   -66.657 1.00 79.67  ? 5   ASP B CA    1 
ATOM   4189 C C     . ASP B 1 5   ? -14.934 9.591   -66.579 1.00 78.22  ? 5   ASP B C     1 
ATOM   4190 O O     . ASP B 1 5   ? -13.898 9.252   -65.947 1.00 76.04  ? 5   ASP B O     1 
ATOM   4191 C CB    . ASP B 1 5   ? -16.407 8.008   -65.292 1.00 78.39  ? 5   ASP B CB    1 
ATOM   4192 C CG    . ASP B 1 5   ? -16.501 9.024   -64.165 1.00 76.49  ? 5   ASP B CG    1 
ATOM   4193 O OD1   . ASP B 1 5   ? -16.572 8.564   -63.002 1.00 70.58  ? 5   ASP B OD1   1 
ATOM   4194 O OD2   . ASP B 1 5   ? -16.503 10.253  -64.425 1.00 74.90  ? 5   ASP B OD2   1 
ATOM   4195 N N     . PRO B 1 6   ? -15.049 10.798  -67.130 1.00 80.25  ? 6   PRO B N     1 
ATOM   4196 C CA    . PRO B 1 6   ? -13.874 11.684  -67.257 1.00 74.48  ? 6   PRO B CA    1 
ATOM   4197 C C     . PRO B 1 6   ? -13.238 12.099  -65.944 1.00 72.95  ? 6   PRO B C     1 
ATOM   4198 O O     . PRO B 1 6   ? -12.091 12.588  -65.947 1.00 75.50  ? 6   PRO B O     1 
ATOM   4199 C CB    . PRO B 1 6   ? -14.397 12.933  -67.987 1.00 72.95  ? 6   PRO B CB    1 
ATOM   4200 C CG    . PRO B 1 6   ? -15.788 12.589  -68.404 1.00 79.23  ? 6   PRO B CG    1 
ATOM   4201 C CD    . PRO B 1 6   ? -16.275 11.444  -67.585 1.00 78.69  ? 6   PRO B CD    1 
ATOM   4202 N N     . GLN B 1 7   ? -13.929 11.958  -64.813 1.00 71.60  ? 7   GLN B N     1 
ATOM   4203 C CA    . GLN B 1 7   ? -13.252 12.250  -63.553 1.00 70.99  ? 7   GLN B CA    1 
ATOM   4204 C C     . GLN B 1 7   ? -12.187 11.213  -63.236 1.00 70.18  ? 7   GLN B C     1 
ATOM   4205 O O     . GLN B 1 7   ? -11.287 11.490  -62.442 1.00 70.00  ? 7   GLN B O     1 
ATOM   4206 C CB    . GLN B 1 7   ? -14.273 12.348  -62.409 1.00 69.27  ? 7   GLN B CB    1 
ATOM   4207 C CG    . GLN B 1 7   ? -15.094 13.624  -62.467 1.00 70.60  ? 7   GLN B CG    1 
ATOM   4208 C CD    . GLN B 1 7   ? -14.258 14.863  -62.185 1.00 76.19  ? 7   GLN B CD    1 
ATOM   4209 O OE1   . GLN B 1 7   ? -14.078 15.252  -61.027 1.00 79.14  ? 7   GLN B OE1   1 
ATOM   4210 N NE2   . GLN B 1 7   ? -13.733 15.487  -63.244 1.00 73.83  ? 7   GLN B NE2   1 
ATOM   4211 N N     . LEU B 1 8   ? -12.250 10.043  -63.865 1.00 68.66  ? 8   LEU B N     1 
ATOM   4212 C CA    . LEU B 1 8   ? -11.274 8.988   -63.652 1.00 60.46  ? 8   LEU B CA    1 
ATOM   4213 C C     . LEU B 1 8   ? -10.181 8.974   -64.715 1.00 58.01  ? 8   LEU B C     1 
ATOM   4214 O O     . LEU B 1 8   ? -9.399  8.023   -64.778 1.00 56.37  ? 8   LEU B O     1 
ATOM   4215 C CB    . LEU B 1 8   ? -11.983 7.637   -63.598 1.00 54.69  ? 8   LEU B CB    1 
ATOM   4216 C CG    . LEU B 1 8   ? -13.153 7.630   -62.625 1.00 56.69  ? 8   LEU B CG    1 
ATOM   4217 C CD1   . LEU B 1 8   ? -13.775 6.247   -62.512 1.00 53.47  ? 8   LEU B CD1   1 
ATOM   4218 C CD2   . LEU B 1 8   ? -12.680 8.136   -61.263 1.00 62.37  ? 8   LEU B CD2   1 
ATOM   4219 N N     . LEU B 1 9   ? -10.090 10.013  -65.533 1.00 57.54  ? 9   LEU B N     1 
ATOM   4220 C CA    . LEU B 1 9   ? -9.095  10.094  -66.589 1.00 57.33  ? 9   LEU B CA    1 
ATOM   4221 C C     . LEU B 1 9   ? -8.158  11.247  -66.290 1.00 57.79  ? 9   LEU B C     1 
ATOM   4222 O O     . LEU B 1 9   ? -8.602  12.394  -66.175 1.00 61.62  ? 9   LEU B O     1 
ATOM   4223 C CB    . LEU B 1 9   ? -9.761  10.291  -67.948 1.00 62.05  ? 9   LEU B CB    1 
ATOM   4224 C CG    . LEU B 1 9   ? -9.780  9.035   -68.797 1.00 58.97  ? 9   LEU B CG    1 
ATOM   4225 C CD1   . LEU B 1 9   ? -10.644 9.275   -70.013 1.00 68.81  ? 9   LEU B CD1   1 
ATOM   4226 C CD2   . LEU B 1 9   ? -8.351  8.693   -69.183 1.00 55.69  ? 9   LEU B CD2   1 
ATOM   4227 N N     . VAL B 1 10  ? -6.872  10.949  -66.159 1.00 54.87  ? 10  VAL B N     1 
ATOM   4228 C CA    . VAL B 1 10  ? -5.876  11.961  -65.834 1.00 56.57  ? 10  VAL B CA    1 
ATOM   4229 C C     . VAL B 1 10  ? -4.712  11.828  -66.800 1.00 57.91  ? 10  VAL B C     1 
ATOM   4230 O O     . VAL B 1 10  ? -4.325  10.714  -67.173 1.00 59.31  ? 10  VAL B O     1 
ATOM   4231 C CB    . VAL B 1 10  ? -5.393  11.845  -64.371 1.00 52.74  ? 10  VAL B CB    1 
ATOM   4232 C CG1   . VAL B 1 10  ? -4.284  12.844  -64.082 1.00 50.81  ? 10  VAL B CG1   1 
ATOM   4233 C CG2   . VAL B 1 10  ? -6.551  12.068  -63.418 1.00 54.20  ? 10  VAL B CG2   1 
ATOM   4234 N N     . ARG B 1 11  ? -4.163  12.971  -67.206 1.00 55.14  ? 11  ARG B N     1 
ATOM   4235 C CA    . ARG B 1 11  ? -2.993  13.051  -68.073 1.00 56.44  ? 11  ARG B CA    1 
ATOM   4236 C C     . ARG B 1 11  ? -1.817  13.597  -67.264 1.00 58.33  ? 11  ARG B C     1 
ATOM   4237 O O     . ARG B 1 11  ? -1.670  14.813  -67.092 1.00 58.09  ? 11  ARG B O     1 
ATOM   4238 C CB    . ARG B 1 11  ? -3.295  13.926  -69.284 1.00 63.10  ? 11  ARG B CB    1 
ATOM   4239 C CG    . ARG B 1 11  ? -2.077  14.452  -70.035 1.00 65.81  ? 11  ARG B CG    1 
ATOM   4240 C CD    . ARG B 1 11  ? -1.751  13.637  -71.264 1.00 71.58  ? 11  ARG B CD    1 
ATOM   4241 N NE    . ARG B 1 11  ? -0.308  13.461  -71.403 1.00 71.61  ? 11  ARG B NE    1 
ATOM   4242 C CZ    . ARG B 1 11  ? 0.274   12.896  -72.455 1.00 76.76  ? 11  ARG B CZ    1 
ATOM   4243 N NH1   . ARG B 1 11  ? -0.472  12.458  -73.473 1.00 68.77  ? 11  ARG B NH1   1 
ATOM   4244 N NH2   . ARG B 1 11  ? 1.603   12.780  -72.488 1.00 74.37  ? 11  ARG B NH2   1 
ATOM   4245 N N     . VAL B 1 12  ? -0.985  12.692  -66.758 1.00 58.48  ? 12  VAL B N     1 
ATOM   4246 C CA    . VAL B 1 12  ? 0.300   13.089  -66.206 1.00 53.73  ? 12  VAL B CA    1 
ATOM   4247 C C     . VAL B 1 12  ? 1.299   13.085  -67.346 1.00 52.36  ? 12  VAL B C     1 
ATOM   4248 O O     . VAL B 1 12  ? 0.974   12.697  -68.474 1.00 56.55  ? 12  VAL B O     1 
ATOM   4249 C CB    . VAL B 1 12  ? 0.754   12.168  -65.064 1.00 51.91  ? 12  VAL B CB    1 
ATOM   4250 C CG1   . VAL B 1 12  ? -0.358  12.037  -64.052 1.00 53.61  ? 12  VAL B CG1   1 
ATOM   4251 C CG2   . VAL B 1 12  ? 1.218   10.805  -65.598 1.00 46.06  ? 12  VAL B CG2   1 
ATOM   4252 N N     . ARG B 1 13  ? 2.531   13.470  -67.045 1.00 45.90  ? 13  ARG B N     1 
ATOM   4253 C CA    . ARG B 1 13  ? 3.485   13.782  -68.085 1.00 47.60  ? 13  ARG B CA    1 
ATOM   4254 C C     . ARG B 1 13  ? 3.947   12.567  -68.873 1.00 49.08  ? 13  ARG B C     1 
ATOM   4255 O O     . ARG B 1 13  ? 4.496   12.725  -69.967 1.00 57.96  ? 13  ARG B O     1 
ATOM   4256 C CB    . ARG B 1 13  ? 4.663   14.495  -67.462 1.00 46.59  ? 13  ARG B CB    1 
ATOM   4257 C CG    . ARG B 1 13  ? 4.306   15.833  -66.861 1.00 62.87  ? 13  ARG B CG    1 
ATOM   4258 C CD    . ARG B 1 13  ? 5.563   16.723  -66.783 1.00 69.52  ? 13  ARG B CD    1 
ATOM   4259 N NE    . ARG B 1 13  ? 6.660   16.115  -66.035 1.00 78.43  ? 13  ARG B NE    1 
ATOM   4260 C CZ    . ARG B 1 13  ? 7.598   15.300  -66.545 1.00 78.86  ? 13  ARG B CZ    1 
ATOM   4261 N NH1   . ARG B 1 13  ? 7.643   14.985  -67.844 1.00 63.35  ? 13  ARG B NH1   1 
ATOM   4262 N NH2   . ARG B 1 13  ? 8.529   14.797  -65.738 1.00 76.60  ? 13  ARG B NH2   1 
ATOM   4263 N N     . GLY B 1 14  ? 3.717   11.372  -68.378 1.00 46.53  ? 14  GLY B N     1 
ATOM   4264 C CA    . GLY B 1 14  ? 4.139   10.198  -69.085 1.00 47.97  ? 14  GLY B CA    1 
ATOM   4265 C C     . GLY B 1 14  ? 3.021   9.496   -69.786 1.00 52.49  ? 14  GLY B C     1 
ATOM   4266 O O     . GLY B 1 14  ? 3.233   8.410   -70.339 1.00 51.78  ? 14  GLY B O     1 
ATOM   4267 N N     . GLY B 1 15  ? 1.832   10.064  -69.777 1.00 49.27  ? 15  GLY B N     1 
ATOM   4268 C CA    . GLY B 1 15  ? 0.741   9.435   -70.470 1.00 49.31  ? 15  GLY B CA    1 
ATOM   4269 C C     . GLY B 1 15  ? -0.541  9.622   -69.714 1.00 55.06  ? 15  GLY B C     1 
ATOM   4270 O O     . GLY B 1 15  ? -0.648  10.479  -68.834 1.00 53.57  ? 15  GLY B O     1 
ATOM   4271 N N     . GLN B 1 16  ? -1.523  8.803   -70.064 1.00 52.33  ? 16  GLN B N     1 
ATOM   4272 C CA    . GLN B 1 16  ? -2.852  8.916   -69.491 1.00 53.66  ? 16  GLN B CA    1 
ATOM   4273 C C     . GLN B 1 16  ? -3.109  7.775   -68.523 1.00 52.68  ? 16  GLN B C     1 
ATOM   4274 O O     . GLN B 1 16  ? -2.761  6.620   -68.798 1.00 51.60  ? 16  GLN B O     1 
ATOM   4275 C CB    . GLN B 1 16  ? -3.926  8.925   -70.575 1.00 53.28  ? 16  GLN B CB    1 
ATOM   4276 C CG    . GLN B 1 16  ? -4.035  10.232  -71.326 1.00 59.26  ? 16  GLN B CG    1 
ATOM   4277 C CD    . GLN B 1 16  ? -5.460  10.505  -71.774 1.00 72.73  ? 16  GLN B CD    1 
ATOM   4278 O OE1   . GLN B 1 16  ? -6.200  11.230  -71.091 1.00 72.26  ? 16  GLN B OE1   1 
ATOM   4279 N NE2   . GLN B 1 16  ? -5.864  9.916   -72.919 1.00 56.42  ? 16  GLN B NE2   1 
ATOM   4280 N N     . LEU B 1 17  ? -3.708  8.122   -67.391 1.00 49.54  ? 17  LEU B N     1 
ATOM   4281 C CA    . LEU B 1 17  ? -4.156  7.177   -66.388 1.00 49.70  ? 17  LEU B CA    1 
ATOM   4282 C C     . LEU B 1 17  ? -5.657  7.037   -66.494 1.00 50.36  ? 17  LEU B C     1 
ATOM   4283 O O     . LEU B 1 17  ? -6.357  8.005   -66.794 1.00 53.01  ? 17  LEU B O     1 
ATOM   4284 C CB    . LEU B 1 17  ? -3.843  7.653   -64.958 1.00 52.39  ? 17  LEU B CB    1 
ATOM   4285 C CG    . LEU B 1 17  ? -2.443  7.851   -64.404 1.00 48.86  ? 17  LEU B CG    1 
ATOM   4286 C CD1   . LEU B 1 17  ? -1.548  6.716   -64.838 1.00 55.11  ? 17  LEU B CD1   1 
ATOM   4287 C CD2   . LEU B 1 17  ? -1.902  9.145   -64.891 1.00 55.84  ? 17  LEU B CD2   1 
ATOM   4288 N N     . ARG B 1 18  ? -6.150  5.847   -66.172 1.00 49.77  ? 18  ARG B N     1 
ATOM   4289 C CA    . ARG B 1 18  ? -7.535  5.672   -65.761 1.00 52.36  ? 18  ARG B CA    1 
ATOM   4290 C C     . ARG B 1 18  ? -7.580  5.208   -64.312 1.00 52.80  ? 18  ARG B C     1 
ATOM   4291 O O     . ARG B 1 18  ? -6.902  4.246   -63.938 1.00 48.94  ? 18  ARG B O     1 
ATOM   4292 C CB    . ARG B 1 18  ? -8.279  4.669   -66.635 1.00 58.44  ? 18  ARG B CB    1 
ATOM   4293 C CG    . ARG B 1 18  ? -9.740  4.546   -66.230 1.00 57.85  ? 18  ARG B CG    1 
ATOM   4294 C CD    . ARG B 1 18  ? -10.512 3.605   -67.113 1.00 68.48  ? 18  ARG B CD    1 
ATOM   4295 N NE    . ARG B 1 18  ? -10.383 3.942   -68.528 1.00 74.92  ? 18  ARG B NE    1 
ATOM   4296 C CZ    . ARG B 1 18  ? -9.563  3.312   -69.363 1.00 73.33  ? 18  ARG B CZ    1 
ATOM   4297 N NH1   . ARG B 1 18  ? -8.799  2.319   -68.910 1.00 68.02  ? 18  ARG B NH1   1 
ATOM   4298 N NH2   . ARG B 1 18  ? -9.502  3.678   -70.639 1.00 68.69  ? 18  ARG B NH2   1 
ATOM   4299 N N     . GLY B 1 19  ? -8.391  5.879   -63.506 1.00 53.06  ? 19  GLY B N     1 
ATOM   4300 C CA    . GLY B 1 19  ? -8.567  5.526   -62.122 1.00 53.05  ? 19  GLY B CA    1 
ATOM   4301 C C     . GLY B 1 19  ? -9.794  4.674   -61.908 1.00 53.29  ? 19  GLY B C     1 
ATOM   4302 O O     . GLY B 1 19  ? -10.316 4.040   -62.829 1.00 54.28  ? 19  GLY B O     1 
ATOM   4303 N N     . ILE B 1 20  ? -10.277 4.676   -60.675 1.00 50.06  ? 20  ILE B N     1 
ATOM   4304 C CA    . ILE B 1 20  ? -11.461 3.910   -60.324 1.00 53.58  ? 20  ILE B CA    1 
ATOM   4305 C C     . ILE B 1 20  ? -12.202 4.670   -59.245 1.00 56.33  ? 20  ILE B C     1 
ATOM   4306 O O     . ILE B 1 20  ? -11.584 5.290   -58.381 1.00 65.49  ? 20  ILE B O     1 
ATOM   4307 C CB    . ILE B 1 20  ? -11.073 2.494   -59.862 1.00 57.50  ? 20  ILE B CB    1 
ATOM   4308 C CG1   . ILE B 1 20  ? -12.275 1.738   -59.319 1.00 56.36  ? 20  ILE B CG1   1 
ATOM   4309 C CG2   . ILE B 1 20  ? -9.995  2.556   -58.812 1.00 55.72  ? 20  ILE B CG2   1 
ATOM   4310 C CD1   . ILE B 1 20  ? -11.950 0.291   -59.064 1.00 57.10  ? 20  ILE B CD1   1 
ATOM   4311 N N     . ARG B 1 21  ? -13.526 4.649   -59.306 1.00 58.30  ? 21  ARG B N     1 
ATOM   4312 C CA    . ARG B 1 21  ? -14.346 5.289   -58.290 1.00 55.49  ? 21  ARG B CA    1 
ATOM   4313 C C     . ARG B 1 21  ? -14.699 4.250   -57.241 1.00 58.99  ? 21  ARG B C     1 
ATOM   4314 O O     . ARG B 1 21  ? -15.243 3.192   -57.568 1.00 57.38  ? 21  ARG B O     1 
ATOM   4315 C CB    . ARG B 1 21  ? -15.607 5.900   -58.896 1.00 60.69  ? 21  ARG B CB    1 
ATOM   4316 C CG    . ARG B 1 21  ? -16.470 6.633   -57.884 1.00 66.97  ? 21  ARG B CG    1 
ATOM   4317 C CD    . ARG B 1 21  ? -17.749 7.195   -58.496 1.00 68.66  ? 21  ARG B CD    1 
ATOM   4318 N NE    . ARG B 1 21  ? -18.536 6.146   -59.124 1.00 70.60  ? 21  ARG B NE    1 
ATOM   4319 C CZ    . ARG B 1 21  ? -19.270 5.264   -58.458 1.00 76.33  ? 21  ARG B CZ    1 
ATOM   4320 N NH1   . ARG B 1 21  ? -19.332 5.303   -57.127 1.00 75.46  ? 21  ARG B NH1   1 
ATOM   4321 N NH2   . ARG B 1 21  ? -19.944 4.338   -59.129 1.00 80.56  ? 21  ARG B NH2   1 
ATOM   4322 N N     . LEU B 1 22  ? -14.367 4.541   -55.987 1.00 62.73  ? 22  LEU B N     1 
ATOM   4323 C CA    . LEU B 1 22  ? -14.660 3.657   -54.875 1.00 58.40  ? 22  LEU B CA    1 
ATOM   4324 C C     . LEU B 1 22  ? -15.594 4.338   -53.899 1.00 60.56  ? 22  LEU B C     1 
ATOM   4325 O O     . LEU B 1 22  ? -15.707 5.564   -53.870 1.00 61.10  ? 22  LEU B O     1 
ATOM   4326 C CB    . LEU B 1 22  ? -13.392 3.230   -54.140 1.00 59.44  ? 22  LEU B CB    1 
ATOM   4327 C CG    . LEU B 1 22  ? -12.231 2.836   -55.027 1.00 60.88  ? 22  LEU B CG    1 
ATOM   4328 C CD1   . LEU B 1 22  ? -11.013 2.794   -54.159 1.00 60.72  ? 22  LEU B CD1   1 
ATOM   4329 C CD2   . LEU B 1 22  ? -12.531 1.505   -55.724 1.00 68.51  ? 22  LEU B CD2   1 
ATOM   4330 N N     . LYS B 1 23  ? -16.251 3.512   -53.092 1.00 63.30  ? 23  LYS B N     1 
ATOM   4331 C CA    . LYS B 1 23  ? -17.180 3.988   -52.082 1.00 63.55  ? 23  LYS B CA    1 
ATOM   4332 C C     . LYS B 1 23  ? -16.448 4.179   -50.761 1.00 64.75  ? 23  LYS B C     1 
ATOM   4333 O O     . LYS B 1 23  ? -15.879 3.230   -50.215 1.00 65.69  ? 23  LYS B O     1 
ATOM   4334 C CB    . LYS B 1 23  ? -18.339 3.010   -51.910 1.00 63.12  ? 23  LYS B CB    1 
ATOM   4335 C CG    . LYS B 1 23  ? -19.676 3.705   -51.791 1.00 74.41  ? 23  LYS B CG    1 
ATOM   4336 C CD    . LYS B 1 23  ? -19.847 4.735   -52.896 1.00 84.60  ? 23  LYS B CD    1 
ATOM   4337 C CE    . LYS B 1 23  ? -21.033 5.561   -52.697 1.00 84.79  ? 23  LYS B CE    1 
ATOM   4338 N NZ    . LYS B 1 23  ? -21.016 6.269   -51.459 1.00 71.58  ? 23  LYS B NZ    1 
ATOM   4339 N N     . ALA B 1 24  ? -16.445 5.396   -50.273 1.00 67.32  ? 24  ALA B N     1 
ATOM   4340 C CA    . ALA B 1 24  ? -16.212 5.735   -48.881 1.00 65.20  ? 24  ALA B CA    1 
ATOM   4341 C C     . ALA B 1 24  ? -17.555 5.922   -48.185 1.00 65.95  ? 24  ALA B C     1 
ATOM   4342 O O     . ALA B 1 24  ? -18.562 6.209   -48.838 1.00 69.27  ? 24  ALA B O     1 
ATOM   4343 C CB    . ALA B 1 24  ? -15.371 7.012   -48.785 1.00 61.48  ? 24  ALA B CB    1 
ATOM   4344 N N     . PRO B 1 25  ? -17.627 5.769   -46.860 1.00 68.19  ? 25  PRO B N     1 
ATOM   4345 C CA    . PRO B 1 25  ? -18.951 5.645   -46.224 1.00 69.26  ? 25  PRO B CA    1 
ATOM   4346 C C     . PRO B 1 25  ? -19.876 6.831   -46.459 1.00 65.62  ? 25  PRO B C     1 
ATOM   4347 O O     . PRO B 1 25  ? -21.094 6.682   -46.308 1.00 67.41  ? 25  PRO B O     1 
ATOM   4348 C CB    . PRO B 1 25  ? -18.612 5.474   -44.736 1.00 60.20  ? 25  PRO B CB    1 
ATOM   4349 C CG    . PRO B 1 25  ? -17.210 4.974   -44.727 1.00 60.13  ? 25  PRO B CG    1 
ATOM   4350 C CD    . PRO B 1 25  ? -16.546 5.686   -45.862 1.00 62.13  ? 25  PRO B CD    1 
ATOM   4351 N N     . GLY B 1 26  ? -19.359 7.987   -46.856 1.00 60.70  ? 26  GLY B N     1 
ATOM   4352 C CA    . GLY B 1 26  ? -20.232 9.129   -47.011 1.00 58.05  ? 26  GLY B CA    1 
ATOM   4353 C C     . GLY B 1 26  ? -20.178 9.738   -48.387 1.00 66.56  ? 26  GLY B C     1 
ATOM   4354 O O     . GLY B 1 26  ? -20.708 10.829  -48.607 1.00 71.63  ? 26  GLY B O     1 
ATOM   4355 N N     . GLY B 1 27  ? -19.546 9.039   -49.325 1.00 68.28  ? 27  GLY B N     1 
ATOM   4356 C CA    . GLY B 1 27  ? -19.346 9.556   -50.659 1.00 67.40  ? 27  GLY B CA    1 
ATOM   4357 C C     . GLY B 1 27  ? -18.293 8.770   -51.412 1.00 68.81  ? 27  GLY B C     1 
ATOM   4358 O O     . GLY B 1 27  ? -17.550 7.976   -50.831 1.00 70.69  ? 27  GLY B O     1 
ATOM   4359 N N     . PRO B 1 28  ? -18.215 8.961   -52.724 1.00 70.35  ? 28  PRO B N     1 
ATOM   4360 C CA    . PRO B 1 28  ? -17.212 8.252   -53.516 1.00 67.53  ? 28  PRO B CA    1 
ATOM   4361 C C     . PRO B 1 28  ? -15.912 9.039   -53.617 1.00 63.92  ? 28  PRO B C     1 
ATOM   4362 O O     . PRO B 1 28  ? -15.873 10.261  -53.454 1.00 63.36  ? 28  PRO B O     1 
ATOM   4363 C CB    . PRO B 1 28  ? -17.893 8.138   -54.886 1.00 68.56  ? 28  PRO B CB    1 
ATOM   4364 C CG    . PRO B 1 28  ? -18.664 9.412   -54.980 1.00 60.50  ? 28  PRO B CG    1 
ATOM   4365 C CD    . PRO B 1 28  ? -19.148 9.714   -53.583 1.00 68.68  ? 28  PRO B CD    1 
ATOM   4366 N N     . VAL B 1 29  ? -14.834 8.304   -53.896 1.00 60.90  ? 29  VAL B N     1 
ATOM   4367 C CA    . VAL B 1 29  ? -13.521 8.899   -54.103 1.00 59.76  ? 29  VAL B CA    1 
ATOM   4368 C C     . VAL B 1 29  ? -12.919 8.351   -55.385 1.00 59.65  ? 29  VAL B C     1 
ATOM   4369 O O     . VAL B 1 29  ? -13.142 7.194   -55.758 1.00 59.14  ? 29  VAL B O     1 
ATOM   4370 C CB    . VAL B 1 29  ? -12.552 8.647   -52.923 1.00 56.79  ? 29  VAL B CB    1 
ATOM   4371 C CG1   . VAL B 1 29  ? -13.025 9.370   -51.696 1.00 55.05  ? 29  VAL B CG1   1 
ATOM   4372 C CG2   . VAL B 1 29  ? -12.415 7.157   -52.654 1.00 54.25  ? 29  VAL B CG2   1 
ATOM   4373 N N     . SER B 1 30  ? -12.150 9.204   -56.059 1.00 57.83  ? 30  SER B N     1 
ATOM   4374 C CA    . SER B 1 30  ? -11.287 8.785   -57.149 1.00 53.86  ? 30  SER B CA    1 
ATOM   4375 C C     . SER B 1 30  ? -10.020 8.158   -56.583 1.00 55.10  ? 30  SER B C     1 
ATOM   4376 O O     . SER B 1 30  ? -9.421  8.696   -55.646 1.00 61.25  ? 30  SER B O     1 
ATOM   4377 C CB    . SER B 1 30  ? -10.935 9.987   -58.020 1.00 60.46  ? 30  SER B CB    1 
ATOM   4378 O OG    . SER B 1 30  ? -12.055 10.841  -58.171 1.00 66.30  ? 30  SER B OG    1 
ATOM   4379 N N     . ALA B 1 31  ? -9.613  7.019   -57.140 1.00 51.14  ? 31  ALA B N     1 
ATOM   4380 C CA    . ALA B 1 31  ? -8.390  6.340   -56.729 1.00 52.39  ? 31  ALA B CA    1 
ATOM   4381 C C     . ALA B 1 31  ? -7.581  5.977   -57.964 1.00 54.65  ? 31  ALA B C     1 
ATOM   4382 O O     . ALA B 1 31  ? -8.115  5.399   -58.914 1.00 56.26  ? 31  ALA B O     1 
ATOM   4383 C CB    . ALA B 1 31  ? -8.687  5.081   -55.905 1.00 48.02  ? 31  ALA B CB    1 
ATOM   4384 N N     . PHE B 1 32  ? -6.297  6.314   -57.949 1.00 51.90  ? 32  PHE B N     1 
ATOM   4385 C CA    . PHE B 1 32  ? -5.368  5.970   -59.017 1.00 50.35  ? 32  PHE B CA    1 
ATOM   4386 C C     . PHE B 1 32  ? -4.252  5.125   -58.407 1.00 50.94  ? 32  PHE B C     1 
ATOM   4387 O O     . PHE B 1 32  ? -3.223  5.651   -57.977 1.00 50.31  ? 32  PHE B O     1 
ATOM   4388 C CB    . PHE B 1 32  ? -4.842  7.219   -59.681 1.00 49.27  ? 32  PHE B CB    1 
ATOM   4389 C CG    . PHE B 1 32  ? -5.920  8.155   -60.110 1.00 53.24  ? 32  PHE B CG    1 
ATOM   4390 C CD1   . PHE B 1 32  ? -6.429  9.096   -59.234 1.00 54.50  ? 32  PHE B CD1   1 
ATOM   4391 C CD2   . PHE B 1 32  ? -6.447  8.080   -61.385 1.00 56.81  ? 32  PHE B CD2   1 
ATOM   4392 C CE1   . PHE B 1 32  ? -7.436  9.954   -59.633 1.00 57.25  ? 32  PHE B CE1   1 
ATOM   4393 C CE2   . PHE B 1 32  ? -7.453  8.935   -61.793 1.00 55.73  ? 32  PHE B CE2   1 
ATOM   4394 C CZ    . PHE B 1 32  ? -7.949  9.869   -60.918 1.00 58.70  ? 32  PHE B CZ    1 
ATOM   4395 N N     . LEU B 1 33  ? -4.453  3.809   -58.395 1.00 46.06  ? 33  LEU B N     1 
ATOM   4396 C CA    . LEU B 1 33  ? -3.527  2.864   -57.792 1.00 46.35  ? 33  LEU B CA    1 
ATOM   4397 C C     . LEU B 1 33  ? -2.586  2.266   -58.836 1.00 48.10  ? 33  LEU B C     1 
ATOM   4398 O O     . LEU B 1 33  ? -3.031  1.824   -59.897 1.00 56.00  ? 33  LEU B O     1 
ATOM   4399 C CB    . LEU B 1 33  ? -4.310  1.751   -57.098 1.00 47.80  ? 33  LEU B CB    1 
ATOM   4400 C CG    . LEU B 1 33  ? -5.646  2.171   -56.477 1.00 51.26  ? 33  LEU B CG    1 
ATOM   4401 C CD1   . LEU B 1 33  ? -6.449  0.954   -56.050 1.00 46.99  ? 33  LEU B CD1   1 
ATOM   4402 C CD2   . LEU B 1 33  ? -5.447  3.121   -55.279 1.00 50.26  ? 33  LEU B CD2   1 
ATOM   4403 N N     . GLY B 1 34  ? -1.293  2.231   -58.526 1.00 45.97  ? 34  GLY B N     1 
ATOM   4404 C CA    . GLY B 1 34  ? -0.337  1.479   -59.316 1.00 43.26  ? 34  GLY B CA    1 
ATOM   4405 C C     . GLY B 1 34  ? 0.425   2.272   -60.348 1.00 48.00  ? 34  GLY B C     1 
ATOM   4406 O O     . GLY B 1 34  ? 1.002   1.676   -61.263 1.00 51.76  ? 34  GLY B O     1 
ATOM   4407 N N     . ILE B 1 35  ? 0.441   3.594   -60.239 1.00 45.92  ? 35  ILE B N     1 
ATOM   4408 C CA    . ILE B 1 35  ? 1.107   4.485   -61.184 1.00 39.64  ? 35  ILE B CA    1 
ATOM   4409 C C     . ILE B 1 35  ? 2.613   4.266   -61.132 1.00 42.94  ? 35  ILE B C     1 
ATOM   4410 O O     . ILE B 1 35  ? 3.218   4.410   -60.063 1.00 48.81  ? 35  ILE B O     1 
ATOM   4411 C CB    . ILE B 1 35  ? 0.763   5.943   -60.861 1.00 40.74  ? 35  ILE B CB    1 
ATOM   4412 C CG1   . ILE B 1 35  ? -0.749  6.100   -60.703 1.00 41.51  ? 35  ILE B CG1   1 
ATOM   4413 C CG2   . ILE B 1 35  ? 1.349   6.866   -61.891 1.00 43.42  ? 35  ILE B CG2   1 
ATOM   4414 C CD1   . ILE B 1 35  ? -1.183  7.470   -60.270 1.00 43.29  ? 35  ILE B CD1   1 
ATOM   4415 N N     . PRO B 1 36  ? 3.267   3.934   -62.237 1.00 44.76  ? 36  PRO B N     1 
ATOM   4416 C CA    . PRO B 1 36  ? 4.730   3.840   -62.212 1.00 46.12  ? 36  PRO B CA    1 
ATOM   4417 C C     . PRO B 1 36  ? 5.352   5.221   -62.086 1.00 42.24  ? 36  PRO B C     1 
ATOM   4418 O O     . PRO B 1 36  ? 4.997   6.140   -62.823 1.00 46.25  ? 36  PRO B O     1 
ATOM   4419 C CB    . PRO B 1 36  ? 5.065   3.202   -63.565 1.00 43.67  ? 36  PRO B CB    1 
ATOM   4420 C CG    . PRO B 1 36  ? 3.974   3.624   -64.438 1.00 42.35  ? 36  PRO B CG    1 
ATOM   4421 C CD    . PRO B 1 36  ? 2.732   3.630   -63.573 1.00 47.85  ? 36  PRO B CD    1 
ATOM   4422 N N     . PHE B 1 37  ? 6.282   5.368   -61.144 1.00 42.30  ? 37  PHE B N     1 
ATOM   4423 C CA    . PHE B 1 37  ? 7.082   6.584   -61.084 1.00 42.30  ? 37  PHE B CA    1 
ATOM   4424 C C     . PHE B 1 37  ? 8.539   6.321   -61.408 1.00 40.43  ? 37  PHE B C     1 
ATOM   4425 O O     . PHE B 1 37  ? 9.302   7.276   -61.584 1.00 41.11  ? 37  PHE B O     1 
ATOM   4426 C CB    . PHE B 1 37  ? 6.953   7.288   -59.706 1.00 43.76  ? 37  PHE B CB    1 
ATOM   4427 C CG    . PHE B 1 37  ? 7.407   6.464   -58.522 1.00 39.08  ? 37  PHE B CG    1 
ATOM   4428 C CD1   . PHE B 1 37  ? 8.727   6.496   -58.098 1.00 39.54  ? 37  PHE B CD1   1 
ATOM   4429 C CD2   . PHE B 1 37  ? 6.506   5.673   -57.817 1.00 39.63  ? 37  PHE B CD2   1 
ATOM   4430 C CE1   . PHE B 1 37  ? 9.144   5.730   -56.992 1.00 40.53  ? 37  PHE B CE1   1 
ATOM   4431 C CE2   . PHE B 1 37  ? 6.921   4.908   -56.717 1.00 37.50  ? 37  PHE B CE2   1 
ATOM   4432 C CZ    . PHE B 1 37  ? 8.238   4.938   -56.308 1.00 34.51  ? 37  PHE B CZ    1 
ATOM   4433 N N     . ALA B 1 38  ? 8.929   5.060   -61.537 1.00 42.83  ? 38  ALA B N     1 
ATOM   4434 C CA    . ALA B 1 38  ? 10.298  4.707   -61.867 1.00 46.98  ? 38  ALA B CA    1 
ATOM   4435 C C     . ALA B 1 38  ? 10.330  3.516   -62.817 1.00 50.02  ? 38  ALA B C     1 
ATOM   4436 O O     . ALA B 1 38  ? 9.435   2.653   -62.815 1.00 44.36  ? 38  ALA B O     1 
ATOM   4437 C CB    . ALA B 1 38  ? 11.108  4.378   -60.605 1.00 43.67  ? 38  ALA B CB    1 
ATOM   4438 N N     . GLU B 1 39  ? 11.388  3.483   -63.620 1.00 46.61  ? 39  GLU B N     1 
ATOM   4439 C CA    . GLU B 1 39  ? 11.715  2.296   -64.395 1.00 47.64  ? 39  GLU B CA    1 
ATOM   4440 C C     . GLU B 1 39  ? 11.977  1.127   -63.455 1.00 53.85  ? 39  GLU B C     1 
ATOM   4441 O O     . GLU B 1 39  ? 12.720  1.287   -62.467 1.00 53.52  ? 39  GLU B O     1 
ATOM   4442 C CB    . GLU B 1 39  ? 12.945  2.558   -65.251 1.00 45.89  ? 39  GLU B CB    1 
ATOM   4443 C CG    . GLU B 1 39  ? 12.677  3.507   -66.375 1.00 51.02  ? 39  GLU B CG    1 
ATOM   4444 C CD    . GLU B 1 39  ? 12.025  2.798   -67.523 1.00 54.32  ? 39  GLU B CD    1 
ATOM   4445 O OE1   . GLU B 1 39  ? 10.771  2.692   -67.538 1.00 55.05  ? 39  GLU B OE1   1 
ATOM   4446 O OE2   . GLU B 1 39  ? 12.788  2.301   -68.382 1.00 57.57  ? 39  GLU B OE2   1 
ATOM   4447 N N     . PRO B 1 40  ? 11.395  -0.043  -63.709 1.00 50.75  ? 40  PRO B N     1 
ATOM   4448 C CA    . PRO B 1 40  ? 11.522  -1.165  -62.773 1.00 51.31  ? 40  PRO B CA    1 
ATOM   4449 C C     . PRO B 1 40  ? 12.974  -1.451  -62.446 1.00 52.37  ? 40  PRO B C     1 
ATOM   4450 O O     . PRO B 1 40  ? 13.785  -1.687  -63.353 1.00 57.10  ? 40  PRO B O     1 
ATOM   4451 C CB    . PRO B 1 40  ? 10.876  -2.323  -63.539 1.00 50.02  ? 40  PRO B CB    1 
ATOM   4452 C CG    . PRO B 1 40  ? 9.797   -1.635  -64.315 1.00 44.03  ? 40  PRO B CG    1 
ATOM   4453 C CD    . PRO B 1 40  ? 10.381  -0.310  -64.739 1.00 44.60  ? 40  PRO B CD    1 
ATOM   4454 N N     . PRO B 1 41  ? 13.337  -1.439  -61.148 1.00 54.89  ? 41  PRO B N     1 
ATOM   4455 C CA    . PRO B 1 41  ? 14.749  -1.550  -60.752 1.00 51.37  ? 41  PRO B CA    1 
ATOM   4456 C C     . PRO B 1 41  ? 15.270  -2.975  -60.777 1.00 48.11  ? 41  PRO B C     1 
ATOM   4457 O O     . PRO B 1 41  ? 16.015  -3.391  -59.892 1.00 50.52  ? 41  PRO B O     1 
ATOM   4458 C CB    . PRO B 1 41  ? 14.733  -1.007  -59.321 1.00 42.56  ? 41  PRO B CB    1 
ATOM   4459 C CG    . PRO B 1 41  ? 13.404  -1.451  -58.819 1.00 40.53  ? 41  PRO B CG    1 
ATOM   4460 C CD    . PRO B 1 41  ? 12.448  -1.353  -59.970 1.00 47.78  ? 41  PRO B CD    1 
ATOM   4461 N N     . VAL B 1 42  ? 14.906  -3.731  -61.798 1.00 55.16  ? 42  VAL B N     1 
ATOM   4462 C CA    . VAL B 1 42  ? 15.203  -5.137  -61.844 1.00 55.36  ? 42  VAL B CA    1 
ATOM   4463 C C     . VAL B 1 42  ? 16.486  -5.388  -62.632 1.00 49.02  ? 42  VAL B C     1 
ATOM   4464 O O     . VAL B 1 42  ? 17.022  -4.510  -63.309 1.00 42.13  ? 42  VAL B O     1 
ATOM   4465 C CB    . VAL B 1 42  ? 14.017  -5.929  -62.417 1.00 50.28  ? 42  VAL B CB    1 
ATOM   4466 C CG1   . VAL B 1 42  ? 12.784  -5.687  -61.543 1.00 46.23  ? 42  VAL B CG1   1 
ATOM   4467 C CG2   . VAL B 1 42  ? 13.758  -5.474  -63.807 1.00 42.75  ? 42  VAL B CG2   1 
ATOM   4468 N N     . GLY B 1 43  ? 17.004  -6.605  -62.504 1.00 48.58  ? 43  GLY B N     1 
ATOM   4469 C CA    . GLY B 1 43  ? 18.198  -7.046  -63.184 1.00 50.37  ? 43  GLY B CA    1 
ATOM   4470 C C     . GLY B 1 43  ? 19.437  -6.278  -62.801 1.00 52.35  ? 43  GLY B C     1 
ATOM   4471 O O     . GLY B 1 43  ? 19.908  -6.348  -61.661 1.00 55.04  ? 43  GLY B O     1 
ATOM   4472 N N     . SER B 1 44  ? 19.987  -5.553  -63.765 1.00 53.46  ? 44  SER B N     1 
ATOM   4473 C CA    . SER B 1 44  ? 21.204  -4.803  -63.527 1.00 54.97  ? 44  SER B CA    1 
ATOM   4474 C C     . SER B 1 44  ? 20.941  -3.514  -62.770 1.00 55.31  ? 44  SER B C     1 
ATOM   4475 O O     . SER B 1 44  ? 21.891  -2.891  -62.279 1.00 53.93  ? 44  SER B O     1 
ATOM   4476 C CB    . SER B 1 44  ? 21.893  -4.486  -64.849 1.00 50.32  ? 44  SER B CB    1 
ATOM   4477 O OG    . SER B 1 44  ? 21.444  -3.232  -65.330 1.00 58.40  ? 44  SER B OG    1 
ATOM   4478 N N     . ARG B 1 45  ? 19.685  -3.095  -62.670 1.00 52.45  ? 45  ARG B N     1 
ATOM   4479 C CA    . ARG B 1 45  ? 19.358  -1.935  -61.859 1.00 54.20  ? 45  ARG B CA    1 
ATOM   4480 C C     . ARG B 1 45  ? 19.098  -2.283  -60.386 1.00 52.07  ? 45  ARG B C     1 
ATOM   4481 O O     . ARG B 1 45  ? 18.759  -1.396  -59.596 1.00 52.54  ? 45  ARG B O     1 
ATOM   4482 C CB    . ARG B 1 45  ? 18.182  -1.198  -62.481 1.00 48.77  ? 45  ARG B CB    1 
ATOM   4483 C CG    . ARG B 1 45  ? 18.668  -0.294  -63.595 1.00 49.66  ? 45  ARG B CG    1 
ATOM   4484 C CD    . ARG B 1 45  ? 17.589  0.660   -64.035 1.00 53.84  ? 45  ARG B CD    1 
ATOM   4485 N NE    . ARG B 1 45  ? 16.408  -0.055  -64.504 1.00 63.12  ? 45  ARG B NE    1 
ATOM   4486 C CZ    . ARG B 1 45  ? 16.048  -0.185  -65.782 1.00 66.38  ? 45  ARG B CZ    1 
ATOM   4487 N NH1   . ARG B 1 45  ? 16.770  0.371   -66.758 1.00 61.99  ? 45  ARG B NH1   1 
ATOM   4488 N NH2   . ARG B 1 45  ? 14.949  -0.872  -66.079 1.00 59.98  ? 45  ARG B NH2   1 
ATOM   4489 N N     . ARG B 1 46  ? 19.273  -3.542  -60.000 1.00 50.30  ? 46  ARG B N     1 
ATOM   4490 C CA    . ARG B 1 46  ? 19.317  -3.896  -58.589 1.00 49.28  ? 46  ARG B CA    1 
ATOM   4491 C C     . ARG B 1 46  ? 20.408  -3.105  -57.881 1.00 50.14  ? 46  ARG B C     1 
ATOM   4492 O O     . ARG B 1 46  ? 21.516  -2.935  -58.411 1.00 47.37  ? 46  ARG B O     1 
ATOM   4493 C CB    . ARG B 1 46  ? 19.564  -5.393  -58.445 1.00 48.73  ? 46  ARG B CB    1 
ATOM   4494 C CG    . ARG B 1 46  ? 19.439  -5.949  -57.067 1.00 46.33  ? 46  ARG B CG    1 
ATOM   4495 C CD    . ARG B 1 46  ? 19.719  -7.444  -57.091 1.00 46.97  ? 46  ARG B CD    1 
ATOM   4496 N NE    . ARG B 1 46  ? 18.507  -8.255  -57.159 1.00 43.31  ? 46  ARG B NE    1 
ATOM   4497 C CZ    . ARG B 1 46  ? 18.506  -9.585  -57.076 1.00 46.78  ? 46  ARG B CZ    1 
ATOM   4498 N NH1   . ARG B 1 46  ? 19.649  -10.244 -56.940 1.00 48.27  ? 46  ARG B NH1   1 
ATOM   4499 N NH2   . ARG B 1 46  ? 17.367  -10.263 -57.120 1.00 44.44  ? 46  ARG B NH2   1 
ATOM   4500 N N     . PHE B 1 47  ? 20.059  -2.594  -56.686 1.00 50.08  ? 47  PHE B N     1 
ATOM   4501 C CA    . PHE B 1 47  ? 20.908  -1.806  -55.788 1.00 41.77  ? 47  PHE B CA    1 
ATOM   4502 C C     . PHE B 1 47  ? 21.213  -0.411  -56.314 1.00 45.74  ? 47  PHE B C     1 
ATOM   4503 O O     . PHE B 1 47  ? 22.008  0.298   -55.709 1.00 53.76  ? 47  PHE B O     1 
ATOM   4504 C CB    . PHE B 1 47  ? 22.245  -2.496  -55.491 1.00 40.59  ? 47  PHE B CB    1 
ATOM   4505 C CG    . PHE B 1 47  ? 22.118  -3.942  -55.128 1.00 46.64  ? 47  PHE B CG    1 
ATOM   4506 C CD1   . PHE B 1 47  ? 21.155  -4.368  -54.220 1.00 45.67  ? 47  PHE B CD1   1 
ATOM   4507 C CD2   . PHE B 1 47  ? 22.957  -4.887  -55.696 1.00 48.28  ? 47  PHE B CD2   1 
ATOM   4508 C CE1   . PHE B 1 47  ? 21.031  -5.710  -53.878 1.00 43.35  ? 47  PHE B CE1   1 
ATOM   4509 C CE2   . PHE B 1 47  ? 22.838  -6.235  -55.358 1.00 50.41  ? 47  PHE B CE2   1 
ATOM   4510 C CZ    . PHE B 1 47  ? 21.870  -6.643  -54.444 1.00 49.85  ? 47  PHE B CZ    1 
ATOM   4511 N N     . MET B 1 48  ? 20.622  0.002   -57.415 1.00 44.74  ? 48  MET B N     1 
ATOM   4512 C CA    . MET B 1 48  ? 21.053  1.207   -58.102 1.00 45.50  ? 48  MET B CA    1 
ATOM   4513 C C     . MET B 1 48  ? 20.035  2.314   -57.917 1.00 39.28  ? 48  MET B C     1 
ATOM   4514 O O     . MET B 1 48  ? 18.859  2.046   -57.655 1.00 39.22  ? 48  MET B O     1 
ATOM   4515 C CB    . MET B 1 48  ? 21.236  0.914   -59.601 1.00 51.83  ? 48  MET B CB    1 
ATOM   4516 C CG    . MET B 1 48  ? 22.516  0.176   -59.941 1.00 52.80  ? 48  MET B CG    1 
ATOM   4517 S SD    . MET B 1 48  ? 23.898  1.327   -60.030 1.00 62.20  ? 48  MET B SD    1 
ATOM   4518 C CE    . MET B 1 48  ? 23.207  2.526   -61.163 1.00 51.53  ? 48  MET B CE    1 
ATOM   4519 N N     . PRO B 1 49  ? 20.445  3.574   -58.041 1.00 40.54  ? 49  PRO B N     1 
ATOM   4520 C CA    . PRO B 1 49  ? 19.481  4.666   -57.908 1.00 43.86  ? 49  PRO B CA    1 
ATOM   4521 C C     . PRO B 1 49  ? 18.359  4.504   -58.913 1.00 43.44  ? 49  PRO B C     1 
ATOM   4522 O O     . PRO B 1 49  ? 18.564  3.957   -60.009 1.00 50.61  ? 49  PRO B O     1 
ATOM   4523 C CB    . PRO B 1 49  ? 20.319  5.921   -58.195 1.00 36.66  ? 49  PRO B CB    1 
ATOM   4524 C CG    . PRO B 1 49  ? 21.707  5.546   -57.883 1.00 41.43  ? 49  PRO B CG    1 
ATOM   4525 C CD    . PRO B 1 49  ? 21.836  4.048   -58.094 1.00 45.84  ? 49  PRO B CD    1 
ATOM   4526 N N     . PRO B 1 50  ? 17.147  4.920   -58.563 1.00 47.25  ? 50  PRO B N     1 
ATOM   4527 C CA    . PRO B 1 50  ? 16.032  4.788   -59.504 1.00 43.14  ? 50  PRO B CA    1 
ATOM   4528 C C     . PRO B 1 50  ? 16.186  5.778   -60.634 1.00 43.59  ? 50  PRO B C     1 
ATOM   4529 O O     . PRO B 1 50  ? 16.911  6.766   -60.519 1.00 50.23  ? 50  PRO B O     1 
ATOM   4530 C CB    . PRO B 1 50  ? 14.798  5.100   -58.654 1.00 42.57  ? 50  PRO B CB    1 
ATOM   4531 C CG    . PRO B 1 50  ? 15.324  5.970   -57.548 1.00 41.90  ? 50  PRO B CG    1 
ATOM   4532 C CD    . PRO B 1 50  ? 16.719  5.489   -57.272 1.00 44.37  ? 50  PRO B CD    1 
ATOM   4533 N N     . GLU B 1 51  ? 15.520  5.491   -61.753 1.00 46.79  ? 51  GLU B N     1 
ATOM   4534 C CA    . GLU B 1 51  ? 15.435  6.484   -62.817 1.00 44.41  ? 51  GLU B CA    1 
ATOM   4535 C C     . GLU B 1 51  ? 13.983  6.724   -63.202 1.00 41.99  ? 51  GLU B C     1 
ATOM   4536 O O     . GLU B 1 51  ? 13.129  5.848   -63.021 1.00 44.31  ? 51  GLU B O     1 
ATOM   4537 C CB    . GLU B 1 51  ? 16.235  6.075   -64.051 1.00 46.37  ? 51  GLU B CB    1 
ATOM   4538 C CG    . GLU B 1 51  ? 17.451  5.228   -63.770 1.00 55.11  ? 51  GLU B CG    1 
ATOM   4539 C CD    . GLU B 1 51  ? 17.948  4.561   -65.038 1.00 66.85  ? 51  GLU B CD    1 
ATOM   4540 O OE1   . GLU B 1 51  ? 18.140  5.276   -66.039 1.00 73.76  ? 51  GLU B OE1   1 
ATOM   4541 O OE2   . GLU B 1 51  ? 18.135  3.336   -65.048 1.00 62.92  ? 51  GLU B OE2   1 
ATOM   4542 N N     . PRO B 1 52  ? 13.670  7.913   -63.704 1.00 39.85  ? 52  PRO B N     1 
ATOM   4543 C CA    . PRO B 1 52  ? 12.266  8.241   -63.992 1.00 45.02  ? 52  PRO B CA    1 
ATOM   4544 C C     . PRO B 1 52  ? 11.644  7.297   -65.018 1.00 44.92  ? 52  PRO B C     1 
ATOM   4545 O O     . PRO B 1 52  ? 12.304  6.837   -65.953 1.00 45.54  ? 52  PRO B O     1 
ATOM   4546 C CB    . PRO B 1 52  ? 12.336  9.683   -64.509 1.00 41.92  ? 52  PRO B CB    1 
ATOM   4547 C CG    . PRO B 1 52  ? 13.781  9.933   -64.799 1.00 42.30  ? 52  PRO B CG    1 
ATOM   4548 C CD    . PRO B 1 52  ? 14.555  9.074   -63.872 1.00 35.56  ? 52  PRO B CD    1 
ATOM   4549 N N     . LYS B 1 53  ? 10.364  6.992   -64.802 1.00 45.34  ? 53  LYS B N     1 
ATOM   4550 C CA    . LYS B 1 53  ? 9.609   6.100   -65.670 1.00 46.81  ? 53  LYS B CA    1 
ATOM   4551 C C     . LYS B 1 53  ? 9.534   6.684   -67.066 1.00 48.43  ? 53  LYS B C     1 
ATOM   4552 O O     . LYS B 1 53  ? 9.288   7.882   -67.234 1.00 49.26  ? 53  LYS B O     1 
ATOM   4553 C CB    . LYS B 1 53  ? 8.197   5.889   -65.109 1.00 47.83  ? 53  LYS B CB    1 
ATOM   4554 C CG    . LYS B 1 53  ? 7.259   5.065   -65.974 1.00 47.69  ? 53  LYS B CG    1 
ATOM   4555 C CD    . LYS B 1 53  ? 7.676   3.603   -66.007 1.00 48.37  ? 53  LYS B CD    1 
ATOM   4556 C CE    . LYS B 1 53  ? 6.870   2.794   -67.039 1.00 50.73  ? 53  LYS B CE    1 
ATOM   4557 N NZ    . LYS B 1 53  ? 7.077   3.231   -68.463 1.00 45.99  ? 53  LYS B NZ    1 
ATOM   4558 N N     . ARG B 1 54  ? 9.769   5.842   -68.070 1.00 51.24  ? 54  ARG B N     1 
ATOM   4559 C CA    . ARG B 1 54  ? 9.655   6.298   -69.444 1.00 47.28  ? 54  ARG B CA    1 
ATOM   4560 C C     . ARG B 1 54  ? 8.185   6.536   -69.794 1.00 45.27  ? 54  ARG B C     1 
ATOM   4561 O O     . ARG B 1 54  ? 7.289   5.916   -69.209 1.00 45.84  ? 54  ARG B O     1 
ATOM   4562 C CB    . ARG B 1 54  ? 10.267  5.274   -70.391 1.00 46.20  ? 54  ARG B CB    1 
ATOM   4563 C CG    . ARG B 1 54  ? 11.782  5.175   -70.305 1.00 49.61  ? 54  ARG B CG    1 
ATOM   4564 C CD    . ARG B 1 54  ? 12.334  4.006   -71.128 1.00 42.73  ? 54  ARG B CD    1 
ATOM   4565 N NE    . ARG B 1 54  ? 11.625  2.760   -70.829 1.00 47.60  ? 54  ARG B NE    1 
ATOM   4566 C CZ    . ARG B 1 54  ? 10.782  2.149   -71.660 1.00 54.24  ? 54  ARG B CZ    1 
ATOM   4567 N NH1   . ARG B 1 54  ? 10.183  1.028   -71.277 1.00 46.52  ? 54  ARG B NH1   1 
ATOM   4568 N NH2   . ARG B 1 54  ? 10.552  2.639   -72.884 1.00 51.81  ? 54  ARG B NH2   1 
ATOM   4569 N N     . PRO B 1 55  ? 7.911   7.441   -70.733 1.00 48.80  ? 55  PRO B N     1 
ATOM   4570 C CA    . PRO B 1 55  ? 6.531   7.643   -71.206 1.00 49.53  ? 55  PRO B CA    1 
ATOM   4571 C C     . PRO B 1 55  ? 5.878   6.362   -71.711 1.00 44.94  ? 55  PRO B C     1 
ATOM   4572 O O     . PRO B 1 55  ? 6.536   5.383   -72.069 1.00 44.55  ? 55  PRO B O     1 
ATOM   4573 C CB    . PRO B 1 55  ? 6.693   8.657   -72.338 1.00 40.77  ? 55  PRO B CB    1 
ATOM   4574 C CG    . PRO B 1 55  ? 7.902   9.436   -71.950 1.00 44.21  ? 55  PRO B CG    1 
ATOM   4575 C CD    . PRO B 1 55  ? 8.837   8.445   -71.288 1.00 48.79  ? 55  PRO B CD    1 
ATOM   4576 N N     . TRP B 1 56  ? 4.551   6.372   -71.714 1.00 44.24  ? 56  TRP B N     1 
ATOM   4577 C CA    . TRP B 1 56  ? 3.786   5.242   -72.213 1.00 47.29  ? 56  TRP B CA    1 
ATOM   4578 C C     . TRP B 1 56  ? 2.713   5.723   -73.186 1.00 54.02  ? 56  TRP B C     1 
ATOM   4579 O O     . TRP B 1 56  ? 2.321   6.898   -73.205 1.00 51.83  ? 56  TRP B O     1 
ATOM   4580 C CB    . TRP B 1 56  ? 3.148   4.428   -71.080 1.00 47.20  ? 56  TRP B CB    1 
ATOM   4581 C CG    . TRP B 1 56  ? 2.183   5.193   -70.253 1.00 49.43  ? 56  TRP B CG    1 
ATOM   4582 C CD1   . TRP B 1 56  ? 0.858   5.379   -70.501 1.00 51.36  ? 56  TRP B CD1   1 
ATOM   4583 C CD2   . TRP B 1 56  ? 2.463   5.877   -69.024 1.00 51.80  ? 56  TRP B CD2   1 
ATOM   4584 N NE1   . TRP B 1 56  ? 0.290   6.144   -69.508 1.00 51.16  ? 56  TRP B NE1   1 
ATOM   4585 C CE2   . TRP B 1 56  ? 1.257   6.459   -68.586 1.00 53.94  ? 56  TRP B CE2   1 
ATOM   4586 C CE3   . TRP B 1 56  ? 3.617   6.048   -68.247 1.00 51.40  ? 56  TRP B CE3   1 
ATOM   4587 C CZ2   . TRP B 1 56  ? 1.173   7.199   -67.398 1.00 52.24  ? 56  TRP B CZ2   1 
ATOM   4588 C CZ3   . TRP B 1 56  ? 3.529   6.788   -67.072 1.00 50.75  ? 56  TRP B CZ3   1 
ATOM   4589 C CH2   . TRP B 1 56  ? 2.318   7.357   -66.668 1.00 51.41  ? 56  TRP B CH2   1 
ATOM   4590 N N     . SER B 1 57  ? 2.274   4.793   -74.025 1.00 50.79  ? 57  SER B N     1 
ATOM   4591 C CA    . SER B 1 57  ? 1.206   5.020   -74.980 1.00 46.59  ? 57  SER B CA    1 
ATOM   4592 C C     . SER B 1 57  ? -0.115  4.567   -74.381 1.00 50.57  ? 57  SER B C     1 
ATOM   4593 O O     . SER B 1 57  ? -0.157  3.833   -73.384 1.00 51.19  ? 57  SER B O     1 
ATOM   4594 C CB    . SER B 1 57  ? 1.476   4.253   -76.268 1.00 46.52  ? 57  SER B CB    1 
ATOM   4595 O OG    . SER B 1 57  ? 1.393   2.864   -76.010 1.00 47.91  ? 57  SER B OG    1 
ATOM   4596 N N     . GLY B 1 58  ? -1.201  5.011   -75.006 1.00 43.74  ? 58  GLY B N     1 
ATOM   4597 C CA    . GLY B 1 58  ? -2.511  4.571   -74.565 1.00 42.69  ? 58  GLY B CA    1 
ATOM   4598 C C     . GLY B 1 58  ? -2.899  5.102   -73.189 1.00 51.06  ? 58  GLY B C     1 
ATOM   4599 O O     . GLY B 1 58  ? -2.351  6.082   -72.668 1.00 49.44  ? 58  GLY B O     1 
ATOM   4600 N N     . VAL B 1 59  ? -3.880  4.435   -72.600 1.00 48.28  ? 59  VAL B N     1 
ATOM   4601 C CA    . VAL B 1 59  ? -4.403  4.829   -71.305 1.00 48.34  ? 59  VAL B CA    1 
ATOM   4602 C C     . VAL B 1 59  ? -4.017  3.744   -70.310 1.00 51.64  ? 59  VAL B C     1 
ATOM   4603 O O     . VAL B 1 59  ? -4.557  2.626   -70.332 1.00 46.22  ? 59  VAL B O     1 
ATOM   4604 C CB    . VAL B 1 59  ? -5.914  5.079   -71.352 1.00 51.20  ? 59  VAL B CB    1 
ATOM   4605 C CG1   . VAL B 1 59  ? -6.558  4.920   -69.956 1.00 54.15  ? 59  VAL B CG1   1 
ATOM   4606 C CG2   . VAL B 1 59  ? -6.161  6.476   -71.902 1.00 55.07  ? 59  VAL B CG2   1 
ATOM   4607 N N     . LEU B 1 60  ? -3.064  4.076   -69.444 1.00 52.79  ? 60  LEU B N     1 
ATOM   4608 C CA    . LEU B 1 60  ? -2.551  3.121   -68.477 1.00 47.79  ? 60  LEU B CA    1 
ATOM   4609 C C     . LEU B 1 60  ? -3.578  2.902   -67.381 1.00 45.33  ? 60  LEU B C     1 
ATOM   4610 O O     . LEU B 1 60  ? -4.186  3.850   -66.872 1.00 49.90  ? 60  LEU B O     1 
ATOM   4611 C CB    . LEU B 1 60  ? -1.230  3.624   -67.912 1.00 49.68  ? 60  LEU B CB    1 
ATOM   4612 C CG    . LEU B 1 60  ? -0.402  2.826   -66.912 1.00 51.95  ? 60  LEU B CG    1 
ATOM   4613 C CD1   . LEU B 1 60  ? 1.045   3.318   -66.994 1.00 52.07  ? 60  LEU B CD1   1 
ATOM   4614 C CD2   . LEU B 1 60  ? -0.970  2.945   -65.484 1.00 56.87  ? 60  LEU B CD2   1 
ATOM   4615 N N     . ASP B 1 61  ? -3.762  1.646   -67.024 1.00 43.83  ? 61  ASP B N     1 
ATOM   4616 C CA    . ASP B 1 61  ? -4.771  1.251   -66.059 1.00 48.41  ? 61  ASP B CA    1 
ATOM   4617 C C     . ASP B 1 61  ? -4.250  1.492   -64.646 1.00 58.34  ? 61  ASP B C     1 
ATOM   4618 O O     . ASP B 1 61  ? -3.334  0.798   -64.194 1.00 59.87  ? 61  ASP B O     1 
ATOM   4619 C CB    . ASP B 1 61  ? -5.116  -0.216  -66.243 1.00 40.73  ? 61  ASP B CB    1 
ATOM   4620 C CG    . ASP B 1 61  ? -6.014  -0.719  -65.152 1.00 58.38  ? 61  ASP B CG    1 
ATOM   4621 O OD1   . ASP B 1 61  ? -5.504  -1.242  -64.128 1.00 63.43  ? 61  ASP B OD1   1 
ATOM   4622 O OD2   . ASP B 1 61  ? -7.242  -0.565  -65.310 1.00 64.06  ? 61  ASP B OD2   1 
ATOM   4623 N N     . ALA B 1 62  ? -4.841  2.457   -63.937 1.00 55.02  ? 62  ALA B N     1 
ATOM   4624 C CA    . ALA B 1 62  ? -4.445  2.743   -62.562 1.00 54.34  ? 62  ALA B CA    1 
ATOM   4625 C C     . ALA B 1 62  ? -5.577  2.416   -61.601 1.00 51.53  ? 62  ALA B C     1 
ATOM   4626 O O     . ALA B 1 62  ? -6.081  3.302   -60.913 1.00 47.31  ? 62  ALA B O     1 
ATOM   4627 C CB    . ALA B 1 62  ? -4.040  4.211   -62.401 1.00 53.29  ? 62  ALA B CB    1 
ATOM   4628 N N     . THR B 1 63  ? -5.995  1.151   -61.566 1.00 54.86  ? 63  THR B N     1 
ATOM   4629 C CA    . THR B 1 63  ? -7.147  0.736   -60.783 1.00 50.32  ? 63  THR B CA    1 
ATOM   4630 C C     . THR B 1 63  ? -6.846  -0.420  -59.848 1.00 53.13  ? 63  THR B C     1 
ATOM   4631 O O     . THR B 1 63  ? -7.763  -0.882  -59.159 1.00 53.89  ? 63  THR B O     1 
ATOM   4632 C CB    . THR B 1 63  ? -8.322  0.322   -61.694 1.00 55.88  ? 63  THR B CB    1 
ATOM   4633 O OG1   . THR B 1 63  ? -8.004  -0.892  -62.394 1.00 50.95  ? 63  THR B OG1   1 
ATOM   4634 C CG2   . THR B 1 63  ? -8.648  1.407   -62.688 1.00 50.75  ? 63  THR B CG2   1 
ATOM   4635 N N     . THR B 1 64  ? -5.610  -0.917  -59.819 1.00 53.09  ? 64  THR B N     1 
ATOM   4636 C CA    . THR B 1 64  ? -5.223  -1.964  -58.886 1.00 52.72  ? 64  THR B CA    1 
ATOM   4637 C C     . THR B 1 64  ? -3.896  -1.630  -58.221 1.00 54.12  ? 64  THR B C     1 
ATOM   4638 O O     . THR B 1 64  ? -3.030  -0.969  -58.801 1.00 53.66  ? 64  THR B O     1 
ATOM   4639 C CB    . THR B 1 64  ? -5.091  -3.299  -59.573 1.00 54.16  ? 64  THR B CB    1 
ATOM   4640 O OG1   . THR B 1 64  ? -4.165  -3.170  -60.661 1.00 60.50  ? 64  THR B OG1   1 
ATOM   4641 C CG2   . THR B 1 64  ? -6.436  -3.738  -60.089 1.00 54.58  ? 64  THR B CG2   1 
ATOM   4642 N N     . PHE B 1 65  ? -3.746  -2.097  -56.989 1.00 54.61  ? 65  PHE B N     1 
ATOM   4643 C CA    . PHE B 1 65  ? -2.454  -2.010  -56.332 1.00 52.96  ? 65  PHE B CA    1 
ATOM   4644 C C     . PHE B 1 65  ? -1.436  -2.853  -57.086 1.00 47.99  ? 65  PHE B C     1 
ATOM   4645 O O     . PHE B 1 65  ? -1.684  -4.024  -57.380 1.00 52.60  ? 65  PHE B O     1 
ATOM   4646 C CB    . PHE B 1 65  ? -2.579  -2.477  -54.883 1.00 49.08  ? 65  PHE B CB    1 
ATOM   4647 C CG    . PHE B 1 65  ? -3.157  -1.444  -53.982 1.00 49.61  ? 65  PHE B CG    1 
ATOM   4648 C CD1   . PHE B 1 65  ? -2.599  -0.170  -53.932 1.00 50.15  ? 65  PHE B CD1   1 
ATOM   4649 C CD2   . PHE B 1 65  ? -4.277  -1.719  -53.206 1.00 47.06  ? 65  PHE B CD2   1 
ATOM   4650 C CE1   . PHE B 1 65  ? -3.133  0.813   -53.099 1.00 47.36  ? 65  PHE B CE1   1 
ATOM   4651 C CE2   . PHE B 1 65  ? -4.822  -0.745  -52.379 1.00 43.23  ? 65  PHE B CE2   1 
ATOM   4652 C CZ    . PHE B 1 65  ? -4.249  0.524   -52.326 1.00 45.14  ? 65  PHE B CZ    1 
ATOM   4653 N N     . GLN B 1 66  ? -0.296  -2.256  -57.404 1.00 43.86  ? 66  GLN B N     1 
ATOM   4654 C CA    . GLN B 1 66  ? 0.798   -2.988  -58.026 1.00 44.57  ? 66  GLN B CA    1 
ATOM   4655 C C     . GLN B 1 66  ? 1.436   -3.936  -57.012 1.00 50.22  ? 66  GLN B C     1 
ATOM   4656 O O     . GLN B 1 66  ? 0.929   -4.147  -55.904 1.00 50.99  ? 66  GLN B O     1 
ATOM   4657 C CB    . GLN B 1 66  ? 1.824   -2.025  -58.604 1.00 44.21  ? 66  GLN B CB    1 
ATOM   4658 C CG    . GLN B 1 66  ? 1.585   -1.698  -60.033 1.00 47.78  ? 66  GLN B CG    1 
ATOM   4659 C CD    . GLN B 1 66  ? 2.073   -2.791  -60.974 1.00 53.52  ? 66  GLN B CD    1 
ATOM   4660 O OE1   . GLN B 1 66  ? 2.523   -3.863  -60.545 1.00 52.53  ? 66  GLN B OE1   1 
ATOM   4661 N NE2   . GLN B 1 66  ? 2.003   -2.513  -62.270 1.00 54.63  ? 66  GLN B NE2   1 
ATOM   4662 N N     . ASN B 1 67  ? 2.581   -4.507  -57.383 1.00 48.00  ? 67  ASN B N     1 
ATOM   4663 C CA    . ASN B 1 67  ? 3.259   -5.467  -56.524 1.00 48.03  ? 67  ASN B CA    1 
ATOM   4664 C C     . ASN B 1 67  ? 3.873   -4.777  -55.300 1.00 50.03  ? 67  ASN B C     1 
ATOM   4665 O O     . ASN B 1 67  ? 4.075   -3.560  -55.271 1.00 52.85  ? 67  ASN B O     1 
ATOM   4666 C CB    . ASN B 1 67  ? 4.351   -6.214  -57.299 1.00 50.43  ? 67  ASN B CB    1 
ATOM   4667 C CG    . ASN B 1 67  ? 3.810   -6.980  -58.516 1.00 54.38  ? 67  ASN B CG    1 
ATOM   4668 O OD1   . ASN B 1 67  ? 3.023   -7.920  -58.362 1.00 48.88  ? 67  ASN B OD1   1 
ATOM   4669 N ND2   . ASN B 1 67  ? 4.259   -6.592  -59.730 1.00 43.06  ? 67  ASN B ND2   1 
ATOM   4670 N N     . VAL B 1 68  ? 4.178   -5.585  -54.280 1.00 48.84  ? 68  VAL B N     1 
ATOM   4671 C CA    . VAL B 1 68  ? 4.883   -5.151  -53.078 1.00 44.24  ? 68  VAL B CA    1 
ATOM   4672 C C     . VAL B 1 68  ? 6.371   -5.432  -53.243 1.00 46.82  ? 68  VAL B C     1 
ATOM   4673 O O     . VAL B 1 68  ? 6.751   -6.521  -53.676 1.00 47.87  ? 68  VAL B O     1 
ATOM   4674 C CB    . VAL B 1 68  ? 4.311   -5.876  -51.847 1.00 48.11  ? 68  VAL B CB    1 
ATOM   4675 C CG1   . VAL B 1 68  ? 5.136   -5.570  -50.581 1.00 46.42  ? 68  VAL B CG1   1 
ATOM   4676 C CG2   . VAL B 1 68  ? 2.845   -5.511  -51.668 1.00 46.01  ? 68  VAL B CG2   1 
ATOM   4677 N N     . CYS B 1 69  ? 7.220   -4.465  -52.875 1.00 48.66  ? 69  CYS B N     1 
ATOM   4678 C CA    . CYS B 1 69  ? 8.664   -4.625  -53.045 1.00 44.90  ? 69  CYS B CA    1 
ATOM   4679 C C     . CYS B 1 69  ? 9.156   -5.883  -52.351 1.00 46.65  ? 69  CYS B C     1 
ATOM   4680 O O     . CYS B 1 69  ? 8.690   -6.235  -51.260 1.00 42.58  ? 69  CYS B O     1 
ATOM   4681 C CB    . CYS B 1 69  ? 9.422   -3.413  -52.508 1.00 39.80  ? 69  CYS B CB    1 
ATOM   4682 S SG    . CYS B 1 69  ? 9.317   -1.917  -53.522 1.00 51.62  ? 69  CYS B SG    1 
ATOM   4683 N N     . TYR B 1 70  ? 10.086  -6.580  -53.005 1.00 45.81  ? 70  TYR B N     1 
ATOM   4684 C CA    . TYR B 1 70  ? 10.477  -7.884  -52.493 1.00 48.73  ? 70  TYR B CA    1 
ATOM   4685 C C     . TYR B 1 70  ? 11.038  -7.726  -51.080 1.00 44.01  ? 70  TYR B C     1 
ATOM   4686 O O     . TYR B 1 70  ? 11.906  -6.882  -50.833 1.00 43.58  ? 70  TYR B O     1 
ATOM   4687 C CB    . TYR B 1 70  ? 11.484  -8.580  -53.434 1.00 48.11  ? 70  TYR B CB    1 
ATOM   4688 C CG    . TYR B 1 70  ? 11.431  -10.089 -53.234 1.00 51.19  ? 70  TYR B CG    1 
ATOM   4689 C CD1   . TYR B 1 70  ? 10.532  -10.874 -53.945 1.00 50.10  ? 70  TYR B CD1   1 
ATOM   4690 C CD2   . TYR B 1 70  ? 12.221  -10.716 -52.272 1.00 51.68  ? 70  TYR B CD2   1 
ATOM   4691 C CE1   . TYR B 1 70  ? 10.445  -12.246 -53.730 1.00 53.43  ? 70  TYR B CE1   1 
ATOM   4692 C CE2   . TYR B 1 70  ? 12.138  -12.090 -52.051 1.00 53.17  ? 70  TYR B CE2   1 
ATOM   4693 C CZ    . TYR B 1 70  ? 11.245  -12.849 -52.780 1.00 53.01  ? 70  TYR B CZ    1 
ATOM   4694 O OH    . TYR B 1 70  ? 11.156  -14.209 -52.561 1.00 47.09  ? 70  TYR B OH    1 
ATOM   4695 N N     . GLN B 1 71  ? 10.507  -8.514  -50.145 1.00 45.01  ? 71  GLN B N     1 
ATOM   4696 C CA    . GLN B 1 71  ? 10.794  -8.286  -48.732 1.00 46.32  ? 71  GLN B CA    1 
ATOM   4697 C C     . GLN B 1 71  ? 10.521  -9.533  -47.916 1.00 47.81  ? 71  GLN B C     1 
ATOM   4698 O O     . GLN B 1 71  ? 9.714   -10.385 -48.287 1.00 50.27  ? 71  GLN B O     1 
ATOM   4699 C CB    . GLN B 1 71  ? 9.955   -7.151  -48.151 1.00 40.86  ? 71  GLN B CB    1 
ATOM   4700 C CG    . GLN B 1 71  ? 8.537   -7.551  -47.896 1.00 38.95  ? 71  GLN B CG    1 
ATOM   4701 C CD    . GLN B 1 71  ? 7.646   -6.356  -47.705 1.00 46.32  ? 71  GLN B CD    1 
ATOM   4702 O OE1   . GLN B 1 71  ? 6.915   -6.247  -46.710 1.00 50.69  ? 71  GLN B OE1   1 
ATOM   4703 N NE2   . GLN B 1 71  ? 7.704   -5.429  -48.659 1.00 46.64  ? 71  GLN B NE2   1 
ATOM   4704 N N     . TYR B 1 72  ? 11.175  -9.583  -46.761 1.00 48.24  ? 72  TYR B N     1 
ATOM   4705 C CA    . TYR B 1 72  ? 10.944  -10.629 -45.782 1.00 47.82  ? 72  TYR B CA    1 
ATOM   4706 C C     . TYR B 1 72  ? 9.485   -10.644 -45.329 1.00 47.60  ? 72  TYR B C     1 
ATOM   4707 O O     . TYR B 1 72  ? 8.855   -9.595  -45.160 1.00 50.23  ? 72  TYR B O     1 
ATOM   4708 C CB    . TYR B 1 72  ? 11.894  -10.409 -44.604 1.00 50.48  ? 72  TYR B CB    1 
ATOM   4709 C CG    . TYR B 1 72  ? 11.671  -11.331 -43.436 1.00 55.21  ? 72  TYR B CG    1 
ATOM   4710 C CD1   . TYR B 1 72  ? 10.867  -10.952 -42.362 1.00 60.08  ? 72  TYR B CD1   1 
ATOM   4711 C CD2   . TYR B 1 72  ? 12.258  -12.580 -43.394 1.00 53.46  ? 72  TYR B CD2   1 
ATOM   4712 C CE1   . TYR B 1 72  ? 10.658  -11.798 -41.277 1.00 54.99  ? 72  TYR B CE1   1 
ATOM   4713 C CE2   . TYR B 1 72  ? 12.048  -13.433 -42.313 1.00 64.83  ? 72  TYR B CE2   1 
ATOM   4714 C CZ    . TYR B 1 72  ? 11.253  -13.037 -41.250 1.00 64.70  ? 72  TYR B CZ    1 
ATOM   4715 O OH    . TYR B 1 72  ? 11.055  -13.896 -40.183 1.00 65.40  ? 72  TYR B OH    1 
ATOM   4716 N N     . VAL B 1 73  ? 8.941   -11.843 -45.139 1.00 48.19  ? 73  VAL B N     1 
ATOM   4717 C CA    . VAL B 1 73  ? 7.554   -12.024 -44.727 1.00 51.50  ? 73  VAL B CA    1 
ATOM   4718 C C     . VAL B 1 73  ? 7.555   -12.736 -43.383 1.00 59.38  ? 73  VAL B C     1 
ATOM   4719 O O     . VAL B 1 73  ? 8.227   -13.761 -43.217 1.00 59.15  ? 73  VAL B O     1 
ATOM   4720 C CB    . VAL B 1 73  ? 6.733   -12.791 -45.782 1.00 49.58  ? 73  VAL B CB    1 
ATOM   4721 C CG1   . VAL B 1 73  ? 5.334   -13.096 -45.279 1.00 48.34  ? 73  VAL B CG1   1 
ATOM   4722 C CG2   . VAL B 1 73  ? 6.638   -11.968 -47.059 1.00 45.44  ? 73  VAL B CG2   1 
ATOM   4723 N N     . ASP B 1 74  ? 6.813   -12.179 -42.428 1.00 61.34  ? 74  ASP B N     1 
ATOM   4724 C CA    . ASP B 1 74  ? 6.899   -12.599 -41.041 1.00 62.71  ? 74  ASP B CA    1 
ATOM   4725 C C     . ASP B 1 74  ? 6.193   -13.931 -40.828 1.00 68.54  ? 74  ASP B C     1 
ATOM   4726 O O     . ASP B 1 74  ? 5.079   -14.142 -41.310 1.00 68.62  ? 74  ASP B O     1 
ATOM   4727 C CB    . ASP B 1 74  ? 6.278   -11.544 -40.132 1.00 65.82  ? 74  ASP B CB    1 
ATOM   4728 C CG    . ASP B 1 74  ? 6.503   -11.844 -38.676 1.00 69.72  ? 74  ASP B CG    1 
ATOM   4729 O OD1   . ASP B 1 74  ? 5.590   -12.410 -38.021 1.00 66.99  ? 74  ASP B OD1   1 
ATOM   4730 O OD2   . ASP B 1 74  ? 7.618   -11.535 -38.205 1.00 70.47  ? 74  ASP B OD2   1 
ATOM   4731 N N     . THR B 1 75  ? 6.840   -14.819 -40.067 1.00 70.87  ? 75  THR B N     1 
ATOM   4732 C CA    . THR B 1 75  ? 6.340   -16.164 -39.816 1.00 70.56  ? 75  THR B CA    1 
ATOM   4733 C C     . THR B 1 75  ? 5.933   -16.409 -38.362 1.00 69.12  ? 75  THR B C     1 
ATOM   4734 O O     . THR B 1 75  ? 5.438   -17.497 -38.055 1.00 64.53  ? 75  THR B O     1 
ATOM   4735 C CB    . THR B 1 75  ? 7.394   -17.201 -40.217 1.00 67.95  ? 75  THR B CB    1 
ATOM   4736 O OG1   . THR B 1 75  ? 8.250   -17.433 -39.103 1.00 88.92  ? 75  THR B OG1   1 
ATOM   4737 C CG2   . THR B 1 75  ? 8.245   -16.688 -41.367 1.00 66.84  ? 75  THR B CG2   1 
ATOM   4738 N N     . LEU B 1 76  ? 6.100   -15.428 -37.472 1.00 64.78  ? 76  LEU B N     1 
ATOM   4739 C CA    . LEU B 1 76  ? 6.012   -15.699 -36.037 1.00 68.68  ? 76  LEU B CA    1 
ATOM   4740 C C     . LEU B 1 76  ? 4.657   -16.280 -35.644 1.00 68.80  ? 76  LEU B C     1 
ATOM   4741 O O     . LEU B 1 76  ? 4.581   -17.265 -34.899 1.00 68.52  ? 76  LEU B O     1 
ATOM   4742 C CB    . LEU B 1 76  ? 6.296   -14.425 -35.242 1.00 72.34  ? 76  LEU B CB    1 
ATOM   4743 C CG    . LEU B 1 76  ? 6.514   -14.561 -33.731 1.00 69.63  ? 76  LEU B CG    1 
ATOM   4744 C CD1   . LEU B 1 76  ? 7.580   -15.603 -33.417 1.00 68.67  ? 76  LEU B CD1   1 
ATOM   4745 C CD2   . LEU B 1 76  ? 6.909   -13.213 -33.168 1.00 67.38  ? 76  LEU B CD2   1 
ATOM   4746 N N     . TYR B 1 77  ? 3.574   -15.682 -36.116 1.00 65.32  ? 77  TYR B N     1 
ATOM   4747 C CA    . TYR B 1 77  ? 2.231   -16.130 -35.765 1.00 63.31  ? 77  TYR B CA    1 
ATOM   4748 C C     . TYR B 1 77  ? 1.414   -16.220 -37.040 1.00 67.99  ? 77  TYR B C     1 
ATOM   4749 O O     . TYR B 1 77  ? 0.650   -15.299 -37.366 1.00 68.05  ? 77  TYR B O     1 
ATOM   4750 C CB    . TYR B 1 77  ? 1.580   -15.192 -34.756 1.00 65.89  ? 77  TYR B CB    1 
ATOM   4751 C CG    . TYR B 1 77  ? 2.292   -15.116 -33.413 1.00 73.06  ? 77  TYR B CG    1 
ATOM   4752 C CD1   . TYR B 1 77  ? 3.038   -13.995 -33.065 1.00 73.42  ? 77  TYR B CD1   1 
