data_6FY5
# 
_entry.id   6FY5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6FY5         
WWPDB D_1200009114 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        'macroh2A1.1 macro domain' 
_pdbx_database_related.db_id          1zr3 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6FY5 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Hothorn, M.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   0000-0002-3597-5698 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'EMBO Rep.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1469-3178 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            19 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'MacroH2A histone variants limit chromatin plasticity through two distinct mechanisms.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.15252/embr.201744445 
_citation.pdbx_database_id_PubMed   30177554 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kozlowski, M.'        1  ?                   
primary 'Corujo, D.'           2  ?                   
primary 'Hothorn, M.'          3  0000-0002-3597-5698 
primary 'Guberovic, I.'        4  ?                   
primary 'Mandemaker, I.K.'     5  ?                   
primary 'Blessing, C.'         6  ?                   
primary 'Sporn, J.'            7  ?                   
primary 'Gutierrez-Triana, A.' 8  ?                   
primary 'Smith, R.'            9  ?                   
primary 'Portmann, T.'         10 ?                   
primary 'Treier, M.'           11 ?                   
primary 'Scheffzek, K.'        12 ?                   
primary 'Huet, S.'             13 ?                   
primary 'Timinszky, G.'        14 0000-0001-6342-8985 
primary 'Buschbeck, M.'        15 0000-0002-3218-4567 
primary 'Ladurner, A.G.'       16 0000-0003-3835-232X 
# 
_cell.entry_id           6FY5 
_cell.length_a           57.750 
_cell.length_b           41.370 
_cell.length_c           84.150 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.05 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         6FY5 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Core histone macro-H2A.2' 21269.057 2   ? ? ? ? 
2 non-polymer syn 'ACETATE ION'              59.044    2   ? ? ? ? 
3 non-polymer syn 1,2-ETHANEDIOL             62.068    3   ? ? ? ? 
4 water       nat water                      18.015    195 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        mH2A2 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AGMGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGP
LEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAI
SAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AGMGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGP
LEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAI
SAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   GLY n 
1 3   MET n 
1 4   GLY n 
1 5   PRO n 
1 6   GLY n 
1 7   ASP n 
1 8   GLY n 
1 9   PHE n 
1 10  THR n 
1 11  ILE n 
1 12  LEU n 
1 13  SER n 
1 14  SER n 
1 15  LYS n 
1 16  SER n 
1 17  LEU n 
1 18  VAL n 
1 19  LEU n 
1 20  GLY n 
1 21  GLN n 
1 22  LYS n 
1 23  LEU n 
1 24  SER n 
1 25  LEU n 
1 26  THR n 
1 27  GLN n 
1 28  SER n 
1 29  ASP n 
1 30  ILE n 
1 31  SER n 
1 32  HIS n 
1 33  ILE n 
1 34  GLY n 
1 35  SER n 
1 36  MET n 
1 37  ARG n 
1 38  VAL n 
1 39  GLU n 
1 40  GLY n 
1 41  ILE n 
1 42  VAL n 
1 43  HIS n 
1 44  PRO n 
1 45  THR n 
1 46  THR n 
1 47  ALA n 
1 48  GLU n 
1 49  ILE n 
1 50  ASP n 
1 51  LEU n 
1 52  LYS n 
1 53  GLU n 
1 54  ASP n 
1 55  ILE n 
1 56  GLY n 
1 57  LYS n 
1 58  ALA n 
1 59  LEU n 
1 60  GLU n 
1 61  LYS n 
1 62  ALA n 
1 63  GLY n 
1 64  GLY n 
1 65  LYS n 
1 66  GLU n 
1 67  PHE n 
1 68  LEU n 
1 69  GLU n 
1 70  THR n 
1 71  VAL n 
1 72  LYS n 
1 73  GLU n 
1 74  LEU n 
1 75  ARG n 
1 76  LYS n 
1 77  SER n 
1 78  GLN n 
1 79  GLY n 
1 80  PRO n 
1 81  LEU n 
1 82  GLU n 
1 83  VAL n 
1 84  ALA n 
1 85  GLU n 
1 86  ALA n 
1 87  ALA n 
1 88  VAL n 
1 89  SER n 
1 90  GLN n 
1 91  SER n 
1 92  SER n 
1 93  GLY n 
1 94  LEU n 
1 95  ALA n 
1 96  ALA n 
1 97  LYS n 
1 98  PHE n 
1 99  VAL n 
1 100 ILE n 
1 101 HIS n 
1 102 CYS n 
1 103 HIS n 
1 104 ILE n 
1 105 PRO n 
1 106 GLN n 
1 107 TRP n 
1 108 GLY n 
1 109 SER n 
1 110 ASP n 
1 111 LYS n 
1 112 CYS n 
1 113 GLU n 
1 114 GLU n 
1 115 GLN n 
1 116 LEU n 
1 117 GLU n 
1 118 GLU n 
1 119 THR n 
1 120 ILE n 
1 121 LYS n 
1 122 ASN n 
1 123 CYS n 
1 124 LEU n 
1 125 SER n 
1 126 ALA n 
1 127 ALA n 
1 128 GLU n 
1 129 ASP n 
1 130 LYS n 
1 131 LYS n 
1 132 LEU n 
1 133 LYS n 
1 134 SER n 
1 135 VAL n 
1 136 ALA n 
1 137 PHE n 
1 138 PRO n 
1 139 PRO n 
1 140 PHE n 
1 141 PRO n 
1 142 SER n 
1 143 GLY n 
1 144 ARG n 
1 145 ASN n 
1 146 CYS n 
1 147 PHE n 
1 148 PRO n 
1 149 LYS n 
1 150 GLN n 
1 151 THR n 
1 152 ALA n 
1 153 ALA n 
1 154 GLN n 
1 155 VAL n 
1 156 THR n 
1 157 LEU n 
1 158 LYS n 
1 159 ALA n 
1 160 ILE n 
1 161 SER n 
1 162 ALA n 
1 163 HIS n 
1 164 PHE n 
1 165 ASP n 
1 166 ASP n 
1 167 SER n 
1 168 SER n 
1 169 ALA n 
1 170 SER n 
1 171 SER n 
1 172 LEU n 
1 173 LYS n 
1 174 ASN n 
1 175 VAL n 
1 176 TYR n 
1 177 PHE n 
1 178 LEU n 
1 179 LEU n 
1 180 PHE n 
1 181 ASP n 
1 182 SER n 
1 183 GLU n 
1 184 SER n 
1 185 ILE n 
1 186 GLY n 
1 187 ILE n 
1 188 TYR n 
1 189 VAL n 
1 190 GLN n 
1 191 GLU n 
1 192 MET n 
1 193 ALA n 
1 194 LYS n 
1 195 LEU n 
1 196 ASP n 
1 197 ALA n 
1 198 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   198 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'H2AFY2, MACROH2A2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pETM11 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    H2AW_HUMAN 
_struct_ref.pdbx_db_accession          Q9P0M6 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEV
AEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAH
FDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK
;
_struct_ref.pdbx_align_begin           178 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6FY5 A 4 ? 198 ? Q9P0M6 178 ? 372 ? 178 372 
2 1 6FY5 B 4 ? 198 ? Q9P0M6 178 ? 372 ? 178 372 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6FY5 ALA A 1 ? UNP Q9P0M6 ? ? 'expression tag' 175 1 
1 6FY5 GLY A 2 ? UNP Q9P0M6 ? ? 'expression tag' 176 2 
1 6FY5 MET A 3 ? UNP Q9P0M6 ? ? 'expression tag' 177 3 
2 6FY5 ALA B 1 ? UNP Q9P0M6 ? ? 'expression tag' 175 4 
2 6FY5 GLY B 2 ? UNP Q9P0M6 ? ? 'expression tag' 176 5 
2 6FY5 MET B 3 ? UNP Q9P0M6 ? ? 'expression tag' 177 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'   ?                 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6FY5 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.34 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.49 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '12.5% (w/v) PEG 1,000, 0.2 M sodium acetate, 0.1 M Mes pH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MAR CCD 165 mm' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2005-05-07 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97565 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97565 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            29.38 
_reflns.entry_id                         6FY5 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.65 
_reflns.d_resolution_low                 19.69 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       46778 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.0 
_reflns.percent_possible_obs             97.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.15 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.06 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.65 
_reflns_shell.d_res_low                   1.69 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.25 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           2724 
_reflns_shell.percent_possible_all        92.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             1.10 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.45 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 6FY5 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     46616 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.68 
_refine.ls_d_res_high                            1.65 
_refine.ls_percent_reflns_obs                    97.5 
_refine.ls_R_factor_obs                          0.216 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.215 
_refine.ls_R_factor_R_free                       0.244 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.970 
_refine.ls_number_reflns_R_free                  2315 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.946 
_refine.correlation_coeff_Fo_to_Fc_free          0.935 
_refine.B_iso_mean                               41.10 
_refine.aniso_B[1][1]                            6.80680 
_refine.aniso_B[2][2]                            -2.63850 
_refine.aniso_B[3][3]                            -4.16830 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            5.29290 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1ZR3 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.110 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.106 
_refine.pdbx_overall_SU_R_Blow_DPI               0.111 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.106 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        6FY5 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        2958 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             195 
_refine_hist.number_atoms_total               3173 
_refine_hist.d_res_high                       1.65 
_refine_hist.d_res_low                        19.68 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  3055 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.12  ? 2.00  4111 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  1092 'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_gen_planes              ?     ? 5.00  519  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 3055 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           2.95  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           17.89 ? ?     ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  407  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  3828 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.65 
_refine_ls_shell.d_res_low                        1.69 
_refine_ls_shell.number_reflns_R_work             2598 
_refine_ls_shell.R_factor_R_work                  0.2389 
_refine_ls_shell.percent_reflns_obs               77.86 
_refine_ls_shell.R_factor_R_free                  0.2479 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.59 
_refine_ls_shell.number_reflns_R_free             125 
_refine_ls_shell.number_reflns_all                2723 
_refine_ls_shell.R_factor_all                     0.2393 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     6FY5 
_struct.title                        'Crystal structure of the macro domain of human macroh2a2' 
_struct.pdbx_descriptor              'Core histone macro-H2A.2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6FY5 
_struct_keywords.text            'macro domain, histone variant, DNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ILE A 30  ? MET A 36  ? ILE A 204 MET A 210 5 ? 7  
HELX_P HELX_P2  AA2 LYS A 52  ? GLY A 79  ? LYS A 226 GLY A 253 1 ? 28 
HELX_P HELX_P3  AA3 LYS A 111 ? ASP A 129 ? LYS A 285 ASP A 303 1 ? 19 
HELX_P HELX_P4  AA4 PRO A 148 ? ASP A 166 ? PRO A 322 ASP A 340 1 ? 19 
HELX_P HELX_P5  AA5 ASP A 181 ? ALA A 193 ? ASP A 355 ALA A 367 1 ? 13 
HELX_P HELX_P6  AA6 ASP B 29  ? MET B 36  ? ASP B 203 MET B 210 5 ? 8  
HELX_P HELX_P7  AA7 GLU B 53  ? GLY B 79  ? GLU B 227 GLY B 253 1 ? 27 
HELX_P HELX_P8  AA8 LYS B 111 ? LYS B 130 ? LYS B 285 LYS B 304 1 ? 20 
HELX_P HELX_P9  AA9 PRO B 148 ? SER B 167 ? PRO B 322 SER B 341 1 ? 20 
HELX_P HELX_P10 AB1 ASP B 181 ? ALA B 193 ? ASP B 355 ALA B 367 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           79 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            253 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    80 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     254 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -3.60 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA2 5 6 ? parallel      
AA2 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 9   ? SER A 16  ? PHE A 183 SER A 190 
AA1 2 LYS A 22  ? SER A 28  ? LYS A 196 SER A 202 
AA1 3 ASN A 174 ? LEU A 179 ? ASN A 348 LEU A 353 
AA1 4 SER A 134 ? PHE A 137 ? SER A 308 PHE A 311 
AA1 5 GLY A 40  ? THR A 45  ? GLY A 214 THR A 219 
AA1 6 PHE A 98  ? HIS A 103 ? PHE A 272 HIS A 277 
AA1 7 ALA A 86  ? GLN A 90  ? ALA A 260 GLN A 264 
AA2 1 THR B 10  ? SER B 16  ? THR B 184 SER B 190 
AA2 2 LYS B 22  ? GLN B 27  ? LYS B 196 GLN B 201 
AA2 3 ASN B 174 ? LEU B 179 ? ASN B 348 LEU B 353 
AA2 4 SER B 134 ? PHE B 137 ? SER B 308 PHE B 311 
AA2 5 GLY B 40  ? THR B 45  ? GLY B 214 THR B 219 
AA2 6 PHE B 98  ? HIS B 103 ? PHE B 272 HIS B 277 
AA2 7 ALA B 86  ? GLN B 90  ? ALA B 260 GLN B 264 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR A 10  ? N THR A 184 O GLN A 27  ? O GLN A 201 
AA1 2 3 N THR A 26  ? N THR A 200 O PHE A 177 ? O PHE A 351 
AA1 3 4 O TYR A 176 ? O TYR A 350 N PHE A 137 ? N PHE A 311 
AA1 4 5 O ALA A 136 ? O ALA A 310 N VAL A 42  ? N VAL A 216 
AA1 5 6 N THR A 45  ? N THR A 219 O CYS A 102 ? O CYS A 276 
AA1 6 7 O HIS A 101 ? O HIS A 275 N ALA A 87  ? N ALA A 261 
AA2 1 2 N LEU B 12  ? N LEU B 186 O LEU B 25  ? O LEU B 199 
AA2 2 3 N THR B 26  ? N THR B 200 O PHE B 177 ? O PHE B 351 
AA2 3 4 O TYR B 176 ? O TYR B 350 N PHE B 137 ? N PHE B 311 
AA2 4 5 O ALA B 136 ? O ALA B 310 N VAL B 42  ? N VAL B 216 
AA2 5 6 N THR B 45  ? N THR B 219 O CYS B 102 ? O CYS B 276 
AA2 6 7 O HIS B 101 ? O HIS B 275 N ALA B 87  ? N ALA B 261 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ACT 1000 ? 4 'binding site for residue ACT A 1000' 
AC2 Software A EDO 1001 ? 7 'binding site for residue EDO A 1001' 
AC3 Software B ACT 1000 ? 3 'binding site for residue ACT B 1000' 
AC4 Software B EDO 1001 ? 8 'binding site for residue EDO B 1001' 
AC5 Software B EDO 1002 ? 7 'binding site for residue EDO B 1002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 GLU A 113 ? GLU A 287  . ? 1_555 ? 
2  AC1 4 GLU A 114 ? GLU A 288  . ? 1_555 ? 
3  AC1 4 GLU A 117 ? GLU A 291  . ? 1_555 ? 
4  AC1 4 LYS A 158 ? LYS A 332  . ? 1_555 ? 
5  AC2 7 PHE A 137 ? PHE A 311  . ? 1_555 ? 
6  AC2 7 PRO A 138 ? PRO A 312  . ? 1_555 ? 
7  AC2 7 PRO A 139 ? PRO A 313  . ? 1_555 ? 
8  AC2 7 PHE A 140 ? PHE A 314  . ? 1_555 ? 
9  AC2 7 LEU A 178 ? LEU A 352  . ? 1_555 ? 
10 AC2 7 TYR A 188 ? TYR A 362  . ? 1_555 ? 
11 AC2 7 HOH H .   ? HOH A 1122 . ? 1_555 ? 
12 AC3 3 GLY B 108 ? GLY B 282  . ? 1_555 ? 
13 AC3 3 SER B 109 ? SER B 283  . ? 1_555 ? 
14 AC3 3 GLU B 113 ? GLU B 287  . ? 1_555 ? 
15 AC4 8 PHE B 137 ? PHE B 311  . ? 1_555 ? 
16 AC4 8 PRO B 138 ? PRO B 312  . ? 1_555 ? 
17 AC4 8 PRO B 139 ? PRO B 313  . ? 1_555 ? 
18 AC4 8 PHE B 177 ? PHE B 351  . ? 1_555 ? 
19 AC4 8 LEU B 178 ? LEU B 352  . ? 1_555 ? 
20 AC4 8 LEU B 179 ? LEU B 353  . ? 1_555 ? 
21 AC4 8 TYR B 188 ? TYR B 362  . ? 1_555 ? 
22 AC4 8 EDO G .   ? EDO B 1002 . ? 1_555 ? 
23 AC5 7 PRO B 139 ? PRO B 313  . ? 1_555 ? 
24 AC5 7 PHE B 140 ? PHE B 314  . ? 1_555 ? 
25 AC5 7 LEU B 179 ? LEU B 353  . ? 1_555 ? 
26 AC5 7 SER B 184 ? SER B 358  . ? 1_555 ? 
27 AC5 7 TYR B 188 ? TYR B 362  . ? 1_555 ? 
28 AC5 7 EDO F .   ? EDO B 1001 . ? 1_555 ? 
29 AC5 7 HOH I .   ? HOH B 1134 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6FY5 
_atom_sites.fract_transf_matrix[1][1]   0.017316 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002141 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024172 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011974 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 41.573 46.216 95.496 1.00 44.52  ? 175  ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? 41.860 46.588 94.135 1.00 42.62  ? 175  ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? 41.242 45.577 93.206 1.00 43.14  ? 175  ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? 41.783 44.486 93.027 1.00 41.04  ? 175  ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? 43.362 46.652 93.914 1.00 43.38  ? 175  ALA A CB  1 
ATOM   6    N N   . GLY A 1 2   ? 40.092 45.934 92.655 1.00 39.36  ? 176  GLY A N   1 
ATOM   7    C CA  . GLY A 1 2   ? 39.395 45.092 91.692 1.00 39.12  ? 176  GLY A CA  1 
ATOM   8    C C   . GLY A 1 2   ? 40.052 45.269 90.343 1.00 38.40  ? 176  GLY A C   1 
ATOM   9    O O   . GLY A 1 2   ? 40.230 46.407 89.901 1.00 39.46  ? 176  GLY A O   1 
ATOM   10   N N   . MET A 1 3   ? 40.441 44.154 89.705 1.00 30.25  ? 177  MET A N   1 
ATOM   11   C CA  A MET A 1 3   ? 41.113 44.148 88.398 0.50 30.30  ? 177  MET A CA  1 
ATOM   12   C CA  B MET A 1 3   ? 41.072 44.169 88.382 0.50 28.68  ? 177  MET A CA  1 
ATOM   13   C C   . MET A 1 3   ? 40.588 43.011 87.517 1.00 29.51  ? 177  MET A C   1 
ATOM   14   O O   . MET A 1 3   ? 40.145 42.001 88.047 1.00 28.69  ? 177  MET A O   1 
ATOM   15   C CB  A MET A 1 3   ? 42.662 44.102 88.522 0.50 33.06  ? 177  MET A CB  1 
ATOM   16   C CB  B MET A 1 3   ? 42.593 44.145 88.489 0.50 30.12  ? 177  MET A CB  1 
ATOM   17   C CG  A MET A 1 3   ? 43.223 42.783 89.061 0.50 37.42  ? 177  MET A CG  1 
ATOM   18   C CG  B MET A 1 3   ? 43.108 42.895 89.118 0.50 32.57  ? 177  MET A CG  1 
ATOM   19   S SD  A MET A 1 3   ? 44.971 42.521 88.685 0.50 43.01  ? 177  MET A SD  1 
ATOM   20   S SD  B MET A 1 3   ? 44.751 43.225 89.633 0.50 35.64  ? 177  MET A SD  1 
ATOM   21   C CE  A MET A 1 3   ? 45.709 43.121 90.184 0.50 40.35  ? 177  MET A CE  1 
ATOM   22   C CE  B MET A 1 3   ? 45.630 42.112 88.533 0.50 31.30  ? 177  MET A CE  1 
ATOM   23   N N   . GLY A 1 4   ? 40.699 43.161 86.203 1.00 24.84  ? 178  GLY A N   1 
ATOM   24   C CA  . GLY A 1 4   ? 40.230 42.114 85.286 1.00 23.50  ? 178  GLY A CA  1 
ATOM   25   C C   . GLY A 1 4   ? 40.538 42.393 83.832 1.00 24.73  ? 178  GLY A C   1 
ATOM   26   O O   . GLY A 1 4   ? 41.125 43.436 83.523 1.00 25.44  ? 178  GLY A O   1 
ATOM   27   N N   . PRO A 1 5   ? 40.123 41.497 82.906 1.00 21.84  ? 179  PRO A N   1 
ATOM   28   C CA  . PRO A 1 5   ? 40.463 41.675 81.474 1.00 21.65  ? 179  PRO A CA  1 
ATOM   29   C C   . PRO A 1 5   ? 39.524 42.598 80.662 1.00 26.47  ? 179  PRO A C   1 
ATOM   30   O O   . PRO A 1 5   ? 38.688 42.155 79.866 1.00 25.38  ? 179  PRO A O   1 
ATOM   31   C CB  . PRO A 1 5   ? 40.466 40.233 80.943 1.00 23.80  ? 179  PRO A CB  1 
ATOM   32   C CG  . PRO A 1 5   ? 39.373 39.561 81.774 1.00 27.01  ? 179  PRO A CG  1 
ATOM   33   C CD  . PRO A 1 5   ? 39.480 40.184 83.152 1.00 22.80  ? 179  PRO A CD  1 
ATOM   34   N N   . GLY A 1 6   ? 39.707 43.892 80.840 1.00 23.56  ? 180  GLY A N   1 
ATOM   35   C CA  . GLY A 1 6   ? 38.918 44.890 80.148 1.00 23.73  ? 180  GLY A CA  1 
ATOM   36   C C   . GLY A 1 6   ? 37.907 45.541 81.048 1.00 29.78  ? 180  GLY A C   1 
ATOM   37   O O   . GLY A 1 6   ? 37.515 44.973 82.086 1.00 29.23  ? 180  GLY A O   1 
ATOM   38   N N   . ASP A 1 7   ? 37.518 46.782 80.681 1.00 27.23  ? 181  ASP A N   1 
ATOM   39   C CA  . ASP A 1 7   ? 36.526 47.513 81.443 1.00 28.00  ? 181  ASP A CA  1 
ATOM   40   C C   . ASP A 1 7   ? 35.249 46.678 81.408 1.00 28.09  ? 181  ASP A C   1 
ATOM   41   O O   . ASP A 1 7   ? 34.877 46.167 80.339 1.00 30.45  ? 181  ASP A O   1 
ATOM   42   C CB  . ASP A 1 7   ? 36.253 48.912 80.834 1.00 31.55  ? 181  ASP A CB  1 
ATOM   43   C CG  . ASP A 1 7   ? 35.448 49.784 81.772 1.00 51.50  ? 181  ASP A CG  1 
ATOM   44   O OD1 . ASP A 1 7   ? 36.029 50.284 82.768 1.00 56.13  ? 181  ASP A OD1 1 
ATOM   45   O OD2 . ASP A 1 7   ? 34.235 49.944 81.534 1.00 60.90  ? 181  ASP A OD2 1 
ATOM   46   N N   . GLY A 1 8   ? 34.674 46.486 82.578 1.00 25.56  ? 182  GLY A N   1 
ATOM   47   C CA  . GLY A 1 8   ? 33.451 45.721 82.788 1.00 24.92  ? 182  GLY A CA  1 
ATOM   48   C C   . GLY A 1 8   ? 33.695 44.338 83.370 1.00 25.27  ? 182  GLY A C   1 
ATOM   49   O O   . GLY A 1 8   ? 32.745 43.612 83.669 1.00 24.52  ? 182  GLY A O   1 
ATOM   50   N N   . PHE A 1 9   ? 34.976 43.938 83.510 1.00 21.83  ? 183  PHE A N   1 
ATOM   51   C CA  . PHE A 1 9   ? 35.268 42.578 83.992 1.00 22.33  ? 183  PHE A CA  1 
ATOM   52   C C   . PHE A 1 9   ? 36.176 42.601 85.214 1.00 27.60  ? 183  PHE A C   1 
ATOM   53   O O   . PHE A 1 9   ? 37.216 43.244 85.153 1.00 27.88  ? 183  PHE A O   1 
ATOM   54   C CB  . PHE A 1 9   ? 35.890 41.764 82.845 1.00 23.66  ? 183  PHE A CB  1 
ATOM   55   C CG  . PHE A 1 9   ? 34.978 41.712 81.633 1.00 24.76  ? 183  PHE A CG  1 
ATOM   56   C CD1 . PHE A 1 9   ? 33.951 40.776 81.556 1.00 24.58  ? 183  PHE A CD1 1 
ATOM   57   C CD2 . PHE A 1 9   ? 35.050 42.691 80.647 1.00 28.01  ? 183  PHE A CD2 1 
ATOM   58   C CE1 . PHE A 1 9   ? 33.056 40.789 80.487 1.00 24.95  ? 183  PHE A CE1 1 
ATOM   59   C CE2 . PHE A 1 9   ? 34.134 42.721 79.595 1.00 30.36  ? 183  PHE A CE2 1 
ATOM   60   C CZ  . PHE A 1 9   ? 33.140 41.773 79.521 1.00 26.84  ? 183  PHE A CZ  1 
ATOM   61   N N   . THR A 1 10  ? 35.792 41.943 86.317 1.00 23.22  ? 184  THR A N   1 
ATOM   62   C CA  . THR A 1 10  ? 36.660 41.888 87.517 1.00 22.14  ? 184  THR A CA  1 
ATOM   63   C C   . THR A 1 10  ? 36.958 40.454 87.930 1.00 21.72  ? 184  THR A C   1 
ATOM   64   O O   . THR A 1 10  ? 36.021 39.694 88.187 1.00 21.29  ? 184  THR A O   1 
ATOM   65   C CB  . THR A 1 10  ? 35.999 42.610 88.702 1.00 30.03  ? 184  THR A CB  1 
ATOM   66   O OG1 . THR A 1 10  ? 35.930 43.974 88.349 1.00 32.40  ? 184  THR A OG1 1 
ATOM   67   C CG2 . THR A 1 10  ? 36.823 42.457 90.025 1.00 27.42  ? 184  THR A CG2 1 
ATOM   68   N N   . ILE A 1 11  ? 38.256 40.095 88.104 1.00 19.61  ? 185  ILE A N   1 
ATOM   69   C CA  . ILE A 1 11  ? 38.545 38.735 88.594 1.00 17.82  ? 185  ILE A CA  1 
ATOM   70   C C   . ILE A 1 11  ? 38.154 38.569 90.057 1.00 21.19  ? 185  ILE A C   1 
ATOM   71   O O   . ILE A 1 11  ? 38.643 39.291 90.933 1.00 24.50  ? 185  ILE A O   1 
ATOM   72   C CB  . ILE A 1 11  ? 40.035 38.297 88.338 1.00 20.02  ? 185  ILE A CB  1 
ATOM   73   C CG1 . ILE A 1 11  ? 40.455 38.409 86.812 1.00 21.98  ? 185  ILE A CG1 1 
ATOM   74   C CG2 . ILE A 1 11  ? 40.303 36.900 88.919 1.00 19.66  ? 185  ILE A CG2 1 
ATOM   75   C CD1 . ILE A 1 11  ? 39.653 37.813 85.833 1.00 32.96  ? 185  ILE A CD1 1 
ATOM   76   N N   . LEU A 1 12  ? 37.308 37.591 90.331 1.00 19.34  ? 186  LEU A N   1 
ATOM   77   C CA  . LEU A 1 12  ? 36.864 37.298 91.674 1.00 19.67  ? 186  LEU A CA  1 
ATOM   78   C C   . LEU A 1 12  ? 37.715 36.257 92.401 1.00 23.75  ? 186  LEU A C   1 
ATOM   79   O O   . LEU A 1 12  ? 37.901 36.358 93.609 1.00 24.34  ? 186  LEU A O   1 
ATOM   80   C CB  . LEU A 1 12  ? 35.426 36.759 91.608 1.00 20.11  ? 186  LEU A CB  1 
ATOM   81   C CG  . LEU A 1 12  ? 34.405 37.732 90.987 1.00 24.48  ? 186  LEU A CG  1 
ATOM   82   C CD1 . LEU A 1 12  ? 33.046 37.116 90.940 1.00 25.59  ? 186  LEU A CD1 1 
ATOM   83   C CD2 . LEU A 1 12  ? 34.346 39.051 91.774 1.00 29.94  ? 186  LEU A CD2 1 
ATOM   84   N N   . SER A 1 13  ? 38.131 35.209 91.672 1.00 21.46  ? 187  SER A N   1 
ATOM   85   C CA  . SER A 1 13  ? 38.864 34.048 92.233 1.00 22.30  ? 187  SER A CA  1 
ATOM   86   C C   . SER A 1 13  ? 39.497 33.262 91.089 1.00 26.17  ? 187  SER A C   1 
ATOM   87   O O   . SER A 1 13  ? 38.889 33.141 90.040 1.00 27.34  ? 187  SER A O   1 
ATOM   88   C CB  . SER A 1 13  ? 37.865 33.123 92.919 1.00 28.88  ? 187  SER A CB  1 
ATOM   89   O OG  . SER A 1 13  ? 38.527 32.128 93.677 1.00 45.32  ? 187  SER A OG  1 
ATOM   90   N N   . SER A 1 14  ? 40.733 32.720 91.272 1.00 23.48  ? 188  SER A N   1 
ATOM   91   C CA  . SER A 1 14  ? 41.387 31.977 90.198 1.00 23.27  ? 188  SER A CA  1 
ATOM   92   C C   . SER A 1 14  ? 42.039 30.727 90.753 1.00 28.96  ? 188  SER A C   1 
ATOM   93   O O   . SER A 1 14  ? 42.329 30.660 91.951 1.00 30.47  ? 188  SER A O   1 
ATOM   94   C CB  . SER A 1 14  ? 42.477 32.819 89.537 1.00 27.55  ? 188  SER A CB  1 
ATOM   95   O OG  . SER A 1 14  ? 41.931 33.967 88.922 1.00 34.64  ? 188  SER A OG  1 
ATOM   96   N N   . LYS A 1 15  ? 42.248 29.748 89.877 1.00 26.67  ? 189  LYS A N   1 
ATOM   97   C CA  . LYS A 1 15  ? 42.900 28.464 90.190 1.00 27.78  ? 189  LYS A CA  1 
ATOM   98   C C   . LYS A 1 15  ? 43.848 28.161 89.062 1.00 30.31  ? 189  LYS A C   1 
ATOM   99   O O   . LYS A 1 15  ? 43.504 28.373 87.884 1.00 31.10  ? 189  LYS A O   1 
ATOM   100  C CB  . LYS A 1 15  ? 41.843 27.359 90.351 1.00 31.16  ? 189  LYS A CB  1 
ATOM   101  C CG  . LYS A 1 15  ? 41.012 27.439 91.643 1.00 43.96  ? 189  LYS A CG  1 
ATOM   102  C CD  . LYS A 1 15  ? 41.790 27.223 92.942 1.00 53.04  ? 189  LYS A CD  1 
ATOM   103  C CE  . LYS A 1 15  ? 40.884 27.263 94.152 1.00 66.01  ? 189  LYS A CE  1 
ATOM   104  N NZ  . LYS A 1 15  ? 41.488 28.039 95.270 1.00 71.00  ? 189  LYS A NZ  1 
ATOM   105  N N   . SER A 1 16  ? 45.083 27.728 89.392 1.00 25.30  ? 190  SER A N   1 
ATOM   106  C CA  . SER A 1 16  ? 46.039 27.439 88.342 1.00 26.40  ? 190  SER A CA  1 
ATOM   107  C C   . SER A 1 16  ? 46.203 25.930 88.266 1.00 30.56  ? 190  SER A C   1 
ATOM   108  O O   . SER A 1 16  ? 46.483 25.332 89.288 1.00 31.98  ? 190  SER A O   1 
ATOM   109  C CB  . SER A 1 16  ? 47.365 28.149 88.614 1.00 30.69  ? 190  SER A CB  1 
ATOM   110  O OG  . SER A 1 16  ? 48.397 27.701 87.751 1.00 44.20  ? 190  SER A OG  1 
ATOM   111  N N   . LEU A 1 17  ? 45.969 25.329 87.095 1.00 25.06  ? 191  LEU A N   1 
ATOM   112  C CA  . LEU A 1 17  ? 46.049 23.871 86.901 1.00 23.72  ? 191  LEU A CA  1 
ATOM   113  C C   . LEU A 1 17  ? 47.538 23.461 86.831 1.00 26.60  ? 191  LEU A C   1 
ATOM   114  O O   . LEU A 1 17  ? 48.413 24.298 86.620 1.00 24.39  ? 191  LEU A O   1 
ATOM   115  C CB  . LEU A 1 17  ? 45.322 23.475 85.628 1.00 23.43  ? 191  LEU A CB  1 
ATOM   116  C CG  . LEU A 1 17  ? 43.817 23.829 85.490 1.00 26.71  ? 191  LEU A CG  1 
ATOM   117  C CD1 . LEU A 1 17  ? 43.245 23.252 84.174 1.00 27.42  ? 191  LEU A CD1 1 
ATOM   118  C CD2 . LEU A 1 17  ? 43.016 23.342 86.697 1.00 27.07  ? 191  LEU A CD2 1 
ATOM   119  N N   . VAL A 1 18  ? 47.826 22.183 87.047 1.00 26.28  ? 192  VAL A N   1 
ATOM   120  C CA  . VAL A 1 18  ? 49.219 21.680 87.085 1.00 24.42  ? 192  VAL A CA  1 
ATOM   121  C C   . VAL A 1 18  ? 50.060 22.056 85.868 1.00 25.51  ? 192  VAL A C   1 
ATOM   122  O O   . VAL A 1 18  ? 51.249 22.402 86.037 1.00 23.57  ? 192  VAL A O   1 
ATOM   123  C CB  . VAL A 1 18  ? 49.230 20.146 87.338 1.00 30.51  ? 192  VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 18  ? 50.612 19.543 87.084 1.00 30.32  ? 192  VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 18  ? 48.775 19.840 88.769 1.00 31.52  ? 192  VAL A CG2 1 
ATOM   126  N N   . LEU A 1 19  ? 49.489 21.984 84.649 1.00 22.20  ? 193  LEU A N   1 
ATOM   127  C CA  . LEU A 1 19  ? 50.225 22.340 83.468 1.00 24.07  ? 193  LEU A CA  1 
ATOM   128  C C   . LEU A 1 19  ? 50.130 23.833 83.149 1.00 26.91  ? 193  LEU A C   1 
ATOM   129  O O   . LEU A 1 19  ? 50.477 24.250 82.044 1.00 28.60  ? 193  LEU A O   1 
ATOM   130  C CB  . LEU A 1 19  ? 49.868 21.440 82.249 1.00 25.99  ? 193  LEU A CB  1 
ATOM   131  C CG  . LEU A 1 19  ? 50.104 19.934 82.483 1.00 32.39  ? 193  LEU A CG  1 
ATOM   132  C CD1 . LEU A 1 19  ? 49.400 19.100 81.469 1.00 33.93  ? 193  LEU A CD1 1 
ATOM   133  C CD2 . LEU A 1 19  ? 51.584 19.620 82.514 1.00 32.58  ? 193  LEU A CD2 1 
ATOM   134  N N   . GLY A 1 20  ? 49.734 24.638 84.144 1.00 23.49  ? 194  GLY A N   1 
ATOM   135  C CA  . GLY A 1 20  ? 49.852 26.083 84.045 1.00 20.83  ? 194  GLY A CA  1 
ATOM   136  C C   . GLY A 1 20  ? 48.702 26.906 83.551 1.00 23.82  ? 194  GLY A C   1 
ATOM   137  O O   . GLY A 1 20  ? 48.806 28.131 83.587 1.00 22.71  ? 194  GLY A O   1 
ATOM   138  N N   . GLN A 1 21  ? 47.592 26.275 83.107 1.00 20.54  ? 195  GLN A N   1 
ATOM   139  C CA  . GLN A 1 21  ? 46.412 27.070 82.645 1.00 20.47  ? 195  GLN A CA  1 
ATOM   140  C C   . GLN A 1 21  ? 45.740 27.728 83.852 1.00 25.65  ? 195  GLN A C   1 
ATOM   141  O O   . GLN A 1 21  ? 45.708 27.137 84.925 1.00 26.16  ? 195  GLN A O   1 
ATOM   142  C CB  . GLN A 1 21  ? 45.411 26.158 81.941 1.00 21.78  ? 195  GLN A CB  1 
ATOM   143  C CG  . GLN A 1 21  ? 45.926 25.454 80.683 1.00 22.54  ? 195  GLN A CG  1 
ATOM   144  C CD  . GLN A 1 21  ? 46.661 24.157 80.977 1.00 26.22  ? 195  GLN A CD  1 
ATOM   145  O OE1 . GLN A 1 21  ? 46.718 23.676 82.110 1.00 22.44  ? 195  GLN A OE1 1 
ATOM   146  N NE2 . GLN A 1 21  ? 47.228 23.568 79.934 1.00 24.62  ? 195  GLN A NE2 1 
ATOM   147  N N   . LYS A 1 22  ? 45.220 28.971 83.689 1.00 22.36  ? 196  LYS A N   1 
ATOM   148  C CA  . LYS A 1 22  ? 44.610 29.682 84.805 1.00 21.79  ? 196  LYS A CA  1 
ATOM   149  C C   . LYS A 1 22  ? 43.109 29.756 84.536 1.00 21.98  ? 196  LYS A C   1 
ATOM   150  O O   . LYS A 1 22  ? 42.733 30.136 83.448 1.00 22.66  ? 196  LYS A O   1 
ATOM   151  C CB  . LYS A 1 22  ? 45.164 31.122 84.899 1.00 24.17  ? 196  LYS A CB  1 
ATOM   152  C CG  . LYS A 1 22  ? 44.818 31.823 86.202 1.00 29.78  ? 196  LYS A CG  1 
ATOM   153  C CD  . LYS A 1 22  ? 45.561 33.153 86.289 1.00 35.94  ? 196  LYS A CD  1 
ATOM   154  C CE  . LYS A 1 22  ? 44.713 34.350 86.629 1.00 46.82  ? 196  LYS A CE  1 
ATOM   155  N NZ  . LYS A 1 22  ? 45.393 35.630 86.254 1.00 47.73  ? 196  LYS A NZ  1 
ATOM   156  N N   . LEU A 1 23  ? 42.301 29.352 85.486 1.00 20.32  ? 197  LEU A N   1 
ATOM   157  C CA  . LEU A 1 23  ? 40.832 29.445 85.363 1.00 20.66  ? 197  LEU A CA  1 
ATOM   158  C C   . LEU A 1 23  ? 40.402 30.601 86.266 1.00 23.58  ? 197  LEU A C   1 
ATOM   159  O O   . LEU A 1 23  ? 40.670 30.563 87.462 1.00 20.48  ? 197  LEU A O   1 
ATOM   160  C CB  . LEU A 1 23  ? 40.144 28.159 85.851 1.00 23.05  ? 197  LEU A CB  1 
ATOM   161  C CG  . LEU A 1 23  ? 40.580 26.813 85.266 1.00 28.21  ? 197  LEU A CG  1 
ATOM   162  C CD1 . LEU A 1 23  ? 39.622 25.759 85.646 1.00 28.32  ? 197  LEU A CD1 1 
ATOM   163  C CD2 . LEU A 1 23  ? 40.781 26.842 83.764 1.00 29.87  ? 197  LEU A CD2 1 
ATOM   164  N N   . SER A 1 24  ? 39.674 31.586 85.730 1.00 20.33  ? 198  SER A N   1 
ATOM   165  C CA  . SER A 1 24  ? 39.348 32.737 86.571 1.00 18.68  ? 198  SER A CA  1 
ATOM   166  C C   . SER A 1 24  ? 37.869 33.035 86.586 1.00 19.84  ? 198  SER A C   1 
ATOM   167  O O   . SER A 1 24  ? 37.318 33.200 85.511 1.00 20.24  ? 198  SER A O   1 
ATOM   168  C CB  . SER A 1 24  ? 40.045 33.962 85.997 1.00 20.30  ? 198  SER A CB  1 
ATOM   169  O OG  . SER A 1 24  ? 41.454 33.910 86.210 1.00 23.64  ? 198  SER A OG  1 
ATOM   170  N N   . LEU A 1 25  ? 37.253 33.075 87.761 1.00 17.92  ? 199  LEU A N   1 
ATOM   171  C CA  . LEU A 1 25  ? 35.839 33.458 87.912 1.00 19.81  ? 199  LEU A CA  1 
ATOM   172  C C   . LEU A 1 25  ? 35.814 34.952 87.777 1.00 21.64  ? 199  LEU A C   1 
ATOM   173  O O   . LEU A 1 25  ? 36.556 35.630 88.482 1.00 19.18  ? 199  LEU A O   1 
ATOM   174  C CB  . LEU A 1 25  ? 35.246 33.041 89.253 1.00 21.80  ? 199  LEU A CB  1 
ATOM   175  C CG  . LEU A 1 25  ? 35.260 31.571 89.538 1.00 28.20  ? 199  LEU A CG  1 
ATOM   176  C CD1 . LEU A 1 25  ? 34.562 31.295 90.846 1.00 30.24  ? 199  LEU A CD1 1 
ATOM   177  C CD2 . LEU A 1 25  ? 34.598 30.768 88.391 1.00 29.56  ? 199  LEU A CD2 1 
ATOM   178  N N   . THR A 1 26  ? 34.974 35.481 86.844 1.00 18.60  ? 200  THR A N   1 
ATOM   179  C CA  . THR A 1 26  ? 35.041 36.888 86.504 1.00 17.49  ? 200  THR A CA  1 
ATOM   180  C C   . THR A 1 26  ? 33.690 37.560 86.634 1.00 22.43  ? 200  THR A C   1 
ATOM   181  O O   . THR A 1 26  ? 32.755 37.102 86.006 1.00 20.84  ? 200  THR A O   1 
ATOM   182  C CB  . THR A 1 26  ? 35.559 36.999 85.029 1.00 23.83  ? 200  THR A CB  1 
ATOM   183  O OG1 . THR A 1 26  ? 36.809 36.291 84.885 1.00 26.62  ? 200  THR A OG1 1 
ATOM   184  C CG2 . THR A 1 26  ? 35.833 38.429 84.615 1.00 25.57  ? 200  THR A CG2 1 
ATOM   185  N N   . GLN A 1 27  ? 33.599 38.631 87.468 1.00 21.73  ? 201  GLN A N   1 
ATOM   186  C CA  . GLN A 1 27  ? 32.384 39.459 87.612 1.00 22.34  ? 201  GLN A CA  1 
ATOM   187  C C   . GLN A 1 27  ? 32.316 40.193 86.300 1.00 19.69  ? 201  GLN A C   1 
ATOM   188  O O   . GLN A 1 27  ? 33.300 40.845 85.934 1.00 22.00  ? 201  GLN A O   1 
ATOM   189  C CB  . GLN A 1 27  ? 32.543 40.488 88.756 1.00 24.18  ? 201  GLN A CB  1 
ATOM   190  C CG  . GLN A 1 27  ? 31.351 41.492 88.788 1.00 27.77  ? 201  GLN A CG  1 
ATOM   191  C CD  . GLN A 1 27  ? 30.097 40.866 89.355 1.00 43.50  ? 201  GLN A CD  1 
ATOM   192  O OE1 . GLN A 1 27  ? 30.159 39.970 90.201 1.00 40.51  ? 201  GLN A OE1 1 
ATOM   193  N NE2 . GLN A 1 27  ? 28.925 41.339 88.931 1.00 34.05  ? 201  GLN A NE2 1 
ATOM   194  N N   . SER A 1 28  ? 31.168 40.110 85.584 1.00 16.33  ? 202  SER A N   1 
ATOM   195  C CA  . SER A 1 28  ? 31.111 40.599 84.208 1.00 16.03  ? 202  SER A CA  1 
ATOM   196  C C   . SER A 1 28  ? 29.907 41.452 83.884 1.00 22.76  ? 202  SER A C   1 
ATOM   197  O O   . SER A 1 28  ? 28.802 41.097 84.232 1.00 20.07  ? 202  SER A O   1 
ATOM   198  C CB  . SER A 1 28  ? 31.066 39.398 83.248 1.00 19.55  ? 202  SER A CB  1 
ATOM   199  O OG  . SER A 1 28  ? 32.259 38.634 83.404 1.00 21.16  ? 202  SER A OG  1 
ATOM   200  N N   . ASP A 1 29  ? 30.143 42.499 83.107 1.00 22.47  ? 203  ASP A N   1 
ATOM   201  C CA  . ASP A 1 29  ? 29.056 43.298 82.536 1.00 22.09  ? 203  ASP A CA  1 
ATOM   202  C C   . ASP A 1 29  ? 28.964 42.774 81.100 1.00 21.65  ? 203  ASP A C   1 
ATOM   203  O O   . ASP A 1 29  ? 29.759 43.131 80.230 1.00 22.26  ? 203  ASP A O   1 
ATOM   204  C CB  . ASP A 1 29  ? 29.381 44.795 82.579 1.00 25.79  ? 203  ASP A CB  1 
ATOM   205  C CG  . ASP A 1 29  ? 28.235 45.632 82.039 1.00 28.90  ? 203  ASP A CG  1 
ATOM   206  O OD1 . ASP A 1 29  ? 27.375 45.073 81.310 1.00 29.82  ? 203  ASP A OD1 1 
ATOM   207  O OD2 . ASP A 1 29  ? 28.200 46.830 82.332 1.00 33.16  ? 203  ASP A OD2 1 
ATOM   208  N N   . ILE A 1 30  ? 28.040 41.832 80.851 1.00 19.43  ? 204  ILE A N   1 
ATOM   209  C CA  . ILE A 1 30  ? 27.931 41.224 79.510 1.00 20.38  ? 204  ILE A CA  1 
ATOM   210  C C   . ILE A 1 30  ? 27.775 42.266 78.357 1.00 26.71  ? 204  ILE A C   1 
ATOM   211  O O   . ILE A 1 30  ? 28.245 42.017 77.256 1.00 27.89  ? 204  ILE A O   1 
ATOM   212  C CB  . ILE A 1 30  ? 26.770 40.183 79.513 1.00 24.41  ? 204  ILE A CB  1 
ATOM   213  C CG1 . ILE A 1 30  ? 26.857 39.230 80.737 1.00 25.66  ? 204  ILE A CG1 1 
ATOM   214  C CG2 . ILE A 1 30  ? 26.734 39.415 78.185 1.00 27.65  ? 204  ILE A CG2 1 
ATOM   215  C CD1 . ILE A 1 30  ? 28.187 38.317 80.882 1.00 34.87  ? 204  ILE A CD1 1 
ATOM   216  N N   . SER A 1 31  ? 27.158 43.426 78.626 1.00 26.44  ? 205  SER A N   1 
ATOM   217  C CA  . SER A 1 31  ? 27.010 44.494 77.626 1.00 27.41  ? 205  SER A CA  1 
ATOM   218  C C   . SER A 1 31  ? 28.372 45.050 77.175 1.00 33.58  ? 205  SER A C   1 
ATOM   219  O O   . SER A 1 31  ? 28.487 45.580 76.066 1.00 32.66  ? 205  SER A O   1 
ATOM   220  C CB  . SER A 1 31  ? 26.106 45.607 78.145 1.00 31.27  ? 205  SER A CB  1 
ATOM   221  O OG  . SER A 1 31  ? 26.738 46.443 79.101 1.00 34.95  ? 205  SER A OG  1 
ATOM   222  N N   . HIS A 1 32  ? 29.423 44.820 77.997 1.00 30.75  ? 206  HIS A N   1 
ATOM   223  C CA  . HIS A 1 32  ? 30.792 45.232 77.695 1.00 31.44  ? 206  HIS A CA  1 
ATOM   224  C C   . HIS A 1 32  ? 31.566 44.158 76.978 1.00 33.10  ? 206  HIS A C   1 
ATOM   225  O O   . HIS A 1 32  ? 32.770 44.285 76.866 1.00 33.59  ? 206  HIS A O   1 
ATOM   226  C CB  . HIS A 1 32  ? 31.515 45.644 78.981 1.00 33.24  ? 206  HIS A CB  1 
ATOM   227  C CG  . HIS A 1 32  ? 31.212 47.036 79.435 1.00 38.07  ? 206  HIS A CG  1 
ATOM   228  N ND1 . HIS A 1 32  ? 29.919 47.530 79.459 1.00 40.92  ? 206  HIS A ND1 1 
ATOM   229  C CD2 . HIS A 1 32  ? 32.042 47.965 79.961 1.00 40.77  ? 206  HIS A CD2 1 
ATOM   230  C CE1 . HIS A 1 32  ? 30.011 48.760 79.948 1.00 40.37  ? 206  HIS A CE1 1 
ATOM   231  N NE2 . HIS A 1 32  ? 31.269 49.063 80.269 1.00 40.83  ? 206  HIS A NE2 1 
ATOM   232  N N   . ILE A 1 33  ? 30.904 43.124 76.423 1.00 30.36  ? 207  ILE A N   1 
ATOM   233  C CA  . ILE A 1 33  ? 31.613 42.043 75.717 1.00 29.48  ? 207  ILE A CA  1 
ATOM   234  C C   . ILE A 1 33  ? 32.574 42.584 74.626 1.00 34.01  ? 207  ILE A C   1 
ATOM   235  O O   . ILE A 1 33  ? 33.624 41.991 74.406 1.00 32.41  ? 207  ILE A O   1 
ATOM   236  C CB  . ILE A 1 33  ? 30.637 40.953 75.194 1.00 33.09  ? 207  ILE A CB  1 
ATOM   237  C CG1 . ILE A 1 33  ? 31.345 39.603 75.012 1.00 33.95  ? 207  ILE A CG1 1 
ATOM   238  C CG2 . ILE A 1 33  ? 29.878 41.383 73.950 1.00 32.96  ? 207  ILE A CG2 1 
ATOM   239  C CD1 . ILE A 1 33  ? 31.659 38.881 76.343 1.00 41.06  ? 207  ILE A CD1 1 
ATOM   240  N N   . GLY A 1 34  ? 32.263 43.750 74.057 1.00 33.43  ? 208  GLY A N   1 
ATOM   241  C CA  . GLY A 1 34  ? 33.132 44.395 73.071 1.00 34.64  ? 208  GLY A CA  1 
ATOM   242  C C   . GLY A 1 34  ? 34.499 44.793 73.602 1.00 37.83  ? 208  GLY A C   1 
ATOM   243  O O   . GLY A 1 34  ? 35.485 44.762 72.858 1.00 38.19  ? 208  GLY A O   1 
ATOM   244  N N   . SER A 1 35  ? 34.570 45.148 74.901 1.00 35.09  ? 209  SER A N   1 
ATOM   245  C CA  . SER A 1 35  ? 35.793 45.578 75.604 1.00 34.46  ? 209  SER A CA  1 
ATOM   246  C C   . SER A 1 35  ? 36.593 44.391 76.181 1.00 32.94  ? 209  SER A C   1 
ATOM   247  O O   . SER A 1 35  ? 37.758 44.549 76.535 1.00 32.67  ? 209  SER A O   1 
ATOM   248  C CB  . SER A 1 35  ? 35.430 46.529 76.741 1.00 39.32  ? 209  SER A CB  1 
ATOM   249  O OG  . SER A 1 35  ? 34.829 47.713 76.245 1.00 54.28  ? 209  SER A OG  1 
ATOM   250  N N   . MET A 1 36  ? 35.959 43.220 76.324 1.00 27.48  ? 210  MET A N   1 
ATOM   251  C CA  . MET A 1 36  ? 36.625 42.069 76.903 1.00 25.91  ? 210  MET A CA  1 
ATOM   252  C C   . MET A 1 36  ? 37.901 41.704 76.233 1.00 29.47  ? 210  MET A C   1 
ATOM   253  O O   . MET A 1 36  ? 37.909 41.347 75.038 1.00 28.46  ? 210  MET A O   1 
ATOM   254  C CB  . MET A 1 36  ? 35.708 40.847 76.992 1.00 26.69  ? 210  MET A CB  1 
ATOM   255  C CG  . MET A 1 36  ? 36.238 39.853 77.978 1.00 29.42  ? 210  MET A CG  1 
ATOM   256  S SD  . MET A 1 36  ? 35.346 38.305 77.925 1.00 34.86  ? 210  MET A SD  1 
ATOM   257  C CE  . MET A 1 36  ? 35.391 37.972 76.239 1.00 31.41  ? 210  MET A CE  1 
ATOM   258  N N   . ARG A 1 37  ? 39.004 41.770 77.031 1.00 26.34  ? 211  ARG A N   1 
ATOM   259  C CA  A ARG A 1 37  ? 40.335 41.440 76.555 0.50 24.86  ? 211  ARG A CA  1 
ATOM   260  C CA  B ARG A 1 37  ? 40.355 41.446 76.579 0.50 24.79  ? 211  ARG A CA  1 
ATOM   261  C C   . ARG A 1 37  ? 40.612 39.946 76.714 1.00 27.61  ? 211  ARG A C   1 
ATOM   262  O O   . ARG A 1 37  ? 41.512 39.511 77.442 1.00 26.69  ? 211  ARG A O   1 
ATOM   263  C CB  A ARG A 1 37  ? 41.400 42.357 77.197 0.50 24.81  ? 211  ARG A CB  1 
ATOM   264  C CB  B ARG A 1 37  ? 41.446 42.316 77.286 0.50 24.14  ? 211  ARG A CB  1 
ATOM   265  C CG  A ARG A 1 37  ? 41.115 43.842 76.903 0.50 28.63  ? 211  ARG A CG  1 
ATOM   266  C CG  B ARG A 1 37  ? 41.362 43.828 76.972 0.50 27.18  ? 211  ARG A CG  1 
ATOM   267  C CD  A ARG A 1 37  ? 42.134 44.797 77.498 0.50 29.79  ? 211  ARG A CD  1 
ATOM   268  C CD  B ARG A 1 37  ? 42.490 44.689 77.578 0.50 20.99  ? 211  ARG A CD  1 
ATOM   269  N NE  A ARG A 1 37  ? 43.485 44.477 77.054 0.50 25.95  ? 211  ARG A NE  1 
ATOM   270  N NE  B ARG A 1 37  ? 42.490 44.669 79.046 0.50 26.77  ? 211  ARG A NE  1 
ATOM   271  C CZ  A ARG A 1 37  ? 44.576 45.141 77.421 0.50 37.59  ? 211  ARG A CZ  1 
ATOM   272  C CZ  B ARG A 1 37  ? 42.318 45.720 79.853 0.50 29.85  ? 211  ARG A CZ  1 
ATOM   273  N NH1 A ARG A 1 37  ? 44.483 46.197 78.227 0.50 21.71  ? 211  ARG A NH1 1 
ATOM   274  N NH1 B ARG A 1 37  ? 42.334 45.563 81.167 0.50 9.63   ? 211  ARG A NH1 1 
ATOM   275  N NH2 A ARG A 1 37  ? 45.769 44.750 76.995 0.50 20.33  ? 211  ARG A NH2 1 
ATOM   276  N NH2 B ARG A 1 37  ? 42.135 46.940 79.345 0.50 21.17  ? 211  ARG A NH2 1 
ATOM   277  N N   . VAL A 1 38  ? 39.779 39.143 76.025 1.00 24.24  ? 212  VAL A N   1 
ATOM   278  C CA  . VAL A 1 38  ? 39.906 37.691 75.992 1.00 24.05  ? 212  VAL A CA  1 
ATOM   279  C C   . VAL A 1 38  ? 39.793 37.434 74.466 1.00 28.41  ? 212  VAL A C   1 
ATOM   280  O O   . VAL A 1 38  ? 38.986 38.100 73.813 1.00 30.15  ? 212  VAL A O   1 
ATOM   281  C CB  . VAL A 1 38  ? 38.809 37.015 76.854 1.00 26.69  ? 212  VAL A CB  1 
ATOM   282  C CG1 . VAL A 1 38  ? 38.918 35.503 76.770 1.00 25.33  ? 212  VAL A CG1 1 
ATOM   283  C CG2 . VAL A 1 38  ? 38.945 37.436 78.318 1.00 26.57  ? 212  VAL A CG2 1 
ATOM   284  N N   . GLU A 1 39  ? 40.586 36.531 73.911 1.00 26.31  ? 213  GLU A N   1 
ATOM   285  C CA  . GLU A 1 39  ? 40.687 36.295 72.456 1.00 26.65  ? 213  GLU A CA  1 
ATOM   286  C C   . GLU A 1 39  ? 39.506 35.551 71.804 1.00 29.50  ? 213  GLU A C   1 
ATOM   287  O O   . GLU A 1 39  ? 39.221 35.766 70.617 1.00 27.51  ? 213  GLU A O   1 
ATOM   288  C CB  . GLU A 1 39  ? 42.004 35.588 72.154 1.00 28.70  ? 213  GLU A CB  1 
ATOM   289  C CG  . GLU A 1 39  ? 43.191 36.512 72.440 1.00 32.97  ? 213  GLU A CG  1 
ATOM   290  C CD  . GLU A 1 39  ? 44.540 35.995 71.999 1.00 50.15  ? 213  GLU A CD  1 
ATOM   291  O OE1 . GLU A 1 39  ? 44.620 34.828 71.557 1.00 41.89  ? 213  GLU A OE1 1 
ATOM   292  O OE2 . GLU A 1 39  ? 45.522 36.765 72.084 1.00 40.97  ? 213  GLU A OE2 1 
ATOM   293  N N   . GLY A 1 40  ? 38.857 34.686 72.572 1.00 25.72  ? 214  GLY A N   1 
ATOM   294  C CA  . GLY A 1 40  ? 37.686 33.934 72.121 1.00 24.19  ? 214  GLY A CA  1 
ATOM   295  C C   . GLY A 1 40  ? 36.522 34.032 73.081 1.00 22.59  ? 214  GLY A C   1 
ATOM   296  O O   . GLY A 1 40  ? 36.703 33.986 74.306 1.00 21.43  ? 214  GLY A O   1 
ATOM   297  N N   . ILE A 1 41  ? 35.315 34.165 72.535 1.00 23.05  ? 215  ILE A N   1 
ATOM   298  C CA  . ILE A 1 41  ? 34.103 34.260 73.341 1.00 23.30  ? 215  ILE A CA  1 
ATOM   299  C C   . ILE A 1 41  ? 33.208 33.138 72.906 1.00 24.93  ? 215  ILE A C   1 
ATOM   300  O O   . ILE A 1 41  ? 32.920 33.008 71.717 1.00 25.31  ? 215  ILE A O   1 
ATOM   301  C CB  . ILE A 1 41  ? 33.360 35.624 73.224 1.00 28.04  ? 215  ILE A CB  1 
ATOM   302  C CG1 . ILE A 1 41  ? 34.321 36.798 73.322 1.00 32.45  ? 215  ILE A CG1 1 
ATOM   303  C CG2 . ILE A 1 41  ? 32.225 35.728 74.265 1.00 26.49  ? 215  ILE A CG2 1 
ATOM   304  C CD1 . ILE A 1 41  ? 33.769 38.125 72.854 1.00 55.65  ? 215  ILE A CD1 1 
ATOM   305  N N   . VAL A 1 42  ? 32.753 32.355 73.873 1.00 21.58  ? 216  VAL A N   1 
ATOM   306  C CA  . VAL A 1 42  ? 31.827 31.253 73.590 1.00 20.74  ? 216  VAL A CA  1 
ATOM   307  C C   . VAL A 1 42  ? 30.429 31.830 73.545 1.00 26.85  ? 216  VAL A C   1 
ATOM   308  O O   . VAL A 1 42  ? 30.095 32.718 74.335 1.00 23.86  ? 216  VAL A O   1 
ATOM   309  C CB  . VAL A 1 42  ? 32.008 30.091 74.600 1.00 23.77  ? 216  VAL A CB  1 
ATOM   310  C CG1 . VAL A 1 42  ? 30.882 29.050 74.497 1.00 24.15  ? 216  VAL A CG1 1 
ATOM   311  C CG2 . VAL A 1 42  ? 33.380 29.433 74.453 1.00 24.41  ? 216  VAL A CG2 1 
ATOM   312  N N   . HIS A 1 43  ? 29.626 31.358 72.564 1.00 25.61  ? 217  HIS A N   1 
ATOM   313  C CA  . HIS A 1 43  ? 28.245 31.739 72.379 1.00 23.79  ? 217  HIS A CA  1 
ATOM   314  C C   . HIS A 1 43  ? 27.413 30.450 72.478 1.00 25.81  ? 217  HIS A C   1 
ATOM   315  O O   . HIS A 1 43  ? 27.318 29.697 71.492 1.00 23.04  ? 217  HIS A O   1 
ATOM   316  C CB  . HIS A 1 43  ? 28.043 32.432 71.027 1.00 25.09  ? 217  HIS A CB  1 
ATOM   317  C CG  . HIS A 1 43  ? 26.610 32.643 70.629 1.00 27.83  ? 217  HIS A CG  1 
ATOM   318  N ND1 . HIS A 1 43  ? 26.200 32.438 69.329 1.00 28.92  ? 217  HIS A ND1 1 
ATOM   319  C CD2 . HIS A 1 43  ? 25.543 33.043 71.364 1.00 29.32  ? 217  HIS A CD2 1 
ATOM   320  C CE1 . HIS A 1 43  ? 24.910 32.714 69.302 1.00 28.90  ? 217  HIS A CE1 1 
ATOM   321  N NE2 . HIS A 1 43  ? 24.469 33.099 70.499 1.00 29.38  ? 217  HIS A NE2 1 
ATOM   322  N N   . PRO A 1 44  ? 26.854 30.148 73.671 1.00 23.74  ? 218  PRO A N   1 
ATOM   323  C CA  . PRO A 1 44  ? 26.013 28.937 73.782 1.00 24.26  ? 218  PRO A CA  1 
ATOM   324  C C   . PRO A 1 44  ? 24.694 29.221 73.071 1.00 28.04  ? 218  PRO A C   1 
ATOM   325  O O   . PRO A 1 44  ? 24.051 30.264 73.265 1.00 27.46  ? 218  PRO A O   1 
ATOM   326  C CB  . PRO A 1 44  ? 25.888 28.703 75.303 1.00 25.99  ? 218  PRO A CB  1 
ATOM   327  C CG  . PRO A 1 44  ? 26.580 29.884 75.977 1.00 29.71  ? 218  PRO A CG  1 
ATOM   328  C CD  . PRO A 1 44  ? 26.842 30.925 74.932 1.00 26.31  ? 218  PRO A CD  1 
ATOM   329  N N   . THR A 1 45  ? 24.346 28.345 72.136 1.00 24.56  ? 219  THR A N   1 
ATOM   330  C CA  . THR A 1 45  ? 23.194 28.587 71.294 1.00 24.03  ? 219  THR A CA  1 
ATOM   331  C C   . THR A 1 45  ? 22.520 27.256 70.974 1.00 23.94  ? 219  THR A C   1 
ATOM   332  O O   . THR A 1 45  ? 22.765 26.233 71.610 1.00 23.34  ? 219  THR A O   1 
ATOM   333  C CB  . THR A 1 45  ? 23.647 29.403 70.014 1.00 33.25  ? 219  THR A CB  1 
ATOM   334  O OG1 . THR A 1 45  ? 22.532 29.837 69.228 1.00 31.97  ? 219  THR A OG1 1 
ATOM   335  C CG2 . THR A 1 45  ? 24.632 28.654 69.128 1.00 30.47  ? 219  THR A CG2 1 
ATOM   336  N N   . THR A 1 46  ? 21.693 27.300 69.969 1.00 24.83  ? 220  THR A N   1 
ATOM   337  C CA  . THR A 1 46  ? 20.903 26.173 69.474 1.00 25.60  ? 220  THR A CA  1 
ATOM   338  C C   . THR A 1 46  ? 21.419 25.797 68.094 1.00 31.52  ? 220  THR A C   1 
ATOM   339  O O   . THR A 1 46  ? 22.328 26.456 67.575 1.00 31.07  ? 220  THR A O   1 
ATOM   340  C CB  . THR A 1 46  ? 19.435 26.586 69.442 1.00 30.48  ? 220  THR A CB  1 
ATOM   341  O OG1 . THR A 1 46  ? 19.307 27.553 68.416 1.00 33.69  ? 220  THR A OG1 1 
ATOM   342  C CG2 . THR A 1 46  ? 18.945 27.150 70.797 1.00 27.03  ? 220  THR A CG2 1 
ATOM   343  N N   . ALA A 1 47  ? 20.829 24.740 67.498 1.00 27.62  ? 221  ALA A N   1 
ATOM   344  C CA  . ALA A 1 47  ? 21.199 24.203 66.185 1.00 28.59  ? 221  ALA A CA  1 
ATOM   345  C C   . ALA A 1 47  ? 21.169 25.285 65.116 1.00 32.21  ? 221  ALA A C   1 
ATOM   346  O O   . ALA A 1 47  ? 22.014 25.294 64.224 1.00 32.04  ? 221  ALA A O   1 
ATOM   347  C CB  . ALA A 1 47  ? 20.242 23.071 65.801 1.00 29.64  ? 221  ALA A CB  1 
ATOM   348  N N   . GLU A 1 48  ? 20.233 26.232 65.250 1.00 31.05  ? 222  GLU A N   1 
ATOM   349  C CA  . GLU A 1 48  ? 20.024 27.340 64.320 1.00 32.23  ? 222  GLU A CA  1 
ATOM   350  C C   . GLU A 1 48  ? 21.012 28.490 64.446 1.00 36.00  ? 222  GLU A C   1 
ATOM   351  O O   . GLU A 1 48  ? 20.975 29.406 63.617 1.00 36.07  ? 222  GLU A O   1 
ATOM   352  C CB  . GLU A 1 48  ? 18.589 27.867 64.448 1.00 34.31  ? 222  GLU A CB  1 
ATOM   353  C CG  . GLU A 1 48  ? 17.560 26.873 63.918 1.00 49.61  ? 222  GLU A CG  1 
ATOM   354  C CD  . GLU A 1 48  ? 16.231 27.430 63.441 1.00 72.92  ? 222  GLU A CD  1 
ATOM   355  O OE1 . GLU A 1 48  ? 15.570 28.154 64.220 1.00 59.77  ? 222  GLU A OE1 1 
ATOM   356  O OE2 . GLU A 1 48  ? 15.837 27.114 62.293 1.00 63.27  ? 222  GLU A OE2 1 
ATOM   357  N N   . ILE A 1 49  ? 21.851 28.480 65.493 1.00 32.48  ? 223  ILE A N   1 
ATOM   358  C CA  . ILE A 1 49  ? 22.819 29.554 65.787 1.00 33.29  ? 223  ILE A CA  1 
ATOM   359  C C   . ILE A 1 49  ? 22.075 30.890 65.952 1.00 36.30  ? 223  ILE A C   1 
ATOM   360  O O   . ILE A 1 49  ? 22.411 31.882 65.299 1.00 35.81  ? 223  ILE A O   1 
ATOM   361  C CB  . ILE A 1 49  ? 24.038 29.658 64.806 1.00 36.74  ? 223  ILE A CB  1 
ATOM   362  C CG1 . ILE A 1 49  ? 24.479 28.296 64.230 1.00 37.05  ? 223  ILE A CG1 1 
ATOM   363  C CG2 . ILE A 1 49  ? 25.211 30.393 65.483 1.00 37.50  ? 223  ILE A CG2 1 
ATOM   364  C CD1 . ILE A 1 49  ? 25.583 28.347 63.100 1.00 44.41  ? 223  ILE A CD1 1 
ATOM   365  N N   . ASP A 1 50  ? 21.027 30.898 66.785 1.00 34.68  ? 224  ASP A N   1 
ATOM   366  C CA  . ASP A 1 50  ? 20.261 32.111 67.048 1.00 36.43  ? 224  ASP A CA  1 
ATOM   367  C C   . ASP A 1 50  ? 20.952 32.968 68.125 1.00 38.88  ? 224  ASP A C   1 
ATOM   368  O O   . ASP A 1 50  ? 21.756 32.454 68.907 1.00 37.09  ? 224  ASP A O   1 
ATOM   369  C CB  . ASP A 1 50  ? 18.796 31.794 67.405 1.00 39.52  ? 224  ASP A CB  1 
ATOM   370  C CG  . ASP A 1 50  ? 18.624 31.260 68.805 1.00 56.75  ? 224  ASP A CG  1 
ATOM   371  O OD1 . ASP A 1 50  ? 18.981 30.089 69.041 1.00 58.84  ? 224  ASP A OD1 1 
ATOM   372  O OD2 . ASP A 1 50  ? 18.164 32.020 69.671 1.00 63.33  ? 224  ASP A OD2 1 
ATOM   373  N N   . LEU A 1 51  ? 20.614 34.262 68.157 1.00 36.56  ? 225  LEU A N   1 
ATOM   374  C CA  . LEU A 1 51  ? 21.218 35.261 69.021 1.00 37.87  ? 225  LEU A CA  1 
ATOM   375  C C   . LEU A 1 51  ? 20.303 35.726 70.151 1.00 44.56  ? 225  LEU A C   1 
ATOM   376  O O   . LEU A 1 51  ? 19.860 36.876 70.200 1.00 43.90  ? 225  LEU A O   1 
ATOM   377  C CB  . LEU A 1 51  ? 21.727 36.435 68.162 1.00 38.27  ? 225  LEU A CB  1 
ATOM   378  C CG  . LEU A 1 51  ? 22.780 36.067 67.104 1.00 43.27  ? 225  LEU A CG  1 
ATOM   379  C CD1 . LEU A 1 51  ? 22.860 37.118 66.016 1.00 44.07  ? 225  LEU A CD1 1 
ATOM   380  C CD2 . LEU A 1 51  ? 24.124 35.789 67.725 1.00 46.33  ? 225  LEU A CD2 1 
ATOM   381  N N   . LYS A 1 52  ? 20.070 34.823 71.100 1.00 42.34  ? 226  LYS A N   1 
ATOM   382  C CA  . LYS A 1 52  ? 19.254 35.113 72.263 1.00 41.88  ? 226  LYS A CA  1 
ATOM   383  C C   . LYS A 1 52  ? 20.142 35.149 73.494 1.00 44.41  ? 226  LYS A C   1 
ATOM   384  O O   . LYS A 1 52  ? 21.343 34.862 73.416 1.00 44.72  ? 226  LYS A O   1 
ATOM   385  C CB  . LYS A 1 52  ? 18.113 34.098 72.397 1.00 45.58  ? 226  LYS A CB  1 
ATOM   386  C CG  . LYS A 1 52  ? 16.912 34.436 71.519 1.00 65.33  ? 226  LYS A CG  1 
ATOM   387  C CD  . LYS A 1 52  ? 15.870 33.312 71.471 1.00 76.92  ? 226  LYS A CD  1 
ATOM   388  C CE  . LYS A 1 52  ? 14.717 33.622 70.538 1.00 91.24  ? 226  LYS A CE  1 
ATOM   389  N NZ  . LYS A 1 52  ? 15.139 33.718 69.110 1.00 100.93 ? 226  LYS A NZ  1 
ATOM   390  N N   . GLU A 1 53  ? 19.560 35.526 74.627 1.00 37.31  ? 227  GLU A N   1 
ATOM   391  C CA  . GLU A 1 53  ? 20.235 35.669 75.901 1.00 35.64  ? 227  GLU A CA  1 
ATOM   392  C C   . GLU A 1 53  ? 21.189 36.852 75.849 1.00 36.06  ? 227  GLU A C   1 
ATOM   393  O O   . GLU A 1 53  ? 21.487 37.379 74.762 1.00 33.27  ? 227  GLU A O   1 
ATOM   394  C CB  . GLU A 1 53  ? 20.913 34.368 76.380 1.00 37.16  ? 227  GLU A CB  1 
ATOM   395  C CG  . GLU A 1 53  ? 19.940 33.302 76.873 1.00 51.74  ? 227  GLU A CG  1 
ATOM   396  C CD  . GLU A 1 53  ? 19.257 32.431 75.830 1.00 84.47  ? 227  GLU A CD  1 
ATOM   397  O OE1 . GLU A 1 53  ? 19.814 32.260 74.721 1.00 87.08  ? 227  GLU A OE1 1 
ATOM   398  O OE2 . GLU A 1 53  ? 18.167 31.896 76.135 1.00 81.68  ? 227  GLU A OE2 1 
ATOM   399  N N   . ASP A 1 54  ? 21.624 37.294 77.025 1.00 31.23  ? 228  ASP A N   1 
ATOM   400  C CA  . ASP A 1 54  ? 22.501 38.442 77.155 1.00 30.92  ? 228  ASP A CA  1 
ATOM   401  C C   . ASP A 1 54  ? 23.692 38.385 76.185 1.00 34.34  ? 228  ASP A C   1 
ATOM   402  O O   . ASP A 1 54  ? 24.010 39.388 75.548 1.00 33.95  ? 228  ASP A O   1 
ATOM   403  C CB  . ASP A 1 54  ? 22.970 38.595 78.618 1.00 31.90  ? 228  ASP A CB  1 
ATOM   404  C CG  . ASP A 1 54  ? 21.862 38.686 79.661 1.00 41.23  ? 228  ASP A CG  1 
ATOM   405  O OD1 . ASP A 1 54  ? 20.730 39.120 79.303 1.00 39.73  ? 228  ASP A OD1 1 
ATOM   406  O OD2 . ASP A 1 54  ? 22.122 38.335 80.837 1.00 42.33  ? 228  ASP A OD2 1 
ATOM   407  N N   . ILE A 1 55  ? 24.335 37.210 76.052 1.00 29.62  ? 229  ILE A N   1 
ATOM   408  C CA  . ILE A 1 55  ? 25.511 37.098 75.189 1.00 29.23  ? 229  ILE A CA  1 
ATOM   409  C C   . ILE A 1 55  ? 25.161 37.276 73.709 1.00 31.45  ? 229  ILE A C   1 
ATOM   410  O O   . ILE A 1 55  ? 25.874 38.016 73.031 1.00 30.34  ? 229  ILE A O   1 
ATOM   411  C CB  . ILE A 1 55  ? 26.340 35.796 75.472 1.00 32.90  ? 229  ILE A CB  1 
ATOM   412  C CG1 . ILE A 1 55  ? 27.655 35.755 74.671 1.00 34.20  ? 229  ILE A CG1 1 
ATOM   413  C CG2 . ILE A 1 55  ? 25.520 34.534 75.257 1.00 30.27  ? 229  ILE A CG2 1 
ATOM   414  C CD1 . ILE A 1 55  ? 28.701 36.832 75.104 1.00 43.10  ? 229  ILE A CD1 1 
ATOM   415  N N   . GLY A 1 56  ? 24.095 36.610 73.232 1.00 29.50  ? 230  GLY A N   1 
ATOM   416  C CA  . GLY A 1 56  ? 23.641 36.698 71.846 1.00 29.69  ? 230  GLY A CA  1 
ATOM   417  C C   . GLY A 1 56  ? 23.289 38.130 71.495 1.00 34.22  ? 230  GLY A C   1 
ATOM   418  O O   . GLY A 1 56  ? 23.743 38.632 70.474 1.00 35.33  ? 230  GLY A O   1 
ATOM   419  N N   . LYS A 1 57  ? 22.534 38.817 72.377 1.00 31.43  ? 231  LYS A N   1 
ATOM   420  C CA  . LYS A 1 57  ? 22.174 40.226 72.186 1.00 31.60  ? 231  LYS A CA  1 
ATOM   421  C C   . LYS A 1 57  ? 23.382 41.148 72.272 1.00 35.86  ? 231  LYS A C   1 
ATOM   422  O O   . LYS A 1 57  ? 23.448 42.128 71.515 1.00 35.71  ? 231  LYS A O   1 
ATOM   423  C CB  . LYS A 1 57  ? 21.068 40.681 73.148 1.00 34.00  ? 231  LYS A CB  1 
ATOM   424  C CG  . LYS A 1 57  ? 19.736 39.989 72.902 1.00 34.63  ? 231  LYS A CG  1 
ATOM   425  C CD  . LYS A 1 57  ? 18.746 40.294 74.015 1.00 55.75  ? 231  LYS A CD  1 
ATOM   426  C CE  . LYS A 1 57  ? 17.516 39.429 73.931 1.00 69.15  ? 231  LYS A CE  1 
ATOM   427  N NZ  . LYS A 1 57  ? 16.500 39.833 74.934 1.00 80.00  ? 231  LYS A NZ  1 
ATOM   428  N N   . ALA A 1 58  ? 24.350 40.853 73.169 1.00 31.93  ? 232  ALA A N   1 
ATOM   429  C CA  . ALA A 1 58  ? 25.542 41.715 73.264 1.00 32.03  ? 232  ALA A CA  1 
ATOM   430  C C   . ALA A 1 58  ? 26.423 41.561 72.041 1.00 35.44  ? 232  ALA A C   1 
ATOM   431  O O   . ALA A 1 58  ? 26.946 42.557 71.549 1.00 34.13  ? 232  ALA A O   1 
ATOM   432  C CB  . ALA A 1 58  ? 26.331 41.418 74.529 1.00 32.75  ? 232  ALA A CB  1 
ATOM   433  N N   . LEU A 1 59  ? 26.560 40.321 71.515 1.00 31.96  ? 233  LEU A N   1 
ATOM   434  C CA  . LEU A 1 59  ? 27.320 40.085 70.286 1.00 32.03  ? 233  LEU A CA  1 
ATOM   435  C C   . LEU A 1 59  ? 26.625 40.716 69.092 1.00 40.69  ? 233  LEU A C   1 
ATOM   436  O O   . LEU A 1 59  ? 27.300 41.258 68.200 1.00 42.23  ? 233  LEU A O   1 
ATOM   437  C CB  . LEU A 1 59  ? 27.539 38.600 70.031 1.00 31.76  ? 233  LEU A CB  1 
ATOM   438  C CG  . LEU A 1 59  ? 28.435 37.842 70.983 1.00 34.75  ? 233  LEU A CG  1 
ATOM   439  C CD1 . LEU A 1 59  ? 28.241 36.345 70.801 1.00 33.63  ? 233  LEU A CD1 1 
ATOM   440  C CD2 . LEU A 1 59  ? 29.909 38.239 70.826 1.00 34.96  ? 233  LEU A CD2 1 
ATOM   441  N N   . GLU A 1 60  ? 25.277 40.673 69.085 1.00 37.37  ? 234  GLU A N   1 
ATOM   442  C CA  . GLU A 1 60  ? 24.478 41.230 68.010 1.00 38.46  ? 234  GLU A CA  1 
ATOM   443  C C   . GLU A 1 60  ? 24.642 42.754 67.964 1.00 44.01  ? 234  GLU A C   1 
ATOM   444  O O   . GLU A 1 60  ? 24.954 43.288 66.897 1.00 44.83  ? 234  GLU A O   1 
ATOM   445  C CB  . GLU A 1 60  ? 23.010 40.831 68.186 1.00 39.98  ? 234  GLU A CB  1 
ATOM   446  C CG  . GLU A 1 60  ? 22.150 41.003 66.946 1.00 52.21  ? 234  GLU A CG  1 
ATOM   447  C CD  . GLU A 1 60  ? 20.710 40.593 67.178 1.00 77.29  ? 234  GLU A CD  1 
ATOM   448  O OE1 . GLU A 1 60  ? 20.142 40.980 68.227 1.00 57.63  ? 234  GLU A OE1 1 
ATOM   449  O OE2 . GLU A 1 60  ? 20.152 39.878 66.312 1.00 76.85  ? 234  GLU A OE2 1 
ATOM   450  N N   . LYS A 1 61  ? 24.481 43.426 69.121 1.00 41.25  ? 235  LYS A N   1 
ATOM   451  C CA  . LYS A 1 61  ? 24.580 44.874 69.284 1.00 42.28  ? 235  LYS A CA  1 
ATOM   452  C C   . LYS A 1 61  ? 25.970 45.420 68.968 1.00 50.44  ? 235  LYS A C   1 
ATOM   453  O O   . LYS A 1 61  ? 26.082 46.489 68.358 1.00 51.10  ? 235  LYS A O   1 
ATOM   454  C CB  . LYS A 1 61  ? 24.119 45.297 70.682 1.00 44.99  ? 235  LYS A CB  1 
ATOM   455  C CG  . LYS A 1 61  ? 23.795 46.781 70.807 1.00 60.01  ? 235  LYS A CG  1 
ATOM   456  C CD  . LYS A 1 61  ? 23.560 47.181 72.252 1.00 67.11  ? 235  LYS A CD  1 
ATOM   457  C CE  . LYS A 1 61  ? 23.502 48.679 72.413 1.00 74.20  ? 235  LYS A CE  1 
ATOM   458  N NZ  . LYS A 1 61  ? 23.426 49.071 73.844 1.00 81.07  ? 235  LYS A NZ  1 
ATOM   459  N N   . ALA A 1 62  ? 27.025 44.691 69.357 1.00 47.49  ? 236  ALA A N   1 
ATOM   460  C CA  . ALA A 1 62  ? 28.395 45.123 69.088 1.00 47.30  ? 236  ALA A CA  1 
ATOM   461  C C   . ALA A 1 62  ? 28.789 44.839 67.645 1.00 51.33  ? 236  ALA A C   1 
ATOM   462  O O   . ALA A 1 62  ? 29.529 45.620 67.051 1.00 50.72  ? 236  ALA A O   1 
ATOM   463  C CB  . ALA A 1 62  ? 29.360 44.421 70.033 1.00 48.07  ? 236  ALA A CB  1 
ATOM   464  N N   . GLY A 1 63  ? 28.295 43.725 67.107 1.00 48.60  ? 237  GLY A N   1 
ATOM   465  C CA  . GLY A 1 63  ? 28.634 43.239 65.776 1.00 49.15  ? 237  GLY A CA  1 
ATOM   466  C C   . GLY A 1 63  ? 28.106 43.992 64.574 1.00 53.56  ? 237  GLY A C   1 
ATOM   467  O O   . GLY A 1 63  ? 28.784 44.056 63.543 1.00 54.01  ? 237  GLY A O   1 
ATOM   468  N N   . GLY A 1 64  ? 26.883 44.492 64.680 1.00 50.06  ? 238  GLY A N   1 
ATOM   469  C CA  . GLY A 1 64  ? 26.223 45.207 63.595 1.00 50.11  ? 238  GLY A CA  1 
ATOM   470  C C   . GLY A 1 64  ? 25.924 44.329 62.396 1.00 54.24  ? 238  GLY A C   1 
ATOM   471  O O   . GLY A 1 64  ? 25.804 43.104 62.526 1.00 53.37  ? 238  GLY A O   1 
ATOM   472  N N   . LYS A 1 65  ? 25.835 44.962 61.212 1.00 50.77  ? 239  LYS A N   1 
ATOM   473  C CA  . LYS A 1 65  ? 25.515 44.327 59.929 1.00 50.54  ? 239  LYS A CA  1 
ATOM   474  C C   . LYS A 1 65  ? 26.508 43.244 59.547 1.00 52.55  ? 239  LYS A C   1 
ATOM   475  O O   . LYS A 1 65  ? 26.107 42.201 59.023 1.00 52.70  ? 239  LYS A O   1 
ATOM   476  C CB  . LYS A 1 65  ? 25.413 45.388 58.803 1.00 53.27  ? 239  LYS A CB  1 
ATOM   477  C CG  . LYS A 1 65  ? 24.276 46.398 58.977 1.00 63.65  ? 239  LYS A CG  1 
ATOM   478  C CD  . LYS A 1 65  ? 22.982 45.959 58.279 1.00 72.34  ? 239  LYS A CD  1 
ATOM   479  C CE  . LYS A 1 65  ? 21.894 47.005 58.339 1.00 76.26  ? 239  LYS A CE  1 
ATOM   480  N NZ  . LYS A 1 65  ? 22.133 48.117 57.382 1.00 85.03  ? 239  LYS A NZ  1 
ATOM   481  N N   . GLU A 1 66  ? 27.802 43.495 59.821 1.00 46.86  ? 240  GLU A N   1 
ATOM   482  C CA  . GLU A 1 66  ? 28.913 42.599 59.539 1.00 45.31  ? 240  GLU A CA  1 
ATOM   483  C C   . GLU A 1 66  ? 28.779 41.291 60.312 1.00 47.53  ? 240  GLU A C   1 
ATOM   484  O O   . GLU A 1 66  ? 29.058 40.236 59.749 1.00 47.11  ? 240  GLU A O   1 
ATOM   485  C CB  . GLU A 1 66  ? 30.258 43.296 59.815 1.00 46.52  ? 240  GLU A CB  1 
ATOM   486  C CG  . GLU A 1 66  ? 31.473 42.533 59.297 1.00 58.65  ? 240  GLU A CG  1 
ATOM   487  C CD  . GLU A 1 66  ? 32.832 43.196 59.448 1.00 83.78  ? 240  GLU A CD  1 
ATOM   488  O OE1 . GLU A 1 66  ? 33.050 43.922 60.446 1.00 80.86  ? 240  GLU A OE1 1 
ATOM   489  O OE2 . GLU A 1 66  ? 33.693 42.968 58.567 1.00 79.48  ? 240  GLU A OE2 1 
ATOM   490  N N   . PHE A 1 67  ? 28.342 41.350 61.584 1.00 43.27  ? 241  PHE A N   1 
ATOM   491  C CA  . PHE A 1 67  ? 28.148 40.133 62.397 1.00 42.61  ? 241  PHE A CA  1 
ATOM   492  C C   . PHE A 1 67  ? 26.936 39.338 61.912 1.00 43.95  ? 241  PHE A C   1 
ATOM   493  O O   . PHE A 1 67  ? 27.072 38.135 61.692 1.00 42.34  ? 241  PHE A O   1 
ATOM   494  C CB  . PHE A 1 67  ? 28.025 40.461 63.893 1.00 43.98  ? 241  PHE A CB  1 
ATOM   495  C CG  . PHE A 1 67  ? 27.810 39.280 64.810 1.00 45.22  ? 241  PHE A CG  1 
ATOM   496  C CD1 . PHE A 1 67  ? 28.793 38.314 64.969 1.00 47.50  ? 241  PHE A CD1 1 
ATOM   497  C CD2 . PHE A 1 67  ? 26.629 39.141 65.522 1.00 47.16  ? 241  PHE A CD2 1 
ATOM   498  C CE1 . PHE A 1 67  ? 28.598 37.227 65.835 1.00 48.10  ? 241  PHE A CE1 1 
ATOM   499  C CE2 . PHE A 1 67  ? 26.442 38.061 66.395 1.00 49.37  ? 241  PHE A CE2 1 
ATOM   500  C CZ  . PHE A 1 67  ? 27.426 37.113 66.542 1.00 46.38  ? 241  PHE A CZ  1 
ATOM   501  N N   . LEU A 1 68  ? 25.769 40.015 61.697 1.00 41.92  ? 242  LEU A N   1 
ATOM   502  C CA  . LEU A 1 68  ? 24.554 39.360 61.191 1.00 41.87  ? 242  LEU A CA  1 
ATOM   503  C C   . LEU A 1 68  ? 24.840 38.599 59.909 1.00 45.47  ? 242  LEU A C   1 
ATOM   504  O O   . LEU A 1 68  ? 24.420 37.453 59.772 1.00 44.39  ? 242  LEU A O   1 
ATOM   505  C CB  . LEU A 1 68  ? 23.394 40.351 60.985 1.00 42.07  ? 242  LEU A CB  1 
ATOM   506  C CG  . LEU A 1 68  ? 22.598 40.751 62.224 1.00 47.57  ? 242  LEU A CG  1 
ATOM   507  C CD1 . LEU A 1 68  ? 21.479 41.688 61.855 1.00 48.29  ? 242  LEU A CD1 1 
ATOM   508  C CD2 . LEU A 1 68  ? 22.001 39.537 62.935 1.00 50.15  ? 242  LEU A CD2 1 
ATOM   509  N N   . GLU A 1 69  ? 25.672 39.199 59.032 1.00 42.89  ? 243  GLU A N   1 
ATOM   510  C CA  . GLU A 1 69  ? 26.116 38.607 57.778 1.00 42.08  ? 243  GLU A CA  1 
ATOM   511  C C   . GLU A 1 69  ? 27.010 37.399 57.982 1.00 42.25  ? 243  GLU A C   1 
ATOM   512  O O   . GLU A 1 69  ? 26.863 36.411 57.264 1.00 40.83  ? 243  GLU A O   1 
ATOM   513  C CB  . GLU A 1 69  ? 26.803 39.658 56.876 1.00 43.48  ? 243  GLU A CB  1 
ATOM   514  C CG  . GLU A 1 69  ? 25.831 40.343 55.930 1.00 56.22  ? 243  GLU A CG  1 
ATOM   515  C CD  . GLU A 1 69  ? 25.093 39.418 54.975 1.00 77.23  ? 243  GLU A CD  1 
ATOM   516  O OE1 . GLU A 1 69  ? 23.842 39.421 55.005 1.00 70.82  ? 243  GLU A OE1 1 
ATOM   517  O OE2 . GLU A 1 69  ? 25.761 38.684 54.211 1.00 72.86  ? 243  GLU A OE2 1 
ATOM   518  N N   . THR A 1 70  ? 27.935 37.465 58.954 1.00 38.26  ? 244  THR A N   1 
ATOM   519  C CA  . THR A 1 70  ? 28.852 36.349 59.227 1.00 37.59  ? 244  THR A CA  1 
ATOM   520  C C   . THR A 1 70  ? 28.087 35.124 59.800 1.00 41.09  ? 244  THR A C   1 
ATOM   521  O O   . THR A 1 70  ? 28.376 33.992 59.410 1.00 40.91  ? 244  THR A O   1 
ATOM   522  C CB  . THR A 1 70  ? 30.005 36.832 60.113 1.00 47.31  ? 244  THR A CB  1 
ATOM   523  O OG1 . THR A 1 70  ? 30.580 38.008 59.518 1.00 41.54  ? 244  THR A OG1 1 
ATOM   524  C CG2 . THR A 1 70  ? 31.078 35.779 60.306 1.00 44.16  ? 244  THR A CG2 1 
ATOM   525  N N   . VAL A 1 71  ? 27.111 35.364 60.700 1.00 38.14  ? 245  VAL A N   1 
ATOM   526  C CA  . VAL A 1 71  ? 26.288 34.283 61.300 1.00 38.56  ? 245  VAL A CA  1 
ATOM   527  C C   . VAL A 1 71  ? 25.429 33.613 60.198 1.00 41.57  ? 245  VAL A C   1 
ATOM   528  O O   . VAL A 1 71  ? 25.418 32.381 60.090 1.00 40.14  ? 245  VAL A O   1 
ATOM   529  C CB  . VAL A 1 71  ? 25.431 34.782 62.492 1.00 42.80  ? 245  VAL A CB  1 
ATOM   530  C CG1 . VAL A 1 71  ? 24.603 33.639 63.092 1.00 42.92  ? 245  VAL A CG1 1 
ATOM   531  C CG2 . VAL A 1 71  ? 26.313 35.416 63.564 1.00 42.47  ? 245  VAL A CG2 1 
ATOM   532  N N   . LYS A 1 72  ? 24.767 34.443 59.360 1.00 38.89  ? 246  LYS A N   1 
ATOM   533  C CA  . LYS A 1 72  ? 23.942 34.005 58.217 1.00 39.27  ? 246  LYS A CA  1 
ATOM   534  C C   . LYS A 1 72  ? 24.760 33.124 57.274 1.00 42.68  ? 246  LYS A C   1 
ATOM   535  O O   . LYS A 1 72  ? 24.275 32.075 56.851 1.00 43.12  ? 246  LYS A O   1 
ATOM   536  C CB  . LYS A 1 72  ? 23.364 35.224 57.475 1.00 42.25  ? 246  LYS A CB  1 
ATOM   537  C CG  . LYS A 1 72  ? 22.508 34.887 56.249 1.00 61.26  ? 246  LYS A CG  1 
ATOM   538  C CD  . LYS A 1 72  ? 22.470 36.036 55.233 1.00 70.56  ? 246  LYS A CD  1 
ATOM   539  C CE  . LYS A 1 72  ? 23.688 36.096 54.334 1.00 82.08  ? 246  LYS A CE  1 
ATOM   540  N NZ  . LYS A 1 72  ? 23.637 35.083 53.250 1.00 92.29  ? 246  LYS A NZ  1 
ATOM   541  N N   . GLU A 1 73  ? 26.017 33.534 56.972 1.00 39.02  ? 247  GLU A N   1 
ATOM   542  C CA  . GLU A 1 73  ? 26.912 32.754 56.123 1.00 38.44  ? 247  GLU A CA  1 
ATOM   543  C C   . GLU A 1 73  ? 27.351 31.459 56.759 1.00 41.03  ? 247  GLU A C   1 
ATOM   544  O O   . GLU A 1 73  ? 27.463 30.452 56.061 1.00 42.68  ? 247  GLU A O   1 
ATOM   545  C CB  . GLU A 1 73  ? 28.120 33.580 55.642 1.00 40.09  ? 247  GLU A CB  1 
ATOM   546  C CG  . GLU A 1 73  ? 27.842 34.345 54.356 1.00 48.46  ? 247  GLU A CG  1 
ATOM   547  C CD  . GLU A 1 73  ? 27.239 33.506 53.244 1.00 61.44  ? 247  GLU A CD  1 
ATOM   548  O OE1 . GLU A 1 73  ? 27.839 32.472 52.866 1.00 62.62  ? 247  GLU A OE1 1 
ATOM   549  O OE2 . GLU A 1 73  ? 26.132 33.864 52.785 1.00 48.45  ? 247  GLU A OE2 1 
ATOM   550  N N   . LEU A 1 74  ? 27.597 31.466 58.078 1.00 37.09  ? 248  LEU A N   1 
ATOM   551  C CA  . LEU A 1 74  ? 28.009 30.270 58.823 1.00 35.40  ? 248  LEU A CA  1 
ATOM   552  C C   . LEU A 1 74  ? 26.859 29.269 58.897 1.00 38.13  ? 248  LEU A C   1 
ATOM   553  O O   . LEU A 1 74  ? 27.107 28.068 58.824 1.00 38.03  ? 248  LEU A O   1 
ATOM   554  C CB  . LEU A 1 74  ? 28.510 30.645 60.245 1.00 35.34  ? 248  LEU A CB  1 
ATOM   555  C CG  . LEU A 1 74  ? 28.983 29.502 61.159 1.00 39.22  ? 248  LEU A CG  1 
ATOM   556  C CD1 . LEU A 1 74  ? 30.280 28.895 60.681 1.00 38.76  ? 248  LEU A CD1 1 
ATOM   557  C CD2 . LEU A 1 74  ? 29.122 29.988 62.606 1.00 43.08  ? 248  LEU A CD2 1 
ATOM   558  N N   . ARG A 1 75  ? 25.615 29.752 59.059 1.00 35.03  ? 249  ARG A N   1 
ATOM   559  C CA  . ARG A 1 75  ? 24.435 28.861 59.082 1.00 36.11  ? 249  ARG A CA  1 
ATOM   560  C C   . ARG A 1 75  ? 24.351 28.149 57.721 1.00 41.90  ? 249  ARG A C   1 
ATOM   561  O O   . ARG A 1 75  ? 24.297 26.924 57.667 1.00 41.31  ? 249  ARG A O   1 
ATOM   562  C CB  . ARG A 1 75  ? 23.140 29.659 59.336 1.00 38.54  ? 249  ARG A CB  1 
ATOM   563  C CG  . ARG A 1 75  ? 22.994 30.230 60.737 1.00 41.55  ? 249  ARG A CG  1 
ATOM   564  C CD  . ARG A 1 75  ? 21.731 31.045 60.811 1.00 37.53  ? 249  ARG A CD  1 
ATOM   565  N NE  . ARG A 1 75  ? 21.601 31.782 62.070 1.00 34.03  ? 249  ARG A NE  1 
ATOM   566  C CZ  . ARG A 1 75  ? 21.171 33.035 62.166 1.00 48.88  ? 249  ARG A CZ  1 
ATOM   567  N NH1 . ARG A 1 75  ? 20.849 33.720 61.073 1.00 41.10  ? 249  ARG A NH1 1 
ATOM   568  N NH2 . ARG A 1 75  ? 21.074 33.619 63.351 1.00 40.65  ? 249  ARG A NH2 1 
ATOM   569  N N   . LYS A 1 76  ? 24.437 28.923 56.620 1.00 41.28  ? 250  LYS A N   1 
ATOM   570  C CA  . LYS A 1 76  ? 24.420 28.378 55.255 1.00 41.87  ? 250  LYS A CA  1 
ATOM   571  C C   . LYS A 1 76  ? 25.552 27.370 55.003 1.00 46.52  ? 250  LYS A C   1 
ATOM   572  O O   . LYS A 1 76  ? 25.284 26.276 54.509 1.00 46.83  ? 250  LYS A O   1 
ATOM   573  C CB  . LYS A 1 76  ? 24.486 29.504 54.221 1.00 44.61  ? 250  LYS A CB  1 
ATOM   574  C CG  . LYS A 1 76  ? 23.195 30.298 54.086 1.00 60.56  ? 250  LYS A CG  1 
ATOM   575  C CD  . LYS A 1 76  ? 23.395 31.614 53.332 1.00 72.59  ? 250  LYS A CD  1 
ATOM   576  C CE  . LYS A 1 76  ? 23.389 31.461 51.827 1.00 85.44  ? 250  LYS A CE  1 
ATOM   577  N NZ  . LYS A 1 76  ? 23.533 32.772 51.143 1.00 96.86  ? 250  LYS A NZ  1 
ATOM   578  N N   . SER A 1 77  ? 26.799 27.712 55.380 1.00 43.70  ? 251  SER A N   1 