ATOM   4753 C CD2   . TYR B 1 77  ? 2.202   -16.150 -32.491 1.00 64.49  ? 77  TYR B CD2   1 
ATOM   4754 C CE1   . TYR B 1 77  ? 3.670   -13.906 -31.843 1.00 70.51  ? 77  TYR B CE1   1 
ATOM   4755 C CE2   . TYR B 1 77  ? 2.835   -16.069 -31.272 1.00 73.08  ? 77  TYR B CE2   1 
ATOM   4756 C CZ    . TYR B 1 77  ? 3.569   -14.943 -30.950 1.00 73.63  ? 77  TYR B CZ    1 
ATOM   4757 O OH    . TYR B 1 77  ? 4.205   -14.852 -29.727 1.00 71.01  ? 77  TYR B OH    1 
ATOM   4758 N N     . PRO B 1 78  ? 1.551   -17.321 -37.785 1.00 68.69  ? 78  PRO B N     1 
ATOM   4759 C CA    . PRO B 1 78  ? 0.908   -17.418 -39.107 1.00 63.10  ? 78  PRO B CA    1 
ATOM   4760 C C     . PRO B 1 78  ? -0.606  -17.479 -38.987 1.00 57.85  ? 78  PRO B C     1 
ATOM   4761 O O     . PRO B 1 78  ? -1.153  -18.340 -38.301 1.00 61.78  ? 78  PRO B O     1 
ATOM   4762 C CB    . PRO B 1 78  ? 1.474   -18.722 -39.686 1.00 57.35  ? 78  PRO B CB    1 
ATOM   4763 C CG    . PRO B 1 78  ? 2.720   -18.982 -38.901 1.00 67.32  ? 78  PRO B CG    1 
ATOM   4764 C CD    . PRO B 1 78  ? 2.427   -18.472 -37.515 1.00 63.45  ? 78  PRO B CD    1 
ATOM   4765 N N     . GLY B 1 79  ? -1.282  -16.569 -39.675 1.00 58.52  ? 79  GLY B N     1 
ATOM   4766 C CA    . GLY B 1 79  ? -2.717  -16.479 -39.590 1.00 56.07  ? 79  GLY B CA    1 
ATOM   4767 C C     . GLY B 1 79  ? -3.228  -15.519 -38.544 1.00 61.89  ? 79  GLY B C     1 
ATOM   4768 O O     . GLY B 1 79  ? -4.442  -15.275 -38.494 1.00 61.76  ? 79  GLY B O     1 
ATOM   4769 N N     . PHE B 1 80  ? -2.345  -14.964 -37.710 1.00 59.38  ? 80  PHE B N     1 
ATOM   4770 C CA    . PHE B 1 80  ? -2.743  -14.042 -36.659 1.00 58.52  ? 80  PHE B CA    1 
ATOM   4771 C C     . PHE B 1 80  ? -2.803  -12.638 -37.251 1.00 57.59  ? 80  PHE B C     1 
ATOM   4772 O O     . PHE B 1 80  ? -1.802  -12.145 -37.784 1.00 57.66  ? 80  PHE B O     1 
ATOM   4773 C CB    . PHE B 1 80  ? -1.776  -14.118 -35.468 1.00 60.79  ? 80  PHE B CB    1 
ATOM   4774 C CG    . PHE B 1 80  ? -2.042  -13.079 -34.412 1.00 59.09  ? 80  PHE B CG    1 
ATOM   4775 C CD1   . PHE B 1 80  ? -3.334  -12.852 -33.968 1.00 61.04  ? 80  PHE B CD1   1 
ATOM   4776 C CD2   . PHE B 1 80  ? -1.019  -12.304 -33.895 1.00 59.17  ? 80  PHE B CD2   1 
ATOM   4777 C CE1   . PHE B 1 80  ? -3.611  -11.879 -33.028 1.00 62.57  ? 80  PHE B CE1   1 
ATOM   4778 C CE2   . PHE B 1 80  ? -1.289  -11.330 -32.945 1.00 61.69  ? 80  PHE B CE2   1 
ATOM   4779 C CZ    . PHE B 1 80  ? -2.589  -11.118 -32.512 1.00 60.77  ? 80  PHE B CZ    1 
ATOM   4780 N N     . GLU B 1 81  ? -3.986  -12.014 -37.164 1.00 59.39  ? 81  GLU B N     1 
ATOM   4781 C CA    . GLU B 1 81  ? -4.227  -10.707 -37.782 1.00 58.00  ? 81  GLU B CA    1 
ATOM   4782 C C     . GLU B 1 81  ? -3.192  -9.680  -37.355 1.00 58.65  ? 81  GLU B C     1 
ATOM   4783 O O     . GLU B 1 81  ? -2.660  -8.947  -38.198 1.00 59.42  ? 81  GLU B O     1 
ATOM   4784 C CB    . GLU B 1 81  ? -5.638  -10.208 -37.440 1.00 54.87  ? 81  GLU B CB    1 
ATOM   4785 C CG    . GLU B 1 81  ? -6.775  -11.225 -37.399 1.00 67.49  ? 81  GLU B CG    1 
ATOM   4786 C CD    . GLU B 1 81  ? -6.873  -12.058 -36.141 1.00 85.08  ? 81  GLU B CD    1 
ATOM   4787 O OE1   . GLU B 1 81  ? -5.959  -12.727 -35.840 1.00 87.31  ? 81  GLU B OE1   1 
ATOM   4788 O OE2   . GLU B 1 81  ? -7.860  -12.072 -35.459 1.00 89.80  ? 81  GLU B OE2   1 
ATOM   4789 N N     . GLY B 1 82  ? -2.866  -9.616  -36.062 1.00 59.03  ? 82  GLY B N     1 
ATOM   4790 C CA    . GLY B 1 82  ? -1.927  -8.608  -35.605 1.00 58.08  ? 82  GLY B CA    1 
ATOM   4791 C C     . GLY B 1 82  ? -0.589  -8.679  -36.314 1.00 59.49  ? 82  GLY B C     1 
ATOM   4792 O O     . GLY B 1 82  ? 0.107   -7.667  -36.453 1.00 59.73  ? 82  GLY B O     1 
ATOM   4793 N N     . THR B 1 83  ? -0.221  -9.867  -36.781 1.00 58.30  ? 83  THR B N     1 
ATOM   4794 C CA    . THR B 1 83  ? 0.985   -10.084 -37.559 1.00 53.74  ? 83  THR B CA    1 
ATOM   4795 C C     . THR B 1 83  ? 0.726   -9.920  -39.048 1.00 57.95  ? 83  THR B C     1 
ATOM   4796 O O     . THR B 1 83  ? 1.476   -9.232  -39.750 1.00 54.09  ? 83  THR B O     1 
ATOM   4797 C CB    . THR B 1 83  ? 1.517   -11.484 -37.272 1.00 58.20  ? 83  THR B CB    1 
ATOM   4798 O OG1   . THR B 1 83  ? 2.135   -11.482 -35.983 1.00 63.13  ? 83  THR B OG1   1 
ATOM   4799 C CG2   . THR B 1 83  ? 2.512   -11.928 -38.334 1.00 60.88  ? 83  THR B CG2   1 
ATOM   4800 N N     . GLU B 1 84  ? -0.348  -10.541 -39.530 1.00 60.05  ? 84  GLU B N     1 
ATOM   4801 C CA    . GLU B 1 84  ? -0.615  -10.567 -40.959 1.00 53.38  ? 84  GLU B CA    1 
ATOM   4802 C C     . GLU B 1 84  ? -0.956  -9.192  -41.507 1.00 54.93  ? 84  GLU B C     1 
ATOM   4803 O O     . GLU B 1 84  ? -0.694  -8.919  -42.683 1.00 56.17  ? 84  GLU B O     1 
ATOM   4804 C CB    . GLU B 1 84  ? -1.750  -11.540 -41.239 1.00 55.77  ? 84  GLU B CB    1 
ATOM   4805 C CG    . GLU B 1 84  ? -1.404  -12.965 -40.893 1.00 58.95  ? 84  GLU B CG    1 
ATOM   4806 C CD    . GLU B 1 84  ? -0.295  -13.526 -41.771 1.00 66.89  ? 84  GLU B CD    1 
ATOM   4807 O OE1   . GLU B 1 84  ? 0.024   -12.916 -42.841 1.00 61.53  ? 84  GLU B OE1   1 
ATOM   4808 O OE2   . GLU B 1 84  ? 0.254   -14.586 -41.379 1.00 64.89  ? 84  GLU B OE2   1 
ATOM   4809 N N     . MET B 1 85  ? -1.544  -8.319  -40.685 1.00 54.14  ? 85  MET B N     1 
ATOM   4810 C CA    . MET B 1 85  ? -2.010  -7.032  -41.188 1.00 48.86  ? 85  MET B CA    1 
ATOM   4811 C C     . MET B 1 85  ? -0.876  -6.181  -41.719 1.00 49.06  ? 85  MET B C     1 
ATOM   4812 O O     . MET B 1 85  ? -1.130  -5.205  -42.433 1.00 50.58  ? 85  MET B O     1 
ATOM   4813 C CB    . MET B 1 85  ? -2.724  -6.268  -40.093 1.00 51.10  ? 85  MET B CB    1 
ATOM   4814 C CG    . MET B 1 85  ? -1.825  -6.020  -38.886 1.00 53.62  ? 85  MET B CG    1 
ATOM   4815 S SD    . MET B 1 85  ? -2.743  -5.179  -37.617 1.00 54.93  ? 85  MET B SD    1 
ATOM   4816 C CE    . MET B 1 85  ? -2.959  -3.605  -38.438 1.00 50.49  ? 85  MET B CE    1 
ATOM   4817 N N     . TRP B 1 86  ? 0.362   -6.516  -41.366 1.00 48.45  ? 86  TRP B N     1 
ATOM   4818 C CA    . TRP B 1 86  ? 1.532   -5.839  -41.894 1.00 48.52  ? 86  TRP B CA    1 
ATOM   4819 C C     . TRP B 1 86  ? 2.240   -6.639  -42.981 1.00 43.43  ? 86  TRP B C     1 
ATOM   4820 O O     . TRP B 1 86  ? 3.147   -6.111  -43.613 1.00 45.12  ? 86  TRP B O     1 
ATOM   4821 C CB    . TRP B 1 86  ? 2.517   -5.526  -40.755 1.00 47.81  ? 86  TRP B CB    1 
ATOM   4822 C CG    . TRP B 1 86  ? 1.856   -4.955  -39.531 1.00 53.25  ? 86  TRP B CG    1 
ATOM   4823 C CD1   . TRP B 1 86  ? 1.579   -5.612  -38.366 1.00 51.11  ? 86  TRP B CD1   1 
ATOM   4824 C CD2   . TRP B 1 86  ? 1.388   -3.612  -39.350 1.00 53.60  ? 86  TRP B CD2   1 
ATOM   4825 N NE1   . TRP B 1 86  ? 0.971   -4.770  -37.481 1.00 49.90  ? 86  TRP B NE1   1 
ATOM   4826 C CE2   . TRP B 1 86  ? 0.837   -3.535  -38.056 1.00 49.92  ? 86  TRP B CE2   1 
ATOM   4827 C CE3   . TRP B 1 86  ? 1.376   -2.469  -40.158 1.00 48.10  ? 86  TRP B CE3   1 
ATOM   4828 C CZ2   . TRP B 1 86  ? 0.283   -2.361  -37.548 1.00 46.73  ? 86  TRP B CZ2   1 
ATOM   4829 C CZ3   . TRP B 1 86  ? 0.823   -1.306  -39.649 1.00 47.27  ? 86  TRP B CZ3   1 
ATOM   4830 C CH2   . TRP B 1 86  ? 0.284   -1.261  -38.357 1.00 42.03  ? 86  TRP B CH2   1 
ATOM   4831 N N     . ASN B 1 87  ? 1.856   -7.890  -43.205 1.00 45.66  ? 87  ASN B N     1 
ATOM   4832 C CA    . ASN B 1 87  ? 2.491   -8.725  -44.211 1.00 48.32  ? 87  ASN B CA    1 
ATOM   4833 C C     . ASN B 1 87  ? 2.098   -8.274  -45.626 1.00 48.44  ? 87  ASN B C     1 
ATOM   4834 O O     . ASN B 1 87  ? 1.085   -7.592  -45.816 1.00 44.02  ? 87  ASN B O     1 
ATOM   4835 C CB    . ASN B 1 87  ? 2.103   -10.186 -43.984 1.00 51.13  ? 87  ASN B CB    1 
ATOM   4836 C CG    . ASN B 1 87  ? 2.981   -10.885 -42.958 1.00 54.24  ? 87  ASN B CG    1 
ATOM   4837 O OD1   . ASN B 1 87  ? 4.160   -10.564 -42.797 1.00 53.03  ? 87  ASN B OD1   1 
ATOM   4838 N ND2   . ASN B 1 87  ? 2.415   -11.875 -42.283 1.00 55.65  ? 87  ASN B ND2   1 
ATOM   4839 N N     . PRO B 1 88  ? 2.887   -8.639  -46.638 1.00 48.74  ? 88  PRO B N     1 
ATOM   4840 C CA    . PRO B 1 88  ? 2.599   -8.155  -48.001 1.00 48.65  ? 88  PRO B CA    1 
ATOM   4841 C C     . PRO B 1 88  ? 1.202   -8.520  -48.480 1.00 49.13  ? 88  PRO B C     1 
ATOM   4842 O O     . PRO B 1 88  ? 0.718   -9.637  -48.305 1.00 50.62  ? 88  PRO B O     1 
ATOM   4843 C CB    . PRO B 1 88  ? 3.679   -8.814  -48.860 1.00 39.54  ? 88  PRO B CB    1 
ATOM   4844 C CG    . PRO B 1 88  ? 4.816   -8.977  -47.942 1.00 50.16  ? 88  PRO B CG    1 
ATOM   4845 C CD    . PRO B 1 88  ? 4.208   -9.286  -46.558 1.00 48.73  ? 88  PRO B CD    1 
ATOM   4846 N N     . ASN B 1 89  ? 0.568   -7.528  -49.082 1.00 51.48  ? 89  ASN B N     1 
ATOM   4847 C CA    . ASN B 1 89  ? -0.801  -7.501  -49.558 1.00 47.67  ? 89  ASN B CA    1 
ATOM   4848 C C     . ASN B 1 89  ? -0.939  -8.042  -50.978 1.00 58.04  ? 89  ASN B C     1 
ATOM   4849 O O     . ASN B 1 89  ? -2.055  -8.330  -51.424 1.00 56.92  ? 89  ASN B O     1 
ATOM   4850 C CB    . ASN B 1 89  ? -1.260  -6.035  -49.547 1.00 44.67  ? 89  ASN B CB    1 
ATOM   4851 C CG    . ASN B 1 89  ? -2.614  -5.854  -48.976 1.00 53.42  ? 89  ASN B CG    1 
ATOM   4852 O OD1   . ASN B 1 89  ? -3.170  -6.762  -48.343 1.00 58.96  ? 89  ASN B OD1   1 
ATOM   4853 N ND2   . ASN B 1 89  ? -3.167  -4.657  -49.165 1.00 50.48  ? 89  ASN B ND2   1 
ATOM   4854 N N     . ARG B 1 90  ? 0.165   -8.117  -51.712 1.00 48.83  ? 90  ARG B N     1 
ATOM   4855 C CA    . ARG B 1 90  ? 0.170   -8.423  -53.122 1.00 49.06  ? 90  ARG B CA    1 
ATOM   4856 C C     . ARG B 1 90  ? 1.384   -9.293  -53.390 1.00 54.29  ? 90  ARG B C     1 
ATOM   4857 O O     . ARG B 1 90  ? 2.172   -9.596  -52.486 1.00 55.79  ? 90  ARG B O     1 
ATOM   4858 C CB    . ARG B 1 90  ? 0.209   -7.149  -53.977 1.00 50.92  ? 90  ARG B CB    1 
ATOM   4859 C CG    . ARG B 1 90  ? -1.014  -6.259  -53.876 1.00 47.64  ? 90  ARG B CG    1 
ATOM   4860 C CD    . ARG B 1 90  ? -2.178  -6.847  -54.635 1.00 50.05  ? 90  ARG B CD    1 
ATOM   4861 N NE    . ARG B 1 90  ? -3.355  -5.996  -54.580 1.00 48.59  ? 90  ARG B NE    1 
ATOM   4862 C CZ    . ARG B 1 90  ? -4.181  -5.940  -53.543 1.00 54.12  ? 90  ARG B CZ    1 
ATOM   4863 N NH1   . ARG B 1 90  ? -3.940  -6.677  -52.459 1.00 51.44  ? 90  ARG B NH1   1 
ATOM   4864 N NH2   . ARG B 1 90  ? -5.235  -5.133  -53.582 1.00 54.49  ? 90  ARG B NH2   1 
ATOM   4865 N N     . GLU B 1 91  ? 1.534   -9.702  -54.640 1.00 54.21  ? 91  GLU B N     1 
ATOM   4866 C CA    . GLU B 1 91  ? 2.659   -10.547 -54.992 1.00 57.41  ? 91  GLU B CA    1 
ATOM   4867 C C     . GLU B 1 91  ? 3.951   -9.763  -54.830 1.00 53.74  ? 91  GLU B C     1 
ATOM   4868 O O     . GLU B 1 91  ? 4.022   -8.581  -55.163 1.00 53.50  ? 91  GLU B O     1 
ATOM   4869 C CB    . GLU B 1 91  ? 2.501   -11.067 -56.424 1.00 59.93  ? 91  GLU B CB    1 
ATOM   4870 C CG    . GLU B 1 91  ? 1.871   -12.455 -56.505 1.00 58.45  ? 91  GLU B CG    1 
ATOM   4871 C CD    . GLU B 1 91  ? 2.834   -13.515 -56.021 1.00 66.47  ? 91  GLU B CD    1 
ATOM   4872 O OE1   . GLU B 1 91  ? 3.927   -13.643 -56.621 1.00 65.99  ? 91  GLU B OE1   1 
ATOM   4873 O OE2   . GLU B 1 91  ? 2.519   -14.194 -55.021 1.00 67.99  ? 91  GLU B OE2   1 
ATOM   4874 N N     . LEU B 1 92  ? 4.963   -10.415 -54.272 1.00 52.55  ? 92  LEU B N     1 
ATOM   4875 C CA    . LEU B 1 92  ? 6.272   -9.794  -54.181 1.00 49.99  ? 92  LEU B CA    1 
ATOM   4876 C C     . LEU B 1 92  ? 6.908   -9.687  -55.560 1.00 50.60  ? 92  LEU B C     1 
ATOM   4877 O O     . LEU B 1 92  ? 6.729   -10.553 -56.414 1.00 58.83  ? 92  LEU B O     1 
ATOM   4878 C CB    . LEU B 1 92  ? 7.175   -10.598 -53.255 1.00 46.90  ? 92  LEU B CB    1 
ATOM   4879 C CG    . LEU B 1 92  ? 6.631   -10.764 -51.839 1.00 49.33  ? 92  LEU B CG    1 
ATOM   4880 C CD1   . LEU B 1 92  ? 7.727   -11.332 -50.984 1.00 42.78  ? 92  LEU B CD1   1 
ATOM   4881 C CD2   . LEU B 1 92  ? 6.141   -9.429  -51.303 1.00 46.23  ? 92  LEU B CD2   1 
ATOM   4882 N N     . SER B 1 93  ? 7.678   -8.624  -55.766 1.00 46.54  ? 93  SER B N     1 
ATOM   4883 C CA    . SER B 1 93  ? 8.359   -8.417  -57.031 1.00 48.03  ? 93  SER B CA    1 
ATOM   4884 C C     . SER B 1 93  ? 9.414   -7.347  -56.826 1.00 45.96  ? 93  SER B C     1 
ATOM   4885 O O     . SER B 1 93  ? 9.152   -6.361  -56.143 1.00 49.87  ? 93  SER B O     1 
ATOM   4886 C CB    . SER B 1 93  ? 7.350   -7.989  -58.119 1.00 52.16  ? 93  SER B CB    1 
ATOM   4887 O OG    . SER B 1 93  ? 7.971   -7.670  -59.355 1.00 46.83  ? 93  SER B OG    1 
ATOM   4888 N N     . GLU B 1 94  ? 10.598  -7.532  -57.417 1.00 43.02  ? 94  GLU B N     1 
ATOM   4889 C CA    . GLU B 1 94  ? 11.543  -6.421  -57.469 1.00 38.81  ? 94  GLU B CA    1 
ATOM   4890 C C     . GLU B 1 94  ? 11.036  -5.265  -58.317 1.00 44.11  ? 94  GLU B C     1 
ATOM   4891 O O     . GLU B 1 94  ? 11.589  -4.160  -58.250 1.00 46.70  ? 94  GLU B O     1 
ATOM   4892 C CB    . GLU B 1 94  ? 12.892  -6.887  -57.995 1.00 37.03  ? 94  GLU B CB    1 
ATOM   4893 C CG    . GLU B 1 94  ? 13.699  -7.685  -56.998 1.00 41.68  ? 94  GLU B CG    1 
ATOM   4894 C CD    . GLU B 1 94  ? 15.159  -7.813  -57.382 1.00 48.43  ? 94  GLU B CD    1 
ATOM   4895 O OE1   . GLU B 1 94  ? 15.598  -8.956  -57.634 1.00 48.17  ? 94  GLU B OE1   1 
ATOM   4896 O OE2   . GLU B 1 94  ? 15.867  -6.776  -57.442 1.00 52.43  ? 94  GLU B OE2   1 
ATOM   4897 N N     . ASP B 1 95  ? 10.008  -5.479  -59.116 1.00 48.17  ? 95  ASP B N     1 
ATOM   4898 C CA    . ASP B 1 95  ? 9.408   -4.407  -59.889 1.00 47.81  ? 95  ASP B CA    1 
ATOM   4899 C C     . ASP B 1 95  ? 8.206   -3.920  -59.096 1.00 46.36  ? 95  ASP B C     1 
ATOM   4900 O O     . ASP B 1 95  ? 7.112   -4.471  -59.209 1.00 49.92  ? 95  ASP B O     1 
ATOM   4901 C CB    . ASP B 1 95  ? 9.033   -4.889  -61.282 1.00 47.09  ? 95  ASP B CB    1 
ATOM   4902 C CG    . ASP B 1 95  ? 8.140   -3.916  -62.004 1.00 52.60  ? 95  ASP B CG    1 
ATOM   4903 O OD1   . ASP B 1 95  ? 7.464   -4.368  -62.953 1.00 54.53  ? 95  ASP B OD1   1 
ATOM   4904 O OD2   . ASP B 1 95  ? 8.107   -2.713  -61.617 1.00 52.76  ? 95  ASP B OD2   1 
ATOM   4905 N N     . CYS B 1 96  ? 8.418   -2.861  -58.313 1.00 47.11  ? 96  CYS B N     1 
ATOM   4906 C CA    . CYS B 1 96  ? 7.479   -2.407  -57.290 1.00 41.82  ? 96  CYS B CA    1 
ATOM   4907 C C     . CYS B 1 96  ? 7.424   -0.903  -57.126 1.00 39.45  ? 96  CYS B C     1 
ATOM   4908 O O     . CYS B 1 96  ? 6.576   -0.416  -56.376 1.00 42.81  ? 96  CYS B O     1 
ATOM   4909 C CB    . CYS B 1 96  ? 7.862   -3.010  -55.947 1.00 43.34  ? 96  CYS B CB    1 
ATOM   4910 S SG    . CYS B 1 96  ? 9.542   -2.536  -55.477 1.00 50.10  ? 96  CYS B SG    1 
ATOM   4911 N N     . LEU B 1 97  ? 8.292   -0.155  -57.785 1.00 39.64  ? 97  LEU B N     1 
ATOM   4912 C CA    . LEU B 1 97  ? 8.308   1.291   -57.727 1.00 35.36  ? 97  LEU B CA    1 
ATOM   4913 C C     . LEU B 1 97  ? 7.049   1.919   -58.321 1.00 39.83  ? 97  LEU B C     1 
ATOM   4914 O O     . LEU B 1 97  ? 7.089   2.508   -59.408 1.00 43.54  ? 97  LEU B O     1 
ATOM   4915 C CB    . LEU B 1 97  ? 9.574   1.785   -58.425 1.00 34.34  ? 97  LEU B CB    1 
ATOM   4916 C CG    . LEU B 1 97  ? 10.828  1.264   -57.712 1.00 38.72  ? 97  LEU B CG    1 
ATOM   4917 C CD1   . LEU B 1 97  ? 12.079  2.021   -58.108 1.00 37.42  ? 97  LEU B CD1   1 
ATOM   4918 C CD2   . LEU B 1 97  ? 10.640  1.308   -56.171 1.00 43.18  ? 97  LEU B CD2   1 
ATOM   4919 N N     . TYR B 1 98  ? 5.932   1.835   -57.588 1.00 43.65  ? 98  TYR B N     1 
ATOM   4920 C CA    . TYR B 1 98  ? 4.667   2.471   -57.960 1.00 45.26  ? 98  TYR B CA    1 
ATOM   4921 C C     . TYR B 1 98  ? 4.113   3.265   -56.786 1.00 42.97  ? 98  TYR B C     1 
ATOM   4922 O O     . TYR B 1 98  ? 4.479   3.043   -55.627 1.00 43.94  ? 98  TYR B O     1 
ATOM   4923 C CB    . TYR B 1 98  ? 3.606   1.442   -58.447 1.00 44.16  ? 98  TYR B CB    1 
ATOM   4924 C CG    . TYR B 1 98  ? 4.169   0.527   -59.521 1.00 50.82  ? 98  TYR B CG    1 
ATOM   4925 C CD1   . TYR B 1 98  ? 3.921   0.747   -60.905 1.00 48.93  ? 98  TYR B CD1   1 
ATOM   4926 C CD2   . TYR B 1 98  ? 4.967   -0.540  -59.175 1.00 44.78  ? 98  TYR B CD2   1 
ATOM   4927 C CE1   . TYR B 1 98  ? 4.481   -0.085  -61.880 1.00 48.61  ? 98  TYR B CE1   1 
ATOM   4928 C CE2   . TYR B 1 98  ? 5.522   -1.376  -60.154 1.00 54.84  ? 98  TYR B CE2   1 
ATOM   4929 C CZ    . TYR B 1 98  ? 5.275   -1.145  -61.506 1.00 51.18  ? 98  TYR B CZ    1 
ATOM   4930 O OH    . TYR B 1 98  ? 5.831   -1.973  -62.451 1.00 51.99  ? 98  TYR B OH    1 
ATOM   4931 N N     . LEU B 1 99  ? 3.221   4.199   -57.106 1.00 42.67  ? 99  LEU B N     1 
ATOM   4932 C CA    . LEU B 1 99  ? 2.595   5.052   -56.114 1.00 42.50  ? 99  LEU B CA    1 
ATOM   4933 C C     . LEU B 1 99  ? 1.088   5.079   -56.339 1.00 45.53  ? 99  LEU B C     1 
ATOM   4934 O O     . LEU B 1 99  ? 0.588   4.681   -57.393 1.00 46.57  ? 99  LEU B O     1 
ATOM   4935 C CB    . LEU B 1 99  ? 3.196   6.463   -56.142 1.00 38.12  ? 99  LEU B CB    1 
ATOM   4936 C CG    . LEU B 1 99  ? 3.118   7.394   -57.345 1.00 42.98  ? 99  LEU B CG    1 
ATOM   4937 C CD1   . LEU B 1 99  ? 1.726   7.971   -57.539 1.00 44.62  ? 99  LEU B CD1   1 
ATOM   4938 C CD2   . LEU B 1 99  ? 4.115   8.509   -57.127 1.00 42.11  ? 99  LEU B CD2   1 
ATOM   4939 N N     . ASN B 1 100 ? 0.365   5.565   -55.326 1.00 44.34  ? 100 ASN B N     1 
ATOM   4940 C CA    . ASN B 1 100 ? -1.090  5.625   -55.320 1.00 44.38  ? 100 ASN B CA    1 
ATOM   4941 C C     . ASN B 1 100 ? -1.552  7.033   -54.979 1.00 49.27  ? 100 ASN B C     1 
ATOM   4942 O O     . ASN B 1 100 ? -0.908  7.729   -54.188 1.00 51.80  ? 100 ASN B O     1 
ATOM   4943 C CB    . ASN B 1 100 ? -1.653  4.647   -54.316 1.00 44.35  ? 100 ASN B CB    1 
ATOM   4944 C CG    . ASN B 1 100 ? -1.034  3.285   -54.450 1.00 48.20  ? 100 ASN B CG    1 
ATOM   4945 O OD1   . ASN B 1 100 ? -0.995  2.720   -55.547 1.00 49.42  ? 100 ASN B OD1   1 
ATOM   4946 N ND2   . ASN B 1 100 ? -0.520  2.750   -53.345 1.00 42.12  ? 100 ASN B ND2   1 
ATOM   4947 N N     . VAL B 1 101 ? -2.670  7.453   -55.569 1.00 47.63  ? 101 VAL B N     1 
ATOM   4948 C CA    . VAL B 1 101 ? -3.230  8.782   -55.340 1.00 48.59  ? 101 VAL B CA    1 
ATOM   4949 C C     . VAL B 1 101 ? -4.718  8.632   -55.074 1.00 50.27  ? 101 VAL B C     1 
ATOM   4950 O O     . VAL B 1 101 ? -5.441  8.082   -55.910 1.00 56.23  ? 101 VAL B O     1 
ATOM   4951 C CB    . VAL B 1 101 ? -3.004  9.723   -56.537 1.00 46.79  ? 101 VAL B CB    1 
ATOM   4952 C CG1   . VAL B 1 101 ? -3.764  11.034  -56.332 1.00 45.33  ? 101 VAL B CG1   1 
ATOM   4953 C CG2   . VAL B 1 101 ? -1.520  9.980   -56.765 1.00 45.07  ? 101 VAL B CG2   1 
ATOM   4954 N N     . TRP B 1 102 ? -5.180  9.108   -53.924 1.00 45.97  ? 102 TRP B N     1 
ATOM   4955 C CA    . TRP B 1 102 ? -6.608  9.258   -53.683 1.00 47.08  ? 102 TRP B CA    1 
ATOM   4956 C C     . TRP B 1 102 ? -6.965  10.736  -53.693 1.00 50.98  ? 102 TRP B C     1 
ATOM   4957 O O     . TRP B 1 102 ? -6.203  11.577  -53.198 1.00 49.48  ? 102 TRP B O     1 
ATOM   4958 C CB    . TRP B 1 102 ? -7.038  8.667   -52.346 1.00 50.60  ? 102 TRP B CB    1 
ATOM   4959 C CG    . TRP B 1 102 ? -6.932  7.192   -52.166 1.00 43.90  ? 102 TRP B CG    1 
ATOM   4960 C CD1   . TRP B 1 102 ? -7.945  6.288   -52.220 1.00 42.07  ? 102 TRP B CD1   1 
ATOM   4961 C CD2   . TRP B 1 102 ? -5.759  6.462   -51.819 1.00 42.74  ? 102 TRP B CD2   1 
ATOM   4962 N NE1   . TRP B 1 102 ? -7.472  5.029   -51.946 1.00 43.00  ? 102 TRP B NE1   1 
ATOM   4963 C CE2   . TRP B 1 102 ? -6.129  5.111   -51.698 1.00 41.71  ? 102 TRP B CE2   1 
ATOM   4964 C CE3   . TRP B 1 102 ? -4.424  6.820   -51.609 1.00 44.54  ? 102 TRP B CE3   1 
ATOM   4965 C CZ2   . TRP B 1 102 ? -5.217  4.116   -51.376 1.00 43.64  ? 102 TRP B CZ2   1 
ATOM   4966 C CZ3   . TRP B 1 102 ? -3.517  5.832   -51.287 1.00 44.16  ? 102 TRP B CZ3   1 
ATOM   4967 C CH2   . TRP B 1 102 ? -3.917  4.496   -51.168 1.00 45.27  ? 102 TRP B CH2   1 
ATOM   4968 N N     . THR B 1 103 ? -8.113  11.053  -54.271 1.00 51.52  ? 103 THR B N     1 
ATOM   4969 C CA    . THR B 1 103 ? -8.603  12.426  -54.277 1.00 57.26  ? 103 THR B CA    1 
ATOM   4970 C C     . THR B 1 103 ? -10.097 12.364  -54.033 1.00 60.46  ? 103 THR B C     1 
ATOM   4971 O O     . THR B 1 103 ? -10.694 11.286  -54.158 1.00 60.73  ? 103 THR B O     1 
ATOM   4972 C CB    . THR B 1 103 ? -8.371  13.156  -55.601 1.00 53.75  ? 103 THR B CB    1 
ATOM   4973 O OG1   . THR B 1 103 ? -9.387  12.734  -56.511 1.00 54.43  ? 103 THR B OG1   1 
ATOM   4974 C CG2   . THR B 1 103 ? -6.987  12.882  -56.185 1.00 50.35  ? 103 THR B CG2   1 
ATOM   4975 N N     . PRO B 1 104 ? -10.735 13.477  -53.685 1.00 60.39  ? 104 PRO B N     1 
ATOM   4976 C CA    . PRO B 1 104 ? -12.194 13.480  -53.624 1.00 59.17  ? 104 PRO B CA    1 
ATOM   4977 C C     . PRO B 1 104 ? -12.787 13.352  -55.016 1.00 65.49  ? 104 PRO B C     1 
ATOM   4978 O O     . PRO B 1 104 ? -12.152 13.678  -56.022 1.00 65.93  ? 104 PRO B O     1 
ATOM   4979 C CB    . PRO B 1 104 ? -12.520 14.835  -52.994 1.00 61.45  ? 104 PRO B CB    1 
ATOM   4980 C CG    . PRO B 1 104 ? -11.297 15.658  -53.216 1.00 59.03  ? 104 PRO B CG    1 
ATOM   4981 C CD    . PRO B 1 104 ? -10.160 14.727  -53.158 1.00 56.78  ? 104 PRO B CD    1 
ATOM   4982 N N     . TYR B 1 105 ? -14.010 12.838  -55.057 1.00 67.44  ? 105 TYR B N     1 
ATOM   4983 C CA    . TYR B 1 105 ? -14.755 12.625  -56.290 1.00 64.16  ? 105 TYR B CA    1 
ATOM   4984 C C     . TYR B 1 105 ? -16.044 13.415  -56.169 1.00 63.67  ? 105 TYR B C     1 
ATOM   4985 O O     . TYR B 1 105 ? -16.900 13.077  -55.359 1.00 69.22  ? 105 TYR B O     1 
ATOM   4986 C CB    . TYR B 1 105 ? -15.035 11.137  -56.505 1.00 64.33  ? 105 TYR B CB    1 
ATOM   4987 C CG    . TYR B 1 105 ? -15.790 10.793  -57.764 1.00 65.25  ? 105 TYR B CG    1 
ATOM   4988 C CD1   . TYR B 1 105 ? -15.124 10.312  -58.880 1.00 71.00  ? 105 TYR B CD1   1 
ATOM   4989 C CD2   . TYR B 1 105 ? -17.168 10.928  -57.834 1.00 65.69  ? 105 TYR B CD2   1 
ATOM   4990 C CE1   . TYR B 1 105 ? -15.810 9.990   -60.038 1.00 73.27  ? 105 TYR B CE1   1 
ATOM   4991 C CE2   . TYR B 1 105 ? -17.863 10.606  -58.978 1.00 65.93  ? 105 TYR B CE2   1 
ATOM   4992 C CZ    . TYR B 1 105 ? -17.180 10.137  -60.079 1.00 72.25  ? 105 TYR B CZ    1 
ATOM   4993 O OH    . TYR B 1 105 ? -17.866 9.816   -61.229 1.00 76.04  ? 105 TYR B OH    1 
ATOM   4994 N N     . PRO B 1 106 ? -16.211 14.451  -56.989 1.00 63.62  ? 106 PRO B N     1 
ATOM   4995 C CA    . PRO B 1 106 ? -15.365 14.814  -58.132 1.00 73.16  ? 106 PRO B CA    1 
ATOM   4996 C C     . PRO B 1 106 ? -13.990 15.351  -57.744 1.00 71.87  ? 106 PRO B C     1 
ATOM   4997 O O     . PRO B 1 106 ? -13.818 15.813  -56.622 1.00 69.45  ? 106 PRO B O     1 
ATOM   4998 C CB    . PRO B 1 106 ? -16.186 15.900  -58.838 1.00 69.28  ? 106 PRO B CB    1 
ATOM   4999 C CG    . PRO B 1 106 ? -17.022 16.497  -57.758 1.00 69.81  ? 106 PRO B CG    1 
ATOM   5000 C CD    . PRO B 1 106 ? -17.330 15.388  -56.798 1.00 64.22  ? 106 PRO B CD    1 
ATOM   5001 N N     . ARG B 1 107 ? -13.029 15.237  -58.661 1.00 70.63  ? 107 ARG B N     1 
ATOM   5002 C CA    . ARG B 1 107 ? -11.694 15.812  -58.556 1.00 68.80  ? 107 ARG B CA    1 
ATOM   5003 C C     . ARG B 1 107 ? -11.769 17.202  -57.928 1.00 68.17  ? 107 ARG B C     1 
ATOM   5004 O O     . ARG B 1 107 ? -12.702 17.954  -58.230 1.00 70.15  ? 107 ARG B O     1 
ATOM   5005 C CB    . ARG B 1 107 ? -11.066 15.854  -59.952 1.00 68.54  ? 107 ARG B CB    1 
ATOM   5006 C CG    . ARG B 1 107 ? -9.744  16.555  -60.052 1.00 66.04  ? 107 ARG B CG    1 
ATOM   5007 C CD    . ARG B 1 107 ? -8.744  15.699  -60.810 1.00 68.68  ? 107 ARG B CD    1 
ATOM   5008 N NE    . ARG B 1 107 ? -8.938  15.697  -62.265 1.00 70.62  ? 107 ARG B NE    1 
ATOM   5009 C CZ    . ARG B 1 107 ? -9.435  14.668  -62.948 1.00 69.17  ? 107 ARG B CZ    1 
ATOM   5010 N NH1   . ARG B 1 107 ? -9.569  14.736  -64.265 1.00 70.51  ? 107 ARG B NH1   1 
ATOM   5011 N NH2   . ARG B 1 107 ? -9.802  13.565  -62.310 1.00 71.25  ? 107 ARG B NH2   1 
ATOM   5012 N N     . PRO B 1 108 ? -10.847 17.566  -57.029 1.00 70.57  ? 108 PRO B N     1 
ATOM   5013 C CA    . PRO B 1 108 ? -10.922 18.885  -56.385 1.00 67.74  ? 108 PRO B CA    1 
ATOM   5014 C C     . PRO B 1 108 ? -11.038 20.013  -57.399 1.00 70.92  ? 108 PRO B C     1 
ATOM   5015 O O     . PRO B 1 108 ? -10.396 20.004  -58.455 1.00 66.52  ? 108 PRO B O     1 
ATOM   5016 C CB    . PRO B 1 108 ? -9.608  18.976  -55.605 1.00 59.84  ? 108 PRO B CB    1 
ATOM   5017 C CG    . PRO B 1 108 ? -9.275  17.584  -55.286 1.00 64.87  ? 108 PRO B CG    1 
ATOM   5018 C CD    . PRO B 1 108 ? -9.764  16.746  -56.457 1.00 68.15  ? 108 PRO B CD    1 
ATOM   5019 N N     . ALA B 1 109 ? -11.887 20.982  -57.068 1.00 73.34  ? 109 ALA B N     1 
ATOM   5020 C CA    . ALA B 1 109 ? -12.025 22.189  -57.867 1.00 72.62  ? 109 ALA B CA    1 
ATOM   5021 C C     . ALA B 1 109 ? -10.755 23.022  -57.775 1.00 70.13  ? 109 ALA B C     1 
ATOM   5022 O O     . ALA B 1 109 ? -10.004 23.138  -58.748 1.00 68.73  ? 109 ALA B O     1 
ATOM   5023 C CB    . ALA B 1 109 ? -13.228 23.002  -57.394 1.00 79.60  ? 109 ALA B CB    1 
ATOM   5024 N N     . SER B 1 110 ? -10.508 23.592  -56.605 1.00 67.41  ? 110 SER B N     1 
ATOM   5025 C CA    . SER B 1 110 ? -9.326  24.399  -56.358 1.00 65.36  ? 110 SER B CA    1 
ATOM   5026 C C     . SER B 1 110 ? -8.152  23.514  -55.959 1.00 65.89  ? 110 SER B C     1 
ATOM   5027 O O     . SER B 1 110 ? -8.335  22.341  -55.610 1.00 65.71  ? 110 SER B O     1 
ATOM   5028 C CB    . SER B 1 110 ? -9.623  25.431  -55.269 1.00 63.27  ? 110 SER B CB    1 
ATOM   5029 O OG    . SER B 1 110 ? -10.617 24.957  -54.371 1.00 66.85  ? 110 SER B OG    1 
ATOM   5030 N N     . PRO B 1 111 ? -6.923  24.038  -56.034 1.00 63.02  ? 111 PRO B N     1 
ATOM   5031 C CA    . PRO B 1 111 ? -5.760  23.275  -55.555 1.00 60.08  ? 111 PRO B CA    1 
ATOM   5032 C C     . PRO B 1 111 ? -5.921  22.846  -54.105 1.00 55.63  ? 111 PRO B C     1 
ATOM   5033 O O     . PRO B 1 111 ? -6.530  23.543  -53.295 1.00 60.65  ? 111 PRO B O     1 
ATOM   5034 C CB    . PRO B 1 111 ? -4.599  24.263  -55.713 1.00 60.38  ? 111 PRO B CB    1 
ATOM   5035 C CG    . PRO B 1 111 ? -5.033  25.185  -56.784 1.00 52.72  ? 111 PRO B CG    1 
ATOM   5036 C CD    . PRO B 1 111 ? -6.527  25.299  -56.686 1.00 57.05  ? 111 PRO B CD    1 
ATOM   5037 N N     . THR B 1 112 ? -5.345  21.688  -53.774 1.00 55.67  ? 112 THR B N     1 
ATOM   5038 C CA    . THR B 1 112 ? -5.618  21.020  -52.509 1.00 50.60  ? 112 THR B CA    1 
ATOM   5039 C C     . THR B 1 112 ? -4.334  20.498  -51.881 1.00 52.99  ? 112 THR B C     1 
ATOM   5040 O O     . THR B 1 112 ? -3.511  19.892  -52.593 1.00 52.20  ? 112 THR B O     1 
ATOM   5041 C CB    . THR B 1 112 ? -6.594  19.875  -52.742 1.00 47.28  ? 112 THR B CB    1 
ATOM   5042 O OG1   . THR B 1 112 ? -7.770  20.397  -53.359 1.00 53.56  ? 112 THR B OG1   1 
ATOM   5043 C CG2   . THR B 1 112 ? -6.981  19.238  -51.451 1.00 52.71  ? 112 THR B CG2   1 
ATOM   5044 N N     . PRO B 1 113 ? -4.129  20.710  -50.572 1.00 51.74  ? 113 PRO B N     1 
ATOM   5045 C CA    . PRO B 1 113 ? -2.908  20.213  -49.921 1.00 48.33  ? 113 PRO B CA    1 
ATOM   5046 C C     . PRO B 1 113 ? -2.770  18.711  -50.057 1.00 45.75  ? 113 PRO B C     1 
ATOM   5047 O O     . PRO B 1 113 ? -3.748  17.964  -49.978 1.00 46.91  ? 113 PRO B O     1 
ATOM   5048 C CB    . PRO B 1 113 ? -3.082  20.628  -48.453 1.00 46.03  ? 113 PRO B CB    1 
ATOM   5049 C CG    . PRO B 1 113 ? -4.513  20.948  -48.306 1.00 54.05  ? 113 PRO B CG    1 
ATOM   5050 C CD    . PRO B 1 113 ? -4.947  21.497  -49.641 1.00 48.94  ? 113 PRO B CD    1 
ATOM   5051 N N     . VAL B 1 114 ? -1.531  18.274  -50.246 1.00 43.31  ? 114 VAL B N     1 
ATOM   5052 C CA    . VAL B 1 114 ? -1.214  16.874  -50.483 1.00 44.08  ? 114 VAL B CA    1 
ATOM   5053 C C     . VAL B 1 114 ? -0.560  16.314  -49.234 1.00 43.70  ? 114 VAL B C     1 
ATOM   5054 O O     . VAL B 1 114 ? 0.372   16.918  -48.684 1.00 46.41  ? 114 VAL B O     1 
ATOM   5055 C CB    . VAL B 1 114 ? -0.290  16.698  -51.705 1.00 45.09  ? 114 VAL B CB    1 
ATOM   5056 C CG1   . VAL B 1 114 ? -0.298  15.254  -52.179 1.00 40.67  ? 114 VAL B CG1   1 
ATOM   5057 C CG2   . VAL B 1 114 ? -0.672  17.663  -52.828 1.00 43.53  ? 114 VAL B CG2   1 
ATOM   5058 N N     . LEU B 1 115 ? -1.046  15.165  -48.787 1.00 41.84  ? 115 LEU B N     1 
ATOM   5059 C CA    . LEU B 1 115 ? -0.369  14.359  -47.785 1.00 42.70  ? 115 LEU B CA    1 
ATOM   5060 C C     . LEU B 1 115 ? 0.310   13.189  -48.470 1.00 45.33  ? 115 LEU B C     1 
ATOM   5061 O O     . LEU B 1 115 ? -0.335  12.455  -49.226 1.00 51.47  ? 115 LEU B O     1 
ATOM   5062 C CB    . LEU B 1 115 ? -1.353  13.846  -46.733 1.00 49.39  ? 115 LEU B CB    1 
ATOM   5063 C CG    . LEU B 1 115 ? -1.961  14.815  -45.725 1.00 48.06  ? 115 LEU B CG    1 
ATOM   5064 C CD1   . LEU B 1 115 ? -3.185  14.167  -45.103 1.00 50.39  ? 115 LEU B CD1   1 
ATOM   5065 C CD2   . LEU B 1 115 ? -0.928  15.234  -44.677 1.00 47.44  ? 115 LEU B CD2   1 
ATOM   5066 N N     . ILE B 1 116 ? 1.604   13.011  -48.229 1.00 42.02  ? 116 ILE B N     1 
ATOM   5067 C CA    . ILE B 1 116 ? 2.340   11.885  -48.783 1.00 43.26  ? 116 ILE B CA    1 
ATOM   5068 C C     . ILE B 1 116 ? 2.707   10.967  -47.628 1.00 40.00  ? 116 ILE B C     1 
ATOM   5069 O O     . ILE B 1 116 ? 3.403   11.384  -46.700 1.00 43.96  ? 116 ILE B O     1 
ATOM   5070 C CB    . ILE B 1 116 ? 3.583   12.337  -49.562 1.00 42.17  ? 116 ILE B CB    1 
ATOM   5071 C CG1   . ILE B 1 116 ? 3.194   13.313  -50.666 1.00 41.82  ? 116 ILE B CG1   1 
ATOM   5072 C CG2   . ILE B 1 116 ? 4.284   11.142  -50.185 1.00 39.23  ? 116 ILE B CG2   1 
ATOM   5073 C CD1   . ILE B 1 116 ? 4.366   13.760  -51.502 1.00 39.18  ? 116 ILE B CD1   1 
ATOM   5074 N N     . TRP B 1 117 ? 2.248   9.724   -47.687 1.00 39.78  ? 117 TRP B N     1 
ATOM   5075 C CA    . TRP B 1 117 ? 2.521   8.720   -46.668 1.00 39.38  ? 117 TRP B CA    1 
ATOM   5076 C C     . TRP B 1 117 ? 3.723   7.854   -47.035 1.00 42.47  ? 117 TRP B C     1 
ATOM   5077 O O     . TRP B 1 117 ? 3.795   7.323   -48.149 1.00 45.09  ? 117 TRP B O     1 
ATOM   5078 C CB    . TRP B 1 117 ? 1.304   7.831   -46.470 1.00 38.81  ? 117 TRP B CB    1 
ATOM   5079 C CG    . TRP B 1 117 ? 1.566   6.680   -45.602 1.00 41.66  ? 117 TRP B CG    1 
ATOM   5080 C CD1   . TRP B 1 117 ? 1.779   5.399   -45.989 1.00 43.61  ? 117 TRP B CD1   1 
ATOM   5081 C CD2   . TRP B 1 117 ? 1.644   6.691   -44.174 1.00 45.05  ? 117 TRP B CD2   1 
ATOM   5082 N NE1   . TRP B 1 117 ? 1.978   4.599   -44.889 1.00 44.59  ? 117 TRP B NE1   1 
ATOM   5083 C CE2   . TRP B 1 117 ? 1.898   5.373   -43.761 1.00 45.89  ? 117 TRP B CE2   1 
ATOM   5084 C CE3   . TRP B 1 117 ? 1.529   7.690   -43.204 1.00 40.85  ? 117 TRP B CE3   1 
ATOM   5085 C CZ2   . TRP B 1 117 ? 2.038   5.028   -42.412 1.00 44.31  ? 117 TRP B CZ2   1 
ATOM   5086 C CZ3   . TRP B 1 117 ? 1.662   7.343   -41.879 1.00 42.72  ? 117 TRP B CZ3   1 
ATOM   5087 C CH2   . TRP B 1 117 ? 1.917   6.028   -41.494 1.00 40.02  ? 117 TRP B CH2   1 
ATOM   5088 N N     . ILE B 1 118 ? 4.648   7.693   -46.088 1.00 41.34  ? 118 ILE B N     1 
ATOM   5089 C CA    . ILE B 1 118 ? 5.815   6.825   -46.229 1.00 39.39  ? 118 ILE B CA    1 
ATOM   5090 C C     . ILE B 1 118 ? 5.682   5.732   -45.175 1.00 43.09  ? 118 ILE B C     1 
ATOM   5091 O O     . ILE B 1 118 ? 5.796   6.005   -43.972 1.00 48.25  ? 118 ILE B O     1 
ATOM   5092 C CB    . ILE B 1 118 ? 7.129   7.596   -46.063 1.00 35.18  ? 118 ILE B CB    1 
ATOM   5093 C CG1   . ILE B 1 118 ? 7.176   8.799   -46.995 1.00 33.59  ? 118 ILE B CG1   1 
ATOM   5094 C CG2   . ILE B 1 118 ? 8.305   6.703   -46.335 1.00 37.89  ? 118 ILE B CG2   1 
ATOM   5095 C CD1   . ILE B 1 118 ? 8.453   9.599   -46.865 1.00 31.39  ? 118 ILE B CD1   1 
ATOM   5096 N N     . TYR B 1 119 ? 5.442   4.499   -45.606 1.00 43.71  ? 119 TYR B N     1 
ATOM   5097 C CA    . TYR B 1 119 ? 5.155   3.442   -44.643 1.00 44.10  ? 119 TYR B CA    1 
ATOM   5098 C C     . TYR B 1 119 ? 6.384   3.068   -43.820 1.00 42.81  ? 119 TYR B C     1 
ATOM   5099 O O     . TYR B 1 119 ? 7.525   3.379   -44.164 1.00 43.42  ? 119 TYR B O     1 
ATOM   5100 C CB    . TYR B 1 119 ? 4.616   2.181   -45.332 1.00 46.92  ? 119 TYR B CB    1 
ATOM   5101 C CG    . TYR B 1 119 ? 5.431   1.643   -46.506 1.00 48.47  ? 119 TYR B CG    1 
ATOM   5102 C CD1   . TYR B 1 119 ? 6.631   0.958   -46.307 1.00 45.69  ? 119 TYR B CD1   1 
ATOM   5103 C CD2   . TYR B 1 119 ? 4.968   1.788   -47.816 1.00 45.13  ? 119 TYR B CD2   1 
ATOM   5104 C CE1   . TYR B 1 119 ? 7.356   0.454   -47.389 1.00 46.86  ? 119 TYR B CE1   1 
ATOM   5105 C CE2   . TYR B 1 119 ? 5.683   1.293   -48.898 1.00 46.84  ? 119 TYR B CE2   1 
ATOM   5106 C CZ    . TYR B 1 119 ? 6.880   0.633   -48.690 1.00 48.91  ? 119 TYR B CZ    1 
ATOM   5107 O OH    . TYR B 1 119 ? 7.586   0.137   -49.785 1.00 47.14  ? 119 TYR B OH    1 
ATOM   5108 N N     . GLY B 1 120 ? 6.124   2.370   -42.715 1.00 47.37  ? 120 GLY B N     1 
ATOM   5109 C CA    . GLY B 1 120 ? 7.164   1.797   -41.892 1.00 44.52  ? 120 GLY B CA    1 
ATOM   5110 C C     . GLY B 1 120 ? 7.348   0.318   -42.170 1.00 46.32  ? 120 GLY B C     1 
ATOM   5111 O O     . GLY B 1 120 ? 6.833   -0.234  -43.146 1.00 49.14  ? 120 GLY B O     1 
ATOM   5112 N N     . GLY B 1 121 ? 8.101   -0.331  -41.285 1.00 45.52  ? 121 GLY B N     1 
ATOM   5113 C CA    . GLY B 1 121 ? 8.466   -1.719  -41.485 1.00 45.50  ? 121 GLY B CA    1 
ATOM   5114 C C     . GLY B 1 121 ? 9.954   -1.956  -41.322 1.00 47.76  ? 121 GLY B C     1 
ATOM   5115 O O     . GLY B 1 121 ? 10.512  -2.862  -41.951 1.00 45.98  ? 121 GLY B O     1 
ATOM   5116 N N     . GLY B 1 122 ? 10.608  -1.137  -40.496 1.00 43.97  ? 122 GLY B N     1 
ATOM   5117 C CA    . GLY B 1 122 ? 12.011  -1.341  -40.181 1.00 42.24  ? 122 GLY B CA    1 
ATOM   5118 C C     . GLY B 1 122 ? 12.957  -1.273  -41.357 1.00 44.37  ? 122 GLY B C     1 
ATOM   5119 O O     . GLY B 1 122 ? 14.049  -1.843  -41.299 1.00 45.59  ? 122 GLY B O     1 
ATOM   5120 N N     . PHE B 1 123 ? 12.576  -0.590  -42.430 1.00 42.31  ? 123 PHE B N     1 
ATOM   5121 C CA    . PHE B 1 123 ? 13.360  -0.545  -43.656 1.00 43.47  ? 123 PHE B CA    1 
ATOM   5122 C C     . PHE B 1 123 ? 13.582  -1.930  -44.262 1.00 46.54  ? 123 PHE B C     1 
ATOM   5123 O O     . PHE B 1 123 ? 14.452  -2.087  -45.125 1.00 50.44  ? 123 PHE B O     1 
ATOM   5124 C CB    . PHE B 1 123 ? 14.724  0.138   -43.442 1.00 43.28  ? 123 PHE B CB    1 
ATOM   5125 C CG    . PHE B 1 123 ? 14.643  1.623   -43.154 1.00 46.66  ? 123 PHE B CG    1 
ATOM   5126 C CD1   . PHE B 1 123 ? 14.348  2.531   -44.173 1.00 44.58  ? 123 PHE B CD1   1 
ATOM   5127 C CD2   . PHE B 1 123 ? 14.898  2.113   -41.873 1.00 43.09  ? 123 PHE B CD2   1 
ATOM   5128 C CE1   . PHE B 1 123 ? 14.283  3.891   -43.923 1.00 40.11  ? 123 PHE B CE1   1 
ATOM   5129 C CE2   . PHE B 1 123 ? 14.841  3.470   -41.611 1.00 41.15  ? 123 PHE B CE2   1 
ATOM   5130 C CZ    . PHE B 1 123 ? 14.531  4.360   -42.634 1.00 45.11  ? 123 PHE B CZ    1 
ATOM   5131 N N     . TYR B 1 124 ? 12.829  -2.948  -43.842 1.00 44.57  ? 124 TYR B N     1 
ATOM   5132 C CA    . TYR B 1 124 ? 12.979  -4.288  -44.405 1.00 47.05  ? 124 TYR B CA    1 
ATOM   5133 C C     . TYR B 1 124 ? 11.663  -4.845  -44.932 1.00 48.55  ? 124 TYR B C     1 
ATOM   5134 O O     . TYR B 1 124 ? 11.617  -6.014  -45.344 1.00 47.94  ? 124 TYR B O     1 
ATOM   5135 C CB    . TYR B 1 124 ? 13.574  -5.261  -43.370 1.00 46.81  ? 124 TYR B CB    1 
ATOM   5136 C CG    . TYR B 1 124 ? 12.629  -5.638  -42.253 1.00 44.35  ? 124 TYR B CG    1 
ATOM   5137 C CD1   . TYR B 1 124 ? 11.731  -6.678  -42.397 1.00 44.91  ? 124 TYR B CD1   1 
ATOM   5138 C CD2   . TYR B 1 124 ? 12.655  -4.965  -41.042 1.00 49.79  ? 124 TYR B CD2   1 
ATOM   5139 C CE1   . TYR B 1 124 ? 10.864  -7.019  -41.390 1.00 46.69  ? 124 TYR B CE1   1 
ATOM   5140 C CE2   . TYR B 1 124 ? 11.789  -5.302  -40.013 1.00 47.49  ? 124 TYR B CE2   1 
ATOM   5141 C CZ    . TYR B 1 124 ? 10.898  -6.330  -40.191 1.00 47.05  ? 124 TYR B CZ    1 
ATOM   5142 O OH    . TYR B 1 124 ? 10.038  -6.661  -39.175 1.00 49.44  ? 124 TYR B OH    1 
ATOM   5143 N N     . SER B 1 125 ? 10.601  -4.049  -44.936 1.00 45.48  ? 125 SER B N     1 
ATOM   5144 C CA    . SER B 1 125 ? 9.259   -4.556  -45.175 1.00 43.31  ? 125 SER B CA    1 
ATOM   5145 C C     . SER B 1 125 ? 8.325   -3.365  -45.278 1.00 45.04  ? 125 SER B C     1 
ATOM   5146 O O     . SER B 1 125 ? 8.732   -2.217  -45.089 1.00 46.02  ? 125 SER B O     1 
ATOM   5147 C CB    . SER B 1 125 ? 8.806   -5.500  -44.059 1.00 46.15  ? 125 SER B CB    1 
ATOM   5148 O OG    . SER B 1 125 ? 8.662   -4.798  -42.827 1.00 48.76  ? 125 SER B OG    1 
ATOM   5149 N N     . GLY B 1 126 ? 7.060   -3.656  -45.540 1.00 47.28  ? 126 GLY B N     1 
ATOM   5150 C CA    . GLY B 1 126 ? 6.029   -2.658  -45.705 1.00 45.58  ? 126 GLY B CA    1 
ATOM   5151 C C     . GLY B 1 126 ? 5.604   -2.522  -47.155 1.00 45.30  ? 126 GLY B C     1 
ATOM   5152 O O     . GLY B 1 126 ? 6.307   -2.926  -48.087 1.00 47.97  ? 126 GLY B O     1 
ATOM   5153 N N     . ALA B 1 127 ? 4.423   -1.936  -47.339 1.00 45.39  ? 127 ALA B N     1 
ATOM   5154 C CA    . ALA B 1 127 ? 3.839   -1.745  -48.662 1.00 47.15  ? 127 ALA B CA    1 
ATOM   5155 C C     . ALA B 1 127 ? 2.794   -0.650  -48.572 1.00 46.51  ? 127 ALA B C     1 
ATOM   5156 O O     . ALA B 1 127 ? 2.150   -0.484  -47.533 1.00 45.39  ? 127 ALA B O     1 
ATOM   5157 C CB    . ALA B 1 127 ? 3.192   -3.027  -49.182 1.00 40.71  ? 127 ALA B CB    1 
ATOM   5158 N N     . ALA B 1 128 ? 2.606   0.078   -49.667 1.00 41.85  ? 128 ALA B N     1 
ATOM   5159 C CA    . ALA B 1 128 ? 1.657   1.179   -49.621 1.00 40.53  ? 128 ALA B CA    1 
ATOM   5160 C C     . ALA B 1 128 ? 0.233   0.720   -49.772 1.00 41.77  ? 128 ALA B C     1 
ATOM   5161 O O     . ALA B 1 128 ? -0.658  1.568   -49.852 1.00 46.78  ? 128 ALA B O     1 
ATOM   5162 C CB    . ALA B 1 128 ? 1.975   2.224   -50.687 1.00 39.22  ? 128 ALA B CB    1 
ATOM   5163 N N     . SER B 1 129 ? -0.005  -0.589  -49.769 1.00 44.52  ? 129 SER B N     1 
ATOM   5164 C CA    . SER B 1 129 ? -1.297  -1.149  -50.145 1.00 44.63  ? 129 SER B CA    1 
ATOM   5165 C C     . SER B 1 129 ? -2.033  -1.822  -48.995 1.00 48.17  ? 129 SER B C     1 
ATOM   5166 O O     . SER B 1 129 ? -3.142  -2.336  -49.213 1.00 45.67  ? 129 SER B O     1 
ATOM   5167 C CB    . SER B 1 129 ? -1.128  -2.154  -51.298 1.00 45.24  ? 129 SER B CB    1 
ATOM   5168 O OG    . SER B 1 129 ? -0.262  -3.233  -50.989 1.00 43.97  ? 129 SER B OG    1 
ATOM   5169 N N     . LEU B 1 130 ? -1.450  -1.852  -47.792 1.00 39.70  ? 130 LEU B N     1 
ATOM   5170 C CA    . LEU B 1 130 ? -2.140  -2.445  -46.657 1.00 41.71  ? 130 LEU B CA    1 
ATOM   5171 C C     . LEU B 1 130 ? -3.411  -1.658  -46.361 1.00 41.32  ? 130 LEU B C     1 
ATOM   5172 O O     . LEU B 1 130 ? -3.513  -0.468  -46.665 1.00 43.21  ? 130 LEU B O     1 
ATOM   5173 C CB    . LEU B 1 130 ? -1.230  -2.474  -45.418 1.00 47.41  ? 130 LEU B CB    1 
ATOM   5174 C CG    . LEU B 1 130 ? 0.217   -2.925  -45.647 1.00 48.18  ? 130 LEU B CG    1 
ATOM   5175 C CD1   . LEU B 1 130 ? 1.018   -2.978  -44.368 1.00 41.61  ? 130 LEU B CD1   1 
ATOM   5176 C CD2   . LEU B 1 130 ? 0.243   -4.280  -46.326 1.00 48.53  ? 130 LEU B CD2   1 
ATOM   5177 N N     . ASP B 1 131 ? -4.394  -2.334  -45.767 1.00 44.95  ? 131 ASP B N     1 
ATOM   5178 C CA    . ASP B 1 131 ? -5.666  -1.673  -45.492 1.00 44.92  ? 131 ASP B CA    1 
ATOM   5179 C C     . ASP B 1 131 ? -5.496  -0.500  -44.540 1.00 48.02  ? 131 ASP B C     1 
ATOM   5180 O O     . ASP B 1 131 ? -6.175  0.519   -44.691 1.00 49.92  ? 131 ASP B O     1 
ATOM   5181 C CB    . ASP B 1 131 ? -6.680  -2.651  -44.912 1.00 46.92  ? 131 ASP B CB    1 
ATOM   5182 C CG    . ASP B 1 131 ? -6.804  -3.900  -45.724 1.00 54.69  ? 131 ASP B CG    1 
ATOM   5183 O OD1   . ASP B 1 131 ? -6.590  -3.855  -46.963 1.00 57.75  ? 131 ASP B OD1   1 
ATOM   5184 O OD2   . ASP B 1 131 ? -7.109  -4.937  -45.105 1.00 59.78  ? 131 ASP B OD2   1 
ATOM   5185 N N     . VAL B 1 132 ? -4.602  -0.616  -43.550 1.00 44.34  ? 132 VAL B N     1 
ATOM   5186 C CA    . VAL B 1 132 ? -4.428  0.475   -42.597 1.00 46.95  ? 132 VAL B CA    1 
ATOM   5187 C C     . VAL B 1 132 ? -3.910  1.751   -43.242 1.00 47.63  ? 132 VAL B C     1 
ATOM   5188 O O     . VAL B 1 132 ? -3.860  2.788   -42.566 1.00 47.82  ? 132 VAL B O     1 
ATOM   5189 C CB    . VAL B 1 132 ? -3.488  0.097   -41.434 1.00 41.22  ? 132 VAL B CB    1 
ATOM   5190 C CG1   . VAL B 1 132 ? -4.242  -0.708  -40.390 1.00 43.77  ? 132 VAL B CG1   1 
ATOM   5191 C CG2   . VAL B 1 132 ? -2.284  -0.651  -41.947 1.00 43.47  ? 132 VAL B CG2   1 
ATOM   5192 N N     . TYR B 1 133 ? -3.526  1.704   -44.526 1.00 43.28  ? 133 TYR B N     1 
ATOM   5193 C CA    . TYR B 1 133 ? -3.073  2.880   -45.265 1.00 44.28  ? 133 TYR B CA    1 
ATOM   5194 C C     . TYR B 1 133 ? -4.082  3.320   -46.325 1.00 46.31  ? 133 TYR B C     1 
ATOM   5195 O O     . TYR B 1 133 ? -3.730  4.055   -47.255 1.00 47.27  ? 133 TYR B O     1 
ATOM   5196 C CB    . TYR B 1 133 ? -1.712  2.625   -45.914 1.00 41.35  ? 133 TYR B CB    1 
ATOM   5197 C CG    . TYR B 1 133 ? -0.664  2.079   -44.979 1.00 40.77  ? 133 TYR B CG    1 
ATOM   5198 C CD1   . TYR B 1 133 ? -0.765  2.239   -43.599 1.00 42.36  ? 133 TYR B CD1   1 
ATOM   5199 C CD2   . TYR B 1 133 ? 0.436   1.422   -45.477 1.00 40.92  ? 133 TYR B CD2   1 
ATOM   5200 C CE1   . TYR B 1 133 ? 0.193   1.735   -42.751 1.00 41.51  ? 133 TYR B CE1   1 
ATOM   5201 C CE2   . TYR B 1 133 ? 1.394   0.917   -44.648 1.00 43.58  ? 133 TYR B CE2   1 
ATOM   5202 C CZ    . TYR B 1 133 ? 1.276   1.073   -43.282 1.00 44.64  ? 133 TYR B CZ    1 
ATOM   5203 O OH    . TYR B 1 133 ? 2.254   0.554   -42.469 1.00 41.33  ? 133 TYR B OH    1 
ATOM   5204 N N     . ASP B 1 134 ? -5.327  2.880   -46.204 1.00 47.06  ? 134 ASP B N     1 
ATOM   5205 C CA    . ASP B 1 134 ? -6.355  3.235   -47.168 1.00 45.61  ? 134 ASP B CA    1 
ATOM   5206 C C     . ASP B 1 134 ? -6.593  4.739   -47.157 1.00 48.05  ? 134 ASP B C     1 
ATOM   5207 O O     . ASP B 1 134 ? -7.039  5.305   -46.150 1.00 48.28  ? 134 ASP B O     1 
ATOM   5208 C CB    . ASP B 1 134 ? -7.636  2.471   -46.837 1.00 49.93  ? 134 ASP B CB    1 
ATOM   5209 C CG    . ASP B 1 134 ? -8.712  2.629   -47.893 1.00 52.37  ? 134 ASP B CG    1 
ATOM   5210 O OD1   . ASP B 1 134 ? -8.639  3.574   -48.703 1.00 53.92  ? 134 ASP B OD1   1 
ATOM   5211 O OD2   . ASP B 1 134 ? -9.651  1.807   -47.901 1.00 53.35  ? 134 ASP B OD2   1 
ATOM   5212 N N     . GLY B 1 135 ? -6.317  5.382   -48.292 1.00 47.33  ? 135 GLY B N     1 
ATOM   5213 C CA    . GLY B 1 135 ? -6.479  6.815   -48.442 1.00 46.61  ? 135 GLY B CA    1 
ATOM   5214 C C     . GLY B 1 135 ? -7.885  7.326   -48.676 1.00 47.42  ? 135 GLY B C     1 
ATOM   5215 O O     . GLY B 1 135 ? -8.072  8.543   -48.707 1.00 49.06  ? 135 GLY B O     1 
ATOM   5216 N N     . ARG B 1 136 ? -8.890  6.455   -48.821 1.00 48.81  ? 136 ARG B N     1 
ATOM   5217 C CA    . ARG B 1 136 ? -10.219 6.932   -49.209 1.00 49.99  ? 136 ARG B CA    1 
ATOM   5218 C C     . ARG B 1 136 ? -10.854 7.787   -48.119 1.00 54.53  ? 136 ARG B C     1 
ATOM   5219 O O     . ARG B 1 136 ? -11.552 8.768   -48.424 1.00 52.90  ? 136 ARG B O     1 
ATOM   5220 C CB    . ARG B 1 136 ? -11.136 5.757   -49.558 1.00 46.68  ? 136 ARG B CB    1 
ATOM   5221 C CG    . ARG B 1 136 ? -11.574 4.913   -48.373 1.00 55.05  ? 136 ARG B CG    1 
ATOM   5222 C CD    . ARG B 1 136 ? -12.522 3.816   -48.794 1.00 54.48  ? 136 ARG B CD    1 
ATOM   5223 N NE    . ARG B 1 136 ? -11.832 2.807   -49.587 1.00 59.36  ? 136 ARG B NE    1 
ATOM   5224 C CZ    . ARG B 1 136 ? -12.437 1.845   -50.279 1.00 63.30  ? 136 ARG B CZ    1 
ATOM   5225 N NH1   . ARG B 1 136 ? -13.760 1.747   -50.289 1.00 65.00  ? 136 ARG B NH1   1 
ATOM   5226 N NH2   . ARG B 1 136 ? -11.715 0.976   -50.967 1.00 64.43  ? 136 ARG B NH2   1 
ATOM   5227 N N     . PHE B 1 137 ? -10.631 7.436   -46.846 1.00 49.84  ? 137 PHE B N     1 
ATOM   5228 C CA    . PHE B 1 137 ? -11.297 8.156   -45.769 1.00 48.55  ? 137 PHE B CA    1 
ATOM   5229 C C     . PHE B 1 137 ? -10.779 9.580   -45.672 1.00 51.27  ? 137 PHE B C     1 
ATOM   5230 O O     . PHE B 1 137 ? -11.561 10.535  -45.585 1.00 49.99  ? 137 PHE B O     1 
ATOM   5231 C CB    . PHE B 1 137 ? -11.114 7.413   -44.457 1.00 51.50  ? 137 PHE B CB    1 
ATOM   5232 C CG    . PHE B 1 137 ? -11.629 6.023   -44.498 1.00 53.74  ? 137 PHE B CG    1 
ATOM   5233 C CD1   . PHE B 1 137 ? -12.985 5.773   -44.355 1.00 56.32  ? 137 PHE B CD1   1 
ATOM   5234 C CD2   . PHE B 1 137 ? -10.770 4.961   -44.709 1.00 54.68  ? 137 PHE B CD2   1 
ATOM   5235 C CE1   . PHE B 1 137 ? -13.475 4.478   -44.401 1.00 59.22  ? 137 PHE B CE1   1 
ATOM   5236 C CE2   . PHE B 1 137 ? -11.253 3.658   -44.764 1.00 53.80  ? 137 PHE B CE2   1 
ATOM   5237 C CZ    . PHE B 1 137 ? -12.605 3.416   -44.611 1.00 56.03  ? 137 PHE B CZ    1 
ATOM   5238 N N     . LEU B 1 138 ? -9.461  9.748   -45.725 1.00 49.58  ? 138 LEU B N     1 
ATOM   5239 C CA    . LEU B 1 138 ? -8.926  11.098  -45.650 1.00 48.32  ? 138 LEU B CA    1 
ATOM   5240 C C     . LEU B 1 138 ? -9.325  11.922  -46.866 1.00 52.54  ? 138 LEU B C     1 
ATOM   5241 O O     . LEU B 1 138 ? -9.519  13.133  -46.745 1.00 56.67  ? 138 LEU B O     1 
ATOM   5242 C CB    . LEU B 1 138 ? -7.406  11.052  -45.491 1.00 52.46  ? 138 LEU B CB    1 
ATOM   5243 C CG    . LEU B 1 138 ? -6.895  10.681  -44.099 1.00 47.04  ? 138 LEU B CG    1 
ATOM   5244 C CD1   . LEU B 1 138 ? -5.409  10.441  -44.073 1.00 42.93  ? 138 LEU B CD1   1 
ATOM   5245 C CD2   . LEU B 1 138 ? -7.224  11.796  -43.194 1.00 46.30  ? 138 LEU B CD2   1 
ATOM   5246 N N     . ALA B 1 139 ? -9.478  11.290  -48.036 1.00 55.46  ? 139 ALA B N     1 
ATOM   5247 C CA    . ALA B 1 139 ? -9.859  12.033  -49.238 1.00 55.20  ? 139 ALA B CA    1 
ATOM   5248 C C     . ALA B 1 139 ? -11.349 12.363  -49.252 1.00 53.61  ? 139 ALA B C     1 
ATOM   5249 O O     . ALA B 1 139 ? -11.734 13.474  -49.629 1.00 51.06  ? 139 ALA B O     1 
ATOM   5250 C CB    . ALA B 1 139 ? -9.467  11.252  -50.496 1.00 51.33  ? 139 ALA B CB    1 
ATOM   5251 N N     . GLN B 1 140 ? -12.202 11.428  -48.827 1.00 50.58  ? 140 GLN B N     1 
ATOM   5252 C CA    . GLN B 1 140 ? -13.632 11.719  -48.783 1.00 53.08  ? 140 GLN B CA    1 
ATOM   5253 C C     . GLN B 1 140 ? -13.997 12.671  -47.643 1.00 58.59  ? 140 GLN B C     1 
ATOM   5254 O O     . GLN B 1 140 ? -14.800 13.591  -47.834 1.00 58.55  ? 140 GLN B O     1 
ATOM   5255 C CB    . GLN B 1 140 ? -14.425 10.425  -48.650 1.00 57.82  ? 140 GLN B CB    1 
ATOM   5256 C CG    . GLN B 1 140 ? -15.870 10.539  -49.134 1.00 63.85  ? 140 GLN B CG    1 
ATOM   5257 C CD    . GLN B 1 140 ? -16.805 11.181  -48.120 1.00 65.53  ? 140 GLN B CD    1 
ATOM   5258 O OE1   . GLN B 1 140 ? -16.953 10.706  -46.984 1.00 65.80  ? 140 GLN B OE1   1 
ATOM   5259 N NE2   . GLN B 1 140 ? -17.453 12.260  -48.533 1.00 65.02  ? 140 GLN B NE2   1 
ATOM   5260 N N     . VAL B 1 141 ? -13.443 12.466  -46.445 1.00 53.80  ? 141 VAL B N     1 
ATOM   5261 C CA    . VAL B 1 141 ? -13.933 13.206  -45.287 1.00 54.69  ? 141 VAL B CA    1 
ATOM   5262 C C     . VAL B 1 141 ? -13.290 14.587  -45.196 1.00 56.24  ? 141 VAL B C     1 
ATOM   5263 O O     . VAL B 1 141 ? -13.979 15.588  -44.974 1.00 58.21  ? 141 VAL B O     1 
ATOM   5264 C CB    . VAL B 1 141 ? -13.714 12.390  -44.003 1.00 57.83  ? 141 VAL B CB    1 
ATOM   5265 C CG1   . VAL B 1 141 ? -13.862 13.276  -42.793 1.00 50.37  ? 141 VAL B CG1   1 
ATOM   5266 C CG2   . VAL B 1 141 ? -14.682 11.221  -43.950 1.00 51.71  ? 141 VAL B CG2   1 
ATOM   5267 N N     . GLU B 1 142 ? -11.971 14.672  -45.349 1.00 52.83  ? 142 GLU B N     1 
ATOM   5268 C CA    . GLU B 1 142 ? -11.276 15.951  -45.276 1.00 52.69  ? 142 GLU B CA    1 
ATOM   5269 C C     . GLU B 1 142 ? -10.965 16.555  -46.644 1.00 55.92  ? 142 GLU B C     1 
ATOM   5270 O O     . GLU B 1 142 ? -10.379 17.642  -46.711 1.00 58.97  ? 142 GLU B O     1 
ATOM   5271 C CB    . GLU B 1 142 ? -9.987  15.795  -44.476 1.00 51.29  ? 142 GLU B CB    1 
ATOM   5272 C CG    . GLU B 1 142 ? -10.226 15.416  -43.042 1.00 56.16  ? 142 GLU B CG    1 
ATOM   5273 C CD    . GLU B 1 142 ? -10.858 16.555  -42.231 1.00 63.93  ? 142 GLU B CD    1 
ATOM   5274 O OE1   . GLU B 1 142 ? -10.741 17.733  -42.657 1.00 63.95  ? 142 GLU B OE1   1 
ATOM   5275 O OE2   . GLU B 1 142 ? -11.463 16.271  -41.166 1.00 60.31  ? 142 GLU B OE2   1 
ATOM   5276 N N     . GLY B 1 143 ? -11.340 15.890  -47.730 1.00 53.07  ? 143 GLY B N     1 
ATOM   5277 C CA    . GLY B 1 143 ? -11.076 16.431  -49.049 1.00 55.77  ? 143 GLY B CA    1 
ATOM   5278 C C     . GLY B 1 143 ? -9.608  16.602  -49.362 1.00 59.29  ? 143 GLY B C     1 
ATOM   5279 O O     . GLY B 1 143 ? -9.234  17.562  -50.046 1.00 61.00  ? 143 GLY B O     1 
ATOM   5280 N N     . ALA B 1 144 ? -8.761  15.699  -48.875 1.00 57.24  ? 144 ALA B N     1 
ATOM   5281 C CA    . ALA B 1 144 ? -7.327  15.780  -49.108 1.00 55.04  ? 144 ALA B CA    1 
ATOM   5282 C C     . ALA B 1 144 ? -6.942  15.000  -50.355 1.00 51.55  ? 144 ALA B C     1 
ATOM   5283 O O     . ALA B 1 144 ? -7.618  14.047  -50.747 1.00 52.99  ? 144 ALA B O     1 
ATOM   5284 C CB    . ALA B 1 144 ? -6.554  15.228  -47.910 1.00 49.22  ? 144 ALA B CB    1 
ATOM   5285 N N     . VAL B 1 145 ? -5.846  15.402  -50.974 1.00 46.33  ? 145 VAL B N     1 
ATOM   5286 C CA    . VAL B 1 145 ? -5.163  14.518  -51.901 1.00 48.51  ? 145 VAL B CA    1 
ATOM   5287 C C     . VAL B 1 145 ? -4.072  13.797  -51.129 1.00 48.44  ? 145 VAL B C     1 
ATOM   5288 O O     . VAL B 1 145 ? -3.222  14.425  -50.486 1.00 47.57  ? 145 VAL B O     1 
ATOM   5289 C CB    . VAL B 1 145 ? -4.598  15.276  -53.111 1.00 48.73  ? 145 VAL B CB    1 
ATOM   5290 C CG1   . VAL B 1 145 ? -3.798  14.311  -54.001 1.00 41.51  ? 145 VAL B CG1   1 
ATOM   5291 C CG2   . VAL B 1 145 ? -5.742  15.901  -53.905 1.00 52.77  ? 145 VAL B CG2   1 
ATOM   5292 N N     . LEU B 1 146 ? -4.106  12.476  -51.194 1.00 47.62  ? 146 LEU B N     1 
ATOM   5293 C CA    . LEU B 1 146 ? -3.257  11.608  -50.407 1.00 44.84  ? 146 LEU B CA    1 
ATOM   5294 C C     . LEU B 1 146 ? -2.487  10.676  -51.328 1.00 48.82  ? 146 LEU B C     1 
ATOM   5295 O O     . LEU B 1 146 ? -3.086  9.972   -52.153 1.00 51.91  ? 146 LEU B O     1 
ATOM   5296 C CB    . LEU B 1 146 ? -4.100  10.807  -49.426 1.00 46.98  ? 146 LEU B CB    1 
ATOM   5297 C CG    . LEU B 1 146 ? -3.234  10.059  -48.433 1.00 49.71  ? 146 LEU B CG    1 
ATOM   5298 C CD1   . LEU B 1 146 ? -3.863  10.202  -47.095 1.00 48.24  ? 146 LEU B CD1   1 
ATOM   5299 C CD2   . LEU B 1 146 ? -3.099  8.594   -48.833 1.00 45.96  ? 146 LEU B CD2   1 
ATOM   5300 N N     . VAL B 1 147 ? -1.169  10.648  -51.166 1.00 45.94  ? 147 VAL B N     1 
ATOM   5301 C CA    . VAL B 1 147 ? -0.280  9.893   -52.038 1.00 46.62  ? 147 VAL B CA    1 
ATOM   5302 C C     . VAL B 1 147 ? 0.547   8.940   -51.191 1.00 47.90  ? 147 VAL B C     1 
ATOM   5303 O O     . VAL B 1 147 ? 1.196   9.375   -50.237 1.00 50.10  ? 147 VAL B O     1 
ATOM   5304 C CB    . VAL B 1 147 ? 0.641   10.837  -52.826 1.00 45.24  ? 147 VAL B CB    1 
ATOM   5305 C CG1   . VAL B 1 147 ? 1.671   10.048  -53.588 1.00 43.99  ? 147 VAL B CG1   1 
ATOM   5306 C CG2   . VAL B 1 147 ? -0.178  11.718  -53.735 1.00 43.20  ? 147 VAL B CG2   1 
ATOM   5307 N N     . SER B 1 148 ? 0.545   7.650   -51.537 1.00 46.62  ? 148 SER B N     1 
ATOM   5308 C CA    . SER B 1 148 ? 1.503   6.712   -50.958 1.00 44.06  ? 148 SER B CA    1 
ATOM   5309 C C     . SER B 1 148 ? 2.298   6.039   -52.068 1.00 44.52  ? 148 SER B C     1 
ATOM   5310 O O     . SER B 1 148 ? 1.760   5.768   -53.139 1.00 48.08  ? 148 SER B O     1 
ATOM   5311 C CB    . SER B 1 148 ? 0.832   5.653   -50.064 1.00 43.52  ? 148 SER B CB    1 
ATOM   5312 O OG    . SER B 1 148 ? -0.238  4.971   -50.678 1.00 43.36  ? 148 SER B OG    1 
ATOM   5313 N N     . MET B 1 149 ? 3.587   5.796   -51.818 1.00 43.95  ? 149 MET B N     1 
ATOM   5314 C CA    . MET B 1 149 ? 4.479   5.129   -52.760 1.00 41.27  ? 149 MET B CA    1 
ATOM   5315 C C     . MET B 1 149 ? 5.113   3.907   -52.116 1.00 42.84  ? 149 MET B C     1 
ATOM   5316 O O     . MET B 1 149 ? 5.328   3.865   -50.903 1.00 45.88  ? 149 MET B O     1 
ATOM   5317 C CB    . MET B 1 149 ? 5.615   6.049   -53.239 1.00 39.91  ? 149 MET B CB    1 