ATOM   579  C CA  . SER A 1 77  ? 27.978 26.874 55.130 1.00 43.10  ? 251  SER A CA  1 
ATOM   580  C C   . SER A 1 77  ? 28.237 25.713 56.088 1.00 46.06  ? 251  SER A C   1 
ATOM   581  O O   . SER A 1 77  ? 28.904 24.760 55.687 1.00 46.13  ? 251  SER A O   1 
ATOM   582  C CB  . SER A 1 77  ? 29.229 27.740 55.082 1.00 47.67  ? 251  SER A CB  1 
ATOM   583  O OG  . SER A 1 77  ? 29.582 28.144 56.393 1.00 58.82  ? 251  SER A OG  1 
ATOM   584  N N   . GLN A 1 78  ? 27.825 25.817 57.367 1.00 42.26  ? 252  GLN A N   1 
ATOM   585  C CA  . GLN A 1 78  ? 28.125 24.785 58.371 1.00 41.54  ? 252  GLN A CA  1 
ATOM   586  C C   . GLN A 1 78  ? 26.907 24.278 59.144 1.00 42.91  ? 252  GLN A C   1 
ATOM   587  O O   . GLN A 1 78  ? 26.994 23.244 59.808 1.00 42.32  ? 252  GLN A O   1 
ATOM   588  C CB  . GLN A 1 78  ? 29.179 25.317 59.364 1.00 43.21  ? 252  GLN A CB  1 
ATOM   589  C CG  . GLN A 1 78  ? 30.460 24.488 59.395 1.00 63.08  ? 252  GLN A CG  1 
ATOM   590  C CD  . GLN A 1 78  ? 31.664 25.335 59.738 1.00 80.30  ? 252  GLN A CD  1 
ATOM   591  O OE1 . GLN A 1 78  ? 32.130 26.147 58.932 1.00 76.76  ? 252  GLN A OE1 1 
ATOM   592  N NE2 . GLN A 1 78  ? 32.202 25.160 60.941 1.00 66.64  ? 252  GLN A NE2 1 
ATOM   593  N N   . GLY A 1 79  ? 25.801 25.000 59.051 1.00 38.12  ? 253  GLY A N   1 
ATOM   594  C CA  . GLY A 1 79  ? 24.584 24.679 59.780 1.00 37.54  ? 253  GLY A CA  1 
ATOM   595  C C   . GLY A 1 79  ? 23.646 23.637 59.188 1.00 39.93  ? 253  GLY A C   1 
ATOM   596  O O   . GLY A 1 79  ? 23.746 23.277 58.010 1.00 38.34  ? 253  GLY A O   1 
ATOM   597  N N   . PRO A 1 80  ? 22.700 23.153 60.026 1.00 33.92  ? 254  PRO A N   1 
ATOM   598  C CA  . PRO A 1 80  ? 22.562 23.495 61.456 1.00 32.46  ? 254  PRO A CA  1 
ATOM   599  C C   . PRO A 1 80  ? 23.631 22.803 62.276 1.00 33.71  ? 254  PRO A C   1 
ATOM   600  O O   . PRO A 1 80  ? 24.186 21.792 61.844 1.00 35.92  ? 254  PRO A O   1 
ATOM   601  C CB  . PRO A 1 80  ? 21.168 22.962 61.829 1.00 33.13  ? 254  PRO A CB  1 
ATOM   602  C CG  . PRO A 1 80  ? 20.571 22.371 60.577 1.00 37.33  ? 254  PRO A CG  1 
ATOM   603  C CD  . PRO A 1 80  ? 21.705 22.142 59.622 1.00 33.54  ? 254  PRO A CD  1 
ATOM   604  N N   . LEU A 1 81  ? 23.912 23.332 63.470 1.00 29.68  ? 255  LEU A N   1 
ATOM   605  C CA  . LEU A 1 81  ? 24.887 22.727 64.365 1.00 29.44  ? 255  LEU A CA  1 
ATOM   606  C C   . LEU A 1 81  ? 24.321 21.494 65.030 1.00 31.87  ? 255  LEU A C   1 
ATOM   607  O O   . LEU A 1 81  ? 23.201 21.522 65.549 1.00 30.65  ? 255  LEU A O   1 
ATOM   608  C CB  . LEU A 1 81  ? 25.319 23.713 65.477 1.00 30.24  ? 255  LEU A CB  1 
ATOM   609  C CG  . LEU A 1 81  ? 26.195 24.896 65.116 1.00 35.87  ? 255  LEU A CG  1 
ATOM   610  C CD1 . LEU A 1 81  ? 26.379 25.793 66.322 1.00 35.30  ? 255  LEU A CD1 1 
ATOM   611  C CD2 . LEU A 1 81  ? 27.574 24.428 64.615 1.00 38.64  ? 255  LEU A CD2 1 
ATOM   612  N N   . GLU A 1 82  ? 25.127 20.441 65.087 1.00 28.64  ? 256  GLU A N   1 
ATOM   613  C CA  . GLU A 1 82  ? 24.778 19.194 65.757 1.00 30.02  ? 256  GLU A CA  1 
ATOM   614  C C   . GLU A 1 82  ? 24.887 19.455 67.263 1.00 34.39  ? 256  GLU A C   1 
ATOM   615  O O   . GLU A 1 82  ? 25.517 20.449 67.655 1.00 31.94  ? 256  GLU A O   1 
ATOM   616  C CB  . GLU A 1 82  ? 25.786 18.105 65.366 1.00 32.23  ? 256  GLU A CB  1 
ATOM   617  C CG  . GLU A 1 82  ? 25.520 17.472 64.010 1.00 44.92  ? 256  GLU A CG  1 
ATOM   618  C CD  . GLU A 1 82  ? 26.638 16.586 63.502 1.00 73.50  ? 256  GLU A CD  1 
ATOM   619  O OE1 . GLU A 1 82  ? 27.072 15.681 64.251 1.00 66.55  ? 256  GLU A OE1 1 
ATOM   620  O OE2 . GLU A 1 82  ? 27.075 16.788 62.346 1.00 76.15  ? 256  GLU A OE2 1 
ATOM   621  N N   . VAL A 1 83  ? 24.302 18.562 68.113 1.00 30.84  ? 257  VAL A N   1 
ATOM   622  C CA  . VAL A 1 83  ? 24.413 18.686 69.565 1.00 29.07  ? 257  VAL A CA  1 
ATOM   623  C C   . VAL A 1 83  ? 25.900 18.584 69.920 1.00 34.39  ? 257  VAL A C   1 
ATOM   624  O O   . VAL A 1 83  ? 26.615 17.729 69.370 1.00 32.55  ? 257  VAL A O   1 
ATOM   625  C CB  . VAL A 1 83  ? 23.568 17.655 70.350 1.00 32.60  ? 257  VAL A CB  1 
ATOM   626  C CG1 . VAL A 1 83  ? 23.767 17.795 71.867 1.00 32.36  ? 257  VAL A CG1 1 
ATOM   627  C CG2 . VAL A 1 83  ? 22.088 17.784 70.003 1.00 32.38  ? 257  VAL A CG2 1 
ATOM   628  N N   . ALA A 1 84  ? 26.358 19.472 70.834 1.00 30.89  ? 258  ALA A N   1 
ATOM   629  C CA  . ALA A 1 84  ? 27.744 19.606 71.300 1.00 29.99  ? 258  ALA A CA  1 
ATOM   630  C C   . ALA A 1 84  ? 28.730 20.119 70.228 1.00 33.69  ? 258  ALA A C   1 
ATOM   631  O O   . ALA A 1 84  ? 29.898 20.284 70.550 1.00 34.99  ? 258  ALA A O   1 
ATOM   632  C CB  . ALA A 1 84  ? 28.253 18.310 71.934 1.00 30.90  ? 258  ALA A CB  1 
ATOM   633  N N   . GLU A 1 85  ? 28.274 20.473 69.017 1.00 28.50  ? 259  GLU A N   1 
ATOM   634  C CA  . GLU A 1 85  ? 29.168 21.003 67.976 1.00 27.92  ? 259  GLU A CA  1 
ATOM   635  C C   . GLU A 1 85  ? 29.500 22.474 68.188 1.00 32.28  ? 259  GLU A C   1 
ATOM   636  O O   . GLU A 1 85  ? 28.628 23.259 68.536 1.00 32.24  ? 259  GLU A O   1 
ATOM   637  C CB  . GLU A 1 85  ? 28.572 20.798 66.564 1.00 29.14  ? 259  GLU A CB  1 
ATOM   638  C CG  . GLU A 1 85  ? 29.556 20.983 65.414 1.00 38.17  ? 259  GLU A CG  1 
ATOM   639  C CD  . GLU A 1 85  ? 28.968 21.198 64.027 1.00 58.23  ? 259  GLU A CD  1 
ATOM   640  O OE1 . GLU A 1 85  ? 27.806 20.791 63.792 1.00 37.97  ? 259  GLU A OE1 1 
ATOM   641  O OE2 . GLU A 1 85  ? 29.674 21.783 63.172 1.00 50.55  ? 259  GLU A OE2 1 
ATOM   642  N N   . ALA A 1 86  ? 30.745 22.859 67.888 1.00 29.46  ? 260  ALA A N   1 
ATOM   643  C CA  . ALA A 1 86  ? 31.218 24.251 67.941 1.00 30.13  ? 260  ALA A CA  1 
ATOM   644  C C   . ALA A 1 86  ? 31.642 24.751 66.545 1.00 33.83  ? 260  ALA A C   1 
ATOM   645  O O   . ALA A 1 86  ? 32.257 24.008 65.788 1.00 35.50  ? 260  ALA A O   1 
ATOM   646  C CB  . ALA A 1 86  ? 32.376 24.385 68.917 1.00 31.00  ? 260  ALA A CB  1 
ATOM   647  N N   . ALA A 1 87  ? 31.309 25.990 66.207 1.00 32.09  ? 261  ALA A N   1 
ATOM   648  C CA  . ALA A 1 87  ? 31.683 26.602 64.916 1.00 33.17  ? 261  ALA A CA  1 
ATOM   649  C C   . ALA A 1 87  ? 32.081 28.048 65.171 1.00 37.11  ? 261  ALA A C   1 
ATOM   650  O O   . ALA A 1 87  ? 31.479 28.708 66.006 1.00 34.92  ? 261  ALA A O   1 
ATOM   651  C CB  . ALA A 1 87  ? 30.540 26.533 63.932 1.00 34.16  ? 261  ALA A CB  1 
ATOM   652  N N   . VAL A 1 88  ? 33.070 28.552 64.432 1.00 35.71  ? 262  VAL A N   1 
ATOM   653  C CA  . VAL A 1 88  ? 33.652 29.873 64.666 1.00 34.49  ? 262  VAL A CA  1 
ATOM   654  C C   . VAL A 1 88  ? 33.327 30.938 63.612 1.00 40.05  ? 262  VAL A C   1 
ATOM   655  O O   . VAL A 1 88  ? 33.297 30.656 62.414 1.00 40.89  ? 262  VAL A O   1 
ATOM   656  C CB  . VAL A 1 88  ? 35.177 29.692 64.822 1.00 38.25  ? 262  VAL A CB  1 
ATOM   657  C CG1 . VAL A 1 88  ? 35.849 30.986 65.237 1.00 37.99  ? 262  VAL A CG1 1 
ATOM   658  C CG2 . VAL A 1 88  ? 35.504 28.589 65.830 1.00 37.38  ? 262  VAL A CG2 1 
ATOM   659  N N   . SER A 1 89  ? 33.143 32.174 64.077 1.00 36.27  ? 263  SER A N   1 
ATOM   660  C CA  . SER A 1 89  ? 32.923 33.335 63.239 1.00 37.30  ? 263  SER A CA  1 
ATOM   661  C C   . SER A 1 89  ? 33.878 34.445 63.668 1.00 43.90  ? 263  SER A C   1 
ATOM   662  O O   . SER A 1 89  ? 34.046 34.709 64.869 1.00 44.10  ? 263  SER A O   1 
ATOM   663  C CB  . SER A 1 89  ? 31.472 33.801 63.311 1.00 40.33  ? 263  SER A CB  1 
ATOM   664  O OG  . SER A 1 89  ? 31.189 34.401 64.562 1.00 54.27  ? 263  SER A OG  1 
ATOM   665  N N   . GLN A 1 90  ? 34.496 35.101 62.680 1.00 40.58  ? 264  GLN A N   1 
ATOM   666  C CA  . GLN A 1 90  ? 35.416 36.204 62.909 1.00 40.14  ? 264  GLN A CA  1 
ATOM   667  C C   . GLN A 1 90  ? 34.612 37.317 63.558 1.00 43.94  ? 264  GLN A C   1 
ATOM   668  O O   . GLN A 1 90  ? 33.476 37.560 63.157 1.00 43.70  ? 264  GLN A O   1 
ATOM   669  C CB  . GLN A 1 90  ? 36.030 36.657 61.571 1.00 41.65  ? 264  GLN A CB  1 
ATOM   670  C CG  . GLN A 1 90  ? 37.195 37.622 61.748 1.00 54.83  ? 264  GLN A CG  1 
ATOM   671  C CD  . GLN A 1 90  ? 37.920 37.861 60.454 1.00 73.91  ? 264  GLN A CD  1 
ATOM   672  O OE1 . GLN A 1 90  ? 38.826 37.111 60.078 1.00 72.65  ? 264  GLN A OE1 1 
ATOM   673  N NE2 . GLN A 1 90  ? 37.534 38.910 59.747 1.00 59.33  ? 264  GLN A NE2 1 
ATOM   674  N N   . SER A 1 91  ? 35.183 37.963 64.576 1.00 40.12  ? 265  SER A N   1 
ATOM   675  C CA  . SER A 1 91  ? 34.522 38.998 65.356 1.00 39.70  ? 265  SER A CA  1 
ATOM   676  C C   . SER A 1 91  ? 34.315 40.317 64.624 1.00 45.24  ? 265  SER A C   1 
ATOM   677  O O   . SER A 1 91  ? 35.075 40.660 63.717 1.00 44.85  ? 265  SER A O   1 
ATOM   678  C CB  . SER A 1 91  ? 35.306 39.261 66.634 1.00 42.40  ? 265  SER A CB  1 
ATOM   679  O OG  . SER A 1 91  ? 36.553 39.873 66.332 1.00 46.69  ? 265  SER A OG  1 
ATOM   680  N N   . SER A 1 92  ? 33.302 41.067 65.077 1.00 41.95  ? 266  SER A N   1 
ATOM   681  C CA  . SER A 1 92  ? 32.938 42.384 64.588 1.00 41.39  ? 266  SER A CA  1 
ATOM   682  C C   . SER A 1 92  ? 32.597 43.226 65.788 1.00 44.21  ? 266  SER A C   1 
ATOM   683  O O   . SER A 1 92  ? 31.721 42.848 66.574 1.00 43.03  ? 266  SER A O   1 
ATOM   684  C CB  . SER A 1 92  ? 31.743 42.295 63.647 1.00 44.05  ? 266  SER A CB  1 
ATOM   685  O OG  . SER A 1 92  ? 32.074 41.502 62.519 1.00 50.28  ? 266  SER A OG  1 
ATOM   686  N N   . GLY A 1 93  ? 33.334 44.321 65.959 1.00 40.23  ? 267  GLY A N   1 
ATOM   687  C CA  . GLY A 1 93  ? 33.115 45.255 67.055 1.00 39.03  ? 267  GLY A CA  1 
ATOM   688  C C   . GLY A 1 93  ? 33.570 44.780 68.417 1.00 41.37  ? 267  GLY A C   1 
ATOM   689  O O   . GLY A 1 93  ? 33.111 45.330 69.426 1.00 41.24  ? 267  GLY A O   1 
ATOM   690  N N   . LEU A 1 94  ? 34.460 43.753 68.465 1.00 36.08  ? 268  LEU A N   1 
ATOM   691  C CA  . LEU A 1 94  ? 34.987 43.224 69.738 1.00 35.95  ? 268  LEU A CA  1 
ATOM   692  C C   . LEU A 1 94  ? 36.503 43.267 69.781 1.00 39.96  ? 268  LEU A C   1 
ATOM   693  O O   . LEU A 1 94  ? 37.139 43.187 68.735 1.00 39.38  ? 268  LEU A O   1 
ATOM   694  C CB  . LEU A 1 94  ? 34.600 41.745 69.956 1.00 35.60  ? 268  LEU A CB  1 
ATOM   695  C CG  . LEU A 1 94  ? 33.214 41.263 69.584 1.00 39.25  ? 268  LEU A CG  1 
ATOM   696  C CD1 . LEU A 1 94  ? 33.154 39.747 69.662 1.00 39.18  ? 268  LEU A CD1 1 
ATOM   697  C CD2 . LEU A 1 94  ? 32.165 41.902 70.459 1.00 41.88  ? 268  LEU A CD2 1 
ATOM   698  N N   . ALA A 1 95  ? 37.076 43.235 71.008 1.00 36.94  ? 269  ALA A N   1 
ATOM   699  C CA  . ALA A 1 95  ? 38.517 43.114 71.223 1.00 37.12  ? 269  ALA A CA  1 
ATOM   700  C C   . ALA A 1 95  ? 38.903 41.650 70.959 1.00 38.37  ? 269  ALA A C   1 
ATOM   701  O O   . ALA A 1 95  ? 40.019 41.358 70.520 1.00 36.24  ? 269  ALA A O   1 
ATOM   702  C CB  . ALA A 1 95  ? 38.869 43.515 72.642 1.00 37.92  ? 269  ALA A CB  1 
ATOM   703  N N   . ALA A 1 96  ? 37.944 40.725 71.184 1.00 34.49  ? 270  ALA A N   1 
ATOM   704  C CA  . ALA A 1 96  ? 38.130 39.312 70.909 1.00 32.60  ? 270  ALA A CA  1 
ATOM   705  C C   . ALA A 1 96  ? 38.274 39.136 69.424 1.00 34.68  ? 270  ALA A C   1 
ATOM   706  O O   . ALA A 1 96  ? 37.725 39.921 68.657 1.00 36.71  ? 270  ALA A O   1 
ATOM   707  C CB  . ALA A 1 96  ? 36.920 38.520 71.386 1.00 32.64  ? 270  ALA A CB  1 
ATOM   708  N N   . LYS A 1 97  ? 38.976 38.119 69.022 1.00 29.66  ? 271  LYS A N   1 
ATOM   709  C CA  . LYS A 1 97  ? 39.185 37.838 67.619 1.00 30.63  ? 271  LYS A CA  1 
ATOM   710  C C   . LYS A 1 97  ? 38.072 36.967 67.023 1.00 34.32  ? 271  LYS A C   1 
ATOM   711  O O   . LYS A 1 97  ? 37.726 37.128 65.859 1.00 33.46  ? 271  LYS A O   1 
ATOM   712  C CB  . LYS A 1 97  ? 40.540 37.142 67.445 1.00 33.87  ? 271  LYS A CB  1 
ATOM   713  C CG  . LYS A 1 97  ? 41.763 38.004 67.880 1.00 31.43  ? 271  LYS A CG  1 
ATOM   714  C CD  . LYS A 1 97  ? 43.009 37.140 68.184 1.00 46.07  ? 271  LYS A CD  1 
ATOM   715  C CE  . LYS A 1 97  ? 43.481 36.180 67.097 1.00 66.35  ? 271  LYS A CE  1 
ATOM   716  N NZ  . LYS A 1 97  ? 43.912 36.870 65.850 1.00 81.85  ? 271  LYS A NZ  1 
ATOM   717  N N   . PHE A 1 98  ? 37.549 36.003 67.801 1.00 30.82  ? 272  PHE A N   1 
ATOM   718  C CA  . PHE A 1 98  ? 36.537 35.082 67.274 1.00 30.58  ? 272  PHE A CA  1 
ATOM   719  C C   . PHE A 1 98  ? 35.431 34.808 68.275 1.00 34.19  ? 272  PHE A C   1 
ATOM   720  O O   . PHE A 1 98  ? 35.641 34.928 69.489 1.00 32.51  ? 272  PHE A O   1 
ATOM   721  C CB  . PHE A 1 98  ? 37.199 33.750 66.921 1.00 32.38  ? 272  PHE A CB  1 
ATOM   722  C CG  . PHE A 1 98  ? 38.225 33.822 65.809 1.00 33.97  ? 272  PHE A CG  1 
ATOM   723  C CD1 . PHE A 1 98  ? 37.834 33.778 64.475 1.00 37.03  ? 272  PHE A CD1 1 
ATOM   724  C CD2 . PHE A 1 98  ? 39.576 33.969 66.098 1.00 36.59  ? 272  PHE A CD2 1 
ATOM   725  C CE1 . PHE A 1 98  ? 38.782 33.833 63.452 1.00 38.89  ? 272  PHE A CE1 1 
ATOM   726  C CE2 . PHE A 1 98  ? 40.521 34.052 65.074 1.00 38.69  ? 272  PHE A CE2 1 
ATOM   727  C CZ  . PHE A 1 98  ? 40.119 33.974 63.759 1.00 36.81  ? 272  PHE A CZ  1 
ATOM   728  N N   . VAL A 1 99  ? 34.247 34.466 67.742 1.00 29.77  ? 273  VAL A N   1 
ATOM   729  C CA  . VAL A 1 99  ? 33.087 34.016 68.505 1.00 28.03  ? 273  VAL A CA  1 
ATOM   730  C C   . VAL A 1 99  ? 33.043 32.526 68.222 1.00 27.71  ? 273  VAL A C   1 
ATOM   731  O O   . VAL A 1 99  ? 33.095 32.144 67.059 1.00 27.09  ? 273  VAL A O   1 
ATOM   732  C CB  . VAL A 1 99  ? 31.770 34.718 68.094 1.00 31.58  ? 273  VAL A CB  1 
ATOM   733  C CG1 . VAL A 1 99  ? 30.577 34.144 68.871 1.00 30.63  ? 273  VAL A CG1 1 
ATOM   734  C CG2 . VAL A 1 99  ? 31.866 36.226 68.311 1.00 31.31  ? 273  VAL A CG2 1 
ATOM   735  N N   . ILE A 1 100 ? 32.958 31.686 69.269 1.00 24.15  ? 274  ILE A N   1 
ATOM   736  C CA  . ILE A 1 100 ? 32.898 30.230 69.142 1.00 24.60  ? 274  ILE A CA  1 
ATOM   737  C C   . ILE A 1 100 ? 31.427 29.838 69.490 1.00 27.35  ? 274  ILE A C   1 
ATOM   738  O O   . ILE A 1 100 ? 31.058 29.776 70.669 1.00 26.51  ? 274  ILE A O   1 
ATOM   739  C CB  . ILE A 1 100 ? 33.900 29.548 70.106 1.00 27.06  ? 274  ILE A CB  1 
ATOM   740  C CG1 . ILE A 1 100 ? 35.382 29.983 69.837 1.00 28.15  ? 274  ILE A CG1 1 
ATOM   741  C CG2 . ILE A 1 100 ? 33.762 28.021 70.150 1.00 27.47  ? 274  ILE A CG2 1 
ATOM   742  C CD1 . ILE A 1 100 ? 36.190 30.076 71.041 1.00 31.08  ? 274  ILE A CD1 1 
ATOM   743  N N   . HIS A 1 101 ? 30.620 29.617 68.473 1.00 26.98  ? 275  HIS A N   1 
ATOM   744  C CA  . HIS A 1 101 ? 29.217 29.238 68.649 1.00 25.22  ? 275  HIS A CA  1 
ATOM   745  C C   . HIS A 1 101 ? 29.144 27.758 69.002 1.00 28.48  ? 275  HIS A C   1 
ATOM   746  O O   . HIS A 1 101 ? 29.870 26.965 68.410 1.00 29.30  ? 275  HIS A O   1 
ATOM   747  C CB  . HIS A 1 101 ? 28.379 29.558 67.380 1.00 24.99  ? 275  HIS A CB  1 
ATOM   748  C CG  . HIS A 1 101 ? 28.602 30.910 66.784 1.00 26.93  ? 275  HIS A CG  1 
ATOM   749  N ND1 . HIS A 1 101 ? 27.763 31.962 67.064 1.00 29.71  ? 275  HIS A ND1 1 
ATOM   750  C CD2 . HIS A 1 101 ? 29.539 31.324 65.896 1.00 28.43  ? 275  HIS A CD2 1 
ATOM   751  C CE1 . HIS A 1 101 ? 28.199 32.981 66.336 1.00 28.83  ? 275  HIS A CE1 1 
ATOM   752  N NE2 . HIS A 1 101 ? 29.269 32.642 65.624 1.00 28.79  ? 275  HIS A NE2 1 
ATOM   753  N N   . CYS A 1 102 ? 28.327 27.366 70.008 1.00 25.04  ? 276  CYS A N   1 
ATOM   754  C CA  . CYS A 1 102 ? 28.216 25.942 70.327 1.00 24.44  ? 276  CYS A CA  1 
ATOM   755  C C   . CYS A 1 102 ? 26.775 25.589 70.580 1.00 26.78  ? 276  CYS A C   1 
ATOM   756  O O   . CYS A 1 102 ? 26.061 26.376 71.166 1.00 26.85  ? 276  CYS A O   1 
ATOM   757  C CB  . CYS A 1 102 ? 29.107 25.501 71.485 1.00 26.25  ? 276  CYS A CB  1 
ATOM   758  S SG  . CYS A 1 102 ? 28.722 26.286 73.074 1.00 31.04  ? 276  CYS A SG  1 
ATOM   759  N N   . HIS A 1 103 ? 26.370 24.383 70.172 1.00 24.82  ? 277  HIS A N   1 
ATOM   760  C CA  . HIS A 1 103 ? 24.992 23.948 70.391 1.00 23.30  ? 277  HIS A CA  1 
ATOM   761  C C   . HIS A 1 103 ? 24.985 23.158 71.669 1.00 24.11  ? 277  HIS A C   1 
ATOM   762  O O   . HIS A 1 103 ? 25.399 22.009 71.715 1.00 25.59  ? 277  HIS A O   1 
ATOM   763  C CB  . HIS A 1 103 ? 24.482 23.171 69.164 1.00 24.36  ? 277  HIS A CB  1 
ATOM   764  C CG  . HIS A 1 103 ? 23.136 22.509 69.337 1.00 27.18  ? 277  HIS A CG  1 
ATOM   765  N ND1 . HIS A 1 103 ? 22.609 21.694 68.341 1.00 28.87  ? 277  HIS A ND1 1 
ATOM   766  C CD2 . HIS A 1 103 ? 22.299 22.492 70.400 1.00 27.62  ? 277  HIS A CD2 1 
ATOM   767  C CE1 . HIS A 1 103 ? 21.471 21.209 68.833 1.00 27.30  ? 277  HIS A CE1 1 
ATOM   768  N NE2 . HIS A 1 103 ? 21.230 21.673 70.055 1.00 26.85  ? 277  HIS A NE2 1 
ATOM   769  N N   . ILE A 1 104 ? 24.524 23.786 72.729 1.00 26.08  ? 278  ILE A N   1 
ATOM   770  C CA  . ILE A 1 104 ? 24.497 23.149 74.041 1.00 26.40  ? 278  ILE A CA  1 
ATOM   771  C C   . ILE A 1 104 ? 23.342 22.106 74.172 1.00 25.76  ? 278  ILE A C   1 
ATOM   772  O O   . ILE A 1 104 ? 22.243 22.357 73.678 1.00 25.21  ? 278  ILE A O   1 
ATOM   773  C CB  . ILE A 1 104 ? 24.485 24.195 75.182 1.00 30.63  ? 278  ILE A CB  1 
ATOM   774  C CG1 . ILE A 1 104 ? 23.274 25.121 75.062 1.00 32.40  ? 278  ILE A CG1 1 
ATOM   775  C CG2 . ILE A 1 104 ? 25.805 25.012 75.197 1.00 31.76  ? 278  ILE A CG2 1 
ATOM   776  C CD1 . ILE A 1 104 ? 22.689 25.480 76.382 1.00 48.30  ? 278  ILE A CD1 1 
ATOM   777  N N   . PRO A 1 105 ? 23.574 20.960 74.861 1.00 23.41  ? 279  PRO A N   1 
ATOM   778  C CA  . PRO A 1 105 ? 22.472 19.969 75.004 1.00 22.36  ? 279  PRO A CA  1 
ATOM   779  C C   . PRO A 1 105 ? 21.381 20.461 75.951 1.00 25.24  ? 279  PRO A C   1 
ATOM   780  O O   . PRO A 1 105 ? 21.645 21.310 76.812 1.00 25.48  ? 279  PRO A O   1 
ATOM   781  C CB  . PRO A 1 105 ? 23.174 18.724 75.570 1.00 24.85  ? 279  PRO A CB  1 
ATOM   782  C CG  . PRO A 1 105 ? 24.410 19.240 76.229 1.00 30.96  ? 279  PRO A CG  1 
ATOM   783  C CD  . PRO A 1 105 ? 24.826 20.471 75.484 1.00 26.42  ? 279  PRO A CD  1 
ATOM   784  N N   . GLN A 1 106 ? 20.157 19.923 75.800 1.00 24.37  ? 280  GLN A N   1 
ATOM   785  C CA  . GLN A 1 106 ? 19.035 20.299 76.684 1.00 24.81  ? 280  GLN A CA  1 
ATOM   786  C C   . GLN A 1 106 ? 19.056 19.397 77.898 1.00 24.61  ? 280  GLN A C   1 
ATOM   787  O O   . GLN A 1 106 ? 19.274 18.195 77.757 1.00 24.77  ? 280  GLN A O   1 
ATOM   788  C CB  . GLN A 1 106 ? 17.691 20.185 75.973 1.00 26.88  ? 280  GLN A CB  1 
ATOM   789  C CG  . GLN A 1 106 ? 17.437 21.287 74.948 1.00 44.37  ? 280  GLN A CG  1 
ATOM   790  C CD  . GLN A 1 106 ? 16.008 21.300 74.444 1.00 73.57  ? 280  GLN A CD  1 
ATOM   791  O OE1 . GLN A 1 106 ? 15.212 22.174 74.806 1.00 73.28  ? 280  GLN A OE1 1 
ATOM   792  N NE2 . GLN A 1 106 ? 15.647 20.338 73.589 1.00 57.03  ? 280  GLN A NE2 1 
ATOM   793  N N   . TRP A 1 107 ? 18.816 19.961 79.080 1.00 22.12  ? 281  TRP A N   1 
ATOM   794  C CA  . TRP A 1 107 ? 18.773 19.200 80.330 1.00 23.14  ? 281  TRP A CA  1 
ATOM   795  C C   . TRP A 1 107 ? 17.611 18.188 80.235 1.00 26.12  ? 281  TRP A C   1 
ATOM   796  O O   . TRP A 1 107 ? 16.570 18.518 79.684 1.00 25.48  ? 281  TRP A O   1 
ATOM   797  C CB  . TRP A 1 107 ? 18.577 20.139 81.539 1.00 22.60  ? 281  TRP A CB  1 
ATOM   798  C CG  . TRP A 1 107 ? 18.324 19.454 82.855 1.00 24.82  ? 281  TRP A CG  1 
ATOM   799  C CD1 . TRP A 1 107 ? 17.141 19.398 83.541 1.00 28.21  ? 281  TRP A CD1 1 
ATOM   800  C CD2 . TRP A 1 107 ? 19.270 18.670 83.617 1.00 25.09  ? 281  TRP A CD2 1 
ATOM   801  N NE1 . TRP A 1 107 ? 17.299 18.656 84.705 1.00 28.32  ? 281  TRP A NE1 1 
ATOM   802  C CE2 . TRP A 1 107 ? 18.586 18.174 84.755 1.00 29.52  ? 281  TRP A CE2 1 
ATOM   803  C CE3 . TRP A 1 107 ? 20.629 18.338 83.445 1.00 26.10  ? 281  TRP A CE3 1 
ATOM   804  C CZ2 . TRP A 1 107 ? 19.229 17.398 85.737 1.00 28.77  ? 281  TRP A CZ2 1 
ATOM   805  C CZ3 . TRP A 1 107 ? 21.273 17.600 84.438 1.00 27.77  ? 281  TRP A CZ3 1 
ATOM   806  C CH2 . TRP A 1 107 ? 20.562 17.090 85.533 1.00 28.42  ? 281  TRP A CH2 1 
ATOM   807  N N   . GLY A 1 108 ? 17.826 16.991 80.735 1.00 26.13  ? 282  GLY A N   1 
ATOM   808  C CA  . GLY A 1 108 ? 16.791 15.953 80.694 1.00 27.25  ? 282  GLY A CA  1 
ATOM   809  C C   . GLY A 1 108 ? 16.881 15.042 79.492 1.00 31.68  ? 282  GLY A C   1 
ATOM   810  O O   . GLY A 1 108 ? 16.150 14.044 79.428 1.00 31.75  ? 282  GLY A O   1 
ATOM   811  N N   . SER A 1 109 ? 17.742 15.388 78.516 1.00 24.23  ? 283  SER A N   1 
ATOM   812  C CA  . SER A 1 109 ? 18.002 14.556 77.349 1.00 24.69  ? 283  SER A CA  1 
ATOM   813  C C   . SER A 1 109 ? 18.979 13.457 77.724 1.00 29.44  ? 283  SER A C   1 
ATOM   814  O O   . SER A 1 109 ? 19.721 13.611 78.698 1.00 25.59  ? 283  SER A O   1 
ATOM   815  C CB  . SER A 1 109 ? 18.493 15.359 76.145 1.00 27.89  ? 283  SER A CB  1 
ATOM   816  O OG  . SER A 1 109 ? 19.733 16.026 76.355 1.00 29.62  ? 283  SER A OG  1 
ATOM   817  N N   . ASP A 1 110 ? 18.931 12.334 76.981 1.00 28.46  ? 284  ASP A N   1 
ATOM   818  C CA  . ASP A 1 110 ? 19.784 11.164 77.194 1.00 28.70  ? 284  ASP A CA  1 
ATOM   819  C C   . ASP A 1 110 ? 21.269 11.563 77.251 1.00 30.04  ? 284  ASP A C   1 
ATOM   820  O O   . ASP A 1 110 ? 21.815 12.085 76.270 1.00 30.32  ? 284  ASP A O   1 
ATOM   821  C CB  . ASP A 1 110 ? 19.571 10.128 76.062 1.00 31.73  ? 284  ASP A CB  1 
ATOM   822  C CG  . ASP A 1 110 ? 20.197 8.758  76.309 1.00 47.03  ? 284  ASP A CG  1 
ATOM   823  O OD1 . ASP A 1 110 ? 19.981 8.189  77.413 1.00 46.53  ? 284  ASP A OD1 1 
ATOM   824  O OD2 . ASP A 1 110 ? 20.880 8.242  75.392 1.00 54.67  ? 284  ASP A OD2 1 
ATOM   825  N N   . LYS A 1 111 ? 21.907 11.288 78.395 1.00 26.46  ? 285  LYS A N   1 
ATOM   826  C CA  . LYS A 1 111 ? 23.346 11.529 78.621 1.00 25.42  ? 285  LYS A CA  1 
ATOM   827  C C   . LYS A 1 111 ? 23.707 13.027 78.467 1.00 26.05  ? 285  LYS A C   1 
ATOM   828  O O   . LYS A 1 111 ? 24.824 13.360 78.051 1.00 24.42  ? 285  LYS A O   1 
ATOM   829  C CB  . LYS A 1 111 ? 24.210 10.682 77.652 1.00 26.01  ? 285  LYS A CB  1 
ATOM   830  C CG  . LYS A 1 111 ? 23.900 9.174  77.616 1.00 33.73  ? 285  LYS A CG  1 
ATOM   831  C CD  . LYS A 1 111 ? 24.230 8.507  78.953 1.00 40.92  ? 285  LYS A CD  1 
ATOM   832  C CE  . LYS A 1 111 ? 23.848 7.053  78.963 1.00 49.63  ? 285  LYS A CE  1 
ATOM   833  N NZ  . LYS A 1 111 ? 23.753 6.550  80.356 1.00 56.72  ? 285  LYS A NZ  1 
ATOM   834  N N   . CYS A 1 112 ? 22.750 13.916 78.759 1.00 23.61  ? 286  CYS A N   1 
ATOM   835  C CA  . CYS A 1 112 ? 22.984 15.364 78.606 1.00 23.85  ? 286  CYS A CA  1 
ATOM   836  C C   . CYS A 1 112 ? 24.252 15.850 79.352 1.00 27.40  ? 286  CYS A C   1 
ATOM   837  O O   . CYS A 1 112 ? 24.950 16.717 78.843 1.00 26.01  ? 286  CYS A O   1 
ATOM   838  C CB  . CYS A 1 112 ? 21.746 16.165 79.014 1.00 24.25  ? 286  CYS A CB  1 
ATOM   839  S SG  . CYS A 1 112 ? 21.268 15.965 80.746 1.00 29.03  ? 286  CYS A SG  1 
ATOM   840  N N   . GLU A 1 113 ? 24.570 15.261 80.521 1.00 24.87  ? 287  GLU A N   1 
ATOM   841  C CA  . GLU A 1 113 ? 25.789 15.616 81.276 1.00 25.77  ? 287  GLU A CA  1 
ATOM   842  C C   . GLU A 1 113 ? 27.055 15.276 80.454 1.00 28.37  ? 287  GLU A C   1 
ATOM   843  O O   . GLU A 1 113 ? 27.938 16.123 80.315 1.00 25.00  ? 287  GLU A O   1 
ATOM   844  C CB  . GLU A 1 113 ? 25.792 14.959 82.674 1.00 26.86  ? 287  GLU A CB  1 
ATOM   845  C CG  . GLU A 1 113 ? 24.756 15.567 83.604 1.00 29.33  ? 287  GLU A CG  1 
ATOM   846  C CD  . GLU A 1 113 ? 24.664 14.995 85.007 1.00 54.49  ? 287  GLU A CD  1 
ATOM   847  O OE1 . GLU A 1 113 ? 25.725 14.728 85.619 1.00 61.69  ? 287  GLU A OE1 1 
ATOM   848  O OE2 . GLU A 1 113 ? 23.524 14.841 85.506 1.00 38.09  ? 287  GLU A OE2 1 
ATOM   849  N N   . GLU A 1 114 ? 27.103 14.092 79.813 1.00 24.28  ? 288  GLU A N   1 
ATOM   850  C CA  . GLU A 1 114 ? 28.237 13.744 78.973 1.00 25.78  ? 288  GLU A CA  1 
ATOM   851  C C   . GLU A 1 114 ? 28.310 14.601 77.711 1.00 28.34  ? 288  GLU A C   1 
ATOM   852  O O   . GLU A 1 114 ? 29.399 14.937 77.261 1.00 27.84  ? 288  GLU A O   1 
ATOM   853  C CB  . GLU A 1 114 ? 28.154 12.278 78.558 1.00 27.40  ? 288  GLU A CB  1 
ATOM   854  C CG  . GLU A 1 114 ? 28.504 11.352 79.701 1.00 35.42  ? 288  GLU A CG  1 
ATOM   855  C CD  . GLU A 1 114 ? 27.934 9.971  79.499 1.00 57.05  ? 288  GLU A CD  1 
ATOM   856  O OE1 . GLU A 1 114 ? 27.797 9.547  78.327 1.00 48.59  ? 288  GLU A OE1 1 
ATOM   857  O OE2 . GLU A 1 114 ? 27.614 9.318  80.516 1.00 50.82  ? 288  GLU A OE2 1 
ATOM   858  N N   . GLN A 1 115 ? 27.151 14.964 77.153 1.00 24.25  ? 289  GLN A N   1 
ATOM   859  C CA  . GLN A 1 115 ? 27.080 15.824 75.978 1.00 23.16  ? 289  GLN A CA  1 
ATOM   860  C C   . GLN A 1 115 ? 27.574 17.256 76.339 1.00 25.18  ? 289  GLN A C   1 
ATOM   861  O O   . GLN A 1 115 ? 28.171 17.912 75.481 1.00 26.31  ? 289  GLN A O   1 
ATOM   862  C CB  . GLN A 1 115 ? 25.670 15.821 75.388 1.00 25.56  ? 289  GLN A CB  1 
ATOM   863  C CG  . GLN A 1 115 ? 25.364 14.490 74.646 1.00 30.43  ? 289  GLN A CG  1 
ATOM   864  C CD  . GLN A 1 115 ? 25.658 14.524 73.170 1.00 57.01  ? 289  GLN A CD  1 
ATOM   865  O OE1 . GLN A 1 115 ? 26.807 14.655 72.738 1.00 50.19  ? 289  GLN A OE1 1 
ATOM   866  N NE2 . GLN A 1 115 ? 24.617 14.373 72.359 1.00 60.02  ? 289  GLN A NE2 1 
ATOM   867  N N   . LEU A 1 116 ? 27.290 17.728 77.576 1.00 19.92  ? 290  LEU A N   1 
ATOM   868  C CA  . LEU A 1 116 ? 27.755 19.072 78.065 1.00 20.13  ? 290  LEU A CA  1 
ATOM   869  C C   . LEU A 1 116 ? 29.267 18.993 78.139 1.00 23.45  ? 290  LEU A C   1 
ATOM   870  O O   . LEU A 1 116 ? 29.931 19.885 77.662 1.00 23.39  ? 290  LEU A O   1 
ATOM   871  C CB  . LEU A 1 116 ? 27.184 19.419 79.460 1.00 20.26  ? 290  LEU A CB  1 
ATOM   872  C CG  . LEU A 1 116 ? 27.678 20.776 80.060 1.00 23.87  ? 290  LEU A CG  1 
ATOM   873  C CD1 . LEU A 1 116 ? 27.491 21.935 79.084 1.00 24.46  ? 290  LEU A CD1 1 
ATOM   874  C CD2 . LEU A 1 116 ? 27.124 21.016 81.465 1.00 27.72  ? 290  LEU A CD2 1 
ATOM   875  N N   . GLU A 1 117 ? 29.804 17.901 78.719 1.00 19.74  ? 291  GLU A N   1 
ATOM   876  C CA  . GLU A 1 117 ? 31.245 17.660 78.752 1.00 20.96  ? 291  GLU A CA  1 
ATOM   877  C C   . GLU A 1 117 ? 31.854 17.766 77.332 1.00 27.69  ? 291  GLU A C   1 
ATOM   878  O O   . GLU A 1 117 ? 32.826 18.498 77.163 1.00 27.65  ? 291  GLU A O   1 
ATOM   879  C CB  . GLU A 1 117 ? 31.540 16.314 79.437 1.00 23.78  ? 291  GLU A CB  1 
ATOM   880  C CG  . GLU A 1 117 ? 32.940 15.792 79.156 1.00 39.60  ? 291  GLU A CG  1 
ATOM   881  C CD  . GLU A 1 117 ? 33.562 14.939 80.243 1.00 61.13  ? 291  GLU A CD  1 
ATOM   882  O OE1 . GLU A 1 117 ? 32.867 14.043 80.776 1.00 54.70  ? 291  GLU A OE1 1 
ATOM   883  O OE2 . GLU A 1 117 ? 34.760 15.155 80.542 1.00 58.07  ? 291  GLU A OE2 1 
ATOM   884  N N   . GLU A 1 118 ? 31.246 17.127 76.304 1.00 24.20  ? 292  GLU A N   1 
ATOM   885  C CA  . GLU A 1 118 ? 31.719 17.182 74.921 1.00 25.70  ? 292  GLU A CA  1 
ATOM   886  C C   . GLU A 1 118 ? 31.605 18.562 74.329 1.00 26.68  ? 292  GLU A C   1 
ATOM   887  O O   . GLU A 1 118 ? 32.456 18.969 73.533 1.00 26.58  ? 292  GLU A O   1 
ATOM   888  C CB  . GLU A 1 118 ? 31.019 16.139 74.009 1.00 28.06  ? 292  GLU A CB  1 
ATOM   889  C CG  . GLU A 1 118 ? 31.414 14.695 74.289 1.00 38.78  ? 292  GLU A CG  1 
ATOM   890  C CD  . GLU A 1 118 ? 32.898 14.401 74.434 1.00 61.17  ? 292  GLU A CD  1 
ATOM   891  O OE1 . GLU A 1 118 ? 33.647 14.652 73.461 1.00 53.21  ? 292  GLU A OE1 1 
ATOM   892  O OE2 . GLU A 1 118 ? 33.313 13.928 75.520 1.00 47.92  ? 292  GLU A OE2 1 
ATOM   893  N N   . THR A 1 119 ? 30.546 19.295 74.706 1.00 21.66  ? 293  THR A N   1 
ATOM   894  C CA  . THR A 1 119 ? 30.368 20.642 74.228 1.00 20.48  ? 293  THR A CA  1 
ATOM   895  C C   . THR A 1 119 ? 31.554 21.514 74.685 1.00 22.89  ? 293  THR A C   1 
ATOM   896  O O   . THR A 1 119 ? 32.100 22.273 73.899 1.00 23.52  ? 293  THR A O   1 
ATOM   897  C CB  . THR A 1 119 ? 29.112 21.272 74.802 1.00 22.47  ? 293  THR A CB  1 
ATOM   898  O OG1 . THR A 1 119 ? 27.981 20.431 74.539 1.00 27.92  ? 293  THR A OG1 1 
ATOM   899  C CG2 . THR A 1 119 ? 28.891 22.673 74.249 1.00 20.99  ? 293  THR A CG2 1 
ATOM   900  N N   . ILE A 1 120 ? 31.869 21.450 75.969 1.00 18.45  ? 294  ILE A N   1 
ATOM   901  C CA  . ILE A 1 120 ? 32.915 22.287 76.560 1.00 19.81  ? 294  ILE A CA  1 
ATOM   902  C C   . ILE A 1 120 ? 34.263 21.931 75.903 1.00 25.44  ? 294  ILE A C   1 
ATOM   903  O O   . ILE A 1 120 ? 35.053 22.827 75.618 1.00 23.04  ? 294  ILE A O   1 
ATOM   904  C CB  . ILE A 1 120 ? 32.959 22.128 78.117 1.00 21.65  ? 294  ILE A CB  1 
ATOM   905  C CG1 . ILE A 1 120 ? 31.641 22.592 78.826 1.00 22.66  ? 294  ILE A CG1 1 
ATOM   906  C CG2 . ILE A 1 120 ? 34.202 22.845 78.716 1.00 23.30  ? 294  ILE A CG2 1 
ATOM   907  C CD1 . ILE A 1 120 ? 31.142 23.969 78.459 1.00 25.09  ? 294  ILE A CD1 1 
ATOM   908  N N   . LYS A 1 121 ? 34.491 20.643 75.633 1.00 22.56  ? 295  LYS A N   1 
ATOM   909  C CA  . LYS A 1 121 ? 35.748 20.196 75.008 1.00 24.17  ? 295  LYS A CA  1 
ATOM   910  C C   . LYS A 1 121 ? 35.825 20.676 73.590 1.00 29.26  ? 295  LYS A C   1 
ATOM   911  O O   . LYS A 1 121 ? 36.879 21.208 73.216 1.00 30.31  ? 295  LYS A O   1 
ATOM   912  C CB  . LYS A 1 121 ? 35.870 18.693 75.104 1.00 27.43  ? 295  LYS A CB  1 
ATOM   913  C CG  . LYS A 1 121 ? 36.155 18.273 76.514 1.00 24.50  ? 295  LYS A CG  1 
ATOM   914  C CD  . LYS A 1 121 ? 36.060 16.783 76.563 1.00 34.07  ? 295  LYS A CD  1 
ATOM   915  C CE  . LYS A 1 121 ? 36.534 16.311 77.899 1.00 34.62  ? 295  LYS A CE  1 
ATOM   916  N NZ  . LYS A 1 121 ? 37.044 14.925 77.784 1.00 38.45  ? 295  LYS A NZ  1 
ATOM   917  N N   . ASN A 1 122 ? 34.692 20.668 72.854 1.00 25.60  ? 296  ASN A N   1 
ATOM   918  C CA  . ASN A 1 122 ? 34.649 21.206 71.485 1.00 25.59  ? 296  ASN A CA  1 
ATOM   919  C C   . ASN A 1 122 ? 34.909 22.718 71.375 1.00 27.90  ? 296  ASN A C   1 
ATOM   920  O O   . ASN A 1 122 ? 35.490 23.150 70.380 1.00 26.40  ? 296  ASN A O   1 
ATOM   921  C CB  . ASN A 1 122 ? 33.375 20.830 70.757 1.00 25.63  ? 296  ASN A CB  1 
ATOM   922  C CG  . ASN A 1 122 ? 33.314 19.360 70.448 1.00 34.19  ? 296  ASN A CG  1 
ATOM   923  O OD1 . ASN A 1 122 ? 34.326 18.641 70.508 1.00 31.93  ? 296  ASN A OD1 1 
ATOM   924  N ND2 . ASN A 1 122 ? 32.113 18.869 70.143 1.00 31.26  ? 296  ASN A ND2 1 
ATOM   925  N N   . CYS A 1 123 ? 34.446 23.526 72.353 1.00 25.96  ? 297  CYS A N   1 
ATOM   926  C CA  . CYS A 1 123 ? 34.704 24.974 72.442 1.00 23.72  ? 297  CYS A CA  1 
ATOM   927  C C   . CYS A 1 123 ? 36.194 25.236 72.588 1.00 25.63  ? 297  CYS A C   1 
ATOM   928  O O   . CYS A 1 123 ? 36.726 26.140 71.942 1.00 24.20  ? 297  CYS A O   1 
ATOM   929  C CB  . CYS A 1 123 ? 33.961 25.565 73.632 1.00 23.76  ? 297  CYS A CB  1 
ATOM   930  S SG  . CYS A 1 123 ? 32.185 25.692 73.365 1.00 26.79  ? 297  CYS A SG  1 
ATOM   931  N N   . LEU A 1 124 ? 36.827 24.519 73.518 1.00 20.67  ? 298  LEU A N   1 
ATOM   932  C CA  . LEU A 1 124 ? 38.268 24.642 73.798 1.00 22.28  ? 298  LEU A CA  1 
ATOM   933  C C   . LEU A 1 124 ? 39.003 24.246 72.527 1.00 27.81  ? 298  LEU A C   1 
ATOM   934  O O   . LEU A 1 124 ? 39.836 25.009 72.075 1.00 26.23  ? 298  LEU A O   1 
ATOM   935  C CB  . LEU A 1 124 ? 38.677 23.763 74.996 1.00 20.86  ? 298  LEU A CB  1 
ATOM   936  C CG  . LEU A 1 124 ? 38.083 24.112 76.407 1.00 23.48  ? 298  LEU A CG  1 
ATOM   937  C CD1 . LEU A 1 124 ? 38.415 23.046 77.430 1.00 23.38  ? 298  LEU A CD1 1 
ATOM   938  C CD2 . LEU A 1 124 ? 38.526 25.500 76.918 1.00 23.85  ? 298  LEU A CD2 1 
ATOM   939  N N   . SER A 1 125 ? 38.584 23.151 71.872 1.00 25.16  ? 299  SER A N   1 
ATOM   940  C CA  . SER A 1 125 ? 39.186 22.715 70.608 1.00 24.65  ? 299  SER A CA  1 
ATOM   941  C C   . SER A 1 125 ? 39.049 23.761 69.512 1.00 28.86  ? 299  SER A C   1 
ATOM   942  O O   . SER A 1 125 ? 40.072 24.072 68.889 1.00 31.69  ? 299  SER A O   1 
ATOM   943  C CB  . SER A 1 125 ? 38.673 21.337 70.186 1.00 25.25  ? 299  SER A CB  1 
ATOM   944  O OG  . SER A 1 125 ? 39.105 20.391 71.155 1.00 34.53  ? 299  SER A OG  1 
ATOM   945  N N   . ALA A 1 126 ? 37.869 24.388 69.351 1.00 24.94  ? 300  ALA A N   1 
ATOM   946  C CA  . ALA A 1 126 ? 37.666 25.482 68.408 1.00 24.87  ? 300  ALA A CA  1 
ATOM   947  C C   . ALA A 1 126 ? 38.600 26.702 68.657 1.00 30.52  ? 300  ALA A C   1 
ATOM   948  O O   . ALA A 1 126 ? 39.109 27.290 67.679 1.00 31.75  ? 300  ALA A O   1 
ATOM   949  C CB  . ALA A 1 126 ? 36.207 25.913 68.411 1.00 25.49  ? 300  ALA A CB  1 
ATOM   950  N N   . ALA A 1 127 ? 38.827 27.078 69.942 1.00 25.08  ? 301  ALA A N   1 
ATOM   951  C CA  . ALA A 1 127 ? 39.694 28.214 70.355 1.00 25.14  ? 301  ALA A CA  1 
ATOM   952  C C   . ALA A 1 127 ? 41.168 27.938 70.002 1.00 29.02  ? 301  ALA A C   1 
ATOM   953  O O   . ALA A 1 127 ? 41.857 28.794 69.435 1.00 28.29  ? 301  ALA A O   1 
ATOM   954  C CB  . ALA A 1 127 ? 39.570 28.467 71.871 1.00 26.05  ? 301  ALA A CB  1 
ATOM   955  N N   . GLU A 1 128 ? 41.663 26.764 70.393 1.00 27.37  ? 302  GLU A N   1 
ATOM   956  C CA  . GLU A 1 128 ? 43.037 26.324 70.104 1.00 30.60  ? 302  GLU A CA  1 
ATOM   957  C C   . GLU A 1 128 ? 43.316 26.245 68.617 1.00 36.03  ? 302  GLU A C   1 
ATOM   958  O O   . GLU A 1 128 ? 44.461 26.410 68.210 1.00 35.44  ? 302  GLU A O   1 
ATOM   959  C CB  . GLU A 1 128 ? 43.222 24.889 70.582 1.00 31.98  ? 302  GLU A CB  1 
ATOM   960  C CG  . GLU A 1 128 ? 43.089 24.729 72.052 1.00 35.13  ? 302  GLU A CG  1 
ATOM   961  C CD  . GLU A 1 128 ? 43.052 23.286 72.482 1.00 36.50  ? 302  GLU A CD  1 
ATOM   962  O OE1 . GLU A 1 128 ? 43.362 23.077 73.666 1.00 36.06  ? 302  GLU A OE1 1 
ATOM   963  O OE2 . GLU A 1 128 ? 42.698 22.378 71.690 1.00 34.70  ? 302  GLU A OE2 1 
ATOM   964  N N   . ASP A 1 129 ? 42.302 25.850 67.826 1.00 33.23  ? 303  ASP A N   1 
ATOM   965  C CA  . ASP A 1 129 ? 42.435 25.725 66.386 1.00 32.62  ? 303  ASP A CA  1 
ATOM   966  C C   . ASP A 1 129 ? 42.591 27.094 65.711 1.00 35.79  ? 303  ASP A C   1 
ATOM   967  O O   . ASP A 1 129 ? 43.032 27.124 64.566 1.00 35.42  ? 303  ASP A O   1 
ATOM   968  C CB  . ASP A 1 129 ? 41.320 24.864 65.776 1.00 34.22  ? 303  ASP A CB  1 
ATOM   969  C CG  . ASP A 1 129 ? 41.406 23.392 66.176 1.00 41.67  ? 303  ASP A CG  1 
ATOM   970  O OD1 . ASP A 1 129 ? 42.373 23.017 66.874 1.00 45.80  ? 303  ASP A OD1 1 
ATOM   971  O OD2 . ASP A 1 129 ? 40.491 22.620 65.811 1.00 45.23  ? 303  ASP A OD2 1 
ATOM   972  N N   . LYS A 1 130 ? 42.349 28.219 66.457 1.00 31.74  ? 304  LYS A N   1 
ATOM   973  C CA  . LYS A 1 130 ? 42.617 29.584 65.985 1.00 30.84  ? 304  LYS A CA  1 
ATOM   974  C C   . LYS A 1 130 ? 43.860 30.152 66.719 1.00 33.27  ? 304  LYS A C   1 
ATOM   975  O O   . LYS A 1 130 ? 44.169 31.360 66.624 1.00 32.87  ? 304  LYS A O   1 
ATOM   976  C CB  . LYS A 1 130 ? 41.393 30.496 66.161 1.00 32.72  ? 304  LYS A CB  1 
ATOM   977  C CG  . LYS A 1 130 ? 40.210 30.095 65.278 1.00 31.70  ? 304  LYS A CG  1 
ATOM   978  C CD  . LYS A 1 130 ? 40.500 30.394 63.782 1.00 39.75  ? 304  LYS A CD  1 
ATOM   979  C CE  . LYS A 1 130 ? 39.323 30.111 62.866 1.00 55.14  ? 304  LYS A CE  1 
ATOM   980  N NZ  . LYS A 1 130 ? 38.980 28.661 62.805 1.00 67.02  ? 304  LYS A NZ  1 
ATOM   981  N N   . LYS A 1 131 ? 44.564 29.259 67.457 1.00 28.52  ? 305  LYS A N   1 
ATOM   982  C CA  . LYS A 1 131 ? 45.731 29.538 68.298 1.00 28.86  ? 305  LYS A CA  1 
ATOM   983  C C   . LYS A 1 131 ? 45.460 30.603 69.339 1.00 33.48  ? 305  LYS A C   1 
ATOM   984  O O   . LYS A 1 131 ? 46.338 31.404 69.669 1.00 32.41  ? 305  LYS A O   1 
ATOM   985  C CB  . LYS A 1 131 ? 46.992 29.881 67.468 1.00 31.26  ? 305  LYS A CB  1 
ATOM   986  C CG  . LYS A 1 131 ? 47.446 28.716 66.638 1.00 32.44  ? 305  LYS A CG  1 
ATOM   987  C CD  . LYS A 1 131 ? 48.589 29.178 65.742 1.00 48.73  ? 305  LYS A CD  1 
ATOM   988  C CE  . LYS A 1 131 ? 48.834 28.222 64.608 1.00 65.74  ? 305  LYS A CE  1 
ATOM   989  N NZ  . LYS A 1 131 ? 49.266 26.877 65.084 1.00 83.93  ? 305  LYS A NZ  1 
ATOM   990  N N   . LEU A 1 132 ? 44.233 30.620 69.862 1.00 30.43  ? 306  LEU A N   1 
ATOM   991  C CA  . LEU A 1 132 ? 43.855 31.594 70.877 1.00 30.06  ? 306  LEU A CA  1 
ATOM   992  C C   . LEU A 1 132 ? 44.533 31.328 72.217 1.00 29.81  ? 306  LEU A C   1 
ATOM   993  O O   . LEU A 1 132 ? 44.674 30.193 72.633 1.00 29.11  ? 306  LEU A O   1 
ATOM   994  C CB  . LEU A 1 132 ? 42.323 31.641 71.037 1.00 30.25  ? 306  LEU A CB  1 
ATOM   995  C CG  . LEU A 1 132 ? 41.498 32.048 69.794 1.00 35.13  ? 306  LEU A CG  1 
ATOM   996  C CD1 . LEU A 1 132 ? 40.004 32.050 70.080 1.00 34.08  ? 306  LEU A CD1 1 
ATOM   997  C CD2 . LEU A 1 132 ? 41.929 33.404 69.207 1.00 35.76  ? 306  LEU A CD2 1 
ATOM   998  N N   . LYS A 1 133 ? 44.959 32.379 72.902 1.00 26.02  ? 307  LYS A N   1 
ATOM   999  C CA  . LYS A 1 133 ? 45.618 32.204 74.188 1.00 25.45  ? 307  LYS A CA  1 
ATOM   1000 C C   . LYS A 1 133 ? 44.650 32.249 75.380 1.00 25.00  ? 307  LYS A C   1 
ATOM   1001 O O   . LYS A 1 133 ? 45.012 31.892 76.515 1.00 22.60  ? 307  LYS A O   1 
ATOM   1002 C CB  . LYS A 1 133 ? 46.661 33.325 74.342 1.00 28.45  ? 307  LYS A CB  1 
ATOM   1003 C CG  . LYS A 1 133 ? 47.978 33.019 73.633 1.00 36.04  ? 307  LYS A CG  1 
ATOM   1004 C CD  . LYS A 1 133 ? 48.963 34.163 73.859 1.00 40.60  ? 307  LYS A CD  1 
ATOM   1005 C CE  . LYS A 1 133 ? 48.816 35.288 72.847 1.00 63.97  ? 307  LYS A CE  1 
ATOM   1006 N NZ  . LYS A 1 133 ? 49.198 34.863 71.467 1.00 76.65  ? 307  LYS A NZ  1 
ATOM   1007 N N   . SER A 1 134 ? 43.435 32.733 75.126 1.00 23.85  ? 308  SER A N   1 
ATOM   1008 C CA  . SER A 1 134 ? 42.446 32.871 76.175 1.00 22.57  ? 308  SER A CA  1 
ATOM   1009 C C   . SER A 1 134 ? 41.058 32.675 75.600 1.00 24.46  ? 308  SER A C   1 
ATOM   1010 O O   . SER A 1 134 ? 40.815 32.936 74.402 1.00 22.42  ? 308  SER A O   1 
ATOM   1011 C CB  . SER A 1 134 ? 42.586 34.229 76.875 1.00 22.70  ? 308  SER A CB  1 
ATOM   1012 O OG  . SER A 1 134 ? 42.438 35.310 75.970 1.00 27.71  ? 308  SER A OG  1 
ATOM   1013 N N   . VAL A 1 135 ? 40.159 32.148 76.440 1.00 20.68  ? 309  VAL A N   1 
ATOM   1014 C CA  . VAL A 1 135 ? 38.771 31.914 76.042 1.00 19.87  ? 309  VAL A CA  1 
ATOM   1015 C C   . VAL A 1 135 ? 37.834 32.230 77.210 1.00 19.45  ? 309  VAL A C   1 
ATOM   1016 O O   . VAL A 1 135 ? 38.166 31.953 78.382 1.00 18.63  ? 309  VAL A O   1 
ATOM   1017 C CB  . VAL A 1 135 ? 38.573 30.493 75.451 1.00 23.06  ? 309  VAL A CB  1 
ATOM   1018 C CG1 . VAL A 1 135 ? 38.788 29.412 76.510 1.00 21.91  ? 309  VAL A CG1 1 
ATOM   1019 C CG2 . VAL A 1 135 ? 37.232 30.364 74.751 1.00 23.40  ? 309  VAL A CG2 1 
ATOM   1020 N N   . ALA A 1 136 ? 36.646 32.814 76.895 1.00 19.81  ? 310  ALA A N   1 
ATOM   1021 C CA  . ALA A 1 136 ? 35.687 33.122 77.942 1.00 17.26  ? 310  ALA A CA  1 
ATOM   1022 C C   . ALA A 1 136 ? 34.370 32.338 77.758 1.00 18.00  ? 310  ALA A C   1 
ATOM   1023 O O   . ALA A 1 136 ? 33.878 32.214 76.640 1.00 20.16  ? 310  ALA A O   1 
ATOM   1024 C CB  . ALA A 1 136 ? 35.389 34.587 77.973 1.00 17.96  ? 310  ALA A CB  1 
ATOM   1025 N N   . PHE A 1 137 ? 33.880 31.782 78.834 1.00 16.76  ? 311  PHE A N   1 
ATOM   1026 C CA  . PHE A 1 137 ? 32.570 31.080 78.815 1.00 16.11  ? 311  PHE A CA  1 
ATOM   1027 C C   . PHE A 1 137 ? 31.545 31.971 79.524 1.00 19.87  ? 311  PHE A C   1 
ATOM   1028 O O   . PHE A 1 137 ? 31.684 32.217 80.746 1.00 19.05  ? 311  PHE A O   1 
ATOM   1029 C CB  . PHE A 1 137 ? 32.617 29.723 79.523 1.00 18.84  ? 311  PHE A CB  1 
ATOM   1030 C CG  . PHE A 1 137 ? 33.369 28.642 78.796 1.00 19.01  ? 311  PHE A CG  1 
ATOM   1031 C CD1 . PHE A 1 137 ? 34.756 28.524 78.937 1.00 22.97  ? 311  PHE A CD1 1 
ATOM   1032 C CD2 . PHE A 1 137 ? 32.725 27.835 77.857 1.00 20.06  ? 311  PHE A CD2 1 
ATOM   1033 C CE1 . PHE A 1 137 ? 35.466 27.574 78.210 1.00 23.36  ? 311  PHE A CE1 1 
ATOM   1034 C CE2 . PHE A 1 137 ? 33.444 26.873 77.119 1.00 20.16  ? 311  PHE A CE2 1 
ATOM   1035 C CZ  . PHE A 1 137 ? 34.801 26.739 77.316 1.00 18.63  ? 311  PHE A CZ  1 
ATOM   1036 N N   . PRO A 1 138 ? 30.466 32.332 78.801 1.00 18.52  ? 312  PRO A N   1 
ATOM   1037 C CA  . PRO A 1 138 ? 29.423 33.178 79.405 1.00 18.91  ? 312  PRO A CA  1 
ATOM   1038 C C   . PRO A 1 138 ? 28.461 32.334 80.220 1.00 25.21  ? 312  PRO A C   1 
ATOM   1039 O O   . PRO A 1 138 ? 28.523 31.081 80.168 1.00 22.10  ? 312  PRO A O   1 
ATOM   1040 C CB  . PRO A 1 138 ? 28.782 33.829 78.202 1.00 21.74  ? 312  PRO A CB  1 
ATOM   1041 C CG  . PRO A 1 138 ? 28.799 32.757 77.183 1.00 24.68  ? 312  PRO A CG  1 
ATOM   1042 C CD  . PRO A 1 138 ? 30.164 32.077 77.371 1.00 19.34  ? 312  PRO A CD  1 
ATOM   1043 N N   . PRO A 1 139 ? 27.520 32.977 80.944 1.00 24.40  ? 313  PRO A N   1 
ATOM   1044 C CA  . PRO A 1 139 ? 26.586 32.181 81.743 1.00 26.01  ? 313  PRO A CA  1 
ATOM   1045 C C   . PRO A 1 139 ? 25.817 31.150 80.948 1.00 31.92  ? 313  PRO A C   1 
ATOM   1046 O O   . PRO A 1 139 ? 25.426 31.346 79.796 1.00 25.74  ? 313  PRO A O   1 
ATOM   1047 C CB  . PRO A 1 139 ? 25.686 33.223 82.410 1.00 27.09  ? 313  PRO A CB  1 
ATOM   1048 C CG  . PRO A 1 139 ? 26.488 34.482 82.414 1.00 30.05  ? 313  PRO A CG  1 
ATOM   1049 C CD  . PRO A 1 139 ? 27.313 34.434 81.152 1.00 25.85  ? 313  PRO A CD  1 
ATOM   1050 N N   . PHE A 1 140 ? 25.712 29.996 81.551 1.00 37.84  ? 314  PHE A N   1 
ATOM   1051 C CA  . PHE A 1 140 ? 24.995 28.879 80.982 1.00 41.65  ? 314  PHE A CA  1 
ATOM   1052 C C   . PHE A 1 140 ? 23.480 29.221 80.929 1.00 46.09  ? 314  PHE A C   1 
ATOM   1053 O O   . PHE A 1 140 ? 22.956 29.729 81.936 1.00 44.49  ? 314  PHE A O   1 
ATOM   1054 C CB  . PHE A 1 140 ? 25.281 27.634 81.839 1.00 45.68  ? 314  PHE A CB  1 
ATOM   1055 C CG  . PHE A 1 140 ? 25.184 26.358 81.048 1.00 49.90  ? 314  PHE A CG  1 
ATOM   1056 C CD1 . PHE A 1 140 ? 25.916 26.189 79.874 1.00 54.92  ? 314  PHE A CD1 1 
ATOM   1057 C CD2 . PHE A 1 140 ? 24.337 25.333 81.456 1.00 53.42  ? 314  PHE A CD2 1 
ATOM   1058 C CE1 . PHE A 1 140 ? 25.788 25.027 79.120 1.00 56.65  ? 314  PHE A CE1 1 
ATOM   1059 C CE2 . PHE A 1 140 ? 24.228 24.161 80.713 1.00 56.86  ? 314  PHE A CE2 1 
ATOM   1060 C CZ  . PHE A 1 140 ? 24.940 24.020 79.544 1.00 55.58  ? 314  PHE A CZ  1 
ATOM   1061 N N   . PRO A 1 141 ? 22.800 29.030 79.756 1.00 44.03  ? 315  PRO A N   1 
ATOM   1062 C CA  . PRO A 1 141 ? 21.362 29.372 79.641 1.00 44.35  ? 315  PRO A CA  1 
ATOM   1063 C C   . PRO A 1 141 ? 20.499 28.827 80.778 1.00 46.11  ? 315  PRO A C   1 
ATOM   1064 O O   . PRO A 1 141 ? 20.796 27.757 81.314 1.00 44.54  ? 315  PRO A O   1 
ATOM   1065 C CB  . PRO A 1 141 ? 20.977 28.805 78.275 1.00 46.71  ? 315  PRO A CB  1 
ATOM   1066 C CG  . PRO A 1 141 ? 22.233 28.890 77.492 1.00 51.23  ? 315  PRO A CG  1 
ATOM   1067 C CD  . PRO A 1 141 ? 23.302 28.481 78.479 1.00 46.79  ? 315  PRO A CD  1 
ATOM   1068 N N   . SER A 1 142 ? 19.486 29.607 81.192 1.00 42.89  ? 316  SER A N   1 
ATOM   1069 C CA  . SER A 1 142 ? 18.679 29.322 82.372 1.00 43.43  ? 316  SER A CA  1 
ATOM   1070 C C   . SER A 1 142 ? 17.134 29.372 82.179 1.00 48.20  ? 316  SER A C   1 
ATOM   1071 O O   . SER A 1 142 ? 16.407 29.826 83.066 1.00 48.56  ? 316  SER A O   1 
ATOM   1072 C CB  . SER A 1 142 ? 19.109 30.246 83.514 1.00 46.75  ? 316  SER A CB  1 
ATOM   1073 O OG  . SER A 1 142 ? 19.005 31.612 83.141 1.00 53.98  ? 316  SER A OG  1 
ATOM   1074 N N   . GLY A 1 143 ? 16.647 28.834 81.066 1.00 44.83  ? 317  GLY A N   1 
ATOM   1075 C CA  . GLY A 1 143 ? 15.213 28.734 80.786 1.00 44.28  ? 317  GLY A CA  1 
ATOM   1076 C C   . GLY A 1 143 ? 14.499 27.667 81.609 1.00 46.86  ? 317  GLY A C   1 
ATOM   1077 O O   . GLY A 1 143 ? 14.941 27.304 82.704 1.00 46.82  ? 317  GLY A O   1 
ATOM   1078 N N   . ARG A 1 144 ? 13.369 27.169 81.099 1.00 40.88  ? 318  ARG A N   1 
ATOM   1079 C CA  . ARG A 1 144 ? 12.567 26.143 81.776 1.00 39.06  ? 318  ARG A CA  1 
ATOM   1080 C C   . ARG A 1 144 ? 13.295 24.791 81.767 1.00 39.71  ? 318  ARG A C   1 
ATOM   1081 O O   . ARG A 1 144 ? 13.906 24.448 80.759 1.00 40.02  ? 318  ARG A O   1 
ATOM   1082 C CB  . ARG A 1 144 ? 11.166 26.041 81.139 1.00 40.15  ? 318  ARG A CB  1 
ATOM   1083 C CG  . ARG A 1 144 ? 11.191 25.907 79.606 1.00 55.85  ? 318  ARG A CG  1 
ATOM   1084 C CD  . ARG A 1 144 ? 9.808  25.763 79.006 1.00 68.13  ? 318  ARG A CD  1 
ATOM   1085 N NE  . ARG A 1 144 ? 9.319  24.386 79.087 1.00 68.54  ? 318  ARG A NE  1 
ATOM   1086 C CZ  . ARG A 1 144 ? 8.520  23.926 80.044 1.00 77.32  ? 318  ARG A CZ  1 
ATOM   1087 N NH1 . ARG A 1 144 ? 8.097  24.729 81.012 1.00 74.03  ? 318  ARG A NH1 1 
ATOM   1088 N NH2 . ARG A 1 144 ? 8.133  22.659 80.038 1.00 48.12  ? 318  ARG A NH2 1 
ATOM   1089 N N   . ASN A 1 145 ? 13.284 24.054 82.903 1.00 34.65  ? 319  ASN A N   1 
ATOM   1090 C CA  . ASN A 1 145 ? 13.936 22.737 83.030 1.00 34.71  ? 319  ASN A CA  1 
ATOM   1091 C C   . ASN A 1 145 ? 15.372 22.761 82.465 1.00 38.42  ? 319  ASN A C   1 
ATOM   1092 O O   . ASN A 1 145 ? 15.765 21.887 81.673 1.00 37.04  ? 319  ASN A O   1 
ATOM   1093 C CB  . ASN A 1 145 ? 13.105 21.657 82.318 1.00 30.81  ? 319  ASN A CB  1 
ATOM   1094 C CG  . ASN A 1 145 ? 11.688 21.535 82.808 1.00 34.75  ? 319  ASN A CG  1 
ATOM   1095 O OD1 . ASN A 1 145 ? 10.728 21.648 82.017 1.00 31.91  ? 319  ASN A OD1 1 
ATOM   1096 N ND2 . ASN A 1 145 ? 11.529 21.271 84.111 1.00 23.51  ? 319  ASN A ND2 1 
ATOM   1097 N N   . CYS A 1 146 ? 16.124 23.800 82.832 1.00 35.14  ? 320  CYS A N   1 
ATOM   1098 C CA  A CYS A 1 146 ? 17.498 23.922 82.356 0.50 35.78  ? 320  CYS A CA  1 
ATOM   1099 C CA  B CYS A 1 146 ? 17.505 23.972 82.376 0.50 33.82  ? 320  CYS A CA  1 
ATOM   1100 C C   . CYS A 1 146 ? 18.444 23.170 83.280 1.00 35.53  ? 320  CYS A C   1 
ATOM   1101 O O   . CYS A 1 146 ? 18.010 22.615 84.299 1.00 33.49  ? 320  CYS A O   1 
ATOM   1102 C CB  A CYS A 1 146 ? 17.901 25.381 82.173 0.50 37.66  ? 320  CYS A CB  1 
ATOM   1103 C CB  B CYS A 1 146 ? 17.879 25.451 82.352 0.50 33.86  ? 320  CYS A CB  1 
ATOM   1104 S SG  A CYS A 1 146 ? 17.608 26.015 80.502 0.50 42.75  ? 320  CYS A SG  1 
ATOM   1105 S SG  B CYS A 1 146 ? 17.877 26.237 83.982 0.50 37.73  ? 320  CYS A SG  1 
ATOM   1106 N N   . PHE A 1 147 ? 19.733 23.101 82.917 1.00 29.25  ? 321  PHE A N   1 
ATOM   1107 C CA  . PHE A 1 147 ? 20.673 22.380 83.745 1.00 26.99  ? 321  PHE A CA  1 
ATOM   1108 C C   . PHE A 1 147 ? 20.744 22.975 85.182 1.00 31.46  ? 321  PHE A C   1 
ATOM   1109 O O   . PHE A 1 147 ? 20.875 24.187 85.311 1.00 33.04  ? 321  PHE A O   1 
ATOM   1110 C CB  . PHE A 1 147 ? 22.075 22.483 83.102 1.00 26.77  ? 321  PHE A CB  1 
ATOM   1111 C CG  . PHE A 1 147 ? 22.495 21.355 82.195 1.00 25.03  ? 321  PHE A CG  1 
ATOM   1112 C CD1 . PHE A 1 147 ? 22.136 21.353 80.856 1.00 24.43  ? 321  PHE A CD1 1 
ATOM   1113 C CD2 . PHE A 1 147 ? 23.399 20.385 82.634 1.00 26.85  ? 321  PHE A CD2 1 
ATOM   1114 C CE1 . PHE A 1 147 ? 22.563 20.340 80.001 1.00 24.16  ? 321  PHE A CE1 1 
ATOM   1115 C CE2 . PHE A 1 147 ? 23.817 19.371 81.782 1.00 25.85  ? 321  PHE A CE2 1 
ATOM   1116 C CZ  . PHE A 1 147 ? 23.441 19.384 80.458 1.00 23.53  ? 321  PHE A CZ  1 
ATOM   1117 N N   . PRO A 1 148 ? 20.684 22.159 86.257 1.00 29.99  ? 322  PRO A N   1 
ATOM   1118 C CA  . PRO A 1 148 ? 20.926 22.685 87.612 1.00 30.29  ? 322  PRO A CA  1 
ATOM   1119 C C   . PRO A 1 148 ? 22.319 23.344 87.659 1.00 34.45  ? 322  PRO A C   1 
ATOM   1120 O O   . PRO A 1 148 ? 23.271 22.803 87.064 1.00 32.06  ? 322  PRO A O   1 
ATOM   1121 C CB  . PRO A 1 148 ? 20.948 21.416 88.468 1.00 32.11  ? 322  PRO A CB  1 
ATOM   1122 C CG  . PRO A 1 148 ? 20.158 20.438 87.721 1.00 36.25  ? 322  PRO A CG  1 
ATOM   1123 C CD  . PRO A 1 148 ? 20.503 20.696 86.295 1.00 32.16  ? 322  PRO A CD  1 
ATOM   1124 N N   . LYS A 1 149 ? 22.435 24.517 88.319 1.00 30.11  ? 323  LYS A N   1 
ATOM   1125 C CA  . LYS A 1 149 ? 23.723 25.253 88.365 1.00 30.68  ? 323  LYS A CA  1 
ATOM   1126 C C   . LYS A 1 149 ? 24.915 24.432 88.858 1.00 33.35  ? 323  LYS A C   1 
ATOM   1127 O O   . LYS A 1 149 ? 25.979 24.522 88.243 1.00 31.85  ? 323  LYS A O   1 
ATOM   1128 C CB  . LYS A 1 149 ? 23.608 26.550 89.161 1.00 33.24  ? 323  LYS A CB  1 
ATOM   1129 C CG  . LYS A 1 149 ? 22.706 27.591 88.525 1.00 39.41  ? 323  LYS A CG  1 
ATOM   1130 C CD  . LYS A 1 149 ? 22.681 28.847 89.386 1.00 48.80  ? 323  LYS A CD  1 
ATOM   1131 C CE  . LYS A 1 149 ? 21.696 29.872 88.874 1.00 59.78  ? 323  LYS A CE  1 
ATOM   1132 N NZ  . LYS A 1 149 ? 22.064 30.362 87.517 1.00 72.78  ? 323  LYS A NZ  1 
ATOM   1133 N N   . GLN A 1 150 ? 24.770 23.699 89.983 1.00 29.12  ? 324  GLN A N   1 
ATOM   1134 C CA  . GLN A 1 150 ? 25.802 22.862 90.567 1.00 30.24  ? 324  GLN A CA  1 
ATOM   1135 C C   . GLN A 1 150 ? 26.315 21.798 89.578 1.00 34.38  ? 324  GLN A C   1 
ATOM   1136 O O   . GLN A 1 150 ? 27.523 21.612 89.469 1.00 33.49  ? 324  GLN A O   1 
ATOM   1137 C CB  . GLN A 1 150 ? 25.325 22.233 91.885 1.00 31.67  ? 324  GLN A CB  1 
ATOM   1138 C CG  . GLN A 1 150 ? 26.374 21.381 92.616 1.00 51.74  ? 324  GLN A CG  1 
ATOM   1139 C CD  . GLN A 1 150 ? 25.963 20.897 94.005 1.00 68.97  ? 324  GLN A CD  1 
ATOM   1140 O OE1 . GLN A 1 150 ? 25.022 21.402 94.639 1.00 66.85  ? 324  GLN A OE1 1 
ATOM   1141 N NE2 . GLN A 1 150 ? 26.687 19.910 94.524 1.00 50.52  ? 324  GLN A NE2 1 
ATOM   1142 N N   . THR A 1 151 ? 25.393 21.160 88.818 1.00 31.63  ? 325  THR A N   1 
ATOM   1143 C CA  . THR A 1 151 ? 25.705 20.150 87.814 1.00 30.01  ? 325  THR A CA  1 
ATOM   1144 C C   . THR A 1 151 ? 26.470 20.747 86.627 1.00 30.23  ? 325  THR A C   1 
ATOM   1145 O O   . THR A 1 151 ? 27.526 20.207 86.259 1.00 29.78  ? 325  THR A O   1 
ATOM   1146 C CB  . THR A 1 151 ? 24.427 19.405 87.418 1.00 38.54  ? 325  THR A CB  1 
ATOM   1147 O OG1 . THR A 1 151 ? 23.927 18.794 88.599 1.00 36.84  ? 325  THR A OG1 1 
ATOM   1148 C CG2 . THR A 1 151 ? 24.670 18.339 86.355 1.00 39.62  ? 325  THR A CG2 1 
ATOM   1149 N N   . ALA A 1 152 ? 25.977 21.867 86.091 1.00 26.61  ? 326  ALA A N   1 
ATOM   1150 C CA  . ALA A 1 152 ? 26.618 22.552 84.976 1.00 24.76  ? 326  ALA A CA  1 
ATOM   1151 C C   . ALA A 1 152 ? 28.047 22.977 85.385 1.00 25.90  ? 326  ALA A C   1 
ATOM   1152 O O   . ALA A 1 152 ? 28.973 22.777 84.613 1.00 25.35  ? 326  ALA A O   1 
ATOM   1153 C CB  . ALA A 1 152 ? 25.814 23.752 84.523 1.00 25.23  ? 326  ALA A CB  1 
ATOM   1154 N N   . ALA A 1 153 ? 28.219 23.546 86.580 1.00 22.77  ? 327  ALA A N   1 
ATOM   1155 C CA  . ALA A 1 153 ? 29.571 23.967 87.031 1.00 21.76  ? 327  ALA A CA  1 
ATOM   1156 C C   . ALA A 1 153 ? 30.517 22.766 87.227 1.00 27.00  ? 327  ALA A C   1 
ATOM   1157 O O   . ALA A 1 153 ? 31.673 22.829 86.815 1.00 26.28  ? 327  ALA A O   1 
ATOM   1158 C CB  . ALA A 1 153 ? 29.453 24.774 88.326 1.00 22.20  ? 327  ALA A CB  1 
ATOM   1159 N N   . GLN A 1 154 ? 30.032 21.680 87.857 1.00 26.00  ? 328  GLN A N   1 
ATOM   1160 C CA  . GLN A 1 154 ? 30.805 20.459 88.090 1.00 26.69  ? 328  GLN A CA  1 
ATOM   1161 C C   . GLN A 1 154 ? 31.273 19.869 86.754 1.00 28.89  ? 328  GLN A C   1 
ATOM   1162 O O   . GLN A 1 154 ? 32.458 19.556 86.594 1.00 28.91  ? 328  GLN A O   1 
ATOM   1163 C CB  . GLN A 1 154 ? 29.906 19.447 88.839 1.00 29.43  ? 328  GLN A CB  1 
ATOM   1164 C CG  . GLN A 1 154 ? 30.645 18.323 89.576 1.00 56.86  ? 328  GLN A CG  1 
ATOM   1165 C CD  . GLN A 1 154 ? 29.705 17.301 90.202 1.00 85.67  ? 328  GLN A CD  1 
ATOM   1166 O OE1 . GLN A 1 154 ? 28.501 17.538 90.407 1.00 80.34  ? 328  GLN A OE1 1 
ATOM   1167 N NE2 . GLN A 1 154 ? 30.239 16.127 90.525 1.00 81.05  ? 328  GLN A NE2 1 
ATOM   1168 N N   . VAL A 1 155 ? 30.350 19.722 85.794 1.00 25.84  ? 329  VAL A N   1 
ATOM   1169 C CA  . VAL A 1 155 ? 30.649 19.152 84.494 1.00 25.53  ? 329  VAL A CA  1 
ATOM   1170 C C   . VAL A 1 155 ? 31.616 20.026 83.688 1.00 26.71  ? 329  VAL A C   1 
ATOM   1171 O O   . VAL A 1 155 ? 32.590 19.498 83.149 1.00 25.35  ? 329  VAL A O   1 
ATOM   1172 C CB  . VAL A 1 155 ? 29.370 18.779 83.704 1.00 29.83  ? 329  VAL A CB  1 
ATOM   1173 C CG1 . VAL A 1 155 ? 29.703 18.364 82.280 1.00 29.83  ? 329  VAL A CG1 1 
ATOM   1174 C CG2 . VAL A 1 155 ? 28.634 17.653 84.412 1.00 29.07  ? 329  VAL A CG2 1 
ATOM   1175 N N   . THR A 1 156 ? 31.384 21.349 83.636 1.00 22.90  ? 330  THR A N   1 
ATOM   1176 C CA  . THR A 1 156 ? 32.261 22.255 82.883 1.00 22.34  ? 330  THR A CA  1 
ATOM   1177 C C   . THR A 1 156 ? 33.695 22.158 83.435 1.00 24.12  ? 330  THR A C   1 
ATOM   1178 O O   . THR A 1 156 ? 34.630 22.027 82.669 1.00 24.39  ? 330  THR A O   1 
ATOM   1179 C CB  . THR A 1 156 ? 31.698 23.688 82.951 1.00 20.42  ? 330  THR A CB  1 
ATOM   1180 O OG1 . THR A 1 156 ? 30.356 23.702 82.440 1.00 23.86  ? 330  THR A OG1 1 
ATOM   1181 C CG2 . THR A 1 156 ? 32.524 24.662 82.211 1.00 21.60  ? 330  THR A CG2 1 
ATOM   1182 N N   . LEU A 1 157 ? 33.865 22.253 84.758 1.00 20.56  ? 331  LEU A N   1 
ATOM   1183 C CA  . LEU A 1 157 ? 35.206 22.249 85.335 1.00 21.85  ? 331  LEU A CA  1 
ATOM   1184 C C   . LEU A 1 157 ? 35.917 20.921 85.118 1.00 26.44  ? 331  LEU A C   1 
ATOM   1185 O O   . LEU A 1 157 ? 37.094 20.917 84.786 1.00 25.72  ? 331  LEU A O   1 
ATOM   1186 C CB  . LEU A 1 157 ? 35.159 22.676 86.807 1.00 22.12  ? 331  LEU A CB  1 
ATOM   1187 C CG  . LEU A 1 157 ? 34.749 24.106 87.065 1.00 25.87  ? 331  LEU A CG  1 
ATOM   1188 C CD1 . LEU A 1 157 ? 34.510 24.303 88.544 1.00 26.55  ? 331  LEU A CD1 1 
ATOM   1189 C CD2 . LEU A 1 157 ? 35.793 25.092 86.563 1.00 25.46  ? 331  LEU A CD2 1 
ATOM   1190 N N   . LYS A 1 158 ? 35.163 19.807 85.139 1.00 24.83  ? 332  LYS A N   1 
ATOM   1191 C CA  . LYS A 1 158 ? 35.676 18.477 84.835 1.00 25.60  ? 332  LYS A CA  1 
ATOM   1192 C C   . LYS A 1 158 ? 36.157 18.389 83.374 1.00 30.82  ? 332  LYS A C   1 
ATOM   1193 O O   . LYS A 1 158 ? 37.223 17.831 83.109 1.00 32.81  ? 332  LYS A O   1 
ATOM   1194 C CB  . LYS A 1 158 ? 34.577 17.415 85.125 1.00 29.06  ? 332  LYS A CB  1 
ATOM   1195 C CG  . LYS A 1 158 ? 34.917 16.001 84.692 1.00 38.76  ? 332  LYS A CG  1 
ATOM   1196 C CD  . LYS A 1 158 ? 33.799 15.034 85.044 1.00 53.72  ? 332  LYS A CD  1 
ATOM   1197 C CE  . LYS A 1 158 ? 34.155 13.605 84.709 1.00 65.66  ? 332  LYS A CE  1 
ATOM   1198 N NZ  . LYS A 1 158 ? 33.882 13.289 83.285 1.00 73.90  ? 332  LYS A NZ  1 
ATOM   1199 N N   . ALA A 1 159 ? 35.371 18.910 82.443 1.00 25.34  ? 333  ALA A N   1 
ATOM   1200 C CA  . ALA A 1 159 ? 35.666 18.920 81.017 1.00 24.56  ? 333  ALA A CA  1 
ATOM   1201 C C   . ALA A 1 159 ? 36.939 19.696 80.755 1.00 26.78  ? 333  ALA A C   1 
ATOM   1202 O O   . ALA A 1 159 ? 37.763 19.269 79.944 1.00 27.09  ? 333  ALA A O   1 
ATOM   1203 C CB  . ALA A 1 159 ? 34.527 19.574 80.262 1.00 25.66  ? 333  ALA A CB  1 
ATOM   1204 N N   . ILE A 1 160 ? 37.063 20.892 81.396 1.00 20.48  ? 334  ILE A N   1 
ATOM   1205 C CA  . ILE A 1 160 ? 38.227 21.742 81.174 1.00 18.00  ? 334  ILE A CA  1 
ATOM   1206 C C   . ILE A 1 160 ? 39.504 21.022 81.611 1.00 26.45  ? 334  ILE A C   1 
ATOM   1207 O O   . ILE A 1 160 ? 40.451 20.893 80.820 1.00 24.81  ? 334  ILE A O   1 
ATOM   1208 C CB  . ILE A 1 160 ? 38.040 23.112 81.841 1.00 21.93  ? 334  ILE A CB  1 
ATOM   1209 C CG1 . ILE A 1 160 ? 36.942 23.890 81.068 1.00 22.86  ? 334  ILE A CG1 1 
ATOM   1210 C CG2 . ILE A 1 160 ? 39.378 23.885 81.790 1.00 23.41  ? 334  ILE A CG2 1 
ATOM   1211 C CD1 . ILE A 1 160 ? 36.285 25.026 81.825 1.00 24.24  ? 334  ILE A CD1 1 
ATOM   1212 N N   . SER A 1 161 ? 39.524 20.534 82.855 1.00 23.87  ? 335  SER A N   1 
ATOM   1213 C CA  . SER A 1 161 ? 40.703 19.826 83.361 1.00 25.82  ? 335  SER A CA  1 
ATOM   1214 C C   . SER A 1 161 ? 41.087 18.679 82.455 1.00 28.60  ? 335  SER A C   1 
ATOM   1215 O O   . SER A 1 161 ? 42.238 18.631 82.039 1.00 26.01  ? 335  SER A O   1 
ATOM   1216 C CB  . SER A 1 161 ? 40.492 19.346 84.794 1.00 31.01  ? 335  SER A CB  1 
ATOM   1217 O OG  . SER A 1 161 ? 40.203 20.435 85.656 1.00 45.56  ? 335  SER A OG  1 
ATOM   1218 N N   . ALA A 1 162 ? 40.120 17.834 82.059 1.00 27.75  ? 336  ALA A N   1 
ATOM   1219 C CA  . ALA A 1 162 ? 40.307 16.704 81.161 1.00 29.30  ? 336  ALA A CA  1 
ATOM   1220 C C   . ALA A 1 162 ? 40.886 17.093 79.813 1.00 30.00  ? 336  ALA A C   1 
ATOM   1221 O O   . ALA A 1 162 ? 41.774 16.416 79.309 1.00 29.32  ? 336  ALA A O   1 
ATOM   1222 C CB  . ALA A 1 162 ? 38.994 15.956 80.967 1.00 30.82  ? 336  ALA A CB  1 
ATOM   1223 N N   . HIS A 1 163 ? 40.394 18.158 79.233 1.00 27.29  ? 337  HIS A N   1 
ATOM   1224 C CA  . HIS A 1 163 ? 40.893 18.617 77.959 1.00 26.46  ? 337  HIS A CA  1 
ATOM   1225 C C   . HIS A 1 163 ? 42.378 18.927 78.076 1.00 28.73  ? 337  HIS A C   1 
ATOM   1226 O O   . HIS A 1 163 ? 43.157 18.454 77.241 1.00 28.87  ? 337  HIS A O   1 
ATOM   1227 C CB  . HIS A 1 163 ? 40.131 19.837 77.510 1.00 25.96  ? 337  HIS A CB  1 
ATOM   1228 C CG  . HIS A 1 163 ? 40.652 20.417 76.244 1.00 29.63  ? 337  HIS A CG  1 
ATOM   1229 N ND1 . HIS A 1 163 ? 40.167 20.017 75.022 1.00 31.77  ? 337  HIS A ND1 1 
ATOM   1230 C CD2 . HIS A 1 163 ? 41.572 21.389 76.058 1.00 30.90  ? 337  HIS A CD2 1 
ATOM   1231 C CE1 . HIS A 1 163 ? 40.815 20.733 74.124 1.00 31.19  ? 337  HIS A CE1 1 
ATOM   1232 N NE2 . HIS A 1 163 ? 41.655 21.586 74.703 1.00 30.75  ? 337  HIS A NE2 1 
ATOM   1233 N N   . PHE A 1 164 ? 42.765 19.698 79.127 1.00 24.11  ? 338  PHE A N   1 
ATOM   1234 C CA  . PHE A 1 164 ? 44.168 20.102 79.305 1.00 24.24  ? 338  PHE A CA  1 
ATOM   1235 C C   . PHE A 1 164 ? 45.065 18.931 79.707 1.00 28.56  ? 338  PHE A C   1 
ATOM   1236 O O   . PHE A 1 164 ? 46.215 18.876 79.262 1.00 27.72  ? 338  PHE A O   1 
ATOM   1237 C CB  . PHE A 1 164 ? 44.278 21.311 80.260 1.00 25.44  ? 338  PHE A CB  1 
ATOM   1238 C CG  . PHE A 1 164 ? 43.776 22.567 79.595 1.00 24.11  ? 338  PHE A CG  1 
ATOM   1239 C CD1 . PHE A 1 164 ? 44.298 22.987 78.378 1.00 26.64  ? 338  PHE A CD1 1 
ATOM   1240 C CD2 . PHE A 1 164 ? 42.769 23.334 80.185 1.00 26.38  ? 338  PHE A CD2 1 
ATOM   1241 C CE1 . PHE A 1 164 ? 43.836 24.156 77.763 1.00 27.65  ? 338  PHE A CE1 1 
ATOM   1242 C CE2 . PHE A 1 164 ? 42.332 24.512 79.591 1.00 27.80  ? 338  PHE A CE2 1 
ATOM   1243 C CZ  . PHE A 1 164 ? 42.851 24.909 78.369 1.00 26.44  ? 338  PHE A CZ  1 
ATOM   1244 N N   . ASP A 1 165 ? 44.518 17.929 80.416 1.00 28.59  ? 339  ASP A N   1 
ATOM   1245 C CA  . ASP A 1 165 ? 45.289 16.693 80.714 1.00 29.48  ? 339  ASP A CA  1 
ATOM   1246 C C   . ASP A 1 165 ? 45.640 15.926 79.429 1.00 38.45  ? 339  ASP A C   1 
ATOM   1247 O O   . ASP A 1 165 ? 46.644 15.209 79.401 1.00 41.48  ? 339  ASP A O   1 
ATOM   1248 C CB  . ASP A 1 165 ? 44.454 15.759 81.590 1.00 31.57  ? 339  ASP A CB  1 
ATOM   1249 C CG  . ASP A 1 165 ? 44.217 16.235 83.014 1.00 50.29  ? 339  ASP A CG  1 
ATOM   1250 O OD1 . ASP A 1 165 ? 45.068 16.991 83.542 1.00 50.64  ? 339  ASP A OD1 1 
ATOM   1251 O OD2 . ASP A 1 165 ? 43.193 15.830 83.611 1.00 60.42  ? 339  ASP A OD2 1 
ATOM   1252 N N   . ASP A 1 166 ? 44.789 16.036 78.392 1.00 33.65  ? 340  ASP A N   1 
ATOM   1253 C CA  . ASP A 1 166 ? 44.925 15.330 77.113 1.00 33.09  ? 340  ASP A CA  1 
ATOM   1254 C C   . ASP A 1 166 ? 45.739 16.054 76.057 1.00 38.71  ? 340  ASP A C   1 
ATOM   1255 O O   . ASP A 1 166 ? 45.892 15.539 74.951 1.00 38.12  ? 340  ASP A O   1 
ATOM   1256 C CB  . ASP A 1 166 ? 43.531 14.989 76.565 1.00 35.18  ? 340  ASP A CB  1 
ATOM   1257 C CG  . ASP A 1 166 ? 42.841 13.893 77.350 1.00 49.31  ? 340  ASP A CG  1 
ATOM   1258 O OD1 . ASP A 1 166 ? 43.392 13.469 78.398 1.00 49.81  ? 340  ASP A OD1 1 
ATOM   1259 O OD2 . ASP A 1 166 ? 41.740 13.473 76.936 1.00 56.30  ? 340  ASP A OD2 1 
ATOM   1260 N N   . SER A 1 167 ? 46.235 17.257 76.385 1.00 35.74  ? 341  SER A N   1 
ATOM   1261 C CA  . SER A 1 167 ? 47.009 18.077 75.468 1.00 35.52  ? 341  SER A CA  1 
ATOM   1262 C C   . SER A 1 167 ? 48.362 18.433 76.055 1.00 38.78  ? 341  SER A C   1 
ATOM   1263 O O   . SER A 1 167 ? 48.471 18.654 77.260 1.00 37.47  ? 341  SER A O   1 
ATOM   1264 C CB  . SER A 1 167 ? 46.250 19.369 75.170 1.00 37.96  ? 341  SER A CB  1 
ATOM   1265 O OG  . SER A 1 167 ? 47.090 20.285 74.488 1.00 44.13  ? 341  SER A OG  1 
ATOM   1266 N N   . SER A 1 168 ? 49.377 18.574 75.207 1.00 37.53  ? 342  SER A N   1 
ATOM   1267 C CA  . SER A 1 168 ? 50.659 19.068 75.704 1.00 37.50  ? 342  SER A CA  1 
ATOM   1268 C C   . SER A 1 168 ? 51.064 20.204 74.801 1.00 38.13  ? 342  SER A C   1 
ATOM   1269 O O   . SER A 1 168 ? 52.193 20.665 74.868 1.00 37.52  ? 342  SER A O   1 
ATOM   1270 C CB  . SER A 1 168 ? 51.718 17.964 75.756 1.00 42.58  ? 342  SER A CB  1 
ATOM   1271 O OG  . SER A 1 168 ? 52.052 17.479 74.463 1.00 51.36  ? 342  SER A OG  1 
ATOM   1272 N N   . ALA A 1 169 ? 50.145 20.678 73.963 1.00 32.68  ? 343  ALA A N   1 
ATOM   1273 C CA  . ALA A 1 169 ? 50.485 21.733 73.009 1.00 31.70  ? 343  ALA A CA  1 
ATOM   1274 C C   . ALA A 1 169 ? 49.436 22.847 72.813 1.00 32.91  ? 343  ALA A C   1 
ATOM   1275 O O   . ALA A 1 169 ? 49.694 23.763 72.027 1.00 31.56  ? 343  ALA A O   1 
ATOM   1276 C CB  . ALA A 1 169 ? 50.819 21.099 71.671 1.00 32.48  ? 343  ALA A CB  1 
ATOM   1277 N N   . SER A 1 170 ? 48.269 22.774 73.476 1.00 29.70  ? 344  SER A N   1 
ATOM   1278 C CA  . SER A 1 170 ? 47.200 23.799 73.340 1.00 28.62  ? 344  SER A CA  1 
ATOM   1279 C C   . SER A 1 170 ? 47.689 25.232 73.624 1.00 28.48  ? 344  SER A C   1 
ATOM   1280 O O   . SER A 1 170 ? 48.297 25.470 74.664 1.00 29.22  ? 344  SER A O   1 
ATOM   1281 C CB  . SER A 1 170 ? 46.065 23.507 74.321 1.00 30.20  ? 344  SER A CB  1 
ATOM   1282 O OG  . SER A 1 170 ? 45.219 24.643 74.445 1.00 33.26  ? 344  SER A OG  1 
ATOM   1283 N N   . SER A 1 171 ? 47.310 26.189 72.760 1.00 26.10  ? 345  SER A N   1 
ATOM   1284 C CA  . SER A 1 171 ? 47.661 27.587 72.888 1.00 24.66  ? 345  SER A CA  1 
ATOM   1285 C C   . SER A 1 171 ? 46.969 28.281 74.049 1.00 30.21  ? 345  SER A C   1 
ATOM   1286 O O   . SER A 1 171 ? 47.423 29.355 74.456 1.00 29.87  ? 345  SER A O   1 
ATOM   1287 C CB  . SER A 1 171 ? 47.303 28.318 71.601 1.00 30.12  ? 345  SER A CB  1 
ATOM   1288 O OG  . SER A 1 171 ? 45.936 28.127 71.278 1.00 30.72  ? 345  SER A OG  1 
ATOM   1289 N N   . LEU A 1 172 ? 45.826 27.714 74.539 1.00 26.34  ? 346  LEU A N   1 
ATOM   1290 C CA  . LEU A 1 172 ? 45.057 28.314 75.646 1.00 24.75  ? 346  LEU A CA  1 
ATOM   1291 C C   . LEU A 1 172 ? 45.783 28.344 76.993 1.00 27.57  ? 346  LEU A C   1 
ATOM   1292 O O   . LEU A 1 172 ? 46.178 27.312 77.507 1.00 27.05  ? 346  LEU A O   1 
ATOM   1293 C CB  . LEU A 1 172 ? 43.710 27.571 75.807 1.00 24.02  ? 346  LEU A CB  1 
ATOM   1294 C CG  . LEU A 1 172 ? 42.681 27.803 74.729 1.00 26.18  ? 346  LEU A CG  1 
ATOM   1295 C CD1 . LEU A 1 172 ? 41.548 26.799 74.864 1.00 25.70  ? 346  LEU A CD1 1 
ATOM   1296 C CD2 . LEU A 1 172 ? 42.179 29.238 74.746 1.00 24.29  ? 346  LEU A CD2 1 
ATOM   1297 N N   . LYS A 1 173 ? 45.915 29.535 77.599 1.00 22.86  ? 347  LYS A N   1 
ATOM   1298 C CA  . LYS A 1 173 ? 46.564 29.708 78.905 1.00 21.40  ? 347  LYS A CA  1 
ATOM   1299 C C   . LYS A 1 173 ? 45.617 30.211 79.997 1.00 23.48  ? 347  LYS A C   1 
ATOM   1300 O O   . LYS A 1 173 ? 45.908 30.068 81.188 1.00 23.47  ? 347  LYS A O   1 
ATOM   1301 C CB  . LYS A 1 173 ? 47.704 30.758 78.763 1.00 26.40  ? 347  LYS A CB  1 
ATOM   1302 C CG  . LYS A 1 173 ? 48.812 30.376 77.769 1.00 34.20  ? 347  LYS A CG  1 
ATOM   1303 C CD  . LYS A 1 173 ? 49.644 29.174 78.240 1.00 48.09  ? 347  LYS A CD  1 
ATOM   1304 C CE  . LYS A 1 173 ? 50.397 29.454 79.524 1.00 61.65  ? 347  LYS A CE  1 
ATOM   1305 N NZ  . LYS A 1 173 ? 51.312 28.349 79.886 1.00 67.02  ? 347  LYS A NZ  1 
ATOM   1306 N N   . ASN A 1 174 ? 44.504 30.858 79.590 1.00 23.18  ? 348  ASN A N   1 
ATOM   1307 C CA  . ASN A 1 174 ? 43.562 31.434 80.524 1.00 22.21  ? 348  ASN A CA  1 
ATOM   1308 C C   . ASN A 1 174 ? 42.162 31.080 80.104 1.00 21.18  ? 348  ASN A C   1 
ATOM   1309 O O   . ASN A 1 174 ? 41.834 31.199 78.937 1.00 20.97  ? 348  ASN A O   1 
ATOM   1310 C CB  . ASN A 1 174 ? 43.692 32.974 80.532 1.00 22.21  ? 348  ASN A CB  1 
ATOM   1311 C CG  . ASN A 1 174 ? 44.960 33.416 81.224 1.00 26.26  ? 348  ASN A CG  1 
ATOM   1312 O OD1 . ASN A 1 174 ? 45.067 33.478 82.454 1.00 25.88  ? 348  ASN A OD1 1 
ATOM   1313 N ND2 . ASN A 1 174 ? 45.964 33.661 80.452 1.00 26.97  ? 348  ASN A ND2 1 
ATOM   1314 N N   . VAL A 1 175 ? 41.379 30.598 81.025 1.00 17.20  ? 349  VAL A N   1 
ATOM   1315 C CA  . VAL A 1 175 ? 39.944 30.356 80.790 1.00 16.99  ? 349  VAL A CA  1 
ATOM   1316 C C   . VAL A 1 175 ? 39.173 31.223 81.793 1.00 19.96  ? 349  VAL A C   1 
ATOM   1317 O O   . VAL A 1 175 ? 39.310 31.032 83.000 1.00 17.30  ? 349  VAL A O   1 
ATOM   1318 C CB  . VAL A 1 175 ? 39.571 28.838 80.908 1.00 20.94  ? 349  VAL A CB  1 
ATOM   1319 C CG1 . VAL A 1 175 ? 38.071 28.626 80.705 1.00 19.80  ? 349  VAL A CG1 1 
ATOM   1320 C CG2 . VAL A 1 175 ? 40.383 28.008 79.920 1.00 20.85  ? 349  VAL A CG2 1 
ATOM   1321 N N   . TYR A 1 176 ? 38.244 32.064 81.292 1.00 18.94  ? 350  TYR A N   1 
ATOM   1322 C CA  . TYR A 1 176 ? 37.455 32.917 82.184 1.00 18.08  ? 350  TYR A CA  1 
ATOM   1323 C C   . TYR A 1 176 ? 36.025 32.431 82.219 1.00 19.66  ? 350  TYR A C   1 
ATOM   1324 O O   . TYR A 1 176 ? 35.525 31.998 81.197 1.00 18.85  ? 350  TYR A O   1 
ATOM   1325 C CB  . TYR A 1 176 ? 37.453 34.332 81.643 1.00 17.37  ? 350  TYR A CB  1 
ATOM   1326 C CG  . TYR A 1 176 ? 38.829 34.950 81.633 1.00 18.82  ? 350  TYR A CG  1 
ATOM   1327 C CD1 . TYR A 1 176 ? 39.291 35.679 82.721 1.00 20.35  ? 350  TYR A CD1 1 
ATOM   1328 C CD2 . TYR A 1 176 ? 39.660 34.823 80.528 1.00 18.04  ? 350  TYR A CD2 1 
ATOM   1329 C CE1 . TYR A 1 176 ? 40.581 36.212 82.742 1.00 22.72  ? 350  TYR A CE1 1 
ATOM   1330 C CE2 . TYR A 1 176 ? 40.968 35.343 80.541 1.00 18.85  ? 350  TYR A CE2 1 
ATOM   1331 C CZ  . TYR A 1 176 ? 41.409 36.048 81.648 1.00 23.09  ? 350  TYR A CZ  1 
ATOM   1332 O OH  . TYR A 1 176 ? 42.659 36.628 81.694 1.00 26.42  ? 350  TYR A OH  1 
ATOM   1333 N N   . PHE A 1 177 ? 35.387 32.492 83.379 1.00 16.08  ? 351  PHE A N   1 
ATOM   1334 C CA  . PHE A 1 177 ? 33.951 32.148 83.463 1.00 16.46  ? 351  PHE A CA  1 
ATOM   1335 C C   . PHE A 1 177 ? 33.299 33.491 83.770 1.00 21.02  ? 351  PHE A C   1 
ATOM   1336 O O   . PHE A 1 177 ? 33.607 34.032 84.836 1.00 19.57  ? 351  PHE A O   1 
ATOM   1337 C CB  . PHE A 1 177 ? 33.726 31.248 84.656 1.00 19.15  ? 351  PHE A CB  1 
ATOM   1338 C CG  . PHE A 1 177 ? 34.496 29.963 84.488 1.00 23.87  ? 351  PHE A CG  1 