ATOM   5318 C CG    . MET B 1 149 ? 6.858   6.061   -52.325 1.00 45.55  ? 149 MET B CG    1 
ATOM   5319 S SD    . MET B 1 149 ? 6.596   6.798   -50.681 1.00 40.35  ? 149 MET B SD    1 
ATOM   5320 C CE    . MET B 1 149 ? 6.618   8.536   -51.108 1.00 29.58  ? 149 MET B CE    1 
ATOM   5321 N N     . ASN B 1 150 ? 5.426   2.914   -52.936 1.00 42.01  ? 150 ASN B N     1 
ATOM   5322 C CA    . ASN B 1 150 ? 6.319   1.864   -52.487 1.00 39.28  ? 150 ASN B CA    1 
ATOM   5323 C C     . ASN B 1 150 ? 7.752   2.335   -52.647 1.00 40.73  ? 150 ASN B C     1 
ATOM   5324 O O     . ASN B 1 150 ? 8.052   3.197   -53.470 1.00 42.49  ? 150 ASN B O     1 
ATOM   5325 C CB    . ASN B 1 150 ? 6.098   0.572   -53.269 1.00 39.74  ? 150 ASN B CB    1 
ATOM   5326 C CG    . ASN B 1 150 ? 4.758   -0.049  -52.972 1.00 46.29  ? 150 ASN B CG    1 
ATOM   5327 O OD1   . ASN B 1 150 ? 4.046   0.414   -52.090 1.00 49.20  ? 150 ASN B OD1   1 
ATOM   5328 N ND2   . ASN B 1 150 ? 4.408   -1.105  -53.692 1.00 45.98  ? 150 ASN B ND2   1 
ATOM   5329 N N     . TYR B 1 151 ? 8.633   1.798   -51.818 1.00 40.69  ? 151 TYR B N     1 
ATOM   5330 C CA    . TYR B 1 151 ? 10.057  2.029   -51.976 1.00 39.68  ? 151 TYR B CA    1 
ATOM   5331 C C     . TYR B 1 151 ? 10.750  0.721   -51.644 1.00 41.24  ? 151 TYR B C     1 
ATOM   5332 O O     . TYR B 1 151 ? 10.200  -0.120  -50.924 1.00 38.80  ? 151 TYR B O     1 
ATOM   5333 C CB    . TYR B 1 151 ? 10.575  3.196   -51.104 1.00 40.74  ? 151 TYR B CB    1 
ATOM   5334 C CG    . TYR B 1 151 ? 10.308  3.022   -49.637 1.00 42.25  ? 151 TYR B CG    1 
ATOM   5335 C CD1   . TYR B 1 151 ? 9.096   3.395   -49.082 1.00 42.76  ? 151 TYR B CD1   1 
ATOM   5336 C CD2   . TYR B 1 151 ? 11.260  2.452   -48.811 1.00 41.87  ? 151 TYR B CD2   1 
ATOM   5337 C CE1   . TYR B 1 151 ? 8.853   3.221   -47.744 1.00 43.45  ? 151 TYR B CE1   1 
ATOM   5338 C CE2   . TYR B 1 151 ? 11.025  2.280   -47.482 1.00 43.41  ? 151 TYR B CE2   1 
ATOM   5339 C CZ    . TYR B 1 151 ? 9.825   2.659   -46.947 1.00 43.66  ? 151 TYR B CZ    1 
ATOM   5340 O OH    . TYR B 1 151 ? 9.622   2.460   -45.599 1.00 43.98  ? 151 TYR B OH    1 
ATOM   5341 N N     . ARG B 1 152 ? 11.929  0.527   -52.231 1.00 41.53  ? 152 ARG B N     1 
ATOM   5342 C CA    . ARG B 1 152 ? 12.647  -0.722  -52.038 1.00 43.18  ? 152 ARG B CA    1 
ATOM   5343 C C     . ARG B 1 152 ? 13.091  -0.848  -50.578 1.00 40.17  ? 152 ARG B C     1 
ATOM   5344 O O     . ARG B 1 152 ? 13.679  0.073   -50.006 1.00 39.67  ? 152 ARG B O     1 
ATOM   5345 C CB    . ARG B 1 152 ? 13.837  -0.797  -53.001 1.00 39.27  ? 152 ARG B CB    1 
ATOM   5346 C CG    . ARG B 1 152 ? 13.499  -1.386  -54.367 1.00 42.46  ? 152 ARG B CG    1 
ATOM   5347 C CD    . ARG B 1 152 ? 14.636  -1.207  -55.369 1.00 37.01  ? 152 ARG B CD    1 
ATOM   5348 N NE    . ARG B 1 152 ? 14.828  0.204   -55.655 1.00 33.95  ? 152 ARG B NE    1 
ATOM   5349 C CZ    . ARG B 1 152 ? 15.913  0.704   -56.220 1.00 34.57  ? 152 ARG B CZ    1 
ATOM   5350 N NH1   . ARG B 1 152 ? 16.898  -0.108  -56.564 1.00 37.95  ? 152 ARG B NH1   1 
ATOM   5351 N NH2   . ARG B 1 152 ? 16.006  2.007   -56.440 1.00 35.00  ? 152 ARG B NH2   1 
ATOM   5352 N N     . VAL B 1 153 ? 12.778  -1.983  -49.970 1.00 38.34  ? 153 VAL B N     1 
ATOM   5353 C CA    . VAL B 1 153 ? 13.176  -2.263  -48.600 1.00 40.59  ? 153 VAL B CA    1 
ATOM   5354 C C     . VAL B 1 153 ? 14.294  -3.293  -48.617 1.00 43.67  ? 153 VAL B C     1 
ATOM   5355 O O     . VAL B 1 153 ? 14.735  -3.713  -49.692 1.00 46.14  ? 153 VAL B O     1 
ATOM   5356 C CB    . VAL B 1 153 ? 11.975  -2.751  -47.780 1.00 43.19  ? 153 VAL B CB    1 
ATOM   5357 C CG1   . VAL B 1 153 ? 10.941  -1.641  -47.682 1.00 41.44  ? 153 VAL B CG1   1 
ATOM   5358 C CG2   . VAL B 1 153 ? 11.380  -3.988  -48.419 1.00 39.55  ? 153 VAL B CG2   1 
ATOM   5359 N N     . GLY B 1 154 ? 14.758  -3.705  -47.436 1.00 46.97  ? 154 GLY B N     1 
ATOM   5360 C CA    . GLY B 1 154 ? 15.785  -4.721  -47.223 1.00 43.62  ? 154 GLY B CA    1 
ATOM   5361 C C     . GLY B 1 154 ? 17.016  -4.498  -48.080 1.00 45.82  ? 154 GLY B C     1 
ATOM   5362 O O     . GLY B 1 154 ? 17.391  -3.363  -48.404 1.00 46.76  ? 154 GLY B O     1 
ATOM   5363 N N     . THR B 1 155 ? 17.652  -5.610  -48.471 1.00 50.22  ? 155 THR B N     1 
ATOM   5364 C CA    . THR B 1 155 ? 18.835  -5.557  -49.336 1.00 49.87  ? 155 THR B CA    1 
ATOM   5365 C C     . THR B 1 155 ? 18.600  -4.765  -50.622 1.00 46.69  ? 155 THR B C     1 
ATOM   5366 O O     . THR B 1 155 ? 19.534  -4.164  -51.160 1.00 48.30  ? 155 THR B O     1 
ATOM   5367 C CB    . THR B 1 155 ? 19.275  -6.974  -49.693 1.00 51.33  ? 155 THR B CB    1 
ATOM   5368 O OG1   . THR B 1 155 ? 18.114  -7.735  -50.032 1.00 55.02  ? 155 THR B OG1   1 
ATOM   5369 C CG2   . THR B 1 155 ? 19.970  -7.642  -48.516 1.00 49.66  ? 155 THR B CG2   1 
ATOM   5370 N N     . PHE B 1 156 ? 17.368  -4.732  -51.125 1.00 43.52  ? 156 PHE B N     1 
ATOM   5371 C CA    . PHE B 1 156 ? 17.135  -4.057  -52.399 1.00 44.10  ? 156 PHE B CA    1 
ATOM   5372 C C     . PHE B 1 156 ? 17.155  -2.542  -52.247 1.00 43.30  ? 156 PHE B C     1 
ATOM   5373 O O     . PHE B 1 156 ? 17.654  -1.837  -53.129 1.00 50.15  ? 156 PHE B O     1 
ATOM   5374 C CB    . PHE B 1 156 ? 15.823  -4.553  -53.011 1.00 42.97  ? 156 PHE B CB    1 
ATOM   5375 C CG    . PHE B 1 156 ? 15.730  -6.056  -53.046 1.00 46.89  ? 156 PHE B CG    1 
ATOM   5376 C CD1   . PHE B 1 156 ? 16.459  -6.788  -53.993 1.00 42.57  ? 156 PHE B CD1   1 
ATOM   5377 C CD2   . PHE B 1 156 ? 14.978  -6.745  -52.095 1.00 45.71  ? 156 PHE B CD2   1 
ATOM   5378 C CE1   . PHE B 1 156 ? 16.416  -8.174  -54.006 1.00 44.57  ? 156 PHE B CE1   1 
ATOM   5379 C CE2   . PHE B 1 156 ? 14.921  -8.149  -52.113 1.00 45.34  ? 156 PHE B CE2   1 
ATOM   5380 C CZ    . PHE B 1 156 ? 15.644  -8.857  -53.059 1.00 47.67  ? 156 PHE B CZ    1 
ATOM   5381 N N     . GLY B 1 157 ? 16.636  -2.020  -51.139 1.00 45.31  ? 157 GLY B N     1 
ATOM   5382 C CA    . GLY B 1 157 ? 16.658  -0.585  -50.908 1.00 42.59  ? 157 GLY B CA    1 
ATOM   5383 C C     . GLY B 1 157 ? 17.935  -0.045  -50.285 1.00 41.86  ? 157 GLY B C     1 
ATOM   5384 O O     . GLY B 1 157 ? 18.320  1.108   -50.529 1.00 38.75  ? 157 GLY B O     1 
ATOM   5385 N N     . PHE B 1 158 ? 18.618  -0.867  -49.484 1.00 42.13  ? 158 PHE B N     1 
ATOM   5386 C CA    . PHE B 1 158 ? 19.600  -0.301  -48.569 1.00 46.76  ? 158 PHE B CA    1 
ATOM   5387 C C     . PHE B 1 158 ? 20.924  -1.044  -48.462 1.00 47.69  ? 158 PHE B C     1 
ATOM   5388 O O     . PHE B 1 158 ? 21.819  -0.545  -47.773 1.00 44.62  ? 158 PHE B O     1 
ATOM   5389 C CB    . PHE B 1 158 ? 18.958  -0.136  -47.179 1.00 39.49  ? 158 PHE B CB    1 
ATOM   5390 C CG    . PHE B 1 158 ? 17.791  0.792   -47.199 1.00 36.31  ? 158 PHE B CG    1 
ATOM   5391 C CD1   . PHE B 1 158 ? 17.988  2.147   -47.344 1.00 34.60  ? 158 PHE B CD1   1 
ATOM   5392 C CD2   . PHE B 1 158 ? 16.500  0.304   -47.154 1.00 39.95  ? 158 PHE B CD2   1 
ATOM   5393 C CE1   . PHE B 1 158 ? 16.920  3.002   -47.402 1.00 38.19  ? 158 PHE B CE1   1 
ATOM   5394 C CE2   . PHE B 1 158 ? 15.425  1.155   -47.208 1.00 38.01  ? 158 PHE B CE2   1 
ATOM   5395 C CZ    . PHE B 1 158 ? 15.633  2.504   -47.337 1.00 37.74  ? 158 PHE B CZ    1 
ATOM   5396 N N     . LEU B 1 159 ? 21.105  -2.181  -49.142 1.00 49.19  ? 159 LEU B N     1 
ATOM   5397 C CA    . LEU B 1 159 ? 22.443  -2.758  -49.257 1.00 47.73  ? 159 LEU B CA    1 
ATOM   5398 C C     . LEU B 1 159 ? 23.361  -1.765  -49.955 1.00 47.87  ? 159 LEU B C     1 
ATOM   5399 O O     . LEU B 1 159 ? 23.031  -1.245  -51.027 1.00 51.65  ? 159 LEU B O     1 
ATOM   5400 C CB    . LEU B 1 159 ? 22.419  -4.091  -50.015 1.00 46.31  ? 159 LEU B CB    1 
ATOM   5401 C CG    . LEU B 1 159 ? 23.772  -4.826  -50.011 1.00 49.71  ? 159 LEU B CG    1 
ATOM   5402 C CD1   . LEU B 1 159 ? 23.603  -6.344  -49.918 1.00 50.16  ? 159 LEU B CD1   1 
ATOM   5403 C CD2   . LEU B 1 159 ? 24.692  -4.438  -51.178 1.00 55.15  ? 159 LEU B CD2   1 
ATOM   5404 N N     . ALA B 1 160 ? 24.508  -1.500  -49.335 1.00 49.42  ? 160 ALA B N     1 
ATOM   5405 C CA    . ALA B 1 160 ? 25.427  -0.455  -49.761 1.00 52.23  ? 160 ALA B CA    1 
ATOM   5406 C C     . ALA B 1 160 ? 26.862  -0.926  -49.623 1.00 56.71  ? 160 ALA B C     1 
ATOM   5407 O O     . ALA B 1 160 ? 27.233  -1.550  -48.620 1.00 56.86  ? 160 ALA B O     1 
ATOM   5408 C CB    . ALA B 1 160 ? 25.263  0.823   -48.940 1.00 52.28  ? 160 ALA B CB    1 
ATOM   5409 N N     . LEU B 1 161 ? 27.664  -0.626  -50.646 1.00 57.42  ? 161 LEU B N     1 
ATOM   5410 C CA    . LEU B 1 161 ? 29.119  -0.656  -50.563 1.00 57.35  ? 161 LEU B CA    1 
ATOM   5411 C C     . LEU B 1 161 ? 29.565  0.782   -50.697 1.00 59.05  ? 161 LEU B C     1 
ATOM   5412 O O     . LEU B 1 161 ? 29.766  1.268   -51.817 1.00 59.30  ? 161 LEU B O     1 
ATOM   5413 C CB    . LEU B 1 161 ? 29.739  -1.539  -51.647 1.00 56.12  ? 161 LEU B CB    1 
ATOM   5414 C CG    . LEU B 1 161 ? 29.439  -2.967  -51.201 1.00 60.07  ? 161 LEU B CG    1 
ATOM   5415 C CD1   . LEU B 1 161 ? 28.264  -3.569  -51.958 1.00 60.65  ? 161 LEU B CD1   1 
ATOM   5416 C CD2   . LEU B 1 161 ? 30.677  -3.870  -51.199 1.00 63.52  ? 161 LEU B CD2   1 
ATOM   5417 N N     . PRO B 1 162 ? 29.697  1.521   -49.594 1.00 56.84  ? 162 PRO B N     1 
ATOM   5418 C CA    . PRO B 1 162 ? 29.906  2.966   -49.694 1.00 56.92  ? 162 PRO B CA    1 
ATOM   5419 C C     . PRO B 1 162 ? 31.078  3.287   -50.600 1.00 55.08  ? 162 PRO B C     1 
ATOM   5420 O O     . PRO B 1 162 ? 32.116  2.623   -50.568 1.00 54.49  ? 162 PRO B O     1 
ATOM   5421 C CB    . PRO B 1 162 ? 30.168  3.390   -48.245 1.00 52.31  ? 162 PRO B CB    1 
ATOM   5422 C CG    . PRO B 1 162 ? 29.491  2.345   -47.421 1.00 54.59  ? 162 PRO B CG    1 
ATOM   5423 C CD    . PRO B 1 162 ? 29.665  1.068   -48.190 1.00 58.21  ? 162 PRO B CD    1 
ATOM   5424 N N     . GLY B 1 163 ? 30.881  4.298   -51.442 1.00 57.56  ? 163 GLY B N     1 
ATOM   5425 C CA    . GLY B 1 163 ? 31.841  4.695   -52.436 1.00 56.47  ? 163 GLY B CA    1 
ATOM   5426 C C     . GLY B 1 163 ? 31.704  3.961   -53.747 1.00 57.62  ? 163 GLY B C     1 
ATOM   5427 O O     . GLY B 1 163 ? 32.106  4.495   -54.783 1.00 60.67  ? 163 GLY B O     1 
ATOM   5428 N N     . SER B 1 164 ? 31.157  2.745   -53.729 1.00 58.80  ? 164 SER B N     1 
ATOM   5429 C CA    . SER B 1 164 ? 30.957  2.019   -54.971 1.00 58.45  ? 164 SER B CA    1 
ATOM   5430 C C     . SER B 1 164 ? 29.932  2.737   -55.830 1.00 60.13  ? 164 SER B C     1 
ATOM   5431 O O     . SER B 1 164 ? 29.150  3.566   -55.355 1.00 61.41  ? 164 SER B O     1 
ATOM   5432 C CB    . SER B 1 164 ? 30.473  0.596   -54.724 1.00 56.70  ? 164 SER B CB    1 
ATOM   5433 O OG    . SER B 1 164 ? 29.067  0.581   -54.531 1.00 55.95  ? 164 SER B OG    1 
ATOM   5434 N N     . ARG B 1 165 ? 29.925  2.388   -57.110 1.00 62.84  ? 165 ARG B N     1 
ATOM   5435 C CA    . ARG B 1 165 ? 29.003  2.993   -58.051 1.00 62.84  ? 165 ARG B CA    1 
ATOM   5436 C C     . ARG B 1 165 ? 27.749  2.156   -58.267 1.00 62.16  ? 165 ARG B C     1 
ATOM   5437 O O     . ARG B 1 165 ? 26.693  2.711   -58.583 1.00 59.71  ? 165 ARG B O     1 
ATOM   5438 C CB    . ARG B 1 165 ? 29.729  3.226   -59.380 1.00 64.85  ? 165 ARG B CB    1 
ATOM   5439 C CG    . ARG B 1 165 ? 28.845  3.580   -60.550 1.00 72.74  ? 165 ARG B CG    1 
ATOM   5440 C CD    . ARG B 1 165 ? 29.546  3.324   -61.885 1.00 79.58  ? 165 ARG B CD    1 
ATOM   5441 N NE    . ARG B 1 165 ? 29.189  2.039   -62.471 1.00 84.98  ? 165 ARG B NE    1 
ATOM   5442 C CZ    . ARG B 1 165 ? 28.027  1.804   -63.080 1.00 83.95  ? 165 ARG B CZ    1 
ATOM   5443 N NH1   . ARG B 1 165 ? 27.099  2.753   -63.162 1.00 79.36  ? 165 ARG B NH1   1 
ATOM   5444 N NH2   . ARG B 1 165 ? 27.779  0.612   -63.602 1.00 81.12  ? 165 ARG B NH2   1 
ATOM   5445 N N     . GLU B 1 166 ? 27.832  0.838   -58.077 1.00 58.68  ? 166 GLU B N     1 
ATOM   5446 C CA    . GLU B 1 166 ? 26.716  -0.060  -58.346 1.00 62.01  ? 166 GLU B CA    1 
ATOM   5447 C C     . GLU B 1 166 ? 26.061  -0.560  -57.067 1.00 60.61  ? 166 GLU B C     1 
ATOM   5448 O O     . GLU B 1 166 ? 25.387  -1.596  -57.081 1.00 60.75  ? 166 GLU B O     1 
ATOM   5449 C CB    . GLU B 1 166 ? 27.164  -1.239  -59.220 1.00 70.91  ? 166 GLU B CB    1 
ATOM   5450 C CG    . GLU B 1 166 ? 28.513  -1.839  -58.836 1.00 71.38  ? 166 GLU B CG    1 
ATOM   5451 C CD    . GLU B 1 166 ? 29.695  -1.022  -59.337 1.00 74.70  ? 166 GLU B CD    1 
ATOM   5452 O OE1   . GLU B 1 166 ? 29.787  -0.843  -60.579 1.00 75.48  ? 166 GLU B OE1   1 
ATOM   5453 O OE2   . GLU B 1 166 ? 30.503  -0.550  -58.487 1.00 66.00  ? 166 GLU B OE2   1 
ATOM   5454 N N     . ALA B 1 167 ? 26.275  0.149   -55.957 1.00 62.74  ? 167 ALA B N     1 
ATOM   5455 C CA    . ALA B 1 167 ? 25.551  0.011   -54.696 1.00 58.10  ? 167 ALA B CA    1 
ATOM   5456 C C     . ALA B 1 167 ? 25.924  1.186   -53.813 1.00 55.96  ? 167 ALA B C     1 
ATOM   5457 O O     . ALA B 1 167 ? 26.532  0.985   -52.758 1.00 57.40  ? 167 ALA B O     1 
ATOM   5458 C CB    . ALA B 1 167 ? 25.873  -1.296  -53.969 1.00 54.75  ? 167 ALA B CB    1 
ATOM   5459 N N     . PRO B 1 168 ? 25.588  2.420   -54.204 1.00 54.60  ? 168 PRO B N     1 
ATOM   5460 C CA    . PRO B 1 168 ? 26.013  3.584   -53.415 1.00 52.81  ? 168 PRO B CA    1 
ATOM   5461 C C     . PRO B 1 168 ? 25.232  3.768   -52.126 1.00 48.82  ? 168 PRO B C     1 
ATOM   5462 O O     . PRO B 1 168 ? 25.574  4.660   -51.350 1.00 48.81  ? 168 PRO B O     1 
ATOM   5463 C CB    . PRO B 1 168 ? 25.765  4.749   -54.376 1.00 47.04  ? 168 PRO B CB    1 
ATOM   5464 C CG    . PRO B 1 168 ? 24.543  4.324   -55.103 1.00 51.19  ? 168 PRO B CG    1 
ATOM   5465 C CD    . PRO B 1 168 ? 24.640  2.808   -55.261 1.00 51.79  ? 168 PRO B CD    1 
ATOM   5466 N N     . GLY B 1 169 ? 24.199  2.964   -51.885 1.00 50.17  ? 169 GLY B N     1 
ATOM   5467 C CA    . GLY B 1 169 ? 23.396  3.043   -50.685 1.00 44.94  ? 169 GLY B CA    1 
ATOM   5468 C C     . GLY B 1 169 ? 22.224  4.006   -50.802 1.00 47.05  ? 169 GLY B C     1 
ATOM   5469 O O     . GLY B 1 169 ? 22.189  4.907   -51.646 1.00 48.69  ? 169 GLY B O     1 
ATOM   5470 N N     . ASN B 1 170 ? 21.242  3.781   -49.930 1.00 41.91  ? 170 ASN B N     1 
ATOM   5471 C CA    . ASN B 1 170 ? 20.106  4.665   -49.699 1.00 41.85  ? 170 ASN B CA    1 
ATOM   5472 C C     . ASN B 1 170 ? 19.107  4.681   -50.845 1.00 47.12  ? 170 ASN B C     1 
ATOM   5473 O O     . ASN B 1 170 ? 18.294  5.616   -50.932 1.00 45.58  ? 170 ASN B O     1 
ATOM   5474 C CB    . ASN B 1 170 ? 20.560  6.102   -49.420 1.00 46.23  ? 170 ASN B CB    1 
ATOM   5475 C CG    . ASN B 1 170 ? 21.375  6.227   -48.146 1.00 52.86  ? 170 ASN B CG    1 
ATOM   5476 O OD1   . ASN B 1 170 ? 21.135  5.516   -47.154 1.00 47.88  ? 170 ASN B OD1   1 
ATOM   5477 N ND2   . ASN B 1 170 ? 22.349  7.142   -48.162 1.00 51.62  ? 170 ASN B ND2   1 
ATOM   5478 N N     . VAL B 1 171 ? 19.130  3.686   -51.741 1.00 44.17  ? 171 VAL B N     1 
ATOM   5479 C CA    . VAL B 1 171 ? 18.337  3.845   -52.961 1.00 43.90  ? 171 VAL B CA    1 
ATOM   5480 C C     . VAL B 1 171 ? 16.838  3.807   -52.647 1.00 44.76  ? 171 VAL B C     1 
ATOM   5481 O O     . VAL B 1 171 ? 16.038  4.468   -53.328 1.00 42.87  ? 171 VAL B O     1 
ATOM   5482 C CB    . VAL B 1 171 ? 18.744  2.817   -54.047 1.00 42.30  ? 171 VAL B CB    1 
ATOM   5483 C CG1   . VAL B 1 171 ? 20.224  3.002   -54.455 1.00 40.60  ? 171 VAL B CG1   1 
ATOM   5484 C CG2   . VAL B 1 171 ? 18.414  1.360   -53.648 1.00 35.26  ? 171 VAL B CG2   1 
ATOM   5485 N N     . GLY B 1 172 ? 16.439  3.090   -51.591 1.00 40.29  ? 172 GLY B N     1 
ATOM   5486 C CA    . GLY B 1 172 ? 15.066  3.180   -51.119 1.00 39.31  ? 172 GLY B CA    1 
ATOM   5487 C C     . GLY B 1 172 ? 14.642  4.595   -50.765 1.00 44.14  ? 172 GLY B C     1 
ATOM   5488 O O     . GLY B 1 172 ? 13.479  4.960   -50.959 1.00 46.14  ? 172 GLY B O     1 
ATOM   5489 N N     . LEU B 1 173 ? 15.569  5.417   -50.249 1.00 40.94  ? 173 LEU B N     1 
ATOM   5490 C CA    . LEU B 1 173 ? 15.225  6.812   -49.968 1.00 42.34  ? 173 LEU B CA    1 
ATOM   5491 C C     . LEU B 1 173 ? 15.154  7.622   -51.250 1.00 41.64  ? 173 LEU B C     1 
ATOM   5492 O O     . LEU B 1 173 ? 14.313  8.518   -51.384 1.00 40.71  ? 173 LEU B O     1 
ATOM   5493 C CB    . LEU B 1 173 ? 16.233  7.444   -48.998 1.00 45.46  ? 173 LEU B CB    1 
ATOM   5494 C CG    . LEU B 1 173 ? 16.263  6.926   -47.557 1.00 43.34  ? 173 LEU B CG    1 
ATOM   5495 C CD1   . LEU B 1 173 ? 17.507  7.389   -46.844 1.00 43.17  ? 173 LEU B CD1   1 
ATOM   5496 C CD2   . LEU B 1 173 ? 15.022  7.360   -46.805 1.00 42.94  ? 173 LEU B CD2   1 
ATOM   5497 N N     . LEU B 1 174 ? 16.042  7.330   -52.200 1.00 46.94  ? 174 LEU B N     1 
ATOM   5498 C CA    . LEU B 1 174 ? 15.920  7.926   -53.528 1.00 43.88  ? 174 LEU B CA    1 
ATOM   5499 C C     . LEU B 1 174 ? 14.594  7.554   -54.181 1.00 41.80  ? 174 LEU B C     1 
ATOM   5500 O O     . LEU B 1 174 ? 13.970  8.395   -54.837 1.00 42.56  ? 174 LEU B O     1 
ATOM   5501 C CB    . LEU B 1 174 ? 17.097  7.509   -54.392 1.00 37.61  ? 174 LEU B CB    1 
ATOM   5502 C CG    . LEU B 1 174 ? 18.410  8.035   -53.823 1.00 42.68  ? 174 LEU B CG    1 
ATOM   5503 C CD1   . LEU B 1 174 ? 19.603  7.564   -54.639 1.00 36.88  ? 174 LEU B CD1   1 
ATOM   5504 C CD2   . LEU B 1 174 ? 18.387  9.553   -53.690 1.00 42.80  ? 174 LEU B CD2   1 
ATOM   5505 N N     . ASP B 1 175 ? 14.129  6.314   -53.990 1.00 40.21  ? 175 ASP B N     1 
ATOM   5506 C CA    . ASP B 1 175 ? 12.789  5.964   -54.454 1.00 42.13  ? 175 ASP B CA    1 
ATOM   5507 C C     . ASP B 1 175 ? 11.762  6.938   -53.911 1.00 43.06  ? 175 ASP B C     1 
ATOM   5508 O O     . ASP B 1 175 ? 10.998  7.540   -54.670 1.00 46.81  ? 175 ASP B O     1 
ATOM   5509 C CB    . ASP B 1 175 ? 12.400  4.547   -54.040 1.00 41.34  ? 175 ASP B CB    1 
ATOM   5510 C CG    . ASP B 1 175 ? 13.295  3.490   -54.642 1.00 44.45  ? 175 ASP B CG    1 
ATOM   5511 O OD1   . ASP B 1 175 ? 14.130  3.823   -55.521 1.00 44.00  ? 175 ASP B OD1   1 
ATOM   5512 O OD2   . ASP B 1 175 ? 13.144  2.310   -54.239 1.00 46.48  ? 175 ASP B OD2   1 
ATOM   5513 N N     . GLN B 1 176 ? 11.732  7.106   -52.590 1.00 42.05  ? 176 GLN B N     1 
ATOM   5514 C CA    . GLN B 1 176 ? 10.852  8.099   -51.988 1.00 42.42  ? 176 GLN B CA    1 
ATOM   5515 C C     . GLN B 1 176 ? 11.059  9.467   -52.614 1.00 41.47  ? 176 GLN B C     1 
ATOM   5516 O O     . GLN B 1 176 ? 10.097  10.114  -53.041 1.00 41.78  ? 176 GLN B O     1 
ATOM   5517 C CB    . GLN B 1 176 ? 11.096  8.166   -50.483 1.00 42.56  ? 176 GLN B CB    1 
ATOM   5518 C CG    . GLN B 1 176 ? 10.753  6.890   -49.755 1.00 40.95  ? 176 GLN B CG    1 
ATOM   5519 C CD    . GLN B 1 176 ? 11.242  6.903   -48.330 1.00 41.59  ? 176 GLN B CD    1 
ATOM   5520 O OE1   . GLN B 1 176 ? 11.682  7.943   -47.818 1.00 40.13  ? 176 GLN B OE1   1 
ATOM   5521 N NE2   . GLN B 1 176 ? 11.194  5.740   -47.685 1.00 37.21  ? 176 GLN B NE2   1 
ATOM   5522 N N     . ARG B 1 177 ? 12.316  9.924   -52.675 1.00 42.41  ? 177 ARG B N     1 
ATOM   5523 C CA    . ARG B 1 177 ? 12.606  11.230  -53.269 1.00 45.11  ? 177 ARG B CA    1 
ATOM   5524 C C     . ARG B 1 177 ? 12.043  11.331  -54.682 1.00 43.93  ? 177 ARG B C     1 
ATOM   5525 O O     . ARG B 1 177 ? 11.473  12.361  -55.058 1.00 44.97  ? 177 ARG B O     1 
ATOM   5526 C CB    . ARG B 1 177 ? 14.118  11.501  -53.261 1.00 43.08  ? 177 ARG B CB    1 
ATOM   5527 C CG    . ARG B 1 177 ? 14.566  12.803  -53.951 1.00 42.41  ? 177 ARG B CG    1 
ATOM   5528 C CD    . ARG B 1 177 ? 16.093  13.006  -53.884 1.00 39.38  ? 177 ARG B CD    1 
ATOM   5529 N NE    . ARG B 1 177 ? 16.443  13.357  -52.510 1.00 64.24  ? 177 ARG B NE    1 
ATOM   5530 C CZ    . ARG B 1 177 ? 17.671  13.359  -51.981 1.00 62.69  ? 177 ARG B CZ    1 
ATOM   5531 N NH1   . ARG B 1 177 ? 18.733  13.027  -52.721 1.00 59.61  ? 177 ARG B NH1   1 
ATOM   5532 N NH2   . ARG B 1 177 ? 17.827  13.699  -50.697 1.00 47.67  ? 177 ARG B NH2   1 
ATOM   5533 N N     . LEU B 1 178 ? 12.154  10.259  -55.470 1.00 44.28  ? 178 LEU B N     1 
ATOM   5534 C CA    . LEU B 1 178 ? 11.637  10.319  -56.834 1.00 45.80  ? 178 LEU B CA    1 
ATOM   5535 C C     . LEU B 1 178 ? 10.121  10.475  -56.844 1.00 47.11  ? 178 LEU B C     1 
ATOM   5536 O O     . LEU B 1 178 ? 9.580   11.278  -57.616 1.00 47.14  ? 178 LEU B O     1 
ATOM   5537 C CB    . LEU B 1 178 ? 12.059  9.082   -57.624 1.00 46.48  ? 178 LEU B CB    1 
ATOM   5538 C CG    . LEU B 1 178 ? 11.781  9.145   -59.137 1.00 46.33  ? 178 LEU B CG    1 
ATOM   5539 C CD1   . LEU B 1 178 ? 12.564  10.253  -59.807 1.00 42.40  ? 178 LEU B CD1   1 
ATOM   5540 C CD2   . LEU B 1 178 ? 12.113  7.822   -59.794 1.00 45.30  ? 178 LEU B CD2   1 
ATOM   5541 N N     . ALA B 1 179 ? 9.416   9.732   -55.987 1.00 42.57  ? 179 ALA B N     1 
ATOM   5542 C CA    . ALA B 1 179 ? 7.972   9.922   -55.887 1.00 43.30  ? 179 ALA B CA    1 
ATOM   5543 C C     . ALA B 1 179 ? 7.621   11.328  -55.411 1.00 45.42  ? 179 ALA B C     1 
ATOM   5544 O O     . ALA B 1 179 ? 6.522   11.830  -55.683 1.00 43.13  ? 179 ALA B O     1 
ATOM   5545 C CB    . ALA B 1 179 ? 7.375   8.875   -54.953 1.00 40.58  ? 179 ALA B CB    1 
ATOM   5546 N N     . LEU B 1 180 ? 8.532   11.981  -54.692 1.00 45.16  ? 180 LEU B N     1 
ATOM   5547 C CA    . LEU B 1 180 ? 8.265   13.348  -54.273 1.00 45.18  ? 180 LEU B CA    1 
ATOM   5548 C C     . LEU B 1 180 ? 8.386   14.314  -55.451 1.00 47.93  ? 180 LEU B C     1 
ATOM   5549 O O     . LEU B 1 180 ? 7.585   15.250  -55.569 1.00 46.46  ? 180 LEU B O     1 
ATOM   5550 C CB    . LEU B 1 180 ? 9.201   13.724  -53.128 1.00 42.45  ? 180 LEU B CB    1 
ATOM   5551 C CG    . LEU B 1 180 ? 8.879   13.210  -51.720 1.00 43.92  ? 180 LEU B CG    1 
ATOM   5552 C CD1   . LEU B 1 180 ? 8.465   11.738  -51.656 1.00 50.41  ? 180 LEU B CD1   1 
ATOM   5553 C CD2   . LEU B 1 180 ? 10.078  13.457  -50.817 1.00 44.31  ? 180 LEU B CD2   1 
ATOM   5554 N N     . GLN B 1 181 ? 9.369   14.092  -56.344 1.00 48.38  ? 181 GLN B N     1 
ATOM   5555 C CA    . GLN B 1 181 ? 9.448   14.875  -57.578 1.00 46.32  ? 181 GLN B CA    1 
ATOM   5556 C C     . GLN B 1 181 ? 8.249   14.596  -58.467 1.00 46.39  ? 181 GLN B C     1 
ATOM   5557 O O     . GLN B 1 181 ? 7.737   15.501  -59.135 1.00 48.80  ? 181 GLN B O     1 
ATOM   5558 C CB    . GLN B 1 181 ? 10.737  14.571  -58.342 1.00 49.44  ? 181 GLN B CB    1 
ATOM   5559 C CG    . GLN B 1 181 ? 12.030  15.186  -57.780 1.00 57.00  ? 181 GLN B CG    1 
ATOM   5560 C CD    . GLN B 1 181 ? 13.240  14.226  -57.888 1.00 60.94  ? 181 GLN B CD    1 
ATOM   5561 O OE1   . GLN B 1 181 ? 13.138  13.150  -58.485 1.00 60.45  ? 181 GLN B OE1   1 
ATOM   5562 N NE2   . GLN B 1 181 ? 14.379  14.616  -57.303 1.00 54.65  ? 181 GLN B NE2   1 
ATOM   5563 N N     . TRP B 1 182 ? 7.783   13.350  -58.477 1.00 46.00  ? 182 TRP B N     1 
ATOM   5564 C CA    . TRP B 1 182 ? 6.622   13.007  -59.287 1.00 45.23  ? 182 TRP B CA    1 
ATOM   5565 C C     . TRP B 1 182 ? 5.404   13.798  -58.859 1.00 46.70  ? 182 TRP B C     1 
ATOM   5566 O O     . TRP B 1 182 ? 4.671   14.325  -59.702 1.00 49.21  ? 182 TRP B O     1 
ATOM   5567 C CB    . TRP B 1 182 ? 6.328   11.520  -59.183 1.00 45.11  ? 182 TRP B CB    1 
ATOM   5568 C CG    . TRP B 1 182 ? 5.310   11.074  -60.167 1.00 50.13  ? 182 TRP B CG    1 
ATOM   5569 C CD1   . TRP B 1 182 ? 5.542   10.588  -61.421 1.00 41.31  ? 182 TRP B CD1   1 
ATOM   5570 C CD2   . TRP B 1 182 ? 3.886   11.067  -59.988 1.00 51.51  ? 182 TRP B CD2   1 
ATOM   5571 N NE1   . TRP B 1 182 ? 4.355   10.273  -62.031 1.00 43.88  ? 182 TRP B NE1   1 
ATOM   5572 C CE2   . TRP B 1 182 ? 3.321   10.561  -61.183 1.00 47.37  ? 182 TRP B CE2   1 
ATOM   5573 C CE3   . TRP B 1 182 ? 3.036   11.435  -58.937 1.00 45.19  ? 182 TRP B CE3   1 
ATOM   5574 C CZ2   . TRP B 1 182 ? 1.945   10.414  -61.356 1.00 48.03  ? 182 TRP B CZ2   1 
ATOM   5575 C CZ3   . TRP B 1 182 ? 1.665   11.286  -59.105 1.00 43.69  ? 182 TRP B CZ3   1 
ATOM   5576 C CH2   . TRP B 1 182 ? 1.133   10.780  -60.304 1.00 53.20  ? 182 TRP B CH2   1 
ATOM   5577 N N     . VAL B 1 183 ? 5.175   13.888  -57.548 1.00 48.14  ? 183 VAL B N     1 
ATOM   5578 C CA    . VAL B 1 183 ? 4.059   14.657  -57.014 1.00 43.06  ? 183 VAL B CA    1 
ATOM   5579 C C     . VAL B 1 183 ? 4.170   16.112  -57.434 1.00 44.73  ? 183 VAL B C     1 
ATOM   5580 O O     . VAL B 1 183 ? 3.178   16.732  -57.831 1.00 45.38  ? 183 VAL B O     1 
ATOM   5581 C CB    . VAL B 1 183 ? 4.010   14.497  -55.484 1.00 43.93  ? 183 VAL B CB    1 
ATOM   5582 C CG1   . VAL B 1 183 ? 3.080   15.542  -54.846 1.00 39.99  ? 183 VAL B CG1   1 
ATOM   5583 C CG2   . VAL B 1 183 ? 3.570   13.092  -55.143 1.00 40.41  ? 183 VAL B CG2   1 
ATOM   5584 N N     . GLN B 1 184 ? 5.376   16.678  -57.362 1.00 43.27  ? 184 GLN B N     1 
ATOM   5585 C CA    . GLN B 1 184 ? 5.589   18.042  -57.826 1.00 43.79  ? 184 GLN B CA    1 
ATOM   5586 C C     . GLN B 1 184 ? 5.131   18.202  -59.268 1.00 51.55  ? 184 GLN B C     1 
ATOM   5587 O O     . GLN B 1 184 ? 4.284   19.050  -59.584 1.00 49.71  ? 184 GLN B O     1 
ATOM   5588 C CB    . GLN B 1 184 ? 7.063   18.407  -57.701 1.00 44.16  ? 184 GLN B CB    1 
ATOM   5589 C CG    . GLN B 1 184 ? 7.500   18.687  -56.301 1.00 52.32  ? 184 GLN B CG    1 
ATOM   5590 C CD    . GLN B 1 184 ? 6.813   19.909  -55.738 1.00 55.90  ? 184 GLN B CD    1 
ATOM   5591 O OE1   . GLN B 1 184 ? 6.783   20.954  -56.380 1.00 59.59  ? 184 GLN B OE1   1 
ATOM   5592 N NE2   . GLN B 1 184 ? 6.239   19.782  -54.544 1.00 49.77  ? 184 GLN B NE2   1 
ATOM   5593 N N     . GLU B 1 185 ? 5.673   17.368  -60.157 1.00 49.37  ? 185 GLU B N     1 
ATOM   5594 C CA    . GLU B 1 185 ? 5.428   17.521  -61.578 1.00 51.44  ? 185 GLU B CA    1 
ATOM   5595 C C     . GLU B 1 185 ? 4.025   17.117  -61.991 1.00 53.20  ? 185 GLU B C     1 
ATOM   5596 O O     . GLU B 1 185 ? 3.628   17.416  -63.124 1.00 59.28  ? 185 GLU B O     1 
ATOM   5597 C CB    . GLU B 1 185 ? 6.425   16.688  -62.372 1.00 58.66  ? 185 GLU B CB    1 
ATOM   5598 C CG    . GLU B 1 185 ? 7.870   17.039  -62.133 1.00 61.66  ? 185 GLU B CG    1 
ATOM   5599 C CD    . GLU B 1 185 ? 8.794   16.028  -62.774 1.00 70.87  ? 185 GLU B CD    1 
ATOM   5600 O OE1   . GLU B 1 185 ? 8.403   14.837  -62.847 1.00 70.35  ? 185 GLU B OE1   1 
ATOM   5601 O OE2   . GLU B 1 185 ? 9.897   16.424  -63.212 1.00 76.65  ? 185 GLU B OE2   1 
ATOM   5602 N N     . ASN B 1 186 ? 3.268   16.447  -61.131 1.00 45.44  ? 186 ASN B N     1 
ATOM   5603 C CA    . ASN B 1 186 ? 2.061   15.790  -61.600 1.00 44.46  ? 186 ASN B CA    1 
ATOM   5604 C C     . ASN B 1 186 ? 0.826   15.977  -60.737 1.00 48.56  ? 186 ASN B C     1 
ATOM   5605 O O     . ASN B 1 186 ? -0.279  15.852  -61.273 1.00 46.32  ? 186 ASN B O     1 
ATOM   5606 C CB    . ASN B 1 186 ? 2.319   14.285  -61.769 1.00 50.51  ? 186 ASN B CB    1 
ATOM   5607 C CG    . ASN B 1 186 ? 3.230   13.981  -62.961 1.00 54.27  ? 186 ASN B CG    1 
ATOM   5608 O OD1   . ASN B 1 186 ? 3.025   14.517  -64.060 1.00 51.35  ? 186 ASN B OD1   1 
ATOM   5609 N ND2   . ASN B 1 186 ? 4.248   13.137  -62.744 1.00 48.62  ? 186 ASN B ND2   1 
ATOM   5610 N N     . ILE B 1 187 ? 0.956   16.262  -59.433 1.00 50.90  ? 187 ILE B N     1 
ATOM   5611 C CA    . ILE B 1 187 ? -0.223  16.212  -58.574 1.00 43.75  ? 187 ILE B CA    1 
ATOM   5612 C C     . ILE B 1 187 ? -1.226  17.276  -59.003 1.00 48.22  ? 187 ILE B C     1 
ATOM   5613 O O     . ILE B 1 187 ? -2.443  17.080  -58.881 1.00 50.37  ? 187 ILE B O     1 
ATOM   5614 C CB    . ILE B 1 187 ? 0.181   16.333  -57.085 1.00 48.74  ? 187 ILE B CB    1 
ATOM   5615 C CG1   . ILE B 1 187 ? -0.860  15.653  -56.192 1.00 47.91  ? 187 ILE B CG1   1 
ATOM   5616 C CG2   . ILE B 1 187 ? 0.400   17.802  -56.641 1.00 43.59  ? 187 ILE B CG2   1 
ATOM   5617 C CD1   . ILE B 1 187 ? -0.905  14.162  -56.376 1.00 45.71  ? 187 ILE B CD1   1 
ATOM   5618 N N     . ALA B 1 188 ? -0.741  18.391  -59.560 1.00 43.42  ? 188 ALA B N     1 
ATOM   5619 C CA    . ALA B 1 188 ? -1.636  19.408  -60.098 1.00 45.39  ? 188 ALA B CA    1 
ATOM   5620 C C     . ALA B 1 188 ? -2.679  18.807  -61.040 1.00 48.67  ? 188 ALA B C     1 
ATOM   5621 O O     . ALA B 1 188 ? -3.852  19.188  -61.000 1.00 48.24  ? 188 ALA B O     1 
ATOM   5622 C CB    . ALA B 1 188 ? -0.819  20.481  -60.813 1.00 43.68  ? 188 ALA B CB    1 
ATOM   5623 N N     . ALA B 1 189 ? -2.276  17.843  -61.877 1.00 48.39  ? 189 ALA B N     1 
ATOM   5624 C CA    . ALA B 1 189 ? -3.220  17.163  -62.757 1.00 45.43  ? 189 ALA B CA    1 
ATOM   5625 C C     . ALA B 1 189 ? -4.348  16.473  -62.004 1.00 50.81  ? 189 ALA B C     1 
ATOM   5626 O O     . ALA B 1 189 ? -5.379  16.166  -62.612 1.00 53.19  ? 189 ALA B O     1 
ATOM   5627 C CB    . ALA B 1 189 ? -2.496  16.130  -63.616 1.00 46.55  ? 189 ALA B CB    1 
ATOM   5628 N N     . PHE B 1 190 ? -4.177  16.206  -60.706 1.00 52.29  ? 190 PHE B N     1 
ATOM   5629 C CA    . PHE B 1 190 ? -5.184  15.526  -59.899 1.00 49.03  ? 190 PHE B CA    1 
ATOM   5630 C C     . PHE B 1 190 ? -5.972  16.478  -59.019 1.00 52.76  ? 190 PHE B C     1 
ATOM   5631 O O     . PHE B 1 190 ? -6.883  16.037  -58.308 1.00 54.12  ? 190 PHE B O     1 
ATOM   5632 C CB    . PHE B 1 190 ? -4.535  14.474  -59.007 1.00 45.99  ? 190 PHE B CB    1 
ATOM   5633 C CG    . PHE B 1 190 ? -3.858  13.368  -59.747 1.00 45.76  ? 190 PHE B CG    1 
ATOM   5634 C CD1   . PHE B 1 190 ? -2.592  13.542  -60.274 1.00 47.01  ? 190 PHE B CD1   1 
ATOM   5635 C CD2   . PHE B 1 190 ? -4.466  12.130  -59.861 1.00 47.82  ? 190 PHE B CD2   1 
ATOM   5636 C CE1   . PHE B 1 190 ? -1.963  12.514  -60.931 1.00 47.94  ? 190 PHE B CE1   1 
ATOM   5637 C CE2   . PHE B 1 190 ? -3.842  11.096  -60.511 1.00 48.30  ? 190 PHE B CE2   1 
ATOM   5638 C CZ    . PHE B 1 190 ? -2.588  11.290  -61.053 1.00 50.44  ? 190 PHE B CZ    1 
ATOM   5639 N N     . GLY B 1 191 ? -5.634  17.765  -59.040 1.00 50.43  ? 191 GLY B N     1 
ATOM   5640 C CA    . GLY B 1 191 ? -6.241  18.741  -58.167 1.00 52.39  ? 191 GLY B CA    1 
ATOM   5641 C C     . GLY B 1 191 ? -5.431  19.048  -56.930 1.00 56.34  ? 191 GLY B C     1 
ATOM   5642 O O     . GLY B 1 191 ? -5.891  19.826  -56.084 1.00 56.58  ? 191 GLY B O     1 
ATOM   5643 N N     . GLY B 1 192 ? -4.248  18.461  -56.795 1.00 51.41  ? 192 GLY B N     1 
ATOM   5644 C CA    . GLY B 1 192 ? -3.422  18.696  -55.637 1.00 50.40  ? 192 GLY B CA    1 
ATOM   5645 C C     . GLY B 1 192 ? -2.564  19.939  -55.782 1.00 52.44  ? 192 GLY B C     1 
ATOM   5646 O O     . GLY B 1 192 ? -2.227  20.357  -56.888 1.00 52.51  ? 192 GLY B O     1 
ATOM   5647 N N     . ASP B 1 193 ? -2.205  20.526  -54.633 1.00 51.30  ? 193 ASP B N     1 
ATOM   5648 C CA    . ASP B 1 193 ? -1.375  21.724  -54.610 1.00 51.20  ? 193 ASP B CA    1 
ATOM   5649 C C     . ASP B 1 193 ? 0.088   21.319  -54.442 1.00 52.65  ? 193 ASP B C     1 
ATOM   5650 O O     . ASP B 1 193 ? 0.477   20.886  -53.346 1.00 50.92  ? 193 ASP B O     1 
ATOM   5651 C CB    . ASP B 1 193 ? -1.819  22.648  -53.483 1.00 50.17  ? 193 ASP B CB    1 
ATOM   5652 C CG    . ASP B 1 193 ? -1.179  24.039  -53.556 1.00 56.70  ? 193 ASP B CG    1 
ATOM   5653 O OD1   . ASP B 1 193 ? -0.232  24.216  -54.350 1.00 54.66  ? 193 ASP B OD1   1 
ATOM   5654 O OD2   . ASP B 1 193 ? -1.616  24.957  -52.804 1.00 56.17  ? 193 ASP B OD2   1 
ATOM   5655 N N     . PRO B 1 194 ? 0.927   21.416  -55.482 1.00 52.65  ? 194 PRO B N     1 
ATOM   5656 C CA    . PRO B 1 194 ? 2.351   21.091  -55.296 1.00 51.93  ? 194 PRO B CA    1 
ATOM   5657 C C     . PRO B 1 194 ? 3.057   22.044  -54.359 1.00 51.49  ? 194 PRO B C     1 
ATOM   5658 O O     . PRO B 1 194 ? 4.198   21.769  -53.969 1.00 50.41  ? 194 PRO B O     1 
ATOM   5659 C CB    . PRO B 1 194 ? 2.927   21.190  -56.715 1.00 48.32  ? 194 PRO B CB    1 
ATOM   5660 C CG    . PRO B 1 194 ? 2.047   22.180  -57.386 1.00 47.55  ? 194 PRO B CG    1 
ATOM   5661 C CD    . PRO B 1 194 ? 0.656   21.908  -56.843 1.00 50.10  ? 194 PRO B CD    1 
ATOM   5662 N N     . MET B 1 195 ? 2.428   23.159  -54.006 1.00 52.33  ? 195 MET B N     1 
ATOM   5663 C CA    . MET B 1 195 ? 3.016   24.121  -53.090 1.00 55.41  ? 195 MET B CA    1 
ATOM   5664 C C     . MET B 1 195 ? 2.633   23.867  -51.634 1.00 49.77  ? 195 MET B C     1 
ATOM   5665 O O     . MET B 1 195 ? 3.132   24.568  -50.751 1.00 47.53  ? 195 MET B O     1 
ATOM   5666 C CB    . MET B 1 195 ? 2.632   25.541  -53.509 1.00 54.63  ? 195 MET B CB    1 
ATOM   5667 C CG    . MET B 1 195 ? 3.176   25.919  -54.873 1.00 54.00  ? 195 MET B CG    1 
ATOM   5668 S SD    . MET B 1 195 ? 3.019   27.677  -55.238 1.00 73.51  ? 195 MET B SD    1 
ATOM   5669 C CE    . MET B 1 195 ? 1.270   27.956  -54.928 1.00 68.12  ? 195 MET B CE    1 
ATOM   5670 N N     . SER B 1 196 ? 1.818   22.833  -51.361 1.00 48.32  ? 196 SER B N     1 
ATOM   5671 C CA    . SER B 1 196 ? 1.438   22.439  -50.008 1.00 47.60  ? 196 SER B CA    1 
ATOM   5672 C C     . SER B 1 196 ? 1.482   20.911  -49.928 1.00 48.90  ? 196 SER B C     1 
ATOM   5673 O O     . SER B 1 196 ? 0.457   20.222  -50.054 1.00 46.82  ? 196 SER B O     1 
ATOM   5674 C CB    . SER B 1 196 ? 0.063   22.976  -49.644 1.00 47.12  ? 196 SER B CB    1 
ATOM   5675 O OG    . SER B 1 196 ? -0.224  22.682  -48.294 1.00 46.99  ? 196 SER B OG    1 
ATOM   5676 N N     . VAL B 1 197 ? 2.679   20.377  -49.702 1.00 45.09  ? 197 VAL B N     1 
ATOM   5677 C CA    . VAL B 1 197 ? 2.898   18.938  -49.581 1.00 45.18  ? 197 VAL B CA    1 
ATOM   5678 C C     . VAL B 1 197 ? 3.399   18.644  -48.171 1.00 44.76  ? 197 VAL B C     1 
ATOM   5679 O O     . VAL B 1 197 ? 4.444   19.161  -47.759 1.00 46.02  ? 197 VAL B O     1 
ATOM   5680 C CB    . VAL B 1 197 ? 3.893   18.431  -50.639 1.00 44.50  ? 197 VAL B CB    1 
ATOM   5681 C CG1   . VAL B 1 197 ? 4.319   17.014  -50.337 1.00 40.21  ? 197 VAL B CG1   1 
ATOM   5682 C CG2   . VAL B 1 197 ? 3.268   18.540  -52.035 1.00 44.68  ? 197 VAL B CG2   1 
ATOM   5683 N N     . THR B 1 198 ? 2.660   17.822  -47.432 1.00 40.06  ? 198 THR B N     1 
ATOM   5684 C CA    . THR B 1 198 ? 3.072   17.372  -46.107 1.00 37.26  ? 198 THR B CA    1 
ATOM   5685 C C     . THR B 1 198 ? 3.485   15.908  -46.185 1.00 39.23  ? 198 THR B C     1 
ATOM   5686 O O     . THR B 1 198 ? 2.707   15.075  -46.663 1.00 44.40  ? 198 THR B O     1 
ATOM   5687 C CB    . THR B 1 198 ? 1.931   17.534  -45.089 1.00 42.42  ? 198 THR B CB    1 
ATOM   5688 O OG1   . THR B 1 198 ? 1.547   18.910  -44.975 1.00 47.38  ? 198 THR B OG1   1 
ATOM   5689 C CG2   . THR B 1 198 ? 2.339   17.025  -43.725 1.00 37.87  ? 198 THR B CG2   1 
ATOM   5690 N N     . LEU B 1 199 ? 4.697   15.586  -45.729 1.00 33.54  ? 199 LEU B N     1 
ATOM   5691 C CA    . LEU B 1 199 ? 5.092   14.190  -45.565 1.00 34.38  ? 199 LEU B CA    1 
ATOM   5692 C C     . LEU B 1 199 ? 4.613   13.672  -44.218 1.00 37.58  ? 199 LEU B C     1 
ATOM   5693 O O     . LEU B 1 199 ? 4.696   14.382  -43.219 1.00 45.05  ? 199 LEU B O     1 
ATOM   5694 C CB    . LEU B 1 199 ? 6.609   14.030  -45.643 1.00 35.64  ? 199 LEU B CB    1 
ATOM   5695 C CG    . LEU B 1 199 ? 7.367   14.597  -46.842 1.00 38.85  ? 199 LEU B CG    1 
ATOM   5696 C CD1   . LEU B 1 199 ? 8.835   14.260  -46.717 1.00 36.25  ? 199 LEU B CD1   1 
ATOM   5697 C CD2   . LEU B 1 199 ? 6.794   14.093  -48.178 1.00 35.17  ? 199 LEU B CD2   1 
ATOM   5698 N N     . PHE B 1 200 ? 4.110   12.439  -44.176 1.00 37.68  ? 200 PHE B N     1 
ATOM   5699 C CA    . PHE B 1 200 ? 3.899   11.806  -42.877 1.00 40.81  ? 200 PHE B CA    1 
ATOM   5700 C C     . PHE B 1 200 ? 4.132   10.312  -42.994 1.00 42.80  ? 200 PHE B C     1 
ATOM   5701 O O     . PHE B 1 200 ? 3.722   9.691   -43.972 1.00 44.88  ? 200 PHE B O     1 
ATOM   5702 C CB    . PHE B 1 200 ? 2.512   12.098  -42.271 1.00 39.21  ? 200 PHE B CB    1 
ATOM   5703 C CG    . PHE B 1 200 ? 1.345   11.417  -42.943 1.00 41.48  ? 200 PHE B CG    1 
ATOM   5704 C CD1   . PHE B 1 200 ? 0.415   10.716  -42.180 1.00 38.65  ? 200 PHE B CD1   1 
ATOM   5705 C CD2   . PHE B 1 200 ? 1.125   11.539  -44.300 1.00 37.83  ? 200 PHE B CD2   1 
ATOM   5706 C CE1   . PHE B 1 200 ? -0.685  10.116  -42.764 1.00 39.35  ? 200 PHE B CE1   1 
ATOM   5707 C CE2   . PHE B 1 200 ? 0.022   10.938  -44.892 1.00 42.56  ? 200 PHE B CE2   1 
ATOM   5708 C CZ    . PHE B 1 200 ? -0.881  10.224  -44.127 1.00 41.36  ? 200 PHE B CZ    1 
ATOM   5709 N N     . GLY B 1 201 ? 4.818   9.755   -42.002 1.00 38.93  ? 201 GLY B N     1 
ATOM   5710 C CA    . GLY B 1 201 ? 5.092   8.333   -41.969 1.00 42.26  ? 201 GLY B CA    1 
ATOM   5711 C C     . GLY B 1 201 ? 5.273   7.876   -40.537 1.00 44.79  ? 201 GLY B C     1 
ATOM   5712 O O     . GLY B 1 201 ? 5.258   8.676   -39.600 1.00 43.33  ? 201 GLY B O     1 
ATOM   5713 N N     . GLU B 1 202 ? 5.484   6.568   -40.377 1.00 44.47  ? 202 GLU B N     1 
ATOM   5714 C CA    . GLU B 1 202 ? 5.552   5.964   -39.059 1.00 40.68  ? 202 GLU B CA    1 
ATOM   5715 C C     . GLU B 1 202 ? 6.640   4.892   -38.997 1.00 42.65  ? 202 GLU B C     1 
ATOM   5716 O O     . GLU B 1 202 ? 6.898   4.182   -39.966 1.00 42.21  ? 202 GLU B O     1 
ATOM   5717 C CB    . GLU B 1 202 ? 4.188   5.400   -38.683 1.00 41.94  ? 202 GLU B CB    1 
ATOM   5718 C CG    . GLU B 1 202 ? 4.113   4.865   -37.279 1.00 45.21  ? 202 GLU B CG    1 
ATOM   5719 C CD    . GLU B 1 202 ? 4.294   3.383   -37.279 1.00 47.19  ? 202 GLU B CD    1 
ATOM   5720 O OE1   . GLU B 1 202 ? 3.856   2.769   -38.249 1.00 55.84  ? 202 GLU B OE1   1 
ATOM   5721 O OE2   . GLU B 1 202 ? 4.873   2.818   -36.339 1.00 53.79  ? 202 GLU B OE2   1 
ATOM   5722 N N     . SER B 1 203 ? 7.294   4.798   -37.839 1.00 43.81  ? 203 SER B N     1 
ATOM   5723 C CA    . SER B 1 203 ? 8.417   3.882   -37.599 1.00 42.98  ? 203 SER B CA    1 
ATOM   5724 C C     . SER B 1 203 ? 9.531   4.189   -38.593 1.00 41.37  ? 203 SER B C     1 
ATOM   5725 O O     . SER B 1 203 ? 10.021  5.333   -38.610 1.00 39.72  ? 203 SER B O     1 
ATOM   5726 C CB    . SER B 1 203 ? 7.913   2.446   -37.616 1.00 44.31  ? 203 SER B CB    1 
ATOM   5727 O OG    . SER B 1 203 ? 8.922   1.598   -37.085 1.00 46.72  ? 203 SER B OG    1 
ATOM   5728 N N     . ALA B 1 204 ? 9.979   3.226   -39.407 1.00 42.69  ? 204 ALA B N     1 
ATOM   5729 C CA    . ALA B 1 204 ? 10.977  3.533   -40.425 1.00 40.26  ? 204 ALA B CA    1 
ATOM   5730 C C     . ALA B 1 204 ? 10.490  4.629   -41.355 1.00 38.33  ? 204 ALA B C     1 
ATOM   5731 O O     . ALA B 1 204 ? 11.295  5.414   -41.869 1.00 37.99  ? 204 ALA B O     1 
ATOM   5732 C CB    . ALA B 1 204 ? 11.324  2.281   -41.217 1.00 43.25  ? 204 ALA B CB    1 
ATOM   5733 N N     . GLY B 1 205 ? 9.176   4.731   -41.539 1.00 38.88  ? 205 GLY B N     1 
ATOM   5734 C CA    . GLY B 1 205 ? 8.637   5.802   -42.363 1.00 42.34  ? 205 GLY B CA    1 
ATOM   5735 C C     . GLY B 1 205 ? 8.857   7.177   -41.765 1.00 41.04  ? 205 GLY B C     1 
ATOM   5736 O O     . GLY B 1 205 ? 9.160   8.134   -42.483 1.00 38.83  ? 205 GLY B O     1 
ATOM   5737 N N     . ALA B 1 206 ? 8.692   7.301   -40.443 1.00 44.20  ? 206 ALA B N     1 
ATOM   5738 C CA    . ALA B 1 206 ? 8.975   8.566   -39.776 1.00 39.34  ? 206 ALA B CA    1 
ATOM   5739 C C     . ALA B 1 206 ? 10.455  8.899   -39.871 1.00 38.46  ? 206 ALA B C     1 
ATOM   5740 O O     . ALA B 1 206 ? 10.826  10.027  -40.215 1.00 39.51  ? 206 ALA B O     1 
ATOM   5741 C CB    . ALA B 1 206 ? 8.513   8.506   -38.326 1.00 38.68  ? 206 ALA B CB    1 
ATOM   5742 N N     . ALA B 1 207 ? 11.318  7.918   -39.597 1.00 36.55  ? 207 ALA B N     1 
ATOM   5743 C CA    . ALA B 1 207 ? 12.742  8.085   -39.869 1.00 37.48  ? 207 ALA B CA    1 
ATOM   5744 C C     . ALA B 1 207 ? 12.994  8.596   -41.289 1.00 39.26  ? 207 ALA B C     1 
ATOM   5745 O O     . ALA B 1 207 ? 13.799  9.517   -41.490 1.00 38.18  ? 207 ALA B O     1 
ATOM   5746 C CB    . ALA B 1 207 ? 13.477  6.766   -39.637 1.00 38.28  ? 207 ALA B CB    1 
ATOM   5747 N N     . SER B 1 208 ? 12.310  8.010   -42.289 1.00 38.09  ? 208 SER B N     1 
ATOM   5748 C CA    . SER B 1 208 ? 12.492  8.445   -43.681 1.00 37.68  ? 208 SER B CA    1 
ATOM   5749 C C     . SER B 1 208 ? 12.121  9.912   -43.850 1.00 36.71  ? 208 SER B C     1 
ATOM   5750 O O     . SER B 1 208 ? 12.920  10.713  -44.350 1.00 36.12  ? 208 SER B O     1 
ATOM   5751 C CB    . SER B 1 208 ? 11.669  7.574   -44.639 1.00 35.79  ? 208 SER B CB    1 
ATOM   5752 O OG    . SER B 1 208 ? 12.219  6.278   -44.784 1.00 36.79  ? 208 SER B OG    1 
ATOM   5753 N N     . VAL B 1 209 ? 10.905  10.279  -43.431 1.00 37.47  ? 209 VAL B N     1 
ATOM   5754 C CA    . VAL B 1 209 ? 10.505  11.684  -43.368 1.00 36.68  ? 209 VAL B CA    1 
ATOM   5755 C C     . VAL B 1 209 ? 11.609  12.525  -42.745 1.00 40.77  ? 209 VAL B C     1 
ATOM   5756 O O     . VAL B 1 209 ? 12.035  13.540  -43.313 1.00 39.93  ? 209 VAL B O     1 
ATOM   5757 C CB    . VAL B 1 209 ? 9.192   11.823  -42.585 1.00 37.08  ? 209 VAL B CB    1 
ATOM   5758 C CG1   . VAL B 1 209 ? 8.828   13.288  -42.417 1.00 35.24  ? 209 VAL B CG1   1 
ATOM   5759 C CG2   . VAL B 1 209 ? 8.092   11.046  -43.293 1.00 38.67  ? 209 VAL B CG2   1 
ATOM   5760 N N     . GLY B 1 210 ? 12.110  12.094  -41.576 1.00 39.05  ? 210 GLY B N     1 
ATOM   5761 C CA    . GLY B 1 210 ? 13.184  12.823  -40.917 1.00 38.44  ? 210 GLY B CA    1 
ATOM   5762 C C     . GLY B 1 210 ? 14.405  13.001  -41.800 1.00 41.53  ? 210 GLY B C     1 
ATOM   5763 O O     . GLY B 1 210 ? 14.993  14.084  -41.863 1.00 41.14  ? 210 GLY B O     1 
ATOM   5764 N N     . MET B 1 211 ? 14.785  11.953  -42.522 1.00 42.17  ? 211 MET B N     1 
ATOM   5765 C CA    . MET B 1 211 ? 15.955  12.078  -43.381 1.00 42.61  ? 211 MET B CA    1 
ATOM   5766 C C     . MET B 1 211 ? 15.696  12.979  -44.581 1.00 43.19  ? 211 MET B C     1 
ATOM   5767 O O     . MET B 1 211 ? 16.633  13.617  -45.074 1.00 45.41  ? 211 MET B O     1 
ATOM   5768 C CB    . MET B 1 211 ? 16.432  10.701  -43.807 1.00 40.11  ? 211 MET B CB    1 
ATOM   5769 C CG    . MET B 1 211 ? 17.063  9.987   -42.652 1.00 39.70  ? 211 MET B CG    1 
ATOM   5770 S SD    . MET B 1 211 ? 17.243  8.250   -42.938 1.00 52.91  ? 211 MET B SD    1 
ATOM   5771 C CE    . MET B 1 211 ? 17.383  7.581   -41.290 1.00 44.13  ? 211 MET B CE    1 
ATOM   5772 N N     . HIS B 1 212 ? 14.451  13.081  -45.054 1.00 41.69  ? 212 HIS B N     1 
ATOM   5773 C CA    . HIS B 1 212 ? 14.208  14.053  -46.117 1.00 42.70  ? 212 HIS B CA    1 
ATOM   5774 C C     . HIS B 1 212 ? 14.303  15.471  -45.585 1.00 44.86  ? 212 HIS B C     1 
ATOM   5775 O O     . HIS B 1 212 ? 14.597  16.393  -46.355 1.00 45.95  ? 212 HIS B O     1 
ATOM   5776 C CB    . HIS B 1 212 ? 12.850  13.828  -46.790 1.00 41.30  ? 212 HIS B CB    1 
ATOM   5777 C CG    . HIS B 1 212 ? 12.777  12.571  -47.602 1.00 42.85  ? 212 HIS B CG    1 
ATOM   5778 N ND1   . HIS B 1 212 ? 13.409  12.434  -48.820 1.00 42.40  ? 212 HIS B ND1   1 
ATOM   5779 C CD2   . HIS B 1 212 ? 12.148  11.393  -47.369 1.00 41.38  ? 212 HIS B CD2   1 
ATOM   5780 C CE1   . HIS B 1 212 ? 13.179  11.222  -49.296 1.00 43.44  ? 212 HIS B CE1   1 
ATOM   5781 N NE2   . HIS B 1 212 ? 12.424  10.567  -48.431 1.00 40.30  ? 212 HIS B NE2   1 
ATOM   5782 N N     . ILE B 1 213 ? 14.053  15.662  -44.280 1.00 45.14  ? 213 ILE B N     1 
ATOM   5783 C CA    . ILE B 1 213 ? 14.267  16.963  -43.646 1.00 42.67  ? 213 ILE B CA    1 
ATOM   5784 C C     . ILE B 1 213 ? 15.744  17.313  -43.642 1.00 46.66  ? 213 ILE B C     1 
ATOM   5785 O O     . ILE B 1 213 ? 16.115  18.489  -43.758 1.00 51.23  ? 213 ILE B O     1 
ATOM   5786 C CB    . ILE B 1 213 ? 13.697  16.973  -42.217 1.00 41.07  ? 213 ILE B CB    1 
ATOM   5787 C CG1   . ILE B 1 213 ? 12.194  16.759  -42.244 1.00 44.77  ? 213 ILE B CG1   1 
ATOM   5788 C CG2   . ILE B 1 213 ? 13.959  18.288  -41.538 1.00 38.45  ? 213 ILE B CG2   1 
ATOM   5789 C CD1   . ILE B 1 213 ? 11.565  16.811  -40.896 1.00 40.83  ? 213 ILE B CD1   1 
ATOM   5790 N N     . LEU B 1 214 ? 16.607  16.307  -43.542 1.00 48.83  ? 214 LEU B N     1 
ATOM   5791 C CA    . LEU B 1 214 ? 18.034  16.495  -43.333 1.00 48.45  ? 214 LEU B CA    1 
ATOM   5792 C C     . LEU B 1 214 ? 18.852  16.398  -44.613 1.00 50.66  ? 214 LEU B C     1 
ATOM   5793 O O     . LEU B 1 214 ? 20.081  16.503  -44.550 1.00 53.68  ? 214 LEU B O     1 
ATOM   5794 C CB    . LEU B 1 214 ? 18.541  15.472  -42.305 1.00 48.14  ? 214 LEU B CB    1 
ATOM   5795 C CG    . LEU B 1 214 ? 17.969  15.634  -40.882 1.00 50.27  ? 214 LEU B CG    1 
ATOM   5796 C CD1   . LEU B 1 214 ? 18.512  14.598  -39.891 1.00 41.96  ? 214 LEU B CD1   1 
ATOM   5797 C CD2   . LEU B 1 214 ? 18.230  17.040  -40.372 1.00 46.49  ? 214 LEU B CD2   1 
ATOM   5798 N N     . SER B 1 215 ? 18.212  16.209  -45.766 1.00 51.98  ? 215 SER B N     1 
ATOM   5799 C CA    . SER B 1 215 ? 18.911  16.045  -47.038 1.00 49.60  ? 215 SER B CA    1 
ATOM   5800 C C     . SER B 1 215 ? 18.487  17.166  -47.969 1.00 52.09  ? 215 SER B C     1 
ATOM   5801 O O     . SER B 1 215 ? 17.291  17.327  -48.235 1.00 51.72  ? 215 SER B O     1 
ATOM   5802 C CB    . SER B 1 215 ? 18.605  14.686  -47.673 1.00 50.24  ? 215 SER B CB    1 
ATOM   5803 O OG    . SER B 1 215 ? 19.521  14.377  -48.709 1.00 52.31  ? 215 SER B OG    1 
ATOM   5804 N N     . LEU B 1 216 ? 19.465  17.918  -48.487 1.00 54.53  ? 216 LEU B N     1 
ATOM   5805 C CA    . LEU B 1 216 ? 19.164  19.120  -49.260 1.00 56.13  ? 216 LEU B CA    1 
ATOM   5806 C C     . LEU B 1 216 ? 18.293  18.883  -50.482 1.00 56.00  ? 216 LEU B C     1 
ATOM   5807 O O     . LEU B 1 216 ? 17.288  19.618  -50.644 1.00 57.80  ? 216 LEU B O     1 
ATOM   5808 C CB    . LEU B 1 216 ? 20.470  19.814  -49.672 1.00 58.20  ? 216 LEU B CB    1 
ATOM   5809 C CG    . LEU B 1 216 ? 20.824  21.033  -48.819 1.00 70.89  ? 216 LEU B CG    1 
ATOM   5810 C CD1   . LEU B 1 216 ? 20.737  20.681  -47.339 1.00 67.53  ? 216 LEU B CD1   1 
ATOM   5811 C CD2   . LEU B 1 216 ? 22.221  21.503  -49.213 1.00 75.77  ? 216 LEU B CD2   1 
ATOM   5812 N N     . PRO B 1 217 ? 18.608  17.952  -51.404 1.00 49.47  ? 217 PRO B N     1 
ATOM   5813 C CA    . PRO B 1 217 ? 17.709  17.783  -52.572 1.00 49.70  ? 217 PRO B CA    1 
ATOM   5814 C C     . PRO B 1 217 ? 16.245  17.552  -52.226 1.00 52.98  ? 217 PRO B C     1 
ATOM   5815 O O     . PRO B 1 217 ? 15.371  18.010  -52.975 1.00 48.27  ? 217 PRO B O     1 
ATOM   5816 C CB    . PRO B 1 217 ? 18.272  16.537  -53.291 1.00 48.00  ? 217 PRO B CB    1 
ATOM   5817 C CG    . PRO B 1 217 ? 19.591  16.245  -52.685 1.00 52.48  ? 217 PRO B CG    1 
ATOM   5818 C CD    . PRO B 1 217 ? 19.841  17.190  -51.548 1.00 52.79  ? 217 PRO B CD    1 
ATOM   5819 N N     . SER B 1 218 ? 15.958  16.835  -51.117 1.00 51.21  ? 218 SER B N     1 
ATOM   5820 C CA    . SER B 1 218 ? 14.563  16.554  -50.765 1.00 44.69  ? 218 SER B CA    1 
ATOM   5821 C C     . SER B 1 218 ? 13.858  17.778  -50.216 1.00 48.12  ? 218 SER B C     1 
ATOM   5822 O O     . SER B 1 218 ? 12.628  17.828  -50.268 1.00 50.96  ? 218 SER B O     1 
ATOM   5823 C CB    . SER B 1 218 ? 14.468  15.418  -49.740 1.00 42.40  ? 218 SER B CB    1 
ATOM   5824 O OG    . SER B 1 218 ? 15.255  14.296  -50.088 1.00 45.77  ? 218 SER B OG    1 
ATOM   5825 N N     . ARG B 1 219 ? 14.606  18.771  -49.713 1.00 47.59  ? 219 ARG B N     1 
ATOM   5826 C CA    . ARG B 1 219 ? 14.017  19.896  -48.990 1.00 47.33  ? 219 ARG B CA    1 
ATOM   5827 C C     . ARG B 1 219 ? 13.264  20.858  -49.897 1.00 47.27  ? 219 ARG B C     1 
ATOM   5828 O O     . ARG B 1 219 ? 12.585  21.761  -49.408 1.00 51.04  ? 219 ARG B O     1 
ATOM   5829 C CB    . ARG B 1 219 ? 15.107  20.634  -48.207 1.00 50.66  ? 219 ARG B CB    1 
ATOM   5830 C CG    . ARG B 1 219 ? 15.627  19.841  -46.999 1.00 51.99  ? 219 ARG B CG    1 
ATOM   5831 C CD    . ARG B 1 219 ? 16.893  20.440  -46.383 1.00 57.22  ? 219 ARG B CD    1 
ATOM   5832 N NE    . ARG B 1 219 ? 16.655  20.940  -45.030 1.00 64.85  ? 219 ARG B NE    1 
ATOM   5833 C CZ    . ARG B 1 219 ? 16.703  22.223  -44.695 1.00 68.46  ? 219 ARG B CZ    1 
ATOM   5834 N NH1   . ARG B 1 219 ? 16.994  23.128  -45.615 1.00 66.48  ? 219 ARG B NH1   1 
ATOM   5835 N NH2   . ARG B 1 219 ? 16.468  22.603  -43.441 1.00 74.11  ? 219 ARG B NH2   1 
ATOM   5836 N N     . SER B 1 220 ? 13.343  20.687  -51.200 1.00 49.66  ? 220 SER B N     1 
ATOM   5837 C CA    . SER B 1 220 ? 12.553  21.487  -52.116 1.00 52.11  ? 220 SER B CA    1 
ATOM   5838 C C     . SER B 1 220 ? 11.330  20.739  -52.615 1.00 50.37  ? 220 SER B C     1 
ATOM   5839 O O     . SER B 1 220 ? 10.681  21.197  -53.561 1.00 52.19  ? 220 SER B O     1 
ATOM   5840 C CB    . SER B 1 220 ? 13.424  21.926  -53.288 1.00 54.12  ? 220 SER B CB    1 
ATOM   5841 O OG    . SER B 1 220 ? 14.295  20.861  -53.649 1.00 58.95  ? 220 SER B OG    1 
ATOM   5842 N N     . LEU B 1 221 ? 11.004  19.603  -51.998 1.00 44.75  ? 221 LEU B N     1 
ATOM   5843 C CA    . LEU B 1 221 ? 9.961   18.716  -52.478 1.00 44.02  ? 221 LEU B CA    1 
ATOM   5844 C C     . LEU B 1 221 ? 8.783   18.603  -51.529 1.00 45.65  ? 221 LEU B C     1 
ATOM   5845 O O     . LEU B 1 221 ? 7.786   17.956  -51.875 1.00 47.35  ? 221 LEU B O     1 
ATOM   5846 C CB    . LEU B 1 221 ? 10.550  17.329  -52.742 1.00 45.64  ? 221 LEU B CB    1 
ATOM   5847 C CG    . LEU B 1 221 ? 11.594  17.382  -53.858 1.00 48.71  ? 221 LEU B CG    1 
ATOM   5848 C CD1   . LEU B 1 221 ? 12.244  16.028  -54.094 1.00 47.64  ? 221 LEU B CD1   1 
ATOM   5849 C CD2   . LEU B 1 221 ? 10.930  17.871  -55.119 1.00 43.35  ? 221 LEU B CD2   1 
ATOM   5850 N N     . PHE B 1 222 ? 8.868   19.201  -50.347 1.00 48.27  ? 222 PHE B N     1 
ATOM   5851 C CA    . PHE B 1 222 ? 7.777   19.165  -49.384 1.00 47.85  ? 222 PHE B CA    1 
ATOM   5852 C C     . PHE B 1 222 ? 7.893   20.389  -48.485 1.00 46.66  ? 222 PHE B C     1 
ATOM   5853 O O     . PHE B 1 222 ? 8.921   21.065  -48.461 1.00 45.28  ? 222 PHE B O     1 
ATOM   5854 C CB    . PHE B 1 222 ? 7.792   17.864  -48.580 1.00 43.99  ? 222 PHE B CB    1 
ATOM   5855 C CG    . PHE B 1 222 ? 8.996   17.698  -47.705 1.00 44.91  ? 222 PHE B CG    1 
ATOM   5856 C CD1   . PHE B 1 222 ? 10.211  17.306  -48.242 1.00 44.50  ? 222 PHE B CD1   1 
ATOM   5857 C CD2   . PHE B 1 222 ? 8.903   17.904  -46.334 1.00 45.04  ? 222 PHE B CD2   1 
ATOM   5858 C CE1   . PHE B 1 222 ? 11.324  17.127  -47.430 1.00 45.04  ? 222 PHE B CE1   1 
ATOM   5859 C CE2   . PHE B 1 222 ? 10.002  17.736  -45.518 1.00 44.86  ? 222 PHE B CE2   1 
ATOM   5860 C CZ    . PHE B 1 222 ? 11.218  17.343  -46.068 1.00 48.82  ? 222 PHE B CZ    1 
ATOM   5861 N N     . HIS B 1 223 ? 6.820   20.669  -47.749 1.00 47.14  ? 223 HIS B N     1 
ATOM   5862 C CA    . HIS B 1 223 ? 6.739   21.862  -46.912 1.00 49.05  ? 223 HIS B CA    1 
ATOM   5863 C C     . HIS B 1 223 ? 6.592   21.572  -45.427 1.00 48.18  ? 223 HIS B C     1 
ATOM   5864 O O     . HIS B 1 223 ? 7.190   22.274  -44.617 1.00 51.59  ? 223 HIS B O     1 
ATOM   5865 C CB    . HIS B 1 223 ? 5.579   22.727  -47.384 1.00 50.34  ? 223 HIS B CB    1 
ATOM   5866 C CG    . HIS B 1 223 ? 5.569   22.916  -48.867 1.00 51.92  ? 223 HIS B CG    1 
ATOM   5867 N ND1   . HIS B 1 223 ? 4.989   22.007  -49.727 1.00 47.17  ? 223 HIS B ND1   1 
ATOM   5868 C CD2   . HIS B 1 223 ? 6.107   23.883  -49.644 1.00 50.23  ? 223 HIS B CD2   1 
ATOM   5869 C CE1   . HIS B 1 223 ? 5.162   22.414  -50.969 1.00 48.48  ? 223 HIS B CE1   1 
ATOM   5870 N NE2   . HIS B 1 223 ? 5.830   23.553  -50.948 1.00 49.26  ? 223 HIS B NE2   1 
ATOM   5871 N N     . ARG B 1 224 ? 5.824   20.555  -45.047 1.00 45.34  ? 224 ARG B N     1 
ATOM   5872 C CA    . ARG B 1 224 ? 5.646   20.183  -43.652 1.00 44.54  ? 224 ARG B CA    1 
ATOM   5873 C C     . ARG B 1 224 ? 5.842   18.678  -43.489 1.00 47.75  ? 224 ARG B C     1 
ATOM   5874 O O     . ARG B 1 224 ? 5.783   17.916  -44.456 1.00 49.64  ? 224 ARG B O     1 
ATOM   5875 C CB    . ARG B 1 224 ? 4.273   20.602  -43.155 1.00 43.83  ? 224 ARG B CB    1 
ATOM   5876 C CG    . ARG B 1 224 ? 4.147   22.085  -42.942 1.00 46.54  ? 224 ARG B CG    1 
ATOM   5877 C CD    . ARG B 1 224 ? 2.693   22.447  -42.816 1.00 46.75  ? 224 ARG B CD    1 
ATOM   5878 N NE    . ARG B 1 224 ? 2.071   22.502  -44.121 1.00 52.14  ? 224 ARG B NE    1 
ATOM   5879 C CZ    . ARG B 1 224 ? 1.995   23.615  -44.830 1.00 53.73  ? 224 ARG B CZ    1 
ATOM   5880 N NH1   . ARG B 1 224 ? 2.491   24.733  -44.319 1.00 54.60  ? 224 ARG B NH1   1 
ATOM   5881 N NH2   . ARG B 1 224 ? 1.435   23.608  -46.031 1.00 56.73  ? 224 ARG B NH2   1 
ATOM   5882 N N     . ALA B 1 225 ? 6.085   18.252  -42.249 1.00 44.27  ? 225 ALA B N     1 
ATOM   5883 C CA    . ALA B 1 225 ? 6.457   16.872  -41.968 1.00 40.97  ? 225 ALA B CA    1 
ATOM   5884 C C     . ALA B 1 225 ? 5.757   16.391  -40.706 1.00 42.41  ? 225 ALA B C     1 
ATOM   5885 O O     . ALA B 1 225 ? 5.501   17.166  -39.784 1.00 46.69  ? 225 ALA B O     1 
ATOM   5886 C CB    . ALA B 1 225 ? 7.977   16.722  -41.805 1.00 40.33  ? 225 ALA B CB    1 
ATOM   5887 N N     . VAL B 1 226 ? 5.443   15.100  -40.684 1.00 37.37  ? 226 VAL B N     1 
ATOM   5888 C CA    . VAL B 1 226 ? 4.862   14.426  -39.534 1.00 38.56  ? 226 VAL B CA    1 
ATOM   5889 C C     . VAL B 1 226 ? 5.661   13.160  -39.307 1.00 39.30  ? 226 VAL B C     1 
ATOM   5890 O O     . VAL B 1 226 ? 5.922   12.414  -40.254 1.00 42.99  ? 226 VAL B O     1 
ATOM   5891 C CB    . VAL B 1 226 ? 3.378   14.095  -39.747 1.00 39.23  ? 226 VAL B CB    1 
ATOM   5892 C CG1   . VAL B 1 226 ? 2.812   13.321  -38.551 1.00 38.56  ? 226 VAL B CG1   1 
ATOM   5893 C CG2   . VAL B 1 226 ? 2.603   15.362  -40.022 1.00 38.43  ? 226 VAL B CG2   1 
ATOM   5894 N N     . LEU B 1 227 ? 6.084   12.933  -38.073 1.00 37.13  ? 227 LEU B N     1 
ATOM   5895 C CA    . LEU B 1 227 ? 6.931   11.791  -37.747 1.00 39.07  ? 227 LEU B CA    1 
ATOM   5896 C C     . LEU B 1 227 ? 6.218   11.042  -36.636 1.00 45.70  ? 227 LEU B C     1 
ATOM   5897 O O     . LEU B 1 227 ? 6.201   11.512  -35.494 1.00 43.07  ? 227 LEU B O     1 
ATOM   5898 C CB    . LEU B 1 227 ? 8.332   12.219  -37.312 1.00 35.91  ? 227 LEU B CB    1 
ATOM   5899 C CG    . LEU B 1 227 ? 9.290   12.715  -38.403 1.00 39.32  ? 227 LEU B CG    1 
ATOM   5900 C CD1   . LEU B 1 227 ? 8.990   14.145  -38.769 1.00 33.28  ? 227 LEU B CD1   1 
ATOM   5901 C CD2   . LEU B 1 227 ? 10.742  12.571  -37.983 1.00 36.02  ? 227 LEU B CD2   1 
ATOM   5902 N N     . GLN B 1 228 ? 5.614   9.896   -36.959 1.00 42.44  ? 228 GLN B N     1 
ATOM   5903 C CA    . GLN B 1 228 ? 4.928   9.086   -35.958 1.00 40.27  ? 228 GLN B CA    1 
ATOM   5904 C C     . GLN B 1 228 ? 5.844   7.936   -35.551 1.00 44.15  ? 228 GLN B C     1 
ATOM   5905 O O     . GLN B 1 228 ? 6.220   7.118   -36.399 1.00 42.10  ? 228 GLN B O     1 
ATOM   5906 C CB    . GLN B 1 228 ? 3.594   8.560   -36.488 1.00 39.46  ? 228 GLN B CB    1 
ATOM   5907 C CG    . GLN B 1 228 ? 2.665   9.633   -37.062 1.00 41.57  ? 228 GLN B CG    1 
ATOM   5908 C CD    . GLN B 1 228 ? 1.467   9.042   -37.809 1.00 44.78  ? 228 GLN B CD    1 
ATOM   5909 O OE1   . GLN B 1 228 ? 0.925   9.661   -38.724 1.00 44.29  ? 228 GLN B OE1   1 
ATOM   5910 N NE2   . GLN B 1 228 ? 1.048   7.846   -37.414 1.00 40.20  ? 228 GLN B NE2   1 
ATOM   5911 N N     . SER B 1 229 ? 6.242   7.908   -34.267 1.00 36.26  ? 229 SER B N     1 
ATOM   5912 C CA    . SER B 1 229 ? 6.938   6.765   -33.660 1.00 36.57  ? 229 SER B CA    1 
ATOM   5913 C C     . SER B 1 229 ? 8.230   6.392   -34.388 1.00 37.98  ? 229 SER B C     1 
ATOM   5914 O O     . SER B 1 229 ? 8.585   5.220   -34.494 1.00 39.60  ? 229 SER B O     1 
ATOM   5915 C CB    . SER B 1 229 ? 6.023   5.547   -33.588 1.00 39.17  ? 229 SER B CB    1 
ATOM   5916 O OG    . SER B 1 229 ? 4.758   5.906   -33.081 1.00 43.60  ? 229 SER B OG    1 
ATOM   5917 N N     . GLY B 1 230 ? 8.950   7.383   -34.887 1.00 37.55  ? 230 GLY B N     1 
ATOM   5918 C CA    . GLY B 1 230 ? 10.231  7.090   -35.498 1.00 34.96  ? 230 GLY B CA    1 
ATOM   5919 C C     . GLY B 1 230 ? 11.026  8.335   -35.830 1.00 36.26  ? 230 GLY B C     1 
ATOM   5920 O O     . GLY B 1 230 ? 10.456  9.411   -36.012 1.00 36.32  ? 230 GLY B O     1 
ATOM   5921 N N     . THR B 1 231 ? 12.346  8.211   -35.913 1.00 37.03  ? 231 THR B N     1 
ATOM   5922 C CA    . THR B 1 231 ? 13.217  9.371   -36.031 1.00 37.42  ? 231 THR B CA    1 
ATOM   5923 C C     . THR B 1 231 ? 14.441  8.996   -36.839 1.00 35.84  ? 231 THR B C     1 
ATOM   5924 O O     . THR B 1 231 ? 14.843  7.829   -36.839 1.00 35.46  ? 231 THR B O     1 
ATOM   5925 C CB    . THR B 1 231 ? 13.683  9.884   -34.656 1.00 41.36  ? 231 THR B CB    1 
ATOM   5926 O OG1   . THR B 1 231 ? 14.430  8.856   -33.985 1.00 38.74  ? 231 THR B OG1   1 
ATOM   5927 C CG2   . THR B 1 231 ? 12.524  10.283  -33.805 1.00 39.47  ? 231 THR B CG2   1 
ATOM   5928 N N     . PRO B 1 232 ? 15.078  9.963   -37.505 1.00 38.69  ? 232 PRO B N     1 
ATOM   5929 C CA    . PRO B 1 232 ? 16.353  9.647   -38.175 1.00 41.54  ? 232 PRO B CA    1 
ATOM   5930 C C     . PRO B 1 232 ? 17.468  9.389   -37.190 1.00 44.99  ? 232 PRO B C     1 
ATOM   5931 O O     . PRO B 1 232 ? 18.272  8.470   -37.391 1.00 47.67  ? 232 PRO B O     1 
ATOM   5932 C CB    . PRO B 1 232 ? 16.622  10.890  -39.036 1.00 41.20  ? 232 PRO B CB    1 
ATOM   5933 C CG    . PRO B 1 232 ? 15.845  11.993  -38.366 1.00 37.14  ? 232 PRO B CG    1 
ATOM   5934 C CD    . PRO B 1 232 ? 14.632  11.344  -37.766 1.00 36.93  ? 232 PRO B CD    1 
ATOM   5935 N N     . ASN B 1 233 ? 17.531  10.181  -36.118 1.00 48.89  ? 233 ASN B N     1 
ATOM   5936 C CA    . ASN B 1 233 ? 18.448  9.920   -35.021 1.00 49.67  ? 233 ASN B CA    1 
ATOM   5937 C C     . ASN B 1 233 ? 18.058  8.624   -34.314 1.00 45.50  ? 233 ASN B C     1 
ATOM   5938 O O     . ASN B 1 233 ? 16.980  8.056   -34.534 1.00 42.00  ? 233 ASN B O     1 
ATOM   5939 C CB    . ASN B 1 233 ? 18.481  11.098  -34.036 1.00 42.51  ? 233 ASN B CB    1 
ATOM   5940 C CG    . ASN B 1 233 ? 17.096  11.560  -33.613 1.00 44.41  ? 233 ASN B CG    1 
ATOM   5941 O OD1   . ASN B 1 233 ? 16.255  11.883  -34.446 1.00 48.31  ? 233 ASN B OD1   1 
ATOM   5942 N ND2   . ASN B 1 233 ? 16.854  11.595  -32.304 1.00 45.98  ? 233 ASN B ND2   1 
ATOM   5943 N N     . GLY B 1 234 ? 18.980  8.131   -33.495 1.00 42.20  ? 234 GLY B N     1 
ATOM   5944 C CA    . GLY B 1 234 ? 18.709  6.984   -32.666 1.00 42.65  ? 234 GLY B CA    1 
ATOM   5945 C C     . GLY B 1 234 ? 19.476  5.755   -33.088 1.00 44.19  ? 234 GLY B C     1 
ATOM   5946 O O     . GLY B 1 234 ? 20.248  5.767   -34.048 1.00 49.66  ? 234 GLY B O     1 
ATOM   5947 N N     . PRO B 1 235 ? 19.234  4.649   -32.388 1.00 40.90  ? 235 PRO B N     1 
ATOM   5948 C CA    . PRO B 1 235 ? 20.093  3.467   -32.524 1.00 44.08  ? 235 PRO B CA    1 
ATOM   5949 C C     . PRO B 1 235 ? 19.808  2.568   -33.720 1.00 53.41  ? 235 PRO B C     1 
ATOM   5950 O O     . PRO B 1 235 ? 20.630  1.684   -33.999 1.00 54.94  ? 235 PRO B O     1 
ATOM   5951 C CB    . PRO B 1 235 ? 19.825  2.709   -31.225 1.00 48.62  ? 235 PRO B CB    1 
ATOM   5952 C CG    . PRO B 1 235 ? 18.420  3.070   -30.892 1.00 51.05  ? 235 PRO B CG    1 
ATOM   5953 C CD    . PRO B 1 235 ? 18.235  4.501   -31.322 1.00 45.93  ? 235 PRO B CD    1 
ATOM   5954 N N     . TRP B 1 236 ? 18.692  2.725   -34.433 1.00 51.12  ? 236 TRP B N     1 
ATOM   5955 C CA    . TRP B 1 236 ? 18.345  1.748   -35.454 1.00 45.50  ? 236 TRP B CA    1 
ATOM   5956 C C     . TRP B 1 236 ? 18.131  2.319   -36.849 1.00 51.25  ? 236 TRP B C     1 
ATOM   5957 O O     . TRP B 1 236 ? 18.067  1.540   -37.802 1.00 50.96  ? 236 TRP B O     1 
ATOM   5958 C CB    . TRP B 1 236 ? 17.084  0.983   -35.048 1.00 43.71  ? 236 TRP B CB    1 
ATOM   5959 C CG    . TRP B 1 236 ? 15.907  1.857   -34.844 1.00 46.01  ? 236 TRP B CG    1 
ATOM   5960 C CD1   . TRP B 1 236 ? 15.455  2.347   -33.657 1.00 48.85  ? 236 TRP B CD1   1 
ATOM   5961 C CD2   . TRP B 1 236 ? 15.011  2.345   -35.847 1.00 47.28  ? 236 TRP B CD2   1 
ATOM   5962 N NE1   . TRP B 1 236 ? 14.331  3.114   -33.854 1.00 47.81  ? 236 TRP B NE1   1 
ATOM   5963 C CE2   . TRP B 1 236 ? 14.036  3.131   -35.189 1.00 48.33  ? 236 TRP B CE2   1 
ATOM   5964 C CE3   . TRP B 1 236 ? 14.934  2.196   -37.234 1.00 45.46  ? 236 TRP B CE3   1 
ATOM   5965 C CZ2   . TRP B 1 236 ? 12.997  3.764   -35.872 1.00 45.06  ? 236 TRP B CZ2   1 
ATOM   5966 C CZ3   . TRP B 1 236 ? 13.908  2.830   -37.913 1.00 46.43  ? 236 TRP B CZ3   1 
ATOM   5967 C CH2   . TRP B 1 236 ? 12.950  3.601   -37.232 1.00 47.53  ? 236 TRP B CH2   1 
ATOM   5968 N N     . ALA B 1 237 ? 18.026  3.638   -37.005 1.00 54.33  ? 237 ALA B N     1 
ATOM   5969 C CA    . ALA B 1 237 ? 17.614  4.215   -38.279 1.00 44.75  ? 237 ALA B CA    1 
ATOM   5970 C C     . ALA B 1 237 ? 18.760  4.360   -39.274 1.00 47.61  ? 237 ALA B C     1 
ATOM   5971 O O     . ALA B 1 237 ? 18.516  4.383   -40.487 1.00 47.36  ? 237 ALA B O     1 
ATOM   5972 C CB    . ALA B 1 237 ? 16.965  5.576   -38.043 1.00 44.70  ? 237 ALA B CB    1 
ATOM   5973 N N     . THR B 1 238 ? 19.998  4.493   -38.810 1.00 47.30  ? 238 THR B N     1 
ATOM   5974 C CA    . THR B 1 238 ? 21.127  4.611   -39.717 1.00 46.22  ? 238 THR B CA    1 
ATOM   5975 C C     . THR B 1 238 ? 22.205  3.620   -39.316 1.00 46.65  ? 238 THR B C     1 
ATOM   5976 O O     . THR B 1 238 ? 22.125  2.959   -38.281 1.00 42.56  ? 238 THR B O     1 
ATOM   5977 C CB    . THR B 1 238 ? 21.718  6.031   -39.745 1.00 48.67  ? 238 THR B CB    1 
ATOM   5978 O OG1   . THR B 1 238 ? 22.291  6.343   -38.471 1.00 48.64  ? 238 THR B OG1   1 
ATOM   5979 C CG2   . THR B 1 238 ? 20.657  7.050   -40.089 1.00 45.56  ? 238 THR B CG2   1 
ATOM   5980 N N     . VAL B 1 239 ? 23.194  3.491   -40.196 1.00 49.63  ? 239 VAL B N     1 
ATOM   5981 C CA    . VAL B 1 239 ? 24.443  2.805   -39.909 1.00 45.47  ? 239 VAL B CA    1 
ATOM   5982 C C     . VAL B 1 239 ? 25.569  3.605   -40.539 1.00 50.90  ? 239 VAL B C     1 
ATOM   5983 O O     . VAL B 1 239 ? 25.377  4.331   -41.521 1.00 50.07  ? 239 VAL B O     1 
ATOM   5984 C CB    . VAL B 1 239 ? 24.475  1.352   -40.425 1.00 48.62  ? 239 VAL B CB    1 
ATOM   5985 C CG1   . VAL B 1 239 ? 23.529  0.489   -39.621 1.00 53.22  ? 239 VAL B CG1   1 
ATOM   5986 C CG2   . VAL B 1 239 ? 24.137  1.289   -41.909 1.00 43.32  ? 239 VAL B CG2   1 
ATOM   5987 N N     . SER B 1 240 ? 26.747  3.487   -39.950 1.00 53.15  ? 240 SER B N     1 
ATOM   5988 C CA    . SER B 1 240 ? 27.922  4.094   -40.538 1.00 54.29  ? 240 SER B CA    1 
ATOM   5989 C C     . SER B 1 240 ? 28.212  3.458   -41.887 1.00 52.88  ? 240 SER B C     1 
ATOM   5990 O O     . SER B 1 240 ? 27.819  2.318   -42.162 1.00 50.77  ? 240 SER B O     1 
ATOM   5991 C CB    . SER B 1 240 ? 29.122  3.905   -39.622 1.00 54.14  ? 240 SER B CB    1 
ATOM   5992 O OG    . SER B 1 240 ? 29.343  2.518   -39.414 1.00 54.60  ? 240 SER B OG    1 
ATOM   5993 N N     . ALA B 1 241 ? 28.932  4.205   -42.728 1.00 53.97  ? 241 ALA B N     1 
ATOM   5994 C CA    . ALA B 1 241 ? 29.432  3.613   -43.967 1.00 51.98  ? 241 ALA B CA    1 
ATOM   5995 C C     . ALA B 1 241 ? 30.289  2.387   -43.681 1.00 56.27  ? 241 ALA B C     1 
ATOM   5996 O O     . ALA B 1 241 ? 30.309  1.445   -44.484 1.00 58.46  ? 241 ALA B O     1 
ATOM   5997 C CB    . ALA B 1 241 ? 30.217  4.645   -44.776 1.00 44.41  ? 241 ALA B CB    1 
ATOM   5998 N N     . GLY B 1 242 ? 30.972  2.363   -42.532 1.00 58.79  ? 242 GLY B N     1 
ATOM   5999 C CA    . GLY B 1 242 ? 31.760  1.216   -42.141 1.00 47.41  ? 242 GLY B CA    1 
ATOM   6000 C C     . GLY B 1 242 ? 30.898  -0.011  -41.962 1.00 53.91  ? 242 GLY B C     1 
ATOM   6001 O O     . GLY B 1 242 ? 31.088  -1.025  -42.644 1.00 55.48  ? 242 GLY B O     1 
ATOM   6002 N N     . GLU B 1 243 ? 29.924  0.080   -41.052 1.00 56.92  ? 243 GLU B N     1 
ATOM   6003 C CA    . GLU B 1 243 ? 29.107  -1.084  -40.714 1.00 53.41  ? 243 GLU B CA    1 
ATOM   6004 C C     . GLU B 1 243 ? 28.206  -1.506  -41.871 1.00 54.91  ? 243 GLU B C     1 
ATOM   6005 O O     . GLU B 1 243 ? 27.839  -2.685  -41.962 1.00 51.14  ? 243 GLU B O     1 
ATOM   6006 C CB    . GLU B 1 243 ? 28.280  -0.792  -39.461 1.00 44.05  ? 243 GLU B CB    1 
ATOM   6007 C CG    . GLU B 1 243 ? 27.276  -1.863  -39.057 1.00 45.42  ? 243 GLU B CG    1 
ATOM   6008 C CD    . GLU B 1 243 ? 27.924  -3.136  -38.564 1.00 49.73  ? 243 GLU B CD    1 
ATOM   6009 O OE1   . GLU B 1 243 ? 27.193  -4.033  -38.089 1.00 50.74  ? 243 GLU B OE1   1 
ATOM   6010 O OE2   . GLU B 1 243 ? 29.163  -3.246  -38.644 1.00 54.13  ? 243 GLU B OE2   1 
ATOM   6011 N N     . ALA B 1 244 ? 27.833  -0.568  -42.750 1.00 51.02  ? 244 ALA B N     1 
ATOM   6012 C CA    . ALA B 1 244 ? 27.073  -0.943  -43.938 1.00 52.96  ? 244 ALA B CA    1 
ATOM   6013 C C     . ALA B 1 244 ? 27.914  -1.827  -44.839 1.00 56.96  ? 244 ALA B C     1 
ATOM   6014 O O     . ALA B 1 244 ? 27.489  -2.919  -45.237 1.00 58.12  ? 244 ALA B O     1 
ATOM   6015 C CB    . ALA B 1 244 ? 26.614  0.299   -44.702 1.00 53.38  ? 244 ALA B CB    1 
ATOM   6016 N N     . ARG B 1 245 ? 29.131  -1.377  -45.142 1.00 54.35  ? 245 ARG B N     1 
ATOM   6017 C CA    . ARG B 1 245 ? 30.034  -2.167  -45.963 1.00 55.01  ? 245 ARG B CA    1 
ATOM   6018 C C     . ARG B 1 245 ? 30.249  -3.555  -45.382 1.00 58.99  ? 245 ARG B C     1 
ATOM   6019 O O     . ARG B 1 245 ? 30.347  -4.536  -46.129 1.00 67.08  ? 245 ARG B O     1 
ATOM   6020 C CB    . ARG B 1 245 ? 31.370  -1.450  -46.110 1.00 54.35  ? 245 ARG B CB    1 
ATOM   6021 C CG    . ARG B 1 245 ? 32.494  -2.361  -46.540 1.00 51.65  ? 245 ARG B CG    1 
ATOM   6022 C CD    . ARG B 1 245 ? 33.659  -1.544  -46.998 1.00 50.29  ? 245 ARG B CD    1 
ATOM   6023 N NE    . ARG B 1 245 ? 33.203  -0.526  -47.922 1.00 54.99  ? 245 ARG B NE    1 
ATOM   6024 C CZ    . ARG B 1 245 ? 33.079  -0.740  -49.228 1.00 63.66  ? 245 ARG B CZ    1 
ATOM   6025 N NH1   . ARG B 1 245 ? 32.652  0.237   -50.027 1.00 61.99  ? 245 ARG B NH1   1 
ATOM   6026 N NH2   . ARG B 1 245 ? 33.372  -1.941  -49.728 1.00 59.21  ? 245 ARG B NH2   1 
ATOM   6027 N N     . ARG B 1 246 ? 30.325  -3.663  -44.057 1.00 50.86  ? 246 ARG B N     1 
ATOM   6028 C CA    . ARG B 1 246 ? 30.571  -4.964  -43.455 1.00 52.35  ? 246 ARG B CA    1 
ATOM   6029 C C     . ARG B 1 246 ? 29.416  -5.912  -43.719 1.00 57.06  ? 246 ARG B C     1 
ATOM   6030 O O     . ARG B 1 246 ? 29.626  -7.080  -44.068 1.00 59.89  ? 246 ARG B O     1 
ATOM   6031 C CB    . ARG B 1 246 ? 30.800  -4.829  -41.946 1.00 59.98  ? 246 ARG B CB    1 
ATOM   6032 C CG    . ARG B 1 246 ? 31.001  -6.179  -41.256 1.00 54.23  ? 246 ARG B CG    1 
ATOM   6033 C CD    . ARG B 1 246 ? 30.903  -6.104  -39.762 1.00 51.41  ? 246 ARG B CD    1 
ATOM   6034 N NE    . ARG B 1 246 ? 29.527  -5.981  -39.301 1.00 53.93  ? 246 ARG B NE    1 
ATOM   6035 C CZ    . ARG B 1 246 ? 28.717  -7.006  -39.055 1.00 53.21  ? 246 ARG B CZ    1 
ATOM   6036 N NH1   . ARG B 1 246 ? 29.134  -8.253  -39.231 1.00 47.71  ? 246 ARG B NH1   1 
ATOM   6037 N NH2   . ARG B 1 246 ? 27.481  -6.778  -38.632 1.00 52.96  ? 246 ARG B NH2   1 
ATOM   6038 N N     . ARG B 1 247 ? 28.183  -5.436  -43.528 1.00 59.00  ? 247 ARG B N     1 
ATOM   6039 C CA    . ARG B 1 247 ? 27.035  -6.323  -43.680 1.00 61.06  ? 247 ARG B CA    1 
ATOM   6040 C C     . ARG B 1 247 ? 26.845  -6.712  -45.138 1.00 62.57  ? 247 ARG B C     1 
ATOM   6041 O O     . ARG B 1 247 ? 26.458  -7.852  -45.434 1.00 64.18  ? 247 ARG B O     1 
ATOM   6042 C CB    . ARG B 1 247 ? 25.773  -5.664  -43.116 1.00 54.30  ? 247 ARG B CB    1 
ATOM   6043 C CG    . ARG B 1 247 ? 25.916  -5.186  -41.665 1.00 57.77  ? 247 ARG B CG    1 
ATOM   6044 C CD    . ARG B 1 247 ? 24.739  -4.317  -41.231 1.00 50.53  ? 247 ARG B CD    1 
ATOM   6045 N NE    . ARG B 1 247 ? 24.842  -3.918  -39.838 1.00 52.34  ? 247 ARG B NE    1 
ATOM   6046 C CZ    . ARG B 1 247 ? 23.815  -3.507  -39.097 1.00 58.02  ? 247 ARG B CZ    1 
ATOM   6047 N NH1   . ARG B 1 247 ? 22.595  -3.440  -39.625 1.00 54.65  ? 247 ARG B NH1   1 
ATOM   6048 N NH2   . ARG B 1 247 ? 24.003  -3.173  -37.826 1.00 47.87  ? 247 ARG B NH2   1 
ATOM   6049 N N     . ALA B 1 248 ? 27.139  -5.786  -46.054 1.00 58.13  ? 248 ALA B N     1 
ATOM   6050 C CA    . ALA B 1 248 ? 27.071  -6.084  -47.480 1.00 59.59  ? 248 ALA B CA    1 
ATOM   6051 C C     . ALA B 1 248 ? 28.026  -7.213  -47.846 1.00 66.26  ? 248 ALA B C     1 
ATOM   6052 O O     . ALA B 1 248 ? 27.613  -8.248  -48.384 1.00 65.22  ? 248 ALA B O     1 
ATOM   6053 C CB    . ALA B 1 248 ? 27.390  -4.826  -48.289 1.00 58.76  ? 248 ALA B CB    1 
ATOM   6054 N N     . THR B 1 249 ? 29.316  -7.040  -47.537 1.00 64.64  ? 249 THR B N     1 
ATOM   6055 C CA    . THR B 1 249 ? 30.291  -8.052  -47.921 1.00 64.17  ? 249 THR B CA    1 
ATOM   6056 C C     . THR B 1 249 ? 30.129  -9.343  -47.126 1.00 59.52  ? 249 THR B C     1 
ATOM   6057 O O     . THR B 1 249 ? 30.652  -10.382 -47.538 1.00 64.08  ? 249 THR B O     1 
ATOM   6058 C CB    . THR B 1 249 ? 31.711  -7.518  -47.759 1.00 56.96  ? 249 THR B CB    1 
ATOM   6059 O OG1   . THR B 1 249 ? 32.014  -7.456  -46.379 1.00 67.97  ? 249 THR B OG1   1 
ATOM   6060 C CG2   . THR B 1 249 ? 31.847  -6.112  -48.330 1.00 58.16  ? 249 THR B CG2   1 
ATOM   6061 N N     . LEU B 1 250 ? 29.415  -9.314  -46.004 1.00 57.97  ? 250 LEU B N     1 
ATOM   6062 C CA    . LEU B 1 250 ? 29.210  -10.563 -45.284 1.00 62.17  ? 250 LEU B CA    1 
ATOM   6063 C C     . LEU B 1 250 ? 28.068  -11.346 -45.903 1.00 60.87  ? 250 LEU B C     1 
ATOM   6064 O O     . LEU B 1 250 ? 28.204  -12.542 -46.171 1.00 63.01  ? 250 LEU B O     1 
ATOM   6065 C CB    . LEU B 1 250 ? 28.953  -10.325 -43.789 1.00 61.36  ? 250 LEU B CB    1 
ATOM   6066 C CG    . LEU B 1 250 ? 28.443  -11.596 -43.092 1.00 56.79  ? 250 LEU B CG    1 
ATOM   6067 C CD1   . LEU B 1 250 ? 29.488  -12.706 -43.125 1.00 58.03  ? 250 LEU B CD1   1 
ATOM   6068 C CD2   . LEU B 1 250 ? 28.015  -11.317 -41.669 1.00 48.89  ? 250 LEU B CD2   1 
ATOM   6069 N N     . LEU B 1 251 ? 26.945  -10.676 -46.162 1.00 62.10  ? 251 LEU B N     1 
ATOM   6070 C CA    . LEU B 1 251 ? 25.842  -11.327 -46.858 1.00 64.19  ? 251 LEU B CA    1 
ATOM   6071 C C     . LEU B 1 251 ? 26.293  -11.868 -48.211 1.00 59.47  ? 251 LEU B C     1 
ATOM   6072 O O     . LEU B 1 251 ? 25.892  -12.964 -48.612 1.00 57.74  ? 251 LEU B O     1 
ATOM   6073 C CB    . LEU B 1 251 ? 24.671  -10.365 -47.041 1.00 60.81  ? 251 LEU B CB    1 
ATOM   6074 C CG    . LEU B 1 251 ? 23.495  -11.005 -47.686 1.00 58.68  ? 251 LEU B CG    1 
ATOM   6075 C CD1   . LEU B 1 251 ? 22.297  -10.992 -46.811 1.00 61.01  ? 251 LEU B CD1   1 
ATOM   6076 C CD2   . LEU B 1 251 ? 23.264  -10.335 -48.988 1.00 52.39  ? 251 LEU B CD2   1 
ATOM   6077 N N     . ALA B 1 252 ? 27.122  -11.104 -48.927 1.00 58.66  ? 252 ALA B N     1 
ATOM   6078 C CA    . ALA B 1 252 ? 27.693  -11.604 -50.176 1.00 63.78  ? 252 ALA B CA    1 
ATOM   6079 C C     . ALA B 1 252 ? 28.382  -12.929 -49.947 1.00 64.80  ? 252 ALA B C     1 
ATOM   6080 O O     . ALA B 1 252 ? 28.299  -13.841 -50.776 1.00 66.11  ? 252 ALA B O     1 
ATOM   6081 C CB    . ALA B 1 252 ? 28.685  -10.599 -50.752 1.00 63.00  ? 252 ALA B CB    1 
ATOM   6082 N N     . ARG B 1 253 ? 29.056  -13.055 -48.816 1.00 61.09  ? 253 ARG B N     1 
ATOM   6083 C CA    . ARG B 1 253 ? 29.765  -14.285 -48.540 1.00 61.92  ? 253 ARG B CA    1 
ATOM   6084 C C     . ARG B 1 253 ? 28.791  -15.427 -48.266 1.00 61.40  ? 253 ARG B C     1 
ATOM   6085 O O     . ARG B 1 253 ? 29.001  -16.551 -48.733 1.00 62.84  ? 253 ARG B O     1 
ATOM   6086 C CB    . ARG B 1 253 ? 30.727  -14.053 -47.383 1.00 60.01  ? 253 ARG B CB    1 
ATOM   6087 C CG    . ARG B 1 253 ? 31.228  -15.314 -46.765 1.00 65.04  ? 253 ARG B CG    1 
ATOM   6088 C CD    . ARG B 1 253 ? 32.432  -15.055 -45.856 1.00 70.12  ? 253 ARG B CD    1 
ATOM   6089 N NE    . ARG B 1 253 ? 33.097  -16.288 -45.478 1.00 82.11  ? 253 ARG B NE    1 
ATOM   6090 C CZ    . ARG B 1 253 ? 33.332  -16.661 -44.213 1.00 85.12  ? 253 ARG B CZ    1 
ATOM   6091 N NH1   . ARG B 1 253 ? 32.951  -15.916 -43.176 1.00 79.76  ? 253 ARG B NH1   1 
ATOM   6092 N NH2   . ARG B 1 253 ? 33.939  -17.812 -43.968 1.00 80.25  ? 253 ARG B NH2   1 
ATOM   6093 N N     . LEU B 1 254 ? 27.705  -15.161 -47.546 1.00 60.87  ? 254 LEU B N     1 
ATOM   6094 C CA    . LEU B 1 254 ? 26.750  -16.229 -47.280 1.00 63.03  ? 254 LEU B CA    1 
ATOM   6095 C C     . LEU B 1 254 ? 25.881  -16.577 -48.472 1.00 58.81  ? 254 LEU B C     1 
ATOM   6096 O O     . LEU B 1 254 ? 25.013  -17.441 -48.333 1.00 57.31  ? 254 LEU B O     1 
ATOM   6097 C CB    . LEU B 1 254 ? 25.827  -15.891 -46.102 1.00 64.80  ? 254 LEU B CB    1 
ATOM   6098 C CG    . LEU B 1 254 ? 26.415  -15.733 -44.713 1.00 61.39  ? 254 LEU B CG    1 
ATOM   6099 C CD1   . LEU B 1 254 ? 26.704  -14.318 -44.518 1.00 61.89  ? 254 LEU B CD1   1 
ATOM   6100 C CD2   . LEU B 1 254 ? 25.426  -16.198 -43.698 1.00 62.81  ? 254 LEU B CD2   1 
ATOM   6101 N N     . VAL B 1 255 ? 26.057  -15.919 -49.617 1.00 61.57  ? 255 VAL B N     1 
ATOM   6102 C CA    . VAL B 1 255 ? 25.351  -16.309 -50.832 1.00 60.97  ? 255 VAL B CA    1 
ATOM   6103 C C     . VAL B 1 255 ? 26.292  -16.776 -51.921 1.00 63.19  ? 255 VAL B C     1 
ATOM   6104 O O     . VAL B 1 255 ? 25.828  -17.135 -53.010 1.00 69.34  ? 255 VAL B O     1 
ATOM   6105 C CB    . VAL B 1 255 ? 24.444  -15.178 -51.355 1.00 60.37  ? 255 VAL B CB    1 
ATOM   6106 C CG1   . VAL B 1 255 ? 23.310  -14.921 -50.376 1.00 55.58  ? 255 VAL B CG1   1 
ATOM   6107 C CG2   . VAL B 1 255 ? 25.241  -13.917 -51.594 1.00 57.96  ? 255 VAL B CG2   1 
ATOM   6108 N N     . GLY B 1 256 ? 27.597  -16.785 -51.670 1.00 62.91  ? 256 GLY B N     1 
ATOM   6109 C CA    . GLY B 1 256 ? 28.566  -17.254 -52.635 1.00 60.28  ? 256 GLY B CA    1 
ATOM   6110 C C     . GLY B 1 256 ? 29.435  -16.195 -53.273 1.00 61.63  ? 256 GLY B C     1 
ATOM   6111 O O     . GLY B 1 256 ? 30.220  -16.526 -54.164 1.00 67.09  ? 256 GLY B O     1 
ATOM   6112 N N     . CYS B 1 257 ? 29.351  -14.944 -52.843 1.00 63.46  ? 257 CYS B N     1 
ATOM   6113 C CA    . CYS B 1 257 ? 30.080  -13.890 -53.533 1.00 68.28  ? 257 CYS B CA    1 
ATOM   6114 C C     . CYS B 1 257 ? 31.237  -13.313 -52.719 1.00 65.49  ? 257 CYS B C     1 
ATOM   6115 O O     . CYS B 1 257 ? 32.326  -13.101 -53.265 1.00 69.91  ? 257 CYS B O     1 
ATOM   6116 C CB    . CYS B 1 257 ? 29.104  -12.778 -53.944 1.00 69.57  ? 257 CYS B CB    1 
ATOM   6117 S SG    . CYS B 1 257 ? 27.610  -13.361 -54.881 1.00 82.90  ? 257 CYS B SG    1 
ATOM   6118 N N     . ASN B 1 265 ? 37.386  -6.163  -54.929 1.00 68.89  ? 265 ASN B N     1 
ATOM   6119 C CA    . ASN B 1 265 ? 36.724  -5.380  -55.972 1.00 76.28  ? 265 ASN B CA    1 
ATOM   6120 C C     . ASN B 1 265 ? 35.233  -5.226  -55.645 1.00 73.88  ? 265 ASN B C     1 
ATOM   6121 O O     . ASN B 1 265 ? 34.530  -6.223  -55.426 1.00 70.73  ? 265 ASN B O     1 
ATOM   6122 C CB    . ASN B 1 265 ? 36.926  -6.049  -57.345 1.00 76.77  ? 265 ASN B CB    1 
ATOM   6123 C CG    . ASN B 1 265 ? 36.625  -5.117  -58.527 1.00 80.34  ? 265 ASN B CG    1 
ATOM   6124 O OD1   . ASN B 1 265 ? 35.542  -4.529  -58.618 1.00 78.64  ? 265 ASN B OD1   1 
ATOM   6125 N ND2   . ASN B 1 265 ? 37.582  -5.008  -59.457 1.00 82.35  ? 265 ASN B ND2   1 
ATOM   6126 N N     . ASP B 1 266 ? 34.756  -3.977  -55.596 1.00 67.29  ? 266 ASP B N     1 
ATOM   6127 C CA    . ASP B 1 266 ? 33.335  -3.737  -55.355 1.00 66.09  ? 266 ASP B CA    1 
ATOM   6128 C C     . ASP B 1 266 ? 32.487  -4.198  -56.545 1.00 72.44  ? 266 ASP B C     1 
ATOM   6129 O O     . ASP B 1 266 ? 31.492  -4.919  -56.372 1.00 65.64  ? 266 ASP B O     1 
ATOM   6130 C CB    . ASP B 1 266 ? 33.100  -2.252  -55.041 1.00 68.12  ? 266 ASP B CB    1 
ATOM   6131 C CG    . ASP B 1 266 ? 33.245  -1.914  -53.524 1.00 72.09  ? 266 ASP B CG    1 
ATOM   6132 O OD1   . ASP B 1 266 ? 33.333  -2.837  -52.679 1.00 68.33  ? 266 ASP B OD1   1 
ATOM   6133 O OD2   . ASP B 1 266 ? 33.256  -0.709  -53.173 1.00 65.81  ? 266 ASP B OD2   1 
ATOM   6134 N N     . THR B 1 267 ? 32.895  -3.827  -57.769 1.00 72.66  ? 267 THR B N     1 
ATOM   6135 C CA    . THR B 1 267 ? 32.098  -4.119  -58.958 1.00 67.78  ? 267 THR B CA    1 
ATOM   6136 C C     . THR B 1 267 ? 31.894  -5.611  -59.160 1.00 68.29  ? 267 THR B C     1 
ATOM   6137 O O     . THR B 1 267 ? 30.805  -6.052  -59.555 1.00 63.75  ? 267 THR B O     1 
ATOM   6138 C CB    . THR B 1 267 ? 32.770  -3.536  -60.186 1.00 68.82  ? 267 THR B CB    1 
ATOM   6139 O OG1   . THR B 1 267 ? 33.229  -2.216  -59.881 1.00 73.37  ? 267 THR B OG1   1 
ATOM   6140 C CG2   . THR B 1 267 ? 31.777  -3.479  -61.322 1.00 66.74  ? 267 THR B CG2   1 
ATOM   6141 N N     . GLU B 1 268 ? 32.940  -6.400  -58.929 1.00 68.47  ? 268 GLU B N     1 
ATOM   6142 C CA    . GLU B 1 268 ? 32.803  -7.839  -59.101 1.00 68.57  ? 268 GLU B CA    1 
ATOM   6143 C C     . GLU B 1 268 ? 31.874  -8.431  -58.058 1.00 64.58  ? 268 GLU B C     1 
ATOM   6144 O O     . GLU B 1 268 ? 31.157  -9.396  -58.344 1.00 61.38  ? 268 GLU B O     1 
ATOM   6145 C CB    . GLU B 1 268 ? 34.171  -8.523  -59.044 1.00 73.21  ? 268 GLU B CB    1 
ATOM   6146 C CG    . GLU B 1 268 ? 35.296  -7.804  -59.798 1.00 78.94  ? 268 GLU B CG    1 
ATOM   6147 C CD    . GLU B 1 268 ? 35.213  -7.890  -61.324 1.00 86.76  ? 268 GLU B CD    1 
ATOM   6148 O OE1   . GLU B 1 268 ? 36.289  -7.981  -61.959 1.00 89.96  ? 268 GLU B OE1   1 
ATOM   6149 O OE2   . GLU B 1 268 ? 34.096  -7.848  -61.896 1.00 83.75  ? 268 GLU B OE2   1 
ATOM   6150 N N     . LEU B 1 269 ? 31.859  -7.861  -56.850 1.00 69.22  ? 269 LEU B N     1 
ATOM   6151 C CA    . LEU B 1 269 ? 31.038  -8.427  -55.787 1.00 63.72  ? 269 LEU B CA    1 
ATOM   6152 C C     . LEU B 1 269 ? 29.572  -8.087  -56.000 1.00 62.93  ? 269 LEU B C     1 
ATOM   6153 O O     . LEU B 1 269 ? 28.696  -8.938  -55.810 1.00 61.84  ? 269 LEU B O     1 
ATOM   6154 C CB    . LEU B 1 269 ? 31.507  -7.939  -54.412 1.00 64.74  ? 269 LEU B CB    1 
ATOM   6155 C CG    . LEU B 1 269 ? 30.813  -8.509  -53.159 1.00 64.45  ? 269 LEU B CG    1 
ATOM   6156 C CD1   . LEU B 1 269 ? 31.784  -8.526  -51.973 1.00 63.97  ? 269 LEU B CD1   1 
ATOM   6157 C CD2   . LEU B 1 269 ? 29.507  -7.787  -52.783 1.00 62.45  ? 269 LEU B CD2   1 
ATOM   6158 N N     . ILE B 1 270 ? 29.290  -6.837  -56.368 1.00 61.75  ? 270 ILE B N     1 
ATOM   6159 C CA    . ILE B 1 270 ? 27.909  -6.434  -56.601 1.00 63.58  ? 270 ILE B CA    1 
ATOM   6160 C C     . ILE B 1 270 ? 27.331  -7.216  -57.770 1.00 63.63  ? 270 ILE B C     1 
ATOM   6161 O O     . ILE B 1 270 ? 26.186  -7.683  -57.718 1.00 58.75  ? 270 ILE B O     1 
ATOM   6162 C CB    . ILE B 1 270 ? 27.835  -4.912  -56.818 1.00 63.43  ? 270 ILE B CB    1 
ATOM   6163 C CG1   . ILE B 1 270 ? 27.932  -4.203  -55.471 1.00 64.92  ? 270 ILE B CG1   1 
ATOM   6164 C CG2   . ILE B 1 270 ? 26.543  -4.536  -57.518 1.00 59.48  ? 270 ILE B CG2   1 
ATOM   6165 C CD1   . ILE B 1 270 ? 28.601  -2.860  -55.547 1.00 66.56  ? 270 ILE B CD1   1 
ATOM   6166 N N     . ALA B 1 271 ? 28.123  -7.393  -58.834 1.00 64.36  ? 271 ALA B N     1 
ATOM   6167 C CA    . ALA B 1 271 ? 27.657  -8.152  -59.989 1.00 57.90  ? 271 ALA B CA    1 
ATOM   6168 C C     . ALA B 1 271 ? 27.164  -9.534  -59.582 1.00 58.11  ? 271 ALA B C     1 
ATOM   6169 O O     . ALA B 1 271 ? 26.049  -9.936  -59.936 1.00 55.32  ? 271 ALA B O     1 
ATOM   6170 C CB    . ALA B 1 271 ? 28.772  -8.257  -61.020 1.00 60.79  ? 271 ALA B CB    1 
ATOM   6171 N N     . CYS B 1 272 ? 27.970  -10.269 -58.807 1.00 58.91  ? 272 CYS B N     1 
ATOM   6172 C CA    . CYS B 1 272 ? 27.548  -11.602 -58.389 1.00 55.80  ? 272 CYS B CA    1 
ATOM   6173 C C     . CYS B 1 272 ? 26.287  -11.544 -57.535 1.00 62.37  ? 272 CYS B C     1 
ATOM   6174 O O     . CYS B 1 272 ? 25.462  -12.467 -57.592 1.00 65.11  ? 272 CYS B O     1 
ATOM   6175 C CB    . CYS B 1 272 ? 28.682  -12.310 -57.648 1.00 53.15  ? 272 CYS B CB    1 
ATOM   6176 S SG    . CYS B 1 272 ? 28.225  -13.880 -56.822 1.00 76.95  ? 272 CYS B SG    1 
ATOM   6177 N N     . LEU B 1 273 ? 26.107  -10.467 -56.754 1.00 60.08  ? 273 LEU B N     1 
ATOM   6178 C CA    . LEU B 1 273 ? 24.876  -10.312 -55.977 1.00 60.21  ? 273 LEU B CA    1 
ATOM   6179 C C     . LEU B 1 273 ? 23.673  -10.084 -56.886 1.00 58.60  ? 273 LEU B C     1 
ATOM   6180 O O     . LEU B 1 273 ? 22.582  -10.613 -56.629 1.00 55.46  ? 273 LEU B O     1 
ATOM   6181 C CB    . LEU B 1 273 ? 25.005  -9.157  -54.976 1.00 60.96  ? 273 LEU B CB    1 
ATOM   6182 C CG    . LEU B 1 273 ? 25.710  -9.376  -53.635 1.00 57.78  ? 273 LEU B CG    1 
ATOM   6183 C CD1   . LEU B 1 273 ? 25.744  -8.075  -52.844 1.00 58.03  ? 273 LEU B CD1   1 
ATOM   6184 C CD2   . LEU B 1 273 ? 25.048  -10.488 -52.828 1.00 56.80  ? 273 LEU B CD2   1 
ATOM   6185 N N     . ARG B 1 274 ? 23.855  -9.309  -57.962 1.00 57.39  ? 274 ARG B N     1 
ATOM   6186 C CA    . ARG B 1 274 ? 22.776  -9.078  -58.917 1.00 56.62  ? 274 ARG B CA    1 
ATOM   6187 C C     . ARG B 1 274 ? 22.352  -10.343 -59.653 1.00 57.66  ? 274 ARG B C     1 
ATOM   6188 O O     . ARG B 1 274 ? 21.314  -10.323 -60.326 1.00 60.85  ? 274 ARG B O     1 
ATOM   6189 C CB    . ARG B 1 274 ? 23.175  -7.999  -59.923 1.00 52.88  ? 274 ARG B CB    1 
ATOM   6190 C CG    . ARG B 1 274 ? 22.962  -6.590  -59.405 1.00 54.50  ? 274 ARG B CG    1 
ATOM   6191 C CD    . ARG B 1 274 ? 23.152  -5.585  -60.500 1.00 56.62  ? 274 ARG B CD    1 
ATOM   6192 N NE    . ARG B 1 274 ? 24.426  -5.841  -61.148 1.00 61.78  ? 274 ARG B NE    1 
ATOM   6193 C CZ    . ARG B 1 274 ? 25.466  -5.018  -61.105 1.00 66.19  ? 274 ARG B CZ    1 
ATOM   6194 N NH1   . ARG B 1 274 ? 25.372  -3.847  -60.456 1.00 61.74  ? 274 ARG B NH1   1 
ATOM   6195 N NH2   . ARG B 1 274 ? 26.591  -5.372  -61.724 1.00 58.25  ? 274 ARG B NH2   1 
ATOM   6196 N N     . THR B 1 275 ? 23.106  -11.434 -59.535 1.00 55.71  ? 275 THR B N     1 
ATOM   6197 C CA    . THR B 1 275 ? 22.711  -12.720 -60.095 1.00 57.38  ? 275 THR B CA    1 
ATOM   6198 C C     . THR B 1 275 ? 22.042  -13.626 -59.076 1.00 58.12  ? 275 THR B C     1 
ATOM   6199 O O     . THR B 1 275 ? 21.914  -14.824 -59.328 1.00 60.42  ? 275 THR B O     1 
ATOM   6200 C CB    . THR B 1 275 ? 23.918  -13.461 -60.668 1.00 59.92  ? 275 THR B CB    1 
ATOM   6201 O OG1   . THR B 1 275 ? 24.632  -14.092 -59.591 1.00 64.94  ? 275 THR B OG1   1 
ATOM   6202 C CG2   . THR B 1 275 ? 24.840  -12.511 -61.409 1.00 54.95  ? 275 THR B CG2   1 
ATOM   6203 N N     . ARG B 1 276 ? 21.663  -13.117 -57.927 1.00 58.09  ? 276 ARG B N     1 
ATOM   6204 C CA    . ARG B 1 276 ? 21.022  -14.175 -57.171 1.00 58.70  ? 276 ARG B CA    1 
ATOM   6205 C C     . ARG B 1 276 ? 19.521  -13.927 -57.089 1.00 54.09  ? 276 ARG B C     1 
ATOM   6206 O O     . ARG B 1 276 ? 19.079  -12.773 -57.045 1.00 50.49  ? 276 ARG B O     1 
ATOM   6207 C CB    . ARG B 1 276 ? 21.611  -14.310 -55.757 1.00 62.01  ? 276 ARG B CB    1 
ATOM   6208 C CG    . ARG B 1 276 ? 23.107  -14.639 -55.734 1.00 61.37  ? 276 ARG B CG    1 
ATOM   6209 C CD    . ARG B 1 276 ? 23.366  -16.050 -55.179 1.00 62.51  ? 276 ARG B CD    1 
ATOM   6210 N NE    . ARG B 1 276 ? 24.793  -16.371 -55.120 1.00 69.16  ? 276 ARG B NE    1 
ATOM   6211 C CZ    . ARG B 1 276 ? 25.572  -16.576 -56.184 1.00 75.27  ? 276 ARG B CZ    1 
ATOM   6212 N NH1   . ARG B 1 276 ? 25.064  -16.508 -57.413 1.00 77.90  ? 276 ARG B NH1   1 
ATOM   6213 N NH2   . ARG B 1 276 ? 26.865  -16.855 -56.022 1.00 70.80  ? 276 ARG B NH2   1 
ATOM   6214 N N     . PRO B 1 277 ? 18.718  -14.988 -57.099 1.00 54.89  ? 277 PRO B N     1 
ATOM   6215 C CA    . PRO B 1 277 ? 17.287  -14.835 -56.823 1.00 55.68  ? 277 PRO B CA    1 
ATOM   6216 C C     . PRO B 1 277 ? 17.054  -13.945 -55.607 1.00 58.85  ? 277 PRO B C     1 
ATOM   6217 O O     . PRO B 1 277 ? 17.830  -13.954 -54.643 1.00 55.94  ? 277 PRO B O     1 
ATOM   6218 C CB    . PRO B 1 277 ? 16.822  -16.273 -56.569 1.00 59.63  ? 277 PRO B CB    1 
ATOM   6219 C CG    . PRO B 1 277 ? 17.762  -17.113 -57.365 1.00 56.32  ? 277 PRO B CG    1 
ATOM   6220 C CD    . PRO B 1 277 ? 19.081  -16.381 -57.414 1.00 54.84  ? 277 PRO B CD    1 
ATOM   6221 N N     . ALA B 1 278 ? 15.988  -13.149 -55.671 1.00 55.98  ? 278 ALA B N     1 
ATOM   6222 C CA    . ALA B 1 278 ? 15.715  -12.219 -54.582 1.00 53.87  ? 278 ALA B CA    1 
ATOM   6223 C C     . ALA B 1 278 ? 15.632  -12.946 -53.240 1.00 55.91  ? 278 ALA B C     1 
ATOM   6224 O O     . ALA B 1 278 ? 16.191  -12.483 -52.237 1.00 54.63  ? 278 ALA B O     1 
ATOM   6225 C CB    . ALA B 1 278 ? 14.429  -11.450 -54.872 1.00 51.46  ? 278 ALA B CB    1 
ATOM   6226 N N     . GLN B 1 279 ? 14.975  -14.109 -53.211 1.00 55.26  ? 279 GLN B N     1 
ATOM   6227 C CA    . GLN B 1 279 ? 14.800  -14.832 -51.957 1.00 53.66  ? 279 GLN B CA    1 
ATOM   6228 C C     . GLN B 1 279 ? 16.106  -15.421 -51.441 1.00 56.70  ? 279 GLN B C     1 
ATOM   6229 O O     . GLN B 1 279 ? 16.205  -15.720 -50.251 1.00 54.34  ? 279 GLN B O     1 
ATOM   6230 C CB    . GLN B 1 279 ? 13.752  -15.929 -52.131 1.00 54.79  ? 279 GLN B CB    1 
ATOM   6231 C CG    . GLN B 1 279 ? 13.309  -16.604 -50.860 1.00 52.83  ? 279 GLN B CG    1 
ATOM   6232 C CD    . GLN B 1 279 ? 12.857  -15.623 -49.797 1.00 56.95  ? 279 GLN B CD    1 
ATOM   6233 O OE1   . GLN B 1 279 ? 13.582  -15.373 -48.839 1.00 62.56  ? 279 GLN B OE1   1 
ATOM   6234 N NE2   . GLN B 1 279 ? 11.656  -15.072 -49.947 1.00 50.76  ? 279 GLN B NE2   1 
ATOM   6235 N N     . ASP B 1 280 ? 17.116  -15.597 -52.300 1.00 59.01  ? 280 ASP B N     1 
ATOM   6236 C CA    . ASP B 1 280 ? 18.431  -15.970 -51.786 1.00 56.11  ? 280 ASP B CA    1 
ATOM   6237 C C     . ASP B 1 280 ? 19.004  -14.862 -50.911 1.00 57.08  ? 280 ASP B C     1 
ATOM   6238 O O     . ASP B 1 280 ? 19.761  -15.139 -49.977 1.00 63.34  ? 280 ASP B O     1 
ATOM   6239 C CB    . ASP B 1 280 ? 19.410  -16.290 -52.927 1.00 57.67  ? 280 ASP B CB    1 
ATOM   6240 C CG    . ASP B 1 280 ? 19.121  -17.628 -53.620 1.00 61.77  ? 280 ASP B CG    1 
ATOM   6241 O OD1   . ASP B 1 280 ? 18.211  -18.370 -53.184 1.00 60.07  ? 280 ASP B OD1   1 
ATOM   6242 O OD2   . ASP B 1 280 ? 19.829  -17.940 -54.606 1.00 59.34  ? 280 ASP B OD2   1 
ATOM   6243 N N     . LEU B 1 281 ? 18.660  -13.603 -51.192 1.00 52.58  ? 281 LEU B N     1 
ATOM   6244 C CA    . LEU B 1 281 ? 19.196  -12.508 -50.397 1.00 53.25  ? 281 LEU B CA    1 
ATOM   6245 C C     . LEU B 1 281 ? 18.392  -12.332 -49.112 1.00 55.49  ? 281 LEU B C     1 
ATOM   6246 O O     . LEU B 1 281 ? 18.961  -12.246 -48.019 1.00 51.71  ? 281 LEU B O     1 
ATOM   6247 C CB    . LEU B 1 281 ? 19.221  -11.221 -51.222 1.00 49.46  ? 281 LEU B CB    1 
ATOM   6248 C CG    . LEU B 1 281 ? 20.108  -11.251 -52.466 1.00 50.46  ? 281 LEU B CG    1 
ATOM   6249 C CD1   . LEU B 1 281 ? 20.109  -9.906  -53.149 1.00 51.27  ? 281 LEU B CD1   1 
ATOM   6250 C CD2   . LEU B 1 281 ? 21.515  -11.655 -52.119 1.00 51.34  ? 281 LEU B CD2   1 
ATOM   6251 N N     . VAL B 1 282 ? 17.065  -12.321 -49.226 1.00 52.46  ? 282 VAL B N     1 
ATOM   6252 C CA    . VAL B 1 282 ? 16.213  -12.269 -48.047 1.00 51.72  ? 282 VAL B CA    1 
ATOM   6253 C C     . VAL B 1 282 ? 16.527  -13.410 -47.079 1.00 55.70  ? 282 VAL B C     1 
ATOM   6254 O O     . VAL B 1 282 ? 16.474  -13.231 -45.855 1.00 56.48  ? 282 VAL B O     1 
ATOM   6255 C CB    . VAL B 1 282 ? 14.745  -12.263 -48.503 1.00 45.45  ? 282 VAL B CB    1 
ATOM   6256 C CG1   . VAL B 1 282 ? 13.801  -12.529 -47.344 1.00 46.41  ? 282 VAL B CG1   1 
ATOM   6257 C CG2   . VAL B 1 282 ? 14.451  -10.934 -49.124 1.00 44.84  ? 282 VAL B CG2   1 
ATOM   6258 N N     . ASP B 1 283 ? 16.899  -14.582 -47.603 1.00 60.99  ? 283 ASP B N     1 
ATOM   6259 C CA    . ASP B 1 283 ? 17.173  -15.746 -46.758 1.00 58.95  ? 283 ASP B CA    1 
ATOM   6260 C C     . ASP B 1 283 ? 18.291  -15.491 -45.750 1.00 57.17  ? 283 ASP B C     1 
ATOM   6261 O O     . ASP B 1 283 ? 18.284  -16.075 -44.663 1.00 59.05  ? 283 ASP B O     1 
ATOM   6262 C CB    . ASP B 1 283 ? 17.534  -16.961 -47.626 1.00 58.05  ? 283 ASP B CB    1 
ATOM   6263 C CG    . ASP B 1 283 ? 16.312  -17.766 -48.068 1.00 60.07  ? 283 ASP B CG    1 
ATOM   6264 O OD1   . ASP B 1 283 ? 15.200  -17.479 -47.575 1.00 57.56  ? 283 ASP B OD1   1 
ATOM   6265 O OD2   . ASP B 1 283 ? 16.474  -18.703 -48.891 1.00 59.11  ? 283 ASP B OD2   1 
ATOM   6266 N N     . HIS B 1 284 ? 19.272  -14.657 -46.089 1.00 57.86  ? 284 HIS B N     1 
ATOM   6267 C CA    . HIS B 1 284 ? 20.381  -14.376 -45.186 1.00 61.03  ? 284 HIS B CA    1 
ATOM   6268 C C     . HIS B 1 284 ? 20.338  -12.951 -44.653 1.00 60.80  ? 284 HIS B C     1 
ATOM   6269 O O     . HIS B 1 284 ? 21.326  -12.463 -44.099 1.00 60.38  ? 284 HIS B O     1 
ATOM   6270 C CB    . HIS B 1 284 ? 21.716  -14.658 -45.879 1.00 60.78  ? 284 HIS B CB    1 
ATOM   6271 C CG    . HIS B 1 284 ? 22.016  -16.117 -45.994 1.00 64.17  ? 284 HIS B CG    1 
ATOM   6272 N ND1   . HIS B 1 284 ? 22.165  -16.930 -44.890 1.00 68.08  ? 284 HIS B ND1   1 
ATOM   6273 C CD2   . HIS B 1 284 ? 22.156  -16.916 -47.075 1.00 58.33  ? 284 HIS B CD2   1 
ATOM   6274 C CE1   . HIS B 1 284 ? 22.394  -18.168 -45.288 1.00 70.57  ? 284 HIS B CE1   1 
ATOM   6275 N NE2   . HIS B 1 284 ? 22.396  -18.185 -46.610 1.00 66.26  ? 284 HIS B NE2   1 
ATOM   6276 N N     . GLU B 1 285 ? 19.194  -12.285 -44.793 1.00 60.02  ? 285 GLU B N     1 
ATOM   6277 C CA    . GLU B 1 285 ? 19.103  -10.873 -44.452 1.00 58.56  ? 285 GLU B CA    1 
ATOM   6278 C C     . GLU B 1 285 ? 19.349  -10.648 -42.964 1.00 61.65  ? 285 GLU B C     1 
ATOM   6279 O O     . GLU B 1 285 ? 20.117  -9.758  -42.576 1.00 57.32  ? 285 GLU B O     1 
ATOM   6280 C CB    . GLU B 1 285 ? 17.735  -10.351 -44.865 1.00 53.95  ? 285 GLU B CB    1 
ATOM   6281 C CG    . GLU B 1 285 ? 17.618  -8.873  -44.851 1.00 54.07  ? 285 GLU B CG    1 
ATOM   6282 C CD    . GLU B 1 285 ? 16.292  -8.424  -45.404 1.00 59.38  ? 285 GLU B CD    1 
ATOM   6283 O OE1   . GLU B 1 285 ? 16.103  -8.492  -46.648 1.00 67.59  ? 285 GLU B OE1   1 
ATOM   6284 O OE2   . GLU B 1 285 ? 15.432  -8.025  -44.592 1.00 59.61  ? 285 GLU B OE2   1 
ATOM   6285 N N     . TRP B 1 286 ? 18.722  -11.465 -42.116 1.00 59.91  ? 286 TRP B N     1 
ATOM   6286 C CA    . TRP B 1 286 ? 18.866  -11.317 -40.676 1.00 56.79  ? 286 TRP B CA    1 
ATOM   6287 C C     . TRP B 1 286 ? 20.166  -11.897 -40.138 1.00 58.91  ? 286 TRP B C     1 
ATOM   6288 O O     . TRP B 1 286 ? 20.486  -11.664 -38.969 1.00 63.19  ? 286 TRP B O     1 
ATOM   6289 C CB    . TRP B 1 286 ? 17.672  -11.963 -39.958 1.00 62.12  ? 286 TRP B CB    1 
ATOM   6290 C CG    . TRP B 1 286 ? 16.355  -11.285 -40.287 1.00 70.95  ? 286 TRP B CG    1 
ATOM   6291 C CD1   . TRP B 1 286 ? 15.496  -11.608 -41.301 1.00 66.16  ? 286 TRP B CD1   1 
ATOM   6292 C CD2   . TRP B 1 286 ? 15.766  -10.156 -39.611 1.00 75.30  ? 286 TRP B CD2   1 
ATOM   6293 N NE1   . TRP B 1 286 ? 14.409  -10.762 -41.289 1.00 66.37  ? 286 TRP B NE1   1 
ATOM   6294 C CE2   . TRP B 1 286 ? 14.555  -9.859  -40.269 1.00 69.13  ? 286 TRP B CE2   1 
ATOM   6295 C CE3   . TRP B 1 286 ? 16.145  -9.372  -38.512 1.00 72.27  ? 286 TRP B CE3   1 
ATOM   6296 C CZ2   . TRP B 1 286 ? 13.719  -8.817  -39.861 1.00 67.01  ? 286 TRP B CZ2   1 
ATOM   6297 C CZ3   . TRP B 1 286 ? 15.310  -8.335  -38.111 1.00 68.45  ? 286 TRP B CZ3   1 
ATOM   6298 C CH2   . TRP B 1 286 ? 14.112  -8.073  -38.780 1.00 66.09  ? 286 TRP B CH2   1 
ATOM   6299 N N     . HIS B 1 287 ? 20.935  -12.622 -40.940 1.00 59.00  ? 287 HIS B N     1 
ATOM   6300 C CA    . HIS B 1 287 ? 22.137  -13.244 -40.403 1.00 56.73  ? 287 HIS B CA    1 
ATOM   6301 C C     . HIS B 1 287 ? 23.320  -12.299 -40.314 1.00 58.10  ? 287 HIS B C     1 
ATOM   6302 O O     . HIS B 1 287 ? 24.368  -12.713 -39.819 1.00 61.11  ? 287 HIS B O     1 
ATOM   6303 C CB    . HIS B 1 287 ? 22.551  -14.450 -41.239 1.00 60.50  ? 287 HIS B CB    1 
ATOM   6304 C CG    . HIS B 1 287 ? 21.519  -15.523 -41.299 1.00 64.00  ? 287 HIS B CG    1 
ATOM   6305 N ND1   . HIS B 1 287 ? 21.509  -16.487 -42.286 1.00 64.97  ? 287 HIS B ND1   1 
ATOM   6306 C CD2   . HIS B 1 287 ? 20.459  -15.784 -40.500 1.00 57.53  ? 287 HIS B CD2   1 
ATOM   6307 C CE1   . HIS B 1 287 ? 20.484  -17.297 -42.091 1.00 66.40  ? 287 HIS B CE1   1 
ATOM   6308 N NE2   . HIS B 1 287 ? 19.830  -16.892 -41.014 1.00 60.56  ? 287 HIS B NE2   1 
ATOM   6309 N N     . VAL B 1 288 ? 23.210  -11.052 -40.774 1.00 57.63  ? 288 VAL B N     1 
ATOM   6310 C CA    . VAL B 1 288 ? 24.368  -10.164 -40.759 1.00 56.37  ? 288 VAL B CA    1 
ATOM   6311 C C     . VAL B 1 288 ? 24.389  -9.221  -39.549 1.00 55.61  ? 288 VAL B C     1 
ATOM   6312 O O     . VAL B 1 288 ? 25.332  -8.426  -39.420 1.00 53.15  ? 288 VAL B O     1 
ATOM   6313 C CB    . VAL B 1 288 ? 24.471  -9.360  -42.076 1.00 56.65  ? 288 VAL B CB    1 
ATOM   6314 C CG1   . VAL B 1 288 ? 24.622  -10.287 -43.259 1.00 57.64  ? 288 VAL B CG1   1 
ATOM   6315 C CG2   . VAL B 1 288 ? 23.262  -8.482  -42.266 1.00 55.09  ? 288 VAL B CG2   1 
ATOM   6316 N N     . LEU B 1 289 ? 23.395  -9.287  -38.657 1.00 51.60  ? 289 LEU B N     1 
ATOM   6317 C CA    . LEU B 1 289 ? 23.386  -8.385  -37.504 1.00 56.19  ? 289 LEU B CA    1 
ATOM   6318 C C     . LEU B 1 289 ? 24.546  -8.713  -36.564 1.00 60.20  ? 289 LEU B C     1 
ATOM   6319 O O     . LEU B 1 289 ? 24.796  -9.888  -36.273 1.00 62.68  ? 289 LEU B O     1 
ATOM   6320 C CB    . LEU B 1 289 ? 22.061  -8.474  -36.740 1.00 53.01  ? 289 LEU B CB    1 
ATOM   6321 C CG    . LEU B 1 289 ? 20.877  -7.766  -37.386 1.00 50.28  ? 289 LEU B CG    1 
ATOM   6322 C CD1   . LEU B 1 289 ? 19.586  -8.132  -36.709 1.00 45.76  ? 289 LEU B CD1   1 
ATOM   6323 C CD2   . LEU B 1 289 ? 21.091  -6.269  -37.369 1.00 48.33  ? 289 LEU B CD2   1 
ATOM   6324 N N     . PRO B 1 290 ? 25.269  -7.701  -36.065 1.00 60.95  ? 290 PRO B N     1 
ATOM   6325 C CA    . PRO B 1 290 ? 26.459  -7.997  -35.245 1.00 57.57  ? 290 PRO B CA    1 
ATOM   6326 C C     . PRO B 1 290 ? 26.135  -8.721  -33.954 1.00 57.11  ? 290 PRO B C     1 
ATOM   6327 O O     . PRO B 1 290 ? 26.763  -9.738  -33.644 1.00 63.73  ? 290 PRO B O     1 
ATOM   6328 C CB    . PRO B 1 290 ? 27.061  -6.608  -34.995 1.00 58.19  ? 290 PRO B CB    1 
ATOM   6329 C CG    . PRO B 1 290 ? 25.923  -5.661  -35.164 1.00 59.57  ? 290 PRO B CG    1 
ATOM   6330 C CD    . PRO B 1 290 ? 25.093  -6.254  -36.270 1.00 60.49  ? 290 PRO B CD    1 
ATOM   6331 N N     . GLN B 1 291 ? 25.173  -8.233  -33.190 1.00 56.02  ? 291 GLN B N     1 
ATOM   6332 C CA    . GLN B 1 291 ? 24.805  -8.868  -31.935 1.00 60.36  ? 291 GLN B CA    1 
ATOM   6333 C C     . GLN B 1 291 ? 23.411  -9.462  -32.045 1.00 56.65  ? 291 GLN B C     1 
ATOM   6334 O O     . GLN B 1 291 ? 22.648  -9.146  -32.959 1.00 55.62  ? 291 GLN B O     1 
ATOM   6335 C CB    . GLN B 1 291 ? 24.852  -7.875  -30.761 1.00 53.00  ? 291 GLN B CB    1 
ATOM   6336 C CG    . GLN B 1 291 ? 26.141  -7.078  -30.664 1.00 51.72  ? 291 GLN B CG    1 
ATOM   6337 C CD    . GLN B 1 291 ? 26.053  -5.732  -31.365 1.00 58.84  ? 291 GLN B CD    1 
ATOM   6338 O OE1   . GLN B 1 291 ? 24.972  -5.147  -31.490 1.00 60.84  ? 291 GLN B OE1   1 
ATOM   6339 N NE2   . GLN B 1 291 ? 27.195  -5.229  -31.820 1.00 59.53  ? 291 GLN B NE2   1 
ATOM   6340 N N     . GLU B 1 292 ? 23.085  -10.334 -31.098 1.00 59.28  ? 292 GLU B N     1 
ATOM   6341 C CA    . GLU B 1 292 ? 21.705  -10.764 -30.935 1.00 58.29  ? 292 GLU B CA    1 
ATOM   6342 C C     . GLU B 1 292 ? 20.903  -9.566  -30.448 1.00 57.26  ? 292 GLU B C     1 
ATOM   6343 O O     . GLU B 1 292 ? 21.230  -8.975  -29.415 1.00 61.90  ? 292 GLU B O     1 
ATOM   6344 C CB    . GLU B 1 292 ? 21.617  -11.928 -29.949 1.00 55.16  ? 292 GLU B CB    1 
ATOM   6345 C CG    . GLU B 1 292 ? 20.188  -12.336 -29.618 1.00 62.95  ? 292 GLU B CG    1 
ATOM   6346 C CD    . GLU B 1 292 ? 20.105  -13.444 -28.575 1.00 79.16  ? 292 GLU B CD    1 
ATOM   6347 O OE1   . GLU B 1 292 ? 21.149  -13.813 -27.985 1.00 77.68  ? 292 GLU B OE1   1 
ATOM   6348 O OE2   . GLU B 1 292 ? 18.981  -13.928 -28.335 1.00 80.30  ? 292 GLU B OE2   1 
ATOM   6349 N N     . SER B 1 293 ? 19.878  -9.173  -31.189 1.00 51.73  ? 293 SER B N     1 
ATOM   6350 C CA    . SER B 1 293 ? 19.255  -7.906  -30.875 1.00 51.55  ? 293 SER B CA    1 
ATOM   6351 C C     . SER B 1 293 ? 17.754  -7.974  -31.103 1.00 50.87  ? 293 SER B C     1 
ATOM   6352 O O     . SER B 1 293 ? 17.200  -8.985  -31.532 1.00 55.04  ? 293 SER B O     1 
ATOM   6353 C CB    . SER B 1 293 ? 19.903  -6.777  -31.680 1.00 52.52  ? 293 SER B CB    1 
ATOM   6354 O OG    . SER B 1 293 ? 20.342  -7.224  -32.944 1.00 53.05  ? 293 SER B OG    1 
ATOM   6355 N N     . ILE B 1 294 ? 17.106  -6.874  -30.757 1.00 51.70  ? 294 ILE B N     1 
ATOM   6356 C CA    . ILE B 1 294 ? 15.690  -6.639  -30.968 1.00 50.22  ? 294 ILE B CA    1 
ATOM   6357 C C     . ILE B 1 294 ? 15.596  -5.170  -31.359 1.00 52.17  ? 294 ILE B C     1 
ATOM   6358 O O     . ILE B 1 294 ? 16.403  -4.353  -30.911 1.00 53.18  ? 294 ILE B O     1 
ATOM   6359 C CB    . ILE B 1 294 ? 14.863  -6.990  -29.700 1.00 59.34  ? 294 ILE B CB    1 
ATOM   6360 C CG1   . ILE B 1 294 ? 13.381  -6.866  -29.969 1.00 63.02  ? 294 ILE B CG1   1 
ATOM   6361 C CG2   . ILE B 1 294 ? 15.232  -6.148  -28.486 1.00 58.40  ? 294 ILE B CG2   1 
ATOM   6362 C CD1   . ILE B 1 294 ? 12.867  -8.134  -30.453 1.00 64.02  ? 294 ILE B CD1   1 
ATOM   6363 N N     . PHE B 1 295 ? 14.662  -4.841  -32.254 1.00 55.46  ? 295 PHE B N     1 
ATOM   6364 C CA    . PHE B 1 295 ? 14.581  -3.482  -32.801 1.00 47.21  ? 295 PHE B CA    1 
ATOM   6365 C C     . PHE B 1 295 ? 15.913  -3.088  -33.440 1.00 48.88  ? 295 PHE B C     1 
ATOM   6366 O O     . PHE B 1 295 ? 16.412  -1.975  -33.256 1.00 50.73  ? 295 PHE B O     1 
ATOM   6367 C CB    . PHE B 1 295 ? 14.165  -2.474  -31.722 1.00 43.01  ? 295 PHE B CB    1 
ATOM   6368 C CG    . PHE B 1 295 ? 13.277  -1.347  -32.210 1.00 46.34  ? 295 PHE B CG    1 
ATOM   6369 C CD1   . PHE B 1 295 ? 12.185  -0.931  -31.444 1.00 43.28  ? 295 PHE B CD1   1 
ATOM   6370 C CD2   . PHE B 1 295 ? 13.539  -0.680  -33.409 1.00 44.08  ? 295 PHE B CD2   1 
ATOM   6371 C CE1   . PHE B 1 295 ? 11.365  0.118   -31.876 1.00 47.26  ? 295 PHE B CE1   1 
ATOM   6372 C CE2   . PHE B 1 295 ? 12.723  0.360   -33.845 1.00 40.19  ? 295 PHE B CE2   1 
ATOM   6373 C CZ    . PHE B 1 295 ? 11.633  0.761   -33.088 1.00 42.05  ? 295 PHE B CZ    1 
ATOM   6374 N N     . ARG B 1 296 ? 16.517  -4.031  -34.161 1.00 44.16  ? 296 ARG B N     1 
ATOM   6375 C CA    . ARG B 1 296 ? 17.651  -3.760  -35.029 1.00 43.90  ? 296 ARG B CA    1 
ATOM   6376 C C     . ARG B 1 296 ? 17.397  -4.398  -36.390 1.00 50.64  ? 296 ARG B C     1 
ATOM   6377 O O     . ARG B 1 296 ? 16.755  -5.447  -36.488 1.00 55.05  ? 296 ARG B O     1 
ATOM   6378 C CB    . ARG B 1 296 ? 18.961  -4.286  -34.456 1.00 44.88  ? 296 ARG B CB    1 
ATOM   6379 C CG    . ARG B 1 296 ? 19.434  -3.565  -33.223 1.00 48.10  ? 296 ARG B CG    1 
ATOM   6380 C CD    . ARG B 1 296 ? 19.823  -2.130  -33.486 1.00 42.81  ? 296 ARG B CD    1 
ATOM   6381 N NE    . ARG B 1 296 ? 20.347  -1.519  -32.268 1.00 50.88  ? 296 ARG B NE    1 
ATOM   6382 C CZ    . ARG B 1 296 ? 19.589  -1.055  -31.276 1.00 52.30  ? 296 ARG B CZ    1 
ATOM   6383 N NH1   . ARG B 1 296 ? 18.268  -1.113  -31.360 1.00 50.40  ? 296 ARG B NH1   1 
ATOM   6384 N NH2   . ARG B 1 296 ? 20.146  -0.524  -30.198 1.00 52.24  ? 296 ARG B NH2   1 
ATOM   6385 N N     . PHE B 1 297 ? 17.903  -3.763  -37.445 1.00 48.19  ? 297 PHE B N     1 
ATOM   6386 C CA    . PHE B 1 297 ? 17.584  -4.179  -38.802 1.00 46.29  ? 297 PHE B CA    1 
ATOM   6387 C C     . PHE B 1 297 ? 18.827  -4.090  -39.676 1.00 46.62  ? 297 PHE B C     1 
ATOM   6388 O O     . PHE B 1 297 ? 19.571  -3.106  -39.630 1.00 43.45  ? 297 PHE B O     1 
ATOM   6389 C CB    . PHE B 1 297 ? 16.444  -3.328  -39.383 1.00 47.38  ? 297 PHE B CB    1 
ATOM   6390 C CG    . PHE B 1 297 ? 15.296  -3.108  -38.417 1.00 46.80  ? 297 PHE B CG    1 
ATOM   6391 C CD1   . PHE B 1 297 ? 14.505  -4.172  -37.999 1.00 46.54  ? 297 PHE B CD1   1 
ATOM   6392 C CD2   . PHE B 1 297 ? 15.015  -1.841  -37.925 1.00 44.28  ? 297 PHE B CD2   1 
ATOM   6393 C CE1   . PHE B 1 297 ? 13.453  -3.980  -37.105 1.00 46.09  ? 297 PHE B CE1   1 
ATOM   6394 C CE2   . PHE B 1 297 ? 13.968  -1.647  -37.031 1.00 46.42  ? 297 PHE B CE2   1 
ATOM   6395 C CZ    . PHE B 1 297 ? 13.187  -2.722  -36.623 1.00 42.60  ? 297 PHE B CZ    1 
ATOM   6396 N N     . SER B 1 298 ? 19.019  -5.117  -40.505 1.00 49.03  ? 298 SER B N     1 
ATOM   6397 C CA    . SER B 1 298 ? 20.302  -5.327  -41.167 1.00 44.90  ? 298 SER B CA    1 
ATOM   6398 C C     . SER B 1 298 ? 20.564  -4.337  -42.302 1.00 46.35  ? 298 SER B C     1 
ATOM   6399 O O     . SER B 1 298 ? 21.727  -4.013  -42.579 1.00 46.27  ? 298 SER B O     1 
ATOM   6400 C CB    . SER B 1 298 ? 20.368  -6.757  -41.677 1.00 45.98  ? 298 SER B CB    1 
ATOM   6401 O OG    . SER B 1 298 ? 19.928  -7.658  -40.675 1.00 50.14  ? 298 SER B OG    1 
ATOM   6402 N N     . PHE B 1 299 ? 19.532  -3.839  -42.976 1.00 41.11  ? 299 PHE B N     1 
ATOM   6403 C CA    . PHE B 1 299 ? 19.771  -2.952  -44.108 1.00 43.05  ? 299 PHE B CA    1 
ATOM   6404 C C     . PHE B 1 299 ? 18.863  -1.739  -44.018 1.00 43.73  ? 299 PHE B C     1 
ATOM   6405 O O     . PHE B 1 299 ? 17.647  -1.845  -44.205 1.00 44.63  ? 299 PHE B O     1 
ATOM   6406 C CB    . PHE B 1 299 ? 19.616  -3.711  -45.422 1.00 42.90  ? 299 PHE B CB    1 
ATOM   6407 C CG    . PHE B 1 299 ? 20.685  -4.737  -45.612 1.00 40.49  ? 299 PHE B CG    1 
ATOM   6408 C CD1   . PHE B 1 299 ? 21.942  -4.364  -46.055 1.00 41.63  ? 299 PHE B CD1   1 
ATOM   6409 C CD2   . PHE B 1 299 ? 20.461  -6.056  -45.270 1.00 42.58  ? 299 PHE B CD2   1 
ATOM   6410 C CE1   . PHE B 1 299 ? 22.944  -5.298  -46.187 1.00 42.87  ? 299 PHE B CE1   1 
ATOM   6411 C CE2   . PHE B 1 299 ? 21.459  -6.996  -45.397 1.00 42.28  ? 299 PHE B CE2   1 
ATOM   6412 C CZ    . PHE B 1 299 ? 22.699  -6.620  -45.856 1.00 43.43  ? 299 PHE B CZ    1 
ATOM   6413 N N     . VAL B 1 300 ? 19.476  -0.593  -43.738 1.00 37.23  ? 300 VAL B N     1 
ATOM   6414 C CA    . VAL B 1 300 ? 18.803  0.629   -43.316 1.00 39.79  ? 300 VAL B CA    1 
ATOM   6415 C C     . VAL B 1 300 ? 19.596  1.753   -43.957 1.00 39.01  ? 300 VAL B C     1 
ATOM   6416 O O     . VAL B 1 300 ? 20.678  1.489   -44.500 1.00 39.08  ? 300 VAL B O     1 
ATOM   6417 C CB    . VAL B 1 300 ? 18.782  0.785   -41.779 1.00 41.96  ? 300 VAL B CB    1 
ATOM   6418 C CG1   . VAL B 1 300 ? 18.134  -0.420  -41.081 1.00 37.92  ? 300 VAL B CG1   1 
ATOM   6419 C CG2   . VAL B 1 300 ? 20.189  1.053   -41.271 1.00 37.43  ? 300 VAL B CG2   1 
ATOM   6420 N N     . PRO B 1 301 ? 19.126  3.000   -43.909 1.00 38.70  ? 301 PRO B N     1 
ATOM   6421 C CA    . PRO B 1 301 ? 19.904  4.099   -44.488 1.00 40.61  ? 301 PRO B CA    1 
ATOM   6422 C C     . PRO B 1 301 ? 21.320  4.133   -43.933 1.00 46.36  ? 301 PRO B C     1 
ATOM   6423 O O     . PRO B 1 301 ? 21.568  3.754   -42.784 1.00 51.40  ? 301 PRO B O     1 
ATOM   6424 C CB    . PRO B 1 301 ? 19.110  5.345   -44.088 1.00 40.00  ? 301 PRO B CB    1 
ATOM   6425 C CG    . PRO B 1 301 ? 17.711  4.867   -43.986 1.00 43.16  ? 301 PRO B CG    1 
ATOM   6426 C CD    . PRO B 1 301 ? 17.752  3.412   -43.580 1.00 40.00  ? 301 PRO B CD    1 
ATOM   6427 N N     . VAL B 1 302 ? 22.254  4.573   -44.773 1.00 45.98  ? 302 VAL B N     1 
ATOM   6428 C CA    . VAL B 1 302 ? 23.667  4.647   -44.426 1.00 47.91  ? 302 VAL B CA    1 
ATOM   6429 C C     . VAL B 1 302 ? 24.074  6.106   -44.393 1.00 49.24  ? 302 VAL B C     1 
ATOM   6430 O O     . VAL B 1 302 ? 23.591  6.914   -45.194 1.00 49.61  ? 302 VAL B O     1 
ATOM   6431 C CB    . VAL B 1 302 ? 24.549  3.867   -45.419 1.00 49.66  ? 302 VAL B CB    1 
ATOM   6432 C CG1   . VAL B 1 302 ? 24.381  4.426   -46.830 1.00 51.45  ? 302 VAL B CG1   1 
ATOM   6433 C CG2   . VAL B 1 302 ? 26.005  3.934   -45.001 1.00 47.52  ? 302 VAL B CG2   1 
ATOM   6434 N N     . VAL B 1 303 ? 24.941  6.447   -43.445 1.00 51.73  ? 303 VAL B N     1 
ATOM   6435 C CA    . VAL B 1 303 ? 25.536  7.777   -43.393 1.00 53.60  ? 303 VAL B CA    1 
ATOM   6436 C C     . VAL B 1 303 ? 26.616  7.794   -44.469 1.00 55.30  ? 303 VAL B C     1 
ATOM   6437 O O     . VAL B 1 303 ? 27.731  7.321   -44.254 1.00 59.43  ? 303 VAL B O     1 
ATOM   6438 C CB    . VAL B 1 303 ? 26.089  8.101   -42.006 1.00 49.78  ? 303 VAL B CB    1 
ATOM   6439 C CG1   . VAL B 1 303 ? 26.409  9.568   -41.896 1.00 47.92  ? 303 VAL B CG1   1 
ATOM   6440 C CG2   . VAL B 1 303 ? 25.069  7.719   -40.973 1.00 49.71  ? 303 VAL B CG2   1 
ATOM   6441 N N     . ASP B 1 304 ? 26.268  8.306   -45.642 1.00 55.07  ? 304 ASP B N     1 
ATOM   6442 C CA    . ASP B 1 304 ? 27.091  8.150   -46.833 1.00 58.10  ? 304 ASP B CA    1 
ATOM   6443 C C     . ASP B 1 304 ? 27.794  9.436   -47.221 1.00 59.16  ? 304 ASP B C     1 
ATOM   6444 O O     . ASP B 1 304 ? 28.414  9.494   -48.285 1.00 54.94  ? 304 ASP B O     1 
ATOM   6445 C CB    . ASP B 1 304 ? 26.242  7.644   -48.008 1.00 56.66  ? 304 ASP B CB    1 
ATOM   6446 C CG    . ASP B 1 304 ? 25.168  8.647   -48.438 1.00 59.15  ? 304 ASP B CG    1 
ATOM   6447 O OD1   . ASP B 1 304 ? 24.829  9.540   -47.631 1.00 59.72  ? 304 ASP B OD1   1 