ATOM   1339 C CD1 . PHE A 1 177 ? 34.101 29.016 83.552 1.00 30.19  ? 351  PHE A CD1 1 
ATOM   1340 C CD2 . PHE A 1 177 ? 35.679 29.755 85.177 1.00 28.50  ? 351  PHE A CD2 1 
ATOM   1341 C CE1 . PHE A 1 177 ? 34.820 27.826 83.393 1.00 31.73  ? 351  PHE A CE1 1 
ATOM   1342 C CE2 . PHE A 1 177 ? 36.413 28.578 85.003 1.00 33.35  ? 351  PHE A CE2 1 
ATOM   1343 C CZ  . PHE A 1 177 ? 35.994 27.637 84.091 1.00 32.22  ? 351  PHE A CZ  1 
ATOM   1344 N N   . LEU A 1 178 ? 32.490 34.031 82.840 1.00 18.84  ? 352  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 178 ? 31.798 35.317 83.033 1.00 18.30  ? 352  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 178 ? 30.528 35.074 83.833 1.00 23.51  ? 352  LEU A C   1 
ATOM   1347 O O   . LEU A 1 178 ? 29.658 34.251 83.460 1.00 23.12  ? 352  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 178 ? 31.471 35.970 81.669 1.00 19.52  ? 352  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 178 ? 32.577 35.998 80.619 1.00 23.09  ? 352  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 178 ? 32.039 36.576 79.320 1.00 23.86  ? 352  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 178 ? 33.878 36.685 81.158 1.00 24.47  ? 352  LEU A CD2 1 
ATOM   1352 N N   . LEU A 1 179 ? 30.459 35.724 85.005 1.00 19.41  ? 353  LEU A N   1 
ATOM   1353 C CA  . LEU A 1 179 ? 29.321 35.532 85.904 1.00 20.81  ? 353  LEU A CA  1 
ATOM   1354 C C   . LEU A 1 179 ? 28.921 36.912 86.525 1.00 21.97  ? 353  LEU A C   1 
ATOM   1355 O O   . LEU A 1 179 ? 29.747 37.830 86.606 1.00 20.86  ? 353  LEU A O   1 
ATOM   1356 C CB  . LEU A 1 179 ? 29.730 34.582 87.067 1.00 22.57  ? 353  LEU A CB  1 
ATOM   1357 C CG  . LEU A 1 179 ? 30.180 33.135 86.768 1.00 29.40  ? 353  LEU A CG  1 
ATOM   1358 C CD1 . LEU A 1 179 ? 31.082 32.585 87.868 1.00 30.45  ? 353  LEU A CD1 1 
ATOM   1359 C CD2 . LEU A 1 179 ? 29.006 32.222 86.551 1.00 35.40  ? 353  LEU A CD2 1 
ATOM   1360 N N   . PHE A 1 180 ? 27.689 37.051 86.962 1.00 23.18  ? 354  PHE A N   1 
ATOM   1361 C CA  . PHE A 1 180 ? 27.261 38.285 87.673 1.00 22.58  ? 354  PHE A CA  1 
ATOM   1362 C C   . PHE A 1 180 ? 26.276 37.989 88.798 1.00 26.94  ? 354  PHE A C   1 
ATOM   1363 O O   . PHE A 1 180 ? 26.179 38.767 89.736 1.00 30.69  ? 354  PHE A O   1 
ATOM   1364 C CB  . PHE A 1 180 ? 26.747 39.394 86.732 1.00 23.99  ? 354  PHE A CB  1 
ATOM   1365 C CG  . PHE A 1 180 ? 25.636 38.981 85.814 1.00 23.72  ? 354  PHE A CG  1 
ATOM   1366 C CD1 . PHE A 1 180 ? 24.301 39.134 86.197 1.00 23.55  ? 354  PHE A CD1 1 
ATOM   1367 C CD2 . PHE A 1 180 ? 25.909 38.518 84.525 1.00 23.77  ? 354  PHE A CD2 1 
ATOM   1368 C CE1 . PHE A 1 180 ? 23.268 38.747 85.336 1.00 22.75  ? 354  PHE A CE1 1 
ATOM   1369 C CE2 . PHE A 1 180 ? 24.873 38.146 83.659 1.00 26.57  ? 354  PHE A CE2 1 
ATOM   1370 C CZ  . PHE A 1 180 ? 23.558 38.270 84.068 1.00 23.34  ? 354  PHE A CZ  1 
ATOM   1371 N N   . ASP A 1 181 ? 25.700 36.803 88.809 1.00 21.57  ? 355  ASP A N   1 
ATOM   1372 C CA  . ASP A 1 181 ? 24.773 36.386 89.856 1.00 22.32  ? 355  ASP A CA  1 
ATOM   1373 C C   . ASP A 1 181 ? 25.481 35.864 91.115 1.00 24.97  ? 355  ASP A C   1 
ATOM   1374 O O   . ASP A 1 181 ? 26.311 34.955 91.028 1.00 24.07  ? 355  ASP A O   1 
ATOM   1375 C CB  . ASP A 1 181 ? 23.819 35.354 89.303 1.00 24.29  ? 355  ASP A CB  1 
ATOM   1376 C CG  . ASP A 1 181 ? 22.875 34.877 90.365 1.00 30.06  ? 355  ASP A CG  1 
ATOM   1377 O OD1 . ASP A 1 181 ? 22.055 35.706 90.844 1.00 31.79  ? 355  ASP A OD1 1 
ATOM   1378 O OD2 . ASP A 1 181 ? 22.944 33.684 90.719 1.00 31.75  ? 355  ASP A OD2 1 
ATOM   1379 N N   . SER A 1 182 ? 25.130 36.400 92.299 1.00 24.02  ? 356  SER A N   1 
ATOM   1380 C CA  . SER A 1 182 ? 25.801 35.992 93.547 1.00 24.00  ? 356  SER A CA  1 
ATOM   1381 C C   . SER A 1 182 ? 25.740 34.469 93.806 1.00 24.73  ? 356  SER A C   1 
ATOM   1382 O O   . SER A 1 182 ? 26.787 33.844 94.092 1.00 24.33  ? 356  SER A O   1 
ATOM   1383 C CB  . SER A 1 182 ? 25.303 36.809 94.736 1.00 25.55  ? 356  SER A CB  1 
ATOM   1384 O OG  . SER A 1 182 ? 25.557 38.185 94.492 1.00 27.17  ? 356  SER A OG  1 
ATOM   1385 N N   . GLU A 1 183 ? 24.557 33.837 93.608 1.00 23.15  ? 357  GLU A N   1 
ATOM   1386 C CA  . GLU A 1 183 ? 24.470 32.390 93.794 1.00 21.81  ? 357  GLU A CA  1 
ATOM   1387 C C   . GLU A 1 183 ? 25.342 31.591 92.783 1.00 24.99  ? 357  GLU A C   1 
ATOM   1388 O O   . GLU A 1 183 ? 26.030 30.641 93.176 1.00 24.27  ? 357  GLU A O   1 
ATOM   1389 C CB  . GLU A 1 183 ? 23.004 31.927 93.800 1.00 23.05  ? 357  GLU A CB  1 
ATOM   1390 C CG  . GLU A 1 183 ? 22.868 30.431 94.063 1.00 28.21  ? 357  GLU A CG  1 
ATOM   1391 C CD  . GLU A 1 183 ? 21.502 29.807 93.803 1.00 57.65  ? 357  GLU A CD  1 
ATOM   1392 O OE1 . GLU A 1 183 ? 20.517 30.554 93.600 1.00 46.07  ? 357  GLU A OE1 1 
ATOM   1393 O OE2 . GLU A 1 183 ? 21.421 28.558 93.805 1.00 52.42  ? 357  GLU A OE2 1 
ATOM   1394 N N   . SER A 1 184 ? 25.311 31.965 91.497 1.00 24.22  ? 358  SER A N   1 
ATOM   1395 C CA  . SER A 1 184 ? 26.146 31.307 90.464 1.00 22.30  ? 358  SER A CA  1 
ATOM   1396 C C   . SER A 1 184 ? 27.628 31.408 90.831 1.00 26.17  ? 358  SER A C   1 
ATOM   1397 O O   . SER A 1 184 ? 28.340 30.394 90.816 1.00 27.16  ? 358  SER A O   1 
ATOM   1398 C CB  . SER A 1 184 ? 25.908 31.933 89.091 1.00 22.48  ? 358  SER A CB  1 
ATOM   1399 O OG  . SER A 1 184 ? 24.510 31.896 88.829 1.00 26.83  ? 358  SER A OG  1 
ATOM   1400 N N   . ILE A 1 185 ? 28.059 32.605 91.293 1.00 23.36  ? 359  ILE A N   1 
ATOM   1401 C CA  . ILE A 1 185 ? 29.423 32.838 91.733 1.00 22.68  ? 359  ILE A CA  1 
ATOM   1402 C C   . ILE A 1 185 ? 29.808 31.893 92.871 1.00 27.11  ? 359  ILE A C   1 
ATOM   1403 O O   . ILE A 1 185 ? 30.859 31.242 92.783 1.00 27.84  ? 359  ILE A O   1 
ATOM   1404 C CB  . ILE A 1 185 ? 29.641 34.353 92.080 1.00 24.89  ? 359  ILE A CB  1 
ATOM   1405 C CG1 . ILE A 1 185 ? 29.570 35.190 90.805 1.00 22.16  ? 359  ILE A CG1 1 
ATOM   1406 C CG2 . ILE A 1 185 ? 30.998 34.568 92.803 1.00 28.33  ? 359  ILE A CG2 1 
ATOM   1407 C CD1 . ILE A 1 185 ? 29.326 36.717 90.982 1.00 25.79  ? 359  ILE A CD1 1 
ATOM   1408 N N   . GLY A 1 186 ? 28.953 31.789 93.898 1.00 23.65  ? 360  GLY A N   1 
ATOM   1409 C CA  . GLY A 1 186 ? 29.207 30.903 95.040 1.00 24.14  ? 360  GLY A CA  1 
ATOM   1410 C C   . GLY A 1 186 ? 29.385 29.459 94.634 1.00 26.77  ? 360  GLY A C   1 
ATOM   1411 O O   . GLY A 1 186 ? 30.265 28.750 95.155 1.00 24.88  ? 360  GLY A O   1 
ATOM   1412 N N   . ILE A 1 187 ? 28.527 29.011 93.692 1.00 23.19  ? 361  ILE A N   1 
ATOM   1413 C CA  . ILE A 1 187 ? 28.548 27.645 93.160 1.00 23.62  ? 361  ILE A CA  1 
ATOM   1414 C C   . ILE A 1 187 ? 29.867 27.336 92.467 1.00 28.37  ? 361  ILE A C   1 
ATOM   1415 O O   . ILE A 1 187 ? 30.458 26.282 92.733 1.00 26.80  ? 361  ILE A O   1 
ATOM   1416 C CB  . ILE A 1 187 ? 27.321 27.404 92.260 1.00 26.93  ? 361  ILE A CB  1 
ATOM   1417 C CG1 . ILE A 1 187 ? 26.041 27.246 93.128 1.00 26.41  ? 361  ILE A CG1 1 
ATOM   1418 C CG2 . ILE A 1 187 ? 27.542 26.165 91.354 1.00 26.70  ? 361  ILE A CG2 1 
ATOM   1419 C CD1 . ILE A 1 187 ? 24.732 27.420 92.397 1.00 34.26  ? 361  ILE A CD1 1 
ATOM   1420 N N   . TYR A 1 188 ? 30.357 28.261 91.615 1.00 25.10  ? 362  TYR A N   1 
ATOM   1421 C CA  . TYR A 1 188 ? 31.646 28.075 90.947 1.00 25.41  ? 362  TYR A CA  1 
ATOM   1422 C C   . TYR A 1 188 ? 32.767 28.080 91.932 1.00 28.86  ? 362  TYR A C   1 
ATOM   1423 O O   . TYR A 1 188 ? 33.718 27.304 91.764 1.00 27.55  ? 362  TYR A O   1 
ATOM   1424 C CB  . TYR A 1 188 ? 31.882 29.121 89.865 1.00 26.84  ? 362  TYR A CB  1 
ATOM   1425 C CG  . TYR A 1 188 ? 31.599 28.583 88.482 1.00 28.75  ? 362  TYR A CG  1 
ATOM   1426 C CD1 . TYR A 1 188 ? 30.309 28.585 87.966 1.00 29.79  ? 362  TYR A CD1 1 
ATOM   1427 C CD2 . TYR A 1 188 ? 32.600 27.964 87.738 1.00 30.74  ? 362  TYR A CD2 1 
ATOM   1428 C CE1 . TYR A 1 188 ? 30.035 28.048 86.712 1.00 32.55  ? 362  TYR A CE1 1 
ATOM   1429 C CE2 . TYR A 1 188 ? 32.345 27.446 86.475 1.00 32.41  ? 362  TYR A CE2 1 
ATOM   1430 C CZ  . TYR A 1 188 ? 31.051 27.454 85.983 1.00 36.57  ? 362  TYR A CZ  1 
ATOM   1431 O OH  . TYR A 1 188 ? 30.807 26.912 84.747 1.00 39.42  ? 362  TYR A OH  1 
ATOM   1432 N N   . VAL A 1 189 ? 32.671 28.948 92.976 1.00 24.36  ? 363  VAL A N   1 
ATOM   1433 C CA  . VAL A 1 189 ? 33.678 28.968 94.035 1.00 25.29  ? 363  VAL A CA  1 
ATOM   1434 C C   . VAL A 1 189 ? 33.768 27.595 94.738 1.00 30.98  ? 363  VAL A C   1 
ATOM   1435 O O   . VAL A 1 189 ? 34.863 27.051 94.861 1.00 32.24  ? 363  VAL A O   1 
ATOM   1436 C CB  . VAL A 1 189 ? 33.410 30.135 95.014 1.00 28.90  ? 363  VAL A CB  1 
ATOM   1437 C CG1 . VAL A 1 189 ? 34.212 29.996 96.294 1.00 29.05  ? 363  VAL A CG1 1 
ATOM   1438 C CG2 . VAL A 1 189 ? 33.721 31.461 94.347 1.00 27.89  ? 363  VAL A CG2 1 
ATOM   1439 N N   . GLN A 1 190 ? 32.617 27.037 95.152 1.00 29.98  ? 364  GLN A N   1 
ATOM   1440 C CA  . GLN A 1 190 ? 32.520 25.721 95.809 1.00 29.94  ? 364  GLN A CA  1 
ATOM   1441 C C   . GLN A 1 190 ? 33.077 24.622 94.907 1.00 34.14  ? 364  GLN A C   1 
ATOM   1442 O O   . GLN A 1 190 ? 33.862 23.783 95.368 1.00 31.50  ? 364  GLN A O   1 
ATOM   1443 C CB  . GLN A 1 190 ? 31.063 25.395 96.163 1.00 31.39  ? 364  GLN A CB  1 
ATOM   1444 C CG  . GLN A 1 190 ? 30.520 26.201 97.321 1.00 32.27  ? 364  GLN A CG  1 
ATOM   1445 C CD  . GLN A 1 190 ? 29.026 26.086 97.467 1.00 38.76  ? 364  GLN A CD  1 
ATOM   1446 O OE1 . GLN A 1 190 ? 28.265 26.100 96.489 1.00 35.86  ? 364  GLN A OE1 1 
ATOM   1447 N NE2 . GLN A 1 190 ? 28.560 25.984 98.696 1.00 33.97  ? 364  GLN A NE2 1 
ATOM   1448 N N   . GLU A 1 191 ? 32.689 24.638 93.618 1.00 29.61  ? 365  GLU A N   1 
ATOM   1449 C CA  . GLU A 1 191 ? 33.148 23.626 92.681 1.00 29.77  ? 365  GLU A CA  1 
ATOM   1450 C C   . GLU A 1 191 ? 34.626 23.727 92.340 1.00 33.92  ? 365  GLU A C   1 
ATOM   1451 O O   . GLU A 1 191 ? 35.271 22.688 92.223 1.00 34.44  ? 365  GLU A O   1 
ATOM   1452 C CB  . GLU A 1 191 ? 32.285 23.607 91.397 1.00 29.93  ? 365  GLU A CB  1 
ATOM   1453 C CG  . GLU A 1 191 ? 30.893 23.016 91.596 1.00 36.64  ? 365  GLU A CG  1 
ATOM   1454 C CD  . GLU A 1 191 ? 30.778 21.713 92.373 1.00 51.04  ? 365  GLU A CD  1 
ATOM   1455 O OE1 . GLU A 1 191 ? 31.540 20.755 92.096 1.00 39.01  ? 365  GLU A OE1 1 
ATOM   1456 O OE2 . GLU A 1 191 ? 29.919 21.666 93.282 1.00 38.97  ? 365  GLU A OE2 1 
ATOM   1457 N N   . MET A 1 192 ? 35.178 24.950 92.179 1.00 28.68  ? 366  MET A N   1 
ATOM   1458 C CA  . MET A 1 192 ? 36.602 25.114 91.869 1.00 28.87  ? 366  MET A CA  1 
ATOM   1459 C C   . MET A 1 192 ? 37.476 24.649 93.015 1.00 35.82  ? 366  MET A C   1 
ATOM   1460 O O   . MET A 1 192 ? 38.611 24.236 92.768 1.00 36.68  ? 366  MET A O   1 
ATOM   1461 C CB  . MET A 1 192 ? 36.965 26.566 91.577 1.00 31.46  ? 366  MET A CB  1 
ATOM   1462 C CG  . MET A 1 192 ? 36.607 26.978 90.180 1.00 36.69  ? 366  MET A CG  1 
ATOM   1463 S SD  . MET A 1 192 ? 36.702 28.748 90.020 1.00 43.13  ? 366  MET A SD  1 
ATOM   1464 C CE  . MET A 1 192 ? 38.401 28.896 89.621 1.00 38.87  ? 366  MET A CE  1 
ATOM   1465 N N   . ALA A 1 193 ? 36.975 24.770 94.262 1.00 31.66  ? 367  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 193 ? 37.724 24.392 95.480 1.00 32.63  ? 367  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 193 ? 38.182 22.924 95.430 1.00 40.56  ? 367  ALA A C   1 
ATOM   1468 O O   . ALA A 1 193 ? 39.214 22.592 95.989 1.00 40.31  ? 367  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 193 ? 36.864 24.623 96.703 1.00 32.80  ? 367  ALA A CB  1 
ATOM   1470 N N   . LYS A 1 194 ? 37.444 22.080 94.711 1.00 41.12  ? 368  LYS A N   1 
ATOM   1471 C CA  . LYS A 1 194 ? 37.676 20.640 94.574 1.00 42.47  ? 368  LYS A CA  1 
ATOM   1472 C C   . LYS A 1 194 ? 38.758 20.247 93.532 1.00 50.09  ? 368  LYS A C   1 
ATOM   1473 O O   . LYS A 1 194 ? 39.227 19.103 93.528 1.00 50.04  ? 368  LYS A O   1 
ATOM   1474 C CB  . LYS A 1 194 ? 36.337 19.945 94.275 1.00 44.73  ? 368  LYS A CB  1 
ATOM   1475 C CG  . LYS A 1 194 ? 35.244 20.306 95.279 1.00 45.88  ? 368  LYS A CG  1 
ATOM   1476 C CD  . LYS A 1 194 ? 33.889 19.726 94.924 1.00 52.30  ? 368  LYS A CD  1 
ATOM   1477 C CE  . LYS A 1 194 ? 32.811 20.320 95.797 1.00 61.86  ? 368  LYS A CE  1 
ATOM   1478 N NZ  . LYS A 1 194 ? 31.448 19.967 95.319 1.00 68.27  ? 368  LYS A NZ  1 
ATOM   1479 N N   . LEU A 1 195 ? 39.174 21.191 92.682 1.00 47.72  ? 369  LEU A N   1 
ATOM   1480 C CA  . LEU A 1 195 ? 40.179 20.963 91.630 1.00 48.07  ? 369  LEU A CA  1 
ATOM   1481 C C   . LEU A 1 195 ? 41.620 20.829 92.176 1.00 54.04  ? 369  LEU A C   1 
ATOM   1482 O O   . LEU A 1 195 ? 41.915 21.313 93.275 1.00 53.50  ? 369  LEU A O   1 
ATOM   1483 C CB  . LEU A 1 195 ? 40.114 22.131 90.617 1.00 47.65  ? 369  LEU A CB  1 
ATOM   1484 C CG  . LEU A 1 195 ? 39.127 22.038 89.425 1.00 51.56  ? 369  LEU A CG  1 
ATOM   1485 C CD1 . LEU A 1 195 ? 37.734 21.460 89.820 1.00 51.93  ? 369  LEU A CD1 1 
ATOM   1486 C CD2 . LEU A 1 195 ? 38.974 23.382 88.761 1.00 50.78  ? 369  LEU A CD2 1 
ATOM   1487 N N   . ASP A 1 196 ? 42.512 20.184 91.390 1.00 52.19  ? 370  ASP A N   1 
ATOM   1488 C CA  . ASP A 1 196 ? 43.936 20.046 91.713 1.00 52.99  ? 370  ASP A CA  1 
ATOM   1489 C C   . ASP A 1 196 ? 44.594 21.299 91.150 1.00 58.10  ? 370  ASP A C   1 
ATOM   1490 O O   . ASP A 1 196 ? 44.984 21.330 89.980 1.00 57.40  ? 370  ASP A O   1 
ATOM   1491 C CB  . ASP A 1 196 ? 44.538 18.764 91.090 1.00 55.13  ? 370  ASP A CB  1 
ATOM   1492 C CG  . ASP A 1 196 ? 45.932 18.401 91.593 1.00 66.43  ? 370  ASP A CG  1 
ATOM   1493 O OD1 . ASP A 1 196 ? 46.395 19.024 92.578 1.00 68.41  ? 370  ASP A OD1 1 
ATOM   1494 O OD2 . ASP A 1 196 ? 46.552 17.486 91.012 1.00 69.51  ? 370  ASP A OD2 1 
ATOM   1495 N N   . ALA A 1 197 ? 44.636 22.368 91.965 1.00 56.21  ? 371  ALA A N   1 
ATOM   1496 C CA  . ALA A 1 197 ? 45.111 23.664 91.501 1.00 56.42  ? 371  ALA A CA  1 
ATOM   1497 C C   . ALA A 1 197 ? 45.828 24.533 92.542 1.00 62.20  ? 371  ALA A C   1 
ATOM   1498 O O   . ALA A 1 197 ? 45.752 24.253 93.736 1.00 61.98  ? 371  ALA A O   1 
ATOM   1499 C CB  . ALA A 1 197 ? 43.940 24.433 90.900 1.00 56.92  ? 371  ALA A CB  1 
ATOM   1500 N N   . LYS A 1 198 ? 46.515 25.606 92.052 1.00 59.84  ? 372  LYS A N   1 
ATOM   1501 C CA  . LYS A 1 198 ? 47.298 26.635 92.762 1.00 63.64  ? 372  LYS A CA  1 
ATOM   1502 C C   . LYS A 1 198 ? 48.577 26.091 93.421 1.00 77.70  ? 372  LYS A C   1 
ATOM   1503 O O   . LYS A 1 198 ? 48.488 25.283 94.376 1.00 83.21  ? 372  LYS A O   1 
ATOM   1504 C CB  . LYS A 1 198 ? 46.447 27.437 93.765 1.00 66.49  ? 372  LYS A CB  1 
ATOM   1505 C CG  . LYS A 1 198 ? 45.476 28.414 93.120 1.00 76.94  ? 372  LYS A CG  1 
ATOM   1506 C CD  . LYS A 1 198 ? 44.592 29.081 94.175 1.00 88.38  ? 372  LYS A CD  1 
ATOM   1507 C CE  . LYS A 1 198 ? 45.020 30.477 94.552 1.00 100.15 ? 372  LYS A CE  1 
ATOM   1508 N NZ  . LYS A 1 198 ? 44.515 31.491 93.591 1.00 108.35 ? 372  LYS A NZ  1 
ATOM   1509 O OXT . LYS A 1 198 ? 49.676 26.480 92.971 1.00 92.54  ? 372  LYS A OXT 1 
ATOM   1510 N N   . GLY B 1 6   ? 55.466 2.938  56.878 1.00 68.91  ? 180  GLY B N   1 
ATOM   1511 C CA  . GLY B 1 6   ? 54.458 1.979  57.302 1.00 69.04  ? 180  GLY B CA  1 
ATOM   1512 C C   . GLY B 1 6   ? 55.030 0.780  58.022 1.00 74.10  ? 180  GLY B C   1 
ATOM   1513 O O   . GLY B 1 6   ? 55.456 0.901  59.172 1.00 74.47  ? 180  GLY B O   1 
ATOM   1514 N N   . ASP B 1 7   ? 55.037 -0.390 57.357 1.00 71.13  ? 181  ASP B N   1 
ATOM   1515 C CA  . ASP B 1 7   ? 55.551 -1.635 57.936 1.00 71.09  ? 181  ASP B CA  1 
ATOM   1516 C C   . ASP B 1 7   ? 57.066 -1.613 58.084 1.00 73.78  ? 181  ASP B C   1 
ATOM   1517 O O   . ASP B 1 7   ? 57.787 -1.268 57.141 1.00 73.00  ? 181  ASP B O   1 
ATOM   1518 C CB  . ASP B 1 7   ? 55.081 -2.866 57.146 1.00 73.38  ? 181  ASP B CB  1 
ATOM   1519 C CG  . ASP B 1 7   ? 53.587 -3.109 57.223 1.00 87.06  ? 181  ASP B CG  1 
ATOM   1520 O OD1 . ASP B 1 7   ? 53.074 -3.318 58.351 1.00 87.84  ? 181  ASP B OD1 1 
ATOM   1521 O OD2 . ASP B 1 7   ? 52.929 -3.103 56.157 1.00 93.90  ? 181  ASP B OD2 1 
ATOM   1522 N N   . GLY B 1 8   ? 57.517 -1.964 59.288 1.00 69.38  ? 182  GLY B N   1 
ATOM   1523 C CA  . GLY B 1 8   ? 58.925 -1.961 59.671 1.00 68.28  ? 182  GLY B CA  1 
ATOM   1524 C C   . GLY B 1 8   ? 59.362 -0.616 60.225 1.00 68.64  ? 182  GLY B C   1 
ATOM   1525 O O   . GLY B 1 8   ? 60.496 -0.477 60.685 1.00 68.93  ? 182  GLY B O   1 
ATOM   1526 N N   . PHE B 1 9   ? 58.442 0.372  60.196 1.00 61.19  ? 183  PHE B N   1 
ATOM   1527 C CA  . PHE B 1 9   ? 58.623 1.751  60.639 1.00 59.22  ? 183  PHE B CA  1 
ATOM   1528 C C   . PHE B 1 9   ? 57.738 2.009  61.857 1.00 59.41  ? 183  PHE B C   1 
ATOM   1529 O O   . PHE B 1 9   ? 56.523 1.824  61.787 1.00 60.49  ? 183  PHE B O   1 
ATOM   1530 C CB  . PHE B 1 9   ? 58.248 2.731  59.498 1.00 60.82  ? 183  PHE B CB  1 
ATOM   1531 C CG  . PHE B 1 9   ? 59.145 2.697  58.279 1.00 62.11  ? 183  PHE B CG  1 
ATOM   1532 C CD1 . PHE B 1 9   ? 60.125 3.663  58.089 1.00 64.57  ? 183  PHE B CD1 1 
ATOM   1533 C CD2 . PHE B 1 9   ? 59.002 1.705  57.315 1.00 63.67  ? 183  PHE B CD2 1 
ATOM   1534 C CE1 . PHE B 1 9   ? 60.952 3.630  56.963 1.00 65.13  ? 183  PHE B CE1 1 
ATOM   1535 C CE2 . PHE B 1 9   ? 59.840 1.665  56.201 1.00 66.14  ? 183  PHE B CE2 1 
ATOM   1536 C CZ  . PHE B 1 9   ? 60.812 2.626  56.032 1.00 64.21  ? 183  PHE B CZ  1 
ATOM   1537 N N   . THR B 1 10  ? 58.335 2.429  62.972 1.00 50.27  ? 184  THR B N   1 
ATOM   1538 C CA  . THR B 1 10  ? 57.555 2.718  64.173 1.00 47.70  ? 184  THR B CA  1 
ATOM   1539 C C   . THR B 1 10  ? 57.323 4.211  64.282 1.00 44.54  ? 184  THR B C   1 
ATOM   1540 O O   . THR B 1 10  ? 58.258 4.982  64.097 1.00 43.13  ? 184  THR B O   1 
ATOM   1541 C CB  . THR B 1 10  ? 58.278 2.234  65.448 1.00 58.05  ? 184  THR B CB  1 
ATOM   1542 O OG1 . THR B 1 10  ? 59.269 1.257  65.135 1.00 57.96  ? 184  THR B OG1 1 
ATOM   1543 C CG2 . THR B 1 10  ? 57.310 1.709  66.507 1.00 59.14  ? 184  THR B CG2 1 
ATOM   1544 N N   . ILE B 1 11  ? 56.094 4.629  64.603 1.00 37.78  ? 185  ILE B N   1 
ATOM   1545 C CA  . ILE B 1 11  ? 55.853 6.042  64.849 1.00 36.28  ? 185  ILE B CA  1 
ATOM   1546 C C   . ILE B 1 11  ? 56.351 6.280  66.283 1.00 41.40  ? 185  ILE B C   1 
ATOM   1547 O O   . ILE B 1 11  ? 55.974 5.538  67.190 1.00 42.51  ? 185  ILE B O   1 
ATOM   1548 C CB  . ILE B 1 11  ? 54.378 6.458  64.646 1.00 38.86  ? 185  ILE B CB  1 
ATOM   1549 C CG1 . ILE B 1 11  ? 53.890 6.217  63.180 1.00 39.68  ? 185  ILE B CG1 1 
ATOM   1550 C CG2 . ILE B 1 11  ? 54.121 7.902  65.115 1.00 39.43  ? 185  ILE B CG2 1 
ATOM   1551 C CD1 . ILE B 1 11  ? 54.679 6.957  62.058 1.00 42.77  ? 185  ILE B CD1 1 
ATOM   1552 N N   . LEU B 1 12  ? 57.229 7.264  66.468 1.00 37.75  ? 186  LEU B N   1 
ATOM   1553 C CA  . LEU B 1 12  ? 57.816 7.559  67.783 1.00 36.28  ? 186  LEU B CA  1 
ATOM   1554 C C   . LEU B 1 12  ? 57.044 8.631  68.527 1.00 40.42  ? 186  LEU B C   1 
ATOM   1555 O O   . LEU B 1 12  ? 56.804 8.501  69.732 1.00 40.98  ? 186  LEU B O   1 
ATOM   1556 C CB  . LEU B 1 12  ? 59.258 8.018  67.599 1.00 35.45  ? 186  LEU B CB  1 
ATOM   1557 C CG  . LEU B 1 12  ? 60.206 7.057  66.923 1.00 39.91  ? 186  LEU B CG  1 
ATOM   1558 C CD1 . LEU B 1 12  ? 61.341 7.799  66.319 1.00 40.67  ? 186  LEU B CD1 1 
ATOM   1559 C CD2 . LEU B 1 12  ? 60.706 6.009  67.877 1.00 41.33  ? 186  LEU B CD2 1 
ATOM   1560 N N   . SER B 1 13  ? 56.672 9.698  67.816 1.00 34.75  ? 187  SER B N   1 
ATOM   1561 C CA  . SER B 1 13  ? 56.000 10.856 68.398 1.00 34.59  ? 187  SER B CA  1 
ATOM   1562 C C   . SER B 1 13  ? 55.304 11.615 67.282 1.00 39.32  ? 187  SER B C   1 
ATOM   1563 O O   . SER B 1 13  ? 55.747 11.564 66.134 1.00 36.72  ? 187  SER B O   1 
ATOM   1564 C CB  . SER B 1 13  ? 57.025 11.762 69.076 1.00 39.81  ? 187  SER B CB  1 
ATOM   1565 O OG  . SER B 1 13  ? 56.426 12.881 69.714 1.00 53.82  ? 187  SER B OG  1 
ATOM   1566 N N   . SER B 1 14  ? 54.218 12.315 67.619 1.00 35.79  ? 188  SER B N   1 
ATOM   1567 C CA  . SER B 1 14  ? 53.450 13.084 66.648 1.00 34.36  ? 188  SER B CA  1 
ATOM   1568 C C   . SER B 1 14  ? 52.783 14.284 67.262 1.00 36.09  ? 188  SER B C   1 
ATOM   1569 O O   . SER B 1 14  ? 52.518 14.286 68.468 1.00 36.05  ? 188  SER B O   1 
ATOM   1570 C CB  . SER B 1 14  ? 52.433 12.203 65.915 1.00 37.66  ? 188  SER B CB  1 
ATOM   1571 O OG  . SER B 1 14  ? 51.483 11.614 66.786 1.00 50.05  ? 188  SER B OG  1 
ATOM   1572 N N   . LYS B 1 15  ? 52.616 15.343 66.445 1.00 30.95  ? 189  LYS B N   1 
ATOM   1573 C CA  . LYS B 1 15  ? 51.946 16.602 66.748 1.00 31.12  ? 189  LYS B CA  1 
ATOM   1574 C C   . LYS B 1 15  ? 50.826 16.814 65.722 1.00 37.33  ? 189  LYS B C   1 
ATOM   1575 O O   . LYS B 1 15  ? 51.093 16.818 64.512 1.00 35.52  ? 189  LYS B O   1 
ATOM   1576 C CB  . LYS B 1 15  ? 52.913 17.805 66.711 1.00 34.69  ? 189  LYS B CB  1 
ATOM   1577 C CG  . LYS B 1 15  ? 53.820 17.938 67.940 1.00 54.10  ? 189  LYS B CG  1 
ATOM   1578 C CD  . LYS B 1 15  ? 53.095 18.483 69.163 1.00 61.90  ? 189  LYS B CD  1 
ATOM   1579 C CE  . LYS B 1 15  ? 53.713 17.970 70.436 1.00 80.54  ? 189  LYS B CE  1 
ATOM   1580 N NZ  . LYS B 1 15  ? 52.805 18.173 71.593 1.00 92.09  ? 189  LYS B NZ  1 
ATOM   1581 N N   . SER B 1 16  ? 49.571 16.932 66.200 1.00 34.80  ? 190  SER B N   1 
ATOM   1582 C CA  . SER B 1 16  ? 48.420 17.191 65.329 1.00 36.14  ? 190  SER B CA  1 
ATOM   1583 C C   . SER B 1 16  ? 48.225 18.693 65.242 1.00 40.67  ? 190  SER B C   1 
ATOM   1584 O O   . SER B 1 16  ? 47.839 19.311 66.233 1.00 42.51  ? 190  SER B O   1 
ATOM   1585 C CB  . SER B 1 16  ? 47.164 16.502 65.859 1.00 37.64  ? 190  SER B CB  1 
ATOM   1586 O OG  . SER B 1 16  ? 47.356 15.100 65.877 1.00 43.93  ? 190  SER B OG  1 
ATOM   1587 N N   . LEU B 1 17  ? 48.578 19.288 64.097 1.00 37.04  ? 191  LEU B N   1 
ATOM   1588 C CA  . LEU B 1 17  ? 48.466 20.730 63.859 1.00 38.54  ? 191  LEU B CA  1 
ATOM   1589 C C   . LEU B 1 17  ? 47.019 21.222 63.886 1.00 44.10  ? 191  LEU B C   1 
ATOM   1590 O O   . LEU B 1 17  ? 46.099 20.437 63.681 1.00 44.45  ? 191  LEU B O   1 
ATOM   1591 C CB  . LEU B 1 17  ? 49.182 21.169 62.563 1.00 38.92  ? 191  LEU B CB  1 
ATOM   1592 C CG  . LEU B 1 17  ? 50.695 20.887 62.455 1.00 43.97  ? 191  LEU B CG  1 
ATOM   1593 C CD1 . LEU B 1 17  ? 51.259 21.496 61.198 1.00 43.77  ? 191  LEU B CD1 1 
ATOM   1594 C CD2 . LEU B 1 17  ? 51.478 21.442 63.659 1.00 46.39  ? 191  LEU B CD2 1 
ATOM   1595 N N   . VAL B 1 18  ? 46.831 22.528 64.118 1.00 43.55  ? 192  VAL B N   1 
ATOM   1596 C CA  . VAL B 1 18  ? 45.529 23.187 64.279 1.00 44.17  ? 192  VAL B CA  1 
ATOM   1597 C C   . VAL B 1 18  ? 44.605 23.021 63.056 1.00 49.49  ? 192  VAL B C   1 
ATOM   1598 O O   . VAL B 1 18  ? 43.388 22.894 63.246 1.00 49.37  ? 192  VAL B O   1 
ATOM   1599 C CB  . VAL B 1 18  ? 45.665 24.676 64.711 1.00 48.02  ? 192  VAL B CB  1 
ATOM   1600 C CG1 . VAL B 1 18  ? 46.391 24.795 66.054 1.00 47.99  ? 192  VAL B CG1 1 
ATOM   1601 C CG2 . VAL B 1 18  ? 46.353 25.531 63.642 1.00 47.90  ? 192  VAL B CG2 1 
ATOM   1602 N N   . LEU B 1 19  ? 45.169 22.992 61.828 1.00 46.23  ? 193  LEU B N   1 
ATOM   1603 C CA  . LEU B 1 19  ? 44.364 22.850 60.611 1.00 46.28  ? 193  LEU B CA  1 
ATOM   1604 C C   . LEU B 1 19  ? 44.215 21.390 60.104 1.00 50.08  ? 193  LEU B C   1 
ATOM   1605 O O   . LEU B 1 19  ? 43.770 21.180 58.975 1.00 51.07  ? 193  LEU B O   1 
ATOM   1606 C CB  . LEU B 1 19  ? 44.858 23.791 59.494 1.00 46.51  ? 193  LEU B CB  1 
ATOM   1607 C CG  . LEU B 1 19  ? 44.620 25.292 59.730 1.00 51.09  ? 193  LEU B CG  1 
ATOM   1608 C CD1 . LEU B 1 19  ? 45.206 26.117 58.610 1.00 50.81  ? 193  LEU B CD1 1 
ATOM   1609 C CD2 . LEU B 1 19  ? 43.136 25.615 59.839 1.00 53.47  ? 193  LEU B CD2 1 
ATOM   1610 N N   . GLY B 1 20  ? 44.512 20.412 60.964 1.00 45.88  ? 194  GLY B N   1 
ATOM   1611 C CA  . GLY B 1 20  ? 44.318 18.993 60.674 1.00 44.84  ? 194  GLY B CA  1 
ATOM   1612 C C   . GLY B 1 20  ? 45.514 18.174 60.225 1.00 46.39  ? 194  GLY B C   1 
ATOM   1613 O O   . GLY B 1 20  ? 45.419 16.943 60.169 1.00 46.42  ? 194  GLY B O   1 
ATOM   1614 N N   . GLN B 1 21  ? 46.631 18.829 59.876 1.00 39.94  ? 195  GLN B N   1 
ATOM   1615 C CA  . GLN B 1 21  ? 47.830 18.111 59.415 1.00 38.71  ? 195  GLN B CA  1 
ATOM   1616 C C   . GLN B 1 21  ? 48.568 17.485 60.577 1.00 42.62  ? 195  GLN B C   1 
ATOM   1617 O O   . GLN B 1 21  ? 48.624 18.080 61.646 1.00 43.50  ? 195  GLN B O   1 
ATOM   1618 C CB  . GLN B 1 21  ? 48.776 19.028 58.638 1.00 39.33  ? 195  GLN B CB  1 
ATOM   1619 C CG  . GLN B 1 21  ? 48.115 19.718 57.442 1.00 45.41  ? 195  GLN B CG  1 
ATOM   1620 C CD  . GLN B 1 21  ? 47.601 21.098 57.776 1.00 54.42  ? 195  GLN B CD  1 
ATOM   1621 O OE1 . GLN B 1 21  ? 47.541 21.519 58.945 1.00 47.27  ? 195  GLN B OE1 1 
ATOM   1622 N NE2 . GLN B 1 21  ? 47.251 21.849 56.746 1.00 34.15  ? 195  GLN B NE2 1 
ATOM   1623 N N   . LYS B 1 22  ? 49.124 16.288 60.372 1.00 36.13  ? 196  LYS B N   1 
ATOM   1624 C CA  . LYS B 1 22  ? 49.855 15.590 61.422 1.00 35.60  ? 196  LYS B CA  1 
ATOM   1625 C C   . LYS B 1 22  ? 51.341 15.527 61.071 1.00 38.15  ? 196  LYS B C   1 
ATOM   1626 O O   . LYS B 1 22  ? 51.689 15.138 59.946 1.00 37.06  ? 196  LYS B O   1 
ATOM   1627 C CB  . LYS B 1 22  ? 49.290 14.175 61.611 1.00 37.79  ? 196  LYS B CB  1 
ATOM   1628 C CG  . LYS B 1 22  ? 49.726 13.494 62.903 1.00 47.73  ? 196  LYS B CG  1 
ATOM   1629 C CD  . LYS B 1 22  ? 49.272 12.056 62.946 1.00 55.48  ? 196  LYS B CD  1 
ATOM   1630 C CE  . LYS B 1 22  ? 48.798 11.676 64.324 1.00 71.01  ? 196  LYS B CE  1 
ATOM   1631 N NZ  . LYS B 1 22  ? 47.965 10.447 64.296 1.00 80.49  ? 196  LYS B NZ  1 
ATOM   1632 N N   . LEU B 1 23  ? 52.205 15.896 62.045 1.00 34.11  ? 197  LEU B N   1 
ATOM   1633 C CA  . LEU B 1 23  ? 53.675 15.820 61.959 1.00 32.99  ? 197  LEU B CA  1 
ATOM   1634 C C   . LEU B 1 23  ? 54.085 14.613 62.770 1.00 35.83  ? 197  LEU B C   1 
ATOM   1635 O O   . LEU B 1 23  ? 53.772 14.564 63.956 1.00 36.90  ? 197  LEU B O   1 
ATOM   1636 C CB  . LEU B 1 23  ? 54.342 17.089 62.535 1.00 32.78  ? 197  LEU B CB  1 
ATOM   1637 C CG  . LEU B 1 23  ? 54.143 18.437 61.823 1.00 37.52  ? 197  LEU B CG  1 
ATOM   1638 C CD1 . LEU B 1 23  ? 55.181 19.457 62.311 1.00 38.00  ? 197  LEU B CD1 1 
ATOM   1639 C CD2 . LEU B 1 23  ? 54.280 18.300 60.308 1.00 39.07  ? 197  LEU B CD2 1 
ATOM   1640 N N   . SER B 1 24  ? 54.747 13.626 62.151 1.00 30.25  ? 198  SER B N   1 
ATOM   1641 C CA  . SER B 1 24  ? 55.139 12.399 62.839 1.00 29.63  ? 198  SER B CA  1 
ATOM   1642 C C   . SER B 1 24  ? 56.604 12.019 62.710 1.00 32.62  ? 198  SER B C   1 
ATOM   1643 O O   . SER B 1 24  ? 57.096 11.855 61.599 1.00 32.31  ? 198  SER B O   1 
ATOM   1644 C CB  . SER B 1 24  ? 54.282 11.228 62.375 1.00 32.07  ? 198  SER B CB  1 
ATOM   1645 O OG  . SER B 1 24  ? 52.906 11.488 62.582 1.00 33.85  ? 198  SER B OG  1 
ATOM   1646 N N   . LEU B 1 25  ? 57.272 11.763 63.846 1.00 28.84  ? 199  LEU B N   1 
ATOM   1647 C CA  . LEU B 1 25  ? 58.662 11.284 63.841 1.00 29.17  ? 199  LEU B CA  1 
ATOM   1648 C C   . LEU B 1 25  ? 58.580 9.779  63.757 1.00 33.85  ? 199  LEU B C   1 
ATOM   1649 O O   . LEU B 1 25  ? 57.820 9.172  64.506 1.00 34.53  ? 199  LEU B O   1 
ATOM   1650 C CB  . LEU B 1 25  ? 59.381 11.675 65.140 1.00 29.15  ? 199  LEU B CB  1 
ATOM   1651 C CG  . LEU B 1 25  ? 59.233 13.124 65.531 1.00 33.45  ? 199  LEU B CG  1 
ATOM   1652 C CD1 . LEU B 1 25  ? 59.845 13.360 66.886 1.00 35.07  ? 199  LEU B CD1 1 
ATOM   1653 C CD2 . LEU B 1 25  ? 59.879 14.031 64.484 1.00 32.71  ? 199  LEU B CD2 1 
ATOM   1654 N N   . THR B 1 26  ? 59.301 9.193  62.807 1.00 32.22  ? 200  THR B N   1 
ATOM   1655 C CA  . THR B 1 26  ? 59.307 7.768  62.528 1.00 32.63  ? 200  THR B CA  1 
ATOM   1656 C C   . THR B 1 26  ? 60.701 7.194  62.626 1.00 37.47  ? 200  THR B C   1 
ATOM   1657 O O   . THR B 1 26  ? 61.651 7.798  62.122 1.00 36.17  ? 200  THR B O   1 
ATOM   1658 C CB  . THR B 1 26  ? 58.760 7.529  61.108 1.00 45.20  ? 200  THR B CB  1 
ATOM   1659 O OG1 . THR B 1 26  ? 57.683 8.430  60.851 1.00 47.19  ? 200  THR B OG1 1 
ATOM   1660 C CG2 . THR B 1 26  ? 58.303 6.106  60.903 1.00 44.30  ? 200  THR B CG2 1 
ATOM   1661 N N   . GLN B 1 27  ? 60.808 6.002  63.239 1.00 37.07  ? 201  GLN B N   1 
ATOM   1662 C CA  . GLN B 1 27  ? 62.064 5.264  63.380 1.00 39.28  ? 201  GLN B CA  1 
ATOM   1663 C C   . GLN B 1 27  ? 62.169 4.490  62.102 1.00 48.08  ? 201  GLN B C   1 
ATOM   1664 O O   . GLN B 1 27  ? 61.314 3.647  61.811 1.00 46.84  ? 201  GLN B O   1 
ATOM   1665 C CB  . GLN B 1 27  ? 62.027 4.306  64.584 1.00 40.19  ? 201  GLN B CB  1 
ATOM   1666 C CG  . GLN B 1 27  ? 63.293 3.435  64.740 1.00 46.89  ? 201  GLN B CG  1 
ATOM   1667 C CD  . GLN B 1 27  ? 64.478 4.191  65.303 1.00 52.87  ? 201  GLN B CD  1 
ATOM   1668 O OE1 . GLN B 1 27  ? 64.394 4.822  66.348 1.00 39.00  ? 201  GLN B OE1 1 
ATOM   1669 N NE2 . GLN B 1 27  ? 65.609 4.143  64.628 1.00 45.68  ? 201  GLN B NE2 1 
ATOM   1670 N N   . SER B 1 28  ? 63.195 4.801  61.324 1.00 48.94  ? 202  SER B N   1 
ATOM   1671 C CA  . SER B 1 28  ? 63.367 4.187  60.028 1.00 50.31  ? 202  SER B CA  1 
ATOM   1672 C C   . SER B 1 28  ? 64.639 3.388  59.885 1.00 55.50  ? 202  SER B C   1 
ATOM   1673 O O   . SER B 1 28  ? 65.708 3.823  60.308 1.00 54.48  ? 202  SER B O   1 
ATOM   1674 C CB  . SER B 1 28  ? 63.307 5.256  58.937 1.00 54.72  ? 202  SER B CB  1 
ATOM   1675 O OG  . SER B 1 28  ? 62.170 6.093  59.076 1.00 61.17  ? 202  SER B OG  1 
ATOM   1676 N N   . ASP B 1 29  ? 64.502 2.212  59.279 1.00 54.12  ? 203  ASP B N   1 
ATOM   1677 C CA  . ASP B 1 29  ? 65.592 1.343  58.872 1.00 54.67  ? 203  ASP B CA  1 
ATOM   1678 C C   . ASP B 1 29  ? 65.731 1.716  57.379 1.00 58.90  ? 203  ASP B C   1 
ATOM   1679 O O   . ASP B 1 29  ? 64.847 1.382  56.589 1.00 58.73  ? 203  ASP B O   1 
ATOM   1680 C CB  . ASP B 1 29  ? 65.206 -0.143 59.070 1.00 56.59  ? 203  ASP B CB  1 
ATOM   1681 C CG  . ASP B 1 29  ? 66.183 -1.189 58.531 1.00 69.77  ? 203  ASP B CG  1 
ATOM   1682 O OD1 . ASP B 1 29  ? 67.247 -0.798 57.981 1.00 70.42  ? 203  ASP B OD1 1 
ATOM   1683 O OD2 . ASP B 1 29  ? 65.885 -2.395 58.655 1.00 77.11  ? 203  ASP B OD2 1 
ATOM   1684 N N   . ILE B 1 30  ? 66.777 2.508  57.035 1.00 55.80  ? 204  ILE B N   1 
ATOM   1685 C CA  . ILE B 1 30  ? 67.097 3.044  55.691 1.00 56.21  ? 204  ILE B CA  1 
ATOM   1686 C C   . ILE B 1 30  ? 66.780 2.081  54.533 1.00 58.22  ? 204  ILE B C   1 
ATOM   1687 O O   . ILE B 1 30  ? 66.152 2.480  53.552 1.00 56.20  ? 204  ILE B O   1 
ATOM   1688 C CB  . ILE B 1 30  ? 68.577 3.530  55.559 1.00 60.26  ? 204  ILE B CB  1 
ATOM   1689 C CG1 . ILE B 1 30  ? 69.190 3.994  56.899 1.00 61.65  ? 204  ILE B CG1 1 
ATOM   1690 C CG2 . ILE B 1 30  ? 68.712 4.603  54.478 1.00 61.58  ? 204  ILE B CG2 1 
ATOM   1691 C CD1 . ILE B 1 30  ? 70.131 2.998  57.564 1.00 73.09  ? 204  ILE B CD1 1 
ATOM   1692 N N   . SER B 1 31  ? 67.254 0.831  54.646 1.00 54.55  ? 205  SER B N   1 
ATOM   1693 C CA  . SER B 1 31  ? 67.097 -0.216 53.637 1.00 54.72  ? 205  SER B CA  1 
ATOM   1694 C C   . SER B 1 31  ? 65.635 -0.687 53.436 1.00 58.45  ? 205  SER B C   1 
ATOM   1695 O O   . SER B 1 31  ? 65.350 -1.365 52.446 1.00 59.04  ? 205  SER B O   1 
ATOM   1696 C CB  . SER B 1 31  ? 68.028 -1.389 53.937 1.00 57.64  ? 205  SER B CB  1 
ATOM   1697 O OG  . SER B 1 31  ? 67.916 -1.824 55.281 1.00 65.13  ? 205  SER B OG  1 
ATOM   1698 N N   . HIS B 1 32  ? 64.719 -0.314 54.345 1.00 52.92  ? 206  HIS B N   1 
ATOM   1699 C CA  . HIS B 1 32  ? 63.299 -0.648 54.238 1.00 52.44  ? 206  HIS B CA  1 
ATOM   1700 C C   . HIS B 1 32  ? 62.480 0.515  53.592 1.00 51.59  ? 206  HIS B C   1 
ATOM   1701 O O   . HIS B 1 32  ? 61.248 0.467  53.601 1.00 51.13  ? 206  HIS B O   1 
ATOM   1702 C CB  . HIS B 1 32  ? 62.734 -1.010 55.630 1.00 54.18  ? 206  HIS B CB  1 
ATOM   1703 C CG  . HIS B 1 32  ? 63.021 -2.414 56.078 1.00 58.45  ? 206  HIS B CG  1 
ATOM   1704 N ND1 . HIS B 1 32  ? 64.313 -2.908 56.138 1.00 60.59  ? 206  HIS B ND1 1 
ATOM   1705 C CD2 . HIS B 1 32  ? 62.167 -3.373 56.515 1.00 60.86  ? 206  HIS B CD2 1 
ATOM   1706 C CE1 . HIS B 1 32  ? 64.205 -4.151 56.585 1.00 60.34  ? 206  HIS B CE1 1 
ATOM   1707 N NE2 . HIS B 1 32  ? 62.934 -4.476 56.829 1.00 60.72  ? 206  HIS B NE2 1 
ATOM   1708 N N   . ILE B 1 33  ? 63.161 1.526  53.004 1.00 45.02  ? 207  ILE B N   1 
ATOM   1709 C CA  . ILE B 1 33  ? 62.544 2.730  52.395 1.00 44.15  ? 207  ILE B CA  1 
ATOM   1710 C C   . ILE B 1 33  ? 61.413 2.413  51.375 1.00 45.88  ? 207  ILE B C   1 
ATOM   1711 O O   . ILE B 1 33  ? 60.412 3.142  51.322 1.00 44.04  ? 207  ILE B O   1 
ATOM   1712 C CB  . ILE B 1 33  ? 63.608 3.704  51.800 1.00 46.85  ? 207  ILE B CB  1 
ATOM   1713 C CG1 . ILE B 1 33  ? 63.074 5.147  51.706 1.00 46.88  ? 207  ILE B CG1 1 
ATOM   1714 C CG2 . ILE B 1 33  ? 64.211 3.231  50.470 1.00 47.75  ? 207  ILE B CG2 1 
ATOM   1715 C CD1 . ILE B 1 33  ? 63.408 5.993  52.871 1.00 53.65  ? 207  ILE B CD1 1 
ATOM   1716 N N   . GLY B 1 34  ? 61.562 1.318  50.637 1.00 41.99  ? 208  GLY B N   1 