ATOM   6448 O OD2   . ASP B 1 304 ? 24.656  8.539   -49.576 1.00 55.58  ? 304 ASP B OD2   1 
ATOM   6449 N N     . GLY B 1 305 ? 27.698  10.470  -46.395 1.00 57.63  ? 305 GLY B N     1 
ATOM   6450 C CA    . GLY B 1 305 ? 28.228  11.763  -46.756 1.00 55.72  ? 305 GLY B CA    1 
ATOM   6451 C C     . GLY B 1 305 ? 27.643  12.311  -48.042 1.00 57.81  ? 305 GLY B C     1 
ATOM   6452 O O     . GLY B 1 305 ? 28.200  13.254  -48.608 1.00 61.29  ? 305 GLY B O     1 
ATOM   6453 N N     . ASP B 1 306 ? 26.528  11.741  -48.518 1.00 58.46  ? 306 ASP B N     1 
ATOM   6454 C CA    . ASP B 1 306 ? 25.890  12.183  -49.762 1.00 57.98  ? 306 ASP B CA    1 
ATOM   6455 C C     . ASP B 1 306 ? 24.420  12.503  -49.520 1.00 57.40  ? 306 ASP B C     1 
ATOM   6456 O O     . ASP B 1 306 ? 24.050  13.672  -49.359 1.00 53.86  ? 306 ASP B O     1 
ATOM   6457 C CB    . ASP B 1 306 ? 26.043  11.113  -50.850 1.00 58.22  ? 306 ASP B CB    1 
ATOM   6458 C CG    . ASP B 1 306 ? 25.407  11.509  -52.181 1.00 59.48  ? 306 ASP B CG    1 
ATOM   6459 O OD1   . ASP B 1 306 ? 25.115  12.705  -52.409 1.00 53.13  ? 306 ASP B OD1   1 
ATOM   6460 O OD2   . ASP B 1 306 ? 25.213  10.599  -53.017 1.00 64.46  ? 306 ASP B OD2   1 
ATOM   6461 N N     . PHE B 1 307 ? 23.565  11.478  -49.502 1.00 55.55  ? 307 PHE B N     1 
ATOM   6462 C CA    . PHE B 1 307 ? 22.201  11.710  -49.044 1.00 55.56  ? 307 PHE B CA    1 
ATOM   6463 C C     . PHE B 1 307 ? 22.210  12.279  -47.630 1.00 51.88  ? 307 PHE B C     1 
ATOM   6464 O O     . PHE B 1 307 ? 21.502  13.247  -47.336 1.00 53.81  ? 307 PHE B O     1 
ATOM   6465 C CB    . PHE B 1 307 ? 21.382  10.414  -49.114 1.00 55.25  ? 307 PHE B CB    1 
ATOM   6466 C CG    . PHE B 1 307 ? 19.889  10.629  -48.991 1.00 54.45  ? 307 PHE B CG    1 
ATOM   6467 C CD1   . PHE B 1 307 ? 19.311  10.945  -47.762 1.00 48.30  ? 307 PHE B CD1   1 
ATOM   6468 C CD2   . PHE B 1 307 ? 19.067  10.518  -50.102 1.00 49.29  ? 307 PHE B CD2   1 
ATOM   6469 C CE1   . PHE B 1 307 ? 17.949  11.149  -47.649 1.00 45.49  ? 307 PHE B CE1   1 
ATOM   6470 C CE2   . PHE B 1 307 ? 17.702  10.720  -49.994 1.00 49.29  ? 307 PHE B CE2   1 
ATOM   6471 C CZ    . PHE B 1 307 ? 17.144  11.036  -48.764 1.00 52.90  ? 307 PHE B CZ    1 
ATOM   6472 N N     . LEU B 1 308 ? 23.033  11.709  -46.753 1.00 54.67  ? 308 LEU B N     1 
ATOM   6473 C CA    . LEU B 1 308 ? 23.180  12.138  -45.362 1.00 55.31  ? 308 LEU B CA    1 
ATOM   6474 C C     . LEU B 1 308 ? 24.609  12.632  -45.193 1.00 57.18  ? 308 LEU B C     1 
ATOM   6475 O O     . LEU B 1 308 ? 25.523  11.829  -44.975 1.00 57.72  ? 308 LEU B O     1 
ATOM   6476 C CB    . LEU B 1 308 ? 22.865  10.998  -44.398 1.00 48.75  ? 308 LEU B CB    1 
ATOM   6477 C CG    . LEU B 1 308 ? 21.386  10.615  -44.365 1.00 50.81  ? 308 LEU B CG    1 
ATOM   6478 C CD1   . LEU B 1 308 ? 21.087  9.435   -43.439 1.00 46.12  ? 308 LEU B CD1   1 
ATOM   6479 C CD2   . LEU B 1 308 ? 20.577  11.836  -43.976 1.00 45.70  ? 308 LEU B CD2   1 
ATOM   6480 N N     . SER B 1 309 ? 24.789  13.955  -45.295 1.00 56.06  ? 309 SER B N     1 
ATOM   6481 C CA    . SER B 1 309 ? 26.121  14.552  -45.226 1.00 53.13  ? 309 SER B CA    1 
ATOM   6482 C C     . SER B 1 309 ? 26.828  14.246  -43.912 1.00 56.48  ? 309 SER B C     1 
ATOM   6483 O O     . SER B 1 309 ? 28.062  14.214  -43.867 1.00 59.89  ? 309 SER B O     1 
ATOM   6484 C CB    . SER B 1 309 ? 26.019  16.061  -45.432 1.00 54.07  ? 309 SER B CB    1 
ATOM   6485 O OG    . SER B 1 309 ? 24.980  16.635  -44.653 1.00 59.02  ? 309 SER B OG    1 
ATOM   6486 N N     . ASP B 1 310 ? 26.080  14.024  -42.837 1.00 53.33  ? 310 ASP B N     1 
ATOM   6487 C CA    . ASP B 1 310 ? 26.663  13.622  -41.565 1.00 56.85  ? 310 ASP B CA    1 
ATOM   6488 C C     . ASP B 1 310 ? 25.640  12.759  -40.837 1.00 56.77  ? 310 ASP B C     1 
ATOM   6489 O O     . ASP B 1 310 ? 24.586  12.437  -41.387 1.00 55.01  ? 310 ASP B O     1 
ATOM   6490 C CB    . ASP B 1 310 ? 27.073  14.845  -40.744 1.00 59.93  ? 310 ASP B CB    1 
ATOM   6491 C CG    . ASP B 1 310 ? 28.241  14.568  -39.829 1.00 61.95  ? 310 ASP B CG    1 
ATOM   6492 O OD1   . ASP B 1 310 ? 28.309  13.448  -39.266 1.00 63.45  ? 310 ASP B OD1   1 
ATOM   6493 O OD2   . ASP B 1 310 ? 29.087  15.478  -39.677 1.00 59.80  ? 310 ASP B OD2   1 
ATOM   6494 N N     . THR B 1 311 ? 25.944  12.376  -39.593 1.00 55.60  ? 311 THR B N     1 
ATOM   6495 C CA    . THR B 1 311 ? 24.958  11.604  -38.855 1.00 53.84  ? 311 THR B CA    1 
ATOM   6496 C C     . THR B 1 311 ? 23.705  12.451  -38.672 1.00 55.14  ? 311 THR B C     1 
ATOM   6497 O O     . THR B 1 311 ? 23.784  13.683  -38.645 1.00 53.55  ? 311 THR B O     1 
ATOM   6498 C CB    . THR B 1 311 ? 25.477  11.144  -37.493 1.00 54.27  ? 311 THR B CB    1 
ATOM   6499 O OG1   . THR B 1 311 ? 25.996  12.258  -36.754 1.00 55.83  ? 311 THR B OG1   1 
ATOM   6500 C CG2   . THR B 1 311 ? 26.535  10.075  -37.661 1.00 50.27  ? 311 THR B CG2   1 
ATOM   6501 N N     . PRO B 1 312 ? 22.529  11.820  -38.622 1.00 56.69  ? 312 PRO B N     1 
ATOM   6502 C CA    . PRO B 1 312 ? 21.326  12.564  -38.223 1.00 56.05  ? 312 PRO B CA    1 
ATOM   6503 C C     . PRO B 1 312 ? 21.544  13.412  -36.981 1.00 54.71  ? 312 PRO B C     1 
ATOM   6504 O O     . PRO B 1 312 ? 21.096  14.568  -36.926 1.00 53.34  ? 312 PRO B O     1 
ATOM   6505 C CB    . PRO B 1 312 ? 20.302  11.445  -37.992 1.00 51.70  ? 312 PRO B CB    1 
ATOM   6506 C CG    . PRO B 1 312 ? 20.704  10.396  -38.981 1.00 52.10  ? 312 PRO B CG    1 
ATOM   6507 C CD    . PRO B 1 312 ? 22.216  10.434  -39.014 1.00 52.45  ? 312 PRO B CD    1 
ATOM   6508 N N     . GLU B 1 313 ? 22.259  12.883  -35.989 1.00 52.95  ? 313 GLU B N     1 
ATOM   6509 C CA    . GLU B 1 313 ? 22.462  13.650  -34.768 1.00 56.55  ? 313 GLU B CA    1 
ATOM   6510 C C     . GLU B 1 313 ? 23.275  14.905  -35.050 1.00 56.86  ? 313 GLU B C     1 
ATOM   6511 O O     . GLU B 1 313 ? 22.903  16.002  -34.622 1.00 59.33  ? 313 GLU B O     1 
ATOM   6512 C CB    . GLU B 1 313 ? 23.121  12.782  -33.696 1.00 55.00  ? 313 GLU B CB    1 
ATOM   6513 C CG    . GLU B 1 313 ? 22.195  11.702  -33.131 1.00 54.89  ? 313 GLU B CG    1 
ATOM   6514 C CD    . GLU B 1 313 ? 22.168  10.403  -33.960 1.00 64.88  ? 313 GLU B CD    1 
ATOM   6515 O OE1   . GLU B 1 313 ? 21.759  9.368   -33.371 1.00 57.52  ? 313 GLU B OE1   1 
ATOM   6516 O OE2   . GLU B 1 313 ? 22.552  10.410  -35.178 1.00 61.82  ? 313 GLU B OE2   1 
ATOM   6517 N N     . ALA B 1 314 ? 24.367  14.773  -35.804 1.00 50.12  ? 314 ALA B N     1 
ATOM   6518 C CA    . ALA B 1 314 ? 25.157  15.952  -36.139 1.00 49.75  ? 314 ALA B CA    1 
ATOM   6519 C C     . ALA B 1 314 ? 24.321  17.001  -36.869 1.00 56.33  ? 314 ALA B C     1 
ATOM   6520 O O     . ALA B 1 314 ? 24.455  18.202  -36.609 1.00 59.53  ? 314 ALA B O     1 
ATOM   6521 C CB    . ALA B 1 314 ? 26.371  15.556  -36.978 1.00 52.25  ? 314 ALA B CB    1 
ATOM   6522 N N     . LEU B 1 315 ? 23.441  16.568  -37.779 1.00 57.91  ? 315 LEU B N     1 
ATOM   6523 C CA    . LEU B 1 315 ? 22.704  17.520  -38.605 1.00 54.66  ? 315 LEU B CA    1 
ATOM   6524 C C     . LEU B 1 315 ? 21.531  18.132  -37.860 1.00 58.32  ? 315 LEU B C     1 
ATOM   6525 O O     . LEU B 1 315 ? 21.135  19.263  -38.166 1.00 59.83  ? 315 LEU B O     1 
ATOM   6526 C CB    . LEU B 1 315 ? 22.210  16.849  -39.884 1.00 54.62  ? 315 LEU B CB    1 
ATOM   6527 C CG    . LEU B 1 315 ? 23.270  16.172  -40.749 1.00 54.20  ? 315 LEU B CG    1 
ATOM   6528 C CD1   . LEU B 1 315 ? 22.598  15.234  -41.710 1.00 53.74  ? 315 LEU B CD1   1 
ATOM   6529 C CD2   . LEU B 1 315 ? 24.076  17.195  -41.507 1.00 54.24  ? 315 LEU B CD2   1 
ATOM   6530 N N     . ILE B 1 316 ? 20.958  17.416  -36.892 1.00 57.61  ? 316 ILE B N     1 
ATOM   6531 C CA    . ILE B 1 316 ? 19.960  18.067  -36.056 1.00 58.15  ? 316 ILE B CA    1 
ATOM   6532 C C     . ILE B 1 316 ? 20.640  18.981  -35.044 1.00 60.26  ? 316 ILE B C     1 
ATOM   6533 O O     . ILE B 1 316 ? 20.138  20.070  -34.754 1.00 64.11  ? 316 ILE B O     1 
ATOM   6534 C CB    . ILE B 1 316 ? 19.025  17.045  -35.375 1.00 56.31  ? 316 ILE B CB    1 
ATOM   6535 C CG1   . ILE B 1 316 ? 19.770  16.144  -34.405 1.00 57.73  ? 316 ILE B CG1   1 
ATOM   6536 C CG2   . ILE B 1 316 ? 18.318  16.182  -36.392 1.00 48.57  ? 316 ILE B CG2   1 
ATOM   6537 C CD1   . ILE B 1 316 ? 18.856  15.173  -33.669 1.00 56.85  ? 316 ILE B CD1   1 
ATOM   6538 N N     . ASN B 1 317 ? 21.810  18.589  -34.522 1.00 61.39  ? 317 ASN B N     1 
ATOM   6539 C CA    . ASN B 1 317 ? 22.481  19.420  -33.519 1.00 64.44  ? 317 ASN B CA    1 
ATOM   6540 C C     . ASN B 1 317 ? 22.880  20.782  -34.068 1.00 66.92  ? 317 ASN B C     1 
ATOM   6541 O O     . ASN B 1 317 ? 23.028  21.728  -33.288 1.00 69.89  ? 317 ASN B O     1 
ATOM   6542 C CB    . ASN B 1 317 ? 23.747  18.744  -32.971 1.00 62.80  ? 317 ASN B CB    1 
ATOM   6543 C CG    . ASN B 1 317 ? 23.458  17.714  -31.883 1.00 67.94  ? 317 ASN B CG    1 
ATOM   6544 O OD1   . ASN B 1 317 ? 22.299  17.414  -31.575 1.00 66.96  ? 317 ASN B OD1   1 
ATOM   6545 N ND2   . ASN B 1 317 ? 24.524  17.141  -31.315 1.00 67.41  ? 317 ASN B ND2   1 
ATOM   6546 N N     . THR B 1 318 ? 23.065  20.905  -35.388 1.00 64.31  ? 318 THR B N     1 
ATOM   6547 C CA    . THR B 1 318 ? 23.700  22.084  -35.959 1.00 63.10  ? 318 THR B CA    1 
ATOM   6548 C C     . THR B 1 318 ? 22.923  22.748  -37.091 1.00 63.01  ? 318 THR B C     1 
ATOM   6549 O O     . THR B 1 318 ? 23.378  23.778  -37.596 1.00 64.76  ? 318 THR B O     1 
ATOM   6550 C CB    . THR B 1 318 ? 25.103  21.728  -36.474 1.00 66.44  ? 318 THR B CB    1 
ATOM   6551 O OG1   . THR B 1 318 ? 24.993  20.888  -37.635 1.00 61.39  ? 318 THR B OG1   1 
ATOM   6552 C CG2   . THR B 1 318 ? 25.915  21.003  -35.390 1.00 60.61  ? 318 THR B CG2   1 
ATOM   6553 N N     . GLY B 1 319 ? 21.770  22.206  -37.502 1.00 63.31  ? 319 GLY B N     1 
ATOM   6554 C CA    . GLY B 1 319 ? 21.040  22.764  -38.622 1.00 64.40  ? 319 GLY B CA    1 
ATOM   6555 C C     . GLY B 1 319 ? 20.123  23.931  -38.259 1.00 61.58  ? 319 GLY B C     1 
ATOM   6556 O O     . GLY B 1 319 ? 19.699  24.096  -37.124 1.00 57.63  ? 319 GLY B O     1 
ATOM   6557 N N     . ASP B 1 320 ? 19.808  24.750  -39.265 1.00 67.26  ? 320 ASP B N     1 
ATOM   6558 C CA    . ASP B 1 320 ? 18.854  25.848  -39.128 1.00 62.73  ? 320 ASP B CA    1 
ATOM   6559 C C     . ASP B 1 320 ? 17.471  25.394  -39.603 1.00 64.79  ? 320 ASP B C     1 
ATOM   6560 O O     . ASP B 1 320 ? 17.303  24.969  -40.759 1.00 62.52  ? 320 ASP B O     1 
ATOM   6561 C CB    . ASP B 1 320 ? 19.325  27.073  -39.912 1.00 65.72  ? 320 ASP B CB    1 
ATOM   6562 C CG    . ASP B 1 320 ? 18.306  28.189  -39.915 1.00 64.52  ? 320 ASP B CG    1 
ATOM   6563 O OD1   . ASP B 1 320 ? 17.497  28.237  -38.980 1.00 58.77  ? 320 ASP B OD1   1 
ATOM   6564 O OD2   . ASP B 1 320 ? 18.308  29.009  -40.858 1.00 71.66  ? 320 ASP B OD2   1 
ATOM   6565 N N     . PHE B 1 321 ? 16.484  25.491  -38.708 1.00 59.10  ? 321 PHE B N     1 
ATOM   6566 C CA    . PHE B 1 321 ? 15.155  24.943  -38.942 1.00 55.32  ? 321 PHE B CA    1 
ATOM   6567 C C     . PHE B 1 321 ? 14.070  25.984  -38.728 1.00 57.55  ? 321 PHE B C     1 
ATOM   6568 O O     . PHE B 1 321 ? 12.946  25.628  -38.363 1.00 54.62  ? 321 PHE B O     1 
ATOM   6569 C CB    . PHE B 1 321 ? 14.896  23.727  -38.050 1.00 48.56  ? 321 PHE B CB    1 
ATOM   6570 C CG    . PHE B 1 321 ? 15.756  22.547  -38.387 1.00 54.92  ? 321 PHE B CG    1 
ATOM   6571 C CD1   . PHE B 1 321 ? 15.557  21.842  -39.570 1.00 59.95  ? 321 PHE B CD1   1 
ATOM   6572 C CD2   . PHE B 1 321 ? 16.782  22.155  -37.550 1.00 56.51  ? 321 PHE B CD2   1 
ATOM   6573 C CE1   . PHE B 1 321 ? 16.363  20.764  -39.897 1.00 57.90  ? 321 PHE B CE1   1 
ATOM   6574 C CE2   . PHE B 1 321 ? 17.590  21.072  -37.869 1.00 57.41  ? 321 PHE B CE2   1 
ATOM   6575 C CZ    . PHE B 1 321 ? 17.379  20.379  -39.045 1.00 58.94  ? 321 PHE B CZ    1 
ATOM   6576 N N     . GLN B 1 322 ? 14.378  27.270  -38.958 1.00 59.58  ? 322 GLN B N     1 
ATOM   6577 C CA    . GLN B 1 322 ? 13.352  28.299  -38.791 1.00 58.67  ? 322 GLN B CA    1 
ATOM   6578 C C     . GLN B 1 322 ? 12.151  28.022  -39.679 1.00 59.55  ? 322 GLN B C     1 
ATOM   6579 O O     . GLN B 1 322 ? 11.020  28.363  -39.314 1.00 60.15  ? 322 GLN B O     1 
ATOM   6580 C CB    . GLN B 1 322 ? 13.882  29.689  -39.131 1.00 60.30  ? 322 GLN B CB    1 
ATOM   6581 C CG    . GLN B 1 322 ? 15.241  30.015  -38.638 1.00 61.98  ? 322 GLN B CG    1 
ATOM   6582 C CD    . GLN B 1 322 ? 15.191  31.050  -37.568 1.00 73.40  ? 322 GLN B CD    1 
ATOM   6583 O OE1   . GLN B 1 322 ? 14.115  31.551  -37.240 1.00 77.20  ? 322 GLN B OE1   1 
ATOM   6584 N NE2   . GLN B 1 322 ? 16.348  31.381  -36.997 1.00 73.99  ? 322 GLN B NE2   1 
ATOM   6585 N N     . ASP B 1 323 ? 12.385  27.411  -40.849 1.00 54.99  ? 323 ASP B N     1 
ATOM   6586 C CA    . ASP B 1 323 ? 11.346  27.182  -41.847 1.00 58.28  ? 323 ASP B CA    1 
ATOM   6587 C C     . ASP B 1 323 ? 10.502  25.953  -41.555 1.00 54.73  ? 323 ASP B C     1 
ATOM   6588 O O     . ASP B 1 323 ? 9.387   25.844  -42.079 1.00 54.47  ? 323 ASP B O     1 
ATOM   6589 C CB    . ASP B 1 323 ? 11.983  27.045  -43.236 1.00 58.26  ? 323 ASP B CB    1 
ATOM   6590 C CG    . ASP B 1 323 ? 13.056  25.955  -43.298 1.00 61.52  ? 323 ASP B CG    1 
ATOM   6591 O OD1   . ASP B 1 323 ? 13.700  25.644  -42.267 1.00 57.03  ? 323 ASP B OD1   1 
ATOM   6592 O OD2   . ASP B 1 323 ? 13.263  25.410  -44.405 1.00 73.54  ? 323 ASP B OD2   1 
ATOM   6593 N N     . LEU B 1 324 ? 10.998  25.050  -40.715 1.00 50.67  ? 324 LEU B N     1 
ATOM   6594 C CA    . LEU B 1 324 ? 10.394  23.743  -40.534 1.00 47.68  ? 324 LEU B CA    1 
ATOM   6595 C C     . LEU B 1 324 ? 9.155   23.812  -39.653 1.00 47.24  ? 324 LEU B C     1 
ATOM   6596 O O     . LEU B 1 324 ? 9.078   24.602  -38.710 1.00 51.73  ? 324 LEU B O     1 
ATOM   6597 C CB    . LEU B 1 324 ? 11.418  22.793  -39.921 1.00 45.81  ? 324 LEU B CB    1 
ATOM   6598 C CG    . LEU B 1 324 ? 10.922  21.381  -39.652 1.00 46.77  ? 324 LEU B CG    1 
ATOM   6599 C CD1   . LEU B 1 324 ? 10.590  20.730  -40.948 1.00 42.54  ? 324 LEU B CD1   1 
ATOM   6600 C CD2   . LEU B 1 324 ? 11.949  20.556  -38.852 1.00 48.90  ? 324 LEU B CD2   1 
ATOM   6601 N N     . GLN B 1 325 ? 8.178   22.982  -39.976 1.00 45.87  ? 325 GLN B N     1 
ATOM   6602 C CA    . GLN B 1 325 ? 7.030   22.738  -39.122 1.00 44.11  ? 325 GLN B CA    1 
ATOM   6603 C C     . GLN B 1 325 ? 6.816   21.237  -39.071 1.00 47.13  ? 325 GLN B C     1 
ATOM   6604 O O     . GLN B 1 325 ? 6.718   20.587  -40.116 1.00 49.80  ? 325 GLN B O     1 
ATOM   6605 C CB    . GLN B 1 325 ? 5.785   23.437  -39.639 1.00 45.32  ? 325 GLN B CB    1 
ATOM   6606 C CG    . GLN B 1 325 ? 5.941   24.916  -39.668 1.00 49.02  ? 325 GLN B CG    1 
ATOM   6607 C CD    . GLN B 1 325 ? 5.034   25.563  -40.675 1.00 49.69  ? 325 GLN B CD    1 
ATOM   6608 O OE1   . GLN B 1 325 ? 4.117   24.937  -41.195 1.00 52.79  ? 325 GLN B OE1   1 
ATOM   6609 N NE2   . GLN B 1 325 ? 5.294   26.827  -40.970 1.00 56.46  ? 325 GLN B NE2   1 
ATOM   6610 N N     . VAL B 1 326 ? 6.767   20.686  -37.865 1.00 44.97  ? 326 VAL B N     1 
ATOM   6611 C CA    . VAL B 1 326 ? 6.733   19.246  -37.678 1.00 42.68  ? 326 VAL B CA    1 
ATOM   6612 C C     . VAL B 1 326 ? 5.700   18.895  -36.623 1.00 48.13  ? 326 VAL B C     1 
ATOM   6613 O O     . VAL B 1 326 ? 5.481   19.636  -35.659 1.00 45.84  ? 326 VAL B O     1 
ATOM   6614 C CB    . VAL B 1 326 ? 8.111   18.692  -37.270 1.00 43.91  ? 326 VAL B CB    1 
ATOM   6615 C CG1   . VAL B 1 326 ? 9.011   18.593  -38.452 1.00 49.24  ? 326 VAL B CG1   1 
ATOM   6616 C CG2   . VAL B 1 326 ? 8.737   19.570  -36.207 1.00 42.82  ? 326 VAL B CG2   1 
ATOM   6617 N N     . LEU B 1 327 ? 5.088   17.730  -36.797 1.00 46.67  ? 327 LEU B N     1 
ATOM   6618 C CA    . LEU B 1 327 ? 4.176   17.142  -35.822 1.00 43.08  ? 327 LEU B CA    1 
ATOM   6619 C C     . LEU B 1 327 ? 4.721   15.757  -35.474 1.00 43.14  ? 327 LEU B C     1 
ATOM   6620 O O     . LEU B 1 327 ? 4.787   14.885  -36.352 1.00 43.55  ? 327 LEU B O     1 
ATOM   6621 C CB    . LEU B 1 327 ? 2.764   17.092  -36.399 1.00 40.31  ? 327 LEU B CB    1 
ATOM   6622 C CG    . LEU B 1 327 ? 1.814   16.066  -35.823 1.00 41.13  ? 327 LEU B CG    1 
ATOM   6623 C CD1   . LEU B 1 327 ? 1.564   16.362  -34.376 1.00 41.04  ? 327 LEU B CD1   1 
ATOM   6624 C CD2   . LEU B 1 327 ? 0.530   16.125  -36.614 1.00 42.27  ? 327 LEU B CD2   1 
ATOM   6625 N N     . VAL B 1 328 ? 5.156   15.559  -34.214 1.00 39.09  ? 328 VAL B N     1 
ATOM   6626 C CA    . VAL B 1 328 ? 5.846   14.339  -33.786 1.00 38.77  ? 328 VAL B CA    1 
ATOM   6627 C C     . VAL B 1 328 ? 5.140   13.725  -32.583 1.00 40.93  ? 328 VAL B C     1 
ATOM   6628 O O     . VAL B 1 328 ? 4.543   14.429  -31.766 1.00 44.76  ? 328 VAL B O     1 
ATOM   6629 C CB    . VAL B 1 328 ? 7.330   14.583  -33.427 1.00 37.75  ? 328 VAL B CB    1 
ATOM   6630 C CG1   . VAL B 1 328 ? 8.053   15.286  -34.548 1.00 38.13  ? 328 VAL B CG1   1 
ATOM   6631 C CG2   . VAL B 1 328 ? 7.457   15.355  -32.103 1.00 37.72  ? 328 VAL B CG2   1 
ATOM   6632 N N     . GLY B 1 329 ? 5.235   12.407  -32.452 1.00 37.99  ? 329 GLY B N     1 
ATOM   6633 C CA    . GLY B 1 329 ? 4.532   11.770  -31.357 1.00 40.41  ? 329 GLY B CA    1 
ATOM   6634 C C     . GLY B 1 329 ? 4.956   10.332  -31.184 1.00 43.45  ? 329 GLY B C     1 
ATOM   6635 O O     . GLY B 1 329 ? 5.818   9.825   -31.903 1.00 43.90  ? 329 GLY B O     1 
ATOM   6636 N N     . VAL B 1 330 ? 4.346   9.683   -30.187 1.00 43.18  ? 330 VAL B N     1 
ATOM   6637 C CA    . VAL B 1 330 ? 4.601   8.288   -29.846 1.00 39.83  ? 330 VAL B CA    1 
ATOM   6638 C C     . VAL B 1 330 ? 3.282   7.671   -29.399 1.00 41.83  ? 330 VAL B C     1 
ATOM   6639 O O     . VAL B 1 330 ? 2.282   8.364   -29.197 1.00 42.63  ? 330 VAL B O     1 
ATOM   6640 C CB    . VAL B 1 330 ? 5.661   8.130   -28.729 1.00 44.24  ? 330 VAL B CB    1 
ATOM   6641 C CG1   . VAL B 1 330 ? 7.013   8.723   -29.132 1.00 40.21  ? 330 VAL B CG1   1 
ATOM   6642 C CG2   . VAL B 1 330 ? 5.157   8.752   -27.425 1.00 37.70  ? 330 VAL B CG2   1 
ATOM   6643 N N     . VAL B 1 331 ? 3.285   6.354   -29.243 1.00 40.69  ? 331 VAL B N     1 
ATOM   6644 C CA    . VAL B 1 331 ? 2.175   5.650   -28.630 1.00 39.68  ? 331 VAL B CA    1 
ATOM   6645 C C     . VAL B 1 331 ? 2.573   5.270   -27.211 1.00 44.87  ? 331 VAL B C     1 
ATOM   6646 O O     . VAL B 1 331 ? 3.725   5.413   -26.804 1.00 45.77  ? 331 VAL B O     1 
ATOM   6647 C CB    . VAL B 1 331 ? 1.754   4.408   -29.440 1.00 40.34  ? 331 VAL B CB    1 
ATOM   6648 C CG1   . VAL B 1 331 ? 1.217   4.830   -30.803 1.00 44.06  ? 331 VAL B CG1   1 
ATOM   6649 C CG2   . VAL B 1 331 ? 2.925   3.474   -29.577 1.00 39.33  ? 331 VAL B CG2   1 
ATOM   6650 N N     . LYS B 1 332 ? 1.607   4.768   -26.439 1.00 40.83  ? 332 LYS B N     1 
ATOM   6651 C CA    . LYS B 1 332 ? 1.871   4.616   -25.018 1.00 47.70  ? 332 LYS B CA    1 
ATOM   6652 C C     . LYS B 1 332 ? 2.898   3.527   -24.746 1.00 48.79  ? 332 LYS B C     1 
ATOM   6653 O O     . LYS B 1 332 ? 3.671   3.641   -23.796 1.00 46.88  ? 332 LYS B O     1 
ATOM   6654 C CB    . LYS B 1 332 ? 0.574   4.343   -24.256 1.00 49.02  ? 332 LYS B CB    1 
ATOM   6655 C CG    . LYS B 1 332 ? 0.702   4.573   -22.746 1.00 48.18  ? 332 LYS B CG    1 
ATOM   6656 C CD    . LYS B 1 332 ? -0.642  4.482   -22.022 1.00 51.64  ? 332 LYS B CD    1 
ATOM   6657 C CE    . LYS B 1 332 ? -1.474  3.261   -22.490 1.00 58.43  ? 332 LYS B CE    1 
ATOM   6658 N NZ    . LYS B 1 332 ? -0.982  1.899   -22.034 1.00 58.00  ? 332 LYS B NZ    1 
ATOM   6659 N N     . ASP B 1 333 ? 2.954   2.488   -25.572 1.00 45.76  ? 333 ASP B N     1 
ATOM   6660 C CA    . ASP B 1 333 ? 3.729   1.294   -25.258 1.00 45.10  ? 333 ASP B CA    1 
ATOM   6661 C C     . ASP B 1 333 ? 4.556   0.902   -26.464 1.00 48.88  ? 333 ASP B C     1 
ATOM   6662 O O     . ASP B 1 333 ? 4.260   -0.077  -27.147 1.00 58.78  ? 333 ASP B O     1 
ATOM   6663 C CB    . ASP B 1 333 ? 2.819   0.172   -24.828 1.00 48.58  ? 333 ASP B CB    1 
ATOM   6664 C CG    . ASP B 1 333 ? 2.148   0.473   -23.519 1.00 51.23  ? 333 ASP B CG    1 
ATOM   6665 O OD1   . ASP B 1 333 ? 0.950   0.829   -23.542 1.00 51.45  ? 333 ASP B OD1   1 
ATOM   6666 O OD2   . ASP B 1 333 ? 2.844   0.394   -22.480 1.00 46.16  ? 333 ASP B OD2   1 
ATOM   6667 N N     . GLU B 1 334 ? 5.610   1.676   -26.718 1.00 48.40  ? 334 GLU B N     1 
ATOM   6668 C CA    . GLU B 1 334 ? 6.313   1.551   -27.984 1.00 43.88  ? 334 GLU B CA    1 
ATOM   6669 C C     . GLU B 1 334 ? 7.053   0.234   -28.061 1.00 49.34  ? 334 GLU B C     1 
ATOM   6670 O O     . GLU B 1 334 ? 7.044   -0.427  -29.107 1.00 53.31  ? 334 GLU B O     1 
ATOM   6671 C CB    . GLU B 1 334 ? 7.272   2.719   -28.180 1.00 40.13  ? 334 GLU B CB    1 
ATOM   6672 C CG    . GLU B 1 334 ? 6.513   3.959   -28.567 1.00 41.98  ? 334 GLU B CG    1 
ATOM   6673 C CD    . GLU B 1 334 ? 6.388   4.114   -30.064 1.00 46.22  ? 334 GLU B CD    1 
ATOM   6674 O OE1   . GLU B 1 334 ? 6.936   3.282   -30.797 1.00 46.64  ? 334 GLU B OE1   1 
ATOM   6675 O OE2   . GLU B 1 334 ? 5.732   5.071   -30.511 1.00 45.47  ? 334 GLU B OE2   1 
ATOM   6676 N N     . GLY B 1 335 ? 7.641   -0.196  -26.942 1.00 47.57  ? 335 GLY B N     1 
ATOM   6677 C CA    . GLY B 1 335 ? 8.502   -1.362  -26.966 1.00 48.25  ? 335 GLY B CA    1 
ATOM   6678 C C     . GLY B 1 335 ? 7.812   -2.698  -26.836 1.00 48.41  ? 335 GLY B C     1 
ATOM   6679 O O     . GLY B 1 335 ? 8.480   -3.724  -26.991 1.00 47.92  ? 335 GLY B O     1 
ATOM   6680 N N     . SER B 1 336 ? 6.504   -2.728  -26.572 1.00 46.43  ? 336 SER B N     1 
ATOM   6681 C CA    . SER B 1 336 ? 5.897   -3.987  -26.157 1.00 52.12  ? 336 SER B CA    1 
ATOM   6682 C C     . SER B 1 336 ? 5.800   -4.958  -27.326 1.00 53.65  ? 336 SER B C     1 
ATOM   6683 O O     . SER B 1 336 ? 6.142   -6.138  -27.188 1.00 57.54  ? 336 SER B O     1 
ATOM   6684 C CB    . SER B 1 336 ? 4.531   -3.740  -25.506 1.00 52.68  ? 336 SER B CB    1 
ATOM   6685 O OG    . SER B 1 336 ? 3.548   -3.352  -26.439 1.00 56.15  ? 336 SER B OG    1 
ATOM   6686 N N     . TYR B 1 337 ? 5.364   -4.472  -28.492 1.00 59.26  ? 337 TYR B N     1 
ATOM   6687 C CA    . TYR B 1 337 ? 5.320   -5.258  -29.728 1.00 60.84  ? 337 TYR B CA    1 
ATOM   6688 C C     . TYR B 1 337 ? 6.585   -6.080  -29.912 1.00 54.68  ? 337 TYR B C     1 
ATOM   6689 O O     . TYR B 1 337 ? 6.527   -7.270  -30.216 1.00 56.32  ? 337 TYR B O     1 
ATOM   6690 C CB    . TYR B 1 337 ? 5.127   -4.334  -30.943 1.00 58.95  ? 337 TYR B CB    1 
ATOM   6691 C CG    . TYR B 1 337 ? 4.720   -5.015  -32.241 1.00 59.78  ? 337 TYR B CG    1 
ATOM   6692 C CD1   . TYR B 1 337 ? 3.505   -4.719  -32.847 1.00 61.83  ? 337 TYR B CD1   1 
ATOM   6693 C CD2   . TYR B 1 337 ? 5.559   -5.935  -32.875 1.00 68.40  ? 337 TYR B CD2   1 
ATOM   6694 C CE1   . TYR B 1 337 ? 3.119   -5.338  -34.051 1.00 67.50  ? 337 TYR B CE1   1 
ATOM   6695 C CE2   . TYR B 1 337 ? 5.187   -6.567  -34.071 1.00 68.78  ? 337 TYR B CE2   1 
ATOM   6696 C CZ    . TYR B 1 337 ? 3.965   -6.265  -34.658 1.00 70.98  ? 337 TYR B CZ    1 
ATOM   6697 O OH    . TYR B 1 337 ? 3.599   -6.879  -35.851 1.00 67.41  ? 337 TYR B OH    1 
ATOM   6698 N N     . PHE B 1 338 ? 7.735   -5.462  -29.700 1.00 55.48  ? 338 PHE B N     1 
ATOM   6699 C CA    . PHE B 1 338 ? 8.982   -6.081  -30.104 1.00 53.05  ? 338 PHE B CA    1 
ATOM   6700 C C     . PHE B 1 338 ? 9.404   -7.237  -29.220 1.00 56.48  ? 338 PHE B C     1 
ATOM   6701 O O     . PHE B 1 338 ? 10.116  -8.109  -29.706 1.00 59.53  ? 338 PHE B O     1 
ATOM   6702 C CB    . PHE B 1 338 ? 10.081  -5.029  -30.149 1.00 52.53  ? 338 PHE B CB    1 
ATOM   6703 C CG    . PHE B 1 338 ? 9.853   -4.007  -31.208 1.00 59.54  ? 338 PHE B CG    1 
ATOM   6704 C CD1   . PHE B 1 338 ? 9.128   -2.854  -30.928 1.00 54.20  ? 338 PHE B CD1   1 
ATOM   6705 C CD2   . PHE B 1 338 ? 10.308  -4.222  -32.506 1.00 54.17  ? 338 PHE B CD2   1 
ATOM   6706 C CE1   . PHE B 1 338 ? 8.883   -1.919  -31.913 1.00 53.43  ? 338 PHE B CE1   1 
ATOM   6707 C CE2   . PHE B 1 338 ? 10.082  -3.285  -33.489 1.00 53.08  ? 338 PHE B CE2   1 
ATOM   6708 C CZ    . PHE B 1 338 ? 9.364   -2.132  -33.199 1.00 53.08  ? 338 PHE B CZ    1 
ATOM   6709 N N     . LEU B 1 339 ? 8.971   -7.295  -27.955 1.00 58.28  ? 339 LEU B N     1 
ATOM   6710 C CA    . LEU B 1 339 ? 9.573   -8.244  -27.013 1.00 58.48  ? 339 LEU B CA    1 
ATOM   6711 C C     . LEU B 1 339 ? 9.371   -9.695  -27.447 1.00 59.81  ? 339 LEU B C     1 
ATOM   6712 O O     . LEU B 1 339 ? 10.272  -10.527 -27.282 1.00 62.45  ? 339 LEU B O     1 
ATOM   6713 C CB    . LEU B 1 339 ? 9.009   -8.023  -25.611 1.00 56.14  ? 339 LEU B CB    1 
ATOM   6714 C CG    . LEU B 1 339 ? 9.372   -6.661  -25.040 1.00 52.90  ? 339 LEU B CG    1 
ATOM   6715 C CD1   . LEU B 1 339 ? 8.574   -6.390  -23.798 1.00 52.92  ? 339 LEU B CD1   1 
ATOM   6716 C CD2   . LEU B 1 339 ? 10.855  -6.604  -24.759 1.00 51.02  ? 339 LEU B CD2   1 
ATOM   6717 N N     . VAL B 1 340 ? 8.197   -10.018 -28.000 1.00 56.99  ? 340 VAL B N     1 
ATOM   6718 C CA    . VAL B 1 340 ? 7.906   -11.378 -28.448 1.00 62.20  ? 340 VAL B CA    1 
ATOM   6719 C C     . VAL B 1 340 ? 8.749   -11.811 -29.638 1.00 60.98  ? 340 VAL B C     1 
ATOM   6720 O O     . VAL B 1 340 ? 8.689   -12.982 -30.032 1.00 61.45  ? 340 VAL B O     1 
ATOM   6721 C CB    . VAL B 1 340 ? 6.414   -11.537 -28.814 1.00 63.47  ? 340 VAL B CB    1 
ATOM   6722 C CG1   . VAL B 1 340 ? 5.545   -10.959 -27.729 1.00 60.78  ? 340 VAL B CG1   1 
ATOM   6723 C CG2   . VAL B 1 340 ? 6.106   -10.881 -30.132 1.00 57.79  ? 340 VAL B CG2   1 
ATOM   6724 N N     . TYR B 1 341 ? 9.525   -10.901 -30.222 1.00 60.80  ? 341 TYR B N     1 
ATOM   6725 C CA    . TYR B 1 341 ? 10.407  -11.187 -31.355 1.00 61.69  ? 341 TYR B CA    1 
ATOM   6726 C C     . TYR B 1 341 ? 11.842  -11.437 -30.913 1.00 57.86  ? 341 TYR B C     1 
ATOM   6727 O O     . TYR B 1 341 ? 12.784  -11.055 -31.608 1.00 60.39  ? 341 TYR B O     1 
ATOM   6728 C CB    . TYR B 1 341 ? 10.359  -10.045 -32.374 1.00 61.25  ? 341 TYR B CB    1 
ATOM   6729 C CG    . TYR B 1 341 ? 9.124   -10.059 -33.245 1.00 65.81  ? 341 TYR B CG    1 
ATOM   6730 C CD1   . TYR B 1 341 ? 7.891   -9.676  -32.738 1.00 62.59  ? 341 TYR B CD1   1 
ATOM   6731 C CD2   . TYR B 1 341 ? 9.192   -10.458 -34.574 1.00 65.62  ? 341 TYR B CD2   1 
ATOM   6732 C CE1   . TYR B 1 341 ? 6.758   -9.702  -33.526 1.00 66.30  ? 341 TYR B CE1   1 
ATOM   6733 C CE2   . TYR B 1 341 ? 8.068   -10.478 -35.368 1.00 63.35  ? 341 TYR B CE2   1 
ATOM   6734 C CZ    . TYR B 1 341 ? 6.855   -10.106 -34.841 1.00 67.89  ? 341 TYR B CZ    1 
ATOM   6735 O OH    . TYR B 1 341 ? 5.731   -10.129 -35.628 1.00 67.94  ? 341 TYR B OH    1 
ATOM   6736 N N     . GLY B 1 342 ? 12.068  -12.049 -29.761 1.00 64.21  ? 342 GLY B N     1 
ATOM   6737 C CA    . GLY B 1 342 ? 13.451  -12.319 -29.427 1.00 66.88  ? 342 GLY B CA    1 
ATOM   6738 C C     . GLY B 1 342 ? 13.856  -12.492 -27.976 1.00 63.98  ? 342 GLY B C     1 
ATOM   6739 O O     . GLY B 1 342 ? 14.866  -13.150 -27.720 1.00 65.13  ? 342 GLY B O     1 
ATOM   6740 N N     . VAL B 1 343 ? 13.140  -11.918 -27.019 1.00 57.82  ? 343 VAL B N     1 
ATOM   6741 C CA    . VAL B 1 343 ? 13.604  -11.880 -25.636 1.00 63.22  ? 343 VAL B CA    1 
ATOM   6742 C C     . VAL B 1 343 ? 12.871  -12.955 -24.843 1.00 61.37  ? 343 VAL B C     1 
ATOM   6743 O O     . VAL B 1 343 ? 11.632  -12.907 -24.748 1.00 61.47  ? 343 VAL B O     1 
ATOM   6744 C CB    . VAL B 1 343 ? 13.419  -10.495 -25.008 1.00 66.44  ? 343 VAL B CB    1 
ATOM   6745 C CG1   . VAL B 1 343 ? 13.569  -10.577 -23.449 1.00 62.18  ? 343 VAL B CG1   1 
ATOM   6746 C CG2   . VAL B 1 343 ? 14.425  -9.537  -25.641 1.00 61.92  ? 343 VAL B CG2   1 
ATOM   6747 N N     . PRO B 1 344 ? 13.581  -13.906 -24.246 1.00 57.31  ? 344 PRO B N     1 
ATOM   6748 C CA    . PRO B 1 344 ? 12.922  -15.072 -23.661 1.00 55.58  ? 344 PRO B CA    1 
ATOM   6749 C C     . PRO B 1 344 ? 11.973  -14.691 -22.542 1.00 59.75  ? 344 PRO B C     1 
ATOM   6750 O O     . PRO B 1 344 ? 12.286  -13.858 -21.690 1.00 61.84  ? 344 PRO B O     1 
ATOM   6751 C CB    . PRO B 1 344 ? 14.093  -15.902 -23.135 1.00 56.06  ? 344 PRO B CB    1 
ATOM   6752 C CG    . PRO B 1 344 ? 15.244  -15.501 -23.959 1.00 57.91  ? 344 PRO B CG    1 
ATOM   6753 C CD    . PRO B 1 344 ? 15.043  -14.041 -24.243 1.00 59.52  ? 344 PRO B CD    1 
ATOM   6754 N N     . GLY B 1 345 ? 10.814  -15.332 -22.540 1.00 57.87  ? 345 GLY B N     1 
ATOM   6755 C CA    . GLY B 1 345 ? 9.781   -15.075 -21.564 1.00 55.29  ? 345 GLY B CA    1 
ATOM   6756 C C     . GLY B 1 345 ? 8.582   -14.345 -22.114 1.00 60.78  ? 345 GLY B C     1 
ATOM   6757 O O     . GLY B 1 345 ? 7.538   -14.313 -21.451 1.00 63.65  ? 345 GLY B O     1 
ATOM   6758 N N     . PHE B 1 346 ? 8.680   -13.763 -23.301 1.00 59.60  ? 346 PHE B N     1 
ATOM   6759 C CA    . PHE B 1 346 ? 7.608   -12.931 -23.822 1.00 61.30  ? 346 PHE B CA    1 
ATOM   6760 C C     . PHE B 1 346 ? 6.855   -13.677 -24.914 1.00 63.53  ? 346 PHE B C     1 
ATOM   6761 O O     . PHE B 1 346 ? 7.473   -14.330 -25.762 1.00 61.22  ? 346 PHE B O     1 
ATOM   6762 C CB    . PHE B 1 346 ? 8.175   -11.604 -24.318 1.00 62.19  ? 346 PHE B CB    1 
ATOM   6763 C CG    . PHE B 1 346 ? 8.657   -10.735 -23.210 1.00 61.97  ? 346 PHE B CG    1 
ATOM   6764 C CD1   . PHE B 1 346 ? 9.934   -10.893 -22.694 1.00 62.60  ? 346 PHE B CD1   1 
ATOM   6765 C CD2   . PHE B 1 346 ? 7.817   -9.800  -22.638 1.00 61.19  ? 346 PHE B CD2   1 
ATOM   6766 C CE1   . PHE B 1 346 ? 10.372  -10.113 -21.650 1.00 54.34  ? 346 PHE B CE1   1 
ATOM   6767 C CE2   . PHE B 1 346 ? 8.252   -9.018  -21.592 1.00 56.23  ? 346 PHE B CE2   1 
ATOM   6768 C CZ    . PHE B 1 346 ? 9.531   -9.174  -21.105 1.00 55.69  ? 346 PHE B CZ    1 
ATOM   6769 N N     . SER B 1 347 ? 5.521   -13.599 -24.864 1.00 60.33  ? 347 SER B N     1 
ATOM   6770 C CA    . SER B 1 347 ? 4.654   -14.274 -25.816 1.00 60.26  ? 347 SER B CA    1 
ATOM   6771 C C     . SER B 1 347 ? 3.332   -13.528 -25.944 1.00 63.53  ? 347 SER B C     1 
ATOM   6772 O O     . SER B 1 347 ? 2.770   -13.074 -24.943 1.00 64.30  ? 347 SER B O     1 
ATOM   6773 C CB    . SER B 1 347 ? 4.379   -15.721 -25.398 1.00 64.48  ? 347 SER B CB    1 
ATOM   6774 O OG    . SER B 1 347 ? 3.196   -16.222 -26.007 1.00 65.38  ? 347 SER B OG    1 
ATOM   6775 N N     . LYS B 1 348 ? 2.843   -13.421 -27.183 1.00 64.29  ? 348 LYS B N     1 
ATOM   6776 C CA    . LYS B 1 348 ? 1.484   -12.952 -27.441 1.00 63.53  ? 348 LYS B CA    1 
ATOM   6777 C C     . LYS B 1 348 ? 0.460   -13.664 -26.560 1.00 64.85  ? 348 LYS B C     1 
ATOM   6778 O O     . LYS B 1 348 ? -0.560  -13.070 -26.205 1.00 65.94  ? 348 LYS B O     1 
ATOM   6779 C CB    . LYS B 1 348 ? 1.182   -13.126 -28.952 1.00 68.13  ? 348 LYS B CB    1 
ATOM   6780 C CG    . LYS B 1 348 ? -0.252  -13.337 -29.357 1.00 70.12  ? 348 LYS B CG    1 
ATOM   6781 C CD    . LYS B 1 348 ? -0.568  -13.960 -30.761 1.00 66.65  ? 348 LYS B CD    1 
ATOM   6782 C CE    . LYS B 1 348 ? -1.460  -15.120 -30.663 1.00 67.61  ? 348 LYS B CE    1 
ATOM   6783 N NZ    . LYS B 1 348 ? -2.530  -14.987 -29.655 1.00 78.76  ? 348 LYS B NZ    1 
ATOM   6784 N N     . ASP B 1 349 ? 0.755   -14.889 -26.132 1.00 66.29  ? 349 ASP B N     1 
ATOM   6785 C CA    . ASP B 1 349 ? -0.247  -15.840 -25.664 1.00 67.00  ? 349 ASP B CA    1 
ATOM   6786 C C     . ASP B 1 349 ? -0.442  -15.896 -24.152 1.00 70.61  ? 349 ASP B C     1 
ATOM   6787 O O     . ASP B 1 349 ? -1.591  -15.946 -23.685 1.00 74.68  ? 349 ASP B O     1 
ATOM   6788 C CB    . ASP B 1 349 ? 0.101   -17.210 -26.240 1.00 67.83  ? 349 ASP B CB    1 
ATOM   6789 C CG    . ASP B 1 349 ? -0.261  -17.268 -27.705 1.00 69.87  ? 349 ASP B CG    1 
ATOM   6790 O OD1   . ASP B 1 349 ? -1.339  -16.690 -27.996 1.00 63.80  ? 349 ASP B OD1   1 
ATOM   6791 O OD2   . ASP B 1 349 ? 0.507   -17.779 -28.557 1.00 68.96  ? 349 ASP B OD2   1 
ATOM   6792 N N     . ASN B 1 350 ? 0.636   -15.862 -23.371 1.00 66.31  ? 350 ASN B N     1 
ATOM   6793 C CA    . ASN B 1 350 ? 0.466   -15.774 -21.930 1.00 64.97  ? 350 ASN B CA    1 
ATOM   6794 C C     . ASN B 1 350 ? 0.548   -14.307 -21.524 1.00 67.05  ? 350 ASN B C     1 
ATOM   6795 O O     . ASN B 1 350 ? 0.125   -13.425 -22.277 1.00 69.06  ? 350 ASN B O     1 
ATOM   6796 C CB    . ASN B 1 350 ? 1.486   -16.666 -21.206 1.00 59.62  ? 350 ASN B CB    1 
ATOM   6797 C CG    . ASN B 1 350 ? 2.927   -16.324 -21.537 1.00 60.57  ? 350 ASN B CG    1 
ATOM   6798 O OD1   . ASN B 1 350 ? 3.313   -15.162 -21.497 1.00 64.61  ? 350 ASN B OD1   1 
ATOM   6799 N ND2   . ASN B 1 350 ? 3.739   -17.344 -21.834 1.00 55.86  ? 350 ASN B ND2   1 
ATOM   6800 N N     . GLU B 1 351 ? 1.063   -14.032 -20.334 1.00 65.97  ? 351 GLU B N     1 
ATOM   6801 C CA    . GLU B 1 351 ? 1.161   -12.669 -19.837 1.00 62.29  ? 351 GLU B CA    1 
ATOM   6802 C C     . GLU B 1 351 ? 2.597   -12.264 -19.573 1.00 60.03  ? 351 GLU B C     1 
ATOM   6803 O O     . GLU B 1 351 ? 2.834   -11.238 -18.923 1.00 60.65  ? 351 GLU B O     1 
ATOM   6804 C CB    . GLU B 1 351 ? 0.331   -12.496 -18.568 1.00 64.22  ? 351 GLU B CB    1 
ATOM   6805 C CG    . GLU B 1 351 ? -1.147  -12.356 -18.824 1.00 71.15  ? 351 GLU B CG    1 
ATOM   6806 C CD    . GLU B 1 351 ? -1.881  -11.836 -17.603 1.00 81.15  ? 351 GLU B CD    1 
ATOM   6807 O OE1   . GLU B 1 351 ? -1.250  -11.783 -16.522 1.00 81.93  ? 351 GLU B OE1   1 
ATOM   6808 O OE2   . GLU B 1 351 ? -3.078  -11.481 -17.722 1.00 83.42  ? 351 GLU B OE2   1 
ATOM   6809 N N     . SER B 1 352 ? 3.555   -13.072 -20.008 1.00 54.62  ? 352 SER B N     1 
ATOM   6810 C CA    . SER B 1 352 ? 4.946   -12.647 -20.126 1.00 60.16  ? 352 SER B CA    1 
ATOM   6811 C C     . SER B 1 352 ? 5.493   -12.065 -18.826 1.00 57.79  ? 352 SER B C     1 
ATOM   6812 O O     . SER B 1 352 ? 6.417   -11.251 -18.837 1.00 59.09  ? 352 SER B O     1 
ATOM   6813 C CB    . SER B 1 352 ? 5.099   -11.649 -21.278 1.00 64.85  ? 352 SER B CB    1 
ATOM   6814 O OG    . SER B 1 352 ? 4.175   -11.927 -22.318 1.00 63.02  ? 352 SER B OG    1 
ATOM   6815 N N     . LEU B 1 353 ? 4.925   -12.465 -17.692 1.00 64.05  ? 353 LEU B N     1 
ATOM   6816 C CA    . LEU B 1 353 ? 5.544   -12.199 -16.395 1.00 56.88  ? 353 LEU B CA    1 
ATOM   6817 C C     . LEU B 1 353 ? 6.918   -12.838 -16.359 1.00 55.60  ? 353 LEU B C     1 
ATOM   6818 O O     . LEU B 1 353 ? 7.052   -14.034 -16.608 1.00 62.11  ? 353 LEU B O     1 
ATOM   6819 C CB    . LEU B 1 353 ? 4.673   -12.767 -15.287 1.00 52.47  ? 353 LEU B CB    1 
ATOM   6820 C CG    . LEU B 1 353 ? 3.235   -12.277 -15.342 1.00 58.80  ? 353 LEU B CG    1 
ATOM   6821 C CD1   . LEU B 1 353 ? 2.386   -12.969 -14.283 1.00 65.91  ? 353 LEU B CD1   1 
ATOM   6822 C CD2   . LEU B 1 353 ? 3.225   -10.760 -15.210 1.00 59.20  ? 353 LEU B CD2   1 
ATOM   6823 N N     . ILE B 1 354 ? 7.949   -12.055 -16.069 1.00 58.50  ? 354 ILE B N     1 
ATOM   6824 C CA    . ILE B 1 354 ? 9.311   -12.554 -16.193 1.00 58.85  ? 354 ILE B CA    1 
ATOM   6825 C C     . ILE B 1 354 ? 10.041  -12.476 -14.855 1.00 63.21  ? 354 ILE B C     1 
ATOM   6826 O O     . ILE B 1 354 ? 9.686   -11.721 -13.945 1.00 54.29  ? 354 ILE B O     1 
ATOM   6827 C CB    . ILE B 1 354 ? 10.112  -11.810 -17.285 1.00 60.28  ? 354 ILE B CB    1 
ATOM   6828 C CG1   . ILE B 1 354 ? 9.963   -10.287 -17.145 1.00 57.85  ? 354 ILE B CG1   1 
ATOM   6829 C CG2   . ILE B 1 354 ? 9.685   -12.302 -18.667 1.00 61.59  ? 354 ILE B CG2   1 
ATOM   6830 C CD1   . ILE B 1 354 ? 11.128  -9.514  -17.738 1.00 56.44  ? 354 ILE B CD1   1 
ATOM   6831 N N     . SER B 1 355 ? 11.084  -13.296 -14.755 1.00 63.86  ? 355 SER B N     1 
ATOM   6832 C CA    . SER B 1 355 ? 11.973  -13.276 -13.616 1.00 59.30  ? 355 SER B CA    1 
ATOM   6833 C C     . SER B 1 355 ? 12.811  -12.010 -13.651 1.00 63.28  ? 355 SER B C     1 
ATOM   6834 O O     . SER B 1 355 ? 12.770  -11.224 -14.602 1.00 66.92  ? 355 SER B O     1 
ATOM   6835 C CB    . SER B 1 355 ? 12.888  -14.493 -13.641 1.00 64.13  ? 355 SER B CB    1 
ATOM   6836 O OG    . SER B 1 355 ? 13.992  -14.259 -14.505 1.00 65.45  ? 355 SER B OG    1 
ATOM   6837 N N     . ARG B 1 356 ? 13.611  -11.824 -12.608 1.00 64.19  ? 356 ARG B N     1 
ATOM   6838 C CA    . ARG B 1 356 ? 14.604  -10.767 -12.672 1.00 63.28  ? 356 ARG B CA    1 
ATOM   6839 C C     . ARG B 1 356 ? 15.678  -11.119 -13.693 1.00 61.38  ? 356 ARG B C     1 
ATOM   6840 O O     . ARG B 1 356 ? 15.979  -10.320 -14.586 1.00 65.67  ? 356 ARG B O     1 
ATOM   6841 C CB    . ARG B 1 356 ? 15.196  -10.502 -11.286 1.00 64.31  ? 356 ARG B CB    1 
ATOM   6842 C CG    . ARG B 1 356 ? 16.047  -9.252  -11.259 1.00 62.57  ? 356 ARG B CG    1 
ATOM   6843 C CD    . ARG B 1 356 ? 15.990  -8.443  -9.970  1.00 56.40  ? 356 ARG B CD    1 
ATOM   6844 N NE    . ARG B 1 356 ? 17.102  -7.502  -10.021 1.00 58.66  ? 356 ARG B NE    1 
ATOM   6845 C CZ    . ARG B 1 356 ? 17.018  -6.256  -10.483 1.00 62.86  ? 356 ARG B CZ    1 
ATOM   6846 N NH1   . ARG B 1 356 ? 15.852  -5.779  -10.889 1.00 62.61  ? 356 ARG B NH1   1 
ATOM   6847 N NH2   . ARG B 1 356 ? 18.099  -5.480  -10.525 1.00 56.90  ? 356 ARG B NH2   1 
ATOM   6848 N N     . ALA B 1 357 ? 16.214  -12.342 -13.623 1.00 59.33  ? 357 ALA B N     1 
ATOM   6849 C CA    . ALA B 1 357 ? 17.312  -12.716 -14.512 1.00 59.10  ? 357 ALA B CA    1 
ATOM   6850 C C     . ALA B 1 357 ? 16.910  -12.626 -15.969 1.00 60.92  ? 357 ALA B C     1 
ATOM   6851 O O     . ALA B 1 357 ? 17.748  -12.330 -16.827 1.00 56.68  ? 357 ALA B O     1 
ATOM   6852 C CB    . ALA B 1 357 ? 17.794  -14.128 -14.212 1.00 52.97  ? 357 ALA B CB    1 
ATOM   6853 N N     . GLN B 1 358 ? 15.639  -12.903 -16.262 1.00 59.00  ? 358 GLN B N     1 
ATOM   6854 C CA    . GLN B 1 358 ? 15.128  -12.688 -17.603 1.00 60.10  ? 358 GLN B CA    1 
ATOM   6855 C C     . GLN B 1 358 ? 15.198  -11.219 -17.977 1.00 62.21  ? 358 GLN B C     1 
ATOM   6856 O O     . GLN B 1 358 ? 15.545  -10.873 -19.115 1.00 59.25  ? 358 GLN B O     1 
ATOM   6857 C CB    . GLN B 1 358 ? 13.695  -13.199 -17.695 1.00 61.37  ? 358 GLN B CB    1 
ATOM   6858 C CG    . GLN B 1 358 ? 13.600  -14.707 -17.624 1.00 60.40  ? 358 GLN B CG    1 
ATOM   6859 C CD    . GLN B 1 358 ? 12.176  -15.213 -17.739 1.00 61.11  ? 358 GLN B CD    1 
ATOM   6860 O OE1   . GLN B 1 358 ? 11.308  -14.889 -16.914 1.00 58.73  ? 358 GLN B OE1   1 
ATOM   6861 N NE2   . GLN B 1 358 ? 11.925  -16.015 -18.766 1.00 56.70  ? 358 GLN B NE2   1 
ATOM   6862 N N     . PHE B 1 359 ? 14.874  -10.339 -17.027 1.00 62.80  ? 359 PHE B N     1 
ATOM   6863 C CA    . PHE B 1 359 ? 14.954  -8.908  -17.287 1.00 59.71  ? 359 PHE B CA    1 
ATOM   6864 C C     . PHE B 1 359 ? 16.393  -8.478  -17.557 1.00 59.41  ? 359 PHE B C     1 
ATOM   6865 O O     . PHE B 1 359 ? 16.646  -7.680  -18.465 1.00 61.34  ? 359 PHE B O     1 
ATOM   6866 C CB    . PHE B 1 359 ? 14.347  -8.132  -16.118 1.00 58.19  ? 359 PHE B CB    1 
ATOM   6867 C CG    . PHE B 1 359 ? 14.607  -6.663  -16.169 1.00 58.37  ? 359 PHE B CG    1 
ATOM   6868 C CD1   . PHE B 1 359 ? 15.365  -6.051  -15.196 1.00 62.71  ? 359 PHE B CD1   1 
ATOM   6869 C CD2   . PHE B 1 359 ? 14.103  -5.892  -17.193 1.00 60.48  ? 359 PHE B CD2   1 
ATOM   6870 C CE1   . PHE B 1 359 ? 15.612  -4.691  -15.245 1.00 61.74  ? 359 PHE B CE1   1 
ATOM   6871 C CE2   . PHE B 1 359 ? 14.352  -4.536  -17.246 1.00 61.48  ? 359 PHE B CE2   1 
ATOM   6872 C CZ    . PHE B 1 359 ? 15.105  -3.935  -16.269 1.00 57.10  ? 359 PHE B CZ    1 
ATOM   6873 N N     . LEU B 1 360 ? 17.360  -9.011  -16.805 1.00 62.11  ? 360 LEU B N     1 
ATOM   6874 C CA    . LEU B 1 360 ? 18.748  -8.627  -17.069 1.00 61.34  ? 360 LEU B CA    1 
ATOM   6875 C C     . LEU B 1 360 ? 19.210  -9.158  -18.415 1.00 59.75  ? 360 LEU B C     1 
ATOM   6876 O O     . LEU B 1 360 ? 19.904  -8.460  -19.164 1.00 61.39  ? 360 LEU B O     1 
ATOM   6877 C CB    . LEU B 1 360 ? 19.676  -9.114  -15.952 1.00 57.69  ? 360 LEU B CB    1 
ATOM   6878 C CG    . LEU B 1 360 ? 19.480  -8.388  -14.607 1.00 67.17  ? 360 LEU B CG    1 
ATOM   6879 C CD1   . LEU B 1 360 ? 18.413  -9.010  -13.777 1.00 60.81  ? 360 LEU B CD1   1 
ATOM   6880 C CD2   . LEU B 1 360 ? 20.748  -8.288  -13.770 1.00 67.20  ? 360 LEU B CD2   1 
ATOM   6881 N N     . ALA B 1 361 ? 18.830  -10.391 -18.742 1.00 56.58  ? 361 ALA B N     1 
ATOM   6882 C CA    . ALA B 1 361 ? 19.198  -10.949 -20.032 1.00 55.24  ? 361 ALA B CA    1 
ATOM   6883 C C     . ALA B 1 361 ? 18.539  -10.172 -21.164 1.00 59.38  ? 361 ALA B C     1 
ATOM   6884 O O     . ALA B 1 361 ? 19.185  -9.866  -22.175 1.00 56.41  ? 361 ALA B O     1 
ATOM   6885 C CB    . ALA B 1 361 ? 18.816  -12.425 -20.088 1.00 49.33  ? 361 ALA B CB    1 
ATOM   6886 N N     . GLY B 1 362 ? 17.258  -9.830  -21.001 1.00 59.13  ? 362 GLY B N     1 
ATOM   6887 C CA    . GLY B 1 362 ? 16.572  -9.040  -22.012 1.00 56.13  ? 362 GLY B CA    1 
ATOM   6888 C C     . GLY B 1 362 ? 17.245  -7.707  -22.278 1.00 57.16  ? 362 GLY B C     1 
ATOM   6889 O O     . GLY B 1 362 ? 17.315  -7.255  -23.423 1.00 56.93  ? 362 GLY B O     1 
ATOM   6890 N N     . VAL B 1 363 ? 17.768  -7.071  -21.229 1.00 55.18  ? 363 VAL B N     1 
ATOM   6891 C CA    . VAL B 1 363 ? 18.402  -5.768  -21.405 1.00 57.66  ? 363 VAL B CA    1 
ATOM   6892 C C     . VAL B 1 363 ? 19.609  -5.856  -22.343 1.00 55.26  ? 363 VAL B C     1 
ATOM   6893 O O     . VAL B 1 363 ? 19.910  -4.897  -23.061 1.00 57.47  ? 363 VAL B O     1 
ATOM   6894 C CB    . VAL B 1 363 ? 18.743  -5.163  -20.019 1.00 50.77  ? 363 VAL B CB    1 
ATOM   6895 C CG1   . VAL B 1 363 ? 19.775  -4.038  -20.107 1.00 43.72  ? 363 VAL B CG1   1 
ATOM   6896 C CG2   . VAL B 1 363 ? 17.475  -4.631  -19.376 1.00 49.06  ? 363 VAL B CG2   1 
ATOM   6897 N N     . ARG B 1 364 ? 20.293  -7.001  -22.400 1.00 57.28  ? 364 ARG B N     1 
ATOM   6898 C CA    . ARG B 1 364 ? 21.407  -7.112  -23.343 1.00 54.19  ? 364 ARG B CA    1 
ATOM   6899 C C     . ARG B 1 364 ? 20.907  -7.266  -24.770 1.00 59.26  ? 364 ARG B C     1 
ATOM   6900 O O     . ARG B 1 364 ? 21.624  -6.943  -25.726 1.00 60.83  ? 364 ARG B O     1 
ATOM   6901 C CB    . ARG B 1 364 ? 22.308  -8.295  -22.991 1.00 57.77  ? 364 ARG B CB    1 
ATOM   6902 C CG    . ARG B 1 364 ? 22.614  -8.454  -21.509 1.00 61.52  ? 364 ARG B CG    1 
ATOM   6903 C CD    . ARG B 1 364 ? 23.203  -7.190  -20.945 1.00 61.33  ? 364 ARG B CD    1 
ATOM   6904 N NE    . ARG B 1 364 ? 24.423  -6.780  -21.639 1.00 61.22  ? 364 ARG B NE    1 
ATOM   6905 C CZ    . ARG B 1 364 ? 25.653  -6.909  -21.142 1.00 66.46  ? 364 ARG B CZ    1 
ATOM   6906 N NH1   . ARG B 1 364 ? 25.845  -7.447  -19.935 1.00 66.90  ? 364 ARG B NH1   1 
ATOM   6907 N NH2   . ARG B 1 364 ? 26.698  -6.492  -21.852 1.00 62.53  ? 364 ARG B NH2   1 
ATOM   6908 N N     . ILE B 1 365 ? 19.695  -7.783  -24.938 1.00 58.60  ? 365 ILE B N     1 
ATOM   6909 C CA    . ILE B 1 365 ? 19.133  -7.899  -26.272 1.00 59.03  ? 365 ILE B CA    1 
ATOM   6910 C C     . ILE B 1 365 ? 18.457  -6.600  -26.704 1.00 57.35  ? 365 ILE B C     1 
ATOM   6911 O O     . ILE B 1 365 ? 18.506  -6.244  -27.882 1.00 59.34  ? 365 ILE B O     1 
ATOM   6912 C CB    . ILE B 1 365 ? 18.162  -9.093  -26.335 1.00 60.27  ? 365 ILE B CB    1 
ATOM   6913 C CG1   . ILE B 1 365 ? 18.868  -10.384 -25.917 1.00 54.39  ? 365 ILE B CG1   1 
ATOM   6914 C CG2   . ILE B 1 365 ? 17.597  -9.264  -27.741 1.00 59.53  ? 365 ILE B CG2   1 
ATOM   6915 C CD1   . ILE B 1 365 ? 17.920  -11.528 -25.749 1.00 52.26  ? 365 ILE B CD1   1 
ATOM   6916 N N     . GLY B 1 366 ? 17.849  -5.869  -25.768 1.00 53.09  ? 366 GLY B N     1 
ATOM   6917 C CA    . GLY B 1 366 ? 17.225  -4.600  -26.113 1.00 52.35  ? 366 GLY B CA    1 
ATOM   6918 C C     . GLY B 1 366 ? 18.241  -3.500  -26.333 1.00 54.19  ? 366 GLY B C     1 
ATOM   6919 O O     . GLY B 1 366 ? 18.062  -2.634  -27.199 1.00 62.31  ? 366 GLY B O     1 
ATOM   6920 N N     . VAL B 1 367 ? 19.327  -3.528  -25.580 1.00 51.04  ? 367 VAL B N     1 
ATOM   6921 C CA    . VAL B 1 367 ? 20.408  -2.568  -25.761 1.00 55.42  ? 367 VAL B CA    1 
ATOM   6922 C C     . VAL B 1 367 ? 21.626  -3.372  -26.188 1.00 56.05  ? 367 VAL B C     1 
ATOM   6923 O O     . VAL B 1 367 ? 22.596  -3.488  -25.426 1.00 54.92  ? 367 VAL B O     1 
ATOM   6924 C CB    . VAL B 1 367 ? 20.677  -1.758  -24.483 1.00 50.49  ? 367 VAL B CB    1 
ATOM   6925 C CG1   . VAL B 1 367 ? 21.509  -0.522  -24.794 1.00 46.31  ? 367 VAL B CG1   1 
ATOM   6926 C CG2   . VAL B 1 367 ? 19.369  -1.369  -23.826 1.00 47.46  ? 367 VAL B CG2   1 
ATOM   6927 N N     . PRO B 1 368 ? 21.617  -3.938  -27.394 1.00 54.84  ? 368 PRO B N     1 
ATOM   6928 C CA    . PRO B 1 368 ? 22.677  -4.880  -27.770 1.00 53.76  ? 368 PRO B CA    1 
ATOM   6929 C C     . PRO B 1 368 ? 24.062  -4.262  -27.813 1.00 55.50  ? 368 PRO B C     1 
ATOM   6930 O O     . PRO B 1 368 ? 25.056  -4.994  -27.770 1.00 57.35  ? 368 PRO B O     1 
ATOM   6931 C CB    . PRO B 1 368 ? 22.225  -5.354  -29.152 1.00 57.58  ? 368 PRO B CB    1 
ATOM   6932 C CG    . PRO B 1 368 ? 21.434  -4.206  -29.679 1.00 56.58  ? 368 PRO B CG    1 
ATOM   6933 C CD    . PRO B 1 368 ? 20.680  -3.704  -28.502 1.00 52.87  ? 368 PRO B CD    1 
ATOM   6934 N N     . GLN B 1 369 ? 24.167  -2.944  -27.883 1.00 53.38  ? 369 GLN B N     1 
ATOM   6935 C CA    . GLN B 1 369 ? 25.457  -2.277  -27.906 1.00 57.76  ? 369 GLN B CA    1 
ATOM   6936 C C     . GLN B 1 369 ? 25.940  -1.879  -26.510 1.00 60.86  ? 369 GLN B C     1 
ATOM   6937 O O     . GLN B 1 369 ? 26.960  -1.190  -26.390 1.00 59.02  ? 369 GLN B O     1 
ATOM   6938 C CB    . GLN B 1 369 ? 25.384  -1.038  -28.806 1.00 53.15  ? 369 GLN B CB    1 
ATOM   6939 C CG    . GLN B 1 369 ? 24.646  0.181   -28.194 1.00 56.37  ? 369 GLN B CG    1 
ATOM   6940 C CD    . GLN B 1 369 ? 23.115  0.039   -28.140 1.00 58.86  ? 369 GLN B CD    1 
ATOM   6941 O OE1   . GLN B 1 369 ? 22.575  -1.063  -27.960 1.00 59.00  ? 369 GLN B OE1   1 
ATOM   6942 N NE2   . GLN B 1 369 ? 22.412  1.168   -28.278 1.00 50.12  ? 369 GLN B NE2   1 
ATOM   6943 N N     . ALA B 1 370 ? 25.231  -2.283  -25.460 1.00 58.81  ? 370 ALA B N     1 
ATOM   6944 C CA    . ALA B 1 370 ? 25.587  -1.867  -24.109 1.00 59.24  ? 370 ALA B CA    1 
ATOM   6945 C C     . ALA B 1 370 ? 26.731  -2.703  -23.555 1.00 59.26  ? 370 ALA B C     1 
ATOM   6946 O O     . ALA B 1 370 ? 26.760  -3.928  -23.721 1.00 57.84  ? 370 ALA B O     1 
ATOM   6947 C CB    . ALA B 1 370 ? 24.384  -1.983  -23.171 1.00 57.39  ? 370 ALA B CB    1 
ATOM   6948 N N     . SER B 1 371 ? 27.665  -2.032  -22.877 1.00 61.39  ? 371 SER B N     1 
ATOM   6949 C CA    . SER B 1 371 ? 28.656  -2.725  -22.060 1.00 61.71  ? 371 SER B CA    1 
ATOM   6950 C C     . SER B 1 371 ? 27.997  -3.308  -20.812 1.00 60.94  ? 371 SER B C     1 
ATOM   6951 O O     . SER B 1 371 ? 26.814  -3.081  -20.527 1.00 58.63  ? 371 SER B O     1 
ATOM   6952 C CB    . SER B 1 371 ? 29.802  -1.788  -21.661 1.00 60.58  ? 371 SER B CB    1 
ATOM   6953 O OG    . SER B 1 371 ? 29.341  -0.608  -21.022 1.00 60.92  ? 371 SER B OG    1 
ATOM   6954 N N     . ASP B 1 372 ? 28.777  -4.092  -20.068 1.00 66.25  ? 372 ASP B N     1 
ATOM   6955 C CA    . ASP B 1 372 ? 28.282  -4.594  -18.793 1.00 63.63  ? 372 ASP B CA    1 
ATOM   6956 C C     . ASP B 1 372 ? 27.886  -3.443  -17.883 1.00 62.51  ? 372 ASP B C     1 
ATOM   6957 O O     . ASP B 1 372 ? 26.849  -3.502  -17.208 1.00 60.22  ? 372 ASP B O     1 
ATOM   6958 C CB    . ASP B 1 372 ? 29.340  -5.462  -18.122 1.00 71.14  ? 372 ASP B CB    1 
ATOM   6959 C CG    . ASP B 1 372 ? 29.647  -6.712  -18.910 1.00 77.62  ? 372 ASP B CG    1 
ATOM   6960 O OD1   . ASP B 1 372 ? 28.687  -7.351  -19.405 1.00 78.60  ? 372 ASP B OD1   1 
ATOM   6961 O OD2   . ASP B 1 372 ? 30.849  -7.046  -19.037 1.00 80.36  ? 372 ASP B OD2   1 
ATOM   6962 N N     . LEU B 1 373 ? 28.683  -2.368  -17.885 1.00 57.04  ? 373 LEU B N     1 
ATOM   6963 C CA    . LEU B 1 373 ? 28.417  -1.248  -16.989 1.00 61.65  ? 373 LEU B CA    1 
ATOM   6964 C C     . LEU B 1 373 ? 27.184  -0.473  -17.419 1.00 59.42  ? 373 LEU B C     1 
ATOM   6965 O O     . LEU B 1 373 ? 26.382  -0.047  -16.574 1.00 54.57  ? 373 LEU B O     1 
ATOM   6966 C CB    . LEU B 1 373 ? 29.625  -0.319  -16.931 1.00 61.21  ? 373 LEU B CB    1 
ATOM   6967 C CG    . LEU B 1 373 ? 29.450  0.858   -15.976 1.00 58.76  ? 373 LEU B CG    1 
ATOM   6968 C CD1   . LEU B 1 373 ? 28.921  0.373   -14.645 1.00 54.54  ? 373 LEU B CD1   1 
ATOM   6969 C CD2   . LEU B 1 373 ? 30.780  1.538   -15.781 1.00 62.14  ? 373 LEU B CD2   1 
ATOM   6970 N N     . ALA B 1 374 ? 27.026  -0.265  -18.728 1.00 59.62  ? 374 ALA B N     1 
ATOM   6971 C CA    . ALA B 1 374 ? 25.850  0.436   -19.222 1.00 55.28  ? 374 ALA B CA    1 
ATOM   6972 C C     . ALA B 1 374 ? 24.592  -0.410  -19.049 1.00 51.53  ? 374 ALA B C     1 
ATOM   6973 O O     . ALA B 1 374 ? 23.534  0.112   -18.684 1.00 46.41  ? 374 ALA B O     1 
ATOM   6974 C CB    . ALA B 1 374 ? 26.065  0.839   -20.676 1.00 52.44  ? 374 ALA B CB    1 
ATOM   6975 N N     . ALA B 1 375 ? 24.690  -1.718  -19.284 1.00 53.02  ? 375 ALA B N     1 
ATOM   6976 C CA    . ALA B 1 375 ? 23.540  -2.582  -19.048 1.00 51.79  ? 375 ALA B CA    1 
ATOM   6977 C C     . ALA B 1 375 ? 23.134  -2.561  -17.582 1.00 55.95  ? 375 ALA B C     1 
ATOM   6978 O O     . ALA B 1 375 ? 21.939  -2.577  -17.261 1.00 56.01  ? 375 ALA B O     1 
ATOM   6979 C CB    . ALA B 1 375 ? 23.843  -4.007  -19.498 1.00 50.94  ? 375 ALA B CB    1 
ATOM   6980 N N     . GLU B 1 376 ? 24.110  -2.524  -16.670 1.00 57.64  ? 376 GLU B N     1 
ATOM   6981 C CA    . GLU B 1 376 ? 23.755  -2.430  -15.255 1.00 60.52  ? 376 GLU B CA    1 
ATOM   6982 C C     . GLU B 1 376 ? 23.132  -1.078  -14.939 1.00 52.42  ? 376 GLU B C     1 
ATOM   6983 O O     . GLU B 1 376 ? 22.154  -0.999  -14.185 1.00 52.31  ? 376 GLU B O     1 
ATOM   6984 C CB    . GLU B 1 376 ? 24.977  -2.703  -14.378 1.00 63.64  ? 376 GLU B CB    1 
ATOM   6985 C CG    . GLU B 1 376 ? 25.490  -4.123  -14.592 1.00 77.33  ? 376 GLU B CG    1 
ATOM   6986 C CD    . GLU B 1 376 ? 26.551  -4.545  -13.601 1.00 85.69  ? 376 GLU B CD    1 
ATOM   6987 O OE1   . GLU B 1 376 ? 26.469  -4.102  -12.431 1.00 83.49  ? 376 GLU B OE1   1 
ATOM   6988 O OE2   . GLU B 1 376 ? 27.456  -5.323  -13.994 1.00 83.37  ? 376 GLU B OE2   1 
ATOM   6989 N N     . ALA B 1 377 ? 23.659  -0.012  -15.541 1.00 48.20  ? 377 ALA B N     1 
ATOM   6990 C CA    . ALA B 1 377 ? 23.006  1.287   -15.463 1.00 45.10  ? 377 ALA B CA    1 
ATOM   6991 C C     . ALA B 1 377 ? 21.551  1.224   -15.916 1.00 49.32  ? 377 ALA B C     1 
ATOM   6992 O O     . ALA B 1 377 ? 20.689  1.865   -15.313 1.00 55.07  ? 377 ALA B O     1 
ATOM   6993 C CB    . ALA B 1 377 ? 23.782  2.304   -16.292 1.00 46.50  ? 377 ALA B CB    1 
ATOM   6994 N N     . VAL B 1 378 ? 21.250  0.460   -16.973 1.00 52.18  ? 378 VAL B N     1 
ATOM   6995 C CA    . VAL B 1 378 ? 19.871  0.365   -17.451 1.00 46.39  ? 378 VAL B CA    1 
ATOM   6996 C C     . VAL B 1 378 ? 19.016  -0.393  -16.453 1.00 47.80  ? 378 VAL B C     1 
ATOM   6997 O O     . VAL B 1 378 ? 17.931  0.057   -16.071 1.00 49.61  ? 378 VAL B O     1 
ATOM   6998 C CB    . VAL B 1 378 ? 19.813  -0.298  -18.841 1.00 48.23  ? 378 VAL B CB    1 
ATOM   6999 C CG1   . VAL B 1 378 ? 18.373  -0.401  -19.326 1.00 39.82  ? 378 VAL B CG1   1 
ATOM   7000 C CG2   . VAL B 1 378 ? 20.624  0.487   -19.830 1.00 50.56  ? 378 VAL B CG2   1 
ATOM   7001 N N     . VAL B 1 379 ? 19.486  -1.565  -16.027 1.00 52.39  ? 379 VAL B N     1 
ATOM   7002 C CA    . VAL B 1 379 ? 18.744  -2.368  -15.053 1.00 57.71  ? 379 VAL B CA    1 
ATOM   7003 C C     . VAL B 1 379 ? 18.496  -1.585  -13.769 1.00 52.49  ? 379 VAL B C     1 
ATOM   7004 O O     . VAL B 1 379 ? 17.388  -1.609  -13.213 1.00 49.90  ? 379 VAL B O     1 
ATOM   7005 C CB    . VAL B 1 379 ? 19.496  -3.679  -14.771 1.00 58.44  ? 379 VAL B CB    1 
ATOM   7006 C CG1   . VAL B 1 379 ? 18.816  -4.445  -13.645 1.00 53.19  ? 379 VAL B CG1   1 
ATOM   7007 C CG2   . VAL B 1 379 ? 19.628  -4.514  -16.064 1.00 55.89  ? 379 VAL B CG2   1 
ATOM   7008 N N     . LEU B 1 380 ? 19.507  -0.858  -13.289 1.00 49.86  ? 380 LEU B N     1 
ATOM   7009 C CA    . LEU B 1 380 ? 19.342  -0.151  -12.027 1.00 57.71  ? 380 LEU B CA    1 
ATOM   7010 C C     . LEU B 1 380 ? 18.361  1.007   -12.160 1.00 56.21  ? 380 LEU B C     1 
ATOM   7011 O O     . LEU B 1 380 ? 17.588  1.287   -11.232 1.00 55.28  ? 380 LEU B O     1 
ATOM   7012 C CB    . LEU B 1 380 ? 20.710  0.317   -11.507 1.00 61.47  ? 380 LEU B CB    1 
ATOM   7013 C CG    . LEU B 1 380 ? 21.664  -0.841  -11.117 1.00 59.47  ? 380 LEU B CG    1 
ATOM   7014 C CD1   . LEU B 1 380 ? 22.964  -0.350  -10.518 1.00 56.93  ? 380 LEU B CD1   1 
ATOM   7015 C CD2   . LEU B 1 380 ? 21.019  -1.863  -10.176 1.00 52.05  ? 380 LEU B CD2   1 
ATOM   7016 N N     . HIS B 1 381 ? 18.342  1.649   -13.319 1.00 54.86  ? 381 HIS B N     1 
ATOM   7017 C CA    . HIS B 1 381 ? 17.485  2.806   -13.515 1.00 54.43  ? 381 HIS B CA    1 
ATOM   7018 C C     . HIS B 1 381 ? 16.028  2.417   -13.763 1.00 51.73  ? 381 HIS B C     1 
ATOM   7019 O O     . HIS B 1 381 ? 15.118  3.155   -13.368 1.00 51.71  ? 381 HIS B O     1 
ATOM   7020 C CB    . HIS B 1 381 ? 18.047  3.628   -14.662 1.00 51.68  ? 381 HIS B CB    1 
ATOM   7021 C CG    . HIS B 1 381 ? 17.397  4.953   -14.820 1.00 58.87  ? 381 HIS B CG    1 
ATOM   7022 N ND1   . HIS B 1 381 ? 16.250  5.129   -15.567 1.00 56.25  ? 381 HIS B ND1   1 
ATOM   7023 C CD2   . HIS B 1 381 ? 17.728  6.171   -14.330 1.00 63.20  ? 381 HIS B CD2   1 
ATOM   7024 C CE1   . HIS B 1 381 ? 15.898  6.401   -15.527 1.00 61.22  ? 381 HIS B CE1   1 
ATOM   7025 N NE2   . HIS B 1 381 ? 16.777  7.055   -14.785 1.00 68.98  ? 381 HIS B NE2   1 
ATOM   7026 N N     . TYR B 1 382 ? 15.784  1.253   -14.372 1.00 48.90  ? 382 TYR B N     1 
ATOM   7027 C CA    . TYR B 1 382 ? 14.424  0.808   -14.652 1.00 47.71  ? 382 TYR B CA    1 
ATOM   7028 C C     . TYR B 1 382 ? 13.831  -0.092  -13.574 1.00 53.23  ? 382 TYR B C     1 
ATOM   7029 O O     . TYR B 1 382 ? 12.601  -0.256  -13.542 1.00 50.18  ? 382 TYR B O     1 
ATOM   7030 C CB    . TYR B 1 382 ? 14.366  0.094   -16.012 1.00 46.88  ? 382 TYR B CB    1 
ATOM   7031 C CG    . TYR B 1 382 ? 14.249  1.075   -17.155 1.00 44.08  ? 382 TYR B CG    1 
ATOM   7032 C CD1   . TYR B 1 382 ? 15.384  1.623   -17.737 1.00 45.88  ? 382 TYR B CD1   1 
ATOM   7033 C CD2   . TYR B 1 382 ? 13.008  1.491   -17.621 1.00 43.41  ? 382 TYR B CD2   1 
ATOM   7034 C CE1   . TYR B 1 382 ? 15.296  2.542   -18.767 1.00 46.35  ? 382 TYR B CE1   1 
ATOM   7035 C CE2   . TYR B 1 382 ? 12.902  2.413   -18.663 1.00 43.97  ? 382 TYR B CE2   1 
ATOM   7036 C CZ    . TYR B 1 382 ? 14.056  2.936   -19.227 1.00 47.78  ? 382 TYR B CZ    1 
ATOM   7037 O OH    . TYR B 1 382 ? 13.991  3.855   -20.249 1.00 48.33  ? 382 TYR B OH    1 
ATOM   7038 N N     . THR B 1 383 ? 14.655  -0.667  -12.691 1.00 55.85  ? 383 THR B N     1 
ATOM   7039 C CA    . THR B 1 383 ? 14.127  -1.423  -11.560 1.00 50.19  ? 383 THR B CA    1 
ATOM   7040 C C     . THR B 1 383 ? 13.278  -0.531  -10.660 1.00 50.93  ? 383 THR B C     1 
ATOM   7041 O O     . THR B 1 383 ? 13.643  0.612   -10.367 1.00 52.18  ? 383 THR B O     1 
ATOM   7042 C CB    . THR B 1 383 ? 15.266  -2.031  -10.751 1.00 53.05  ? 383 THR B CB    1 
ATOM   7043 O OG1   . THR B 1 383 ? 16.083  -2.846  -11.596 1.00 54.26  ? 383 THR B OG1   1 
ATOM   7044 C CG2   . THR B 1 383 ? 14.716  -2.883  -9.637  1.00 58.74  ? 383 THR B CG2   1 
ATOM   7045 N N     . ASP B 1 384 ? 12.122  -1.045  -10.248 1.00 48.23  ? 384 ASP B N     1 
ATOM   7046 C CA    . ASP B 1 384 ? 11.349  -0.436  -9.169  1.00 61.11  ? 384 ASP B CA    1 
ATOM   7047 C C     . ASP B 1 384 ? 11.820  -1.065  -7.856  1.00 62.49  ? 384 ASP B C     1 
ATOM   7048 O O     . ASP B 1 384 ? 11.507  -2.224  -7.571  1.00 61.01  ? 384 ASP B O     1 
ATOM   7049 C CB    . ASP B 1 384 ? 9.848   -0.636  -9.385  1.00 64.34  ? 384 ASP B CB    1 
ATOM   7050 C CG    . ASP B 1 384 ? 8.996   0.134   -8.372  1.00 70.38  ? 384 ASP B CG    1 
ATOM   7051 O OD1   . ASP B 1 384 ? 9.397   0.215   -7.193  1.00 69.45  ? 384 ASP B OD1   1 
ATOM   7052 O OD2   . ASP B 1 384 ? 7.929   0.672   -8.753  1.00 70.99  ? 384 ASP B OD2   1 
ATOM   7053 N N     . TRP B 1 385 ? 12.573  -0.304  -7.053  1.00 62.57  ? 385 TRP B N     1 
ATOM   7054 C CA    . TRP B 1 385 ? 13.255  -0.886  -5.894  1.00 64.42  ? 385 TRP B CA    1 
ATOM   7055 C C     . TRP B 1 385 ? 12.339  -1.116  -4.710  1.00 63.87  ? 385 TRP B C     1 
ATOM   7056 O O     . TRP B 1 385 ? 12.758  -1.722  -3.719  1.00 65.60  ? 385 TRP B O     1 
ATOM   7057 C CB    . TRP B 1 385 ? 14.432  -0.014  -5.475  1.00 54.80  ? 385 TRP B CB    1 
ATOM   7058 C CG    . TRP B 1 385 ? 15.438  0.006   -6.540  1.00 54.56  ? 385 TRP B CG    1 
ATOM   7059 C CD1   . TRP B 1 385 ? 15.636  0.988   -7.463  1.00 55.05  ? 385 TRP B CD1   1 
ATOM   7060 C CD2   . TRP B 1 385 ? 16.358  -1.032  -6.853  1.00 51.23  ? 385 TRP B CD2   1 
ATOM   7061 N NE1   . TRP B 1 385 ? 16.646  0.635   -8.315  1.00 52.70  ? 385 TRP B NE1   1 
ATOM   7062 C CE2   . TRP B 1 385 ? 17.104  -0.607  -7.962  1.00 55.27  ? 385 TRP B CE2   1 
ATOM   7063 C CE3   . TRP B 1 385 ? 16.625  -2.282  -6.304  1.00 54.16  ? 385 TRP B CE3   1 
ATOM   7064 C CZ2   . TRP B 1 385 ? 18.103  -1.388  -8.530  1.00 58.95  ? 385 TRP B CZ2   1 
ATOM   7065 C CZ3   . TRP B 1 385 ? 17.619  -3.056  -6.869  1.00 55.70  ? 385 TRP B CZ3   1 
ATOM   7066 C CH2   . TRP B 1 385 ? 18.346  -2.608  -7.965  1.00 57.23  ? 385 TRP B CH2   1 
ATOM   7067 N N     . LEU B 1 386 ? 11.103  -0.670  -4.806  1.00 64.61  ? 386 LEU B N     1 
ATOM   7068 C CA    . LEU B 1 386 ? 10.108  -1.104  -3.853  1.00 69.84  ? 386 LEU B CA    1 
ATOM   7069 C C     . LEU B 1 386 ? 9.618   -2.517  -4.174  1.00 70.07  ? 386 LEU B C     1 
ATOM   7070 O O     . LEU B 1 386 ? 9.318   -3.286  -3.256  1.00 73.83  ? 386 LEU B O     1 
ATOM   7071 C CB    . LEU B 1 386 ? 8.973   -0.084  -3.835  1.00 72.23  ? 386 LEU B CB    1 
ATOM   7072 C CG    . LEU B 1 386 ? 7.725   -0.513  -3.081  1.00 84.76  ? 386 LEU B CG    1 
ATOM   7073 C CD1   . LEU B 1 386 ? 8.177   -0.725  -1.623  1.00 79.78  ? 386 LEU B CD1   1 
ATOM   7074 C CD2   . LEU B 1 386 ? 6.621   0.547   -3.165  1.00 85.85  ? 386 LEU B CD2   1 
ATOM   7075 N N     . HIS B 1 387 ? 9.556   -2.893  -5.456  1.00 74.83  ? 387 HIS B N     1 
ATOM   7076 C CA    . HIS B 1 387 ? 9.230   -4.267  -5.858  1.00 71.23  ? 387 HIS B CA    1 
ATOM   7077 C C     . HIS B 1 387 ? 10.215  -4.727  -6.931  1.00 68.71  ? 387 HIS B C     1 
ATOM   7078 O O     . HIS B 1 387 ? 9.832   -4.990  -8.073  1.00 68.54  ? 387 HIS B O     1 
ATOM   7079 C CB    . HIS B 1 387 ? 7.792   -4.387  -6.376  1.00 73.51  ? 387 HIS B CB    1 
ATOM   7080 C CG    . HIS B 1 387 ? 6.802   -3.468  -5.727  1.00 76.47  ? 387 HIS B CG    1 
ATOM   7081 N ND1   . HIS B 1 387 ? 6.344   -2.319  -6.338  1.00 79.08  ? 387 HIS B ND1   1 
ATOM   7082 C CD2   . HIS B 1 387 ? 6.142   -3.553  -4.548  1.00 80.30  ? 387 HIS B CD2   1 
ATOM   7083 C CE1   . HIS B 1 387 ? 5.478   -1.714  -5.544  1.00 79.03  ? 387 HIS B CE1   1 
ATOM   7084 N NE2   . HIS B 1 387 ? 5.333   -2.446  -4.452  1.00 79.42  ? 387 HIS B NE2   1 
ATOM   7085 N N     . PRO B 1 388 ? 11.501  -4.854  -6.587  1.00 67.49  ? 388 PRO B N     1 
ATOM   7086 C CA    . PRO B 1 388 ? 12.516  -5.153  -7.611  1.00 66.28  ? 388 PRO B CA    1 
ATOM   7087 C C     . PRO B 1 388 ? 12.377  -6.519  -8.253  1.00 66.80  ? 388 PRO B C     1 
ATOM   7088 O O     . PRO B 1 388 ? 13.151  -6.827  -9.173  1.00 62.85  ? 388 PRO B O     1 
ATOM   7089 C CB    . PRO B 1 388 ? 13.832  -5.057  -6.830  1.00 68.87  ? 388 PRO B CB    1 
ATOM   7090 C CG    . PRO B 1 388 ? 13.450  -5.368  -5.439  1.00 64.69  ? 388 PRO B CG    1 
ATOM   7091 C CD    . PRO B 1 388 ? 12.097  -4.748  -5.249  1.00 65.08  ? 388 PRO B CD    1 
ATOM   7092 N N     . GLU B 1 389 ? 11.425  -7.339  -7.791  1.00 71.26  ? 389 GLU B N     1 
ATOM   7093 C CA    . GLU B 1 389 ? 11.210  -8.682  -8.310  1.00 68.26  ? 389 GLU B CA    1 
ATOM   7094 C C     . GLU B 1 389 ? 9.795   -8.936  -8.800  1.00 64.85  ? 389 GLU B C     1 
ATOM   7095 O O     . GLU B 1 389 ? 9.571   -9.961  -9.453  1.00 70.24  ? 389 GLU B O     1 
ATOM   7096 C CB    . GLU B 1 389 ? 11.545  -9.738  -7.246  1.00 65.84  ? 389 GLU B CB    1 
ATOM   7097 C CG    . GLU B 1 389 ? 12.758  -9.407  -6.394  1.00 74.97  ? 389 GLU B CG    1 
ATOM   7098 C CD    . GLU B 1 389 ? 13.890  -10.399 -6.586  1.00 84.00  ? 389 GLU B CD    1 
ATOM   7099 O OE1   . GLU B 1 389 ? 14.798  -10.440 -5.723  1.00 89.26  ? 389 GLU B OE1   1 
ATOM   7100 O OE2   . GLU B 1 389 ? 13.869  -11.134 -7.600  1.00 83.37  ? 389 GLU B OE2   1 
ATOM   7101 N N     . ASP B 1 390 ? 8.836   -8.049  -8.511  1.00 56.99  ? 390 ASP B N     1 
ATOM   7102 C CA    . ASP B 1 390 ? 7.474   -8.222  -9.002  1.00 58.53  ? 390 ASP B CA    1 
ATOM   7103 C C     . ASP B 1 390 ? 7.463   -8.397  -10.520 1.00 64.90  ? 390 ASP B C     1 
ATOM   7104 O O     . ASP B 1 390 ? 7.843   -7.479  -11.262 1.00 61.79  ? 390 ASP B O     1 
ATOM   7105 C CB    . ASP B 1 390 ? 6.613   -7.035  -8.602  1.00 58.08  ? 390 ASP B CB    1 
ATOM   7106 C CG    . ASP B 1 390 ? 5.355   -6.937  -9.422  1.00 66.91  ? 390 ASP B CG    1 
ATOM   7107 O OD1   . ASP B 1 390 ? 4.647   -7.963  -9.569  1.00 65.91  ? 390 ASP B OD1   1 
ATOM   7108 O OD2   . ASP B 1 390 ? 5.083   -5.830  -9.938  1.00 70.02  ? 390 ASP B OD2   1 
ATOM   7109 N N     . PRO B 1 391 ? 7.034   -9.556  -11.019 1.00 64.03  ? 391 PRO B N     1 
ATOM   7110 C CA    . PRO B 1 391 ? 7.190   -9.831  -12.460 1.00 61.18  ? 391 PRO B CA    1 
ATOM   7111 C C     . PRO B 1 391 ? 6.367   -8.923  -13.360 1.00 59.43  ? 391 PRO B C     1 
ATOM   7112 O O     . PRO B 1 391 ? 6.765   -8.704  -14.506 1.00 61.52  ? 391 PRO B O     1 
ATOM   7113 C CB    . PRO B 1 391 ? 6.754   -11.296 -12.588 1.00 61.71  ? 391 PRO B CB    1 
ATOM   7114 C CG    . PRO B 1 391 ? 5.817   -11.495 -11.415 1.00 67.56  ? 391 PRO B CG    1 
ATOM   7115 C CD    . PRO B 1 391 ? 6.331   -10.635 -10.306 1.00 57.35  ? 391 PRO B CD    1 
ATOM   7116 N N     . THR B 1 392 ? 5.234   -8.387  -12.897 1.00 59.42  ? 392 THR B N     1 
ATOM   7117 C CA    . THR B 1 392 ? 4.505   -7.423  -13.717 1.00 57.15  ? 392 THR B CA    1 
ATOM   7118 C C     . THR B 1 392 ? 5.338   -6.167  -13.953 1.00 60.10  ? 392 THR B C     1 
ATOM   7119 O O     . THR B 1 392 ? 5.345   -5.611  -15.058 1.00 57.19  ? 392 THR B O     1 
ATOM   7120 C CB    . THR B 1 392 ? 3.174   -7.058  -13.060 1.00 56.95  ? 392 THR B CB    1 
ATOM   7121 O OG1   . THR B 1 392 ? 2.330   -8.208  -13.004 1.00 61.70  ? 392 THR B OG1   1 
ATOM   7122 C CG2   . THR B 1 392 ? 2.465   -5.992  -13.856 1.00 54.80  ? 392 THR B CG2   1 
ATOM   7123 N N     . HIS B 1 393 ? 6.037   -5.697  -12.918 1.00 61.66  ? 393 HIS B N     1 
ATOM   7124 C CA    . HIS B 1 393 ? 6.893   -4.527  -13.075 1.00 59.92  ? 393 HIS B CA    1 
ATOM   7125 C C     . HIS B 1 393 ? 7.995   -4.802  -14.083 1.00 54.56  ? 393 HIS B C     1 
ATOM   7126 O O     . HIS B 1 393 ? 8.202   -4.021  -15.016 1.00 56.83  ? 393 HIS B O     1 
ATOM   7127 C CB    . HIS B 1 393 ? 7.499   -4.116  -11.728 1.00 63.56  ? 393 HIS B CB    1 
ATOM   7128 C CG    . HIS B 1 393 ? 6.610   -3.251  -10.890 1.00 68.56  ? 393 HIS B CG    1 
ATOM   7129 N ND1   . HIS B 1 393 ? 5.791   -2.280  -11.428 1.00 72.20  ? 393 HIS B ND1   1 
ATOM   7130 C CD2   . HIS B 1 393 ? 6.423   -3.201  -9.547  1.00 71.11  ? 393 HIS B CD2   1 
ATOM   7131 C CE1   . HIS B 1 393 ? 5.130   -1.677  -10.453 1.00 76.75  ? 393 HIS B CE1   1 
ATOM   7132 N NE2   . HIS B 1 393 ? 5.498   -2.214  -9.301  1.00 71.57  ? 393 HIS B NE2   1 
ATOM   7133 N N     . LEU B 1 394 ? 8.716   -5.910  -13.908 1.00 54.74  ? 394 LEU B N     1 
ATOM   7134 C CA    . LEU B 1 394 ? 9.856   -6.189  -14.776 1.00 59.28  ? 394 LEU B CA    1 
ATOM   7135 C C     . LEU B 1 394 ? 9.423   -6.393  -16.219 1.00 57.07  ? 394 LEU B C     1 
ATOM   7136 O O     . LEU B 1 394 ? 10.150  -6.007  -17.143 1.00 53.68  ? 394 LEU B O     1 
ATOM   7137 C CB    . LEU B 1 394 ? 10.624  -7.410  -14.274 1.00 55.43  ? 394 LEU B CB    1 
ATOM   7138 C CG    . LEU B 1 394 ? 11.067  -7.443  -12.823 1.00 61.29  ? 394 LEU B CG    1 
ATOM   7139 C CD1   . LEU B 1 394 ? 11.120  -8.886  -12.343 1.00 65.93  ? 394 LEU B CD1   1 
ATOM   7140 C CD2   . LEU B 1 394 ? 12.410  -6.730  -12.715 1.00 59.69  ? 394 LEU B CD2   1 
ATOM   7141 N N     . ARG B 1 395 ? 8.243   -6.985  -16.420 1.00 56.95  ? 395 ARG B N     1 
ATOM   7142 C CA    . ARG B 1 395 ? 7.695   -7.136  -17.762 1.00 54.98  ? 395 ARG B CA    1 
ATOM   7143 C C     . ARG B 1 395 ? 7.400   -5.771  -18.378 1.00 55.73  ? 395 ARG B C     1 
ATOM   7144 O O     . ARG B 1 395 ? 7.840   -5.471  -19.496 1.00 57.81  ? 395 ARG B O     1 
ATOM   7145 C CB    . ARG B 1 395 ? 6.442   -8.014  -17.704 1.00 55.08  ? 395 ARG B CB    1 
ATOM   7146 C CG    . ARG B 1 395 ? 5.739   -8.223  -19.018 1.00 53.77  ? 395 ARG B CG    1 
ATOM   7147 C CD    . ARG B 1 395 ? 4.465   -7.420  -19.041 1.00 53.37  ? 395 ARG B CD    1 
ATOM   7148 N NE    . ARG B 1 395 ? 3.332   -8.170  -18.522 1.00 52.81  ? 395 ARG B NE    1 
ATOM   7149 C CZ    . ARG B 1 395 ? 2.257   -7.615  -17.974 1.00 51.91  ? 395 ARG B CZ    1 
ATOM   7150 N NH1   . ARG B 1 395 ? 2.170   -6.303  -17.849 1.00 44.71  ? 395 ARG B NH1   1 
ATOM   7151 N NH2   . ARG B 1 395 ? 1.271   -8.382  -17.535 1.00 60.11  ? 395 ARG B NH2   1 
ATOM   7152 N N     . ASP B 1 396 ? 6.688   -4.911  -17.648 1.00 52.42  ? 396 ASP B N     1 
ATOM   7153 C CA    . ASP B 1 396 ? 6.475   -3.561  -18.151 1.00 47.44  ? 396 ASP B CA    1 
ATOM   7154 C C     . ASP B 1 396 ? 7.781   -2.788  -18.234 1.00 48.82  ? 396 ASP B C     1 
ATOM   7155 O O     . ASP B 1 396 ? 7.920   -1.907  -19.086 1.00 50.44  ? 396 ASP B O     1 
ATOM   7156 C CB    . ASP B 1 396 ? 5.471   -2.815  -17.285 1.00 47.33  ? 396 ASP B CB    1 
ATOM   7157 C CG    . ASP B 1 396 ? 4.126   -3.496  -17.247 1.00 54.16  ? 396 ASP B CG    1 
ATOM   7158 O OD1   . ASP B 1 396 ? 3.857   -4.303  -18.158 1.00 57.03  ? 396 ASP B OD1   1 
ATOM   7159 O OD2   . ASP B 1 396 ? 3.334   -3.234  -16.315 1.00 55.44  ? 396 ASP B OD2   1 
ATOM   7160 N N     . ALA B 1 397 ? 8.754   -3.102  -17.378 1.00 50.90  ? 397 ALA B N     1 
ATOM   7161 C CA    . ALA B 1 397 ? 10.049  -2.440  -17.488 1.00 47.55  ? 397 ALA B CA    1 
ATOM   7162 C C     . ALA B 1 397 ? 10.740  -2.815  -18.784 1.00 48.67  ? 397 ALA B C     1 
ATOM   7163 O O     . ALA B 1 397 ? 11.371  -1.967  -19.426 1.00 44.00  ? 397 ALA B O     1 
ATOM   7164 C CB    . ALA B 1 397 ? 10.945  -2.804  -16.313 1.00 48.07  ? 397 ALA B CB    1 
ATOM   7165 N N     . MET B 1 398 ? 10.658  -4.091  -19.162 1.00 49.25  ? 398 MET B N     1 
ATOM   7166 C CA    . MET B 1 398 ? 11.337  -4.554  -20.363 1.00 47.51  ? 398 MET B CA    1 
ATOM   7167 C C     . MET B 1 398 ? 10.765  -3.853  -21.587 1.00 47.38  ? 398 MET B C     1 
ATOM   7168 O O     . MET B 1 398 ? 11.507  -3.318  -22.417 1.00 44.60  ? 398 MET B O     1 
ATOM   7169 C CB    . MET B 1 398 ? 11.209  -6.075  -20.458 1.00 44.54  ? 398 MET B CB    1 
ATOM   7170 C CG    . MET B 1 398 ? 12.132  -6.746  -21.455 1.00 48.48  ? 398 MET B CG    1 
ATOM   7171 S SD    . MET B 1 398 ? 13.900  -6.620  -21.128 1.00 58.00  ? 398 MET B SD    1 
ATOM   7172 C CE    . MET B 1 398 ? 14.406  -5.549  -22.464 1.00 51.49  ? 398 MET B CE    1 
ATOM   7173 N N     . SER B 1 399 ? 9.435   -3.791  -21.671 1.00 45.90  ? 399 SER B N     1 
ATOM   7174 C CA    . SER B 1 399 ? 8.769   -3.044  -22.729 1.00 44.03  ? 399 SER B CA    1 
ATOM   7175 C C     . SER B 1 399 ? 9.243   -1.599  -22.777 1.00 45.01  ? 399 SER B C     1 
ATOM   7176 O O     . SER B 1 399 ? 9.439   -1.033  -23.860 1.00 46.17  ? 399 SER B O     1 
ATOM   7177 C CB    . SER B 1 399 ? 7.260   -3.117  -22.503 1.00 49.32  ? 399 SER B CB    1 
ATOM   7178 O OG    . SER B 1 399 ? 6.556   -2.140  -23.233 1.00 49.46  ? 399 SER B OG    1 
ATOM   7179 N N     . ALA B 1 400 ? 9.440   -0.987  -21.611 1.00 46.99  ? 400 ALA B N     1 
ATOM   7180 C CA    . ALA B 1 400 ? 9.787   0.427   -21.554 1.00 43.33  ? 400 ALA B CA    1 
ATOM   7181 C C     . ALA B 1 400 ? 11.246  0.691   -21.892 1.00 43.24  ? 400 ALA B C     1 
ATOM   7182 O O     . ALA B 1 400 ? 11.552  1.734   -22.467 1.00 46.29  ? 400 ALA B O     1 
ATOM   7183 C CB    . ALA B 1 400 ? 9.466   0.986   -20.175 1.00 40.53  ? 400 ALA B CB    1 
ATOM   7184 N N     . VAL B 1 401 ? 12.164  -0.199  -21.519 1.00 42.91  ? 401 VAL B N     1 
ATOM   7185 C CA    . VAL B 1 401 ? 13.547  -0.034  -21.952 1.00 42.18  ? 401 VAL B CA    1 
ATOM   7186 C C     . VAL B 1 401 ? 13.605  0.005   -23.465 1.00 45.68  ? 401 VAL B C     1 
ATOM   7187 O O     . VAL B 1 401 ? 14.259  0.866   -24.068 1.00 43.57  ? 401 VAL B O     1 
ATOM   7188 C CB    . VAL B 1 401 ? 14.434  -1.163  -21.404 1.00 46.53  ? 401 VAL B CB    1 
ATOM   7189 C CG1   . VAL B 1 401 ? 15.820  -1.064  -22.002 1.00 41.68  ? 401 VAL B CG1   1 
ATOM   7190 C CG2   . VAL B 1 401 ? 14.502  -1.110  -19.892 1.00 45.31  ? 401 VAL B CG2   1 
ATOM   7191 N N     . VAL B 1 402 ? 12.897  -0.924  -24.102 1.00 48.82  ? 402 VAL B N     1 
ATOM   7192 C CA    . VAL B 1 402 ? 12.919  -0.997  -25.556 1.00 47.41  ? 402 VAL B CA    1 
ATOM   7193 C C     . VAL B 1 402 ? 12.207  0.208   -26.159 1.00 47.24  ? 402 VAL B C     1 
ATOM   7194 O O     . VAL B 1 402 ? 12.720  0.830   -27.100 1.00 43.45  ? 402 VAL B O     1 
ATOM   7195 C CB    . VAL B 1 402 ? 12.317  -2.330  -26.033 1.00 44.76  ? 402 VAL B CB    1 
ATOM   7196 C CG1   . VAL B 1 402 ? 12.015  -2.268  -27.551 1.00 44.64  ? 402 VAL B CG1   1 
ATOM   7197 C CG2   . VAL B 1 402 ? 13.250  -3.488  -25.670 1.00 36.76  ? 402 VAL B CG2   1 
ATOM   7198 N N     . GLY B 1 403 ? 11.039  0.580   -25.615 1.00 42.38  ? 403 GLY B N     1 
ATOM   7199 C CA    . GLY B 1 403 ? 10.328  1.740   -26.140 1.00 42.41  ? 403 GLY B CA    1 
ATOM   7200 C C     . GLY B 1 403 ? 11.107  3.038   -25.981 1.00 45.13  ? 403 GLY B C     1 
ATOM   7201 O O     . GLY B 1 403 ? 11.175  3.858   -26.902 1.00 45.38  ? 403 GLY B O     1 
ATOM   7202 N N     . ASP B 1 404 ? 11.718  3.234   -24.810 1.00 43.76  ? 404 ASP B N     1 
ATOM   7203 C CA    . ASP B 1 404 ? 12.420  4.481   -24.518 1.00 42.18  ? 404 ASP B CA    1 
ATOM   7204 C C     . ASP B 1 404 ? 13.722  4.580   -25.298 1.00 42.38  ? 404 ASP B C     1 
ATOM   7205 O O     . ASP B 1 404 ? 14.048  5.631   -25.858 1.00 44.30  ? 404 ASP B O     1 
ATOM   7206 C CB    . ASP B 1 404 ? 12.703  4.588   -23.018 1.00 42.42  ? 404 ASP B CB    1 
ATOM   7207 C CG    . ASP B 1 404 ? 11.447  4.798   -22.201 1.00 46.03  ? 404 ASP B CG    1 
ATOM   7208 O OD1   . ASP B 1 404 ? 10.406  5.089   -22.824 1.00 50.49  ? 404 ASP B OD1   1 
ATOM   7209 O OD2   . ASP B 1 404 ? 11.500  4.706   -20.945 1.00 48.04  ? 404 ASP B OD2   1 
ATOM   7210 N N     . HIS B 1 405 ? 14.501  3.506   -25.309 1.00 40.33  ? 405 HIS B N     1 
ATOM   7211 C CA    . HIS B 1 405 ? 15.759  3.524   -26.042 1.00 42.91  ? 405 HIS B CA    1 
ATOM   7212 C C     . HIS B 1 405 ? 15.536  3.776   -27.543 1.00 45.33  ? 405 HIS B C     1 
ATOM   7213 O O     . HIS B 1 405 ? 16.261  4.565   -28.161 1.00 41.80  ? 405 HIS B O     1 
ATOM   7214 C CB    . HIS B 1 405 ? 16.492  2.205   -25.795 1.00 40.70  ? 405 HIS B CB    1 
ATOM   7215 C CG    . HIS B 1 405 ? 17.753  2.044   -26.584 1.00 44.18  ? 405 HIS B CG    1 
ATOM   7216 N ND1   . HIS B 1 405 ? 18.690  3.049   -26.709 1.00 43.46  ? 405 HIS B ND1   1 
ATOM   7217 C CD2   . HIS B 1 405 ? 18.240  0.985   -27.276 1.00 46.53  ? 405 HIS B CD2   1 
ATOM   7218 C CE1   . HIS B 1 405 ? 19.695  2.617   -27.454 1.00 46.45  ? 405 HIS B CE1   1 
ATOM   7219 N NE2   . HIS B 1 405 ? 19.447  1.369   -27.812 1.00 46.59  ? 405 HIS B NE2   1 
ATOM   7220 N N     . ASN B 1 406 ? 14.524  3.147   -28.141 1.00 42.04  ? 406 ASN B N     1 
ATOM   7221 C CA    . ASN B 1 406 ? 14.433  3.127   -29.600 1.00 46.60  ? 406 ASN B CA    1 
ATOM   7222 C C     . ASN B 1 406 ? 13.474  4.155   -30.185 1.00 45.53  ? 406 ASN B C     1 
ATOM   7223 O O     . ASN B 1 406 ? 13.681  4.585   -31.325 1.00 44.76  ? 406 ASN B O     1 
ATOM   7224 C CB    . ASN B 1 406 ? 14.041  1.725   -30.102 1.00 44.45  ? 406 ASN B CB    1 
ATOM   7225 C CG    . ASN B 1 406 ? 15.181  0.720   -29.971 1.00 45.65  ? 406 ASN B CG    1 
ATOM   7226 O OD1   . ASN B 1 406 ? 16.228  0.882   -30.607 1.00 46.41  ? 406 ASN B OD1   1 
ATOM   7227 N ND2   . ASN B 1 406 ? 14.985  -0.326  -29.146 1.00 42.89  ? 406 ASN B ND2   1 
ATOM   7228 N N     . VAL B 1 407 ? 12.447  4.587   -29.455 1.00 43.71  ? 407 VAL B N     1 
ATOM   7229 C CA    . VAL B 1 407 ? 11.535  5.572   -30.028 1.00 42.47  ? 407 VAL B CA    1 
ATOM   7230 C C     . VAL B 1 407 ? 11.392  6.795   -29.125 1.00 42.67  ? 407 VAL B C     1 
ATOM   7231 O O     . VAL B 1 407 ? 11.752  7.911   -29.525 1.00 39.89  ? 407 VAL B O     1 
ATOM   7232 C CB    . VAL B 1 407 ? 10.168  4.937   -30.335 1.00 42.79  ? 407 VAL B CB    1 
ATOM   7233 C CG1   . VAL B 1 407 ? 9.225   5.958   -30.929 1.00 40.85  ? 407 VAL B CG1   1 
ATOM   7234 C CG2   . VAL B 1 407 ? 10.343  3.804   -31.296 1.00 43.07  ? 407 VAL B CG2   1 
ATOM   7235 N N     . VAL B 1 408 ? 10.896  6.600   -27.896 1.00 43.82  ? 408 VAL B N     1 
ATOM   7236 C CA    . VAL B 1 408 ? 10.507  7.741   -27.059 1.00 41.52  ? 408 VAL B CA    1 
ATOM   7237 C C     . VAL B 1 408 ? 11.661  8.720   -26.884 1.00 40.24  ? 408 VAL B C     1 
ATOM   7238 O O     . VAL B 1 408 ? 11.516  9.926   -27.110 1.00 41.07  ? 408 VAL B O     1 
ATOM   7239 C CB    . VAL B 1 408 ? 9.987   7.276   -25.694 1.00 40.80  ? 408 VAL B CB    1 
ATOM   7240 C CG1   . VAL B 1 408 ? 9.395   8.458   -24.999 1.00 40.55  ? 408 VAL B CG1   1 
ATOM   7241 C CG2   . VAL B 1 408 ? 8.957   6.179   -25.838 1.00 43.41  ? 408 VAL B CG2   1 
ATOM   7242 N N     . CYS B 1 409 ? 12.808  8.234   -26.478 1.00 38.07  ? 409 CYS B N     1 
ATOM   7243 C CA    . CYS B 1 409 ? 13.838  9.219   -26.192 1.00 39.04  ? 409 CYS B CA    1 
ATOM   7244 C C     . CYS B 1 409 ? 14.452  9.791   -27.463 1.00 42.82  ? 409 CYS B C     1 
ATOM   7245 O O     . CYS B 1 409 ? 14.787  10.984  -27.492 1.00 42.06  ? 409 CYS B O     1 
ATOM   7246 C CB    . CYS B 1 409 ? 14.879  8.619   -25.251 1.00 40.91  ? 409 CYS B CB    1 
ATOM   7247 S SG    . CYS B 1 409 ? 14.122  8.358   -23.571 1.00 50.20  ? 409 CYS B SG    1 
ATOM   7248 N N     . PRO B 1 410 ? 14.596  9.000   -28.538 1.00 44.72  ? 410 PRO B N     1 
ATOM   7249 C CA    . PRO B 1 410 ? 14.900  9.609   -29.849 1.00 40.63  ? 410 PRO B CA    1 
ATOM   7250 C C     . PRO B 1 410 ? 13.885  10.642  -30.324 1.00 42.17  ? 410 PRO B C     1 
ATOM   7251 O O     . PRO B 1 410 ? 14.292  11.705  -30.812 1.00 41.70  ? 410 PRO B O     1 
ATOM   7252 C CB    . PRO B 1 410 ? 14.946  8.399   -30.779 1.00 37.71  ? 410 PRO B CB    1 
ATOM   7253 C CG    . PRO B 1 410 ? 15.383  7.321   -29.956 1.00 44.39  ? 410 PRO B CG    1 
ATOM   7254 C CD    . PRO B 1 410 ? 14.868  7.554   -28.553 1.00 43.51  ? 410 PRO B CD    1 
ATOM   7255 N N     . VAL B 1 411 ? 12.578  10.366  -30.221 1.00 40.93  ? 411 VAL B N     1 
ATOM   7256 C CA    . VAL B 1 411 ? 11.588  11.382  -30.585 1.00 39.43  ? 411 VAL B CA    1 
ATOM   7257 C C     . VAL B 1 411 ? 11.764  12.633  -29.727 1.00 41.74  ? 411 VAL B C     1 
ATOM   7258 O O     . VAL B 1 411 ? 11.775  13.760  -30.240 1.00 45.30  ? 411 VAL B O     1 
ATOM   7259 C CB    . VAL B 1 411 ? 10.159  10.820  -30.487 1.00 35.95  ? 411 VAL B CB    1 
ATOM   7260 C CG1   . VAL B 1 411 ? 9.145   11.922  -30.674 1.00 31.49  ? 411 VAL B CG1   1 
ATOM   7261 C CG2   . VAL B 1 411 ? 9.950   9.748   -31.530 1.00 35.21  ? 411 VAL B CG2   1 
ATOM   7262 N N     . ALA B 1 412 ? 11.941  12.461  -28.416 1.00 43.01  ? 412 ALA B N     1 
ATOM   7263 C CA    . ALA B 1 412 ? 12.120  13.620  -27.545 1.00 43.45  ? 412 ALA B CA    1 
ATOM   7264 C C     . ALA B 1 412 ? 13.390  14.389  -27.894 1.00 43.77  ? 412 ALA B C     1 
ATOM   7265 O O     . ALA B 1 412 ? 13.377  15.622  -27.986 1.00 43.89  ? 412 ALA B O     1 
ATOM   7266 C CB    . ALA B 1 412 ? 12.141  13.175  -26.089 1.00 42.39  ? 412 ALA B CB    1 
ATOM   7267 N N     . GLN B 1 413 ? 14.494  13.674  -28.099 1.00 42.20  ? 413 GLN B N     1 
ATOM   7268 C CA    . GLN B 1 413 ? 15.710  14.310  -28.587 1.00 41.70  ? 413 GLN B CA    1 
ATOM   7269 C C     . GLN B 1 413 ? 15.457  15.112  -29.870 1.00 49.77  ? 413 GLN B C     1 
ATOM   7270 O O     . GLN B 1 413 ? 15.900  16.260  -29.988 1.00 48.94  ? 413 GLN B O     1 
ATOM   7271 C CB    . GLN B 1 413 ? 16.770  13.232  -28.791 1.00 42.32  ? 413 GLN B CB    1 
ATOM   7272 C CG    . GLN B 1 413 ? 17.815  13.556  -29.817 1.00 51.65  ? 413 GLN B CG    1 
ATOM   7273 C CD    . GLN B 1 413 ? 19.125  13.956  -29.191 1.00 63.12  ? 413 GLN B CD    1 
ATOM   7274 O OE1   . GLN B 1 413 ? 19.171  14.344  -28.015 1.00 59.49  ? 413 GLN B OE1   1 
ATOM   7275 N NE2   . GLN B 1 413 ? 20.213  13.855  -29.970 1.00 68.59  ? 413 GLN B NE2   1 
ATOM   7276 N N     . LEU B 1 414 ? 14.723  14.544  -30.835 1.00 46.85  ? 414 LEU B N     1 
ATOM   7277 C CA    . LEU B 1 414 ? 14.459  15.292  -32.057 1.00 45.43  ? 414 LEU B CA    1 
ATOM   7278 C C     . LEU B 1 414 ? 13.596  16.510  -31.769 1.00 45.96  ? 414 LEU B C     1 
ATOM   7279 O O     . LEU B 1 414 ? 13.880  17.615  -32.252 1.00 45.76  ? 414 LEU B O     1 
ATOM   7280 C CB    . LEU B 1 414 ? 13.791  14.405  -33.109 1.00 43.63  ? 414 LEU B CB    1 
ATOM   7281 C CG    . LEU B 1 414 ? 13.429  15.143  -34.408 1.00 38.17  ? 414 LEU B CG    1 
ATOM   7282 C CD1   . LEU B 1 414 ? 14.672  15.449  -35.210 1.00 42.93  ? 414 LEU B CD1   1 
ATOM   7283 C CD2   . LEU B 1 414 ? 12.457  14.349  -35.248 1.00 37.30  ? 414 LEU B CD2   1 
ATOM   7284 N N     . ALA B 1 415 ? 12.524  16.327  -30.997 1.00 41.32  ? 415 ALA B N     1 
ATOM   7285 C CA    . ALA B 1 415 ? 11.617  17.442  -30.746 1.00 46.27  ? 415 ALA B CA    1 
ATOM   7286 C C     . ALA B 1 415 ? 12.360  18.606  -30.103 1.00 52.44  ? 415 ALA B C     1 
ATOM   7287 O O     . ALA B 1 415 ? 12.139  19.774  -30.460 1.00 50.32  ? 415 ALA B O     1 
ATOM   7288 C CB    . ALA B 1 415 ? 10.455  16.986  -29.868 1.00 40.25  ? 415 ALA B CB    1 
ATOM   7289 N N     . GLY B 1 416 ? 13.302  18.291  -29.207 1.00 47.97  ? 416 GLY B N     1 
ATOM   7290 C CA    . GLY B 1 416 ? 14.017  19.326  -28.483 1.00 45.37  ? 416 GLY B CA    1 
ATOM   7291 C C     . GLY B 1 416 ? 14.968  20.132  -29.342 1.00 45.68  ? 416 GLY B C     1 
ATOM   7292 O O     . GLY B 1 416 ? 15.036  21.356  -29.216 1.00 47.96  ? 416 GLY B O     1 
ATOM   7293 N N     . ARG B 1 417 ? 15.729  19.467  -30.214 1.00 49.18  ? 417 ARG B N     1 
ATOM   7294 C CA    . ARG B 1 417 ? 16.667  20.199  -31.064 1.00 50.40  ? 417 ARG B CA    1 
ATOM   7295 C C     . ARG B 1 417 ? 15.941  20.979  -32.154 1.00 49.19  ? 417 ARG B C     1 
ATOM   7296 O O     . ARG B 1 417 ? 16.325  22.107  -32.473 1.00 51.20  ? 417 ARG B O     1 
ATOM   7297 C CB    . ARG B 1 417 ? 17.675  19.259  -31.700 1.00 49.58  ? 417 ARG B CB    1 
ATOM   7298 C CG    . ARG B 1 417 ? 18.081  18.156  -30.803 1.00 50.14  ? 417 ARG B CG    1 
ATOM   7299 C CD    . ARG B 1 417 ? 19.170  18.652  -29.805 1.00 62.27  ? 417 ARG B CD    1 
ATOM   7300 N NE    . ARG B 1 417 ? 20.011  19.714  -30.330 1.00 65.18  ? 417 ARG B NE    1 
ATOM   7301 C CZ    . ARG B 1 417 ? 21.129  20.171  -29.722 1.00 67.98  ? 417 ARG B CZ    1 
ATOM   7302 N NH1   . ARG B 1 417 ? 21.580  19.678  -28.567 1.00 63.74  ? 417 ARG B NH1   1 
ATOM   7303 N NH2   . ARG B 1 417 ? 21.867  21.128  -30.283 1.00 67.12  ? 417 ARG B NH2   1 
ATOM   7304 N N     . LEU B 1 418 ? 14.897  20.398  -32.743 1.00 46.90  ? 418 LEU B N     1 
ATOM   7305 C CA    . LEU B 1 418 ? 14.167  21.138  -33.770 1.00 45.60  ? 418 LEU B CA    1 
ATOM   7306 C C     . LEU B 1 418 ? 13.572  22.407  -33.173 1.00 47.56  ? 418 LEU B C     1 
ATOM   7307 O O     . LEU B 1 418 ? 13.712  23.497  -33.741 1.00 48.15  ? 418 LEU B O     1 
ATOM   7308 C CB    . LEU B 1 418 ? 13.087  20.255  -34.420 1.00 42.48  ? 418 LEU B CB    1 
ATOM   7309 C CG    . LEU B 1 418 ? 13.498  19.017  -35.247 1.00 42.15  ? 418 LEU B CG    1 
ATOM   7310 C CD1   . LEU B 1 418 ? 12.294  18.332  -35.857 1.00 37.37  ? 418 LEU B CD1   1 
ATOM   7311 C CD2   . LEU B 1 418 ? 14.526  19.337  -36.322 1.00 41.55  ? 418 LEU B CD2   1 
ATOM   7312 N N     . ALA B 1 419 ? 12.955  22.294  -31.991 1.00 46.25  ? 419 ALA B N     1 
ATOM   7313 C CA    . ALA B 1 419 ? 12.400  23.473  -31.331 1.00 47.56  ? 419 ALA B CA    1 
ATOM   7314 C C     . ALA B 1 419 ? 13.496  24.476  -31.000 1.00 49.15  ? 419 ALA B C     1 
ATOM   7315 O O     . ALA B 1 419 ? 13.391  25.662  -31.336 1.00 49.10  ? 419 ALA B O     1 
ATOM   7316 C CB    . ALA B 1 419 ? 11.638  23.075  -30.064 1.00 43.58  ? 419 ALA B CB    1 
ATOM   7317 N N     . ALA B 1 420 ? 14.570  24.007  -30.355 1.00 49.74  ? 420 ALA B N     1 
ATOM   7318 C CA    . ALA B 1 420 ? 15.682  24.873  -29.979 1.00 44.54  ? 420 ALA B CA    1 
ATOM   7319 C C     . ALA B 1 420 ? 16.209  25.682  -31.145 1.00 45.91  ? 420 ALA B C     1 
ATOM   7320 O O     . ALA B 1 420 ? 16.717  26.787  -30.946 1.00 49.56  ? 420 ALA B O     1 
ATOM   7321 C CB    . ALA B 1 420 ? 16.823  24.043  -29.387 1.00 42.33  ? 420 ALA B CB    1 
ATOM   7322 N N     . GLN B 1 421 ? 16.102  25.161  -32.363 1.00 47.96  ? 421 GLN B N     1 
ATOM   7323 C CA    . GLN B 1 421 ? 16.747  25.805  -33.496 1.00 49.17  ? 421 GLN B CA    1 
ATOM   7324 C C     . GLN B 1 421 ? 15.760  26.276  -34.556 1.00 51.14  ? 421 GLN B C     1 
ATOM   7325 O O     . GLN B 1 421 ? 15.982  26.080  -35.752 1.00 54.62  ? 421 GLN B O     1 
ATOM   7326 C CB    . GLN B 1 421 ? 17.773  24.844  -34.075 1.00 52.86  ? 421 GLN B CB    1 
ATOM   7327 C CG    . GLN B 1 421 ? 18.497  24.148  -32.951 1.00 57.89  ? 421 GLN B CG    1 
ATOM   7328 C CD    . GLN B 1 421 ? 19.828  23.597  -33.351 1.00 68.44  ? 421 GLN B CD    1 
ATOM   7329 O OE1   . GLN B 1 421 ? 20.495  24.144  -34.232 1.00 70.02  ? 421 GLN B OE1   1 
ATOM   7330 N NE2   . GLN B 1 421 ? 20.239  22.505  -32.696 1.00 66.72  ? 421 GLN B NE2   1 
ATOM   7331 N N     . GLY B 1 422 ? 14.677  26.915  -34.132 1.00 49.54  ? 422 GLY B N     1 
ATOM   7332 C CA    . GLY B 1 422 ? 13.832  27.678  -35.016 1.00 53.03  ? 422 GLY B CA    1 
ATOM   7333 C C     . GLY B 1 422 ? 12.515  27.025  -35.373 1.00 53.81  ? 422 GLY B C     1 
ATOM   7334 O O     . GLY B 1 422 ? 11.580  27.731  -35.771 1.00 54.49  ? 422 GLY B O     1 
ATOM   7335 N N     . ALA B 1 423 ? 12.407  25.710  -35.232 1.00 51.70  ? 423 ALA B N     1 
ATOM   7336 C CA    . ALA B 1 423 ? 11.270  25.007  -35.806 1.00 50.74  ? 423 ALA B CA    1 
ATOM   7337 C C     . ALA B 1 423 ? 10.054  25.108  -34.911 1.00 45.94  ? 423 ALA B C     1 
ATOM   7338 O O     . ALA B 1 423 ? 10.163  25.257  -33.692 1.00 48.81  ? 423 ALA B O     1 
ATOM   7339 C CB    . ALA B 1 423 ? 11.598  23.535  -36.047 1.00 52.03  ? 423 ALA B CB    1 
ATOM   7340 N N     . ARG B 1 424 ? 8.885   25.032  -35.538 1.00 41.66  ? 424 ARG B N     1 
ATOM   7341 C CA    . ARG B 1 424 ? 7.626   24.927  -34.825 1.00 44.99  ? 424 ARG B CA    1 
ATOM   7342 C C     . ARG B 1 424 ? 7.272   23.454  -34.724 1.00 48.65  ? 424 ARG B C     1 
ATOM   7343 O O     . ARG B 1 424 ? 7.217   22.749  -35.739 1.00 47.75  ? 424 ARG B O     1 
ATOM   7344 C CB    . ARG B 1 424 ? 6.524   25.714  -35.517 1.00 44.44  ? 424 ARG B CB    1 
ATOM   7345 C CG    . ARG B 1 424 ? 5.156   25.079  -35.425 1.00 52.30  ? 424 ARG B CG    1 
ATOM   7346 C CD    . ARG B 1 424 ? 4.109   25.894  -36.220 1.00 50.64  ? 424 ARG B CD    1 
ATOM   7347 N NE    . ARG B 1 424 ? 4.235   27.320  -35.970 1.00 55.21  ? 424 ARG B NE    1 
ATOM   7348 C CZ    . ARG B 1 424 ? 3.822   27.927  -34.848 1.00 54.62  ? 424 ARG B CZ    1 
ATOM   7349 N NH1   . ARG B 1 424 ? 3.255   27.271  -33.844 1.00 56.04  ? 424 ARG B NH1   1 
ATOM   7350 N NH2   . ARG B 1 424 ? 3.980   29.219  -34.703 1.00 55.56  ? 424 ARG B NH2   1 
ATOM   7351 N N     . VAL B 1 425 ? 7.054   22.988  -33.499 1.00 47.81  ? 425 VAL B N     1 
ATOM   7352 C CA    . VAL B 1 425 ? 6.995   21.575  -33.177 1.00 42.44  ? 425 VAL B CA    1 
ATOM   7353 C C     . VAL B 1 425 ? 5.706   21.337  -32.418 1.00 42.36  ? 425 VAL B C     1 
ATOM   7354 O O     . VAL B 1 425 ? 5.422   22.044  -31.448 1.00 45.14  ? 425 VAL B O     1 
ATOM   7355 C CB    . VAL B 1 425 ? 8.213   21.153  -32.333 1.00 42.06  ? 425 VAL B CB    1 
ATOM   7356 C CG1   . VAL B 1 425 ? 8.156   19.686  -31.963 1.00 41.48  ? 425 VAL B CG1   1 
ATOM   7357 C CG2   . VAL B 1 425 ? 9.496   21.481  -33.068 1.00 42.36  ? 425 VAL B CG2   1 
ATOM   7358 N N     . TYR B 1 426 ? 4.917   20.376  -32.866 1.00 38.59  ? 426 TYR B N     1 
ATOM   7359 C CA    . TYR B 1 426 ? 3.801   19.879  -32.086 1.00 38.68  ? 426 TYR B CA    1 
ATOM   7360 C C     . TYR B 1 426 ? 4.083   18.429  -31.725 1.00 42.81  ? 426 TYR B C     1 
ATOM   7361 O O     . TYR B 1 426 ? 4.511   17.647  -32.579 1.00 41.29  ? 426 TYR B O     1 
ATOM   7362 C CB    . TYR B 1 426 ? 2.479   20.001  -32.837 1.00 40.13  ? 426 TYR B CB    1 
ATOM   7363 C CG    . TYR B 1 426 ? 2.053   21.423  -33.091 1.00 44.62  ? 426 TYR B CG    1 
ATOM   7364 C CD1   . TYR B 1 426 ? 2.374   22.066  -34.289 1.00 41.73  ? 426 TYR B CD1   1 
ATOM   7365 C CD2   . TYR B 1 426 ? 1.323   22.128  -32.139 1.00 43.97  ? 426 TYR B CD2   1 
ATOM   7366 C CE1   . TYR B 1 426 ? 1.983   23.374  -34.531 1.00 43.16  ? 426 TYR B CE1   1 
ATOM   7367 C CE2   . TYR B 1 426 ? 0.924   23.438  -32.372 1.00 46.99  ? 426 TYR B CE2   1 
ATOM   7368 C CZ    . TYR B 1 426 ? 1.258   24.055  -33.571 1.00 47.76  ? 426 TYR B CZ    1 
ATOM   7369 O OH    . TYR B 1 426 ? 0.865   25.352  -33.796 1.00 46.97  ? 426 TYR B OH    1 
ATOM   7370 N N     . ALA B 1 427 ? 3.872   18.083  -30.454 1.00 42.23  ? 427 ALA B N     1 
ATOM   7371 C CA    . ALA B 1 427 ? 4.135   16.745  -29.964 1.00 36.96  ? 427 ALA B CA    1 
ATOM   7372 C C     . ALA B 1 427 ? 2.851   16.166  -29.403 1.00 39.66  ? 427 ALA B C     1 
ATOM   7373 O O     . ALA B 1 427 ? 2.010   16.901  -28.885 1.00 41.60  ? 427 ALA B O     1 
ATOM   7374 C CB    . ALA B 1 427 ? 5.231   16.757  -28.918 1.00 33.74  ? 427 ALA B CB    1 
ATOM   7375 N N     . TYR B 1 428 ? 2.681   14.855  -29.551 1.00 38.60  ? 428 TYR B N     1 
ATOM   7376 C CA    . TYR B 1 428 ? 1.550   14.145  -28.974 1.00 40.12  ? 428 TYR B CA    1 
ATOM   7377 C C     . TYR B 1 428 ? 2.032   12.858  -28.318 1.00 43.06  ? 428 TYR B C     1 
ATOM   7378 O O     . TYR B 1 428 ? 3.163   12.410  -28.516 1.00 44.38  ? 428 TYR B O     1 
ATOM   7379 C CB    . TYR B 1 428 ? 0.479   13.810  -30.023 1.00 41.73  ? 428 TYR B CB    1 
ATOM   7380 C CG    . TYR B 1 428 ? 0.938   12.812  -31.066 1.00 45.53  ? 428 TYR B CG    1 
ATOM   7381 C CD1   . TYR B 1 428 ? 0.871   11.445  -30.837 1.00 45.49  ? 428 TYR B CD1   1 
ATOM   7382 C CD2   . TYR B 1 428 ? 1.442   13.244  -32.284 1.00 44.00  ? 428 TYR B CD2   1 
ATOM   7383 C CE1   . TYR B 1 428 ? 1.310   10.546  -31.782 1.00 44.63  ? 428 TYR B CE1   1 
ATOM   7384 C CE2   . TYR B 1 428 ? 1.870   12.360  -33.228 1.00 41.42  ? 428 TYR B CE2   1 
ATOM   7385 C CZ    . TYR B 1 428 ? 1.806   11.014  -32.977 1.00 43.82  ? 428 TYR B CZ    1 
ATOM   7386 O OH    . TYR B 1 428 ? 2.242   10.136  -33.940 1.00 48.64  ? 428 TYR B OH    1 
ATOM   7387 N N     . ILE B 1 429 ? 1.158   12.262  -27.523 1.00 40.66  ? 429 ILE B N     1 
ATOM   7388 C CA    . ILE B 1 429 ? 1.288   10.867  -27.145 1.00 40.37  ? 429 ILE B CA    1 
ATOM   7389 C C     . ILE B 1 429 ? -0.060  10.223  -27.397 1.00 43.75  ? 429 ILE B C     1 
ATOM   7390 O O     . ILE B 1 429 ? -1.096  10.764  -26.991 1.00 43.89  ? 429 ILE B O     1 
ATOM   7391 C CB    . ILE B 1 429 ? 1.744   10.683  -25.686 1.00 48.22  ? 429 ILE B CB    1 
ATOM   7392 C CG1   . ILE B 1 429 ? 1.859   9.199   -25.353 1.00 44.28  ? 429 ILE B CG1   1 
ATOM   7393 C CG2   . ILE B 1 429 ? 0.816   11.389  -24.689 1.00 43.15  ? 429 ILE B CG2   1 
ATOM   7394 C CD1   . ILE B 1 429 ? 2.617   8.985   -24.090 1.00 40.67  ? 429 ILE B CD1   1 
ATOM   7395 N N     . PHE B 1 430 ? -0.049  9.114   -28.128 1.00 41.92  ? 430 PHE B N     1 
ATOM   7396 C CA    . PHE B 1 430 ? -1.264  8.400   -28.485 1.00 42.79  ? 430 PHE B CA    1 
ATOM   7397 C C     . PHE B 1 430 ? -1.498  7.321   -27.440 1.00 41.49  ? 430 PHE B C     1 
ATOM   7398 O O     . PHE B 1 430 ? -0.643  6.452   -27.248 1.00 44.38  ? 430 PHE B O     1 
ATOM   7399 C CB    . PHE B 1 430 ? -1.129  7.800   -29.887 1.00 44.80  ? 430 PHE B CB    1 
ATOM   7400 C CG    . PHE B 1 430 ? -2.416  7.277   -30.446 1.00 43.58  ? 430 PHE B CG    1 
ATOM   7401 C CD1   . PHE B 1 430 ? -2.781  5.952   -30.257 1.00 44.74  ? 430 PHE B CD1   1 
ATOM   7402 C CD2   . PHE B 1 430 ? -3.270  8.115   -31.149 1.00 43.70  ? 430 PHE B CD2   1 
ATOM   7403 C CE1   . PHE B 1 430 ? -3.978  5.469   -30.757 1.00 46.30  ? 430 PHE B CE1   1 
ATOM   7404 C CE2   . PHE B 1 430 ? -4.468  7.643   -31.655 1.00 45.07  ? 430 PHE B CE2   1 
ATOM   7405 C CZ    . PHE B 1 430 ? -4.824  6.316   -31.457 1.00 48.02  ? 430 PHE B CZ    1 
ATOM   7406 N N     . GLU B 1 431 ? -2.645  7.379   -26.764 1.00 46.47  ? 431 GLU B N     1 
ATOM   7407 C CA    . GLU B 1 431 ? -2.902  6.561   -25.575 1.00 47.69  ? 431 GLU B CA    1 
ATOM   7408 C C     . GLU B 1 431 ? -4.159  5.718   -25.656 1.00 46.13  ? 431 GLU B C     1 
ATOM   7409 O O     . GLU B 1 431 ? -4.457  5.001   -24.703 1.00 51.10  ? 431 GLU B O     1 
ATOM   7410 C CB    . GLU B 1 431 ? -3.018  7.433   -24.320 1.00 46.51  ? 431 GLU B CB    1 
ATOM   7411 C CG    . GLU B 1 431 ? -1.709  7.774   -23.669 1.00 50.52  ? 431 GLU B CG    1 
ATOM   7412 C CD    . GLU B 1 431 ? -1.903  8.625   -22.431 1.00 53.61  ? 431 GLU B CD    1 
ATOM   7413 O OE1   . GLU B 1 431 ? -2.855  9.439   -22.438 1.00 49.14  ? 431 GLU B OE1   1 
ATOM   7414 O OE2   . GLU B 1 431 ? -1.120  8.461   -21.459 1.00 54.89  ? 431 GLU B OE2   1 
ATOM   7415 N N     . HIS B 1 432 ? -4.917  5.789   -26.739 1.00 51.10  ? 432 HIS B N     1 
ATOM   7416 C CA    . HIS B 1 432 ? -6.095  4.949   -26.876 1.00 52.23  ? 432 HIS B CA    1 
ATOM   7417 C C     . HIS B 1 432 ? -5.735  3.607   -27.499 1.00 51.39  ? 432 HIS B C     1 
ATOM   7418 O O     . HIS B 1 432 ? -5.030  3.551   -28.509 1.00 54.44  ? 432 HIS B O     1 
ATOM   7419 C CB    . HIS B 1 432 ? -7.159  5.620   -27.728 1.00 49.30  ? 432 HIS B CB    1 
ATOM   7420 C CG    . HIS B 1 432 ? -8.309  4.719   -28.010 1.00 54.02  ? 432 HIS B CG    1 
ATOM   7421 N ND1   . HIS B 1 432 ? -9.320  4.506   -27.100 1.00 59.24  ? 432 HIS B ND1   1 
ATOM   7422 C CD2   . HIS B 1 432 ? -8.580  3.926   -29.072 1.00 59.32  ? 432 HIS B CD2   1 
ATOM   7423 C CE1   . HIS B 1 432 ? -10.185 3.645   -27.605 1.00 60.80  ? 432 HIS B CE1   1 
ATOM   7424 N NE2   . HIS B 1 432 ? -9.758  3.275   -28.799 1.00 60.44  ? 432 HIS B NE2   1 
ATOM   7425 N N     . ARG B 1 433 ? -6.235  2.534   -26.905 1.00 53.22  ? 433 ARG B N     1 
ATOM   7426 C CA    . ARG B 1 433 ? -6.017  1.189   -27.409 1.00 52.39  ? 433 ARG B CA    1 
ATOM   7427 C C     . ARG B 1 433 ? -7.285  0.730   -28.114 1.00 60.83  ? 433 ARG B C     1 
ATOM   7428 O O     . ARG B 1 433 ? -8.385  0.842   -27.556 1.00 58.00  ? 433 ARG B O     1 
ATOM   7429 C CB    . ARG B 1 433 ? -5.653  0.232   -26.276 1.00 50.28  ? 433 ARG B CB    1 
ATOM   7430 C CG    . ARG B 1 433 ? -5.885  -1.225  -26.602 1.00 60.52  ? 433 ARG B CG    1 
ATOM   7431 C CD    . ARG B 1 433 ? -5.282  -2.143  -25.555 1.00 55.06  ? 433 ARG B CD    1 
ATOM   7432 N NE    . ARG B 1 433 ? -5.614  -3.541  -25.811 1.00 55.13  ? 433 ARG B NE    1 
ATOM   7433 C CZ    . ARG B 1 433 ? -4.716  -4.508  -25.937 1.00 57.71  ? 433 ARG B CZ    1 
ATOM   7434 N NH1   . ARG B 1 433 ? -3.423  -4.234  -25.832 1.00 55.64  ? 433 ARG B NH1   1 
ATOM   7435 N NH2   . ARG B 1 433 ? -5.112  -5.750  -26.166 1.00 59.99  ? 433 ARG B NH2   1 
ATOM   7436 N N     . ALA B 1 434 ? -7.129  0.228   -29.342 1.00 60.75  ? 434 ALA B N     1 
ATOM   7437 C CA    . ALA B 1 434 ? -8.281  -0.095  -30.174 1.00 59.13  ? 434 ALA B CA    1 
ATOM   7438 C C     . ALA B 1 434 ? -9.053  -1.275  -29.597 1.00 60.46  ? 434 ALA B C     1 
ATOM   7439 O O     . ALA B 1 434 ? -8.464  -2.277  -29.180 1.00 57.97  ? 434 ALA B O     1 
ATOM   7440 C CB    . ALA B 1 434 ? -7.837  -0.404  -31.600 1.00 53.16  ? 434 ALA B CB    1 
ATOM   7441 N N     . SER B 1 435 ? -10.384 -1.136  -29.560 1.00 56.02  ? 435 SER B N     1 
ATOM   7442 C CA    . SER B 1 435 ? -11.242 -2.248  -29.169 1.00 52.96  ? 435 SER B CA    1 
ATOM   7443 C C     . SER B 1 435 ? -11.050 -3.452  -30.086 1.00 60.51  ? 435 SER B C     1 
ATOM   7444 O O     . SER B 1 435 ? -11.119 -4.597  -29.625 1.00 63.94  ? 435 SER B O     1 
ATOM   7445 C CB    . SER B 1 435 ? -12.703 -1.807  -29.174 1.00 54.35  ? 435 SER B CB    1 
ATOM   7446 O OG    . SER B 1 435 ? -13.095 -1.314  -30.446 1.00 61.21  ? 435 SER B OG    1 
ATOM   7447 N N     . THR B 1 436 ? -10.799 -3.213  -31.378 1.00 58.66  ? 436 THR B N     1 
ATOM   7448 C CA    . THR B 1 436 ? -10.506 -4.253  -32.353 1.00 52.38  ? 436 THR B CA    1 
ATOM   7449 C C     . THR B 1 436 ? -9.139  -4.894  -32.178 1.00 57.74  ? 436 THR B C     1 
ATOM   7450 O O     . THR B 1 436 ? -8.822  -5.788  -32.968 1.00 63.14  ? 436 THR B O     1 
ATOM   7451 C CB    . THR B 1 436 ? -10.548 -3.696  -33.773 1.00 60.87  ? 436 THR B CB    1 
ATOM   7452 O OG1   . THR B 1 436 ? -9.459  -2.768  -33.949 1.00 60.40  ? 436 THR B OG1   1 
ATOM   7453 C CG2   . THR B 1 436 ? -11.894 -3.029  -34.084 1.00 61.89  ? 436 THR B CG2   1 
ATOM   7454 N N     . LEU B 1 437 ? -8.317  -4.463  -31.216 1.00 57.41  ? 437 LEU B N     1 
ATOM   7455 C CA    . LEU B 1 437 ? -6.919  -4.894  -31.202 1.00 58.17  ? 437 LEU B CA    1 
ATOM   7456 C C     . LEU B 1 437 ? -6.837  -6.352  -30.776 1.00 55.86  ? 437 LEU B C     1 
ATOM   7457 O O     . LEU B 1 437 ? -7.650  -6.822  -29.979 1.00 57.73  ? 437 LEU B O     1 
ATOM   7458 C CB    . LEU B 1 437 ? -6.063  -3.983  -30.306 1.00 56.31  ? 437 LEU B CB    1 
ATOM   7459 C CG    . LEU B 1 437 ? -4.556  -4.282  -30.383 1.00 54.14  ? 437 LEU B CG    1 
ATOM   7460 C CD1   . LEU B 1 437 ? -4.065  -4.331  -31.804 1.00 58.28  ? 437 LEU B CD1   1 
ATOM   7461 C CD2   . LEU B 1 437 ? -3.754  -3.246  -29.634 1.00 54.96  ? 437 LEU B CD2   1 
ATOM   7462 N N     . THR B 1 438 ? -5.902  -7.087  -31.374 1.00 57.40  ? 438 THR B N     1 
ATOM   7463 C CA    . THR B 1 438 ? -5.857  -8.538  -31.276 1.00 57.44  ? 438 THR B CA    1 
ATOM   7464 C C     . THR B 1 438 ? -4.626  -9.039  -30.545 1.00 56.49  ? 438 THR B C     1 
ATOM   7465 O O     . THR B 1 438 ? -4.490  -10.249 -30.342 1.00 59.01  ? 438 THR B O     1 
ATOM   7466 C CB    . THR B 1 438 ? -5.910  -9.172  -32.679 1.00 61.05  ? 438 THR B CB    1 
ATOM   7467 O OG1   . THR B 1 438 ? -4.714  -8.852  -33.409 1.00 56.73  ? 438 THR B OG1   1 
ATOM   7468 C CG2   . THR B 1 438 ? -7.103  -8.648  -33.449 1.00 55.94  ? 438 THR B CG2   1 
ATOM   7469 N N     . TRP B 1 439 ? -3.726  -8.151  -30.155 1.00 58.60  ? 439 TRP B N     1 
ATOM   7470 C CA    . TRP B 1 439 ? -2.610  -8.515  -29.299 1.00 58.30  ? 439 TRP B CA    1 
ATOM   7471 C C     . TRP B 1 439 ? -3.067  -8.514  -27.846 1.00 54.61  ? 439 TRP B C     1 
ATOM   7472 O O     . TRP B 1 439 ? -4.101  -7.925  -27.523 1.00 57.04  ? 439 TRP B O     1 
ATOM   7473 C CB    . TRP B 1 439 ? -1.462  -7.531  -29.490 1.00 58.70  ? 439 TRP B CB    1 
ATOM   7474 C CG    . TRP B 1 439 ? -0.864  -7.514  -30.865 1.00 55.87  ? 439 TRP B CG    1 
ATOM   7475 C CD1   . TRP B 1 439 ? -1.207  -6.689  -31.892 1.00 51.98  ? 439 TRP B CD1   1 
ATOM   7476 C CD2   . TRP B 1 439 ? 0.206   -8.337  -31.345 1.00 55.31  ? 439 TRP B CD2   1 
ATOM   7477 N NE1   . TRP B 1 439 ? -0.429  -6.953  -32.990 1.00 56.93  ? 439 TRP B NE1   1 
ATOM   7478 C CE2   . TRP B 1 439 ? 0.449   -7.959  -32.686 1.00 57.31  ? 439 TRP B CE2   1 
ATOM   7479 C CE3   . TRP B 1 439 ? 0.980   -9.358  -30.775 1.00 52.26  ? 439 TRP B CE3   1 
ATOM   7480 C CZ2   . TRP B 1 439 ? 1.432   -8.565  -33.471 1.00 55.95  ? 439 TRP B CZ2   1 
ATOM   7481 C CZ3   . TRP B 1 439 ? 1.956   -9.961  -31.549 1.00 57.05  ? 439 TRP B CZ3   1 
ATOM   7482 C CH2   . TRP B 1 439 ? 2.173   -9.563  -32.891 1.00 62.56  ? 439 TRP B CH2   1 
ATOM   7483 N N     . PRO B 1 440 ? -2.315  -9.157  -26.948 1.00 56.99  ? 440 PRO B N     1 
ATOM   7484 C CA    . PRO B 1 440 ? -2.753  -9.254  -25.546 1.00 56.87  ? 440 PRO B CA    1 
ATOM   7485 C C     . PRO B 1 440 ? -2.815  -7.897  -24.851 1.00 56.34  ? 440 PRO B C     1 
ATOM   7486 O O     . PRO B 1 440 ? -2.290  -6.882  -25.314 1.00 53.35  ? 440 PRO B O     1 
ATOM   7487 C CB    . PRO B 1 440 ? -1.697  -10.160 -24.906 1.00 55.96  ? 440 PRO B CB    1 
ATOM   7488 C CG    . PRO B 1 440 ? -0.510  -9.993  -25.757 1.00 59.57  ? 440 PRO B CG    1 
ATOM   7489 C CD    . PRO B 1 440 ? -1.041  -9.866  -27.158 1.00 58.00  ? 440 PRO B CD    1 
ATOM   7490 N N     . LEU B 1 441 ? -3.477  -7.892  -23.696 1.00 57.29  ? 441 LEU B N     1 
ATOM   7491 C CA    . LEU B 1 441 ? -3.666  -6.634  -22.990 1.00 55.70  ? 441 LEU B CA    1 
ATOM   7492 C C     . LEU B 1 441 ? -2.360  -6.093  -22.442 1.00 54.49  ? 441 LEU B C     1 
ATOM   7493 O O     . LEU B 1 441 ? -2.176  -4.874  -22.383 1.00 55.51  ? 441 LEU B O     1 
ATOM   7494 C CB    . LEU B 1 441 ? -4.679  -6.807  -21.871 1.00 54.87  ? 441 LEU B CB    1 
ATOM   7495 C CG    . LEU B 1 441 ? -6.113  -6.687  -22.353 1.00 60.70  ? 441 LEU B CG    1 
ATOM   7496 C CD1   . LEU B 1 441 ? -7.062  -7.171  -21.279 1.00 62.71  ? 441 LEU B CD1   1 
ATOM   7497 C CD2   . LEU B 1 441 ? -6.373  -5.240  -22.690 1.00 54.97  ? 441 LEU B CD2   1 
ATOM   7498 N N     . TRP B 1 442 ? -1.431  -6.971  -22.068 1.00 56.73  ? 442 TRP B N     1 
ATOM   7499 C CA    . TRP B 1 442 ? -0.205  -6.503  -21.436 1.00 54.71  ? 442 TRP B CA    1 
ATOM   7500 C C     . TRP B 1 442 ? 0.642   -5.651  -22.365 1.00 54.52  ? 442 TRP B C     1 
ATOM   7501 O O     . TRP B 1 442 ? 1.528   -4.937  -21.885 1.00 52.42  ? 442 TRP B O     1 
ATOM   7502 C CB    . TRP B 1 442 ? 0.619   -7.685  -20.921 1.00 56.10  ? 442 TRP B CB    1 
ATOM   7503 C CG    . TRP B 1 442 ? 1.251   -8.552  -21.980 1.00 58.96  ? 442 TRP B CG    1 
ATOM   7504 C CD1   . TRP B 1 442 ? 0.754   -9.717  -22.486 1.00 60.02  ? 442 TRP B CD1   1 
ATOM   7505 C CD2   . TRP B 1 442 ? 2.515   -8.337  -22.636 1.00 61.33  ? 442 TRP B CD2   1 
ATOM   7506 N NE1   . TRP B 1 442 ? 1.620   -10.234 -23.424 1.00 61.64  ? 442 TRP B NE1   1 
ATOM   7507 C CE2   . TRP B 1 442 ? 2.705   -9.404  -23.535 1.00 60.57  ? 442 TRP B CE2   1 
ATOM   7508 C CE3   . TRP B 1 442 ? 3.496   -7.340  -22.558 1.00 59.71  ? 442 TRP B CE3   1 
ATOM   7509 C CZ2   . TRP B 1 442 ? 3.835   -9.505  -24.343 1.00 59.04  ? 442 TRP B CZ2   1 
ATOM   7510 C CZ3   . TRP B 1 442 ? 4.617   -7.441  -23.366 1.00 58.22  ? 442 TRP B CZ3   1 
ATOM   7511 C CH2   . TRP B 1 442 ? 4.777   -8.516  -24.245 1.00 58.89  ? 442 TRP B CH2   1 
ATOM   7512 N N     . MET B 1 443 ? 0.408   -5.721  -23.675 1.00 54.09  ? 443 MET B N     1 
ATOM   7513 C CA    . MET B 1 443 ? 1.169   -4.914  -24.616 1.00 55.43  ? 443 MET B CA    1 
ATOM   7514 C C     . MET B 1 443 ? 0.656   -3.488  -24.707 1.00 54.72  ? 443 MET B C     1 
ATOM   7515 O O     . MET B 1 443 ? 1.302   -2.655  -25.356 1.00 51.31  ? 443 MET B O     1 
ATOM   7516 C CB    . MET B 1 443 ? 1.140   -5.537  -26.009 1.00 55.02  ? 443 MET B CB    1 
ATOM   7517 C CG    . MET B 1 443 ? 1.854   -6.862  -26.129 1.00 58.14  ? 443 MET B CG    1 
ATOM   7518 S SD    . MET B 1 443 ? 1.891   -7.362  -27.866 1.00 56.40  ? 443 MET B SD    1 
ATOM   7519 C CE    . MET B 1 443 ? 2.893   -8.830  -27.789 1.00 54.92  ? 443 MET B CE    1 
ATOM   7520 N N     . GLY B 1 444 ? -0.495  -3.204  -24.106 1.00 50.67  ? 444 GLY B N     1 
ATOM   7521 C CA    . GLY B 1 444 ? -0.982  -1.835  -24.080 1.00 56.38  ? 444 GLY B CA    1 
ATOM   7522 C C     . GLY B 1 444 ? -1.361  -1.333  -25.461 1.00 51.47  ? 444 GLY B C     1 
ATOM   7523 O O     . GLY B 1 444 ? -2.141  -1.970  -26.171 1.00 56.04  ? 444 GLY B O     1 
ATOM   7524 N N     . VAL B 1 445 ? -0.838  -0.162  -25.827 1.00 51.31  ? 445 VAL B N     1 
ATOM   7525 C CA    . VAL B 1 445 ? -1.000  0.433   -27.155 1.00 47.15  ? 445 VAL B CA    1 
ATOM   7526 C C     . VAL B 1 445 ? 0.313   0.234   -27.901 1.00 49.47  ? 445 VAL B C     1 
ATOM   7527 O O     . VAL B 1 445 ? 1.250   1.020   -27.711 1.00 49.88  ? 445 VAL B O     1 
ATOM   7528 C CB    . VAL B 1 445 ? -1.356  1.924   -27.076 1.00 46.19  ? 445 VAL B CB    1 
ATOM   7529 C CG1   . VAL B 1 445 ? -1.685  2.471   -28.458 1.00 46.49  ? 445 VAL B CG1   1 
ATOM   7530 C CG2   . VAL B 1 445 ? -2.508  2.147   -26.143 1.00 49.51  ? 445 VAL B CG2   1 
ATOM   7531 N N     . PRO B 1 446 ? 0.444   -0.791  -28.733 1.00 52.00  ? 446 PRO B N     1 
ATOM   7532 C CA    . PRO B 1 446 ? 1.760   -1.128  -29.280 1.00 49.87  ? 446 PRO B CA    1 
ATOM   7533 C C     . PRO B 1 446 ? 2.103   -0.310  -30.511 1.00 46.04  ? 446 PRO B C     1 
ATOM   7534 O O     . PRO B 1 446 ? 1.259   0.327   -31.137 1.00 42.76  ? 446 PRO B O     1 
ATOM   7535 C CB    . PRO B 1 446 ? 1.641   -2.617  -29.629 1.00 47.49  ? 446 PRO B CB    1 
ATOM   7536 C CG    . PRO B 1 446 ? 0.264   -3.052  -29.110 1.00 51.76  ? 446 PRO B CG    1 
ATOM   7537 C CD    . PRO B 1 446 ? -0.585  -1.839  -29.041 1.00 47.43  ? 446 PRO B CD    1 
ATOM   7538 N N     . HIS B 1 447 ? 3.392   -0.338  -30.825 1.00 49.26  ? 447 HIS B N     1 
ATOM   7539 C CA    . HIS B 1 447 ? 3.991   0.306   -31.984 1.00 44.07  ? 447 HIS B CA    1 
ATOM   7540 C C     . HIS B 1 447 ? 3.193   0.037   -33.249 1.00 48.32  ? 447 HIS B C     1 
ATOM   7541 O O     . HIS B 1 447 ? 3.124   -1.102  -33.724 1.00 50.95  ? 447 HIS B O     1 
ATOM   7542 C CB    . HIS B 1 447 ? 5.428   -0.204  -32.123 1.00 48.79  ? 447 HIS B CB    1 
ATOM   7543 C CG    . HIS B 1 447 ? 6.219   0.429   -33.222 1.00 50.37  ? 447 HIS B CG    1 
ATOM   7544 N ND1   . HIS B 1 447 ? 6.575   1.760   -33.218 1.00 50.00  ? 447 HIS B ND1   1 
ATOM   7545 C CD2   . HIS B 1 447 ? 6.781   -0.108  -34.330 1.00 51.29  ? 447 HIS B CD2   1 
ATOM   7546 C CE1   . HIS B 1 447 ? 7.309   2.020   -34.284 1.00 47.24  ? 447 HIS B CE1   1 
ATOM   7547 N NE2   . HIS B 1 447 ? 7.448   0.903   -34.976 1.00 48.60  ? 447 HIS B NE2   1 
ATOM   7548 N N     . GLY B 1 448 ? 2.571   1.078   -33.787 1.00 48.94  ? 448 GLY B N     1 
ATOM   7549 C CA    . GLY B 1 448 ? 1.877   1.013   -35.049 1.00 43.07  ? 448 GLY B CA    1 
ATOM   7550 C C     . GLY B 1 448 ? 0.381   1.188   -34.951 1.00 45.10  ? 448 GLY B C     1 
ATOM   7551 O O     . GLY B 1 448 ? -0.262  1.462   -35.980 1.00 47.37  ? 448 GLY B O     1 
ATOM   7552 N N     . TYR B 1 449 ? -0.204  1.073   -33.759 1.00 41.15  ? 449 TYR B N     1 
ATOM   7553 C CA    . TYR B 1 449 ? -1.654  0.983   -33.668 1.00 42.64  ? 449 TYR B CA    1 
ATOM   7554 C C     . TYR B 1 449 ? -2.346  2.331   -33.488 1.00 40.87  ? 449 TYR B C     1 
ATOM   7555 O O     . TYR B 1 449 ? -3.536  2.367   -33.167 1.00 46.03  ? 449 TYR B O     1 
ATOM   7556 C CB    . TYR B 1 449 ? -2.041  -0.027  -32.591 1.00 42.03  ? 449 TYR B CB    1 
ATOM   7557 C CG    . TYR B 1 449 ? -1.798  -1.387  -33.173 1.00 45.51  ? 449 TYR B CG    1 
ATOM   7558 C CD1   . TYR B 1 449 ? -0.581  -2.023  -33.011 1.00 44.21  ? 449 TYR B CD1   1 
ATOM   7559 C CD2   . TYR B 1 449 ? -2.743  -1.977  -34.005 1.00 47.51  ? 449 TYR B CD2   1 
ATOM   7560 C CE1   . TYR B 1 449 ? -0.338  -3.245  -33.599 1.00 47.91  ? 449 TYR B CE1   1 
ATOM   7561 C CE2   . TYR B 1 449 ? -2.507  -3.202  -34.606 1.00 47.32  ? 449 TYR B CE2   1 
ATOM   7562 C CZ    . TYR B 1 449 ? -1.302  -3.829  -34.399 1.00 49.34  ? 449 TYR B CZ    1 
ATOM   7563 O OH    . TYR B 1 449 ? -1.054  -5.045  -34.988 1.00 49.66  ? 449 TYR B OH    1 
ATOM   7564 N N     . GLU B 1 450 ? -1.664  3.429   -33.769 1.00 38.76  ? 450 GLU B N     1 
ATOM   7565 C CA    . GLU B 1 450 ? -2.356  4.684   -34.029 1.00 42.37  ? 450 GLU B CA    1 
ATOM   7566 C C     . GLU B 1 450 ? -2.730  4.888   -35.503 1.00 45.71  ? 450 GLU B C     1 
ATOM   7567 O O     . GLU B 1 450 ? -3.610  5.712   -35.794 1.00 45.62  ? 450 GLU B O     1 
ATOM   7568 C CB    . GLU B 1 450 ? -1.493  5.862   -33.572 1.00 41.99  ? 450 GLU B CB    1 
ATOM   7569 C CG    . GLU B 1 450 ? -0.497  6.372   -34.614 1.00 39.67  ? 450 GLU B CG    1 
ATOM   7570 C CD    . GLU B 1 450 ? 0.756   5.511   -34.741 1.00 43.90  ? 450 GLU B CD    1 
ATOM   7571 O OE1   . GLU B 1 450 ? 0.729   4.325   -34.348 1.00 47.94  ? 450 GLU B OE1   1 
ATOM   7572 O OE2   . GLU B 1 450 ? 1.791   6.027   -35.215 1.00 43.64  ? 450 GLU B OE2   1 
ATOM   7573 N N     . ILE B 1 451 ? -2.092  4.171   -36.436 1.00 44.50  ? 451 ILE B N     1 
ATOM   7574 C CA    . ILE B 1 451 ? -2.268  4.465   -37.856 1.00 42.51  ? 451 ILE B CA    1 
ATOM   7575 C C     . ILE B 1 451 ? -3.713  4.263   -38.277 1.00 43.84  ? 451 ILE B C     1 
ATOM   7576 O O     . ILE B 1 451 ? -4.293  5.096   -38.976 1.00 44.71  ? 451 ILE B O     1 
ATOM   7577 C CB    . ILE B 1 451 ? -1.344  3.592   -38.713 1.00 44.02  ? 451 ILE B CB    1 