ATOM   1717 C CA  . GLY B 1 34  ? 60.581 0.905  49.643 1.00 42.42  ? 208  GLY B CA  1 
ATOM   1718 C C   . GLY B 1 34  ? 59.263 0.426  50.220 1.00 47.37  ? 208  GLY B C   1 
ATOM   1719 O O   . GLY B 1 34  ? 58.250 0.400  49.514 1.00 46.32  ? 208  GLY B O   1 
ATOM   1720 N N   . SER B 1 35  ? 59.264 0.043  51.505 1.00 44.26  ? 209  SER B N   1 
ATOM   1721 C CA  . SER B 1 35  ? 58.070 -0.471 52.185 1.00 45.23  ? 209  SER B CA  1 
ATOM   1722 C C   . SER B 1 35  ? 57.288 0.610  52.920 1.00 49.74  ? 209  SER B C   1 
ATOM   1723 O O   . SER B 1 35  ? 56.175 0.346  53.376 1.00 51.15  ? 209  SER B O   1 
ATOM   1724 C CB  . SER B 1 35  ? 58.447 -1.599 53.143 1.00 49.89  ? 209  SER B CB  1 
ATOM   1725 O OG  . SER B 1 35  ? 59.348 -2.516 52.541 1.00 61.66  ? 209  SER B OG  1 
ATOM   1726 N N   . MET B 1 36  ? 57.864 1.816  53.049 1.00 45.99  ? 210  MET B N   1 
ATOM   1727 C CA  . MET B 1 36  ? 57.244 2.928  53.779 1.00 45.23  ? 210  MET B CA  1 
ATOM   1728 C C   . MET B 1 36  ? 55.947 3.444  53.148 1.00 46.16  ? 210  MET B C   1 
ATOM   1729 O O   . MET B 1 36  ? 55.957 3.941  52.024 1.00 43.86  ? 210  MET B O   1 
ATOM   1730 C CB  . MET B 1 36  ? 58.243 4.061  53.991 1.00 47.81  ? 210  MET B CB  1 
ATOM   1731 C CG  . MET B 1 36  ? 57.650 5.240  54.685 1.00 51.61  ? 210  MET B CG  1 
ATOM   1732 S SD  . MET B 1 36  ? 58.870 6.425  55.193 1.00 56.56  ? 210  MET B SD  1 
ATOM   1733 C CE  . MET B 1 36  ? 59.697 6.736  53.677 1.00 53.69  ? 210  MET B CE  1 
ATOM   1734 N N   . ARG B 1 37  ? 54.857 3.385  53.933 1.00 42.24  ? 211  ARG B N   1 
ATOM   1735 C CA  . ARG B 1 37  ? 53.506 3.784  53.537 1.00 41.40  ? 211  ARG B CA  1 
ATOM   1736 C C   . ARG B 1 37  ? 53.296 5.303  53.584 1.00 42.42  ? 211  ARG B C   1 
ATOM   1737 O O   . ARG B 1 37  ? 52.538 5.822  54.410 1.00 41.90  ? 211  ARG B O   1 
ATOM   1738 C CB  . ARG B 1 37  ? 52.428 3.021  54.340 1.00 42.76  ? 211  ARG B CB  1 
ATOM   1739 C CG  . ARG B 1 37  ? 52.521 1.495  54.194 1.00 54.13  ? 211  ARG B CG  1 
ATOM   1740 C CD  . ARG B 1 37  ? 51.213 0.779  54.490 1.00 73.13  ? 211  ARG B CD  1 
ATOM   1741 N NE  . ARG B 1 37  ? 50.821 0.884  55.898 1.00 91.35  ? 211  ARG B NE  1 
ATOM   1742 C CZ  . ARG B 1 37  ? 49.720 0.347  56.417 1.00 110.46 ? 211  ARG B CZ  1 
ATOM   1743 N NH1 . ARG B 1 37  ? 48.886 -0.348 55.651 1.00 98.63  ? 211  ARG B NH1 1 
ATOM   1744 N NH2 . ARG B 1 37  ? 49.444 0.499  57.705 1.00 99.67  ? 211  ARG B NH2 1 
ATOM   1745 N N   . VAL B 1 38  ? 53.964 6.001  52.664 1.00 36.91  ? 212  VAL B N   1 
ATOM   1746 C CA  . VAL B 1 38  ? 53.880 7.458  52.467 1.00 35.61  ? 212  VAL B CA  1 
ATOM   1747 C C   . VAL B 1 38  ? 53.781 7.684  50.940 1.00 38.69  ? 212  VAL B C   1 
ATOM   1748 O O   . VAL B 1 38  ? 54.259 6.833  50.207 1.00 39.65  ? 212  VAL B O   1 
ATOM   1749 C CB  . VAL B 1 38  ? 55.084 8.185  53.126 1.00 38.40  ? 212  VAL B CB  1 
ATOM   1750 C CG1 . VAL B 1 38  ? 56.387 7.950  52.371 1.00 38.09  ? 212  VAL B CG1 1 
ATOM   1751 C CG2 . VAL B 1 38  ? 54.819 9.669  53.274 1.00 37.97  ? 212  VAL B CG2 1 
ATOM   1752 N N   . GLU B 1 39  ? 53.194 8.800  50.463 1.00 33.24  ? 213  GLU B N   1 
ATOM   1753 C CA  . GLU B 1 39  ? 53.020 9.037  49.012 1.00 31.12  ? 213  GLU B CA  1 
ATOM   1754 C C   . GLU B 1 39  ? 54.184 9.715  48.301 1.00 32.70  ? 213  GLU B C   1 
ATOM   1755 O O   . GLU B 1 39  ? 54.354 9.533  47.093 1.00 32.96  ? 213  GLU B O   1 
ATOM   1756 C CB  . GLU B 1 39  ? 51.725 9.823  48.749 1.00 31.62  ? 213  GLU B CB  1 
ATOM   1757 C CG  . GLU B 1 39  ? 50.502 9.045  49.180 1.00 32.67  ? 213  GLU B CG  1 
ATOM   1758 C CD  . GLU B 1 39  ? 49.169 9.449  48.583 1.00 48.94  ? 213  GLU B CD  1 
ATOM   1759 O OE1 . GLU B 1 39  ? 49.053 10.584 48.063 1.00 38.02  ? 213  GLU B OE1 1 
ATOM   1760 O OE2 . GLU B 1 39  ? 48.232 8.619  48.646 1.00 45.65  ? 213  GLU B OE2 1 
ATOM   1761 N N   . GLY B 1 40  ? 54.941 10.530 49.017 1.00 27.82  ? 214  GLY B N   1 
ATOM   1762 C CA  . GLY B 1 40  ? 56.101 11.223 48.475 1.00 25.89  ? 214  GLY B CA  1 
ATOM   1763 C C   . GLY B 1 40  ? 57.297 11.084 49.395 1.00 31.38  ? 214  GLY B C   1 
ATOM   1764 O O   . GLY B 1 40  ? 57.145 11.217 50.609 1.00 30.62  ? 214  GLY B O   1 
ATOM   1765 N N   . ILE B 1 41  ? 58.482 10.751 48.845 1.00 28.19  ? 215  ILE B N   1 
ATOM   1766 C CA  . ILE B 1 41  ? 59.700 10.639 49.669 1.00 26.65  ? 215  ILE B CA  1 
ATOM   1767 C C   . ILE B 1 41  ? 60.655 11.733 49.224 1.00 30.49  ? 215  ILE B C   1 
ATOM   1768 O O   . ILE B 1 41  ? 60.979 11.801 48.054 1.00 31.35  ? 215  ILE B O   1 
ATOM   1769 C CB  . ILE B 1 41  ? 60.349 9.218  49.650 1.00 28.26  ? 215  ILE B CB  1 
ATOM   1770 C CG1 . ILE B 1 41  ? 59.399 8.152  50.244 1.00 27.86  ? 215  ILE B CG1 1 
ATOM   1771 C CG2 . ILE B 1 41  ? 61.715 9.205  50.396 1.00 30.04  ? 215  ILE B CG2 1 
ATOM   1772 C CD1 . ILE B 1 41  ? 59.835 6.697  50.085 1.00 32.12  ? 215  ILE B CD1 1 
ATOM   1773 N N   . VAL B 1 42  ? 61.099 12.612 50.138 1.00 26.38  ? 216  VAL B N   1 
ATOM   1774 C CA  . VAL B 1 42  ? 62.047 13.646 49.757 1.00 25.84  ? 216  VAL B CA  1 
ATOM   1775 C C   . VAL B 1 42  ? 63.452 13.044 49.666 1.00 31.24  ? 216  VAL B C   1 
ATOM   1776 O O   . VAL B 1 42  ? 63.836 12.227 50.501 1.00 29.33  ? 216  VAL B O   1 
ATOM   1777 C CB  . VAL B 1 42  ? 61.975 14.896 50.680 1.00 28.23  ? 216  VAL B CB  1 
ATOM   1778 C CG1 . VAL B 1 42  ? 63.070 15.922 50.349 1.00 27.60  ? 216  VAL B CG1 1 
ATOM   1779 C CG2 . VAL B 1 42  ? 60.589 15.539 50.618 1.00 27.52  ? 216  VAL B CG2 1 
ATOM   1780 N N   . HIS B 1 43  ? 64.193 13.418 48.634 1.00 30.29  ? 217  HIS B N   1 
ATOM   1781 C CA  . HIS B 1 43  ? 65.546 12.935 48.407 1.00 31.57  ? 217  HIS B CA  1 
ATOM   1782 C C   . HIS B 1 43  ? 66.478 14.155 48.343 1.00 36.48  ? 217  HIS B C   1 
ATOM   1783 O O   . HIS B 1 43  ? 66.573 14.800 47.293 1.00 38.76  ? 217  HIS B O   1 
ATOM   1784 C CB  . HIS B 1 43  ? 65.606 12.055 47.138 1.00 33.56  ? 217  HIS B CB  1 
ATOM   1785 C CG  . HIS B 1 43  ? 66.986 11.716 46.650 1.00 37.82  ? 217  HIS B CG  1 
ATOM   1786 N ND1 . HIS B 1 43  ? 67.374 11.988 45.346 1.00 40.60  ? 217  HIS B ND1 1 
ATOM   1787 C CD2 . HIS B 1 43  ? 68.011 11.110 47.292 1.00 40.47  ? 217  HIS B CD2 1 
ATOM   1788 C CE1 . HIS B 1 43  ? 68.620 11.552 45.242 1.00 40.09  ? 217  HIS B CE1 1 
ATOM   1789 N NE2 . HIS B 1 43  ? 69.043 11.008 46.388 1.00 40.65  ? 217  HIS B NE2 1 
ATOM   1790 N N   . PRO B 1 44  ? 67.121 14.556 49.470 1.00 32.27  ? 218  PRO B N   1 
ATOM   1791 C CA  . PRO B 1 44  ? 67.998 15.740 49.418 1.00 32.93  ? 218  PRO B CA  1 
ATOM   1792 C C   . PRO B 1 44  ? 69.247 15.354 48.633 1.00 42.63  ? 218  PRO B C   1 
ATOM   1793 O O   . PRO B 1 44  ? 69.839 14.299 48.881 1.00 42.28  ? 218  PRO B O   1 
ATOM   1794 C CB  . PRO B 1 44  ? 68.313 16.038 50.903 1.00 34.54  ? 218  PRO B CB  1 
ATOM   1795 C CG  . PRO B 1 44  ? 67.390 15.159 51.697 1.00 38.76  ? 218  PRO B CG  1 
ATOM   1796 C CD  . PRO B 1 44  ? 67.107 13.967 50.822 1.00 34.22  ? 218  PRO B CD  1 
ATOM   1797 N N   . THR B 1 45  ? 69.580 16.143 47.620 1.00 43.39  ? 219  THR B N   1 
ATOM   1798 C CA  . THR B 1 45  ? 70.692 15.795 46.748 1.00 45.18  ? 219  THR B CA  1 
ATOM   1799 C C   . THR B 1 45  ? 71.394 17.060 46.233 1.00 51.72  ? 219  THR B C   1 
ATOM   1800 O O   . THR B 1 45  ? 71.332 18.102 46.890 1.00 50.34  ? 219  THR B O   1 
ATOM   1801 C CB  . THR B 1 45  ? 70.188 14.810 45.665 1.00 56.61  ? 219  THR B CB  1 
ATOM   1802 O OG1 . THR B 1 45  ? 71.299 14.257 44.956 1.00 59.38  ? 219  THR B OG1 1 
ATOM   1803 C CG2 . THR B 1 45  ? 69.123 15.424 44.725 1.00 54.77  ? 219  THR B CG2 1 
ATOM   1804 N N   . THR B 1 46  ? 72.083 16.961 45.089 1.00 50.99  ? 220  THR B N   1 
ATOM   1805 C CA  . THR B 1 46  ? 72.804 18.094 44.507 1.00 52.00  ? 220  THR B CA  1 
ATOM   1806 C C   . THR B 1 46  ? 72.090 18.623 43.260 1.00 57.41  ? 220  THR B C   1 
ATOM   1807 O O   . THR B 1 46  ? 70.939 18.254 42.994 1.00 55.81  ? 220  THR B O   1 
ATOM   1808 C CB  . THR B 1 46  ? 74.264 17.687 44.206 1.00 63.39  ? 220  THR B CB  1 
ATOM   1809 O OG1 . THR B 1 46  ? 74.260 16.531 43.370 1.00 62.94  ? 220  THR B OG1 1 
ATOM   1810 C CG2 . THR B 1 46  ? 75.087 17.422 45.473 1.00 61.28  ? 220  THR B CG2 1 
ATOM   1811 N N   . ALA B 1 47  ? 72.782 19.498 42.501 1.00 56.02  ? 221  ALA B N   1 
ATOM   1812 C CA  . ALA B 1 47  ? 72.317 20.070 41.233 1.00 56.54  ? 221  ALA B CA  1 
ATOM   1813 C C   . ALA B 1 47  ? 72.166 18.963 40.168 1.00 60.21  ? 221  ALA B C   1 
ATOM   1814 O O   . ALA B 1 47  ? 71.278 19.043 39.320 1.00 59.71  ? 221  ALA B O   1 
ATOM   1815 C CB  . ALA B 1 47  ? 73.320 21.113 40.748 1.00 57.26  ? 221  ALA B CB  1 
ATOM   1816 N N   . GLU B 1 48  ? 73.037 17.939 40.235 1.00 57.00  ? 222  GLU B N   1 
ATOM   1817 C CA  . GLU B 1 48  ? 73.119 16.802 39.318 1.00 57.42  ? 222  GLU B CA  1 
ATOM   1818 C C   . GLU B 1 48  ? 72.156 15.682 39.700 1.00 61.80  ? 222  GLU B C   1 
ATOM   1819 O O   . GLU B 1 48  ? 71.992 14.741 38.922 1.00 62.57  ? 222  GLU B O   1 
ATOM   1820 C CB  . GLU B 1 48  ? 74.555 16.246 39.283 1.00 59.15  ? 222  GLU B CB  1 
ATOM   1821 C CG  . GLU B 1 48  ? 75.641 17.276 39.028 1.00 71.55  ? 222  GLU B CG  1 
ATOM   1822 C CD  . GLU B 1 48  ? 76.896 17.021 39.839 1.00 100.77 ? 222  GLU B CD  1 
ATOM   1823 O OE1 . GLU B 1 48  ? 76.916 17.385 41.038 1.00 90.32  ? 222  GLU B OE1 1 
ATOM   1824 O OE2 . GLU B 1 48  ? 77.858 16.449 39.276 1.00 102.27 ? 222  GLU B OE2 1 
ATOM   1825 N N   . ILE B 1 49  ? 71.527 15.767 40.892 1.00 56.46  ? 223  ILE B N   1 
ATOM   1826 C CA  . ILE B 1 49  ? 70.559 14.782 41.396 1.00 56.07  ? 223  ILE B CA  1 
ATOM   1827 C C   . ILE B 1 49  ? 71.220 13.379 41.549 1.00 60.59  ? 223  ILE B C   1 
ATOM   1828 O O   . ILE B 1 49  ? 70.672 12.383 41.069 1.00 59.73  ? 223  ILE B O   1 
ATOM   1829 C CB  . ILE B 1 49  ? 69.219 14.767 40.563 1.00 58.82  ? 223  ILE B CB  1 
ATOM   1830 C CG1 . ILE B 1 49  ? 68.731 16.196 40.214 1.00 59.18  ? 223  ILE B CG1 1 
ATOM   1831 C CG2 . ILE B 1 49  ? 68.122 13.987 41.278 1.00 59.70  ? 223  ILE B CG2 1 
ATOM   1832 C CD1 . ILE B 1 49  ? 67.577 16.291 39.213 1.00 66.04  ? 223  ILE B CD1 1 
ATOM   1833 N N   . ASP B 1 50  ? 72.397 13.299 42.216 1.00 58.59  ? 224  ASP B N   1 
ATOM   1834 C CA  . ASP B 1 50  ? 73.055 11.996 42.388 1.00 59.08  ? 224  ASP B CA  1 
ATOM   1835 C C   . ASP B 1 50  ? 72.386 11.130 43.461 1.00 63.72  ? 224  ASP B C   1 
ATOM   1836 O O   . ASP B 1 50  ? 71.618 11.643 44.280 1.00 63.42  ? 224  ASP B O   1 
ATOM   1837 C CB  . ASP B 1 50  ? 74.581 12.084 42.610 1.00 61.48  ? 224  ASP B CB  1 
ATOM   1838 C CG  . ASP B 1 50  ? 75.140 13.396 43.113 1.00 78.16  ? 224  ASP B CG  1 
ATOM   1839 O OD1 . ASP B 1 50  ? 75.304 14.322 42.292 1.00 79.98  ? 224  ASP B OD1 1 
ATOM   1840 O OD2 . ASP B 1 50  ? 75.476 13.476 44.318 1.00 85.12  ? 224  ASP B OD2 1 
ATOM   1841 N N   . LEU B 1 51  ? 72.636 9.810  43.412 1.00 60.33  ? 225  LEU B N   1 
ATOM   1842 C CA  . LEU B 1 51  ? 72.089 8.829  44.358 1.00 60.65  ? 225  LEU B CA  1 
ATOM   1843 C C   . LEU B 1 51  ? 73.238 8.210  45.167 1.00 65.64  ? 225  LEU B C   1 
ATOM   1844 O O   . LEU B 1 51  ? 73.095 7.127  45.744 1.00 64.95  ? 225  LEU B O   1 
ATOM   1845 C CB  . LEU B 1 51  ? 71.289 7.739  43.609 1.00 60.68  ? 225  LEU B CB  1 
ATOM   1846 C CG  . LEU B 1 51  ? 70.044 8.191  42.832 1.00 65.44  ? 225  LEU B CG  1 
ATOM   1847 C CD1 . LEU B 1 51  ? 69.823 7.321  41.614 1.00 65.33  ? 225  LEU B CD1 1 
ATOM   1848 C CD2 . LEU B 1 51  ? 68.798 8.210  43.719 1.00 66.95  ? 225  LEU B CD2 1 
ATOM   1849 N N   . LYS B 1 52  ? 74.369 8.938  45.228 1.00 63.76  ? 226  LYS B N   1 
ATOM   1850 C CA  . LYS B 1 52  ? 75.609 8.555  45.908 1.00 64.50  ? 226  LYS B CA  1 
ATOM   1851 C C   . LYS B 1 52  ? 75.505 8.424  47.437 1.00 68.26  ? 226  LYS B C   1 
ATOM   1852 O O   . LYS B 1 52  ? 76.334 7.736  48.042 1.00 68.56  ? 226  LYS B O   1 
ATOM   1853 C CB  . LYS B 1 52  ? 76.740 9.530  45.537 1.00 67.93  ? 226  LYS B CB  1 
ATOM   1854 C CG  . LYS B 1 52  ? 77.465 9.168  44.242 1.00 86.00  ? 226  LYS B CG  1 
ATOM   1855 C CD  . LYS B 1 52  ? 78.989 9.277  44.383 1.00 95.79  ? 226  LYS B CD  1 
ATOM   1856 C CE  . LYS B 1 52  ? 79.631 7.999  44.880 1.00 103.04 ? 226  LYS B CE  1 
ATOM   1857 N NZ  . LYS B 1 52  ? 81.063 8.199  45.228 1.00 106.77 ? 226  LYS B NZ  1 
ATOM   1858 N N   . GLU B 1 53  ? 74.497 9.064  48.056 1.00 63.22  ? 227  GLU B N   1 
ATOM   1859 C CA  . GLU B 1 53  ? 74.317 9.052  49.510 1.00 62.01  ? 227  GLU B CA  1 
ATOM   1860 C C   . GLU B 1 53  ? 73.377 7.927  49.994 1.00 61.70  ? 227  GLU B C   1 
ATOM   1861 O O   . GLU B 1 53  ? 72.801 7.218  49.170 1.00 60.51  ? 227  GLU B O   1 
ATOM   1862 C CB  . GLU B 1 53  ? 73.884 10.440 50.007 1.00 63.70  ? 227  GLU B CB  1 
ATOM   1863 C CG  . GLU B 1 53  ? 74.939 11.516 49.765 1.00 77.01  ? 227  GLU B CG  1 
ATOM   1864 C CD  . GLU B 1 53  ? 74.827 12.334 48.490 1.00 107.61 ? 227  GLU B CD  1 
ATOM   1865 O OE1 . GLU B 1 53  ? 74.907 11.746 47.386 1.00 107.41 ? 227  GLU B OE1 1 
ATOM   1866 O OE2 . GLU B 1 53  ? 74.685 13.574 48.597 1.00 103.61 ? 227  GLU B OE2 1 
ATOM   1867 N N   . ASP B 1 54  ? 73.296 7.727  51.332 1.00 55.53  ? 228  ASP B N   1 
ATOM   1868 C CA  . ASP B 1 54  ? 72.506 6.699  52.030 1.00 54.17  ? 228  ASP B CA  1 
ATOM   1869 C C   . ASP B 1 54  ? 71.061 6.583  51.502 1.00 52.64  ? 228  ASP B C   1 
ATOM   1870 O O   . ASP B 1 54  ? 70.666 5.514  51.033 1.00 51.58  ? 228  ASP B O   1 
ATOM   1871 C CB  . ASP B 1 54  ? 72.517 6.975  53.550 1.00 56.97  ? 228  ASP B CB  1 
ATOM   1872 C CG  . ASP B 1 54  ? 72.494 5.748  54.448 1.00 77.46  ? 228  ASP B CG  1 
ATOM   1873 O OD1 . ASP B 1 54  ? 71.717 5.747  55.434 1.00 80.31  ? 228  ASP B OD1 1 
ATOM   1874 O OD2 . ASP B 1 54  ? 73.275 4.800  54.187 1.00 84.57  ? 228  ASP B OD2 1 
ATOM   1875 N N   . ILE B 1 55  ? 70.304 7.695  51.544 1.00 45.31  ? 229  ILE B N   1 
ATOM   1876 C CA  . ILE B 1 55  ? 68.924 7.796  51.056 1.00 43.65  ? 229  ILE B CA  1 
ATOM   1877 C C   . ILE B 1 55  ? 68.861 7.422  49.562 1.00 44.33  ? 229  ILE B C   1 
ATOM   1878 O O   . ILE B 1 55  ? 68.023 6.593  49.174 1.00 42.66  ? 229  ILE B O   1 
ATOM   1879 C CB  . ILE B 1 55  ? 68.271 9.186  51.399 1.00 46.94  ? 229  ILE B CB  1 
ATOM   1880 C CG1 . ILE B 1 55  ? 66.904 9.395  50.722 1.00 46.92  ? 229  ILE B CG1 1 
ATOM   1881 C CG2 . ILE B 1 55  ? 69.205 10.389 51.114 1.00 48.84  ? 229  ILE B CG2 1 
ATOM   1882 C CD1 . ILE B 1 55  ? 65.743 8.557  51.301 1.00 59.96  ? 229  ILE B CD1 1 
ATOM   1883 N N   . GLY B 1 56  ? 69.782 7.990  48.773 1.00 38.60  ? 230  GLY B N   1 
ATOM   1884 C CA  . GLY B 1 56  ? 69.888 7.751  47.338 1.00 39.36  ? 230  GLY B CA  1 
ATOM   1885 C C   . GLY B 1 56  ? 70.070 6.285  46.991 1.00 44.09  ? 230  GLY B C   1 
ATOM   1886 O O   . GLY B 1 56  ? 69.312 5.738  46.184 1.00 43.62  ? 230  GLY B O   1 
ATOM   1887 N N   . LYS B 1 57  ? 71.053 5.638  47.639 1.00 40.76  ? 231  LYS B N   1 
ATOM   1888 C CA  . LYS B 1 57  ? 71.367 4.217  47.466 1.00 41.05  ? 231  LYS B CA  1 
ATOM   1889 C C   . LYS B 1 57  ? 70.168 3.345  47.822 1.00 44.17  ? 231  LYS B C   1 
ATOM   1890 O O   . LYS B 1 57  ? 69.857 2.399  47.088 1.00 43.75  ? 231  LYS B O   1 
ATOM   1891 C CB  . LYS B 1 57  ? 72.568 3.810  48.340 1.00 44.12  ? 231  LYS B CB  1 
ATOM   1892 C CG  . LYS B 1 57  ? 73.914 4.328  47.845 1.00 64.03  ? 231  LYS B CG  1 
ATOM   1893 C CD  . LYS B 1 57  ? 75.003 4.117  48.891 1.00 77.91  ? 231  LYS B CD  1 
ATOM   1894 C CE  . LYS B 1 57  ? 76.377 4.433  48.354 1.00 92.03  ? 231  LYS B CE  1 
ATOM   1895 N NZ  . LYS B 1 57  ? 77.421 4.323  49.406 1.00 102.56 ? 231  LYS B NZ  1 
ATOM   1896 N N   . ALA B 1 58  ? 69.492 3.662  48.943 1.00 38.15  ? 232  ALA B N   1 
ATOM   1897 C CA  . ALA B 1 58  ? 68.335 2.898  49.391 1.00 36.98  ? 232  ALA B CA  1 
ATOM   1898 C C   . ALA B 1 58  ? 67.178 3.008  48.377 1.00 40.24  ? 232  ALA B C   1 
ATOM   1899 O O   . ALA B 1 58  ? 66.555 1.992  48.072 1.00 39.69  ? 232  ALA B O   1 
ATOM   1900 C CB  . ALA B 1 58  ? 67.901 3.365  50.769 1.00 37.05  ? 232  ALA B CB  1 
ATOM   1901 N N   . LEU B 1 59  ? 66.936 4.219  47.821 1.00 37.20  ? 233  LEU B N   1 
ATOM   1902 C CA  . LEU B 1 59  ? 65.877 4.446  46.828 1.00 37.04  ? 233  LEU B CA  1 
ATOM   1903 C C   . LEU B 1 59  ? 66.197 3.713  45.522 1.00 45.78  ? 233  LEU B C   1 
ATOM   1904 O O   . LEU B 1 59  ? 65.339 2.994  45.007 1.00 44.76  ? 233  LEU B O   1 
ATOM   1905 C CB  . LEU B 1 59  ? 65.645 5.948  46.571 1.00 35.94  ? 233  LEU B CB  1 
ATOM   1906 C CG  . LEU B 1 59  ? 65.018 6.780  47.714 1.00 37.47  ? 233  LEU B CG  1 
ATOM   1907 C CD1 . LEU B 1 59  ? 65.252 8.248  47.498 1.00 35.91  ? 233  LEU B CD1 1 
ATOM   1908 C CD2 . LEU B 1 59  ? 63.542 6.515  47.870 1.00 35.74  ? 233  LEU B CD2 1 
ATOM   1909 N N   . GLU B 1 60  ? 67.449 3.853  45.028 1.00 46.84  ? 234  GLU B N   1 
ATOM   1910 C CA  . GLU B 1 60  ? 67.949 3.196  43.813 1.00 48.47  ? 234  GLU B CA  1 
ATOM   1911 C C   . GLU B 1 60  ? 67.782 1.671  43.907 1.00 52.79  ? 234  GLU B C   1 
ATOM   1912 O O   . GLU B 1 60  ? 67.216 1.067  42.986 1.00 53.95  ? 234  GLU B O   1 
ATOM   1913 C CB  . GLU B 1 60  ? 69.418 3.586  43.549 1.00 50.45  ? 234  GLU B CB  1 
ATOM   1914 C CG  . GLU B 1 60  ? 69.968 3.100  42.212 1.00 63.72  ? 234  GLU B CG  1 
ATOM   1915 C CD  . GLU B 1 60  ? 71.261 3.726  41.718 1.00 94.87  ? 234  GLU B CD  1 
ATOM   1916 O OE1 . GLU B 1 60  ? 71.763 4.680  42.357 1.00 93.65  ? 234  GLU B OE1 1 
ATOM   1917 O OE2 . GLU B 1 60  ? 71.771 3.260  40.674 1.00 99.47  ? 234  GLU B OE2 1 
ATOM   1918 N N   . LYS B 1 61  ? 68.217 1.066  45.036 1.00 47.24  ? 235  LYS B N   1 
ATOM   1919 C CA  . LYS B 1 61  ? 68.098 -0.373 45.266 1.00 46.18  ? 235  LYS B CA  1 
ATOM   1920 C C   . LYS B 1 61  ? 66.644 -0.852 45.254 1.00 47.57  ? 235  LYS B C   1 
ATOM   1921 O O   . LYS B 1 61  ? 66.350 -1.843 44.589 1.00 48.29  ? 235  LYS B O   1 
ATOM   1922 C CB  . LYS B 1 61  ? 68.823 -0.811 46.558 1.00 49.66  ? 235  LYS B CB  1 
ATOM   1923 C CG  . LYS B 1 61  ? 68.983 -2.333 46.669 1.00 69.74  ? 235  LYS B CG  1 
ATOM   1924 C CD  . LYS B 1 61  ? 69.696 -2.774 47.942 1.00 81.71  ? 235  LYS B CD  1 
ATOM   1925 C CE  . LYS B 1 61  ? 69.739 -4.280 48.090 1.00 91.13  ? 235  LYS B CE  1 
ATOM   1926 N NZ  . LYS B 1 61  ? 70.684 -4.916 47.128 1.00 101.15 ? 235  LYS B NZ  1 
ATOM   1927 N N   . ALA B 1 62  ? 65.747 -0.157 45.975 1.00 41.24  ? 236  ALA B N   1 
ATOM   1928 C CA  . ALA B 1 62  ? 64.335 -0.519 46.077 1.00 40.69  ? 236  ALA B CA  1 
ATOM   1929 C C   . ALA B 1 62  ? 63.579 -0.382 44.751 1.00 43.98  ? 236  ALA B C   1 
ATOM   1930 O O   . ALA B 1 62  ? 62.670 -1.171 44.484 1.00 43.19  ? 236  ALA B O   1 
ATOM   1931 C CB  . ALA B 1 62  ? 63.657 0.321  47.144 1.00 41.42  ? 236  ALA B CB  1 
ATOM   1932 N N   . GLY B 1 63  ? 63.970 0.602  43.948 1.00 39.35  ? 237  GLY B N   1 
ATOM   1933 C CA  . GLY B 1 63  ? 63.326 0.887  42.673 1.00 40.69  ? 237  GLY B CA  1 
ATOM   1934 C C   . GLY B 1 63  ? 63.872 0.143  41.474 1.00 46.25  ? 237  GLY B C   1 
ATOM   1935 O O   . GLY B 1 63  ? 63.205 0.105  40.439 1.00 46.06  ? 237  GLY B O   1 
ATOM   1936 N N   . GLY B 1 64  ? 65.087 -0.407 41.598 1.00 44.35  ? 238  GLY B N   1 
ATOM   1937 C CA  . GLY B 1 64  ? 65.767 -1.145 40.531 1.00 43.89  ? 238  GLY B CA  1 
ATOM   1938 C C   . GLY B 1 64  ? 66.118 -0.291 39.327 1.00 46.63  ? 238  GLY B C   1 
ATOM   1939 O O   . GLY B 1 64  ? 66.175 0.939  39.430 1.00 46.26  ? 238  GLY B O   1 
ATOM   1940 N N   . LYS B 1 65  ? 66.311 -0.949 38.166 1.00 43.08  ? 239  LYS B N   1 
ATOM   1941 C CA  . LYS B 1 65  ? 66.675 -0.367 36.861 1.00 43.06  ? 239  LYS B CA  1 
ATOM   1942 C C   . LYS B 1 65  ? 65.717 0.741  36.393 1.00 44.11  ? 239  LYS B C   1 
ATOM   1943 O O   . LYS B 1 65  ? 66.174 1.770  35.890 1.00 43.30  ? 239  LYS B O   1 
ATOM   1944 C CB  . LYS B 1 65  ? 66.781 -1.498 35.804 1.00 47.09  ? 239  LYS B CB  1 
ATOM   1945 C CG  . LYS B 1 65  ? 67.090 -1.077 34.358 1.00 64.88  ? 239  LYS B CG  1 
ATOM   1946 C CD  . LYS B 1 65  ? 68.541 -0.625 34.140 1.00 74.68  ? 239  LYS B CD  1 
ATOM   1947 C CE  . LYS B 1 65  ? 68.813 -0.228 32.710 1.00 81.44  ? 239  LYS B CE  1 
ATOM   1948 N NZ  . LYS B 1 65  ? 68.876 -1.409 31.809 1.00 90.68  ? 239  LYS B NZ  1 
ATOM   1949 N N   . GLU B 1 66  ? 64.400 0.530  36.585 1.00 40.08  ? 240  GLU B N   1 
ATOM   1950 C CA  . GLU B 1 66  ? 63.323 1.441  36.195 1.00 39.74  ? 240  GLU B CA  1 
ATOM   1951 C C   . GLU B 1 66  ? 63.467 2.785  36.895 1.00 45.63  ? 240  GLU B C   1 
ATOM   1952 O O   . GLU B 1 66  ? 63.345 3.828  36.241 1.00 45.77  ? 240  GLU B O   1 
ATOM   1953 C CB  . GLU B 1 66  ? 61.940 0.824  36.487 1.00 41.24  ? 240  GLU B CB  1 
ATOM   1954 C CG  . GLU B 1 66  ? 61.619 -0.427 35.676 1.00 46.28  ? 240  GLU B CG  1 
ATOM   1955 C CD  . GLU B 1 66  ? 62.182 -1.760 36.137 1.00 66.75  ? 240  GLU B CD  1 
ATOM   1956 O OE1 . GLU B 1 66  ? 62.654 -1.861 37.293 1.00 62.17  ? 240  GLU B OE1 1 
ATOM   1957 O OE2 . GLU B 1 66  ? 62.138 -2.718 35.331 1.00 62.84  ? 240  GLU B OE2 1 
ATOM   1958 N N   . PHE B 1 67  ? 63.783 2.761  38.219 1.00 41.62  ? 241  PHE B N   1 
ATOM   1959 C CA  . PHE B 1 67  ? 63.987 3.991  38.984 1.00 40.20  ? 241  PHE B CA  1 
ATOM   1960 C C   . PHE B 1 67  ? 65.231 4.756  38.498 1.00 43.32  ? 241  PHE B C   1 
ATOM   1961 O O   . PHE B 1 67  ? 65.166 5.976  38.297 1.00 41.76  ? 241  PHE B O   1 
ATOM   1962 C CB  . PHE B 1 67  ? 64.043 3.711  40.502 1.00 41.22  ? 241  PHE B CB  1 
ATOM   1963 C CG  . PHE B 1 67  ? 64.198 4.966  41.329 1.00 42.37  ? 241  PHE B CG  1 
ATOM   1964 C CD1 . PHE B 1 67  ? 63.134 5.855  41.483 1.00 45.03  ? 241  PHE B CD1 1 
ATOM   1965 C CD2 . PHE B 1 67  ? 65.422 5.294  41.902 1.00 44.15  ? 241  PHE B CD2 1 
ATOM   1966 C CE1 . PHE B 1 67  ? 63.294 7.043  42.204 1.00 45.72  ? 241  PHE B CE1 1 
ATOM   1967 C CE2 . PHE B 1 67  ? 65.577 6.480  42.629 1.00 46.84  ? 241  PHE B CE2 1 
ATOM   1968 C CZ  . PHE B 1 67  ? 64.511 7.341  42.779 1.00 44.53  ? 241  PHE B CZ  1 
ATOM   1969 N N   . LEU B 1 68  ? 66.343 4.034  38.274 1.00 42.44  ? 242  LEU B N   1 
ATOM   1970 C CA  . LEU B 1 68  ? 67.589 4.637  37.793 1.00 43.70  ? 242  LEU B CA  1 
ATOM   1971 C C   . LEU B 1 68  ? 67.394 5.302  36.424 1.00 49.93  ? 242  LEU B C   1 
ATOM   1972 O O   . LEU B 1 68  ? 67.889 6.409  36.200 1.00 48.70  ? 242  LEU B O   1 
ATOM   1973 C CB  . LEU B 1 68  ? 68.735 3.596  37.786 1.00 44.04  ? 242  LEU B CB  1 
ATOM   1974 C CG  . LEU B 1 68  ? 70.113 4.025  37.226 1.00 49.54  ? 242  LEU B CG  1 
ATOM   1975 C CD1 . LEU B 1 68  ? 70.705 5.213  37.995 1.00 50.18  ? 242  LEU B CD1 1 
ATOM   1976 C CD2 . LEU B 1 68  ? 71.075 2.874  37.229 1.00 50.45  ? 242  LEU B CD2 1 
ATOM   1977 N N   . GLU B 1 69  ? 66.626 4.639  35.533 1.00 49.51  ? 243  GLU B N   1 
ATOM   1978 C CA  . GLU B 1 69  ? 66.315 5.144  34.199 1.00 50.12  ? 243  GLU B CA  1 
ATOM   1979 C C   . GLU B 1 69  ? 65.443 6.404  34.295 1.00 54.40  ? 243  GLU B C   1 
ATOM   1980 O O   . GLU B 1 69  ? 65.674 7.352  33.541 1.00 54.21  ? 243  GLU B O   1 
ATOM   1981 C CB  . GLU B 1 69  ? 65.613 4.063  33.365 1.00 51.89  ? 243  GLU B CB  1 
ATOM   1982 C CG  . GLU B 1 69  ? 66.543 3.007  32.794 1.00 62.81  ? 243  GLU B CG  1 
ATOM   1983 C CD  . GLU B 1 69  ? 65.841 2.046  31.855 1.00 85.89  ? 243  GLU B CD  1 
ATOM   1984 O OE1 . GLU B 1 69  ? 65.609 0.884  32.257 1.00 68.90  ? 243  GLU B OE1 1 
ATOM   1985 O OE2 . GLU B 1 69  ? 65.509 2.459  30.719 1.00 86.86  ? 243  GLU B OE2 1 
ATOM   1986 N N   . THR B 1 70  ? 64.473 6.422  35.253 1.00 50.53  ? 244  THR B N   1 
ATOM   1987 C CA  . THR B 1 70  ? 63.560 7.551  35.503 1.00 50.65  ? 244  THR B CA  1 
ATOM   1988 C C   . THR B 1 70  ? 64.323 8.829  35.913 1.00 53.77  ? 244  THR B C   1 
ATOM   1989 O O   . THR B 1 70  ? 64.033 9.900  35.376 1.00 52.46  ? 244  THR B O   1 
ATOM   1990 C CB  . THR B 1 70  ? 62.451 7.149  36.516 1.00 63.36  ? 244  THR B CB  1 
ATOM   1991 O OG1 . THR B 1 70  ? 61.741 6.015  36.017 1.00 65.81  ? 244  THR B OG1 1 
ATOM   1992 C CG2 . THR B 1 70  ? 61.452 8.277  36.795 1.00 62.34  ? 244  THR B CG2 1 
ATOM   1993 N N   . VAL B 1 71  ? 65.302 8.712  36.842 1.00 50.89  ? 245  VAL B N   1 
ATOM   1994 C CA  . VAL B 1 71  ? 66.070 9.870  37.309 1.00 51.26  ? 245  VAL B CA  1 
ATOM   1995 C C   . VAL B 1 71  ? 67.013 10.401 36.198 1.00 56.94  ? 245  VAL B C   1 
ATOM   1996 O O   . VAL B 1 71  ? 67.142 11.622 36.062 1.00 55.53  ? 245  VAL B O   1 
ATOM   1997 C CB  . VAL B 1 71  ? 66.778 9.653  38.686 1.00 55.20  ? 245  VAL B CB  1 
ATOM   1998 C CG1 . VAL B 1 71  ? 67.927 8.655  38.608 1.00 55.23  ? 245  VAL B CG1 1 
ATOM   1999 C CG2 . VAL B 1 71  ? 67.246 10.971 39.291 1.00 54.97  ? 245  VAL B CG2 1 
ATOM   2000 N N   . LYS B 1 72  ? 67.630 9.499  35.390 1.00 56.29  ? 246  LYS B N   1 
ATOM   2001 C CA  . LYS B 1 72  ? 68.515 9.889  34.275 1.00 56.96  ? 246  LYS B CA  1 
ATOM   2002 C C   . LYS B 1 72  ? 67.755 10.792 33.290 1.00 62.02  ? 246  LYS B C   1 
ATOM   2003 O O   . LYS B 1 72  ? 68.277 11.834 32.877 1.00 60.71  ? 246  LYS B O   1 
ATOM   2004 C CB  . LYS B 1 72  ? 69.073 8.656  33.547 1.00 59.99  ? 246  LYS B CB  1 
ATOM   2005 C CG  . LYS B 1 72  ? 70.216 7.953  34.274 1.00 74.16  ? 246  LYS B CG  1 
ATOM   2006 C CD  . LYS B 1 72  ? 71.125 7.159  33.316 1.00 84.82  ? 246  LYS B CD  1 
ATOM   2007 C CE  . LYS B 1 72  ? 70.681 5.733  33.055 1.00 97.94  ? 246  LYS B CE  1 
ATOM   2008 N NZ  . LYS B 1 72  ? 69.703 5.639  31.936 1.00 106.65 ? 246  LYS B NZ  1 
ATOM   2009 N N   . GLU B 1 73  ? 66.493 10.419 32.979 1.00 61.08  ? 247  GLU B N   1 
ATOM   2010 C CA  . GLU B 1 73  ? 65.597 11.175 32.100 1.00 62.07  ? 247  GLU B CA  1 
ATOM   2011 C C   . GLU B 1 73  ? 65.285 12.556 32.679 1.00 67.12  ? 247  GLU B C   1 
ATOM   2012 O O   . GLU B 1 73  ? 65.296 13.536 31.936 1.00 67.54  ? 247  GLU B O   1 
ATOM   2013 C CB  . GLU B 1 73  ? 64.298 10.392 31.819 1.00 63.72  ? 247  GLU B CB  1 
ATOM   2014 C CG  . GLU B 1 73  ? 64.470 9.192  30.899 1.00 76.64  ? 247  GLU B CG  1 
ATOM   2015 C CD  . GLU B 1 73  ? 64.798 9.527  29.456 1.00 101.72 ? 247  GLU B CD  1 
ATOM   2016 O OE1 . GLU B 1 73  ? 63.851 9.751  28.668 1.00 96.56  ? 247  GLU B OE1 1 
ATOM   2017 O OE2 . GLU B 1 73  ? 66.002 9.567  29.114 1.00 96.88  ? 247  GLU B OE2 1 
ATOM   2018 N N   . LEU B 1 74  ? 65.049 12.639 34.008 1.00 64.18  ? 248  LEU B N   1 
ATOM   2019 C CA  . LEU B 1 74  ? 64.767 13.903 34.699 1.00 63.62  ? 248  LEU B CA  1 
ATOM   2020 C C   . LEU B 1 74  ? 65.989 14.835 34.699 1.00 65.60  ? 248  LEU B C   1 
ATOM   2021 O O   . LEU B 1 74  ? 65.827 16.037 34.512 1.00 64.10  ? 248  LEU B O   1 
ATOM   2022 C CB  . LEU B 1 74  ? 64.249 13.652 36.133 1.00 63.56  ? 248  LEU B CB  1 
ATOM   2023 C CG  . LEU B 1 74  ? 63.770 14.884 36.917 1.00 68.05  ? 248  LEU B CG  1 
ATOM   2024 C CD1 . LEU B 1 74  ? 62.370 15.323 36.482 1.00 68.09  ? 248  LEU B CD1 1 
ATOM   2025 C CD2 . LEU B 1 74  ? 63.806 14.625 38.399 1.00 69.88  ? 248  LEU B CD2 1 
ATOM   2026 N N   . ARG B 1 75  ? 67.204 14.276 34.884 1.00 62.15  ? 249  ARG B N   1 
ATOM   2027 C CA  . ARG B 1 75  ? 68.464 15.030 34.891 1.00 62.13  ? 249  ARG B CA  1 
ATOM   2028 C C   . ARG B 1 75  ? 68.628 15.901 33.635 1.00 68.89  ? 249  ARG B C   1 
ATOM   2029 O O   . ARG B 1 75  ? 69.030 17.059 33.746 1.00 68.76  ? 249  ARG B O   1 
ATOM   2030 C CB  . ARG B 1 75  ? 69.666 14.086 35.040 1.00 60.04  ? 249  ARG B CB  1 
ATOM   2031 C CG  . ARG B 1 75  ? 69.919 13.598 36.455 1.00 63.94  ? 249  ARG B CG  1 
ATOM   2032 C CD  . ARG B 1 75  ? 71.225 12.836 36.519 1.00 65.29  ? 249  ARG B CD  1 
ATOM   2033 N NE  . ARG B 1 75  ? 71.108 11.612 37.311 1.00 70.68  ? 249  ARG B NE  1 
ATOM   2034 C CZ  . ARG B 1 75  ? 71.906 11.287 38.323 1.00 83.45  ? 249  ARG B CZ  1 
ATOM   2035 N NH1 . ARG B 1 75  ? 72.895 12.097 38.686 1.00 75.08  ? 249  ARG B NH1 1 
ATOM   2036 N NH2 . ARG B 1 75  ? 71.723 10.150 38.981 1.00 63.09  ? 249  ARG B NH2 1 
ATOM   2037 N N   . LYS B 1 76  ? 68.289 15.345 32.449 1.00 67.78  ? 250  LYS B N   1 
ATOM   2038 C CA  . LYS B 1 76  ? 68.375 16.043 31.160 1.00 68.18  ? 250  LYS B CA  1 
ATOM   2039 C C   . LYS B 1 76  ? 67.149 16.908 30.866 1.00 72.68  ? 250  LYS B C   1 
ATOM   2040 O O   . LYS B 1 76  ? 67.317 18.047 30.417 1.00 72.12  ? 250  LYS B O   1 
ATOM   2041 C CB  . LYS B 1 76  ? 68.643 15.061 30.009 1.00 70.92  ? 250  LYS B CB  1 
ATOM   2042 C CG  . LYS B 1 76  ? 70.117 14.684 29.860 1.00 87.50  ? 250  LYS B CG  1 
ATOM   2043 C CD  . LYS B 1 76  ? 70.364 13.745 28.676 1.00 98.80  ? 250  LYS B CD  1 
ATOM   2044 C CE  . LYS B 1 76  ? 70.333 12.276 29.046 1.00 106.56 ? 250  LYS B CE  1 
ATOM   2045 N NZ  . LYS B 1 76  ? 70.626 11.407 27.874 1.00 112.21 ? 250  LYS B NZ  1 
ATOM   2046 N N   . SER B 1 77  ? 65.923 16.379 31.119 1.00 69.59  ? 251  SER B N   1 
ATOM   2047 C CA  . SER B 1 77  ? 64.666 17.100 30.881 1.00 69.64  ? 251  SER B CA  1 
ATOM   2048 C C   . SER B 1 77  ? 64.507 18.337 31.767 1.00 73.85  ? 251  SER B C   1 
ATOM   2049 O O   . SER B 1 77  ? 64.233 19.415 31.240 1.00 73.72  ? 251  SER B O   1 
ATOM   2050 C CB  . SER B 1 77  ? 63.458 16.174 31.004 1.00 73.41  ? 251  SER B CB  1 
ATOM   2051 O OG  . SER B 1 77  ? 63.163 15.838 32.350 1.00 82.81  ? 251  SER B OG  1 
ATOM   2052 N N   . GLN B 1 78  ? 64.702 18.188 33.098 1.00 70.88  ? 252  GLN B N   1 
ATOM   2053 C CA  . GLN B 1 78  ? 64.614 19.289 34.070 1.00 70.69  ? 252  GLN B CA  1 
ATOM   2054 C C   . GLN B 1 78  ? 65.821 20.222 33.976 1.00 74.47  ? 252  GLN B C   1 
ATOM   2055 O O   . GLN B 1 78  ? 65.686 21.422 34.232 1.00 73.73  ? 252  GLN B O   1 
ATOM   2056 C CB  . GLN B 1 78  ? 64.465 18.756 35.504 1.00 72.04  ? 252  GLN B CB  1 
ATOM   2057 C CG  . GLN B 1 78  ? 63.210 19.256 36.222 1.00 88.87  ? 252  GLN B CG  1 
ATOM   2058 C CD  . GLN B 1 78  ? 63.339 20.639 36.828 1.00 111.85 ? 252  GLN B CD  1 
ATOM   2059 O OE1 . GLN B 1 78  ? 64.436 21.195 36.986 1.00 107.86 ? 252  GLN B OE1 1 
ATOM   2060 N NE2 . GLN B 1 78  ? 62.208 21.220 37.201 1.00 105.02 ? 252  GLN B NE2 1 
ATOM   2061 N N   . GLY B 1 79  ? 66.974 19.659 33.609 1.00 71.06  ? 253  GLY B N   1 
ATOM   2062 C CA  . GLY B 1 79  ? 68.232 20.384 33.470 1.00 70.85  ? 253  GLY B CA  1 
ATOM   2063 C C   . GLY B 1 79  ? 68.979 20.501 34.784 1.00 74.78  ? 253  GLY B C   1 
ATOM   2064 O O   . GLY B 1 79  ? 68.843 19.621 35.640 1.00 74.73  ? 253  GLY B O   1 
ATOM   2065 N N   . PRO B 1 80  ? 69.781 21.571 35.002 1.00 71.11  ? 254  PRO B N   1 
ATOM   2066 C CA  . PRO B 1 80  ? 70.480 21.692 36.295 1.00 70.56  ? 254  PRO B CA  1 
ATOM   2067 C C   . PRO B 1 80  ? 69.551 22.195 37.400 1.00 71.86  ? 254  PRO B C   1 
ATOM   2068 O O   . PRO B 1 80  ? 68.854 23.199 37.208 1.00 71.61  ? 254  PRO B O   1 
ATOM   2069 C CB  . PRO B 1 80  ? 71.633 22.662 35.998 1.00 72.50  ? 254  PRO B CB  1 
ATOM   2070 C CG  . PRO B 1 80  ? 71.204 23.439 34.802 1.00 76.97  ? 254  PRO B CG  1 
ATOM   2071 C CD  . PRO B 1 80  ? 70.058 22.726 34.121 1.00 72.69  ? 254  PRO B CD  1 
ATOM   2072 N N   . LEU B 1 81  ? 69.505 21.472 38.543 1.00 65.91  ? 255  LEU B N   1 
ATOM   2073 C CA  . LEU B 1 81  ? 68.678 21.854 39.696 1.00 63.58  ? 255  LEU B CA  1 
ATOM   2074 C C   . LEU B 1 81  ? 69.343 23.013 40.416 1.00 62.15  ? 255  LEU B C   1 
ATOM   2075 O O   . LEU B 1 81  ? 70.464 22.870 40.888 1.00 61.29  ? 255  LEU B O   1 
ATOM   2076 C CB  . LEU B 1 81  ? 68.514 20.675 40.687 1.00 63.64  ? 255  LEU B CB  1 
ATOM   2077 C CG  . LEU B 1 81  ? 67.215 19.844 40.696 1.00 67.95  ? 255  LEU B CG  1 
ATOM   2078 C CD1 . LEU B 1 81  ? 67.136 19.019 41.963 1.00 67.76  ? 255  LEU B CD1 1 
ATOM   2079 C CD2 . LEU B 1 81  ? 65.965 20.710 40.636 1.00 69.70  ? 255  LEU B CD2 1 
ATOM   2080 N N   . GLU B 1 82  ? 68.673 24.158 40.490 1.00 56.87  ? 256  GLU B N   1 
ATOM   2081 C CA  . GLU B 1 82  ? 69.181 25.340 41.194 1.00 56.42  ? 256  GLU B CA  1 
ATOM   2082 C C   . GLU B 1 82  ? 69.043 25.133 42.731 1.00 58.64  ? 256  GLU B C   1 
ATOM   2083 O O   . GLU B 1 82  ? 68.254 24.288 43.165 1.00 57.48  ? 256  GLU B O   1 
ATOM   2084 C CB  . GLU B 1 82  ? 68.384 26.578 40.759 1.00 58.07  ? 256  GLU B CB  1 
ATOM   2085 C CG  . GLU B 1 82  ? 69.181 27.874 40.789 1.00 72.13  ? 256  GLU B CG  1 
ATOM   2086 C CD  . GLU B 1 82  ? 68.420 29.133 40.411 1.00 97.61  ? 256  GLU B CD  1 
ATOM   2087 O OE1 . GLU B 1 82  ? 69.077 30.185 40.240 1.00 94.35  ? 256  GLU B OE1 1 
ATOM   2088 O OE2 . GLU B 1 82  ? 67.174 29.076 40.288 1.00 93.98  ? 256  GLU B OE2 1 
ATOM   2089 N N   . VAL B 1 83  ? 69.812 25.894 43.541 1.00 54.56  ? 257  VAL B N   1 
ATOM   2090 C CA  . VAL B 1 83  ? 69.765 25.828 45.008 1.00 53.35  ? 257  VAL B CA  1 
ATOM   2091 C C   . VAL B 1 83  ? 68.332 26.121 45.457 1.00 55.48  ? 257  VAL B C   1 
ATOM   2092 O O   . VAL B 1 83  ? 67.737 27.097 44.982 1.00 55.44  ? 257  VAL B O   1 
ATOM   2093 C CB  . VAL B 1 83  ? 70.796 26.785 45.673 1.00 57.44  ? 257  VAL B CB  1 
ATOM   2094 C CG1 . VAL B 1 83  ? 70.632 26.822 47.192 1.00 57.13  ? 257  VAL B CG1 1 
ATOM   2095 C CG2 . VAL B 1 83  ? 72.228 26.402 45.306 1.00 57.22  ? 257  VAL B CG2 1 
ATOM   2096 N N   . ALA B 1 84  ? 67.776 25.243 46.343 1.00 49.79  ? 258  ALA B N   1 
ATOM   2097 C CA  . ALA B 1 84  ? 66.422 25.268 46.922 1.00 48.51  ? 258  ALA B CA  1 
ATOM   2098 C C   . ALA B 1 84  ? 65.331 24.700 45.999 1.00 52.08  ? 258  ALA B C   1 
ATOM   2099 O O   . ALA B 1 84  ? 64.203 24.513 46.450 1.00 52.38  ? 258  ALA B O   1 
ATOM   2100 C CB  . ALA B 1 84  ? 66.037 26.663 47.421 1.00 48.67  ? 258  ALA B CB  1 
ATOM   2101 N N   . GLU B 1 85  ? 65.673 24.360 44.742 1.00 47.72  ? 259  GLU B N   1 
ATOM   2102 C CA  . GLU B 1 85  ? 64.719 23.829 43.772 1.00 46.46  ? 259  GLU B CA  1 
ATOM   2103 C C   . GLU B 1 85  ? 64.422 22.361 43.988 1.00 47.03  ? 259  GLU B C   1 
ATOM   2104 O O   . GLU B 1 85  ? 65.326 21.584 44.298 1.00 44.85  ? 259  GLU B O   1 
ATOM   2105 C CB  . GLU B 1 85  ? 65.214 24.069 42.328 1.00 47.99  ? 259  GLU B CB  1 
ATOM   2106 C CG  . GLU B 1 85  ? 64.107 24.094 41.284 1.00 58.54  ? 259  GLU B CG  1 
ATOM   2107 C CD  . GLU B 1 85  ? 64.516 23.842 39.842 1.00 78.43  ? 259  GLU B CD  1 
ATOM   2108 O OE1 . GLU B 1 85  ? 65.716 23.992 39.514 1.00 77.26  ? 259  GLU B OE1 1 
ATOM   2109 O OE2 . GLU B 1 85  ? 63.626 23.488 39.035 1.00 68.75  ? 259  GLU B OE2 1 
ATOM   2110 N N   . ALA B 1 86  ? 63.155 21.982 43.761 1.00 44.24  ? 260  ALA B N   1 
ATOM   2111 C CA  . ALA B 1 86  ? 62.655 20.620 43.858 1.00 45.04  ? 260  ALA B CA  1 
ATOM   2112 C C   . ALA B 1 86  ? 62.168 20.114 42.492 1.00 50.15  ? 260  ALA B C   1 
ATOM   2113 O O   . ALA B 1 86  ? 61.617 20.885 41.703 1.00 49.45  ? 260  ALA B O   1 
ATOM   2114 C CB  . ALA B 1 86  ? 61.520 20.545 44.868 1.00 45.94  ? 260  ALA B CB  1 
ATOM   2115 N N   . ALA B 1 87  ? 62.355 18.809 42.242 1.00 47.73  ? 261  ALA B N   1 
ATOM   2116 C CA  . ALA B 1 87  ? 61.948 18.114 41.019 1.00 47.74  ? 261  ALA B CA  1 
ATOM   2117 C C   . ALA B 1 87  ? 61.389 16.750 41.405 1.00 51.42  ? 261  ALA B C   1 
ATOM   2118 O O   . ALA B 1 87  ? 61.832 16.156 42.389 1.00 50.73  ? 261  ALA B O   1 
ATOM   2119 C CB  . ALA B 1 87  ? 63.134 17.964 40.078 1.00 48.26  ? 261  ALA B CB  1 
ATOM   2120 N N   . VAL B 1 88  ? 60.407 16.260 40.650 1.00 47.18  ? 262  VAL B N   1 
ATOM   2121 C CA  . VAL B 1 88  ? 59.728 15.007 40.973 1.00 47.19  ? 262  VAL B CA  1 
ATOM   2122 C C   . VAL B 1 88  ? 60.045 13.860 39.983 1.00 51.13  ? 262  VAL B C   1 
ATOM   2123 O O   . VAL B 1 88  ? 60.245 14.108 38.798 1.00 51.07  ? 262  VAL B O   1 
ATOM   2124 C CB  . VAL B 1 88  ? 58.202 15.300 41.104 1.00 51.28  ? 262  VAL B CB  1 
ATOM   2125 C CG1 . VAL B 1 88  ? 57.382 14.028 41.252 1.00 50.99  ? 262  VAL B CG1 1 
ATOM   2126 C CG2 . VAL B 1 88  ? 57.921 16.256 42.267 1.00 50.93  ? 262  VAL B CG2 1 
ATOM   2127 N N   . SER B 1 89  ? 60.092 12.607 40.495 1.00 46.95  ? 263  SER B N   1 
ATOM   2128 C CA  . SER B 1 89  ? 60.279 11.373 39.721 1.00 46.29  ? 263  SER B CA  1 
ATOM   2129 C C   . SER B 1 89  ? 59.328 10.320 40.247 1.00 49.08  ? 263  SER B C   1 
ATOM   2130 O O   . SER B 1 89  ? 59.213 10.157 41.463 1.00 48.06  ? 263  SER B O   1 
ATOM   2131 C CB  . SER B 1 89  ? 61.702 10.835 39.844 1.00 48.36  ? 263  SER B CB  1 
ATOM   2132 O OG  . SER B 1 89  ? 62.676 11.745 39.368 1.00 51.83  ? 263  SER B OG  1 
ATOM   2133 N N   . GLN B 1 90  ? 58.657 9.576  39.343 1.00 44.24  ? 264  GLN B N   1 
ATOM   2134 C CA  . GLN B 1 90  ? 57.753 8.494  39.737 1.00 43.08  ? 264  GLN B CA  1 
ATOM   2135 C C   . GLN B 1 90  ? 58.603 7.354  40.327 1.00 46.04  ? 264  GLN B C   1 
ATOM   2136 O O   . GLN B 1 90  ? 59.732 7.147  39.875 1.00 47.45  ? 264  GLN B O   1 
ATOM   2137 C CB  . GLN B 1 90  ? 56.928 8.031  38.520 1.00 44.43  ? 264  GLN B CB  1 
ATOM   2138 C CG  . GLN B 1 90  ? 55.840 7.009  38.849 1.00 56.54  ? 264  GLN B CG  1 
ATOM   2139 C CD  . GLN B 1 90  ? 55.009 6.700  37.639 1.00 65.65  ? 264  GLN B CD  1 
ATOM   2140 O OE1 . GLN B 1 90  ? 53.880 7.188  37.494 1.00 57.68  ? 264  GLN B OE1 1 
ATOM   2141 N NE2 . GLN B 1 90  ? 55.560 5.897  36.738 1.00 47.54  ? 264  GLN B NE2 1 
ATOM   2142 N N   . SER B 1 91  ? 58.080 6.641  41.351 1.00 40.17  ? 265  SER B N   1 
ATOM   2143 C CA  . SER B 1 91  ? 58.817 5.591  42.053 1.00 38.22  ? 265  SER B CA  1 
ATOM   2144 C C   . SER B 1 91  ? 58.132 4.220  42.071 1.00 41.22  ? 265  SER B C   1 
ATOM   2145 O O   . SER B 1 91  ? 57.756 3.722  43.134 1.00 38.74  ? 265  SER B O   1 
ATOM   2146 C CB  . SER B 1 91  ? 59.133 6.052  43.474 1.00 39.29  ? 265  SER B CB  1 
ATOM   2147 O OG  . SER B 1 91  ? 57.935 6.388  44.162 1.00 41.79  ? 265  SER B OG  1 
ATOM   2148 N N   . SER B 1 92  ? 58.036 3.566  40.899 1.00 38.75  ? 266  SER B N   1 
ATOM   2149 C CA  . SER B 1 92  ? 57.422 2.244  40.789 1.00 38.42  ? 266  SER B CA  1 
ATOM   2150 C C   . SER B 1 92  ? 58.222 1.203  41.587 1.00 42.31  ? 266  SER B C   1 
ATOM   2151 O O   . SER B 1 92  ? 59.447 1.277  41.637 1.00 42.13  ? 266  SER B O   1 
ATOM   2152 C CB  . SER B 1 92  ? 57.298 1.838  39.323 1.00 41.52  ? 266  SER B CB  1 
ATOM   2153 O OG  . SER B 1 92  ? 56.692 2.876  38.566 1.00 48.02  ? 266  SER B OG  1 
ATOM   2154 N N   . GLY B 1 93  ? 57.520 0.300  42.265 1.00 40.25  ? 267  GLY B N   1 
ATOM   2155 C CA  . GLY B 1 93  ? 58.143 -0.723 43.101 1.00 40.96  ? 267  GLY B CA  1 
ATOM   2156 C C   . GLY B 1 93  ? 58.253 -0.331 44.564 1.00 46.62  ? 267  GLY B C   1 
ATOM   2157 O O   . GLY B 1 93  ? 58.467 -1.192 45.426 1.00 47.79  ? 267  GLY B O   1 
ATOM   2158 N N   . LEU B 1 94  ? 58.133 0.977  44.850 1.00 43.28  ? 268  LEU B N   1 
ATOM   2159 C CA  . LEU B 1 94  ? 58.148 1.556  46.198 1.00 43.04  ? 268  LEU B CA  1 
ATOM   2160 C C   . LEU B 1 94  ? 56.694 1.800  46.593 1.00 47.72  ? 268  LEU B C   1 
ATOM   2161 O O   . LEU B 1 94  ? 55.845 1.896  45.709 1.00 46.78  ? 268  LEU B O   1 
ATOM   2162 C CB  . LEU B 1 94  ? 58.898 2.897  46.200 1.00 42.83  ? 268  LEU B CB  1 
ATOM   2163 C CG  . LEU B 1 94  ? 60.426 2.851  46.082 1.00 47.36  ? 268  LEU B CG  1 
ATOM   2164 C CD1 . LEU B 1 94  ? 60.860 2.822  44.639 1.00 46.92  ? 268  LEU B CD1 1 
ATOM   2165 C CD2 . LEU B 1 94  ? 61.034 4.097  46.690 1.00 50.61  ? 268  LEU B CD2 1 
ATOM   2166 N N   . ALA B 1 95  ? 56.394 1.905  47.909 1.00 43.72  ? 269  ALA B N   1 
ATOM   2167 C CA  . ALA B 1 95  ? 55.029 2.184  48.364 1.00 42.51  ? 269  ALA B CA  1 
ATOM   2168 C C   . ALA B 1 95  ? 54.671 3.642  48.067 1.00 45.26  ? 269  ALA B C   1 
ATOM   2169 O O   . ALA B 1 95  ? 53.493 3.958  47.887 1.00 46.59  ? 269  ALA B O   1 
ATOM   2170 C CB  . ALA B 1 95  ? 54.894 1.881  49.850 1.00 43.46  ? 269  ALA B CB  1 
ATOM   2171 N N   . ALA B 1 96  ? 55.695 4.520  47.974 1.00 38.26  ? 270  ALA B N   1 
ATOM   2172 C CA  . ALA B 1 96  ? 55.560 5.938  47.641 1.00 38.25  ? 270  ALA B CA  1 
ATOM   2173 C C   . ALA B 1 96  ? 55.228 6.082  46.171 1.00 43.29  ? 270  ALA B C   1 
ATOM   2174 O O   . ALA B 1 96  ? 55.762 5.335  45.361 1.00 42.02  ? 270  ALA B O   1 
ATOM   2175 C CB  . ALA B 1 96  ? 56.856 6.674  47.934 1.00 38.55  ? 270  ALA B CB  1 
ATOM   2176 N N   . LYS B 1 97  ? 54.378 7.056  45.831 1.00 41.93  ? 271  LYS B N   1 
ATOM   2177 C CA  . LYS B 1 97  ? 53.991 7.364  44.448 1.00 41.44  ? 271  LYS B CA  1 
ATOM   2178 C C   . LYS B 1 97  ? 55.154 8.034  43.731 1.00 42.70  ? 271  LYS B C   1 
ATOM   2179 O O   . LYS B 1 97  ? 55.441 7.708  42.574 1.00 40.70  ? 271  LYS B O   1 
ATOM   2180 C CB  . LYS B 1 97  ? 52.762 8.294  44.415 1.00 44.33  ? 271  LYS B CB  1 
ATOM   2181 C CG  . LYS B 1 97  ? 51.435 7.598  44.707 1.00 68.94  ? 271  LYS B CG  1 
ATOM   2182 C CD  . LYS B 1 97  ? 50.256 8.581  44.827 1.00 83.42  ? 271  LYS B CD  1 
ATOM   2183 C CE  . LYS B 1 97  ? 49.797 9.206  43.521 1.00 102.35 ? 271  LYS B CE  1 
ATOM   2184 N NZ  . LYS B 1 97  ? 49.192 8.213  42.591 1.00 114.65 ? 271  LYS B NZ  1 
ATOM   2185 N N   . PHE B 1 98  ? 55.826 8.979  44.424 1.00 37.19  ? 272  PHE B N   1 
ATOM   2186 C CA  . PHE B 1 98  ? 56.926 9.747  43.870 1.00 36.74  ? 272  PHE B CA  1 
ATOM   2187 C C   . PHE B 1 98  ? 58.025 9.963  44.887 1.00 38.37  ? 272  PHE B C   1 
ATOM   2188 O O   . PHE B 1 98  ? 57.828 9.757  46.094 1.00 36.52  ? 272  PHE B O   1 
ATOM   2189 C CB  . PHE B 1 98  ? 56.436 11.136 43.428 1.00 39.66  ? 272  PHE B CB  1 
ATOM   2190 C CG  . PHE B 1 98  ? 55.334 11.181 42.397 1.00 42.80  ? 272  PHE B CG  1 
ATOM   2191 C CD1 . PHE B 1 98  ? 54.009 11.353 42.779 1.00 46.47  ? 272  PHE B CD1 1 
ATOM   2192 C CD2 . PHE B 1 98  ? 55.627 11.128 41.040 1.00 47.14  ? 272  PHE B CD2 1 
ATOM   2193 C CE1 . PHE B 1 98  ? 52.989 11.436 41.822 1.00 47.99  ? 272  PHE B CE1 1 
ATOM   2194 C CE2 . PHE B 1 98  ? 54.611 11.239 40.081 1.00 50.01  ? 272  PHE B CE2 1 
ATOM   2195 C CZ  . PHE B 1 98  ? 53.299 11.383 40.481 1.00 47.87  ? 272  PHE B CZ  1 
ATOM   2196 N N   . VAL B 1 99  ? 59.165 10.420 44.379 1.00 33.99  ? 273  VAL B N   1 
ATOM   2197 C CA  . VAL B 1 99  ? 60.346 10.810 45.116 1.00 33.90  ? 273  VAL B CA  1 
ATOM   2198 C C   . VAL B 1 99  ? 60.505 12.271 44.717 1.00 39.44  ? 273  VAL B C   1 
ATOM   2199 O O   . VAL B 1 99  ? 60.443 12.582 43.521 1.00 41.29  ? 273  VAL B O   1 
ATOM   2200 C CB  . VAL B 1 99  ? 61.598 9.967  44.728 1.00 36.38  ? 273  VAL B CB  1 
ATOM   2201 C CG1 . VAL B 1 99  ? 62.890 10.654 45.149 1.00 36.03  ? 273  VAL B CG1 1 
ATOM   2202 C CG2 . VAL B 1 99  ? 61.520 8.557  45.290 1.00 35.75  ? 273  VAL B CG2 1 
ATOM   2203 N N   . ILE B 1 100 ? 60.657 13.168 45.702 1.00 33.30  ? 274  ILE B N   1 
ATOM   2204 C CA  . ILE B 1 100 ? 60.855 14.594 45.475 1.00 32.00  ? 274  ILE B CA  1 
ATOM   2205 C C   . ILE B 1 100 ? 62.322 14.948 45.710 1.00 38.96  ? 274  ILE B C   1 
ATOM   2206 O O   . ILE B 1 100 ? 62.756 15.110 46.855 1.00 36.39  ? 274  ILE B O   1 
ATOM   2207 C CB  . ILE B 1 100 ? 59.903 15.463 46.341 1.00 33.87  ? 274  ILE B CB  1 
ATOM   2208 C CG1 . ILE B 1 100 ? 58.436 14.996 46.212 1.00 32.94  ? 274  ILE B CG1 1 
ATOM   2209 C CG2 . ILE B 1 100 ? 60.068 16.951 46.012 1.00 34.88  ? 274  ILE B CG2 1 
ATOM   2210 C CD1 . ILE B 1 100 ? 57.592 15.147 47.421 1.00 35.82  ? 274  ILE B CD1 1 
ATOM   2211 N N   . HIS B 1 101 ? 63.077 15.085 44.622 1.00 37.46  ? 275  HIS B N   1 
ATOM   2212 C CA  . HIS B 1 101 ? 64.488 15.441 44.669 1.00 37.85  ? 275  HIS B CA  1 
ATOM   2213 C C   . HIS B 1 101 ? 64.606 16.933 44.964 1.00 42.49  ? 275  HIS B C   1 
ATOM   2214 O O   . HIS B 1 101 ? 63.823 17.709 44.424 1.00 43.23  ? 275  HIS B O   1 
ATOM   2215 C CB  . HIS B 1 101 ? 65.153 15.150 43.304 1.00 38.47  ? 275  HIS B CB  1 
ATOM   2216 C CG  . HIS B 1 101 ? 64.884 13.781 42.777 1.00 41.19  ? 275  HIS B CG  1 
ATOM   2217 N ND1 . HIS B 1 101 ? 65.678 12.708 43.126 1.00 42.71  ? 275  HIS B ND1 1 
ATOM   2218 C CD2 . HIS B 1 101 ? 63.919 13.359 41.928 1.00 42.28  ? 275  HIS B CD2 1 
ATOM   2219 C CE1 . HIS B 1 101 ? 65.174 11.668 42.483 1.00 42.32  ? 275  HIS B CE1 1 
ATOM   2220 N NE2 . HIS B 1 101 ? 64.105 12.010 41.763 1.00 42.22  ? 275  HIS B NE2 1 
ATOM   2221 N N   . CYS B 1 102 ? 65.557 17.346 45.819 1.00 39.72  ? 276  CYS B N   1 
ATOM   2222 C CA  . CYS B 1 102 ? 65.772 18.773 46.054 1.00 39.98  ? 276  CYS B CA  1 
ATOM   2223 C C   . CYS B 1 102 ? 67.231 19.108 46.236 1.00 45.64  ? 276  CYS B C   1 
ATOM   2224 O O   . CYS B 1 102 ? 67.975 18.327 46.830 1.00 45.22  ? 276  CYS B O   1 
ATOM   2225 C CB  . CYS B 1 102 ? 64.924 19.307 47.204 1.00 41.04  ? 276  CYS B CB  1 
ATOM   2226 S SG  . CYS B 1 102 ? 65.345 18.601 48.815 1.00 45.15  ? 276  CYS B SG  1 
ATOM   2227 N N   . HIS B 1 103 ? 67.633 20.279 45.734 1.00 44.66  ? 277  HIS B N   1 
ATOM   2228 C CA  . HIS B 1 103 ? 69.003 20.749 45.853 1.00 46.33  ? 277  HIS B CA  1 
ATOM   2229 C C   . HIS B 1 103 ? 69.106 21.556 47.136 1.00 48.92  ? 277  HIS B C   1 
ATOM   2230 O O   . HIS B 1 103 ? 68.676 22.708 47.211 1.00 47.05  ? 277  HIS B O   1 
ATOM   2231 C CB  . HIS B 1 103 ? 69.457 21.538 44.611 1.00 48.02  ? 277  HIS B CB  1 
ATOM   2232 C CG  . HIS B 1 103 ? 70.894 21.974 44.646 1.00 52.57  ? 277  HIS B CG  1 
ATOM   2233 N ND1 . HIS B 1 103 ? 71.356 22.993 43.826 1.00 54.79  ? 277  HIS B ND1 1 
ATOM   2234 C CD2 . HIS B 1 103 ? 71.928 21.517 45.397 1.00 54.81  ? 277  HIS B CD2 1 
ATOM   2235 C CE1 . HIS B 1 103 ? 72.640 23.131 44.117 1.00 54.30  ? 277  HIS B CE1 1 
ATOM   2236 N NE2 . HIS B 1 103 ? 73.028 22.267 45.057 1.00 54.63  ? 277  HIS B NE2 1 
ATOM   2237 N N   . ILE B 1 104 ? 69.618 20.898 48.169 1.00 46.76  ? 278  ILE B N   1 
ATOM   2238 C CA  . ILE B 1 104 ? 69.769 21.482 49.500 1.00 45.90  ? 278  ILE B CA  1 
ATOM   2239 C C   . ILE B 1 104 ? 70.959 22.442 49.551 1.00 47.68  ? 278  ILE B C   1 
ATOM   2240 O O   . ILE B 1 104 ? 72.036 22.101 49.050 1.00 46.55  ? 278  ILE B O   1 
ATOM   2241 C CB  . ILE B 1 104 ? 69.801 20.392 50.615 1.00 49.18  ? 278  ILE B CB  1 
ATOM   2242 C CG1 . ILE B 1 104 ? 70.772 19.248 50.293 1.00 49.88  ? 278  ILE B CG1 1 
ATOM   2243 C CG2 . ILE B 1 104 ? 68.416 19.826 50.854 1.00 49.97  ? 278  ILE B CG2 1 
ATOM   2244 C CD1 . ILE B 1 104 ? 72.037 19.308 51.019 1.00 62.18  ? 278  ILE B CD1 1 
ATOM   2245 N N   . PRO B 1 105 ? 70.798 23.649 50.142 1.00 43.53  ? 279  PRO B N   1 
ATOM   2246 C CA  . PRO B 1 105 ? 71.937 24.573 50.231 1.00 43.04  ? 279  PRO B CA  1 
ATOM   2247 C C   . PRO B 1 105 ? 73.037 24.044 51.146 1.00 45.34  ? 279  PRO B C   1 
ATOM   2248 O O   . PRO B 1 105 ? 72.785 23.215 52.030 1.00 44.18  ? 279  PRO B O   1 
ATOM   2249 C CB  . PRO B 1 105 ? 71.318 25.831 50.839 1.00 45.33  ? 279  PRO B CB  1 
ATOM   2250 C CG  . PRO B 1 105 ? 70.150 25.331 51.624 1.00 49.92  ? 279  PRO B CG  1 
ATOM   2251 C CD  . PRO B 1 105 ? 69.593 24.226 50.778 1.00 45.44  ? 279  PRO B CD  1 
ATOM   2252 N N   . GLN B 1 106 ? 74.263 24.507 50.921 1.00 39.99  ? 280  GLN B N   1 
ATOM   2253 C CA  . GLN B 1 106 ? 75.363 24.111 51.788 1.00 39.00  ? 280  GLN B CA  1 
ATOM   2254 C C   . GLN B 1 106 ? 75.303 25.041 52.991 1.00 42.24  ? 280  GLN B C   1 
ATOM   2255 O O   . GLN B 1 106 ? 74.855 26.182 52.867 1.00 41.49  ? 280  GLN B O   1 
ATOM   2256 C CB  . GLN B 1 106 ? 76.706 24.245 51.069 1.00 40.21  ? 280  GLN B CB  1 
ATOM   2257 C CG  . GLN B 1 106 ? 77.077 23.022 50.227 1.00 51.35  ? 280  GLN B CG  1 
ATOM   2258 C CD  . GLN B 1 106 ? 78.536 23.033 49.846 1.00 67.87  ? 280  GLN B CD  1 
ATOM   2259 O OE1 . GLN B 1 106 ? 79.083 24.050 49.396 1.00 66.34  ? 280  GLN B OE1 1 
ATOM   2260 N NE2 . GLN B 1 106 ? 79.201 21.900 50.018 1.00 57.19  ? 280  GLN B NE2 1 
ATOM   2261 N N   . TRP B 1 107 ? 75.732 24.557 54.157 1.00 38.13  ? 281  TRP B N   1 
ATOM   2262 C CA  . TRP B 1 107 ? 75.730 25.389 55.352 1.00 36.27  ? 281  TRP B CA  1 
ATOM   2263 C C   . TRP B 1 107 ? 76.998 26.236 55.362 1.00 43.87  ? 281  TRP B C   1 
ATOM   2264 O O   . TRP B 1 107 ? 78.058 25.746 54.984 1.00 44.27  ? 281  TRP B O   1 
ATOM   2265 C CB  . TRP B 1 107 ? 75.683 24.497 56.603 1.00 34.04  ? 281  TRP B CB  1 
ATOM   2266 C CG  . TRP B 1 107 ? 75.651 25.261 57.891 1.00 33.89  ? 281  TRP B CG  1 
ATOM   2267 C CD1 . TRP B 1 107 ? 74.549 25.701 58.556 1.00 36.45  ? 281  TRP B CD1 1 
ATOM   2268 C CD2 . TRP B 1 107 ? 76.783 25.735 58.630 1.00 33.68  ? 281  TRP B CD2 1 
ATOM   2269 N NE1 . TRP B 1 107 ? 74.920 26.414 59.670 1.00 35.32  ? 281  TRP B NE1 1 
ATOM   2270 C CE2 . TRP B 1 107 ? 76.287 26.422 59.760 1.00 37.56  ? 281  TRP B CE2 1 
ATOM   2271 C CE3 . TRP B 1 107 ? 78.175 25.619 58.462 1.00 35.22  ? 281  TRP B CE3 1 
ATOM   2272 C CZ2 . TRP B 1 107 ? 77.130 27.056 60.679 1.00 37.15  ? 281  TRP B CZ2 1 
ATOM   2273 C CZ3 . TRP B 1 107 ? 79.011 26.250 59.374 1.00 37.07  ? 281  TRP B CZ3 1 
ATOM   2274 C CH2 . TRP B 1 107 ? 78.491 26.919 60.489 1.00 37.89  ? 281  TRP B CH2 1 
ATOM   2275 N N   . GLY B 1 108 ? 76.897 27.465 55.849 1.00 43.20  ? 282  GLY B N   1 
ATOM   2276 C CA  . GLY B 1 108 ? 78.069 28.321 55.987 1.00 44.90  ? 282  GLY B CA  1 
ATOM   2277 C C   . GLY B 1 108 ? 77.777 29.789 55.833 1.00 52.60  ? 282  GLY B C   1 
ATOM   2278 O O   . GLY B 1 108 ? 78.025 30.569 56.759 1.00 54.57  ? 282  GLY B O   1 
ATOM   2279 N N   . SER B 1 109 ? 77.255 30.166 54.655 1.00 50.22  ? 283  SER B N   1 
ATOM   2280 C CA  . SER B 1 109 ? 76.903 31.534 54.280 1.00 51.67  ? 283  SER B CA  1 
ATOM   2281 C C   . SER B 1 109 ? 75.795 32.152 55.153 1.00 59.13  ? 283  SER B C   1 
ATOM   2282 O O   . SER B 1 109 ? 75.069 31.436 55.851 1.00 58.65  ? 283  SER B O   1 
ATOM   2283 C CB  . SER B 1 109 ? 76.532 31.600 52.800 1.00 55.98  ? 283  SER B CB  1 
ATOM   2284 O OG  . SER B 1 109 ? 75.355 30.858 52.535 1.00 66.69  ? 283  SER B OG  1 
ATOM   2285 N N   . ASP B 1 110 ? 75.674 33.489 55.095 1.00 57.90  ? 284  ASP B N   1 
ATOM   2286 C CA  . ASP B 1 110 ? 74.728 34.306 55.867 1.00 58.65  ? 284  ASP B CA  1 
ATOM   2287 C C   . ASP B 1 110 ? 73.242 33.989 55.655 1.00 61.03  ? 284  ASP B C   1 
ATOM   2288 O O   . ASP B 1 110 ? 72.438 34.238 56.557 1.00 62.21  ? 284  ASP B O   1 
ATOM   2289 C CB  . ASP B 1 110 ? 74.978 35.804 55.600 1.00 61.64  ? 284  ASP B CB  1 
ATOM   2290 C CG  . ASP B 1 110 ? 76.412 36.263 55.823 1.00 78.71  ? 284  ASP B CG  1 
ATOM   2291 O OD1 . ASP B 1 110 ? 77.004 35.894 56.871 1.00 79.70  ? 284  ASP B OD1 1 
ATOM   2292 O OD2 . ASP B 1 110 ? 76.940 37.001 54.956 1.00 86.74  ? 284  ASP B OD2 1 
ATOM   2293 N N   . LYS B 1 111 ? 72.873 33.474 54.476 1.00 54.06  ? 285  LYS B N   1 
ATOM   2294 C CA  . LYS B 1 111 ? 71.477 33.195 54.128 1.00 52.00  ? 285  LYS B CA  1 
ATOM   2295 C C   . LYS B 1 111 ? 71.158 31.691 53.930 1.00 49.33  ? 285  LYS B C   1 
ATOM   2296 O O   . LYS B 1 111 ? 70.114 31.369 53.355 1.00 48.28  ? 285  LYS B O   1 
ATOM   2297 C CB  . LYS B 1 111 ? 71.080 34.028 52.884 1.00 55.46  ? 285  LYS B CB  1 
ATOM   2298 C CG  . LYS B 1 111 ? 71.854 33.654 51.596 1.00 73.32  ? 285  LYS B CG  1 
ATOM   2299 C CD  . LYS B 1 111 ? 72.283 34.865 50.759 1.00 83.72  ? 285  LYS B CD  1 
ATOM   2300 C CE  . LYS B 1 111 ? 73.508 35.590 51.288 1.00 93.87  ? 285  LYS B CE  1 
ATOM   2301 N NZ  . LYS B 1 111 ? 74.725 34.730 51.298 1.00 101.89 ? 285  LYS B NZ  1 
ATOM   2302 N N   . CYS B 1 112 ? 72.046 30.776 54.402 1.00 42.19  ? 286  CYS B N   1 
ATOM   2303 C CA  . CYS B 1 112 ? 71.827 29.328 54.247 1.00 40.04  ? 286  CYS B CA  1 
ATOM   2304 C C   . CYS B 1 112 ? 70.552 28.852 54.940 1.00 41.44  ? 286  CYS B C   1 
ATOM   2305 O O   . CYS B 1 112 ? 69.899 27.954 54.417 1.00 40.64  ? 286  CYS B O   1 
ATOM   2306 C CB  . CYS B 1 112 ? 73.048 28.505 54.661 1.00 39.56  ? 286  CYS B CB  1 
ATOM   2307 S SG  . CYS B 1 112 ? 73.491 28.619 56.420 1.00 42.54  ? 286  CYS B SG  1 
ATOM   2308 N N   . GLU B 1 113 ? 70.177 29.476 56.086 1.00 38.42  ? 287  GLU B N   1 
ATOM   2309 C CA  . GLU B 1 113 ? 68.944 29.136 56.819 1.00 38.26  ? 287  GLU B CA  1 
ATOM   2310 C C   . GLU B 1 113 ? 67.687 29.505 56.038 1.00 41.74  ? 287  GLU B C   1 
ATOM   2311 O O   . GLU B 1 113 ? 66.730 28.717 56.000 1.00 40.17  ? 287  GLU B O   1 
ATOM   2312 C CB  . GLU B 1 113 ? 68.945 29.734 58.237 1.00 39.91  ? 287  GLU B CB  1 
ATOM   2313 C CG  . GLU B 1 113 ? 69.847 28.938 59.169 1.00 48.33  ? 287  GLU B CG  1 
ATOM   2314 C CD  . GLU B 1 113 ? 70.146 29.563 60.514 1.00 70.51  ? 287  GLU B CD  1 
ATOM   2315 O OE1 . GLU B 1 113 ? 69.188 29.942 61.227 1.00 67.35  ? 287  GLU B OE1 1 
ATOM   2316 O OE2 . GLU B 1 113 ? 71.345 29.651 60.865 1.00 69.58  ? 287  GLU B OE2 1 
ATOM   2317 N N   . GLU B 1 114 ? 67.713 30.674 55.357 1.00 38.38  ? 288  GLU B N   1 
ATOM   2318 C CA  . GLU B 1 114 ? 66.603 31.119 54.517 1.00 38.39  ? 288  GLU B CA  1 
ATOM   2319 C C   . GLU B 1 114 ? 66.481 30.240 53.284 1.00 39.83  ? 288  GLU B C   1 
ATOM   2320 O O   . GLU B 1 114 ? 65.375 29.827 52.951 1.00 39.15  ? 288  GLU B O   1 
ATOM   2321 C CB  . GLU B 1 114 ? 66.750 32.600 54.155 1.00 40.25  ? 288  GLU B CB  1 
ATOM   2322 C CG  . GLU B 1 114 ? 66.265 33.520 55.263 1.00 52.81  ? 288  GLU B CG  1 
ATOM   2323 C CD  . GLU B 1 114 ? 66.634 34.985 55.112 1.00 80.83  ? 288  GLU B CD  1 
ATOM   2324 O OE1 . GLU B 1 114 ? 66.547 35.517 53.980 1.00 79.06  ? 288  GLU B OE1 1 
ATOM   2325 O OE2 . GLU B 1 114 ? 66.998 35.606 56.137 1.00 73.85  ? 288  GLU B OE2 1 
ATOM   2326 N N   . GLN B 1 115 ? 67.626 29.868 52.672 1.00 37.23  ? 289  GLN B N   1 
ATOM   2327 C CA  . GLN B 1 115 ? 67.664 28.959 51.520 1.00 36.88  ? 289  GLN B CA  1 
ATOM   2328 C C   . GLN B 1 115 ? 67.138 27.586 51.916 1.00 38.83  ? 289  GLN B C   1 
ATOM   2329 O O   . GLN B 1 115 ? 66.413 26.973 51.128 1.00 38.32  ? 289  GLN B O   1 
ATOM   2330 C CB  . GLN B 1 115 ? 69.073 28.821 50.946 1.00 38.44  ? 289  GLN B CB  1 
ATOM   2331 C CG  . GLN B 1 115 ? 69.575 30.077 50.236 1.00 60.51  ? 289  GLN B CG  1 
ATOM   2332 C CD  . GLN B 1 115 ? 70.916 29.848 49.588 1.00 77.65  ? 289  GLN B CD  1 
ATOM   2333 O OE1 . GLN B 1 115 ? 71.900 29.474 50.243 1.00 69.37  ? 289  GLN B OE1 1 
ATOM   2334 N NE2 . GLN B 1 115 ? 70.982 30.075 48.279 1.00 69.82  ? 289  GLN B NE2 1 
ATOM   2335 N N   . LEU B 1 116 ? 67.474 27.110 53.140 1.00 33.41  ? 290  LEU B N   1 
ATOM   2336 C CA  . LEU B 1 116 ? 66.931 25.827 53.600 1.00 31.65  ? 290  LEU B CA  1 
ATOM   2337 C C   . LEU B 1 116 ? 65.415 25.907 53.708 1.00 34.47  ? 290  LEU B C   1 
ATOM   2338 O O   . LEU B 1 116 ? 64.723 24.986 53.284 1.00 33.38  ? 290  LEU B O   1 
ATOM   2339 C CB  . LEU B 1 116 ? 67.550 25.364 54.941 1.00 30.63  ? 290  LEU B CB  1 
ATOM   2340 C CG  . LEU B 1 116 ? 67.082 23.978 55.448 1.00 33.21  ? 290  LEU B CG  1 
ATOM   2341 C CD1 . LEU B 1 116 ? 67.291 22.883 54.392 1.00 34.61  ? 290  LEU B CD1 1 
ATOM   2342 C CD2 . LEU B 1 116 ? 67.777 23.587 56.757 1.00 29.29  ? 290  LEU B CD2 1 
ATOM   2343 N N   . GLU B 1 117 ? 64.896 27.012 54.262 1.00 33.51  ? 291  GLU B N   1 
ATOM   2344 C CA  . GLU B 1 117 ? 63.463 27.240 54.423 1.00 33.86  ? 291  GLU B CA  1 
ATOM   2345 C C   . GLU B 1 117 ? 62.778 27.165 53.042 1.00 38.95  ? 291  GLU B C   1 
ATOM   2346 O O   . GLU B 1 117 ? 61.786 26.459 52.901 1.00 36.82  ? 291  GLU B O   1 
ATOM   2347 C CB  . GLU B 1 117 ? 63.224 28.605 55.082 1.00 35.48  ? 291  GLU B CB  1 
ATOM   2348 C CG  . GLU B 1 117 ? 61.805 28.831 55.572 1.00 47.01  ? 291  GLU B CG  1 
ATOM   2349 C CD  . GLU B 1 117 ? 61.452 30.268 55.905 1.00 76.48  ? 291  GLU B CD  1 
ATOM   2350 O OE1 . GLU B 1 117 ? 62.269 31.175 55.620 1.00 67.27  ? 291  GLU B OE1 1 
ATOM   2351 O OE2 . GLU B 1 117 ? 60.343 30.487 56.446 1.00 76.59  ? 291  GLU B OE2 1 
ATOM   2352 N N   . GLU B 1 118 ? 63.367 27.821 52.018 1.00 37.45  ? 292  GLU B N   1 
ATOM   2353 C CA  . GLU B 1 118 ? 62.844 27.800 50.645 1.00 37.64  ? 292  GLU B CA  1 
ATOM   2354 C C   . GLU B 1 118 ? 62.823 26.389 50.063 1.00 38.71  ? 292  GLU B C   1 
ATOM   2355 O O   . GLU B 1 118 ? 61.838 26.029 49.426 1.00 38.80  ? 292  GLU B O   1 
ATOM   2356 C CB  . GLU B 1 118 ? 63.604 28.778 49.718 1.00 39.31  ? 292  GLU B CB  1 
ATOM   2357 C CG  . GLU B 1 118 ? 63.225 30.246 49.912 1.00 52.47  ? 292  GLU B CG  1 
ATOM   2358 C CD  . GLU B 1 118 ? 61.752 30.620 49.831 1.00 82.29  ? 292  GLU B CD  1 
ATOM   2359 O OE1 . GLU B 1 118 ? 61.055 30.158 48.896 1.00 74.68  ? 292  GLU B OE1 1 
ATOM   2360 O OE2 . GLU B 1 118 ? 61.296 31.388 50.710 1.00 83.03  ? 292  GLU B OE2 1 
ATOM   2361 N N   . THR B 1 119 ? 63.879 25.580 50.321 1.00 33.37  ? 293  THR B N   1 
ATOM   2362 C CA  . THR B 1 119 ? 63.988 24.191 49.870 1.00 32.27  ? 293  THR B CA  1 
ATOM   2363 C C   . THR B 1 119 ? 62.829 23.398 50.418 1.00 35.07  ? 293  THR B C   1 
ATOM   2364 O O   . THR B 1 119 ? 62.183 22.682 49.663 1.00 33.07  ? 293  THR B O   1 
ATOM   2365 C CB  . THR B 1 119 ? 65.317 23.569 50.313 1.00 34.72  ? 293  THR B CB  1 
ATOM   2366 O OG1 . THR B 1 119 ? 66.374 24.504 50.139 1.00 35.06  ? 293  THR B OG1 1 
ATOM   2367 C CG2 . THR B 1 119 ? 65.643 22.268 49.585 1.00 35.48  ? 293  THR B CG2 1 
ATOM   2368 N N   . ILE B 1 120 ? 62.578 23.510 51.750 1.00 32.52  ? 294  ILE B N   1 
ATOM   2369 C CA  . ILE B 1 120 ? 61.493 22.811 52.432 1.00 30.53  ? 294  ILE B CA  1 
ATOM   2370 C C   . ILE B 1 120 ? 60.144 23.229 51.845 1.00 34.04  ? 294  ILE B C   1 
ATOM   2371 O O   . ILE B 1 120 ? 59.296 22.381 51.594 1.00 31.45  ? 294  ILE B O   1 
ATOM   2372 C CB  . ILE B 1 120 ? 61.587 22.984 53.984 1.00 32.50  ? 294  ILE B CB  1 
ATOM   2373 C CG1 . ILE B 1 120 ? 62.951 22.488 54.517 1.00 31.97  ? 294  ILE B CG1 1 
ATOM   2374 C CG2 . ILE B 1 120 ? 60.441 22.255 54.710 1.00 34.39  ? 294  ILE B CG2 1 
ATOM   2375 C CD1 . ILE B 1 120 ? 63.424 21.043 54.027 1.00 37.28  ? 294  ILE B CD1 1 
ATOM   2376 N N   . LYS B 1 121 ? 59.964 24.535 51.623 1.00 33.35  ? 295  LYS B N   1 
ATOM   2377 C CA  . LYS B 1 121 ? 58.740 25.100 51.070 1.00 34.74  ? 295  LYS B CA  1 
ATOM   2378 C C   . LYS B 1 121 ? 58.515 24.587 49.666 1.00 37.54  ? 295  LYS B C   1 
ATOM   2379 O O   . LYS B 1 121 ? 57.393 24.194 49.350 1.00 36.79  ? 295  LYS B O   1 
ATOM   2380 C CB  . LYS B 1 121 ? 58.761 26.634 51.123 1.00 38.75  ? 295  LYS B CB  1 
ATOM   2381 C CG  . LYS B 1 121 ? 58.546 27.191 52.531 1.00 47.79  ? 295  LYS B CG  1 
ATOM   2382 C CD  . LYS B 1 121 ? 58.696 28.706 52.560 1.00 56.36  ? 295  LYS B CD  1 
ATOM   2383 C CE  . LYS B 1 121 ? 58.410 29.275 53.928 1.00 69.69  ? 295  LYS B CE  1 
ATOM   2384 N NZ  . LYS B 1 121 ? 58.742 30.724 54.005 1.00 79.37  ? 295  LYS B NZ  1 
ATOM   2385 N N   . ASN B 1 122 ? 59.597 24.473 48.868 1.00 34.93  ? 296  ASN B N   1 
ATOM   2386 C CA  . ASN B 1 122 ? 59.538 23.941 47.500 1.00 34.99  ? 296  ASN B CA  1 
ATOM   2387 C C   . ASN B 1 122 ? 59.223 22.443 47.450 1.00 37.61  ? 296  ASN B C   1 
ATOM   2388 O O   . ASN B 1 122 ? 58.521 22.018 46.535 1.00 35.75  ? 296  ASN B O   1 
ATOM   2389 C CB  . ASN B 1 122 ? 60.797 24.290 46.705 1.00 35.68  ? 296  ASN B CB  1 
ATOM   2390 C CG  . ASN B 1 122 ? 60.891 25.756 46.337 1.00 45.20  ? 296  ASN B CG  1 
ATOM   2391 O OD1 . ASN B 1 122 ? 59.949 26.538 46.492 1.00 45.17  ? 296  ASN B OD1 1 
ATOM   2392 N ND2 . ASN B 1 122 ? 62.049 26.174 45.888 1.00 37.10  ? 296  ASN B ND2 1 
ATOM   2393 N N   . CYS B 1 123 ? 59.676 21.646 48.454 1.00 32.89  ? 297  CYS B N   1 
ATOM   2394 C CA  . CYS B 1 123 ? 59.321 20.214 48.517 1.00 31.56  ? 297  CYS B CA  1 
ATOM   2395 C C   . CYS B 1 123 ? 57.823 20.076 48.785 1.00 34.67  ? 297  CYS B C   1 
ATOM   2396 O O   . CYS B 1 123 ? 57.170 19.181 48.244 1.00 33.46  ? 297  CYS B O   1 
ATOM   2397 C CB  . CYS B 1 123 ? 60.135 19.488 49.589 1.00 31.32  ? 297  CYS B CB  1 
ATOM   2398 S SG  . CYS B 1 123 ? 61.908 19.378 49.247 1.00 34.91  ? 297  CYS B SG  1 
ATOM   2399 N N   . LEU B 1 124 ? 57.300 20.914 49.690 1.00 30.96  ? 298  LEU B N   1 
ATOM   2400 C CA  . LEU B 1 124 ? 55.889 20.894 50.043 1.00 30.87  ? 298  LEU B CA  1 
ATOM   2401 C C   . LEU B 1 124 ? 55.036 21.295 48.818 1.00 35.93  ? 298  LEU B C   1 
ATOM   2402 O O   . LEU B 1 124 ? 54.083 20.590 48.493 1.00 34.53  ? 298  LEU B O   1 
ATOM   2403 C CB  . LEU B 1 124 ? 55.585 21.755 51.287 1.00 30.27  ? 298  LEU B CB  1 
ATOM   2404 C CG  . LEU B 1 124 ? 56.306 21.379 52.596 1.00 33.04  ? 298  LEU B CG  1 
ATOM   2405 C CD1 . LEU B 1 124 ? 56.103 22.461 53.658 1.00 32.15  ? 298  LEU B CD1 1 
ATOM   2406 C CD2 . LEU B 1 124 ? 55.887 20.005 53.101 1.00 36.00  ? 298  LEU B CD2 1 
ATOM   2407 N N   . SER B 1 125 ? 55.439 22.366 48.099 1.00 35.03  ? 299  SER B N   1 
ATOM   2408 C CA  . SER B 1 125 ? 54.759 22.817 46.878 1.00 35.10  ? 299  SER B CA  1 
ATOM   2409 C C   . SER B 1 125 ? 54.754 21.713 45.822 1.00 39.09  ? 299  SER B C   1 
ATOM   2410 O O   . SER B 1 125 ? 53.678 21.411 45.296 1.00 40.11  ? 299  SER B O   1 
ATOM   2411 C CB  . SER B 1 125 ? 55.397 24.090 46.335 1.00 40.42  ? 299  SER B CB  1 
ATOM   2412 O OG  . SER B 1 125 ? 55.116 25.184 47.195 1.00 52.40  ? 299  SER B OG  1 
ATOM   2413 N N   . ALA B 1 126 ? 55.917 21.028 45.600 1.00 33.78  ? 300  ALA B N   1 
ATOM   2414 C CA  . ALA B 1 126 ? 56.027 19.911 44.641 1.00 32.87  ? 300  ALA B CA  1 
ATOM   2415 C C   . ALA B 1 126 ? 55.090 18.744 45.000 1.00 36.66  ? 300  ALA B C   1 
ATOM   2416 O O   . ALA B 1 126 ? 54.428 18.201 44.113 1.00 35.74  ? 300  ALA B O   1 
ATOM   2417 C CB  . ALA B 1 126 ? 57.460 19.426 44.537 1.00 33.20  ? 300  ALA B CB  1 
ATOM   2418 N N   . ALA B 1 127 ? 54.958 18.406 46.315 1.00 30.70  ? 301  ALA B N   1 
ATOM   2419 C CA  . ALA B 1 127 ? 54.053 17.347 46.752 1.00 30.48  ? 301  ALA B CA  1 
ATOM   2420 C C   . ALA B 1 127 ? 52.597 17.780 46.524 1.00 34.37  ? 301  ALA B C   1 
ATOM   2421 O O   . ALA B 1 127 ? 51.776 16.983 46.075 1.00 33.35  ? 301  ALA B O   1 
ATOM   2422 C CB  . ALA B 1 127 ? 54.274 17.045 48.233 1.00 31.56  ? 301  ALA B CB  1 
ATOM   2423 N N   . GLU B 1 128 ? 52.289 19.039 46.846 1.00 32.88  ? 302  GLU B N   1 
ATOM   2424 C CA  . GLU B 1 128 ? 50.941 19.600 46.679 1.00 34.29  ? 302  GLU B CA  1 
ATOM   2425 C C   . GLU B 1 128 ? 50.495 19.645 45.221 1.00 40.46  ? 302  GLU B C   1 
ATOM   2426 O O   . GLU B 1 128 ? 49.309 19.441 44.941 1.00 40.40  ? 302  GLU B O   1 
ATOM   2427 C CB  . GLU B 1 128 ? 50.859 20.980 47.292 1.00 35.38  ? 302  GLU B CB  1 
ATOM   2428 C CG  . GLU B 1 128 ? 50.584 20.881 48.773 1.00 46.35  ? 302  GLU B CG  1 
ATOM   2429 C CD  . GLU B 1 128 ? 50.925 22.104 49.586 1.00 55.56  ? 302  GLU B CD  1 
ATOM   2430 O OE1 . GLU B 1 128 ? 51.449 23.096 49.027 1.00 38.37  ? 302  GLU B OE1 1 
ATOM   2431 O OE2 . GLU B 1 128 ? 50.678 22.055 50.809 1.00 48.68  ? 302  GLU B OE2 1 
ATOM   2432 N N   . ASP B 1 129 ? 51.436 19.928 44.307 1.00 38.18  ? 303  ASP B N   1 
ATOM   2433 C CA  . ASP B 1 129 ? 51.151 19.988 42.872 1.00 38.04  ? 303  ASP B CA  1 
ATOM   2434 C C   . ASP B 1 129 ? 50.773 18.603 42.325 1.00 42.17  ? 303  ASP B C   1 
ATOM   2435 O O   . ASP B 1 129 ? 50.004 18.529 41.366 1.00 42.70  ? 303  ASP B O   1 
ATOM   2436 C CB  . ASP B 1 129 ? 52.322 20.620 42.097 1.00 39.73  ? 303  ASP B CB  1 
ATOM   2437 C CG  . ASP B 1 129 ? 51.913 21.563 40.965 1.00 50.54  ? 303  ASP B CG  1 
ATOM   2438 O OD1 . ASP B 1 129 ? 50.705 21.929 40.889 1.00 46.52  ? 303  ASP B OD1 1 
ATOM   2439 O OD2 . ASP B 1 129 ? 52.793 21.938 40.162 1.00 55.31  ? 303  ASP B OD2 1 
ATOM   2440 N N   . LYS B 1 130 ? 51.267 17.504 42.959 1.00 37.36  ? 304  LYS B N   1 
ATOM   2441 C CA  . LYS B 1 130 ? 50.924 16.127 42.586 1.00 36.05  ? 304  LYS B CA  1 
ATOM   2442 C C   . LYS B 1 130 ? 49.767 15.588 43.425 1.00 37.48  ? 304  LYS B C   1 
ATOM   2443 O O   . LYS B 1 130 ? 49.449 14.395 43.348 1.00 37.20  ? 304  LYS B O   1 
ATOM   2444 C CB  . LYS B 1 130 ? 52.151 15.181 42.637 1.00 39.08  ? 304  LYS B CB  1 
ATOM   2445 C CG  . LYS B 1 130 ? 53.260 15.511 41.635 1.00 47.80  ? 304  LYS B CG  1 
ATOM   2446 C CD  . LYS B 1 130 ? 52.930 15.078 40.195 1.00 54.86  ? 304  LYS B CD  1 
ATOM   2447 C CE  . LYS B 1 130 ? 54.049 15.374 39.226 1.00 51.19  ? 304  LYS B CE  1 
ATOM   2448 N NZ  . LYS B 1 130 ? 54.238 16.836 39.032 1.00 59.88  ? 304  LYS B NZ  1 
ATOM   2449 N N   . LYS B 1 131 ? 49.142 16.472 44.239 1.00 34.03  ? 305  LYS B N   1 
ATOM   2450 C CA  . LYS B 1 131 ? 48.007 16.183 45.129 1.00 33.85  ? 305  LYS B CA  1 
ATOM   2451 C C   . LYS B 1 131 ? 48.350 15.039 46.095 1.00 36.94  ? 305  LYS B C   1 
ATOM   2452 O O   . LYS B 1 131 ? 47.524 14.159 46.356 1.00 35.40  ? 305  LYS B O   1 
ATOM   2453 C CB  . LYS B 1 131 ? 46.703 15.905 44.331 1.00 37.76  ? 305  LYS B CB  1 
ATOM   2454 C CG  . LYS B 1 131 ? 46.240 17.073 43.458 1.00 49.02  ? 305  LYS B CG  1 
ATOM   2455 C CD  . LYS B 1 131 ? 45.470 18.120 44.257 1.00 52.78  ? 305  LYS B CD  1 
ATOM   2456 C CE  . LYS B 1 131 ? 44.783 19.097 43.354 1.00 58.69  ? 305  LYS B CE  1 
ATOM   2457 N NZ  . LYS B 1 131 ? 44.549 20.393 44.033 1.00 61.10  ? 305  LYS B NZ  1 
ATOM   2458 N N   . LEU B 1 132 ? 49.597 15.043 46.608 1.00 32.71  ? 306  LEU B N   1 
ATOM   2459 C CA  . LEU B 1 132 ? 50.033 13.987 47.514 1.00 31.82  ? 306  LEU B CA  1 
ATOM   2460 C C   . LEU B 1 132 ? 49.431 14.224 48.898 1.00 33.68  ? 306  LEU B C   1 
ATOM   2461 O O   . LEU B 1 132 ? 49.360 15.373 49.350 1.00 31.81  ? 306  LEU B O   1 
ATOM   2462 C CB  . LEU B 1 132 ? 51.577 13.881 47.561 1.00 32.13  ? 306  LEU B CB  1 
ATOM   2463 C CG  . LEU B 1 132 ? 52.321 13.647 46.226 1.00 37.34  ? 306  LEU B CG  1 
ATOM   2464 C CD1 . LEU B 1 132 ? 53.837 13.563 46.458 1.00 38.42  ? 306  LEU B CD1 1 
ATOM   2465 C CD2 . LEU B 1 132 ? 51.814 12.366 45.496 1.00 40.16  ? 306  LEU B CD2 1 
ATOM   2466 N N   . LYS B 1 133 ? 48.988 13.135 49.548 1.00 29.71  ? 307  LYS B N   1 
ATOM   2467 C CA  . LYS B 1 133 ? 48.321 13.141 50.850 1.00 31.28  ? 307  LYS B CA  1 
ATOM   2468 C C   . LYS B 1 133 ? 49.308 13.059 52.014 1.00 34.01  ? 307  LYS B C   1 
ATOM   2469 O O   . LYS B 1 133 ? 48.971 13.420 53.139 1.00 33.33  ? 307  LYS B O   1 
ATOM   2470 C CB  . LYS B 1 133 ? 47.320 11.976 50.942 1.00 34.51  ? 307  LYS B CB  1 
ATOM   2471 C CG  . LYS B 1 133 ? 46.217 12.042 49.882 1.00 39.83  ? 307  LYS B CG  1 
ATOM   2472 C CD  . LYS B 1 133 ? 45.438 10.733 49.797 1.00 48.67  ? 307  LYS B CD  1 
ATOM   2473 C CE  . LYS B 1 133 ? 44.313 10.790 48.778 1.00 55.98  ? 307  LYS B CE  1 
ATOM   2474 N NZ  . LYS B 1 133 ? 44.819 10.757 47.379 1.00 65.30  ? 307  LYS B NZ  1 
ATOM   2475 N N   . SER B 1 134 ? 50.500 12.547 51.743 1.00 31.91  ? 308  SER B N   1 
ATOM   2476 C CA  . SER B 1 134 ? 51.549 12.415 52.739 1.00 31.76  ? 308  SER B CA  1 