ATOM   7578 C CG1   . ILE B 1 451 ? 0.109   3.915   -38.419 1.00 45.03  ? 451 ILE B CG1   1 
ATOM   7579 C CG2   . ILE B 1 451 ? -1.627  3.813   -40.189 1.00 44.21  ? 451 ILE B CG2   1 
ATOM   7580 C CD1   . ILE B 1 451 ? 0.948   2.754   -38.628 1.00 40.57  ? 451 ILE B CD1   1 
ATOM   7581 N N     . GLU B 1 452 ? -4.293  3.121   -37.904 1.00 46.98  ? 452 GLU B N     1 
ATOM   7582 C CA    . GLU B 1 452 ? -5.676  2.854   -38.280 1.00 47.40  ? 452 GLU B CA    1 
ATOM   7583 C C     . GLU B 1 452 ? -6.583  4.040   -37.965 1.00 51.59  ? 452 GLU B C     1 
ATOM   7584 O O     . GLU B 1 452 ? -7.539  4.299   -38.706 1.00 52.23  ? 452 GLU B O     1 
ATOM   7585 C CB    . GLU B 1 452 ? -6.195  1.594   -37.577 1.00 48.57  ? 452 GLU B CB    1 
ATOM   7586 C CG    . GLU B 1 452 ? -5.213  0.859   -36.659 1.00 47.21  ? 452 GLU B CG    1 
ATOM   7587 C CD    . GLU B 1 452 ? -5.933  -0.243  -35.864 1.00 56.48  ? 452 GLU B CD    1 
ATOM   7588 O OE1   . GLU B 1 452 ? -6.994  0.058   -35.271 1.00 54.86  ? 452 GLU B OE1   1 
ATOM   7589 O OE2   . GLU B 1 452 ? -5.476  -1.415  -35.859 1.00 59.59  ? 452 GLU B OE2   1 
ATOM   7590 N N     . PHE B 1 453 ? -6.280  4.791   -36.894 1.00 48.74  ? 453 PHE B N     1 
ATOM   7591 C CA    . PHE B 1 453 ? -7.104  5.934   -36.508 1.00 48.41  ? 453 PHE B CA    1 
ATOM   7592 C C     . PHE B 1 453 ? -6.794  7.177   -37.331 1.00 49.10  ? 453 PHE B C     1 
ATOM   7593 O O     . PHE B 1 453 ? -7.717  7.886   -37.740 1.00 51.69  ? 453 PHE B O     1 
ATOM   7594 C CB    . PHE B 1 453 ? -6.947  6.214   -35.009 1.00 47.29  ? 453 PHE B CB    1 
ATOM   7595 C CG    . PHE B 1 453 ? -7.551  5.146   -34.160 1.00 47.46  ? 453 PHE B CG    1 
ATOM   7596 C CD1   . PHE B 1 453 ? -8.909  5.154   -33.888 1.00 45.71  ? 453 PHE B CD1   1 
ATOM   7597 C CD2   . PHE B 1 453 ? -6.779  4.091   -33.698 1.00 47.88  ? 453 PHE B CD2   1 
ATOM   7598 C CE1   . PHE B 1 453 ? -9.482  4.144   -33.144 1.00 49.34  ? 453 PHE B CE1   1 
ATOM   7599 C CE2   . PHE B 1 453 ? -7.345  3.075   -32.953 1.00 48.37  ? 453 PHE B CE2   1 
ATOM   7600 C CZ    . PHE B 1 453 ? -8.700  3.105   -32.674 1.00 53.29  ? 453 PHE B CZ    1 
ATOM   7601 N N     . ILE B 1 454 ? -5.512  7.455   -37.587 1.00 49.11  ? 454 ILE B N     1 
ATOM   7602 C CA    . ILE B 1 454 ? -5.142  8.617   -38.396 1.00 47.16  ? 454 ILE B CA    1 
ATOM   7603 C C     . ILE B 1 454 ? -5.753  8.529   -39.791 1.00 49.12  ? 454 ILE B C     1 
ATOM   7604 O O     . ILE B 1 454 ? -6.178  9.542   -40.354 1.00 52.34  ? 454 ILE B O     1 
ATOM   7605 C CB    . ILE B 1 454 ? -3.610  8.755   -38.468 1.00 50.05  ? 454 ILE B CB    1 
ATOM   7606 C CG1   . ILE B 1 454 ? -2.985  8.684   -37.057 1.00 44.83  ? 454 ILE B CG1   1 
ATOM   7607 C CG2   . ILE B 1 454 ? -3.224  10.014  -39.243 1.00 41.05  ? 454 ILE B CG2   1 
ATOM   7608 C CD1   . ILE B 1 454 ? -3.293  9.862   -36.194 1.00 43.87  ? 454 ILE B CD1   1 
ATOM   7609 N N     . PHE B 1 455 ? -5.807  7.319   -40.375 1.00 50.44  ? 455 PHE B N     1 
ATOM   7610 C CA    . PHE B 1 455 ? -6.379  7.108   -41.709 1.00 46.99  ? 455 PHE B CA    1 
ATOM   7611 C C     . PHE B 1 455 ? -7.898  6.955   -41.709 1.00 49.02  ? 455 PHE B C     1 
ATOM   7612 O O     . PHE B 1 455 ? -8.486  6.859   -42.788 1.00 53.86  ? 455 PHE B O     1 
ATOM   7613 C CB    . PHE B 1 455 ? -5.760  5.873   -42.378 1.00 43.42  ? 455 PHE B CB    1 
ATOM   7614 C CG    . PHE B 1 455 ? -4.456  6.149   -43.075 1.00 44.46  ? 455 PHE B CG    1 
ATOM   7615 C CD1   . PHE B 1 455 ? -3.257  6.059   -42.396 1.00 44.21  ? 455 PHE B CD1   1 
ATOM   7616 C CD2   . PHE B 1 455 ? -4.430  6.500   -44.413 1.00 48.51  ? 455 PHE B CD2   1 
ATOM   7617 C CE1   . PHE B 1 455 ? -2.048  6.320   -43.029 1.00 41.85  ? 455 PHE B CE1   1 
ATOM   7618 C CE2   . PHE B 1 455 ? -3.220  6.765   -45.059 1.00 48.57  ? 455 PHE B CE2   1 
ATOM   7619 C CZ    . PHE B 1 455 ? -2.026  6.669   -44.357 1.00 46.29  ? 455 PHE B CZ    1 
ATOM   7620 N N     . GLY B 1 456 ? -8.540  6.890   -40.543 1.00 52.06  ? 456 GLY B N     1 
ATOM   7621 C CA    . GLY B 1 456 ? -9.988  6.923   -40.462 1.00 50.49  ? 456 GLY B CA    1 
ATOM   7622 C C     . GLY B 1 456 ? -10.705 5.606   -40.630 1.00 53.78  ? 456 GLY B C     1 
ATOM   7623 O O     . GLY B 1 456 ? -11.904 5.608   -40.925 1.00 54.71  ? 456 GLY B O     1 
ATOM   7624 N N     . LEU B 1 457 ? -10.022 4.481   -40.441 1.00 53.08  ? 457 LEU B N     1 
ATOM   7625 C CA    . LEU B 1 457 ? -10.680 3.192   -40.612 1.00 55.89  ? 457 LEU B CA    1 
ATOM   7626 C C     . LEU B 1 457 ? -11.915 3.001   -39.735 1.00 60.28  ? 457 LEU B C     1 
ATOM   7627 O O     . LEU B 1 457 ? -12.853 2.338   -40.206 1.00 63.47  ? 457 LEU B O     1 
ATOM   7628 C CB    . LEU B 1 457 ? -9.677  2.057   -40.370 1.00 55.02  ? 457 LEU B CB    1 
ATOM   7629 C CG    . LEU B 1 457 ? -8.992  1.569   -41.647 1.00 48.63  ? 457 LEU B CG    1 
ATOM   7630 C CD1   . LEU B 1 457 ? -8.214  2.675   -42.334 1.00 46.26  ? 457 LEU B CD1   1 
ATOM   7631 C CD2   . LEU B 1 457 ? -8.081  0.415   -41.323 1.00 47.45  ? 457 LEU B CD2   1 
ATOM   7632 N N     . PRO B 1 458 ? -11.991 3.514   -38.504 1.00 59.23  ? 458 PRO B N     1 
ATOM   7633 C CA    . PRO B 1 458 ? -13.250 3.388   -37.753 1.00 63.72  ? 458 PRO B CA    1 
ATOM   7634 C C     . PRO B 1 458 ? -14.481 3.919   -38.471 1.00 61.54  ? 458 PRO B C     1 
ATOM   7635 O O     . PRO B 1 458 ? -15.592 3.444   -38.204 1.00 63.21  ? 458 PRO B O     1 
ATOM   7636 C CB    . PRO B 1 458 ? -12.955 4.175   -36.472 1.00 60.83  ? 458 PRO B CB    1 
ATOM   7637 C CG    . PRO B 1 458 ? -11.513 3.923   -36.254 1.00 57.39  ? 458 PRO B CG    1 
ATOM   7638 C CD    . PRO B 1 458 ? -10.888 3.935   -37.619 1.00 55.46  ? 458 PRO B CD    1 
ATOM   7639 N N     . LEU B 1 459 ? -14.325 4.875   -39.382 1.00 56.43  ? 459 LEU B N     1 
ATOM   7640 C CA    . LEU B 1 459 ? -15.479 5.381   -40.115 1.00 63.79  ? 459 LEU B CA    1 
ATOM   7641 C C     . LEU B 1 459 ? -16.104 4.343   -41.056 1.00 70.23  ? 459 LEU B C     1 
ATOM   7642 O O     . LEU B 1 459 ? -17.209 4.569   -41.568 1.00 67.82  ? 459 LEU B O     1 
ATOM   7643 C CB    . LEU B 1 459 ? -15.080 6.629   -40.902 1.00 61.33  ? 459 LEU B CB    1 
ATOM   7644 C CG    . LEU B 1 459 ? -14.931 7.940   -40.134 1.00 60.26  ? 459 LEU B CG    1 
ATOM   7645 C CD1   . LEU B 1 459 ? -13.676 7.983   -39.289 1.00 58.91  ? 459 LEU B CD1   1 
ATOM   7646 C CD2   . LEU B 1 459 ? -14.902 9.051   -41.136 1.00 63.12  ? 459 LEU B CD2   1 
ATOM   7647 N N     . ASP B 1 460 ? -15.442 3.214   -41.299 1.00 68.43  ? 460 ASP B N     1 
ATOM   7648 C CA    . ASP B 1 460 ? -16.043 2.148   -42.084 1.00 68.42  ? 460 ASP B CA    1 
ATOM   7649 C C     . ASP B 1 460 ? -16.804 1.227   -41.146 1.00 72.47  ? 460 ASP B C     1 
ATOM   7650 O O     . ASP B 1 460 ? -16.172 0.468   -40.396 1.00 74.94  ? 460 ASP B O     1 
ATOM   7651 C CB    . ASP B 1 460 ? -14.982 1.374   -42.840 1.00 71.23  ? 460 ASP B CB    1 
ATOM   7652 C CG    . ASP B 1 460 ? -15.549 0.182   -43.576 1.00 75.06  ? 460 ASP B CG    1 
ATOM   7653 O OD1   . ASP B 1 460 ? -14.741 -0.586  -44.127 1.00 77.86  ? 460 ASP B OD1   1 
ATOM   7654 O OD2   . ASP B 1 460 ? -16.790 0.004   -43.605 1.00 76.56  ? 460 ASP B OD2   1 
ATOM   7655 N N     . PRO B 1 461 ? -18.139 1.220   -41.181 1.00 76.74  ? 461 PRO B N     1 
ATOM   7656 C CA    . PRO B 1 461 ? -18.894 0.477   -40.154 1.00 74.66  ? 461 PRO B CA    1 
ATOM   7657 C C     . PRO B 1 461 ? -18.519 -0.988  -40.075 1.00 76.83  ? 461 PRO B C     1 
ATOM   7658 O O     . PRO B 1 461 ? -18.483 -1.558  -38.975 1.00 80.46  ? 461 PRO B O     1 
ATOM   7659 C CB    . PRO B 1 461 ? -20.355 0.666   -40.591 1.00 73.66  ? 461 PRO B CB    1 
ATOM   7660 C CG    . PRO B 1 461 ? -20.341 1.902   -41.452 1.00 79.21  ? 461 PRO B CG    1 
ATOM   7661 C CD    . PRO B 1 461 ? -19.018 1.878   -42.161 1.00 76.44  ? 461 PRO B CD    1 
ATOM   7662 N N     . SER B 1 462 ? -18.199 -1.604  -41.212 1.00 74.15  ? 462 SER B N     1 
ATOM   7663 C CA    . SER B 1 462 ? -17.932 -3.036  -41.254 1.00 74.70  ? 462 SER B CA    1 
ATOM   7664 C C     . SER B 1 462 ? -16.781 -3.460  -40.355 1.00 72.82  ? 462 SER B C     1 
ATOM   7665 O O     . SER B 1 462 ? -16.624 -4.660  -40.109 1.00 76.97  ? 462 SER B O     1 
ATOM   7666 C CB    . SER B 1 462 ? -17.643 -3.461  -42.694 1.00 73.84  ? 462 SER B CB    1 
ATOM   7667 O OG    . SER B 1 462 ? -16.622 -2.658  -43.261 1.00 72.28  ? 462 SER B OG    1 
ATOM   7668 N N     . LEU B 1 463 ? -15.981 -2.522  -39.861 1.00 71.32  ? 463 LEU B N     1 
ATOM   7669 C CA    . LEU B 1 463 ? -14.806 -2.868  -39.080 1.00 69.58  ? 463 LEU B CA    1 
ATOM   7670 C C     . LEU B 1 463 ? -15.113 -3.064  -37.604 1.00 73.24  ? 463 LEU B C     1 
ATOM   7671 O O     . LEU B 1 463 ? -14.250 -3.565  -36.870 1.00 75.46  ? 463 LEU B O     1 
ATOM   7672 C CB    . LEU B 1 463 ? -13.734 -1.794  -39.276 1.00 69.62  ? 463 LEU B CB    1 
ATOM   7673 C CG    . LEU B 1 463 ? -13.431 -1.627  -40.769 1.00 70.35  ? 463 LEU B CG    1 
ATOM   7674 C CD1   . LEU B 1 463 ? -12.378 -0.575  -41.044 1.00 66.59  ? 463 LEU B CD1   1 
ATOM   7675 C CD2   . LEU B 1 463 ? -12.994 -2.952  -41.323 1.00 67.10  ? 463 LEU B CD2   1 
ATOM   7676 N N     . ASN B 1 464 ? -16.322 -2.698  -37.163 1.00 74.47  ? 464 ASN B N     1 
ATOM   7677 C CA    . ASN B 1 464 ? -16.804 -2.974  -35.804 1.00 73.63  ? 464 ASN B CA    1 
ATOM   7678 C C     . ASN B 1 464 ? -15.975 -2.234  -34.746 1.00 74.12  ? 464 ASN B C     1 
ATOM   7679 O O     . ASN B 1 464 ? -15.643 -2.784  -33.698 1.00 77.52  ? 464 ASN B O     1 
ATOM   7680 C CB    . ASN B 1 464 ? -16.850 -4.487  -35.518 1.00 71.00  ? 464 ASN B CB    1 
ATOM   7681 C CG    . ASN B 1 464 ? -17.651 -5.280  -36.582 1.00 82.59  ? 464 ASN B CG    1 
ATOM   7682 O OD1   . ASN B 1 464 ? -18.662 -4.799  -37.110 1.00 79.52  ? 464 ASN B OD1   1 
ATOM   7683 N ND2   . ASN B 1 464 ? -17.192 -6.499  -36.893 1.00 82.70  ? 464 ASN B ND2   1 
ATOM   7684 N N     . TYR B 1 465 ? -15.632 -0.974  -35.028 1.00 73.51  ? 465 TYR B N     1 
ATOM   7685 C CA    . TYR B 1 465 ? -15.137 -0.045  -34.021 1.00 62.57  ? 465 TYR B CA    1 
ATOM   7686 C C     . TYR B 1 465 ? -16.313 0.571   -33.276 1.00 62.87  ? 465 TYR B C     1 
ATOM   7687 O O     . TYR B 1 465 ? -17.432 0.621   -33.783 1.00 69.07  ? 465 TYR B O     1 
ATOM   7688 C CB    . TYR B 1 465 ? -14.319 1.082   -34.655 1.00 61.40  ? 465 TYR B CB    1 
ATOM   7689 C CG    . TYR B 1 465 ? -12.945 0.703   -35.139 1.00 60.76  ? 465 TYR B CG    1 
ATOM   7690 C CD1   . TYR B 1 465 ? -11.874 0.656   -34.263 1.00 58.41  ? 465 TYR B CD1   1 
ATOM   7691 C CD2   . TYR B 1 465 ? -12.713 0.418   -36.478 1.00 62.15  ? 465 TYR B CD2   1 
ATOM   7692 C CE1   . TYR B 1 465 ? -10.614 0.320   -34.699 1.00 56.94  ? 465 TYR B CE1   1 
ATOM   7693 C CE2   . TYR B 1 465 ? -11.458 0.096   -36.928 1.00 60.00  ? 465 TYR B CE2   1 
ATOM   7694 C CZ    . TYR B 1 465 ? -10.411 0.041   -36.033 1.00 59.12  ? 465 TYR B CZ    1 
ATOM   7695 O OH    . TYR B 1 465 ? -9.155  -0.294  -36.477 1.00 58.97  ? 465 TYR B OH    1 
ATOM   7696 N N     . THR B 1 466 ? -16.047 1.077   -32.075 1.00 63.50  ? 466 THR B N     1 
ATOM   7697 C CA    . THR B 1 466 ? -17.107 1.670   -31.275 1.00 60.44  ? 466 THR B CA    1 
ATOM   7698 C C     . THR B 1 466 ? -17.366 3.100   -31.722 1.00 64.53  ? 466 THR B C     1 
ATOM   7699 O O     . THR B 1 466 ? -16.592 3.685   -32.477 1.00 67.44  ? 466 THR B O     1 
ATOM   7700 C CB    . THR B 1 466 ? -16.742 1.653   -29.801 1.00 64.85  ? 466 THR B CB    1 
ATOM   7701 O OG1   . THR B 1 466 ? -15.896 2.775   -29.516 1.00 68.86  ? 466 THR B OG1   1 
ATOM   7702 C CG2   . THR B 1 466 ? -16.009 0.366   -29.471 1.00 57.88  ? 466 THR B CG2   1 
ATOM   7703 N N     . THR B 1 467 ? -18.465 3.680   -31.232 1.00 69.35  ? 467 THR B N     1 
ATOM   7704 C CA    . THR B 1 467 ? -18.832 5.016   -31.692 1.00 66.45  ? 467 THR B CA    1 
ATOM   7705 C C     . THR B 1 467 ? -17.806 6.049   -31.267 1.00 66.46  ? 467 THR B C     1 
ATOM   7706 O O     . THR B 1 467 ? -17.462 6.943   -32.045 1.00 64.75  ? 467 THR B O     1 
ATOM   7707 C CB    . THR B 1 467 ? -20.200 5.431   -31.169 1.00 65.15  ? 467 THR B CB    1 
ATOM   7708 O OG1   . THR B 1 467 ? -21.167 4.441   -31.521 1.00 73.51  ? 467 THR B OG1   1 
ATOM   7709 C CG2   . THR B 1 467 ? -20.606 6.751   -31.796 1.00 61.30  ? 467 THR B CG2   1 
ATOM   7710 N N     . GLU B 1 468 ? -17.320 5.959   -30.031 1.00 66.32  ? 468 GLU B N     1 
ATOM   7711 C CA    . GLU B 1 468 ? -16.325 6.935   -29.608 1.00 68.20  ? 468 GLU B CA    1 
ATOM   7712 C C     . GLU B 1 468 ? -15.039 6.779   -30.406 1.00 64.69  ? 468 GLU B C     1 
ATOM   7713 O O     . GLU B 1 468 ? -14.326 7.762   -30.620 1.00 63.59  ? 468 GLU B O     1 
ATOM   7714 C CB    . GLU B 1 468 ? -16.061 6.821   -28.101 1.00 67.82  ? 468 GLU B CB    1 
ATOM   7715 C CG    . GLU B 1 468 ? -17.295 6.513   -27.238 1.00 73.28  ? 468 GLU B CG    1 
ATOM   7716 C CD    . GLU B 1 468 ? -17.563 5.017   -27.115 1.00 86.12  ? 468 GLU B CD    1 
ATOM   7717 O OE1   . GLU B 1 468 ? -18.609 4.549   -27.592 1.00 86.46  ? 468 GLU B OE1   1 
ATOM   7718 O OE2   . GLU B 1 468 ? -16.733 4.311   -26.517 1.00 84.95  ? 468 GLU B OE2   1 
ATOM   7719 N N     . GLU B 1 469 ? -14.735 5.566   -30.872 1.00 61.75  ? 469 GLU B N     1 
ATOM   7720 C CA    . GLU B 1 469 ? -13.558 5.395   -31.715 1.00 58.10  ? 469 GLU B CA    1 
ATOM   7721 C C     . GLU B 1 469 ? -13.758 6.054   -33.075 1.00 58.86  ? 469 GLU B C     1 
ATOM   7722 O O     . GLU B 1 469 ? -12.831 6.654   -33.630 1.00 58.59  ? 469 GLU B O     1 
ATOM   7723 C CB    . GLU B 1 469 ? -13.234 3.914   -31.865 1.00 56.14  ? 469 GLU B CB    1 
ATOM   7724 C CG    . GLU B 1 469 ? -12.406 3.367   -30.737 1.00 55.39  ? 469 GLU B CG    1 
ATOM   7725 C CD    . GLU B 1 469 ? -12.410 1.857   -30.704 1.00 58.92  ? 469 GLU B CD    1 
ATOM   7726 O OE1   . GLU B 1 469 ? -13.449 1.268   -31.065 1.00 60.25  ? 469 GLU B OE1   1 
ATOM   7727 O OE2   . GLU B 1 469 ? -11.377 1.255   -30.334 1.00 56.71  ? 469 GLU B OE2   1 
ATOM   7728 N N     . ARG B 1 470 ? -14.967 5.970   -33.621 1.00 59.28  ? 470 ARG B N     1 
ATOM   7729 C CA    . ARG B 1 470 ? -15.259 6.682   -34.856 1.00 56.68  ? 470 ARG B CA    1 
ATOM   7730 C C     . ARG B 1 470 ? -15.152 8.190   -34.643 1.00 59.43  ? 470 ARG B C     1 
ATOM   7731 O O     . ARG B 1 470 ? -14.580 8.908   -35.473 1.00 57.27  ? 470 ARG B O     1 
ATOM   7732 C CB    . ARG B 1 470 ? -16.647 6.274   -35.349 1.00 59.32  ? 470 ARG B CB    1 
ATOM   7733 C CG    . ARG B 1 470 ? -16.920 6.542   -36.807 1.00 66.94  ? 470 ARG B CG    1 
ATOM   7734 C CD    . ARG B 1 470 ? -17.816 7.758   -36.987 1.00 67.47  ? 470 ARG B CD    1 
ATOM   7735 N NE    . ARG B 1 470 ? -19.020 7.666   -36.165 1.00 77.49  ? 470 ARG B NE    1 
ATOM   7736 C CZ    . ARG B 1 470 ? -19.857 8.679   -35.932 1.00 77.87  ? 470 ARG B CZ    1 
ATOM   7737 N NH1   . ARG B 1 470 ? -19.625 9.876   -36.456 1.00 74.60  ? 470 ARG B NH1   1 
ATOM   7738 N NH2   . ARG B 1 470 ? -20.924 8.495   -35.163 1.00 72.00  ? 470 ARG B NH2   1 
ATOM   7739 N N     . ILE B 1 471 ? -15.661 8.682   -33.507 1.00 65.01  ? 471 ILE B N     1 
ATOM   7740 C CA    . ILE B 1 471 ? -15.567 10.107  -33.177 1.00 63.47  ? 471 ILE B CA    1 
ATOM   7741 C C     . ILE B 1 471 ? -14.107 10.516  -32.977 1.00 59.56  ? 471 ILE B C     1 
ATOM   7742 O O     . ILE B 1 471 ? -13.668 11.575  -33.454 1.00 56.67  ? 471 ILE B O     1 
ATOM   7743 C CB    . ILE B 1 471 ? -16.428 10.423  -31.932 1.00 61.70  ? 471 ILE B CB    1 
ATOM   7744 C CG1   . ILE B 1 471 ? -17.887 10.044  -32.170 1.00 63.23  ? 471 ILE B CG1   1 
ATOM   7745 C CG2   . ILE B 1 471 ? -16.375 11.893  -31.591 1.00 54.10  ? 471 ILE B CG2   1 
ATOM   7746 C CD1   . ILE B 1 471 ? -18.420 10.576  -33.477 1.00 69.31  ? 471 ILE B CD1   1 
ATOM   7747 N N     . PHE B 1 472 ? -13.340 9.683   -32.264 1.00 52.36  ? 472 PHE B N     1 
ATOM   7748 C CA    . PHE B 1 472 ? -11.903 9.877   -32.112 1.00 50.17  ? 472 PHE B CA    1 
ATOM   7749 C C     . PHE B 1 472 ? -11.233 10.029  -33.471 1.00 53.86  ? 472 PHE B C     1 
ATOM   7750 O O     . PHE B 1 472 ? -10.633 11.067  -33.782 1.00 50.99  ? 472 PHE B O     1 
ATOM   7751 C CB    . PHE B 1 472 ? -11.324 8.683   -31.351 1.00 52.21  ? 472 PHE B CB    1 
ATOM   7752 C CG    . PHE B 1 472 ? -9.911  8.865   -30.891 1.00 47.30  ? 472 PHE B CG    1 
ATOM   7753 C CD1   . PHE B 1 472 ? -9.438  10.104  -30.531 1.00 45.15  ? 472 PHE B CD1   1 
ATOM   7754 C CD2   . PHE B 1 472 ? -9.058  7.778   -30.812 1.00 48.75  ? 472 PHE B CD2   1 
ATOM   7755 C CE1   . PHE B 1 472 ? -8.137  10.261  -30.112 1.00 45.16  ? 472 PHE B CE1   1 
ATOM   7756 C CE2   . PHE B 1 472 ? -7.758  7.930   -30.391 1.00 48.40  ? 472 PHE B CE2   1 
ATOM   7757 C CZ    . PHE B 1 472 ? -7.299  9.176   -30.035 1.00 46.05  ? 472 PHE B CZ    1 
ATOM   7758 N N     . ALA B 1 473 ? -11.360 8.999   -34.307 1.00 56.66  ? 473 ALA B N     1 
ATOM   7759 C CA    . ALA B 1 473 ? -10.778 8.987   -35.642 1.00 52.28  ? 473 ALA B CA    1 
ATOM   7760 C C     . ALA B 1 473 ? -11.031 10.304  -36.364 1.00 51.63  ? 473 ALA B C     1 
ATOM   7761 O O     . ALA B 1 473 ? -10.120 10.856  -36.993 1.00 51.98  ? 473 ALA B O     1 
ATOM   7762 C CB    . ALA B 1 473 ? -11.331 7.809   -36.438 1.00 52.25  ? 473 ALA B CB    1 
ATOM   7763 N N     . GLN B 1 474 ? -12.244 10.845  -36.242 1.00 49.64  ? 474 GLN B N     1 
ATOM   7764 C CA    . GLN B 1 474 ? -12.533 12.108  -36.914 1.00 51.06  ? 474 GLN B CA    1 
ATOM   7765 C C     . GLN B 1 474 ? -11.711 13.248  -36.333 1.00 50.97  ? 474 GLN B C     1 
ATOM   7766 O O     . GLN B 1 474 ? -11.244 14.118  -37.075 1.00 54.04  ? 474 GLN B O     1 
ATOM   7767 C CB    . GLN B 1 474 ? -14.024 12.423  -36.836 1.00 56.16  ? 474 GLN B CB    1 
ATOM   7768 C CG    . GLN B 1 474 ? -14.899 11.443  -37.615 1.00 63.98  ? 474 GLN B CG    1 
ATOM   7769 C CD    . GLN B 1 474 ? -16.376 11.774  -37.539 1.00 67.00  ? 474 GLN B CD    1 
ATOM   7770 O OE1   . GLN B 1 474 ? -17.200 10.906  -37.256 1.00 68.19  ? 474 GLN B OE1   1 
ATOM   7771 N NE2   . GLN B 1 474 ? -16.720 13.035  -37.796 1.00 71.15  ? 474 GLN B NE2   1 
ATOM   7772 N N     . ARG B 1 475 ? -11.515 13.265  -35.011 1.00 50.44  ? 475 ARG B N     1 
ATOM   7773 C CA    . ARG B 1 475 ? -10.675 14.297  -34.415 1.00 48.74  ? 475 ARG B CA    1 
ATOM   7774 C C     . ARG B 1 475 ? -9.263  14.229  -34.975 1.00 49.09  ? 475 ARG B C     1 
ATOM   7775 O O     . ARG B 1 475 ? -8.690  15.248  -35.377 1.00 50.21  ? 475 ARG B O     1 
ATOM   7776 C CB    . ARG B 1 475 ? -10.650 14.161  -32.887 1.00 51.68  ? 475 ARG B CB    1 
ATOM   7777 C CG    . ARG B 1 475 ? -11.930 14.569  -32.155 1.00 53.71  ? 475 ARG B CG    1 
ATOM   7778 C CD    . ARG B 1 475 ? -11.840 14.208  -30.677 1.00 50.53  ? 475 ARG B CD    1 
ATOM   7779 N NE    . ARG B 1 475 ? -10.593 14.719  -30.120 1.00 53.71  ? 475 ARG B NE    1 
ATOM   7780 C CZ    . ARG B 1 475 ? -9.924  14.160  -29.116 1.00 45.80  ? 475 ARG B CZ    1 
ATOM   7781 N NH1   . ARG B 1 475 ? -10.374 13.052  -28.542 1.00 43.29  ? 475 ARG B NH1   1 
ATOM   7782 N NH2   . ARG B 1 475 ? -8.791  14.709  -28.703 1.00 46.70  ? 475 ARG B NH2   1 
ATOM   7783 N N     . LEU B 1 476 ? -8.687  13.030  -35.025 1.00 48.06  ? 476 LEU B N     1 
ATOM   7784 C CA    . LEU B 1 476 ? -7.310  12.912  -35.493 1.00 49.92  ? 476 LEU B CA    1 
ATOM   7785 C C     . LEU B 1 476 ? -7.188  13.231  -36.974 1.00 48.12  ? 476 LEU B C     1 
ATOM   7786 O O     . LEU B 1 476 ? -6.202  13.842  -37.403 1.00 49.81  ? 476 LEU B O     1 
ATOM   7787 C CB    . LEU B 1 476 ? -6.773  11.520  -35.200 1.00 50.95  ? 476 LEU B CB    1 
ATOM   7788 C CG    . LEU B 1 476 ? -6.938  11.169  -33.726 1.00 50.19  ? 476 LEU B CG    1 
ATOM   7789 C CD1   . LEU B 1 476 ? -7.732  9.895   -33.608 1.00 48.57  ? 476 LEU B CD1   1 
ATOM   7790 C CD2   . LEU B 1 476 ? -5.585  11.048  -33.063 1.00 47.55  ? 476 LEU B CD2   1 
ATOM   7791 N N     . MET B 1 477 ? -8.164  12.820  -37.777 1.00 47.91  ? 477 MET B N     1 
ATOM   7792 C CA    . MET B 1 477 ? -8.126  13.197  -39.184 1.00 51.14  ? 477 MET B CA    1 
ATOM   7793 C C     . MET B 1 477 ? -8.148  14.713  -39.330 1.00 54.03  ? 477 MET B C     1 
ATOM   7794 O O     . MET B 1 477 ? -7.457  15.274  -40.193 1.00 51.46  ? 477 MET B O     1 
ATOM   7795 C CB    . MET B 1 477 ? -9.289  12.551  -39.936 1.00 53.23  ? 477 MET B CB    1 
ATOM   7796 C CG    . MET B 1 477 ? -9.151  11.038  -40.094 1.00 54.75  ? 477 MET B CG    1 
ATOM   7797 S SD    . MET B 1 477 ? -10.563 10.241  -40.902 1.00 64.74  ? 477 MET B SD    1 
ATOM   7798 C CE    . MET B 1 477 ? -10.826 11.331  -42.269 1.00 48.67  ? 477 MET B CE    1 
ATOM   7799 N N     . LYS B 1 478 ? -8.916  15.394  -38.469 1.00 51.62  ? 478 LYS B N     1 
ATOM   7800 C CA    . LYS B 1 478 ? -8.897  16.852  -38.449 1.00 51.13  ? 478 LYS B CA    1 
ATOM   7801 C C     . LYS B 1 478 ? -7.535  17.386  -38.026 1.00 48.63  ? 478 LYS B C     1 
ATOM   7802 O O     . LYS B 1 478 ? -7.048  18.359  -38.600 1.00 50.29  ? 478 LYS B O     1 
ATOM   7803 C CB    . LYS B 1 478 ? -9.979  17.379  -37.512 1.00 51.61  ? 478 LYS B CB    1 
ATOM   7804 C CG    . LYS B 1 478 ? -11.257 17.795  -38.173 1.00 52.17  ? 478 LYS B CG    1 
ATOM   7805 C CD    . LYS B 1 478 ? -11.239 19.264  -38.538 1.00 61.62  ? 478 LYS B CD    1 
ATOM   7806 C CE    . LYS B 1 478 ? -12.519 19.640  -39.294 1.00 69.42  ? 478 LYS B CE    1 
ATOM   7807 N NZ    . LYS B 1 478 ? -12.706 18.841  -40.553 1.00 56.29  ? 478 LYS B NZ    1 
ATOM   7808 N N     . TYR B 1 479 ? -6.917  16.788  -37.006 1.00 48.26  ? 479 TYR B N     1 
ATOM   7809 C CA    . TYR B 1 479 ? -5.630  17.290  -36.534 1.00 46.76  ? 479 TYR B CA    1 
ATOM   7810 C C     . TYR B 1 479 ? -4.591  17.192  -37.629 1.00 44.85  ? 479 TYR B C     1 
ATOM   7811 O O     . TYR B 1 479 ? -3.849  18.147  -37.891 1.00 44.46  ? 479 TYR B O     1 
ATOM   7812 C CB    . TYR B 1 479 ? -5.153  16.504  -35.304 1.00 50.49  ? 479 TYR B CB    1 
ATOM   7813 C CG    . TYR B 1 479 ? -5.905  16.793  -34.026 1.00 49.68  ? 479 TYR B CG    1 
ATOM   7814 C CD1   . TYR B 1 479 ? -6.236  18.092  -33.673 1.00 51.62  ? 479 TYR B CD1   1 
ATOM   7815 C CD2   . TYR B 1 479 ? -6.294  15.766  -33.180 1.00 47.50  ? 479 TYR B CD2   1 
ATOM   7816 C CE1   . TYR B 1 479 ? -6.933  18.358  -32.516 1.00 50.04  ? 479 TYR B CE1   1 
ATOM   7817 C CE2   . TYR B 1 479 ? -6.992  16.022  -32.025 1.00 47.35  ? 479 TYR B CE2   1 
ATOM   7818 C CZ    . TYR B 1 479 ? -7.309  17.319  -31.696 1.00 50.40  ? 479 TYR B CZ    1 
ATOM   7819 O OH    . TYR B 1 479 ? -8.005  17.590  -30.537 1.00 56.08  ? 479 TYR B OH    1 
ATOM   7820 N N     . TRP B 1 480 ? -4.525  16.030  -38.280 1.00 47.09  ? 480 TRP B N     1 
ATOM   7821 C CA    . TRP B 1 480 ? -3.488  15.785  -39.275 1.00 43.13  ? 480 TRP B CA    1 
ATOM   7822 C C     . TRP B 1 480 ? -3.702  16.658  -40.505 1.00 42.78  ? 480 TRP B C     1 
ATOM   7823 O O     . TRP B 1 480 ? -2.774  17.331  -40.967 1.00 44.21  ? 480 TRP B O     1 
ATOM   7824 C CB    . TRP B 1 480 ? -3.455  14.298  -39.629 1.00 40.15  ? 480 TRP B CB    1 
ATOM   7825 C CG    . TRP B 1 480 ? -2.372  13.499  -38.937 1.00 41.92  ? 480 TRP B CG    1 
ATOM   7826 C CD1   . TRP B 1 480 ? -1.338  12.845  -39.532 1.00 42.31  ? 480 TRP B CD1   1 
ATOM   7827 C CD2   . TRP B 1 480 ? -2.218  13.280  -37.528 1.00 46.03  ? 480 TRP B CD2   1 
ATOM   7828 N NE1   . TRP B 1 480 ? -0.552  12.224  -38.593 1.00 42.11  ? 480 TRP B NE1   1 
ATOM   7829 C CE2   . TRP B 1 480 ? -1.069  12.477  -37.352 1.00 46.90  ? 480 TRP B CE2   1 
ATOM   7830 C CE3   . TRP B 1 480 ? -2.932  13.689  -36.399 1.00 45.18  ? 480 TRP B CE3   1 
ATOM   7831 C CZ2   . TRP B 1 480 ? -0.625  12.072  -36.094 1.00 43.52  ? 480 TRP B CZ2   1 
ATOM   7832 C CZ3   . TRP B 1 480 ? -2.491  13.286  -35.154 1.00 45.40  ? 480 TRP B CZ3   1 
ATOM   7833 C CH2   . TRP B 1 480 ? -1.346  12.490  -35.011 1.00 44.30  ? 480 TRP B CH2   1 
ATOM   7834 N N     . THR B 1 481 ? -4.932  16.715  -41.012 1.00 42.38  ? 481 THR B N     1 
ATOM   7835 C CA    . THR B 1 481 ? -5.185  17.539  -42.186 1.00 43.42  ? 481 THR B CA    1 
ATOM   7836 C C     . THR B 1 481 ? -4.975  19.017  -41.883 1.00 46.66  ? 481 THR B C     1 
ATOM   7837 O O     . THR B 1 481 ? -4.297  19.713  -42.641 1.00 47.34  ? 481 THR B O     1 
ATOM   7838 C CB    . THR B 1 481 ? -6.592  17.290  -42.708 1.00 50.16  ? 481 THR B CB    1 
ATOM   7839 O OG1   . THR B 1 481 ? -7.522  17.470  -41.639 1.00 55.58  ? 481 THR B OG1   1 
ATOM   7840 C CG2   . THR B 1 481 ? -6.709  15.874  -43.253 1.00 46.94  ? 481 THR B CG2   1 
ATOM   7841 N N     . ASN B 1 482 ? -5.551  19.513  -40.778 1.00 50.68  ? 482 ASN B N     1 
ATOM   7842 C CA    . ASN B 1 482 ? -5.314  20.898  -40.352 1.00 50.34  ? 482 ASN B CA    1 
ATOM   7843 C C     . ASN B 1 482 ? -3.830  21.216  -40.302 1.00 44.46  ? 482 ASN B C     1 
ATOM   7844 O O     . ASN B 1 482 ? -3.400  22.286  -40.743 1.00 44.23  ? 482 ASN B O     1 
ATOM   7845 C CB    . ASN B 1 482 ? -5.939  21.175  -38.978 1.00 45.47  ? 482 ASN B CB    1 
ATOM   7846 C CG    . ASN B 1 482 ? -7.428  21.473  -39.053 1.00 51.95  ? 482 ASN B CG    1 
ATOM   7847 O OD1   . ASN B 1 482 ? -7.902  22.102  -39.990 1.00 58.26  ? 482 ASN B OD1   1 
ATOM   7848 N ND2   . ASN B 1 482 ? -8.173  21.010  -38.064 1.00 58.89  ? 482 ASN B ND2   1 
ATOM   7849 N N     . PHE B 1 483 ? -3.030  20.307  -39.759 1.00 43.36  ? 483 PHE B N     1 
ATOM   7850 C CA    . PHE B 1 483 ? -1.596  20.544  -39.783 1.00 45.68  ? 483 PHE B CA    1 
ATOM   7851 C C     . PHE B 1 483 ? -1.067  20.603  -41.219 1.00 45.41  ? 483 PHE B C     1 
ATOM   7852 O O     . PHE B 1 483 ? -0.130  21.359  -41.511 1.00 42.64  ? 483 PHE B O     1 
ATOM   7853 C CB    . PHE B 1 483 ? -0.873  19.473  -38.972 1.00 39.93  ? 483 PHE B CB    1 
ATOM   7854 C CG    . PHE B 1 483 ? 0.605   19.624  -39.001 1.00 42.60  ? 483 PHE B CG    1 
ATOM   7855 C CD1   . PHE B 1 483 ? 1.228   20.570  -38.211 1.00 43.75  ? 483 PHE B CD1   1 
ATOM   7856 C CD2   . PHE B 1 483 ? 1.377   18.852  -39.856 1.00 44.28  ? 483 PHE B CD2   1 
ATOM   7857 C CE1   . PHE B 1 483 ? 2.604   20.729  -38.247 1.00 47.30  ? 483 PHE B CE1   1 
ATOM   7858 C CE2   . PHE B 1 483 ? 2.754   19.007  -39.906 1.00 44.47  ? 483 PHE B CE2   1 
ATOM   7859 C CZ    . PHE B 1 483 ? 3.369   19.947  -39.096 1.00 48.00  ? 483 PHE B CZ    1 
ATOM   7860 N N     . ALA B 1 484 ? -1.672  19.843  -42.135 1.00 46.03  ? 484 ALA B N     1 
ATOM   7861 C CA    . ALA B 1 484 ? -1.231  19.884  -43.531 1.00 45.68  ? 484 ALA B CA    1 
ATOM   7862 C C     . ALA B 1 484 ? -1.615  21.200  -44.209 1.00 42.54  ? 484 ALA B C     1 
ATOM   7863 O O     . ALA B 1 484 ? -0.804  21.777  -44.942 1.00 43.10  ? 484 ALA B O     1 
ATOM   7864 C CB    . ALA B 1 484 ? -1.793  18.687  -44.293 1.00 39.40  ? 484 ALA B CB    1 
ATOM   7865 N N     . ARG B 1 485 ? -2.829  21.710  -43.958 1.00 42.76  ? 485 ARG B N     1 
ATOM   7866 C CA    . ARG B 1 485 ? -3.216  22.985  -44.560 1.00 46.58  ? 485 ARG B CA    1 
ATOM   7867 C C     . ARG B 1 485 ? -2.456  24.156  -43.970 1.00 48.23  ? 485 ARG B C     1 
ATOM   7868 O O     . ARG B 1 485 ? -2.228  25.150  -44.667 1.00 53.73  ? 485 ARG B O     1 
ATOM   7869 C CB    . ARG B 1 485 ? -4.702  23.286  -44.386 1.00 44.13  ? 485 ARG B CB    1 
ATOM   7870 C CG    . ARG B 1 485 ? -5.584  22.097  -44.235 1.00 51.38  ? 485 ARG B CG    1 
ATOM   7871 C CD    . ARG B 1 485 ? -7.067  22.459  -44.325 1.00 51.21  ? 485 ARG B CD    1 
ATOM   7872 N NE    . ARG B 1 485 ? -7.852  21.544  -43.519 1.00 59.38  ? 485 ARG B NE    1 
ATOM   7873 C CZ    . ARG B 1 485 ? -8.412  20.444  -44.015 1.00 60.92  ? 485 ARG B CZ    1 
ATOM   7874 N NH1   . ARG B 1 485 ? -8.262  20.148  -45.300 1.00 60.81  ? 485 ARG B NH1   1 
ATOM   7875 N NH2   . ARG B 1 485 ? -9.110  19.623  -43.235 1.00 60.05  ? 485 ARG B NH2   1 
ATOM   7876 N N     . THR B 1 486 ? -2.105  24.097  -42.689 1.00 46.96  ? 486 THR B N     1 
ATOM   7877 C CA    . THR B 1 486 ? -1.692  25.321  -42.003 1.00 46.44  ? 486 THR B CA    1 
ATOM   7878 C C     . THR B 1 486 ? -0.424  25.224  -41.163 1.00 48.00  ? 486 THR B C     1 
ATOM   7879 O O     . THR B 1 486 ? 0.008   26.257  -40.647 1.00 48.99  ? 486 THR B O     1 
ATOM   7880 C CB    . THR B 1 486 ? -2.823  25.816  -41.088 1.00 46.89  ? 486 THR B CB    1 
ATOM   7881 O OG1   . THR B 1 486 ? -3.108  24.822  -40.091 1.00 47.49  ? 486 THR B OG1   1 
ATOM   7882 C CG2   . THR B 1 486 ? -4.087  26.111  -41.884 1.00 42.14  ? 486 THR B CG2   1 
ATOM   7883 N N     . GLY B 1 487 ? 0.189   24.053  -40.997 1.00 47.74  ? 487 GLY B N     1 
ATOM   7884 C CA    . GLY B 1 487 ? 1.250   23.935  -40.016 1.00 45.87  ? 487 GLY B CA    1 
ATOM   7885 C C     . GLY B 1 487 ? 0.780   24.017  -38.584 1.00 48.28  ? 487 GLY B C     1 
ATOM   7886 O O     . GLY B 1 487 ? 1.602   24.208  -37.684 1.00 52.42  ? 487 GLY B O     1 
ATOM   7887 N N     . ASP B 1 488 ? -0.514  23.886  -38.344 1.00 44.66  ? 488 ASP B N     1 
ATOM   7888 C CA    . ASP B 1 488 ? -1.051  24.014  -37.006 1.00 44.69  ? 488 ASP B CA    1 
ATOM   7889 C C     . ASP B 1 488 ? -2.224  23.061  -36.863 1.00 46.61  ? 488 ASP B C     1 
ATOM   7890 O O     . ASP B 1 488 ? -3.234  23.216  -37.559 1.00 47.70  ? 488 ASP B O     1 
ATOM   7891 C CB    . ASP B 1 488 ? -1.477  25.458  -36.755 1.00 50.40  ? 488 ASP B CB    1 
ATOM   7892 C CG    . ASP B 1 488 ? -1.963  25.701  -35.336 1.00 49.38  ? 488 ASP B CG    1 
ATOM   7893 O OD1   . ASP B 1 488 ? -2.393  24.741  -34.659 1.00 50.59  ? 488 ASP B OD1   1 
ATOM   7894 O OD2   . ASP B 1 488 ? -1.941  26.877  -34.911 1.00 50.89  ? 488 ASP B OD2   1 
ATOM   7895 N N     . PRO B 1 489 ? -2.139  22.086  -35.953 1.00 44.42  ? 489 PRO B N     1 
ATOM   7896 C CA    . PRO B 1 489 ? -3.194  21.071  -35.849 1.00 44.91  ? 489 PRO B CA    1 
ATOM   7897 C C     . PRO B 1 489 ? -4.498  21.566  -35.256 1.00 47.20  ? 489 PRO B C     1 
ATOM   7898 O O     . PRO B 1 489 ? -5.476  20.814  -35.303 1.00 52.05  ? 489 PRO B O     1 
ATOM   7899 C CB    . PRO B 1 489 ? -2.563  20.009  -34.948 1.00 43.90  ? 489 PRO B CB    1 
ATOM   7900 C CG    . PRO B 1 489 ? -1.617  20.780  -34.109 1.00 46.42  ? 489 PRO B CG    1 
ATOM   7901 C CD    . PRO B 1 489 ? -1.025  21.802  -35.041 1.00 46.19  ? 489 PRO B CD    1 
ATOM   7902 N N     . ASN B 1 490 ? -4.565  22.780  -34.715 1.00 46.91  ? 490 ASN B N     1 
ATOM   7903 C CA    . ASN B 1 490 ? -5.799  23.252  -34.097 1.00 51.88  ? 490 ASN B CA    1 
ATOM   7904 C C     . ASN B 1 490 ? -6.814  23.705  -35.142 1.00 58.13  ? 490 ASN B C     1 
ATOM   7905 O O     . ASN B 1 490 ? -6.455  24.265  -36.180 1.00 62.26  ? 490 ASN B O     1 
ATOM   7906 C CB    . ASN B 1 490 ? -5.510  24.399  -33.130 1.00 50.68  ? 490 ASN B CB    1 
ATOM   7907 C CG    . ASN B 1 490 ? -4.588  23.986  -32.002 1.00 53.60  ? 490 ASN B CG    1 
ATOM   7908 O OD1   . ASN B 1 490 ? -5.022  23.362  -31.028 1.00 52.04  ? 490 ASN B OD1   1 
ATOM   7909 N ND2   . ASN B 1 490 ? -3.304  24.332  -32.123 1.00 51.85  ? 490 ASN B ND2   1 
ATOM   7910 N N     . ASP B 1 491 ? -8.096  23.478  -34.842 1.00 64.24  ? 491 ASP B N     1 
ATOM   7911 C CA    . ASP B 1 491 ? -9.201  23.826  -35.747 1.00 69.57  ? 491 ASP B CA    1 
ATOM   7912 C C     . ASP B 1 491 ? -9.427  25.337  -35.770 1.00 74.98  ? 491 ASP B C     1 
ATOM   7913 O O     . ASP B 1 491 ? -9.806  25.906  -34.738 1.00 79.13  ? 491 ASP B O     1 
ATOM   7914 C CB    . ASP B 1 491 ? -10.471 23.102  -35.289 1.00 75.47  ? 491 ASP B CB    1 
ATOM   7915 C CG    . ASP B 1 491 ? -11.427 22.772  -36.435 1.00 77.79  ? 491 ASP B CG    1 
ATOM   7916 O OD1   . ASP B 1 491 ? -11.192 23.223  -37.574 1.00 77.06  ? 491 ASP B OD1   1 
ATOM   7917 O OD2   . ASP B 1 491 ? -12.433 22.068  -36.184 1.00 76.34  ? 491 ASP B OD2   1 
ATOM   7918 N N     . PRO B 1 492 ? -9.249  26.022  -36.911 1.00 85.12  ? 492 PRO B N     1 
ATOM   7919 C CA    . PRO B 1 492 ? -9.353  27.496  -36.919 1.00 85.38  ? 492 PRO B CA    1 
ATOM   7920 C C     . PRO B 1 492 ? -10.768 28.010  -36.705 1.00 88.05  ? 492 PRO B C     1 
ATOM   7921 O O     . PRO B 1 492 ? -10.970 29.233  -36.683 1.00 84.02  ? 492 PRO B O     1 
ATOM   7922 C CB    . PRO B 1 492 ? -8.841  27.877  -38.321 1.00 79.05  ? 492 PRO B CB    1 
ATOM   7923 C CG    . PRO B 1 492 ? -9.251  26.704  -39.174 1.00 75.89  ? 492 PRO B CG    1 
ATOM   7924 C CD    . PRO B 1 492 ? -9.128  25.474  -38.281 1.00 79.21  ? 492 PRO B CD    1 
ATOM   7925 N N     . ARG B 1 493 ? -11.743 27.107  -36.583 1.00 86.58  ? 493 ARG B N     1 
ATOM   7926 C CA    . ARG B 1 493 ? -13.122 27.427  -36.249 1.00 89.25  ? 493 ARG B CA    1 
ATOM   7927 C C     . ARG B 1 493 ? -13.496 26.993  -34.845 1.00 88.67  ? 493 ARG B C     1 
ATOM   7928 O O     . ARG B 1 493 ? -14.332 27.639  -34.207 1.00 89.06  ? 493 ARG B O     1 
ATOM   7929 C CB    . ARG B 1 493 ? -14.081 26.758  -37.245 1.00 90.14  ? 493 ARG B CB    1 
ATOM   7930 N N     . ASP B 1 494 ? -12.896 25.911  -34.361 1.00 86.30  ? 494 ASP B N     1 
ATOM   7931 C CA    . ASP B 1 494 ? -13.091 25.468  -32.991 1.00 85.25  ? 494 ASP B CA    1 
ATOM   7932 C C     . ASP B 1 494 ? -12.312 26.390  -32.062 1.00 87.75  ? 494 ASP B C     1 
ATOM   7933 O O     . ASP B 1 494 ? -11.095 26.555  -32.214 1.00 88.86  ? 494 ASP B O     1 
ATOM   7934 C CB    . ASP B 1 494 ? -12.630 24.020  -32.832 1.00 83.14  ? 494 ASP B CB    1 
ATOM   7935 C CG    . ASP B 1 494 ? -13.180 23.361  -31.579 1.00 91.18  ? 494 ASP B CG    1 
ATOM   7936 O OD1   . ASP B 1 494 ? -14.239 22.698  -31.686 1.00 90.41  ? 494 ASP B OD1   1 
ATOM   7937 O OD2   . ASP B 1 494 ? -12.557 23.501  -30.496 1.00 89.78  ? 494 ASP B OD2   1 
ATOM   7938 N N     . SER B 1 495 ? -13.016 27.008  -31.115 1.00 82.69  ? 495 SER B N     1 
ATOM   7939 C CA    . SER B 1 495 ? -12.359 27.776  -30.064 1.00 83.31  ? 495 SER B CA    1 
ATOM   7940 C C     . SER B 1 495 ? -11.912 26.831  -28.944 1.00 87.29  ? 495 SER B C     1 
ATOM   7941 O O     . SER B 1 495 ? -11.171 25.867  -29.199 1.00 87.77  ? 495 SER B O     1 
ATOM   7942 C CB    . SER B 1 495 ? -13.302 28.862  -29.526 1.00 76.82  ? 495 SER B CB    1 
ATOM   7943 O OG    . SER B 1 495 ? -13.970 29.526  -30.590 1.00 71.62  ? 495 SER B OG    1 
ATOM   7944 N N     . LYS B 1 496 ? -12.360 27.100  -27.708 1.00 77.85  ? 496 LYS B N     1 
ATOM   7945 C CA    . LYS B 1 496 ? -12.209 26.193  -26.565 1.00 79.94  ? 496 LYS B CA    1 
ATOM   7946 C C     . LYS B 1 496 ? -10.772 26.039  -26.067 1.00 79.62  ? 496 LYS B C     1 
ATOM   7947 O O     . LYS B 1 496 ? -9.849  25.795  -26.855 1.00 77.07  ? 496 LYS B O     1 
ATOM   7948 C CB    . LYS B 1 496 ? -12.803 24.801  -26.867 1.00 78.05  ? 496 LYS B CB    1 
ATOM   7949 C CG    . LYS B 1 496 ? -14.206 24.848  -27.483 1.00 79.65  ? 496 LYS B CG    1 
ATOM   7950 C CD    . LYS B 1 496 ? -15.277 25.387  -26.520 1.00 79.00  ? 496 LYS B CD    1 
ATOM   7951 C CE    . LYS B 1 496 ? -16.394 26.045  -27.299 1.00 83.01  ? 496 LYS B CE    1 
ATOM   7952 N NZ    . LYS B 1 496 ? -15.859 26.619  -28.555 1.00 83.86  ? 496 LYS B NZ    1 
ATOM   7953 N N     . SER B 1 497 ? -10.611 26.097  -24.733 1.00 75.82  ? 497 SER B N     1 
ATOM   7954 C CA    . SER B 1 497 ? -9.292  26.183  -24.102 1.00 69.38  ? 497 SER B CA    1 
ATOM   7955 C C     . SER B 1 497 ? -8.315  25.049  -24.431 1.00 81.38  ? 497 SER B C     1 
ATOM   7956 O O     . SER B 1 497 ? -7.141  25.355  -24.726 1.00 79.08  ? 497 SER B O     1 
ATOM   7957 C CB    . SER B 1 497 ? -9.474  26.297  -22.590 1.00 68.67  ? 497 SER B CB    1 
ATOM   7958 O OG    . SER B 1 497 ? -8.267  25.977  -21.908 1.00 72.57  ? 497 SER B OG    1 
ATOM   7959 N N     . PRO B 1 498 ? -8.681  23.723  -24.349 1.00 81.05  ? 498 PRO B N     1 
ATOM   7960 C CA    . PRO B 1 498 ? -7.704  22.704  -24.751 1.00 71.86  ? 498 PRO B CA    1 
ATOM   7961 C C     . PRO B 1 498 ? -7.274  22.943  -26.193 1.00 65.66  ? 498 PRO B C     1 
ATOM   7962 O O     . PRO B 1 498 ? -7.883  22.423  -27.127 1.00 64.35  ? 498 PRO B O     1 
ATOM   7963 C CB    . PRO B 1 498 ? -8.469  21.386  -24.580 1.00 66.56  ? 498 PRO B CB    1 
ATOM   7964 C CG    . PRO B 1 498 ? -9.883  21.766  -24.823 1.00 73.94  ? 498 PRO B CG    1 
ATOM   7965 C CD    . PRO B 1 498 ? -9.998  23.106  -24.100 1.00 79.46  ? 498 PRO B CD    1 
ATOM   7966 N N     . GLN B 1 499 ? -6.274  23.806  -26.366 1.00 61.85  ? 499 GLN B N     1 
ATOM   7967 C CA    . GLN B 1 499 ? -5.564  24.018  -27.615 1.00 57.66  ? 499 GLN B CA    1 
ATOM   7968 C C     . GLN B 1 499 ? -4.251  23.251  -27.575 1.00 54.30  ? 499 GLN B C     1 
ATOM   7969 O O     . GLN B 1 499 ? -3.651  23.074  -26.515 1.00 47.75  ? 499 GLN B O     1 
ATOM   7970 C CB    . GLN B 1 499 ? -5.273  25.502  -27.847 1.00 56.73  ? 499 GLN B CB    1 
ATOM   7971 C CG    . GLN B 1 499 ? -6.477  26.335  -28.207 1.00 56.81  ? 499 GLN B CG    1 
ATOM   7972 C CD    . GLN B 1 499 ? -6.618  26.567  -29.701 1.00 57.77  ? 499 GLN B CD    1 
ATOM   7973 O OE1   . GLN B 1 499 ? -7.682  26.312  -30.268 1.00 63.75  ? 499 GLN B OE1   1 
ATOM   7974 N NE2   . GLN B 1 499 ? -5.554  27.080  -30.347 1.00 50.42  ? 499 GLN B NE2   1 
ATOM   7975 N N     . TRP B 1 500 ? -3.802  22.812  -28.740 1.00 52.55  ? 500 TRP B N     1 
ATOM   7976 C CA    . TRP B 1 500 ? -2.544  22.086  -28.808 1.00 49.04  ? 500 TRP B CA    1 
ATOM   7977 C C     . TRP B 1 500 ? -1.403  23.095  -28.841 1.00 46.40  ? 500 TRP B C     1 
ATOM   7978 O O     . TRP B 1 500 ? -1.248  23.822  -29.827 1.00 47.16  ? 500 TRP B O     1 
ATOM   7979 C CB    . TRP B 1 500 ? -2.542  21.177  -30.032 1.00 46.36  ? 500 TRP B CB    1 
ATOM   7980 C CG    . TRP B 1 500 ? -1.467  20.160  -30.088 1.00 42.93  ? 500 TRP B CG    1 
ATOM   7981 C CD1   . TRP B 1 500 ? -0.254  20.192  -29.460 1.00 44.10  ? 500 TRP B CD1   1 
ATOM   7982 C CD2   . TRP B 1 500 ? -1.502  18.947  -30.839 1.00 45.04  ? 500 TRP B CD2   1 
ATOM   7983 N NE1   . TRP B 1 500 ? 0.468   19.060  -29.768 1.00 44.39  ? 500 TRP B NE1   1 
ATOM   7984 C CE2   . TRP B 1 500 ? -0.275  18.283  -30.622 1.00 46.53  ? 500 TRP B CE2   1 
ATOM   7985 C CE3   . TRP B 1 500 ? -2.447  18.360  -31.689 1.00 43.98  ? 500 TRP B CE3   1 
ATOM   7986 C CZ2   . TRP B 1 500 ? 0.025   17.055  -31.224 1.00 46.14  ? 500 TRP B CZ2   1 
ATOM   7987 C CZ3   . TRP B 1 500 ? -2.150  17.138  -32.276 1.00 42.62  ? 500 TRP B CZ3   1 
ATOM   7988 C CH2   . TRP B 1 500 ? -0.929  16.501  -32.042 1.00 42.37  ? 500 TRP B CH2   1 
ATOM   7989 N N     . PRO B 1 501 ? -0.624  23.220  -27.773 1.00 46.81  ? 501 PRO B N     1 
ATOM   7990 C CA    . PRO B 1 501 ? 0.447   24.201  -27.768 1.00 45.94  ? 501 PRO B CA    1 
ATOM   7991 C C     . PRO B 1 501 ? 1.675   23.661  -28.472 1.00 41.65  ? 501 PRO B C     1 
ATOM   7992 O O     . PRO B 1 501 ? 1.895   22.438  -28.509 1.00 44.06  ? 501 PRO B O     1 
ATOM   7993 C CB    . PRO B 1 501 ? 0.710   24.424  -26.269 1.00 37.93  ? 501 PRO B CB    1 
ATOM   7994 C CG    . PRO B 1 501 ? 0.384   23.144  -25.653 1.00 37.78  ? 501 PRO B CG    1 
ATOM   7995 C CD    . PRO B 1 501 ? -0.781  22.593  -26.445 1.00 44.90  ? 501 PRO B CD    1 
ATOM   7996 N N     . PRO B 1 502 ? 2.477   24.542  -29.063 1.00 40.53  ? 502 PRO B N     1 
ATOM   7997 C CA    . PRO B 1 502 ? 3.770   24.125  -29.623 1.00 41.64  ? 502 PRO B CA    1 
ATOM   7998 C C     . PRO B 1 502 ? 4.719   23.606  -28.551 1.00 43.89  ? 502 PRO B C     1 
ATOM   7999 O O     . PRO B 1 502 ? 4.904   24.228  -27.504 1.00 48.51  ? 502 PRO B O     1 
ATOM   8000 C CB    . PRO B 1 502 ? 4.304   25.411  -30.261 1.00 40.87  ? 502 PRO B CB    1 
ATOM   8001 C CG    . PRO B 1 502 ? 3.076   26.202  -30.590 1.00 45.38  ? 502 PRO B CG    1 
ATOM   8002 C CD    . PRO B 1 502 ? 2.064   25.875  -29.533 1.00 43.50  ? 502 PRO B CD    1 
ATOM   8003 N N     . TYR B 1 503 ? 5.339   22.465  -28.821 1.00 43.59  ? 503 TYR B N     1 
ATOM   8004 C CA    . TYR B 1 503 ? 6.417   22.000  -27.961 1.00 43.99  ? 503 TYR B CA    1 
ATOM   8005 C C     . TYR B 1 503 ? 7.594   22.968  -28.049 1.00 44.61  ? 503 TYR B C     1 
ATOM   8006 O O     . TYR B 1 503 ? 8.132   23.205  -29.138 1.00 50.05  ? 503 TYR B O     1 
ATOM   8007 C CB    . TYR B 1 503 ? 6.849   20.593  -28.361 1.00 42.17  ? 503 TYR B CB    1 
ATOM   8008 C CG    . TYR B 1 503 ? 8.051   20.103  -27.584 1.00 43.94  ? 503 TYR B CG    1 
ATOM   8009 C CD1   . TYR B 1 503 ? 9.337   20.241  -28.093 1.00 44.24  ? 503 TYR B CD1   1 
ATOM   8010 C CD2   . TYR B 1 503 ? 7.901   19.512  -26.327 1.00 43.58  ? 503 TYR B CD2   1 
ATOM   8011 C CE1   . TYR B 1 503 ? 10.436  19.794  -27.381 1.00 44.30  ? 503 TYR B CE1   1 
ATOM   8012 C CE2   . TYR B 1 503 ? 8.994   19.069  -25.611 1.00 41.88  ? 503 TYR B CE2   1 
ATOM   8013 C CZ    . TYR B 1 503 ? 10.253  19.212  -26.135 1.00 43.75  ? 503 TYR B CZ    1 
ATOM   8014 O OH    . TYR B 1 503 ? 11.341  18.773  -25.417 1.00 45.76  ? 503 TYR B OH    1 
ATOM   8015 N N     . THR B 1 504 ? 7.998   23.518  -26.910 1.00 42.48  ? 504 THR B N     1 
ATOM   8016 C CA    . THR B 1 504 ? 9.124   24.438  -26.809 1.00 45.09  ? 504 THR B CA    1 
ATOM   8017 C C     . THR B 1 504 ? 10.160  23.882  -25.846 1.00 46.44  ? 504 THR B C     1 
ATOM   8018 O O     . THR B 1 504 ? 9.898   22.941  -25.091 1.00 48.34  ? 504 THR B O     1 
ATOM   8019 C CB    . THR B 1 504 ? 8.672   25.810  -26.323 1.00 43.02  ? 504 THR B CB    1 
ATOM   8020 O OG1   . THR B 1 504 ? 8.198   25.682  -24.972 1.00 44.47  ? 504 THR B OG1   1 
ATOM   8021 C CG2   . THR B 1 504 ? 7.549   26.316  -27.208 1.00 37.08  ? 504 THR B CG2   1 
ATOM   8022 N N     . THR B 1 505 ? 11.349  24.485  -25.860 1.00 44.06  ? 505 THR B N     1 
ATOM   8023 C CA    . THR B 1 505 ? 12.405  23.990  -24.987 1.00 46.78  ? 505 THR B CA    1 
ATOM   8024 C C     . THR B 1 505 ? 12.090  24.277  -23.524 1.00 52.35  ? 505 THR B C     1 
ATOM   8025 O O     . THR B 1 505 ? 12.310  23.423  -22.655 1.00 50.56  ? 505 THR B O     1 
ATOM   8026 C CB    . THR B 1 505 ? 13.746  24.600  -25.374 1.00 47.06  ? 505 THR B CB    1 
ATOM   8027 O OG1   . THR B 1 505 ? 14.255  23.919  -26.525 1.00 48.95  ? 505 THR B OG1   1 
ATOM   8028 C CG2   . THR B 1 505 ? 14.739  24.446  -24.237 1.00 46.05  ? 505 THR B CG2   1 
ATOM   8029 N N     . ALA B 1 506 ? 11.555  25.462  -23.235 1.00 49.84  ? 506 ALA B N     1 
ATOM   8030 C CA    . ALA B 1 506 ? 11.229  25.814  -21.860 1.00 49.17  ? 506 ALA B CA    1 
ATOM   8031 C C     . ALA B 1 506 ? 10.071  24.984  -21.328 1.00 51.89  ? 506 ALA B C     1 
ATOM   8032 O O     . ALA B 1 506 ? 10.260  24.163  -20.425 1.00 58.90  ? 506 ALA B O     1 
ATOM   8033 C CB    . ALA B 1 506 ? 10.885  27.296  -21.745 1.00 48.51  ? 506 ALA B CB    1 
ATOM   8034 N N     . ALA B 1 507 ? 8.873   25.190  -21.880 1.00 48.92  ? 507 ALA B N     1 
ATOM   8035 C CA    . ALA B 1 507 ? 7.672   24.598  -21.303 1.00 45.37  ? 507 ALA B CA    1 
ATOM   8036 C C     . ALA B 1 507 ? 7.515   23.114  -21.633 1.00 46.53  ? 507 ALA B C     1 
ATOM   8037 O O     . ALA B 1 507 ? 6.890   22.388  -20.859 1.00 49.84  ? 507 ALA B O     1 
ATOM   8038 C CB    . ALA B 1 507 ? 6.438   25.373  -21.761 1.00 44.74  ? 507 ALA B CB    1 
ATOM   8039 N N     . GLN B 1 508 ? 8.034   22.642  -22.765 1.00 45.81  ? 508 GLN B N     1 
ATOM   8040 C CA    . GLN B 1 508 ? 8.028   21.211  -23.081 1.00 45.54  ? 508 GLN B CA    1 
ATOM   8041 C C     . GLN B 1 508 ? 6.621   20.602  -23.115 1.00 42.47  ? 508 GLN B C     1 
ATOM   8042 O O     . GLN B 1 508 ? 6.430   19.432  -22.770 1.00 39.23  ? 508 GLN B O     1 
ATOM   8043 C CB    . GLN B 1 508 ? 8.907   20.445  -22.097 1.00 44.84  ? 508 GLN B CB    1 
ATOM   8044 C CG    . GLN B 1 508 ? 10.269  21.072  -21.914 1.00 49.56  ? 508 GLN B CG    1 
ATOM   8045 C CD    . GLN B 1 508 ? 11.236  20.186  -21.133 1.00 58.09  ? 508 GLN B CD    1 
ATOM   8046 O OE1   . GLN B 1 508 ? 11.741  20.592  -20.086 1.00 61.62  ? 508 GLN B OE1   1 
ATOM   8047 N NE2   . GLN B 1 508 ? 11.505  18.973  -21.649 1.00 55.83  ? 508 GLN B NE2   1 
ATOM   8048 N N     . GLN B 1 509 ? 5.627   21.366  -23.557 1.00 41.22  ? 509 GLN B N     1 
ATOM   8049 C CA    . GLN B 1 509 ? 4.261   20.862  -23.604 1.00 42.09  ? 509 GLN B CA    1 
ATOM   8050 C C     . GLN B 1 509 ? 4.024   19.914  -24.783 1.00 44.58  ? 509 GLN B C     1 
ATOM   8051 O O     . GLN B 1 509 ? 4.635   20.028  -25.857 1.00 38.62  ? 509 GLN B O     1 
ATOM   8052 C CB    . GLN B 1 509 ? 3.270   22.015  -23.686 1.00 44.99  ? 509 GLN B CB    1 
ATOM   8053 C CG    . GLN B 1 509 ? 3.333   22.991  -22.531 1.00 38.98  ? 509 GLN B CG    1 
ATOM   8054 C CD    . GLN B 1 509 ? 2.603   24.287  -22.851 1.00 48.07  ? 509 GLN B CD    1 
ATOM   8055 O OE1   . GLN B 1 509 ? 1.407   24.415  -22.592 1.00 48.50  ? 509 GLN B OE1   1 
ATOM   8056 N NE2   . GLN B 1 509 ? 3.317   25.251  -23.437 1.00 45.71  ? 509 GLN B NE2   1 
ATOM   8057 N N     . TYR B 1 510 ? 3.118   18.964  -24.549 1.00 42.20  ? 510 TYR B N     1 
ATOM   8058 C CA    . TYR B 1 510 ? 2.657   17.977  -25.515 1.00 39.87  ? 510 TYR B CA    1 
ATOM   8059 C C     . TYR B 1 510 ? 1.233   17.625  -25.103 1.00 42.92  ? 510 TYR B C     1 
ATOM   8060 O O     . TYR B 1 510 ? 0.779   17.987  -24.015 1.00 42.77  ? 510 TYR B O     1 
ATOM   8061 C CB    . TYR B 1 510 ? 3.568   16.736  -25.561 1.00 36.99  ? 510 TYR B CB    1 
ATOM   8062 C CG    . TYR B 1 510 ? 3.521   15.875  -24.313 1.00 42.06  ? 510 TYR B CG    1 
ATOM   8063 C CD1   . TYR B 1 510 ? 4.322   16.162  -23.205 1.00 45.80  ? 510 TYR B CD1   1 
ATOM   8064 C CD2   . TYR B 1 510 ? 2.676   14.777  -24.232 1.00 43.28  ? 510 TYR B CD2   1 
ATOM   8065 C CE1   . TYR B 1 510 ? 4.275   15.375  -22.055 1.00 45.78  ? 510 TYR B CE1   1 
ATOM   8066 C CE2   . TYR B 1 510 ? 2.625   13.984  -23.086 1.00 41.39  ? 510 TYR B CE2   1 
ATOM   8067 C CZ    . TYR B 1 510 ? 3.426   14.288  -22.007 1.00 43.47  ? 510 TYR B CZ    1 
ATOM   8068 O OH    . TYR B 1 510 ? 3.369   13.511  -20.873 1.00 47.09  ? 510 TYR B OH    1 
ATOM   8069 N N     . VAL B 1 511 ? 0.505   16.943  -25.977 1.00 39.58  ? 511 VAL B N     1 
ATOM   8070 C CA    . VAL B 1 511 ? -0.883  16.639  -25.667 1.00 37.99  ? 511 VAL B CA    1 
ATOM   8071 C C     . VAL B 1 511 ? -1.092  15.135  -25.730 1.00 41.82  ? 511 VAL B C     1 
ATOM   8072 O O     . VAL B 1 511 ? -0.255  14.380  -26.230 1.00 43.46  ? 511 VAL B O     1 
ATOM   8073 C CB    . VAL B 1 511 ? -1.866  17.376  -26.594 1.00 42.58  ? 511 VAL B CB    1 
ATOM   8074 C CG1   . VAL B 1 511 ? -1.551  18.860  -26.618 1.00 40.91  ? 511 VAL B CG1   1 
ATOM   8075 C CG2   . VAL B 1 511 ? -1.838  16.770  -28.021 1.00 42.33  ? 511 VAL B CG2   1 
ATOM   8076 N N     . SER B 1 512 ? -2.213  14.693  -25.186 1.00 41.54  ? 512 SER B N     1 
ATOM   8077 C CA    . SER B 1 512 ? -2.537  13.276  -25.168 1.00 44.68  ? 512 SER B CA    1 
ATOM   8078 C C     . SER B 1 512 ? -3.720  13.055  -26.094 1.00 45.67  ? 512 SER B C     1 
ATOM   8079 O O     . SER B 1 512 ? -4.722  13.778  -26.015 1.00 45.37  ? 512 SER B O     1 
ATOM   8080 C CB    . SER B 1 512 ? -2.856  12.789  -23.750 1.00 39.25  ? 512 SER B CB    1 
ATOM   8081 O OG    . SER B 1 512 ? -4.057  13.375  -23.271 1.00 47.43  ? 512 SER B OG    1 
ATOM   8082 N N     . LEU B 1 513 ? -3.594  12.085  -26.988 1.00 43.06  ? 513 LEU B N     1 
ATOM   8083 C CA    . LEU B 1 513 ? -4.681  11.726  -27.883 1.00 40.79  ? 513 LEU B CA    1 
ATOM   8084 C C     . LEU B 1 513 ? -5.298  10.445  -27.356 1.00 42.98  ? 513 LEU B C     1 
ATOM   8085 O O     . LEU B 1 513 ? -4.685  9.374   -27.428 1.00 43.94  ? 513 LEU B O     1 
ATOM   8086 C CB    . LEU B 1 513 ? -4.190  11.565  -29.316 1.00 40.85  ? 513 LEU B CB    1 
ATOM   8087 C CG    . LEU B 1 513 ? -3.423  12.798  -29.772 1.00 40.13  ? 513 LEU B CG    1 
ATOM   8088 C CD1   . LEU B 1 513 ? -2.719  12.559  -31.105 1.00 41.11  ? 513 LEU B CD1   1 
ATOM   8089 C CD2   . LEU B 1 513 ? -4.374  13.975  -29.818 1.00 35.96  ? 513 LEU B CD2   1 
ATOM   8090 N N     . ASN B 1 514 ? -6.496  10.568  -26.807 1.00 40.36  ? 514 ASN B N     1 
ATOM   8091 C CA    . ASN B 1 514 ? -7.303  9.435   -26.378 1.00 48.03  ? 514 ASN B CA    1 
ATOM   8092 C C     . ASN B 1 514 ? -8.753  9.865   -26.513 1.00 49.93  ? 514 ASN B C     1 
ATOM   8093 O O     . ASN B 1 514 ? -9.045  10.891  -27.138 1.00 47.94  ? 514 ASN B O     1 
ATOM   8094 C CB    . ASN B 1 514 ? -6.946  8.993   -24.942 1.00 47.99  ? 514 ASN B CB    1 
ATOM   8095 C CG    . ASN B 1 514 ? -6.830  10.167  -23.972 1.00 47.93  ? 514 ASN B CG    1 
ATOM   8096 O OD1   . ASN B 1 514 ? -7.691  11.055  -23.918 1.00 48.35  ? 514 ASN B OD1   1 
ATOM   8097 N ND2   . ASN B 1 514 ? -5.732  10.193  -23.229 1.00 47.42  ? 514 ASN B ND2   1 
ATOM   8098 N N     . LEU B 1 515 ? -9.662  9.111   -25.891 1.00 47.96  ? 515 LEU B N     1 
ATOM   8099 C CA    . LEU B 1 515 ? -11.074 9.434   -26.022 1.00 47.13  ? 515 LEU B CA    1 
ATOM   8100 C C     . LEU B 1 515 ? -11.460 10.676  -25.232 1.00 50.31  ? 515 LEU B C     1 
ATOM   8101 O O     . LEU B 1 515 ? -12.469 11.310  -25.562 1.00 51.74  ? 515 LEU B O     1 
ATOM   8102 C CB    . LEU B 1 515 ? -11.919 8.241   -25.597 1.00 51.00  ? 515 LEU B CB    1 
ATOM   8103 C CG    . LEU B 1 515 ? -11.637 6.987   -26.427 1.00 56.88  ? 515 LEU B CG    1 
ATOM   8104 C CD1   . LEU B 1 515 ? -12.505 5.823   -25.987 1.00 53.79  ? 515 LEU B CD1   1 
ATOM   8105 C CD2   . LEU B 1 515 ? -11.844 7.287   -27.908 1.00 54.70  ? 515 LEU B CD2   1 
ATOM   8106 N N     . LYS B 1 516 ? -10.689 11.046  -24.206 1.00 50.94  ? 516 LYS B N     1 
ATOM   8107 C CA    . LYS B 1 516 ? -10.961 12.281  -23.480 1.00 52.40  ? 516 LYS B CA    1 
ATOM   8108 C C     . LYS B 1 516 ? -10.453 13.464  -24.291 1.00 54.82  ? 516 LYS B C     1 
ATOM   8109 O O     . LYS B 1 516 ? -9.650  13.298  -25.213 1.00 53.10  ? 516 LYS B O     1 
ATOM   8110 C CB    . LYS B 1 516 ? -10.298 12.257  -22.107 1.00 48.42  ? 516 LYS B CB    1 
ATOM   8111 C CG    . LYS B 1 516 ? -10.609 11.012  -21.310 1.00 53.50  ? 516 LYS B CG    1 
ATOM   8112 C CD    . LYS B 1 516 ? -9.677  10.844  -20.135 1.00 61.86  ? 516 LYS B CD    1 
ATOM   8113 C CE    . LYS B 1 516 ? -10.101 9.662   -19.263 1.00 70.45  ? 516 LYS B CE    1 
ATOM   8114 N NZ    . LYS B 1 516 ? -9.364  9.631   -17.956 1.00 71.89  ? 516 LYS B NZ    1 
ATOM   8115 N N     . PRO B 1 517 ? -10.919 14.673  -23.990 1.00 56.71  ? 517 PRO B N     1 
ATOM   8116 C CA    . PRO B 1 517 ? -10.455 15.838  -24.748 1.00 53.80  ? 517 PRO B CA    1 
ATOM   8117 C C     . PRO B 1 517 ? -8.961  16.066  -24.570 1.00 53.35  ? 517 PRO B C     1 
ATOM   8118 O O     . PRO B 1 517 ? -8.288  15.469  -23.719 1.00 53.62  ? 517 PRO B O     1 
ATOM   8119 C CB    . PRO B 1 517 ? -11.285 16.991  -24.171 1.00 49.43  ? 517 PRO B CB    1 
ATOM   8120 C CG    . PRO B 1 517 ? -12.514 16.340  -23.685 1.00 45.20  ? 517 PRO B CG    1 
ATOM   8121 C CD    . PRO B 1 517 ? -12.057 15.016  -23.124 1.00 51.82  ? 517 PRO B CD    1 
ATOM   8122 N N     . LEU B 1 518 ? -8.439  16.927  -25.436 1.00 51.28  ? 518 LEU B N     1 
ATOM   8123 C CA    . LEU B 1 518 ? -7.033  17.282  -25.398 1.00 50.09  ? 518 LEU B CA    1 
ATOM   8124 C C     . LEU B 1 518 ? -6.626  17.666  -23.990 1.00 48.74  ? 518 LEU B C     1 
ATOM   8125 O O     . LEU B 1 518 ? -7.241  18.531  -23.366 1.00 55.22  ? 518 LEU B O     1 
ATOM   8126 C CB    . LEU B 1 518 ? -6.756  18.444  -26.348 1.00 51.34  ? 518 LEU B CB    1 
ATOM   8127 C CG    . LEU B 1 518 ? -6.376  18.093  -27.768 1.00 50.33  ? 518 LEU B CG    1 
ATOM   8128 C CD1   . LEU B 1 518 ? -5.731  19.305  -28.424 1.00 50.28  ? 518 LEU B CD1   1 
ATOM   8129 C CD2   . LEU B 1 518 ? -5.435  16.913  -27.732 1.00 47.59  ? 518 LEU B CD2   1 
ATOM   8130 N N     . GLU B 1 519 ? -5.589  17.013  -23.496 1.00 49.85  ? 519 GLU B N     1 
ATOM   8131 C CA    . GLU B 1 519 ? -5.003  17.313  -22.204 1.00 44.15  ? 519 GLU B CA    1 
ATOM   8132 C C     . GLU B 1 519 ? -3.541  17.664  -22.414 1.00 44.83  ? 519 GLU B C     1 
ATOM   8133 O O     . GLU B 1 519 ? -2.821  16.933  -23.095 1.00 50.70  ? 519 GLU B O     1 
ATOM   8134 C CB    . GLU B 1 519 ? -5.148  16.111  -21.293 1.00 51.27  ? 519 GLU B CB    1 
ATOM   8135 C CG    . GLU B 1 519 ? -4.527  16.239  -19.927 1.00 53.67  ? 519 GLU B CG    1 
ATOM   8136 C CD    . GLU B 1 519 ? -4.748  14.983  -19.128 1.00 54.58  ? 519 GLU B CD    1 
ATOM   8137 O OE1   . GLU B 1 519 ? -5.455  14.069  -19.619 1.00 59.02  ? 519 GLU B OE1   1 
ATOM   8138 O OE2   . GLU B 1 519 ? -4.187  14.886  -18.028 1.00 63.33  ? 519 GLU B OE2   1 
ATOM   8139 N N     . VAL B 1 520 ? -3.098  18.770  -21.845 1.00 43.18  ? 520 VAL B N     1 
ATOM   8140 C CA    . VAL B 1 520 ? -1.731  19.240  -22.019 1.00 40.13  ? 520 VAL B CA    1 
ATOM   8141 C C     . VAL B 1 520 ? -0.883  18.786  -20.844 1.00 37.53  ? 520 VAL B C     1 
ATOM   8142 O O     . VAL B 1 520 ? -1.263  18.972  -19.686 1.00 49.08  ? 520 VAL B O     1 
ATOM   8143 C CB    . VAL B 1 520 ? -1.701  20.766  -22.166 1.00 38.20  ? 520 VAL B CB    1 
ATOM   8144 C CG1   . VAL B 1 520 ? -0.273  21.256  -22.397 1.00 37.72  ? 520 VAL B CG1   1 
ATOM   8145 C CG2   . VAL B 1 520 ? -2.661  21.195  -23.289 1.00 30.94  ? 520 VAL B CG2   1 
ATOM   8146 N N     . ARG B 1 521 ? 0.253   18.180  -21.137 1.00 38.66  ? 521 ARG B N     1 
ATOM   8147 C CA    . ARG B 1 521 ? 1.227   17.751  -20.154 1.00 36.54  ? 521 ARG B CA    1 
ATOM   8148 C C     . ARG B 1 521 ? 2.565   18.397  -20.487 1.00 39.00  ? 521 ARG B C     1 
ATOM   8149 O O     . ARG B 1 521 ? 2.738   18.990  -21.549 1.00 44.03  ? 521 ARG B O     1 
ATOM   8150 C CB    . ARG B 1 521 ? 1.380   16.225  -20.133 1.00 43.22  ? 521 ARG B CB    1 
ATOM   8151 C CG    . ARG B 1 521 ? 0.112   15.370  -20.291 1.00 41.83  ? 521 ARG B CG    1 
ATOM   8152 C CD    . ARG B 1 521 ? 0.467   13.950  -19.856 1.00 42.45  ? 521 ARG B CD    1 
ATOM   8153 N NE    . ARG B 1 521 ? -0.304  12.829  -20.401 1.00 45.36  ? 521 ARG B NE    1 
ATOM   8154 C CZ    . ARG B 1 521 ? -1.614  12.665  -20.239 1.00 48.33  ? 521 ARG B CZ    1 
ATOM   8155 N NH1   . ARG B 1 521 ? -2.218  11.584  -20.720 1.00 43.04  ? 521 ARG B NH1   1 
ATOM   8156 N NH2   . ARG B 1 521 ? -2.325  13.597  -19.625 1.00 45.48  ? 521 ARG B NH2   1 
ATOM   8157 N N     . ARG B 1 522 ? 3.526   18.294  -19.573 1.00 41.42  ? 522 ARG B N     1 
ATOM   8158 C CA    . ARG B 1 522 ? 4.847   18.868  -19.787 1.00 41.08  ? 522 ARG B CA    1 
ATOM   8159 C C     . ARG B 1 522 ? 5.895   17.799  -19.564 1.00 43.69  ? 522 ARG B C     1 
ATOM   8160 O O     . ARG B 1 522 ? 5.713   16.911  -18.731 1.00 50.39  ? 522 ARG B O     1 
ATOM   8161 C CB    . ARG B 1 522 ? 5.108   20.056  -18.877 1.00 39.96  ? 522 ARG B CB    1 
ATOM   8162 C CG    . ARG B 1 522 ? 4.312   21.275  -19.277 1.00 42.92  ? 522 ARG B CG    1 
ATOM   8163 C CD    . ARG B 1 522 ? 4.244   22.358  -18.192 1.00 48.35  ? 522 ARG B CD    1 
ATOM   8164 N NE    . ARG B 1 522 ? 5.507   23.066  -17.980 1.00 49.12  ? 522 ARG B NE    1 
ATOM   8165 C CZ    . ARG B 1 522 ? 5.595   24.313  -17.517 1.00 55.12  ? 522 ARG B CZ    1 
ATOM   8166 N NH1   . ARG B 1 522 ? 4.491   24.996  -17.229 1.00 53.21  ? 522 ARG B NH1   1 
ATOM   8167 N NH2   . ARG B 1 522 ? 6.784   24.887  -17.352 1.00 54.05  ? 522 ARG B NH2   1 
ATOM   8168 N N     . GLY B 1 523 ? 6.974   17.870  -20.333 1.00 45.41  ? 523 GLY B N     1 
ATOM   8169 C CA    . GLY B 1 523 ? 8.048   16.907  -20.218 1.00 46.79  ? 523 GLY B CA    1 
ATOM   8170 C C     . GLY B 1 523 ? 7.839   15.661  -21.049 1.00 47.19  ? 523 GLY B C     1 
ATOM   8171 O O     . GLY B 1 523 ? 6.962   14.848  -20.745 1.00 47.48  ? 523 GLY B O     1 
ATOM   8172 N N     . LEU B 1 524 ? 8.646   15.506  -22.106 1.00 52.53  ? 524 LEU B N     1 
ATOM   8173 C CA    . LEU B 1 524 ? 8.660   14.289  -22.925 1.00 49.33  ? 524 LEU B CA    1 
ATOM   8174 C C     . LEU B 1 524 ? 9.511   13.236  -22.221 1.00 46.33  ? 524 LEU B C     1 
ATOM   8175 O O     . LEU B 1 524 ? 10.648  12.949  -22.612 1.00 44.16  ? 524 LEU B O     1 
ATOM   8176 C CB    . LEU B 1 524 ? 9.205   14.578  -24.317 1.00 49.01  ? 524 LEU B CB    1 
ATOM   8177 C CG    . LEU B 1 524 ? 8.256   14.783  -25.484 1.00 53.97  ? 524 LEU B CG    1 
ATOM   8178 C CD1   . LEU B 1 524 ? 7.397   13.492  -25.783 1.00 64.74  ? 524 LEU B CD1   1 
ATOM   8179 C CD2   . LEU B 1 524 ? 7.409   16.014  -25.221 1.00 43.29  ? 524 LEU B CD2   1 
ATOM   8180 N N     . ARG B 1 525 ? 8.938   12.667  -21.152 1.00 44.78  ? 525 ARG B N     1 
ATOM   8181 C CA    . ARG B 1 525 ? 9.616   11.645  -20.361 1.00 42.00  ? 525 ARG B CA    1 
ATOM   8182 C C     . ARG B 1 525 ? 11.033  12.119  -20.003 1.00 44.96  ? 525 ARG B C     1 
ATOM   8183 O O     . ARG B 1 525 ? 12.038  11.453  -20.264 1.00 43.82  ? 525 ARG B O     1 
ATOM   8184 C CB    . ARG B 1 525 ? 9.608   10.314  -21.124 1.00 40.16  ? 525 ARG B CB    1 
ATOM   8185 C CG    . ARG B 1 525 ? 10.258  9.154   -20.428 1.00 38.80  ? 525 ARG B CG    1 
ATOM   8186 C CD    . ARG B 1 525 ? 9.753   7.793   -20.844 1.00 44.07  ? 525 ARG B CD    1 
ATOM   8187 N NE    . ARG B 1 525 ? 8.297   7.682   -20.741 1.00 49.57  ? 525 ARG B NE    1 
ATOM   8188 C CZ    . ARG B 1 525 ? 7.595   6.625   -21.147 1.00 51.04  ? 525 ARG B CZ    1 
ATOM   8189 N NH1   . ARG B 1 525 ? 6.271   6.611   -21.038 1.00 53.60  ? 525 ARG B NH1   1 
ATOM   8190 N NH2   . ARG B 1 525 ? 8.210   5.577   -21.672 1.00 45.52  ? 525 ARG B NH2   1 
ATOM   8191 N N     . ALA B 1 526 ? 11.107  13.314  -19.401 1.00 45.88  ? 526 ALA B N     1 
ATOM   8192 C CA    . ALA B 1 526 ? 12.340  14.097  -19.479 1.00 45.18  ? 526 ALA B CA    1 
ATOM   8193 C C     . ALA B 1 526 ? 13.439  13.538  -18.584 1.00 49.51  ? 526 ALA B C     1 
ATOM   8194 O O     . ALA B 1 526 ? 14.621  13.596  -18.957 1.00 50.08  ? 526 ALA B O     1 
ATOM   8195 C CB    . ALA B 1 526 ? 12.061  15.561  -19.144 1.00 42.93  ? 526 ALA B CB    1 
ATOM   8196 N N     . GLN B 1 527 ? 13.078  13.003  -17.405 1.00 43.27  ? 527 GLN B N     1 
ATOM   8197 C CA    . GLN B 1 527 ? 14.080  12.442  -16.500 1.00 45.98  ? 527 GLN B CA    1 
ATOM   8198 C C     . GLN B 1 527 ? 14.766  11.238  -17.125 1.00 48.09  ? 527 GLN B C     1 
ATOM   8199 O O     . GLN B 1 527 ? 15.998  11.180  -17.218 1.00 48.96  ? 527 GLN B O     1 
ATOM   8200 C CB    . GLN B 1 527 ? 13.452  12.031  -15.159 1.00 52.02  ? 527 GLN B CB    1 
ATOM   8201 C CG    . GLN B 1 527 ? 13.173  13.139  -14.156 1.00 46.01  ? 527 GLN B CG    1 
ATOM   8202 C CD    . GLN B 1 527 ? 14.333  14.094  -14.015 1.00 54.49  ? 527 GLN B CD    1 
ATOM   8203 O OE1   . GLN B 1 527 ? 14.201  15.293  -14.305 1.00 55.37  ? 527 GLN B OE1   1 
ATOM   8204 N NE2   . GLN B 1 527 ? 15.484  13.576  -13.573 1.00 55.29  ? 527 GLN B NE2   1 
ATOM   8205 N N     . THR B 1 528 ? 13.977  10.245  -17.533 1.00 46.10  ? 528 THR B N     1 
ATOM   8206 C CA    . THR B 1 528 ? 14.569  9.031   -18.079 1.00 47.11  ? 528 THR B CA    1 
ATOM   8207 C C     . THR B 1 528 ? 15.192  9.273   -19.456 1.00 50.98  ? 528 THR B C     1 
ATOM   8208 O O     . THR B 1 528 ? 16.139  8.575   -19.833 1.00 54.73  ? 528 THR B O     1 
ATOM   8209 C CB    . THR B 1 528 ? 13.514  7.925   -18.146 1.00 51.21  ? 528 THR B CB    1 
ATOM   8210 O OG1   . THR B 1 528 ? 12.349  8.470   -18.726 1.00 62.38  ? 528 THR B OG1   1 
ATOM   8211 C CG2   . THR B 1 528 ? 13.093  7.461   -16.795 1.00 45.78  ? 528 THR B CG2   1 
ATOM   8212 N N     . CYS B 1 529 ? 14.702  10.251  -20.223 1.00 44.31  ? 529 CYS B N     1 
ATOM   8213 C CA    . CYS B 1 529 ? 15.368  10.526  -21.490 1.00 45.14  ? 529 CYS B CA    1 
ATOM   8214 C C     . CYS B 1 529 ? 16.667  11.287  -21.288 1.00 47.78  ? 529 CYS B C     1 
ATOM   8215 O O     . CYS B 1 529 ? 17.596  11.158  -22.102 1.00 44.40  ? 529 CYS B O     1 
ATOM   8216 C CB    . CYS B 1 529 ? 14.426  11.269  -22.443 1.00 48.36  ? 529 CYS B CB    1 
ATOM   8217 S SG    . CYS B 1 529 ? 13.145  10.131  -23.140 1.00 58.36  ? 529 CYS B SG    1 
ATOM   8218 N N     . ALA B 1 530 ? 16.765  12.056  -20.203 1.00 46.75  ? 530 ALA B N     1 
ATOM   8219 C CA    . ALA B 1 530 ? 18.065  12.589  -19.825 1.00 47.05  ? 530 ALA B CA    1 
ATOM   8220 C C     . ALA B 1 530 ? 19.091  11.474  -19.643 1.00 47.31  ? 530 ALA B C     1 
ATOM   8221 O O     . ALA B 1 530 ? 20.270  11.663  -19.952 1.00 45.84  ? 530 ALA B O     1 
ATOM   8222 C CB    . ALA B 1 530 ? 17.933  13.424  -18.559 1.00 48.15  ? 530 ALA B CB    1 
ATOM   8223 N N     . PHE B 1 531 ? 18.666  10.303  -19.167 1.00 46.07  ? 531 PHE B N     1 
ATOM   8224 C CA    . PHE B 1 531 ? 19.596  9.188   -19.029 1.00 45.16  ? 531 PHE B CA    1 
ATOM   8225 C C     . PHE B 1 531 ? 20.034  8.678   -20.392 1.00 50.24  ? 531 PHE B C     1 
ATOM   8226 O O     . PHE B 1 531 ? 21.228  8.454   -20.637 1.00 49.47  ? 531 PHE B O     1 
ATOM   8227 C CB    . PHE B 1 531 ? 18.954  8.058   -18.223 1.00 44.44  ? 531 PHE B CB    1 
ATOM   8228 C CG    . PHE B 1 531 ? 19.710  6.759   -18.289 1.00 47.68  ? 531 PHE B CG    1 
ATOM   8229 C CD1   . PHE B 1 531 ? 20.832  6.553   -17.504 1.00 51.59  ? 531 PHE B CD1   1 
ATOM   8230 C CD2   . PHE B 1 531 ? 19.306  5.739   -19.148 1.00 52.11  ? 531 PHE B CD2   1 
ATOM   8231 C CE1   . PHE B 1 531 ? 21.538  5.354   -17.560 1.00 51.96  ? 531 PHE B CE1   1 
ATOM   8232 C CE2   . PHE B 1 531 ? 20.008  4.532   -19.223 1.00 51.06  ? 531 PHE B CE2   1 
ATOM   8233 C CZ    . PHE B 1 531 ? 21.122  4.337   -18.424 1.00 55.01  ? 531 PHE B CZ    1 
ATOM   8234 N N     . TRP B 1 532 ? 19.071  8.483   -21.295 1.00 49.01  ? 532 TRP B N     1 
ATOM   8235 C CA    . TRP B 1 532 ? 19.380  7.887   -22.585 1.00 46.90  ? 532 TRP B CA    1 
ATOM   8236 C C     . TRP B 1 532 ? 20.125  8.860   -23.481 1.00 46.07  ? 532 TRP B C     1 
ATOM   8237 O O     . TRP B 1 532 ? 21.043  8.459   -24.201 1.00 47.27  ? 532 TRP B O     1 
ATOM   8238 C CB    . TRP B 1 532 ? 18.104  7.428   -23.270 1.00 44.87  ? 532 TRP B CB    1 
ATOM   8239 C CG    . TRP B 1 532 ? 17.484  6.210   -22.706 1.00 41.66  ? 532 TRP B CG    1 
ATOM   8240 C CD1   . TRP B 1 532 ? 16.322  6.134   -22.006 1.00 42.54  ? 532 TRP B CD1   1 
ATOM   8241 C CD2   . TRP B 1 532 ? 17.960  4.872   -22.840 1.00 40.42  ? 532 TRP B CD2   1 
ATOM   8242 N NE1   . TRP B 1 532 ? 16.044  4.826   -21.686 1.00 41.29  ? 532 TRP B NE1   1 
ATOM   8243 C CE2   . TRP B 1 532 ? 17.042  4.034   -22.182 1.00 39.85  ? 532 TRP B CE2   1 
ATOM   8244 C CE3   . TRP B 1 532 ? 19.079  4.300   -23.445 1.00 42.89  ? 532 TRP B CE3   1 
ATOM   8245 C CZ2   . TRP B 1 532 ? 17.207  2.664   -22.115 1.00 42.88  ? 532 TRP B CZ2   1 
ATOM   8246 C CZ3   . TRP B 1 532 ? 19.240  2.940   -23.383 1.00 40.67  ? 532 TRP B CZ3   1 
ATOM   8247 C CH2   . TRP B 1 532 ? 18.308  2.133   -22.726 1.00 41.85  ? 532 TRP B CH2   1 
ATOM   8248 N N     . ASN B 1 533 ? 19.750  10.137  -23.464 1.00 43.98  ? 533 ASN B N     1 
ATOM   8249 C CA    . ASN B 1 533 ? 20.340  11.054  -24.432 1.00 47.49  ? 533 ASN B CA    1 
ATOM   8250 C C     . ASN B 1 533 ? 21.549  11.792  -23.883 1.00 50.15  ? 533 ASN B C     1 
ATOM   8251 O O     . ASN B 1 533 ? 22.449  12.148  -24.654 1.00 45.27  ? 533 ASN B O     1 
ATOM   8252 C CB    . ASN B 1 533 ? 19.311  12.084  -24.931 1.00 46.62  ? 533 ASN B CB    1 
ATOM   8253 C CG    . ASN B 1 533 ? 18.010  11.449  -25.403 1.00 47.69  ? 533 ASN B CG    1 
ATOM   8254 O OD1   . ASN B 1 533 ? 18.000  10.324  -25.902 1.00 51.24  ? 533 ASN B OD1   1 
ATOM   8255 N ND2   . ASN B 1 533 ? 16.900  12.166  -25.228 1.00 46.08  ? 533 ASN B ND2   1 
ATOM   8256 N N     . ARG B 1 534 ? 21.595  12.038  -22.572 1.00 50.91  ? 534 ARG B N     1 
ATOM   8257 C CA    . ARG B 1 534 ? 22.714  12.758  -21.980 1.00 46.62  ? 534 ARG B CA    1 
ATOM   8258 C C     . ARG B 1 534 ? 23.702  11.848  -21.273 1.00 46.97  ? 534 ARG B C     1 
ATOM   8259 O O     . ARG B 1 534 ? 24.913  12.030  -21.410 1.00 47.81  ? 534 ARG B O     1 
ATOM   8260 C CB    . ARG B 1 534 ? 22.196  13.817  -21.008 1.00 51.89  ? 534 ARG B CB    1 
ATOM   8261 C CG    . ARG B 1 534 ? 21.224  14.784  -21.655 1.00 50.27  ? 534 ARG B CG    1 
ATOM   8262 C CD    . ARG B 1 534 ? 20.262  15.358  -20.642 1.00 54.73  ? 534 ARG B CD    1 
ATOM   8263 N NE    . ARG B 1 534 ? 19.346  16.347  -21.206 1.00 55.97  ? 534 ARG B NE    1 
ATOM   8264 C CZ    . ARG B 1 534 ? 19.715  17.578  -21.548 1.00 55.11  ? 534 ARG B CZ    1 
ATOM   8265 N NH1   . ARG B 1 534 ? 20.989  17.956  -21.412 1.00 47.21  ? 534 ARG B NH1   1 
ATOM   8266 N NH2   . ARG B 1 534 ? 18.812  18.423  -22.031 1.00 48.67  ? 534 ARG B NH2   1 
ATOM   8267 N N     . PHE B 1 535 ? 23.238  10.860  -20.521 1.00 51.89  ? 535 PHE B N     1 
ATOM   8268 C CA    . PHE B 1 535 ? 24.235  10.183  -19.707 1.00 53.49  ? 535 PHE B CA    1 
ATOM   8269 C C     . PHE B 1 535 ? 24.774  8.940   -20.386 1.00 51.62  ? 535 PHE B C     1 
ATOM   8270 O O     . PHE B 1 535 ? 25.991  8.765   -20.476 1.00 53.09  ? 535 PHE B O     1 
ATOM   8271 C CB    . PHE B 1 535 ? 23.680  9.817   -18.326 1.00 53.85  ? 535 PHE B CB    1 
ATOM   8272 C CG    . PHE B 1 535 ? 24.659  9.037   -17.495 1.00 51.52  ? 535 PHE B CG    1 
ATOM   8273 C CD1   . PHE B 1 535 ? 25.860  9.615   -17.102 1.00 45.03  ? 535 PHE B CD1   1 
ATOM   8274 C CD2   . PHE B 1 535 ? 24.407  7.713   -17.164 1.00 49.14  ? 535 PHE B CD2   1 
ATOM   8275 C CE1   . PHE B 1 535 ? 26.770  8.908   -16.389 1.00 42.04  ? 535 PHE B CE1   1 
ATOM   8276 C CE2   . PHE B 1 535 ? 25.316  6.996   -16.435 1.00 49.74  ? 535 PHE B CE2   1 
ATOM   8277 C CZ    . PHE B 1 535 ? 26.501  7.592   -16.044 1.00 49.06  ? 535 PHE B CZ    1 
ATOM   8278 N N     . LEU B 1 536 ? 23.883  8.064   -20.835 1.00 52.19  ? 536 LEU B N     1 
ATOM   8279 C CA    . LEU B 1 536 ? 24.320  6.802   -21.420 1.00 53.73  ? 536 LEU B CA    1 
ATOM   8280 C C     . LEU B 1 536 ? 25.338  6.981   -22.533 1.00 54.49  ? 536 LEU B C     1 
ATOM   8281 O O     . LEU B 1 536 ? 26.318  6.217   -22.552 1.00 55.71  ? 536 LEU B O     1 
ATOM   8282 C CB    . LEU B 1 536 ? 23.115  6.001   -21.922 1.00 52.26  ? 536 LEU B CB    1 
ATOM   8283 C CG    . LEU B 1 536 ? 23.517  4.631   -22.448 1.00 56.06  ? 536 LEU B CG    1 
ATOM   8284 C CD1   . LEU B 1 536 ? 22.760  3.578   -21.648 1.00 56.84  ? 536 LEU B CD1   1 
ATOM   8285 C CD2   . LEU B 1 536 ? 23.308  4.498   -23.989 1.00 56.43  ? 536 LEU B CD2   1 
ATOM   8286 N N     . PRO B 1 537 ? 25.196  7.934   -23.467 1.00 57.70  ? 537 PRO B N     1 
ATOM   8287 C CA    . PRO B 1 537 ? 26.305  8.171   -24.402 1.00 58.21  ? 537 PRO B CA    1 
ATOM   8288 C C     . PRO B 1 537 ? 27.618  8.388   -23.677 1.00 64.81  ? 537 PRO B C     1 
ATOM   8289 O O     . PRO B 1 537 ? 28.620  7.769   -24.036 1.00 68.98  ? 537 PRO B O     1 
ATOM   8290 C CB    . PRO B 1 537 ? 25.852  9.411   -25.179 1.00 50.38  ? 537 PRO B CB    1 
ATOM   8291 C CG    . PRO B 1 537 ? 24.398  9.360   -25.139 1.00 51.05  ? 537 PRO B CG    1 
ATOM   8292 C CD    . PRO B 1 537 ? 24.032  8.774   -23.807 1.00 56.99  ? 537 PRO B CD    1 
ATOM   8293 N N     . LYS B 1 538 ? 27.629  9.208   -22.620 1.00 63.98  ? 538 LYS B N     1 
ATOM   8294 C CA    . LYS B 1 538 ? 28.883  9.463   -21.916 1.00 62.93  ? 538 LYS B CA    1 
ATOM   8295 C C     . LYS B 1 538 ? 29.438  8.198   -21.284 1.00 64.61  ? 538 LYS B C     1 
ATOM   8296 O O     . LYS B 1 538 ? 30.660  8.030   -21.194 1.00 65.58  ? 538 LYS B O     1 
ATOM   8297 C CB    . LYS B 1 538 ? 28.700  10.555  -20.873 1.00 64.36  ? 538 LYS B CB    1 
ATOM   8298 C CG    . LYS B 1 538 ? 28.950  11.933  -21.452 1.00 68.70  ? 538 LYS B CG    1 
ATOM   8299 C CD    . LYS B 1 538 ? 28.506  13.033  -20.517 1.00 74.80  ? 538 LYS B CD    1 
ATOM   8300 C CE    . LYS B 1 538 ? 28.231  14.308  -21.291 1.00 81.75  ? 538 LYS B CE    1 
ATOM   8301 N NZ    . LYS B 1 538 ? 29.139  14.442  -22.469 1.00 79.61  ? 538 LYS B NZ    1 
ATOM   8302 N N     . LEU B 1 539 ? 28.560  7.289   -20.867 1.00 64.77  ? 539 LEU B N     1 
ATOM   8303 C CA    . LEU B 1 539 ? 29.017  6.044   -20.264 1.00 65.80  ? 539 LEU B CA    1 
ATOM   8304 C C     . LEU B 1 539 ? 29.721  5.164   -21.291 1.00 70.39  ? 539 LEU B C     1 
ATOM   8305 O O     . LEU B 1 539 ? 30.852  4.723   -21.064 1.00 73.21  ? 539 LEU B O     1 
ATOM   8306 C CB    . LEU B 1 539 ? 27.835  5.319   -19.633 1.00 58.71  ? 539 LEU B CB    1 
ATOM   8307 C CG    . LEU B 1 539 ? 28.211  4.063   -18.882 1.00 62.95  ? 539 LEU B CG    1 
ATOM   8308 C CD1   . LEU B 1 539 ? 29.353  4.389   -17.944 1.00 68.78  ? 539 LEU B CD1   1 
ATOM   8309 C CD2   . LEU B 1 539 ? 27.010  3.609   -18.101 1.00 64.73  ? 539 LEU B CD2   1 
ATOM   8310 N N     . LEU B 1 540 ? 29.067  4.895   -22.430 1.00 72.69  ? 540 LEU B N     1 
ATOM   8311 C CA    . LEU B 1 540 ? 29.689  4.092   -23.484 1.00 70.08  ? 540 LEU B CA    1 
ATOM   8312 C C     . LEU B 1 540 ? 30.901  4.796   -24.097 1.00 71.64  ? 540 LEU B C     1 
ATOM   8313 O O     . LEU B 1 540 ? 31.929  4.164   -24.346 1.00 72.94  ? 540 LEU B O     1 
ATOM   8314 C CB    . LEU B 1 540 ? 28.654  3.755   -24.557 1.00 69.38  ? 540 LEU B CB    1 
ATOM   8315 C CG    . LEU B 1 540 ? 27.423  2.990   -24.067 1.00 66.16  ? 540 LEU B CG    1 
ATOM   8316 C CD1   . LEU B 1 540 ? 26.267  3.095   -25.067 1.00 48.70  ? 540 LEU B CD1   1 
ATOM   8317 C CD2   . LEU B 1 540 ? 27.808  1.549   -23.805 1.00 66.80  ? 540 LEU B CD2   1 
ATOM   8318 N N     . SER B 1 541 ? 30.822  6.104   -24.313 1.00 70.85  ? 541 SER B N     1 
ATOM   8319 C CA    . SER B 1 541 ? 31.927  6.860   -24.906 1.00 75.40  ? 541 SER B CA    1 
ATOM   8320 C C     . SER B 1 541 ? 33.121  7.016   -23.974 1.00 80.68  ? 541 SER B C     1 
ATOM   8321 O O     . SER B 1 541 ? 33.907  7.969   -24.130 1.00 80.74  ? 541 SER B O     1 
ATOM   8322 C CB    . SER B 1 541 ? 31.429  8.244   -25.278 1.00 78.78  ? 541 SER B CB    1 
ATOM   8323 O OG    . SER B 1 541 ? 30.657  8.725   -24.186 1.00 81.18  ? 541 SER B OG    1 
ATOM   8324 N N     . ALA B 1 542 ? 33.219  6.154   -22.947 1.00 81.68  ? 542 ALA B N     1 
ATOM   8325 C CA    . ALA B 1 542 ? 34.250  6.209   -21.907 1.00 85.63  ? 542 ALA B CA    1 
ATOM   8326 C C     . ALA B 1 542 ? 34.052  5.096   -20.879 1.00 87.72  ? 542 ALA B C     1 
ATOM   8327 O O     . ALA B 1 542 ? 34.211  5.332   -19.677 1.00 84.14  ? 542 ALA B O     1 
ATOM   8328 C CB    . ALA B 1 542 ? 34.264  7.575   -21.187 1.00 75.22  ? 542 ALA B CB    1 
ATOM   8329 N N     . THR B 1 543 ? 33.669  3.897   -21.320 1.00 86.18  ? 543 THR B N     1 
ATOM   8330 C CA    . THR B 1 543 ? 33.460  2.792   -20.378 1.00 87.94  ? 543 THR B CA    1 
ATOM   8331 C C     . THR B 1 543 ? 34.830  2.302   -19.922 1.00 100.28 ? 543 THR B C     1 
ATOM   8332 O O     . THR B 1 543 ? 34.962  1.550   -18.947 1.00 101.71 ? 543 THR B O     1 
ATOM   8333 C CB    . THR B 1 543 ? 32.645  1.612   -20.988 1.00 84.46  ? 543 THR B CB    1 
ATOM   8334 O OG1   . THR B 1 543 ? 31.579  2.124   -21.793 1.00 84.83  ? 543 THR B OG1   1 
ATOM   8335 C CG2   . THR B 1 543 ? 32.038  0.747   -19.891 1.00 75.71  ? 543 THR B CG2   1 
HETATM 8336 O O01   . E5H C 2 .   ? 31.623  20.554  6.921   1.00 60.99  ? 601 E5H A O01   1 
HETATM 8337 C C02   . E5H C 2 .   ? 32.068  21.313  7.809   1.00 72.65  ? 601 E5H A C02   1 
HETATM 8338 N N03   . E5H C 2 .   ? 31.313  21.579  9.082   1.00 53.88  ? 601 E5H A N03   1 
HETATM 8339 C C04   . E5H C 2 .   ? 29.965  20.955  9.392   1.00 54.93  ? 601 E5H A C04   1 
HETATM 8340 C C05   . E5H C 2 .   ? 29.086  21.552  10.545  1.00 67.08  ? 601 E5H A C05   1 
HETATM 8341 C C06   . E5H C 2 .   ? 27.996  20.510  10.952  1.00 65.39  ? 601 E5H A C06   1 
HETATM 8342 N N07   . E5H C 2 .   ? 27.299  20.952  12.255  1.00 71.90  ? 601 E5H A N07   1 
HETATM 8343 C C08   . E5H C 2 .   ? 25.951  20.202  12.182  1.00 67.33  ? 601 E5H A C08   1 
HETATM 8344 C C09   . E5H C 2 .   ? 25.267  20.068  13.568  1.00 57.33  ? 601 E5H A C09   1 
HETATM 8345 C C10   . E5H C 2 .   ? 26.190  19.500  14.617  1.00 50.89  ? 601 E5H A C10   1 
HETATM 8346 C C11   . E5H C 2 .   ? 27.468  20.309  14.731  1.00 57.93  ? 601 E5H A C11   1 
HETATM 8347 C C12   . E5H C 2 .   ? 28.211  20.475  13.380  1.00 68.82  ? 601 E5H A C12   1 
HETATM 8348 C C13   . E5H C 2 .   ? 33.479  22.018  7.547   1.00 74.31  ? 601 E5H A C13   1 
HETATM 8349 O O14   . E5H C 2 .   ? 33.843  23.160  8.388   1.00 78.69  ? 601 E5H A O14   1 
HETATM 8350 C C15   . E5H C 2 .   ? 35.056  23.875  8.104   1.00 75.60  ? 601 E5H A C15   1 
HETATM 8351 C C16   . E5H C 2 .   ? 35.644  24.760  9.050   1.00 72.21  ? 601 E5H A C16   1 
HETATM 8352 C C17   . E5H C 2 .   ? 36.848  25.457  8.754   1.00 72.72  ? 601 E5H A C17   1 
HETATM 8353 C C18   . E5H C 2 .   ? 37.597  25.373  7.550   1.00 70.68  ? 601 E5H A C18   1 
HETATM 8354 C C19   . E5H C 2 .   ? 38.901  26.163  7.302   1.00 67.01  ? 601 E5H A C19   1 
HETATM 8355 C C25   . E5H C 2 .   ? 36.989  24.481  6.620   1.00 67.38  ? 601 E5H A C25   1 
HETATM 8356 C C26   . E5H C 2 .   ? 35.785  23.773  6.882   1.00 67.68  ? 601 E5H A C26   1 
HETATM 8357 O "O2'" . TOE D 3 .   ? 10.077  10.608  -1.298  1.00 74.01  ? 602 TOE A "O2'" 1 
HETATM 8358 C "CA'" . TOE D 3 .   ? 10.343  10.613  0.055   1.00 63.16  ? 602 TOE A "CA'" 1 
HETATM 8359 C "CB'" . TOE D 3 .   ? 11.689  10.010  0.303   1.00 59.98  ? 602 TOE A "CB'" 1 
HETATM 8360 O "OC'" . TOE D 3 .   ? 12.057  10.209  1.618   1.00 57.52  ? 602 TOE A "OC'" 1 
HETATM 8361 C "CD'" . TOE D 3 .   ? 12.180  9.097   2.412   1.00 53.91  ? 602 TOE A "CD'" 1 
HETATM 8362 C "CE'" . TOE D 3 .   ? 13.469  9.199   3.144   1.00 52.20  ? 602 TOE A "CE'" 1 
HETATM 8363 O "OF'" . TOE D 3 .   ? 13.628  8.013   3.823   1.00 54.22  ? 602 TOE A "OF'" 1 
HETATM 8364 C "CG'" . TOE D 3 .   ? 14.391  8.006   4.973   1.00 53.55  ? 602 TOE A "CG'" 1 
HETATM 8365 C "CH'" . TOE D 3 .   ? 15.095  6.706   5.157   1.00 48.64  ? 602 TOE A "CH'" 1 
HETATM 8366 O "OI'" . TOE D 3 .   ? 15.499  6.595   6.467   1.00 53.73  ? 602 TOE A "OI'" 1 
HETATM 8367 C "CK'" . TOE D 3 .   ? 14.549  6.312   7.424   1.00 44.92  ? 602 TOE A "CK'" 1 
HETATM 8368 C C5    . PG0 E 4 .   ? 24.239  -3.826  -1.892  1.00 61.57  ? 603 PG0 A C5    1 
HETATM 8369 O O2    . PG0 E 4 .   ? 23.279  -3.444  -0.966  1.00 72.55  ? 603 PG0 A O2    1 
HETATM 8370 C C4    . PG0 E 4 .   ? 22.020  -4.028  -0.970  1.00 69.63  ? 603 PG0 A C4    1 
HETATM 8371 C C3    . PG0 E 4 .   ? 21.363  -3.904  0.374   1.00 67.99  ? 603 PG0 A C3    1 
HETATM 8372 O O1    . PG0 E 4 .   ? 20.125  -4.531  0.414   1.00 68.49  ? 603 PG0 A O1    1 
HETATM 8373 C C2    . PG0 E 4 .   ? 19.898  -5.622  1.233   1.00 64.86  ? 603 PG0 A C2    1 
HETATM 8374 C C1    . PG0 E 4 .   ? 18.535  -6.166  0.955   1.00 65.32  ? 603 PG0 A C1    1 
HETATM 8375 O OTT   . PG0 E 4 .   ? 18.582  -7.544  0.863   1.00 67.92  ? 603 PG0 A OTT   1 
HETATM 8376 O O01   . E5H F 2 .   ? 12.361  -6.821  -33.930 1.00 65.27  ? 601 E5H B O01   1 
HETATM 8377 C C02   . E5H F 2 .   ? 12.102  -7.533  -34.909 1.00 71.87  ? 601 E5H B C02   1 
HETATM 8378 N N03   . E5H F 2 .   ? 10.988  -7.222  -35.798 1.00 61.51  ? 601 E5H B N03   1 
HETATM 8379 C C04   . E5H F 2 .   ? 10.087  -6.046  -35.634 1.00 60.13  ? 601 E5H B C04   1 
HETATM 8380 C C05   . E5H F 2 .   ? 8.584   -6.261  -35.897 1.00 65.22  ? 601 E5H B C05   1 
HETATM 8381 C C06   . E5H F 2 .   ? 7.840   -4.940  -35.602 1.00 68.81  ? 601 E5H B C06   1 
HETATM 8382 N N07   . E5H F 2 .   ? 6.696   -4.757  -36.615 1.00 75.36  ? 601 E5H B N07   1 
HETATM 8383 C C08   . E5H F 2 .   ? 7.364   -4.164  -37.816 1.00 64.98  ? 601 E5H B C08   1 
HETATM 8384 C C09   . E5H F 2 .   ? 6.313   -3.732  -38.791 1.00 64.74  ? 601 E5H B C09   1 
HETATM 8385 C C10   . E5H F 2 .   ? 5.319   -2.772  -38.152 1.00 62.77  ? 601 E5H B C10   1 
HETATM 8386 C C11   . E5H F 2 .   ? 4.696   -3.357  -36.918 1.00 63.67  ? 601 E5H B C11   1 
HETATM 8387 C C12   . E5H F 2 .   ? 5.792   -3.731  -35.945 1.00 71.55  ? 601 E5H B C12   1 
HETATM 8388 C C13   . E5H F 2 .   ? 13.003  -8.825  -35.191 1.00 76.89  ? 601 E5H B C13   1 
HETATM 8389 O O14   . E5H F 2 .   ? 12.551  -9.754  -36.221 1.00 82.26  ? 601 E5H B O14   1 
HETATM 8390 C C15   . E5H F 2 .   ? 13.293  -10.955 -36.485 1.00 83.97  ? 601 E5H B C15   1 
HETATM 8391 C C16   . E5H F 2 .   ? 13.291  -11.563 -37.769 1.00 76.14  ? 601 E5H B C16   1 
HETATM 8392 C C17   . E5H F 2 .   ? 14.032  -12.759 -38.037 1.00 78.70  ? 601 E5H B C17   1 
HETATM 8393 C C18   . E5H F 2 .   ? 14.837  -13.484 -37.116 1.00 81.76  ? 601 E5H B C18   1 
HETATM 8394 C C19   . E5H F 2 .   ? 15.614  -14.782 -37.483 1.00 74.68  ? 601 E5H B C19   1 
HETATM 8395 C C25   . E5H F 2 .   ? 14.825  -12.855 -35.829 1.00 82.21  ? 601 E5H B C25   1 
HETATM 8396 C C26   . E5H F 2 .   ? 14.093  -11.657 -35.531 1.00 80.09  ? 601 E5H B C26   1 
HETATM 8397 C C2    . 1PG G 5 .   ? 17.196  5.990   -10.604 1.00 63.20  ? 602 1PG B C2    1 
HETATM 8398 C C1    . 1PG G 5 .   ? 15.289  6.476   -11.990 1.00 58.37  ? 602 1PG B C1    1 
HETATM 8399 O O1    . 1PG G 5 .   ? 16.368  5.663   -11.669 1.00 64.93  ? 602 1PG B O1    1 
HETATM 8400 O O2    . 1PG G 5 .   ? 19.313  5.020   -10.834 1.00 68.45  ? 602 1PG B O2    1 
HETATM 8401 C C3    . 1PG G 5 .   ? 18.083  4.851   -10.221 1.00 59.83  ? 602 1PG B C3    1 
HETATM 8402 C C4    . 1PG G 5 .   ? 20.287  4.030   -10.787 1.00 59.55  ? 602 1PG B C4    1 
HETATM 8403 C C5    . 1PG G 5 .   ? 21.080  4.048   -12.058 1.00 60.40  ? 602 1PG B C5    1 
HETATM 8404 O O3    . 1PG G 5 .   ? 21.603  5.304   -12.277 1.00 59.74  ? 602 1PG B O3    1 
HETATM 8405 C C6    . 1PG G 5 .   ? 21.334  5.993   -13.427 1.00 55.50  ? 602 1PG B C6    1 
HETATM 8406 C C7    . 1PG G 5 .   ? 22.460  6.942   -13.590 1.00 50.80  ? 602 1PG B C7    1 
HETATM 8407 O O4    . 1PG G 5 .   ? 22.020  7.815   -14.538 1.00 54.07  ? 602 1PG B O4    1 
HETATM 8408 C C8    . 1PG G 5 .   ? 21.663  9.109   -14.254 1.00 55.99  ? 602 1PG B C8    1 
HETATM 8409 C C9    . 1PG G 5 .   ? 20.869  9.615   -15.420 1.00 56.11  ? 602 1PG B C9    1 
HETATM 8410 O O5    . 1PG G 5 .   ? 19.967  10.606  -15.064 1.00 64.85  ? 602 1PG B O5    1 
HETATM 8411 C C10   . 1PG G 5 .   ? 18.612  10.348  -14.848 1.00 62.12  ? 602 1PG B C10   1 
HETATM 8412 C C11   . 1PG G 5 .   ? 18.376  9.572   -13.575 1.00 67.69  ? 602 1PG B C11   1 
HETATM 8413 O O6    . 1PG G 5 .   ? 17.442  10.141  -12.710 1.00 65.58  ? 602 1PG B O6    1 
HETATM 8414 C C5    . PG0 H 4 .   ? 22.898  20.198  -44.707 1.00 66.99  ? 603 PG0 B C5    1 
HETATM 8415 O O2    . PG0 H 4 .   ? 21.849  19.599  -44.021 1.00 76.67  ? 603 PG0 B O2    1 
HETATM 8416 C C4    . PG0 H 4 .   ? 20.580  20.165  -44.010 1.00 72.03  ? 603 PG0 B C4    1 
HETATM 8417 C C3    . PG0 H 4 .   ? 20.080  20.415  -42.622 1.00 67.97  ? 603 PG0 B C3    1 
HETATM 8418 O O1    . PG0 H 4 .   ? 19.328  21.579  -42.646 1.00 77.77  ? 603 PG0 B O1    1 
HETATM 8419 C C2    . PG0 H 4 .   ? 19.654  22.652  -41.830 1.00 71.25  ? 603 PG0 B C2    1 
HETATM 8420 C C1    . PG0 H 4 .   ? 20.106  23.813  -42.664 1.00 71.49  ? 603 PG0 B C1    1 
HETATM 8421 O OTT   . PG0 H 4 .   ? 21.085  24.544  -42.009 1.00 72.58  ? 603 PG0 B OTT   1 
HETATM 8422 O O     . HOH I 6 .   ? 24.898  -8.491  16.122  1.00 69.13  ? 701 HOH A O     1 
HETATM 8423 O O     . HOH I 6 .   ? 11.563  21.703  -10.139 1.00 69.30  ? 702 HOH A O     1 
HETATM 8424 O O     . HOH I 6 .   ? 29.772  15.801  0.863   1.00 43.66  ? 703 HOH A O     1 
HETATM 8425 O O     . HOH I 6 .   ? 39.420  15.945  12.361  1.00 43.04  ? 704 HOH A O     1 
HETATM 8426 O O     . HOH I 6 .   ? 44.282  0.643   16.044  1.00 48.10  ? 705 HOH A O     1 
HETATM 8427 O O     . HOH I 6 .   ? 16.942  14.834  29.083  1.00 46.24  ? 706 HOH A O     1 
HETATM 8428 O O     . HOH I 6 .   ? 51.848  15.731  24.002  1.00 46.53  ? 707 HOH A O     1 
HETATM 8429 O O     . HOH I 6 .   ? 32.881  4.726   6.477   1.00 45.93  ? 708 HOH A O     1 
HETATM 8430 O O     . HOH I 6 .   ? 35.572  15.994  38.218  1.00 47.82  ? 709 HOH A O     1 
HETATM 8431 O O     . HOH I 6 .   ? 17.879  11.522  13.169  1.00 39.85  ? 710 HOH A O     1 
HETATM 8432 O O     . HOH I 6 .   ? 45.619  14.497  24.269  1.00 47.39  ? 711 HOH A O     1 
HETATM 8433 O O     . HOH I 6 .   ? 29.299  3.024   2.233   1.00 63.77  ? 712 HOH A O     1 
HETATM 8434 O O     . HOH I 6 .   ? 25.599  10.718  55.103  1.00 48.63  ? 713 HOH A O     1 
HETATM 8435 O O     . HOH I 6 .   ? 31.507  16.559  32.570  1.00 41.41  ? 714 HOH A O     1 
HETATM 8436 O O     . HOH I 6 .   ? 47.905  4.214   26.600  1.00 57.50  ? 715 HOH A O     1 
HETATM 8437 O O     . HOH I 6 .   ? 38.780  19.988  16.102  1.00 45.81  ? 716 HOH A O     1 
HETATM 8438 O O     . HOH I 6 .   ? 7.384   11.208  28.123  1.00 56.50  ? 717 HOH A O     1 
HETATM 8439 O O     . HOH I 6 .   ? 40.112  11.905  33.371  1.00 42.80  ? 718 HOH A O     1 
HETATM 8440 O O     . HOH I 6 .   ? 24.369  22.205  30.021  1.00 47.33  ? 719 HOH A O     1 
HETATM 8441 O O     . HOH I 6 .   ? 42.132  9.050   11.462  1.00 43.76  ? 720 HOH A O     1 
HETATM 8442 O O     . HOH I 6 .   ? 23.215  8.609   48.201  1.00 48.45  ? 721 HOH A O     1 
HETATM 8443 O O     . HOH I 6 .   ? 13.629  -5.573  11.587  1.00 54.78  ? 722 HOH A O     1 
HETATM 8444 O O     . HOH I 6 .   ? 44.554  7.639   29.825  1.00 46.40  ? 723 HOH A O     1 
HETATM 8445 O O     . HOH I 6 .   ? 11.245  2.929   33.725  1.00 48.47  ? 724 HOH A O     1 
HETATM 8446 O O     . HOH I 6 .   ? 28.491  11.746  24.653  1.00 36.76  ? 725 HOH A O     1 
HETATM 8447 O O     . HOH I 6 .   ? 18.515  19.807  18.517  1.00 44.63  ? 726 HOH A O     1 
HETATM 8448 O O     . HOH I 6 .   ? 45.620  -1.680  17.156  1.00 47.78  ? 727 HOH A O     1 
HETATM 8449 O O     . HOH I 6 .   ? 28.931  20.135  19.088  1.00 38.04  ? 728 HOH A O     1 
HETATM 8450 O O     . HOH I 6 .   ? 37.137  8.257   47.498  1.00 43.50  ? 729 HOH A O     1 
HETATM 8451 O O     . HOH I 6 .   ? 27.344  -1.635  37.499  1.00 47.05  ? 730 HOH A O     1 
HETATM 8452 O O     . HOH I 6 .   ? 41.991  6.980   14.125  1.00 40.20  ? 731 HOH A O     1 
HETATM 8453 O O     . HOH I 6 .   ? 25.261  14.828  18.503  1.00 39.55  ? 732 HOH A O     1 
HETATM 8454 O O     . HOH I 6 .   ? 17.595  14.593  3.919   1.00 39.67  ? 733 HOH A O     1 
HETATM 8455 O O     . HOH I 6 .   ? 39.925  25.750  19.353  1.00 52.71  ? 734 HOH A O     1 
HETATM 8456 O O     . HOH I 6 .   ? 36.336  9.344   4.392   1.00 35.83  ? 735 HOH A O     1 
HETATM 8457 O O     . HOH I 6 .   ? 32.904  7.264   -2.030  1.00 50.95  ? 736 HOH A O     1 
HETATM 8458 O O     . HOH I 6 .   ? 43.004  18.214  16.116  1.00 43.34  ? 737 HOH A O     1 
HETATM 8459 O O     . HOH I 6 .   ? 27.968  -0.503  29.688  1.00 44.35  ? 738 HOH A O     1 
HETATM 8460 O O     . HOH I 6 .   ? 20.227  14.748  12.807  1.00 39.34  ? 739 HOH A O     1 
HETATM 8461 O O     . HOH I 6 .   ? 42.675  15.481  36.127  1.00 44.89  ? 740 HOH A O     1 
HETATM 8462 O O     . HOH I 6 .   ? 35.819  -5.251  13.935  1.00 47.16  ? 741 HOH A O     1 
HETATM 8463 O O     . HOH I 6 .   ? 28.313  17.684  19.929  1.00 34.12  ? 742 HOH A O     1 
HETATM 8464 O O     . HOH I 6 .   ? 13.439  3.501   32.850  1.00 52.01  ? 743 HOH A O     1 
HETATM 8465 O O     . HOH I 6 .   ? 37.778  3.094   45.290  1.00 44.49  ? 744 HOH A O     1 
HETATM 8466 O O     . HOH I 6 .   ? 30.661  25.165  -12.488 1.00 39.47  ? 745 HOH A O     1 
HETATM 8467 O O     . HOH I 6 .   ? 32.191  18.745  29.180  1.00 41.52  ? 746 HOH A O     1 
HETATM 8468 O O     . HOH I 6 .   ? 18.697  14.578  1.642   1.00 38.03  ? 747 HOH A O     1 
HETATM 8469 O O     . HOH I 6 .   ? 63.423  3.924   16.128  1.00 69.06  ? 748 HOH A O     1 
HETATM 8470 O O     . HOH I 6 .   ? 37.027  15.091  12.490  1.00 37.81  ? 749 HOH A O     1 
HETATM 8471 O O     . HOH I 6 .   ? 39.094  26.957  17.045  1.00 52.16  ? 750 HOH A O     1 
HETATM 8472 O O     . HOH I 6 .   ? 13.786  7.209   -4.332  1.00 44.04  ? 751 HOH A O     1 
HETATM 8473 O O     . HOH I 6 .   ? 28.765  2.336   46.041  1.00 45.89  ? 752 HOH A O     1 
HETATM 8474 O O     . HOH I 6 .   ? 45.613  10.045  10.945  1.00 39.51  ? 753 HOH A O     1 
HETATM 8475 O O     . HOH I 6 .   ? 40.154  16.244  21.587  1.00 41.59  ? 754 HOH A O     1 
HETATM 8476 O O     . HOH I 6 .   ? 37.666  12.454  -13.954 1.00 62.08  ? 755 HOH A O     1 
HETATM 8477 O O     . HOH I 6 .   ? 36.453  -6.440  16.520  1.00 46.22  ? 756 HOH A O     1 
HETATM 8478 O O     . HOH I 6 .   ? 42.962  14.853  24.896  1.00 43.62  ? 757 HOH A O     1 
HETATM 8479 O O     . HOH I 6 .   ? 21.084  34.067  17.341  1.00 54.42  ? 758 HOH A O     1 
HETATM 8480 O O     . HOH I 6 .   ? 41.150  13.461  31.459  1.00 46.04  ? 759 HOH A O     1 
HETATM 8481 O O     . HOH I 6 .   ? 9.360   12.439  3.643   1.00 65.61  ? 760 HOH A O     1 
HETATM 8482 O O     . HOH I 6 .   ? 18.929  17.619  2.583   1.00 40.73  ? 761 HOH A O     1 
HETATM 8483 O O     . HOH I 6 .   ? 30.935  16.464  29.574  1.00 41.06  ? 762 HOH A O     1 
HETATM 8484 O O     . HOH I 6 .   ? 35.828  1.267   36.801  1.00 47.22  ? 763 HOH A O     1 
HETATM 8485 O O     . HOH I 6 .   ? 4.844   5.185   1.279   1.00 53.77  ? 764 HOH A O     1 
HETATM 8486 O O     . HOH I 6 .   ? 16.374  25.496  18.087  1.00 38.82  ? 765 HOH A O     1 
HETATM 8487 O O     . HOH I 6 .   ? 29.903  7.758   6.771   1.00 41.91  ? 766 HOH A O     1 
HETATM 8488 O O     . HOH I 6 .   ? 14.874  1.620   0.985   1.00 45.85  ? 767 HOH A O     1 
HETATM 8489 O O     . HOH I 6 .   ? 32.096  14.168  17.111  1.00 33.37  ? 768 HOH A O     1 
HETATM 8490 O O     . HOH I 6 .   ? 46.484  20.868  26.278  1.00 48.26  ? 769 HOH A O     1 
HETATM 8491 O O     . HOH I 6 .   ? 20.147  32.741  10.178  1.00 57.66  ? 770 HOH A O     1 
HETATM 8492 O O     . HOH I 6 .   ? 40.714  18.678  17.842  1.00 44.44  ? 771 HOH A O     1 
HETATM 8493 O O     . HOH I 6 .   ? 11.254  5.278   -1.244  1.00 49.58  ? 772 HOH A O     1 
HETATM 8494 O O     . HOH I 6 .   ? 18.013  -5.988  28.598  1.00 53.74  ? 773 HOH A O     1 
HETATM 8495 O O     . HOH I 6 .   ? 2.062   15.925  19.054  1.00 51.71  ? 774 HOH A O     1 
HETATM 8496 O O     . HOH I 6 .   ? 37.902  15.367  1.232   1.00 48.68  ? 775 HOH A O     1 
HETATM 8497 O O     . HOH I 6 .   ? 24.915  29.114  -14.601 1.00 45.89  ? 776 HOH A O     1 
HETATM 8498 O O     . HOH I 6 .   ? 35.869  12.053  -0.549  1.00 48.74  ? 777 HOH A O     1 
HETATM 8499 O O     . HOH I 6 .   ? 32.799  -2.381  -8.101  1.00 56.30  ? 778 HOH A O     1 
HETATM 8500 O O     . HOH I 6 .   ? 41.515  16.532  23.944  1.00 44.57  ? 779 HOH A O     1 
HETATM 8501 O O     . HOH I 6 .   ? 51.852  13.294  3.629   1.00 50.43  ? 780 HOH A O     1 
HETATM 8502 O O     . HOH I 6 .   ? 6.310   20.861  31.449  1.00 58.08  ? 781 HOH A O     1 
HETATM 8503 O O     . HOH I 6 .   ? 43.160  0.893   18.587  1.00 49.10  ? 782 HOH A O     1 
HETATM 8504 O O     . HOH I 6 .   ? 14.925  18.768  -20.981 1.00 50.91  ? 783 HOH A O     1 
HETATM 8505 O O     . HOH I 6 .   ? 12.343  15.901  46.673  1.00 50.98  ? 784 HOH A O     1 
HETATM 8506 O O     . HOH I 6 .   ? 36.014  1.237   33.779  1.00 50.39  ? 785 HOH A O     1 
HETATM 8507 O O     . HOH I 6 .   ? 26.751  3.225   2.111   1.00 51.07  ? 786 HOH A O     1 
HETATM 8508 O O     . HOH I 6 .   ? 32.314  -8.457  13.534  1.00 43.09  ? 787 HOH A O     1 
HETATM 8509 O O     . HOH I 6 .   ? 11.368  3.512   -12.229 1.00 56.95  ? 788 HOH A O     1 
HETATM 8510 O O     . HOH I 6 .   ? 31.821  0.296   -1.543  1.00 48.58  ? 789 HOH A O     1 
HETATM 8511 O O     . HOH J 6 .   ? -5.449  25.053  -38.232 1.00 52.53  ? 701 HOH B O     1 
HETATM 8512 O O     . HOH J 6 .   ? -0.366  26.822  -32.215 1.00 45.51  ? 702 HOH B O     1 
HETATM 8513 O O     . HOH J 6 .   ? 13.085  -8.044  -46.332 1.00 47.20  ? 703 HOH B O     1 
HETATM 8514 O O     . HOH J 6 .   ? 3.017   7.850   -33.292 1.00 43.14  ? 704 HOH B O     1 
HETATM 8515 O O     . HOH J 6 .   ? 25.574  4.896   -58.074 1.00 54.09  ? 705 HOH B O     1 
HETATM 8516 O O     . HOH J 6 .   ? 3.399   3.922   -33.793 1.00 40.57  ? 706 HOH B O     1 
HETATM 8517 O O     . HOH J 6 .   ? 6.063   -0.421  -19.890 1.00 44.64  ? 707 HOH B O     1 
HETATM 8518 O O     . HOH J 6 .   ? 8.616   23.386  -18.231 1.00 52.74  ? 708 HOH B O     1 
HETATM 8519 O O     . HOH J 6 .   ? 20.957  7.194   -36.459 1.00 51.77  ? 709 HOH B O     1 
HETATM 8520 O O     . HOH J 6 .   ? 27.989  5.492   -51.549 1.00 46.72  ? 710 HOH B O     1 
HETATM 8521 O O     . HOH J 6 .   ? 12.098  3.924   -74.500 1.00 41.54  ? 711 HOH B O     1 
HETATM 8522 O O     . HOH J 6 .   ? -3.642  24.128  -51.432 1.00 53.66  ? 712 HOH B O     1 
HETATM 8523 O O     . HOH J 6 .   ? 4.116   4.769   -48.405 1.00 42.24  ? 713 HOH B O     1 
HETATM 8524 O O     . HOH J 6 .   ? 7.885   0.178   -72.139 1.00 42.87  ? 714 HOH B O     1 
HETATM 8525 O O     . HOH J 6 .   ? 16.149  -3.551  -42.894 1.00 41.89  ? 715 HOH B O     1 
HETATM 8526 O O     . HOH J 6 .   ? -0.130  7.840   -73.095 1.00 46.38  ? 716 HOH B O     1 
HETATM 8527 O O     . HOH J 6 .   ? 22.361  15.884  -45.711 1.00 53.49  ? 717 HOH B O     1 
HETATM 8528 O O     . HOH J 6 .   ? 22.849  -1.146  -31.537 1.00 53.24  ? 718 HOH B O     1 
HETATM 8529 O O     . HOH J 6 .   ? -1.427  -7.092  -45.201 1.00 48.34  ? 719 HOH B O     1 
HETATM 8530 O O     . HOH J 6 .   ? -12.367 16.526  -65.253 1.00 64.30  ? 720 HOH B O     1 
HETATM 8531 O O     . HOH J 6 .   ? 4.125   -2.457  -13.476 1.00 58.48  ? 721 HOH B O     1 
HETATM 8532 O O     . HOH J 6 .   ? -7.248  13.419  -26.762 1.00 40.13  ? 722 HOH B O     1 
HETATM 8533 O O     . HOH J 6 .   ? -9.056  20.798  -47.758 1.00 46.73  ? 723 HOH B O     1 
HETATM 8534 O O     . HOH J 6 .   ? 23.657  -2.559  -43.730 1.00 46.97  ? 724 HOH B O     1 
HETATM 8535 O O     . HOH J 6 .   ? 1.614   0.125   -53.198 1.00 44.16  ? 725 HOH B O     1 
HETATM 8536 O O     . HOH J 6 .   ? -15.748 -7.863  -38.708 1.00 62.90  ? 726 HOH B O     1 
HETATM 8537 O O     . HOH J 6 .   ? 4.448   -3.870  -42.800 1.00 44.31  ? 727 HOH B O     1 
HETATM 8538 O O     . HOH J 6 .   ? 12.325  15.092  -22.647 1.00 40.01  ? 728 HOH B O     1 
HETATM 8539 O O     . HOH J 6 .   ? 4.631   -13.244 -53.589 1.00 50.32  ? 729 HOH B O     1 
HETATM 8540 O O     . HOH J 6 .   ? 22.526  -5.725  -33.577 1.00 52.82  ? 730 HOH B O     1 
HETATM 8541 O O     . HOH J 6 .   ? 6.179   16.786  -53.766 1.00 50.81  ? 731 HOH B O     1 
HETATM 8542 O O     . HOH J 6 .   ? 17.709  29.658  -35.349 1.00 59.65  ? 732 HOH B O     1 
HETATM 8543 O O     . HOH J 6 .   ? 17.274  -8.229  -60.292 1.00 48.14  ? 733 HOH B O     1 
HETATM 8544 O O     . HOH J 6 .   ? 8.188   0.519   -61.592 1.00 46.69  ? 734 HOH B O     1 
HETATM 8545 O O     . HOH J 6 .   ? 12.994  6.601   -33.285 1.00 43.29  ? 735 HOH B O     1 
HETATM 8546 O O     . HOH J 6 .   ? 10.108  -0.089  -43.933 1.00 41.87  ? 736 HOH B O     1 
HETATM 8547 O O     . HOH J 6 .   ? -7.258  19.232  -47.732 1.00 46.12  ? 737 HOH B O     1 
HETATM 8548 O O     . HOH J 6 .   ? 5.181   8.506   -64.284 1.00 41.34  ? 738 HOH B O     1 
HETATM 8549 O O     . HOH J 6 .   ? -6.659  -3.710  -34.753 1.00 46.92  ? 739 HOH B O     1 
HETATM 8550 O O     . HOH J 6 .   ? 24.107  -5.943  -24.303 1.00 57.52  ? 740 HOH B O     1 
HETATM 8551 O O     . HOH J 6 .   ? 22.268  0.892   -36.370 1.00 35.90  ? 741 HOH B O     1 
HETATM 8552 O O     . HOH J 6 .   ? 5.922   23.949  -24.657 1.00 42.48  ? 742 HOH B O     1 
HETATM 8553 O O     . HOH J 6 .   ? -4.659  1.401   -30.751 1.00 47.38  ? 743 HOH B O     1 
HETATM 8554 O O     . HOH J 6 .   ? -0.240  19.903  -47.318 1.00 43.04  ? 744 HOH B O     1 
HETATM 8555 O O     . HOH J 6 .   ? 22.812  -0.328  -45.036 1.00 40.77  ? 745 HOH B O     1 
HETATM 8556 O O     . HOH J 6 .   ? -9.213  6.813   -24.218 1.00 53.84  ? 746 HOH B O     1 
HETATM 8557 O O     . HOH J 6 .   ? 18.557  6.076   -27.185 1.00 47.09  ? 747 HOH B O     1 
HETATM 8558 O O     . HOH J 6 .   ? 18.749  -20.105 -56.261 1.00 55.70  ? 748 HOH B O     1 
HETATM 8559 O O     . HOH J 6 .   ? 16.730  -3.446  -66.026 1.00 52.93  ? 749 HOH B O     1 
HETATM 8560 O O     . HOH J 6 .   ? -3.339  0.254   -22.708 1.00 48.72  ? 750 HOH B O     1 
HETATM 8561 O O     . HOH J 6 .   ? -12.985 -1.292  -52.377 1.00 57.50  ? 751 HOH B O     1 
HETATM 8562 O O     . HOH J 6 .   ? -6.266  -3.605  -55.908 1.00 45.42  ? 752 HOH B O     1 
HETATM 8563 O O     . HOH J 6 .   ? 31.820  -5.182  -21.149 1.00 68.03  ? 753 HOH B O     1 
HETATM 8564 O O     . HOH J 6 .   ? 25.226  6.510   -37.978 1.00 49.41  ? 754 HOH B O     1 
HETATM 8565 O O     . HOH J 6 .   ? 8.504   -1.342  -12.486 1.00 53.48  ? 755 HOH B O     1 
HETATM 8566 O O     . HOH J 6 .   ? 7.213   28.859  -42.256 1.00 62.98  ? 756 HOH B O     1 
HETATM 8567 O O     . HOH J 6 .   ? 4.687   1.488   -69.350 1.00 42.80  ? 757 HOH B O     1 
HETATM 8568 O O     . HOH J 6 .   ? 8.424   13.990  -18.027 1.00 43.24  ? 758 HOH B O     1 
HETATM 8569 O O     . HOH J 6 .   ? -3.324  -5.472  -45.517 1.00 47.45  ? 759 HOH B O     1 
HETATM 8570 O O     . HOH J 6 .   ? 6.059   2.296   -72.034 1.00 45.58  ? 760 HOH B O     1 
HETATM 8571 O O     . HOH J 6 .   ? -3.061  -13.427 -22.552 1.00 67.03  ? 761 HOH B O     1 
HETATM 8572 O O     . HOH J 6 .   ? -1.407  28.081  -52.859 1.00 61.24  ? 762 HOH B O     1 
HETATM 8573 O O     . HOH J 6 .   ? 1.750   -12.335 -51.002 1.00 48.50  ? 763 HOH B O     1 
HETATM 8574 O O     . HOH J 6 .   ? 20.471  2.409   -63.132 1.00 56.28  ? 764 HOH B O     1 
HETATM 8575 O O     . HOH J 6 .   ? 15.566  15.807  -21.047 1.00 45.39  ? 765 HOH B O     1 
HETATM 8576 O O     . HOH J 6 .   ? 30.327  -17.608 -42.493 1.00 63.67  ? 766 HOH B O     1 
HETATM 8577 O O     . HOH J 6 .   ? 11.551  28.316  -24.857 1.00 43.62  ? 767 HOH B O     1 
HETATM 8578 O O     . HOH J 6 .   ? 6.544   28.682  -32.277 1.00 59.88  ? 768 HOH B O     1 
HETATM 8579 O O     . HOH J 6 .   ? 0.717   18.254  -65.043 1.00 49.15  ? 769 HOH B O     1 
HETATM 8580 O O     . HOH J 6 .   ? 10.018  3.325   -10.238 1.00 53.18  ? 770 HOH B O     1 
HETATM 8581 O O     . HOH J 6 .   ? 22.920  -7.037  -17.578 1.00 65.21  ? 771 HOH B O     1 
HETATM 8582 O O     . HOH J 6 .   ? 24.409  6.003   -35.462 1.00 52.56  ? 772 HOH B O     1 
HETATM 8583 O O     . HOH J 6 .   ? 16.568  30.094  -33.158 1.00 49.18  ? 773 HOH B O     1 
HETATM 8584 O O     . HOH J 6 .   ? -0.289  20.572  -64.274 1.00 43.18  ? 774 HOH B O     1 
HETATM 8585 O O     . HOH J 6 .   ? -14.320 7.733   -22.682 1.00 42.76  ? 775 HOH B O     1 
HETATM 8586 O O     . HOH J 6 .   ? 25.485  9.899   -29.367 1.00 32.95  ? 776 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 ?   ?   ?   A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
A 1 544 ALA 544 544 ?   ?   ?   A . n 
A 1 545 THR 545 545 ?   ?   ?   A . n 
A 1 546 GLY 546 546 ?   ?   ?   A . n 
A 1 547 ALA 547 547 ?   ?   ?   A . n 
A 1 548 PRO 548 548 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 ?   ?   ?   B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
B 1 544 ALA 544 544 ?   ?   ?   B . n 
B 1 545 THR 545 545 ?   ?   ?   B . n 
B 1 546 GLY 546 546 ?   ?   ?   B . n 
B 1 547 ALA 547 547 ?   ?   ?   B . n 
B 1 548 PRO 548 548 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 E5H 1  601 1   E5H 264 A . 
D 3 TOE 1  602 1   TOE P3G A . 
E 4 PG0 1  603 2   PG0 P2G A . 
F 2 E5H 1  601 2   E5H 264 B . 
G 5 1PG 1  602 1   1PG P5G B . 
H 4 PG0 1  603 1   PG0 P2G B . 
I 6 HOH 1  701 78  HOH HOH A . 
I 6 HOH 2  702 159 HOH HOH A . 
I 6 HOH 3  703 6   HOH HOH A . 
I 6 HOH 4  704 294 HOH HOH A . 
I 6 HOH 5  705 35  HOH HOH A . 
I 6 HOH 6  706 288 HOH HOH A . 
I 6 HOH 7  707 39  HOH HOH A . 
I 6 HOH 8  708 58  HOH HOH A . 
I 6 HOH 9  709 203 HOH HOH A . 
I 6 HOH 10 710 98  HOH HOH A . 
I 6 HOH 11 711 34  HOH HOH A . 
I 6 HOH 12 712 282 HOH HOH A . 
I 6 HOH 13 713 25  HOH HOH A . 
I 6 HOH 14 714 129 HOH HOH A . 
I 6 HOH 15 715 298 HOH HOH A . 
I 6 HOH 16 716 149 HOH HOH A . 
I 6 HOH 17 717 263 HOH HOH A . 
I 6 HOH 18 718 23  HOH HOH A . 
I 6 HOH 19 719 15  HOH HOH A . 
I 6 HOH 20 720 18  HOH HOH A . 
I 6 HOH 21 721 100 HOH HOH A . 
I 6 HOH 22 722 44  HOH HOH A . 
I 6 HOH 23 723 166 HOH HOH A . 
I 6 HOH 24 724 190 HOH HOH A . 
I 6 HOH 25 725 9   HOH HOH A . 
I 6 HOH 26 726 163 HOH HOH A . 
I 6 HOH 27 727 28  HOH HOH A . 
I 6 HOH 28 728 184 HOH HOH A . 
I 6 HOH 29 729 55  HOH HOH A . 
I 6 HOH 30 730 85  HOH HOH A . 
I 6 HOH 31 731 151 HOH HOH A . 
I 6 HOH 32 732 144 HOH HOH A . 
I 6 HOH 33 733 54  HOH HOH A . 
I 6 HOH 34 734 289 HOH HOH A . 
I 6 HOH 35 735 31  HOH HOH A . 
I 6 HOH 36 736 167 HOH HOH A . 
I 6 HOH 37 737 171 HOH HOH A . 
I 6 HOH 38 738 162 HOH HOH A . 
I 6 HOH 39 739 152 HOH HOH A . 
I 6 HOH 40 740 249 HOH HOH A . 
I 6 HOH 41 741 211 HOH HOH A . 
I 6 HOH 42 742 188 HOH HOH A . 
I 6 HOH 43 743 59  HOH HOH A . 
I 6 HOH 44 744 266 HOH HOH A . 
I 6 HOH 45 745 67  HOH HOH A . 
I 6 HOH 46 746 275 HOH HOH A . 
I 6 HOH 47 747 46  HOH HOH A . 
I 6 HOH 48 748 183 HOH HOH A . 
I 6 HOH 49 749 3   HOH HOH A . 
I 6 HOH 50 750 231 HOH HOH A . 
I 6 HOH 51 751 169 HOH HOH A . 
I 6 HOH 52 752 233 HOH HOH A . 
I 6 HOH 53 753 7   HOH HOH A . 
I 6 HOH 54 754 142 HOH HOH A . 
I 6 HOH 55 755 177 HOH HOH A . 
I 6 HOH 56 756 224 HOH HOH A . 
I 6 HOH 57 757 37  HOH HOH A . 
I 6 HOH 58 758 27  HOH HOH A . 
I 6 HOH 59 759 42  HOH HOH A . 
I 6 HOH 60 760 26  HOH HOH A . 
I 6 HOH 61 761 69  HOH HOH A . 
I 6 HOH 62 762 196 HOH HOH A . 
I 6 HOH 63 763 130 HOH HOH A . 
I 6 HOH 64 764 154 HOH HOH A . 
I 6 HOH 65 765 84  HOH HOH A . 
I 6 HOH 66 766 175 HOH HOH A . 
I 6 HOH 67 767 145 HOH HOH A . 
I 6 HOH 68 768 83  HOH HOH A . 
I 6 HOH 69 769 230 HOH HOH A . 
I 6 HOH 70 770 96  HOH HOH A . 
I 6 HOH 71 771 124 HOH HOH A . 
I 6 HOH 72 772 63  HOH HOH A . 
I 6 HOH 73 773 79  HOH HOH A . 
I 6 HOH 74 774 257 HOH HOH A . 
I 6 HOH 75 775 131 HOH HOH A . 
I 6 HOH 76 776 157 HOH HOH A . 
I 6 HOH 77 777 173 HOH HOH A . 
I 6 HOH 78 778 221 HOH HOH A . 
I 6 HOH 79 779 120 HOH HOH A . 
I 6 HOH 80 780 229 HOH HOH A . 
I 6 HOH 81 781 36  HOH HOH A . 
I 6 HOH 82 782 209 HOH HOH A . 
I 6 HOH 83 783 255 HOH HOH A . 
I 6 HOH 84 784 242 HOH HOH A . 
I 6 HOH 85 785 114 HOH HOH A . 
I 6 HOH 86 786 38  HOH HOH A . 
I 6 HOH 87 787 291 HOH HOH A . 
I 6 HOH 88 788 89  HOH HOH A . 
I 6 HOH 89 789 93  HOH HOH A . 
J 6 HOH 1  701 20  HOH HOH B . 
J 6 HOH 2  702 19  HOH HOH B . 
J 6 HOH 3  703 301 HOH HOH B . 
J 6 HOH 4  704 56  HOH HOH B . 
J 6 HOH 5  705 49  HOH HOH B . 
J 6 HOH 6  706 137 HOH HOH B . 
J 6 HOH 7  707 97  HOH HOH B . 
J 6 HOH 8  708 45  HOH HOH B . 
J 6 HOH 9  709 24  HOH HOH B . 
J 6 HOH 10 710 14  HOH HOH B . 
J 6 HOH 11 711 77  HOH HOH B . 
J 6 HOH 12 712 271 HOH HOH B . 
J 6 HOH 13 713 273 HOH HOH B . 
J 6 HOH 14 714 76  HOH HOH B . 
J 6 HOH 15 715 82  HOH HOH B . 
J 6 HOH 16 716 48  HOH HOH B . 
J 6 HOH 17 717 102 HOH HOH B . 
J 6 HOH 18 718 135 HOH HOH B . 
J 6 HOH 19 719 116 HOH HOH B . 
J 6 HOH 20 720 212 HOH HOH B . 
J 6 HOH 21 721 91  HOH HOH B . 
J 6 HOH 22 722 1   HOH HOH B . 
J 6 HOH 23 723 236 HOH HOH B . 
J 6 HOH 24 724 65  HOH HOH B . 
J 6 HOH 25 725 237 HOH HOH B . 
J 6 HOH 26 726 147 HOH HOH B . 
J 6 HOH 27 727 92  HOH HOH B . 
J 6 HOH 28 728 244 HOH HOH B . 
J 6 HOH 29 729 72  HOH HOH B . 
J 6 HOH 30 730 123 HOH HOH B . 
J 6 HOH 31 731 5   HOH HOH B . 
J 6 HOH 32 732 112 HOH HOH B . 
J 6 HOH 33 733 22  HOH HOH B . 
J 6 HOH 34 734 300 HOH HOH B . 
J 6 HOH 35 735 110 HOH HOH B . 
J 6 HOH 36 736 16  HOH HOH B . 
J 6 HOH 37 737 141 HOH HOH B . 
J 6 HOH 38 738 43  HOH HOH B . 
J 6 HOH 39 739 99  HOH HOH B . 
J 6 HOH 40 740 86  HOH HOH B . 
J 6 HOH 41 741 47  HOH HOH B . 
J 6 HOH 42 742 4   HOH HOH B . 
J 6 HOH 43 743 70  HOH HOH B . 
J 6 HOH 44 744 170 HOH HOH B . 
J 6 HOH 45 745 66  HOH HOH B . 
J 6 HOH 46 746 186 HOH HOH B . 
J 6 HOH 47 747 227 HOH HOH B . 
J 6 HOH 48 748 210 HOH HOH B . 
J 6 HOH 49 749 280 HOH HOH B . 
J 6 HOH 50 750 133 HOH HOH B . 
J 6 HOH 51 751 115 HOH HOH B . 
J 6 HOH 52 752 30  HOH HOH B . 
J 6 HOH 53 753 267 HOH HOH B . 
J 6 HOH 54 754 225 HOH HOH B . 
J 6 HOH 55 755 213 HOH HOH B . 
J 6 HOH 56 756 158 HOH HOH B . 
J 6 HOH 57 757 40  HOH HOH B . 
J 6 HOH 58 758 140 HOH HOH B . 
J 6 HOH 59 759 105 HOH HOH B . 
J 6 HOH 60 760 132 HOH HOH B . 
J 6 HOH 61 761 52  HOH HOH B . 
J 6 HOH 62 762 189 HOH HOH B . 
J 6 HOH 63 763 153 HOH HOH B . 
J 6 HOH 64 764 148 HOH HOH B . 
J 6 HOH 65 765 205 HOH HOH B . 
J 6 HOH 66 766 118 HOH HOH B . 
J 6 HOH 67 767 176 HOH HOH B . 
J 6 HOH 68 768 223 HOH HOH B . 
J 6 HOH 69 769 41  HOH HOH B . 
J 6 HOH 70 770 94  HOH HOH B . 
J 6 HOH 71 771 164 HOH HOH B . 
J 6 HOH 72 772 90  HOH HOH B . 
J 6 HOH 73 773 117 HOH HOH B . 
J 6 HOH 74 774 51  HOH HOH B . 
J 6 HOH 75 775 293 HOH HOH B . 
J 6 HOH 76 776 279 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3750  ? 
1 MORE         7     ? 
1 'SSA (A^2)'  37040 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-10-31 
2 'Structure model' 1 1 2019-04-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                
2 2 'Structure model' citation_author         
3 2 'Structure model' database_PDB_rev        
4 2 'Structure model' database_PDB_rev_record 
5 2 'Structure model' pdbx_database_proc      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_abbrev'  
2 2 'Structure model' '_citation.journal_id_ISSN' 
3 2 'Structure model' '_citation.journal_volume'  
4 2 'Structure model' '_citation.page_first'      
5 2 'Structure model' '_citation.page_last'       
6 2 'Structure model' '_citation.title'           
7 2 'Structure model' '_citation_author.name'     
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)'    1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                       2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA  ? ? ? .                       3 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot   ? ? ? '0.7.2 (revision 4730)' 4 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             81 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE1 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             81 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.172 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            -0.080 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 72.89   -5.30   
2  1 CYS A 96  ? ? -154.85 -3.26   
3  1 ALA A 167 ? ? -157.42 64.36   
4  1 SER A 203 ? ? 58.63   -124.05 
5  1 SER A 240 ? ? -49.65  160.37  
6  1 ASP A 306 ? ? -126.94 -84.16  
7  1 VAL A 367 ? ? -115.86 67.06   
8  1 HIS A 387 ? ? -143.65 55.85   
9  1 PRO A 388 ? ? -66.55  2.58    
10 1 VAL A 407 ? ? -131.69 -65.22  
11 1 ARG A 493 ? ? -87.75  -74.45  
12 1 ASP A 494 ? ? -35.86  87.23   
13 1 ALA A 506 ? ? -56.72  -74.04  
14 1 PRO B 41  ? ? -79.99  41.77   
15 1 ALA B 62  ? ? -114.11 60.87   
16 1 GLN B 66  ? ? -71.19  -169.55 
17 1 CYS B 96  ? ? -144.74 -6.97   
18 1 LEU B 97  ? ? -64.73  74.27   
19 1 ARG B 107 ? ? -39.19  139.07  
20 1 PHE B 123 ? ? 59.35   15.30   
21 1 ALA B 167 ? ? -168.75 64.13   
22 1 SER B 203 ? ? 58.81   -122.69 
23 1 ASP B 306 ? ? -126.48 -81.44  
24 1 TYR B 341 ? ? -97.53  34.77   
25 1 ASN B 350 ? ? -94.85  -147.65 
26 1 VAL B 367 ? ? -116.30 68.82   
27 1 VAL B 407 ? ? -125.99 -61.34  
28 1 SER B 495 ? ? -83.33  -123.84 
29 1 LYS B 496 ? ? 69.46   134.94  
30 1 PRO B 498 ? ? -57.68  85.80   
31 1 ALA B 542 ? ? 178.94  39.16   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 496 ? CG  ? A LYS 496 CG  
2  1 Y 1 A LYS 496 ? CD  ? A LYS 496 CD  
3  1 Y 1 A LYS 496 ? CE  ? A LYS 496 CE  
4  1 Y 1 A LYS 496 ? NZ  ? A LYS 496 NZ  
5  1 Y 1 B ARG 493 ? CG  ? B ARG 493 CG  
6  1 Y 1 B ARG 493 ? CD  ? B ARG 493 CD  
7  1 Y 1 B ARG 493 ? NE  ? B ARG 493 NE  
8  1 Y 1 B ARG 493 ? CZ  ? B ARG 493 CZ  
9  1 Y 1 B ARG 493 ? NH1 ? B ARG 493 NH1 
10 1 Y 1 B ARG 493 ? NH2 ? B ARG 493 NH2 
11 1 N 1 A E5H 601 ? C1  ? C E5H 1   C1  
12 1 N 1 A E5H 601 ? C2  ? C E5H 1   C2  
13 1 N 1 A E5H 601 ? C3  ? C E5H 1   C3  
14 1 N 1 A E5H 601 ? C4  ? C E5H 1   C4  
15 1 N 1 A E5H 601 ? C5  ? C E5H 1   C5  
16 1 N 1 B E5H 601 ? C1  ? F E5H 1   C1  
17 1 N 1 B E5H 601 ? C2  ? F E5H 1   C2  
18 1 N 1 B E5H 601 ? C3  ? F E5H 1   C3  
19 1 N 1 B E5H 601 ? C4  ? F E5H 1   C4  
20 1 N 1 B E5H 601 ? C5  ? F E5H 1   C5  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 258 ? A PRO 258 
2  1 Y 1 A PRO 259 ? A PRO 259 
3  1 Y 1 A GLY 260 ? A GLY 260 
4  1 Y 1 A GLY 261 ? A GLY 261 
5  1 Y 1 A ALA 262 ? A ALA 262 
6  1 Y 1 A GLY 263 ? A GLY 263 
7  1 Y 1 A GLY 264 ? A GLY 264 
8  1 Y 1 A THR 543 ? A THR 543 
9  1 Y 1 A ALA 544 ? A ALA 544 
10 1 Y 1 A THR 545 ? A THR 545 
11 1 Y 1 A GLY 546 ? A GLY 546 
12 1 Y 1 A ALA 547 ? A ALA 547 
13 1 Y 1 A PRO 548 ? A PRO 548 
14 1 Y 1 B GLU 1   ? B GLU 1   
15 1 Y 1 B GLY 2   ? B GLY 2   
16 1 Y 1 B ARG 3   ? B ARG 3   
17 1 Y 1 B PRO 258 ? B PRO 258 
18 1 Y 1 B PRO 259 ? B PRO 259 
19 1 Y 1 B GLY 260 ? B GLY 260 
20 1 Y 1 B GLY 261 ? B GLY 261 
21 1 Y 1 B ALA 262 ? B ALA 262 
22 1 Y 1 B GLY 263 ? B GLY 263 
23 1 Y 1 B GLY 264 ? B GLY 264 
24 1 Y 1 B ALA 544 ? B ALA 544 
25 1 Y 1 B THR 545 ? B THR 545 
26 1 Y 1 B GLY 546 ? B GLY 546 
27 1 Y 1 B ALA 547 ? B ALA 547 
28 1 Y 1 B PRO 548 ? B PRO 548 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Swedish Research Council' Sweden 2014-4218 1 
'Swedish Research Council' Sweden 2014-2636 2 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        E5H 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   E5H 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-(4-phenylphenoxy)-~{N}-(3-piperidin-1-ylpropyl)ethanamide'   E5H 
3 '2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXYL'                       TOE 
4 '2-(2-METHOXYETHOXY)ETHANOL'                                    PG0 
5 '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL' 1PG 
6 water                                                           HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#