ATOM   2477 C C   . SER B 1 134 ? 52.921 12.589 52.109 1.00 33.98  ? 308  SER B C   1 
ATOM   2478 O O   . SER B 1 134 ? 53.074 12.369 50.909 1.00 32.61  ? 308  SER B O   1 
ATOM   2479 C CB  . SER B 1 134 ? 51.430 11.079 53.458 1.00 33.60  ? 308  SER B CB  1 
ATOM   2480 O OG  . SER B 1 134 ? 51.495 9.985  52.565 1.00 38.38  ? 308  SER B OG  1 
ATOM   2481 N N   . VAL B 1 135 ? 53.912 13.041 52.901 1.00 28.51  ? 309  VAL B N   1 
ATOM   2482 C CA  . VAL B 1 135 ? 55.286 13.256 52.429 1.00 28.85  ? 309  VAL B CA  1 
ATOM   2483 C C   . VAL B 1 135 ? 56.259 12.946 53.557 1.00 30.79  ? 309  VAL B C   1 
ATOM   2484 O O   . VAL B 1 135 ? 55.944 13.177 54.727 1.00 29.25  ? 309  VAL B O   1 
ATOM   2485 C CB  . VAL B 1 135 ? 55.518 14.656 51.777 1.00 33.25  ? 309  VAL B CB  1 
ATOM   2486 C CG1 . VAL B 1 135 ? 55.417 15.794 52.797 1.00 33.18  ? 309  VAL B CG1 1 
ATOM   2487 C CG2 . VAL B 1 135 ? 56.838 14.719 51.016 1.00 32.98  ? 309  VAL B CG2 1 
ATOM   2488 N N   . ALA B 1 136 ? 57.414 12.388 53.210 1.00 27.24  ? 310  ALA B N   1 
ATOM   2489 C CA  . ALA B 1 136 ? 58.422 12.067 54.225 1.00 26.62  ? 310  ALA B CA  1 
ATOM   2490 C C   . ALA B 1 136 ? 59.732 12.727 53.912 1.00 30.09  ? 310  ALA B C   1 
ATOM   2491 O O   . ALA B 1 136 ? 60.145 12.782 52.749 1.00 28.94  ? 310  ALA B O   1 
ATOM   2492 C CB  . ALA B 1 136 ? 58.598 10.566 54.353 1.00 27.12  ? 310  ALA B CB  1 
ATOM   2493 N N   . PHE B 1 137 ? 60.394 13.261 54.951 1.00 25.86  ? 311  PHE B N   1 
ATOM   2494 C CA  . PHE B 1 137 ? 61.710 13.869 54.834 1.00 25.04  ? 311  PHE B CA  1 
ATOM   2495 C C   . PHE B 1 137 ? 62.672 12.929 55.561 1.00 30.60  ? 311  PHE B C   1 
ATOM   2496 O O   . PHE B 1 137 ? 62.462 12.618 56.750 1.00 29.94  ? 311  PHE B O   1 
ATOM   2497 C CB  . PHE B 1 137 ? 61.789 15.261 55.492 1.00 25.12  ? 311  PHE B CB  1 
ATOM   2498 C CG  . PHE B 1 137 ? 61.048 16.352 54.777 1.00 25.75  ? 311  PHE B CG  1 
ATOM   2499 C CD1 . PHE B 1 137 ? 59.679 16.510 54.947 1.00 28.95  ? 311  PHE B CD1 1 
ATOM   2500 C CD2 . PHE B 1 137 ? 61.711 17.210 53.905 1.00 26.43  ? 311  PHE B CD2 1 
ATOM   2501 C CE1 . PHE B 1 137 ? 58.984 17.499 54.245 1.00 30.50  ? 311  PHE B CE1 1 
ATOM   2502 C CE2 . PHE B 1 137 ? 61.011 18.200 53.209 1.00 28.90  ? 311  PHE B CE2 1 
ATOM   2503 C CZ  . PHE B 1 137 ? 59.660 18.343 53.397 1.00 27.14  ? 311  PHE B CZ  1 
ATOM   2504 N N   . PRO B 1 138 ? 63.707 12.434 54.874 1.00 28.42  ? 312  PRO B N   1 
ATOM   2505 C CA  . PRO B 1 138 ? 64.702 11.617 55.574 1.00 28.18  ? 312  PRO B CA  1 
ATOM   2506 C C   . PRO B 1 138 ? 65.754 12.553 56.207 1.00 30.47  ? 312  PRO B C   1 
ATOM   2507 O O   . PRO B 1 138 ? 65.687 13.770 56.001 1.00 29.80  ? 312  PRO B O   1 
ATOM   2508 C CB  . PRO B 1 138 ? 65.291 10.783 54.435 1.00 30.53  ? 312  PRO B CB  1 
ATOM   2509 C CG  . PRO B 1 138 ? 65.330 11.762 53.288 1.00 33.75  ? 312  PRO B CG  1 
ATOM   2510 C CD  . PRO B 1 138 ? 64.124 12.693 53.474 1.00 30.20  ? 312  PRO B CD  1 
ATOM   2511 N N   . PRO B 1 139 ? 66.779 12.023 56.897 1.00 28.56  ? 313  PRO B N   1 
ATOM   2512 C CA  . PRO B 1 139 ? 67.843 12.897 57.422 1.00 29.35  ? 313  PRO B CA  1 
ATOM   2513 C C   . PRO B 1 139 ? 68.590 13.638 56.323 1.00 36.39  ? 313  PRO B C   1 
ATOM   2514 O O   . PRO B 1 139 ? 68.774 13.129 55.216 1.00 36.51  ? 313  PRO B O   1 
ATOM   2515 C CB  . PRO B 1 139 ? 68.775 11.911 58.140 1.00 30.35  ? 313  PRO B CB  1 
ATOM   2516 C CG  . PRO B 1 139 ? 67.919 10.744 58.453 1.00 33.38  ? 313  PRO B CG  1 
ATOM   2517 C CD  . PRO B 1 139 ? 67.060 10.616 57.217 1.00 29.18  ? 313  PRO B CD  1 
ATOM   2518 N N   . PHE B 1 140 ? 68.965 14.871 56.621 1.00 35.41  ? 314  PHE B N   1 
ATOM   2519 C CA  . PHE B 1 140 ? 69.742 15.719 55.744 1.00 37.18  ? 314  PHE B CA  1 
ATOM   2520 C C   . PHE B 1 140 ? 71.223 15.309 55.838 1.00 41.42  ? 314  PHE B C   1 
ATOM   2521 O O   . PHE B 1 140 ? 71.591 14.654 56.822 1.00 40.96  ? 314  PHE B O   1 
ATOM   2522 C CB  . PHE B 1 140 ? 69.584 17.178 56.187 1.00 40.29  ? 314  PHE B CB  1 
ATOM   2523 C CG  . PHE B 1 140 ? 68.282 17.830 55.802 1.00 43.31  ? 314  PHE B CG  1 
ATOM   2524 C CD1 . PHE B 1 140 ? 67.779 17.711 54.509 1.00 47.32  ? 314  PHE B CD1 1 
ATOM   2525 C CD2 . PHE B 1 140 ? 67.613 18.658 56.695 1.00 46.31  ? 314  PHE B CD2 1 
ATOM   2526 C CE1 . PHE B 1 140 ? 66.586 18.339 54.148 1.00 48.99  ? 314  PHE B CE1 1 
ATOM   2527 C CE2 . PHE B 1 140 ? 66.430 19.296 56.325 1.00 49.18  ? 314  PHE B CE2 1 
ATOM   2528 C CZ  . PHE B 1 140 ? 65.916 19.115 55.064 1.00 47.31  ? 314  PHE B CZ  1 
ATOM   2529 N N   . PRO B 1 141 ? 72.097 15.693 54.868 1.00 37.79  ? 315  PRO B N   1 
ATOM   2530 C CA  . PRO B 1 141 ? 73.521 15.348 55.002 1.00 39.15  ? 315  PRO B CA  1 
ATOM   2531 C C   . PRO B 1 141 ? 74.110 15.959 56.286 1.00 44.32  ? 315  PRO B C   1 
ATOM   2532 O O   . PRO B 1 141 ? 73.634 16.998 56.738 1.00 42.79  ? 315  PRO B O   1 
ATOM   2533 C CB  . PRO B 1 141 ? 74.157 15.966 53.751 1.00 41.24  ? 315  PRO B CB  1 
ATOM   2534 C CG  . PRO B 1 141 ? 73.029 16.114 52.776 1.00 45.62  ? 315  PRO B CG  1 
ATOM   2535 C CD  . PRO B 1 141 ? 71.848 16.454 53.627 1.00 40.34  ? 315  PRO B CD  1 
ATOM   2536 N N   . SER B 1 142 ? 75.105 15.283 56.876 1.00 42.43  ? 316  SER B N   1 
ATOM   2537 C CA  . SER B 1 142 ? 75.812 15.663 58.099 1.00 42.96  ? 316  SER B CA  1 
ATOM   2538 C C   . SER B 1 142 ? 77.321 15.773 57.808 1.00 48.37  ? 316  SER B C   1 
ATOM   2539 O O   . SER B 1 142 ? 77.832 15.075 56.913 1.00 48.15  ? 316  SER B O   1 
ATOM   2540 C CB  . SER B 1 142 ? 75.594 14.609 59.179 1.00 47.02  ? 316  SER B CB  1 
ATOM   2541 O OG  . SER B 1 142 ? 76.069 13.342 58.749 1.00 58.56  ? 316  SER B OG  1 
ATOM   2542 N N   . GLY B 1 143 ? 78.012 16.602 58.600 1.00 43.56  ? 317  GLY B N   1 
ATOM   2543 C CA  . GLY B 1 143 ? 79.449 16.832 58.462 1.00 42.00  ? 317  GLY B CA  1 
ATOM   2544 C C   . GLY B 1 143 ? 79.761 18.237 58.003 1.00 41.40  ? 317  GLY B C   1 
ATOM   2545 O O   . GLY B 1 143 ? 78.935 19.129 58.180 1.00 39.30  ? 317  GLY B O   1 
ATOM   2546 N N   . ARG B 1 144 ? 80.954 18.451 57.403 1.00 38.09  ? 318  ARG B N   1 
ATOM   2547 C CA  . ARG B 1 144 ? 81.400 19.760 56.923 1.00 37.54  ? 318  ARG B CA  1 
ATOM   2548 C C   . ARG B 1 144 ? 80.467 20.325 55.883 1.00 43.79  ? 318  ARG B C   1 
ATOM   2549 O O   . ARG B 1 144 ? 79.987 19.584 55.016 1.00 46.37  ? 318  ARG B O   1 
ATOM   2550 C CB  . ARG B 1 144 ? 82.824 19.702 56.326 1.00 37.69  ? 318  ARG B CB  1 
ATOM   2551 C CG  . ARG B 1 144 ? 83.880 19.126 57.241 1.00 44.51  ? 318  ARG B CG  1 
ATOM   2552 C CD  . ARG B 1 144 ? 84.324 20.096 58.322 1.00 40.78  ? 318  ARG B CD  1 
ATOM   2553 N NE  . ARG B 1 144 ? 85.186 19.392 59.271 1.00 36.26  ? 318  ARG B NE  1 
ATOM   2554 C CZ  . ARG B 1 144 ? 85.353 19.744 60.540 1.00 54.95  ? 318  ARG B CZ  1 
ATOM   2555 N NH1 . ARG B 1 144 ? 84.703 20.792 61.039 1.00 37.05  ? 318  ARG B NH1 1 
ATOM   2556 N NH2 . ARG B 1 144 ? 86.148 19.037 61.329 1.00 42.44  ? 318  ARG B NH2 1 
ATOM   2557 N N   . ASN B 1 145 ? 80.167 21.627 56.001 1.00 39.55  ? 319  ASN B N   1 
ATOM   2558 C CA  . ASN B 1 145 ? 79.282 22.375 55.115 1.00 40.32  ? 319  ASN B CA  1 
ATOM   2559 C C   . ASN B 1 145 ? 77.859 21.822 55.078 1.00 43.32  ? 319  ASN B C   1 
ATOM   2560 O O   . ASN B 1 145 ? 77.106 22.106 54.138 1.00 44.03  ? 319  ASN B O   1 
ATOM   2561 C CB  . ASN B 1 145 ? 79.884 22.517 53.703 1.00 43.85  ? 319  ASN B CB  1 
ATOM   2562 C CG  . ASN B 1 145 ? 81.013 23.501 53.706 1.00 60.58  ? 319  ASN B CG  1 
ATOM   2563 O OD1 . ASN B 1 145 ? 80.805 24.708 53.868 1.00 57.82  ? 319  ASN B OD1 1 
ATOM   2564 N ND2 . ASN B 1 145 ? 82.231 22.998 53.579 1.00 50.02  ? 319  ASN B ND2 1 
ATOM   2565 N N   . CYS B 1 146 ? 77.493 21.046 56.119 1.00 36.61  ? 320  CYS B N   1 
ATOM   2566 C CA  . CYS B 1 146 ? 76.146 20.513 56.297 1.00 34.93  ? 320  CYS B CA  1 
ATOM   2567 C C   . CYS B 1 146 ? 75.546 21.198 57.512 1.00 37.17  ? 320  CYS B C   1 
ATOM   2568 O O   . CYS B 1 146 ? 76.283 21.713 58.371 1.00 33.62  ? 320  CYS B O   1 
ATOM   2569 C CB  . CYS B 1 146 ? 76.170 19.004 56.476 1.00 35.83  ? 320  CYS B CB  1 
ATOM   2570 S SG  . CYS B 1 146 ? 76.810 18.100 55.046 1.00 39.88  ? 320  CYS B SG  1 
ATOM   2571 N N   . PHE B 1 147 ? 74.210 21.199 57.605 1.00 31.99  ? 321  PHE B N   1 
ATOM   2572 C CA  . PHE B 1 147 ? 73.574 21.849 58.733 1.00 30.68  ? 321  PHE B CA  1 
ATOM   2573 C C   . PHE B 1 147 ? 73.724 21.056 60.029 1.00 31.87  ? 321  PHE B C   1 
ATOM   2574 O O   . PHE B 1 147 ? 73.497 19.833 60.052 1.00 29.08  ? 321  PHE B O   1 
ATOM   2575 C CB  . PHE B 1 147 ? 72.078 22.090 58.460 1.00 31.69  ? 321  PHE B CB  1 
ATOM   2576 C CG  . PHE B 1 147 ? 71.785 23.120 57.402 1.00 32.13  ? 321  PHE B CG  1 
ATOM   2577 C CD1 . PHE B 1 147 ? 71.797 22.779 56.054 1.00 33.40  ? 321  PHE B CD1 1 
ATOM   2578 C CD2 . PHE B 1 147 ? 71.490 24.432 57.751 1.00 34.69  ? 321  PHE B CD2 1 
ATOM   2579 C CE1 . PHE B 1 147 ? 71.524 23.745 55.070 1.00 34.88  ? 321  PHE B CE1 1 
ATOM   2580 C CE2 . PHE B 1 147 ? 71.221 25.389 56.774 1.00 36.73  ? 321  PHE B CE2 1 
ATOM   2581 C CZ  . PHE B 1 147 ? 71.229 25.039 55.439 1.00 34.13  ? 321  PHE B CZ  1 
ATOM   2582 N N   . PRO B 1 148 ? 73.990 21.770 61.144 1.00 29.34  ? 322  PRO B N   1 
ATOM   2583 C CA  . PRO B 1 148 ? 73.958 21.117 62.462 1.00 28.98  ? 322  PRO B CA  1 
ATOM   2584 C C   . PRO B 1 148 ? 72.537 20.563 62.672 1.00 30.24  ? 322  PRO B C   1 
ATOM   2585 O O   . PRO B 1 148 ? 71.576 21.143 62.168 1.00 29.02  ? 322  PRO B O   1 
ATOM   2586 C CB  . PRO B 1 148 ? 74.264 22.278 63.426 1.00 30.80  ? 322  PRO B CB  1 
ATOM   2587 C CG  . PRO B 1 148 ? 74.988 23.287 62.581 1.00 34.22  ? 322  PRO B CG  1 
ATOM   2588 C CD  . PRO B 1 148 ? 74.264 23.221 61.279 1.00 30.39  ? 322  PRO B CD  1 
ATOM   2589 N N   . LYS B 1 149 ? 72.393 19.428 63.350 1.00 26.71  ? 323  LYS B N   1 
ATOM   2590 C CA  . LYS B 1 149 ? 71.067 18.817 63.536 1.00 25.56  ? 323  LYS B CA  1 
ATOM   2591 C C   . LYS B 1 149 ? 70.017 19.780 64.065 1.00 30.02  ? 323  LYS B C   1 
ATOM   2592 O O   . LYS B 1 149 ? 68.892 19.800 63.556 1.00 30.17  ? 323  LYS B O   1 
ATOM   2593 C CB  . LYS B 1 149 ? 71.159 17.601 64.453 1.00 27.01  ? 323  LYS B CB  1 
ATOM   2594 C CG  . LYS B 1 149 ? 71.877 16.419 63.828 1.00 35.73  ? 323  LYS B CG  1 
ATOM   2595 C CD  . LYS B 1 149 ? 71.979 15.291 64.826 1.00 34.22  ? 323  LYS B CD  1 
ATOM   2596 C CE  . LYS B 1 149 ? 72.883 14.211 64.298 1.00 37.56  ? 323  LYS B CE  1 
ATOM   2597 N NZ  . LYS B 1 149 ? 72.989 13.076 65.248 1.00 37.83  ? 323  LYS B NZ  1 
ATOM   2598 N N   . GLN B 1 150 ? 70.364 20.561 65.087 1.00 28.89  ? 324  GLN B N   1 
ATOM   2599 C CA  . GLN B 1 150 ? 69.410 21.482 65.697 1.00 30.59  ? 324  GLN B CA  1 
ATOM   2600 C C   . GLN B 1 150 ? 68.945 22.516 64.711 1.00 31.32  ? 324  GLN B C   1 
ATOM   2601 O O   . GLN B 1 150 ? 67.752 22.806 64.661 1.00 29.10  ? 324  GLN B O   1 
ATOM   2602 C CB  . GLN B 1 150 ? 69.990 22.130 66.966 1.00 32.30  ? 324  GLN B CB  1 
ATOM   2603 C CG  . GLN B 1 150 ? 68.949 22.816 67.863 1.00 43.27  ? 324  GLN B CG  1 
ATOM   2604 C CD  . GLN B 1 150 ? 68.771 24.282 67.540 1.00 68.71  ? 324  GLN B CD  1 
ATOM   2605 O OE1 . GLN B 1 150 ? 69.666 24.943 67.001 1.00 69.01  ? 324  GLN B OE1 1 
ATOM   2606 N NE2 . GLN B 1 150 ? 67.609 24.833 67.867 1.00 58.37  ? 324  GLN B NE2 1 
ATOM   2607 N N   . THR B 1 151 ? 69.878 23.075 63.927 1.00 29.51  ? 325  THR B N   1 
ATOM   2608 C CA  . THR B 1 151 ? 69.516 24.074 62.919 1.00 29.21  ? 325  THR B CA  1 
ATOM   2609 C C   . THR B 1 151 ? 68.593 23.465 61.855 1.00 31.78  ? 325  THR B C   1 
ATOM   2610 O O   . THR B 1 151 ? 67.547 24.052 61.546 1.00 31.12  ? 325  THR B O   1 
ATOM   2611 C CB  . THR B 1 151 ? 70.764 24.746 62.338 1.00 35.83  ? 325  THR B CB  1 
ATOM   2612 O OG1 . THR B 1 151 ? 71.622 25.173 63.401 1.00 36.51  ? 325  THR B OG1 1 
ATOM   2613 C CG2 . THR B 1 151 ? 70.421 25.910 61.442 1.00 33.47  ? 325  THR B CG2 1 
ATOM   2614 N N   . ALA B 1 152 ? 68.948 22.297 61.334 1.00 27.12  ? 326  ALA B N   1 
ATOM   2615 C CA  . ALA B 1 152 ? 68.130 21.602 60.342 1.00 27.83  ? 326  ALA B CA  1 
ATOM   2616 C C   . ALA B 1 152 ? 66.710 21.375 60.890 1.00 31.16  ? 326  ALA B C   1 
ATOM   2617 O O   . ALA B 1 152 ? 65.751 21.758 60.229 1.00 31.71  ? 326  ALA B O   1 
ATOM   2618 C CB  . ALA B 1 152 ? 68.772 20.267 59.960 1.00 29.40  ? 326  ALA B CB  1 
ATOM   2619 N N   . ALA B 1 153 ? 66.589 20.847 62.138 1.00 25.73  ? 327  ALA B N   1 
ATOM   2620 C CA  . ALA B 1 153 ? 65.317 20.610 62.823 1.00 24.12  ? 327  ALA B CA  1 
ATOM   2621 C C   . ALA B 1 153 ? 64.479 21.879 63.008 1.00 26.97  ? 327  ALA B C   1 
ATOM   2622 O O   . ALA B 1 153 ? 63.314 21.891 62.624 1.00 27.75  ? 327  ALA B O   1 
ATOM   2623 C CB  . ALA B 1 153 ? 65.573 19.979 64.173 1.00 25.74  ? 327  ALA B CB  1 
ATOM   2624 N N   . GLN B 1 154 ? 65.063 22.937 63.578 1.00 25.17  ? 328  GLN B N   1 
ATOM   2625 C CA  . GLN B 1 154 ? 64.393 24.212 63.816 1.00 26.53  ? 328  GLN B CA  1 
ATOM   2626 C C   . GLN B 1 154 ? 63.873 24.803 62.493 1.00 32.12  ? 328  GLN B C   1 
ATOM   2627 O O   . GLN B 1 154 ? 62.683 25.098 62.391 1.00 32.68  ? 328  GLN B O   1 
ATOM   2628 C CB  . GLN B 1 154 ? 65.368 25.186 64.507 1.00 28.28  ? 328  GLN B CB  1 
ATOM   2629 C CG  . GLN B 1 154 ? 64.736 26.446 65.084 1.00 50.07  ? 328  GLN B CG  1 
ATOM   2630 C CD  . GLN B 1 154 ? 65.760 27.387 65.696 1.00 83.13  ? 328  GLN B CD  1 
ATOM   2631 O OE1 . GLN B 1 154 ? 66.767 26.977 66.298 1.00 78.31  ? 328  GLN B OE1 1 
ATOM   2632 N NE2 . GLN B 1 154 ? 65.516 28.685 65.567 1.00 82.03  ? 328  GLN B NE2 1 
ATOM   2633 N N   . VAL B 1 155 ? 64.746 24.921 61.485 1.00 30.25  ? 329  VAL B N   1 
ATOM   2634 C CA  . VAL B 1 155 ? 64.381 25.504 60.186 1.00 30.33  ? 329  VAL B CA  1 
ATOM   2635 C C   . VAL B 1 155 ? 63.274 24.704 59.490 1.00 33.10  ? 329  VAL B C   1 
ATOM   2636 O O   . VAL B 1 155 ? 62.286 25.310 59.050 1.00 33.40  ? 329  VAL B O   1 
ATOM   2637 C CB  . VAL B 1 155 ? 65.620 25.748 59.282 1.00 33.86  ? 329  VAL B CB  1 
ATOM   2638 C CG1 . VAL B 1 155 ? 65.202 26.152 57.870 1.00 34.30  ? 329  VAL B CG1 1 
ATOM   2639 C CG2 . VAL B 1 155 ? 66.517 26.821 59.887 1.00 32.84  ? 329  VAL B CG2 1 
ATOM   2640 N N   . THR B 1 156 ? 63.414 23.352 59.425 1.00 27.81  ? 330  THR B N   1 
ATOM   2641 C CA  . THR B 1 156 ? 62.480 22.435 58.792 1.00 27.41  ? 330  THR B CA  1 
ATOM   2642 C C   . THR B 1 156 ? 61.091 22.488 59.429 1.00 30.66  ? 330  THR B C   1 
ATOM   2643 O O   . THR B 1 156 ? 60.091 22.595 58.709 1.00 28.79  ? 330  THR B O   1 
ATOM   2644 C CB  . THR B 1 156 ? 63.062 20.997 58.733 1.00 32.02  ? 330  THR B CB  1 
ATOM   2645 O OG1 . THR B 1 156 ? 64.334 21.035 58.084 1.00 30.80  ? 330  THR B OG1 1 
ATOM   2646 C CG2 . THR B 1 156 ? 62.157 20.023 57.999 1.00 31.11  ? 330  THR B CG2 1 
ATOM   2647 N N   . LEU B 1 157 ? 61.025 22.400 60.767 1.00 27.24  ? 331  LEU B N   1 
ATOM   2648 C CA  . LEU B 1 157 ? 59.738 22.410 61.477 1.00 28.79  ? 331  LEU B CA  1 
ATOM   2649 C C   . LEU B 1 157 ? 59.041 23.742 61.369 1.00 33.82  ? 331  LEU B C   1 
ATOM   2650 O O   . LEU B 1 157 ? 57.831 23.756 61.159 1.00 34.05  ? 331  LEU B O   1 
ATOM   2651 C CB  . LEU B 1 157 ? 59.892 21.977 62.933 1.00 29.98  ? 331  LEU B CB  1 
ATOM   2652 C CG  . LEU B 1 157 ? 60.215 20.507 63.123 1.00 34.54  ? 331  LEU B CG  1 
ATOM   2653 C CD1 . LEU B 1 157 ? 60.751 20.271 64.496 1.00 35.09  ? 331  LEU B CD1 1 
ATOM   2654 C CD2 . LEU B 1 157 ? 59.006 19.644 62.845 1.00 37.78  ? 331  LEU B CD2 1 
ATOM   2655 N N   . LYS B 1 158 ? 59.811 24.848 61.428 1.00 32.12  ? 332  LYS B N   1 
ATOM   2656 C CA  . LYS B 1 158 ? 59.334 26.233 61.271 1.00 33.27  ? 332  LYS B CA  1 
ATOM   2657 C C   . LYS B 1 158 ? 58.765 26.450 59.863 1.00 38.82  ? 332  LYS B C   1 
ATOM   2658 O O   . LYS B 1 158 ? 57.703 27.040 59.738 1.00 40.17  ? 332  LYS B O   1 
ATOM   2659 C CB  . LYS B 1 158 ? 60.447 27.254 61.573 1.00 36.21  ? 332  LYS B CB  1 
ATOM   2660 C CG  . LYS B 1 158 ? 59.989 28.718 61.568 1.00 55.47  ? 332  LYS B CG  1 
ATOM   2661 C CD  . LYS B 1 158 ? 61.151 29.703 61.752 1.00 63.40  ? 332  LYS B CD  1 
ATOM   2662 C CE  . LYS B 1 158 ? 61.828 30.109 60.459 1.00 75.58  ? 332  LYS B CE  1 
ATOM   2663 N NZ  . LYS B 1 158 ? 61.040 31.123 59.708 1.00 82.92  ? 332  LYS B NZ  1 
ATOM   2664 N N   . ALA B 1 159 ? 59.448 25.969 58.818 1.00 35.62  ? 333  ALA B N   1 
ATOM   2665 C CA  . ALA B 1 159 ? 58.949 26.079 57.441 1.00 34.92  ? 333  ALA B CA  1 
ATOM   2666 C C   . ALA B 1 159 ? 57.637 25.275 57.238 1.00 36.58  ? 333  ALA B C   1 
ATOM   2667 O O   . ALA B 1 159 ? 56.675 25.807 56.697 1.00 38.31  ? 333  ALA B O   1 
ATOM   2668 C CB  . ALA B 1 159 ? 60.016 25.615 56.463 1.00 35.72  ? 333  ALA B CB  1 
ATOM   2669 N N   . ILE B 1 160 ? 57.579 24.033 57.728 1.00 31.32  ? 334  ILE B N   1 
ATOM   2670 C CA  . ILE B 1 160 ? 56.415 23.153 57.579 1.00 32.09  ? 334  ILE B CA  1 
ATOM   2671 C C   . ILE B 1 160 ? 55.185 23.655 58.332 1.00 37.80  ? 334  ILE B C   1 
ATOM   2672 O O   . ILE B 1 160 ? 54.105 23.703 57.748 1.00 38.32  ? 334  ILE B O   1 
ATOM   2673 C CB  . ILE B 1 160 ? 56.752 21.693 57.931 1.00 35.48  ? 334  ILE B CB  1 
ATOM   2674 C CG1 . ILE B 1 160 ? 57.674 21.108 56.842 1.00 36.57  ? 334  ILE B CG1 1 
ATOM   2675 C CG2 . ILE B 1 160 ? 55.480 20.841 58.058 1.00 37.35  ? 334  ILE B CG2 1 
ATOM   2676 C CD1 . ILE B 1 160 ? 58.375 19.863 57.201 1.00 44.56  ? 334  ILE B CD1 1 
ATOM   2677 N N   . SER B 1 161 ? 55.339 23.987 59.625 1.00 35.55  ? 335  SER B N   1 
ATOM   2678 C CA  . SER B 1 161 ? 54.224 24.443 60.454 1.00 35.51  ? 335  SER B CA  1 
ATOM   2679 C C   . SER B 1 161 ? 53.629 25.723 59.920 1.00 44.06  ? 335  SER B C   1 
ATOM   2680 O O   . SER B 1 161 ? 52.402 25.819 59.878 1.00 45.67  ? 335  SER B O   1 
ATOM   2681 C CB  . SER B 1 161 ? 54.631 24.591 61.920 1.00 34.31  ? 335  SER B CB  1 
ATOM   2682 O OG  . SER B 1 161 ? 55.755 25.445 62.060 1.00 38.64  ? 335  SER B OG  1 
ATOM   2683 N N   . ALA B 1 162 ? 54.480 26.664 59.441 1.00 41.89  ? 336  ALA B N   1 
ATOM   2684 C CA  . ALA B 1 162 ? 54.065 27.950 58.854 1.00 41.82  ? 336  ALA B CA  1 
ATOM   2685 C C   . ALA B 1 162 ? 53.273 27.730 57.585 1.00 50.15  ? 336  ALA B C   1 
ATOM   2686 O O   . ALA B 1 162 ? 52.293 28.440 57.327 1.00 51.08  ? 336  ALA B O   1 
ATOM   2687 C CB  . ALA B 1 162 ? 55.276 28.799 58.539 1.00 42.15  ? 336  ALA B CB  1 
ATOM   2688 N N   . HIS B 1 163 ? 53.719 26.763 56.773 1.00 47.04  ? 337  HIS B N   1 
ATOM   2689 C CA  . HIS B 1 163 ? 53.076 26.408 55.527 1.00 46.38  ? 337  HIS B CA  1 
ATOM   2690 C C   . HIS B 1 163 ? 51.666 25.861 55.842 1.00 50.50  ? 337  HIS B C   1 
ATOM   2691 O O   . HIS B 1 163 ? 50.689 26.406 55.341 1.00 50.34  ? 337  HIS B O   1 
ATOM   2692 C CB  . HIS B 1 163 ? 53.968 25.396 54.783 1.00 46.97  ? 337  HIS B CB  1 
ATOM   2693 C CG  . HIS B 1 163 ? 53.483 25.021 53.427 1.00 50.03  ? 337  HIS B CG  1 
ATOM   2694 N ND1 . HIS B 1 163 ? 52.483 24.088 53.259 1.00 51.72  ? 337  HIS B ND1 1 
ATOM   2695 C CD2 . HIS B 1 163 ? 53.901 25.445 52.212 1.00 51.71  ? 337  HIS B CD2 1 
ATOM   2696 C CE1 . HIS B 1 163 ? 52.297 23.999 51.955 1.00 50.95  ? 337  HIS B CE1 1 
ATOM   2697 N NE2 . HIS B 1 163 ? 53.138 24.783 51.283 1.00 51.43  ? 337  HIS B NE2 1 
ATOM   2698 N N   . PHE B 1 164 ? 51.557 24.885 56.763 1.00 47.52  ? 338  PHE B N   1 
ATOM   2699 C CA  . PHE B 1 164 ? 50.296 24.241 57.152 1.00 47.75  ? 338  PHE B CA  1 
ATOM   2700 C C   . PHE B 1 164 ? 49.342 25.026 58.054 1.00 54.84  ? 338  PHE B C   1 
ATOM   2701 O O   . PHE B 1 164 ? 48.153 24.691 58.074 1.00 54.38  ? 338  PHE B O   1 
ATOM   2702 C CB  . PHE B 1 164 ? 50.575 22.896 57.816 1.00 49.66  ? 338  PHE B CB  1 
ATOM   2703 C CG  . PHE B 1 164 ? 51.038 21.830 56.866 1.00 50.99  ? 338  PHE B CG  1 
ATOM   2704 C CD1 . PHE B 1 164 ? 50.661 21.855 55.526 1.00 53.41  ? 338  PHE B CD1 1 
ATOM   2705 C CD2 . PHE B 1 164 ? 51.805 20.768 57.316 1.00 52.99  ? 338  PHE B CD2 1 
ATOM   2706 C CE1 . PHE B 1 164 ? 51.084 20.861 54.648 1.00 54.33  ? 338  PHE B CE1 1 
ATOM   2707 C CE2 . PHE B 1 164 ? 52.220 19.772 56.440 1.00 55.70  ? 338  PHE B CE2 1 
ATOM   2708 C CZ  . PHE B 1 164 ? 51.860 19.826 55.113 1.00 54.04  ? 338  PHE B CZ  1 
ATOM   2709 N N   . ASP B 1 165 ? 49.843 25.986 58.856 1.00 53.24  ? 339  ASP B N   1 
ATOM   2710 C CA  . ASP B 1 165 ? 48.979 26.795 59.738 1.00 53.68  ? 339  ASP B CA  1 
ATOM   2711 C C   . ASP B 1 165 ? 48.358 27.955 58.921 1.00 60.69  ? 339  ASP B C   1 
ATOM   2712 O O   . ASP B 1 165 ? 47.342 28.517 59.331 1.00 59.97  ? 339  ASP B O   1 
ATOM   2713 C CB  . ASP B 1 165 ? 49.756 27.347 60.962 1.00 54.29  ? 339  ASP B CB  1 
ATOM   2714 C CG  . ASP B 1 165 ? 50.260 26.328 61.993 1.00 59.12  ? 339  ASP B CG  1 
ATOM   2715 O OD1 . ASP B 1 165 ? 49.799 25.158 61.962 1.00 57.92  ? 339  ASP B OD1 1 
ATOM   2716 O OD2 . ASP B 1 165 ? 51.107 26.706 62.835 1.00 58.45  ? 339  ASP B OD2 1 
ATOM   2717 N N   . ASP B 1 166 ? 48.981 28.300 57.767 1.00 59.52  ? 340  ASP B N   1 
ATOM   2718 C CA  . ASP B 1 166 ? 48.551 29.377 56.861 1.00 60.18  ? 340  ASP B CA  1 
ATOM   2719 C C   . ASP B 1 166 ? 47.240 29.042 56.130 1.00 64.51  ? 340  ASP B C   1 
ATOM   2720 O O   . ASP B 1 166 ? 46.397 29.931 55.935 1.00 64.42  ? 340  ASP B O   1 
ATOM   2721 C CB  . ASP B 1 166 ? 49.679 29.706 55.852 1.00 62.11  ? 340  ASP B CB  1 
ATOM   2722 C CG  . ASP B 1 166 ? 49.248 30.404 54.569 1.00 76.04  ? 340  ASP B CG  1 
ATOM   2723 O OD1 . ASP B 1 166 ? 49.095 29.710 53.534 1.00 75.21  ? 340  ASP B OD1 1 
ATOM   2724 O OD2 . ASP B 1 166 ? 49.064 31.642 54.598 1.00 85.90  ? 340  ASP B OD2 1 
ATOM   2725 N N   . SER B 1 167 ? 47.092 27.771 55.702 1.00 60.03  ? 341  SER B N   1 
ATOM   2726 C CA  . SER B 1 167 ? 45.947 27.293 54.929 1.00 59.36  ? 341  SER B CA  1 
ATOM   2727 C C   . SER B 1 167 ? 45.743 25.778 55.052 1.00 62.01  ? 341  SER B C   1 
ATOM   2728 O O   . SER B 1 167 ? 46.715 25.012 55.093 1.00 61.02  ? 341  SER B O   1 
ATOM   2729 C CB  . SER B 1 167 ? 46.134 27.657 53.456 1.00 62.88  ? 341  SER B CB  1 
ATOM   2730 O OG  . SER B 1 167 ? 45.007 27.305 52.673 1.00 72.99  ? 341  SER B OG  1 
ATOM   2731 N N   . SER B 1 168 ? 44.465 25.359 55.080 1.00 58.14  ? 342  SER B N   1 
ATOM   2732 C CA  . SER B 1 168 ? 44.046 23.956 55.106 1.00 58.09  ? 342  SER B CA  1 
ATOM   2733 C C   . SER B 1 168 ? 43.762 23.478 53.665 1.00 61.45  ? 342  SER B C   1 
ATOM   2734 O O   . SER B 1 168 ? 43.506 22.286 53.446 1.00 60.82  ? 342  SER B O   1 
ATOM   2735 C CB  . SER B 1 168 ? 42.812 23.776 55.990 1.00 61.81  ? 342  SER B CB  1 
ATOM   2736 O OG  . SER B 1 168 ? 41.729 24.588 55.567 1.00 71.88  ? 342  SER B OG  1 
ATOM   2737 N N   . ALA B 1 169 ? 43.842 24.417 52.686 1.00 57.46  ? 343  ALA B N   1 
ATOM   2738 C CA  . ALA B 1 169 ? 43.631 24.177 51.255 1.00 57.12  ? 343  ALA B CA  1 
ATOM   2739 C C   . ALA B 1 169 ? 44.912 23.625 50.626 1.00 59.34  ? 343  ALA B C   1 
ATOM   2740 O O   . ALA B 1 169 ? 45.602 24.306 49.856 1.00 60.20  ? 343  ALA B O   1 
ATOM   2741 C CB  . ALA B 1 169 ? 43.200 25.463 50.567 1.00 58.00  ? 343  ALA B CB  1 
ATOM   2742 N N   . SER B 1 170 ? 45.227 22.379 50.999 1.00 52.39  ? 344  SER B N   1 
ATOM   2743 C CA  . SER B 1 170 ? 46.400 21.600 50.612 1.00 50.19  ? 344  SER B CA  1 
ATOM   2744 C C   . SER B 1 170 ? 46.053 20.145 50.821 1.00 47.91  ? 344  SER B C   1 
ATOM   2745 O O   . SER B 1 170 ? 45.423 19.788 51.819 1.00 46.78  ? 344  SER B O   1 
ATOM   2746 C CB  . SER B 1 170 ? 47.597 21.972 51.489 1.00 54.83  ? 344  SER B CB  1 
ATOM   2747 O OG  . SER B 1 170 ? 48.483 20.885 51.711 1.00 61.50  ? 344  SER B OG  1 
ATOM   2748 N N   . SER B 1 171 ? 46.480 19.309 49.880 1.00 41.17  ? 345  SER B N   1 
ATOM   2749 C CA  . SER B 1 171 ? 46.248 17.870 49.873 1.00 39.13  ? 345  SER B CA  1 
ATOM   2750 C C   . SER B 1 171 ? 47.022 17.146 50.980 1.00 38.63  ? 345  SER B C   1 
ATOM   2751 O O   . SER B 1 171 ? 46.635 16.037 51.342 1.00 36.81  ? 345  SER B O   1 
ATOM   2752 C CB  . SER B 1 171 ? 46.655 17.294 48.519 1.00 40.91  ? 345  SER B CB  1 
ATOM   2753 O OG  . SER B 1 171 ? 48.026 17.539 48.247 1.00 41.88  ? 345  SER B OG  1 
ATOM   2754 N N   . LEU B 1 172 ? 48.132 17.740 51.468 1.00 35.24  ? 346  LEU B N   1 
ATOM   2755 C CA  . LEU B 1 172 ? 48.998 17.093 52.470 1.00 34.35  ? 346  LEU B CA  1 
ATOM   2756 C C   . LEU B 1 172 ? 48.358 17.018 53.847 1.00 39.60  ? 346  LEU B C   1 
ATOM   2757 O O   . LEU B 1 172 ? 48.057 18.057 54.438 1.00 41.44  ? 346  LEU B O   1 
ATOM   2758 C CB  . LEU B 1 172 ? 50.383 17.783 52.555 1.00 33.91  ? 346  LEU B CB  1 
ATOM   2759 C CG  . LEU B 1 172 ? 51.387 17.509 51.425 1.00 37.05  ? 346  LEU B CG  1 
ATOM   2760 C CD1 . LEU B 1 172 ? 52.557 18.495 51.480 1.00 37.74  ? 346  LEU B CD1 1 
ATOM   2761 C CD2 . LEU B 1 172 ? 51.934 16.096 51.489 1.00 39.48  ? 346  LEU B CD2 1 
ATOM   2762 N N   . LYS B 1 173 ? 48.141 15.799 54.356 1.00 36.10  ? 347  LYS B N   1 
ATOM   2763 C CA  . LYS B 1 173 ? 47.562 15.606 55.692 1.00 36.70  ? 347  LYS B CA  1 
ATOM   2764 C C   . LYS B 1 173 ? 48.566 15.005 56.689 1.00 37.85  ? 347  LYS B C   1 
ATOM   2765 O O   . LYS B 1 173 ? 48.336 15.063 57.894 1.00 38.22  ? 347  LYS B O   1 
ATOM   2766 C CB  . LYS B 1 173 ? 46.267 14.762 55.658 1.00 40.40  ? 347  LYS B CB  1 
ATOM   2767 C CG  . LYS B 1 173 ? 45.129 15.298 54.759 1.00 50.39  ? 347  LYS B CG  1 
ATOM   2768 C CD  . LYS B 1 173 ? 44.834 16.791 54.924 1.00 59.37  ? 347  LYS B CD  1 
ATOM   2769 C CE  . LYS B 1 173 ? 44.027 17.325 53.764 1.00 75.71  ? 347  LYS B CE  1 
ATOM   2770 N NZ  . LYS B 1 173 ? 43.784 18.788 53.883 1.00 87.22  ? 347  LYS B NZ  1 
ATOM   2771 N N   . ASN B 1 174 ? 49.649 14.405 56.185 1.00 33.06  ? 348  ASN B N   1 
ATOM   2772 C CA  . ASN B 1 174 ? 50.672 13.784 57.018 1.00 31.41  ? 348  ASN B CA  1 
ATOM   2773 C C   . ASN B 1 174 ? 52.067 14.053 56.504 1.00 32.39  ? 348  ASN B C   1 
ATOM   2774 O O   . ASN B 1 174 ? 52.378 13.782 55.348 1.00 29.94  ? 348  ASN B O   1 
ATOM   2775 C CB  . ASN B 1 174 ? 50.447 12.266 57.112 1.00 30.44  ? 348  ASN B CB  1 
ATOM   2776 C CG  . ASN B 1 174 ? 49.298 11.874 57.998 1.00 53.45  ? 348  ASN B CG  1 
ATOM   2777 O OD1 . ASN B 1 174 ? 49.373 11.964 59.227 1.00 50.67  ? 348  ASN B OD1 1 
ATOM   2778 N ND2 . ASN B 1 174 ? 48.214 11.408 57.401 1.00 46.44  ? 348  ASN B ND2 1 
ATOM   2779 N N   . VAL B 1 175 ? 52.930 14.539 57.386 1.00 27.54  ? 349  VAL B N   1 
ATOM   2780 C CA  . VAL B 1 175 ? 54.355 14.721 57.073 1.00 26.61  ? 349  VAL B CA  1 
ATOM   2781 C C   . VAL B 1 175 ? 55.121 13.849 58.050 1.00 32.57  ? 349  VAL B C   1 
ATOM   2782 O O   . VAL B 1 175 ? 54.875 13.935 59.251 1.00 32.83  ? 349  VAL B O   1 
ATOM   2783 C CB  . VAL B 1 175 ? 54.800 16.209 57.089 1.00 30.84  ? 349  VAL B CB  1 
ATOM   2784 C CG1 . VAL B 1 175 ? 56.298 16.355 56.804 1.00 30.51  ? 349  VAL B CG1 1 
ATOM   2785 C CG2 . VAL B 1 175 ? 53.992 17.025 56.079 1.00 30.82  ? 349  VAL B CG2 1 
ATOM   2786 N N   . TYR B 1 176 ? 56.011 12.993 57.539 1.00 28.97  ? 350  TYR B N   1 
ATOM   2787 C CA  . TYR B 1 176 ? 56.821 12.092 58.342 1.00 28.78  ? 350  TYR B CA  1 
ATOM   2788 C C   . TYR B 1 176 ? 58.270 12.523 58.289 1.00 31.55  ? 350  TYR B C   1 
ATOM   2789 O O   . TYR B 1 176 ? 58.767 12.957 57.244 1.00 28.97  ? 350  TYR B O   1 
ATOM   2790 C CB  . TYR B 1 176 ? 56.713 10.640 57.845 1.00 30.86  ? 350  TYR B CB  1 
ATOM   2791 C CG  . TYR B 1 176 ? 55.325 10.065 57.958 1.00 34.06  ? 350  TYR B CG  1 
ATOM   2792 C CD1 . TYR B 1 176 ? 54.390 10.243 56.940 1.00 35.71  ? 350  TYR B CD1 1 
ATOM   2793 C CD2 . TYR B 1 176 ? 54.931 9.358  59.089 1.00 35.31  ? 350  TYR B CD2 1 
ATOM   2794 C CE1 . TYR B 1 176 ? 53.091 9.757  57.059 1.00 34.94  ? 350  TYR B CE1 1 
ATOM   2795 C CE2 . TYR B 1 176 ? 53.630 8.872  59.223 1.00 36.54  ? 350  TYR B CE2 1 
ATOM   2796 C CZ  . TYR B 1 176 ? 52.720 9.056  58.195 1.00 40.90  ? 350  TYR B CZ  1 
ATOM   2797 O OH  . TYR B 1 176 ? 51.444 8.556  58.310 1.00 39.19  ? 350  TYR B OH  1 
ATOM   2798 N N   . PHE B 1 177 ? 58.925 12.449 59.446 1.00 28.38  ? 351  PHE B N   1 
ATOM   2799 C CA  . PHE B 1 177 ? 60.342 12.757 59.599 1.00 27.83  ? 351  PHE B CA  1 
ATOM   2800 C C   . PHE B 1 177 ? 60.983 11.466 59.934 1.00 31.90  ? 351  PHE B C   1 
ATOM   2801 O O   . PHE B 1 177 ? 60.801 10.921 61.039 1.00 31.89  ? 351  PHE B O   1 
ATOM   2802 C CB  . PHE B 1 177 ? 60.596 13.803 60.705 1.00 28.53  ? 351  PHE B CB  1 
ATOM   2803 C CG  . PHE B 1 177 ? 59.890 15.092 60.407 1.00 30.70  ? 351  PHE B CG  1 
ATOM   2804 C CD1 . PHE B 1 177 ? 60.468 16.040 59.576 1.00 34.27  ? 351  PHE B CD1 1 
ATOM   2805 C CD2 . PHE B 1 177 ? 58.610 15.330 60.894 1.00 33.96  ? 351  PHE B CD2 1 
ATOM   2806 C CE1 . PHE B 1 177 ? 59.790 17.231 59.272 1.00 36.78  ? 351  PHE B CE1 1 
ATOM   2807 C CE2 . PHE B 1 177 ? 57.926 16.509 60.570 1.00 37.43  ? 351  PHE B CE2 1 
ATOM   2808 C CZ  . PHE B 1 177 ? 58.526 17.458 59.777 1.00 35.14  ? 351  PHE B CZ  1 
ATOM   2809 N N   . LEU B 1 178 ? 61.700 10.935 58.952 1.00 27.63  ? 352  LEU B N   1 
ATOM   2810 C CA  . LEU B 1 178 ? 62.389 9.665  59.045 1.00 29.81  ? 352  LEU B CA  1 
ATOM   2811 C C   . LEU B 1 178 ? 63.699 9.930  59.751 1.00 32.76  ? 352  LEU B C   1 
ATOM   2812 O O   . LEU B 1 178 ? 64.490 10.736 59.283 1.00 30.62  ? 352  LEU B O   1 
ATOM   2813 C CB  . LEU B 1 178 ? 62.665 9.125  57.637 1.00 31.07  ? 352  LEU B CB  1 
ATOM   2814 C CG  . LEU B 1 178 ? 61.507 9.112  56.665 1.00 38.01  ? 352  LEU B CG  1 
ATOM   2815 C CD1 . LEU B 1 178 ? 61.979 8.629  55.306 1.00 39.17  ? 352  LEU B CD1 1 
ATOM   2816 C CD2 . LEU B 1 178 ? 60.327 8.297  57.220 1.00 40.08  ? 352  LEU B CD2 1 
ATOM   2817 N N   . LEU B 1 179 ? 63.873 9.326  60.923 1.00 30.81  ? 353  LEU B N   1 
ATOM   2818 C CA  . LEU B 1 179 ? 65.032 9.526  61.785 1.00 30.35  ? 353  LEU B CA  1 
ATOM   2819 C C   . LEU B 1 179 ? 65.606 8.200  62.179 1.00 37.18  ? 353  LEU B C   1 
ATOM   2820 O O   . LEU B 1 179 ? 64.869 7.236  62.355 1.00 37.84  ? 353  LEU B O   1 
ATOM   2821 C CB  . LEU B 1 179 ? 64.631 10.341 63.040 1.00 29.36  ? 353  LEU B CB  1 
ATOM   2822 C CG  . LEU B 1 179 ? 64.159 11.783 62.766 1.00 32.83  ? 353  LEU B CG  1 
ATOM   2823 C CD1 . LEU B 1 179 ? 63.509 12.402 63.977 1.00 34.00  ? 353  LEU B CD1 1 
ATOM   2824 C CD2 . LEU B 1 179 ? 65.300 12.670 62.322 1.00 32.20  ? 353  LEU B CD2 1 
ATOM   2825 N N   . PHE B 1 180 ? 66.924 8.149  62.311 1.00 38.77  ? 354  PHE B N   1 
ATOM   2826 C CA  . PHE B 1 180 ? 67.631 6.914  62.619 1.00 40.80  ? 354  PHE B CA  1 
ATOM   2827 C C   . PHE B 1 180 ? 68.225 6.921  64.030 1.00 43.04  ? 354  PHE B C   1 
ATOM   2828 O O   . PHE B 1 180 ? 67.871 6.075  64.854 1.00 45.49  ? 354  PHE B O   1 
ATOM   2829 C CB  . PHE B 1 180 ? 68.715 6.633  61.544 1.00 44.24  ? 354  PHE B CB  1 
ATOM   2830 C CG  . PHE B 1 180 ? 68.324 6.796  60.084 1.00 47.86  ? 354  PHE B CG  1 
ATOM   2831 C CD1 . PHE B 1 180 ? 67.106 6.318  59.612 1.00 51.84  ? 354  PHE B CD1 1 
ATOM   2832 C CD2 . PHE B 1 180 ? 69.202 7.364  59.173 1.00 51.84  ? 354  PHE B CD2 1 
ATOM   2833 C CE1 . PHE B 1 180 ? 66.751 6.458  58.266 1.00 53.55  ? 354  PHE B CE1 1 
ATOM   2834 C CE2 . PHE B 1 180 ? 68.851 7.491  57.824 1.00 55.05  ? 354  PHE B CE2 1 
ATOM   2835 C CZ  . PHE B 1 180 ? 67.623 7.051  57.384 1.00 52.67  ? 354  PHE B CZ  1 
ATOM   2836 N N   . ASP B 1 181 ? 69.085 7.892  64.314 1.00 35.73  ? 355  ASP B N   1 
ATOM   2837 C CA  . ASP B 1 181 ? 69.790 7.990  65.592 1.00 33.68  ? 355  ASP B CA  1 
ATOM   2838 C C   . ASP B 1 181 ? 69.005 8.687  66.718 1.00 32.98  ? 355  ASP B C   1 
ATOM   2839 O O   . ASP B 1 181 ? 68.191 9.572  66.458 1.00 29.23  ? 355  ASP B O   1 
ATOM   2840 C CB  . ASP B 1 181 ? 71.146 8.665  65.378 1.00 34.67  ? 355  ASP B CB  1 
ATOM   2841 C CG  . ASP B 1 181 ? 71.017 10.124 65.050 1.00 43.32  ? 355  ASP B CG  1 
ATOM   2842 O OD1 . ASP B 1 181 ? 70.626 10.438 63.912 1.00 46.55  ? 355  ASP B OD1 1 
ATOM   2843 O OD2 . ASP B 1 181 ? 71.300 10.956 65.938 1.00 40.42  ? 355  ASP B OD2 1 
ATOM   2844 N N   . SER B 1 182 ? 69.291 8.291  67.977 1.00 29.15  ? 356  SER B N   1 
ATOM   2845 C CA  . SER B 1 182 ? 68.647 8.827  69.193 1.00 26.95  ? 356  SER B CA  1 
ATOM   2846 C C   . SER B 1 182 ? 68.817 10.315 69.361 1.00 27.52  ? 356  SER B C   1 
ATOM   2847 O O   . SER B 1 182 ? 67.857 10.989 69.745 1.00 27.20  ? 356  SER B O   1 
ATOM   2848 C CB  . SER B 1 182 ? 69.138 8.084  70.428 1.00 31.52  ? 356  SER B CB  1 
ATOM   2849 O OG  . SER B 1 182 ? 68.856 6.699  70.292 1.00 34.84  ? 356  SER B OG  1 
ATOM   2850 N N   . GLU B 1 183 ? 70.032 10.837 69.122 1.00 25.42  ? 357  GLU B N   1 
ATOM   2851 C CA  . GLU B 1 183 ? 70.266 12.269 69.278 1.00 23.99  ? 357  GLU B CA  1 
ATOM   2852 C C   . GLU B 1 183 ? 69.349 13.069 68.351 1.00 28.64  ? 357  GLU B C   1 
ATOM   2853 O O   . GLU B 1 183 ? 68.716 14.021 68.809 1.00 27.68  ? 357  GLU B O   1 
ATOM   2854 C CB  . GLU B 1 183 ? 71.735 12.636 69.042 1.00 24.67  ? 357  GLU B CB  1 
ATOM   2855 C CG  . GLU B 1 183 ? 72.030 14.109 69.337 1.00 28.43  ? 357  GLU B CG  1 
ATOM   2856 C CD  . GLU B 1 183 ? 73.287 14.711 68.731 1.00 49.49  ? 357  GLU B CD  1 
ATOM   2857 O OE1 . GLU B 1 183 ? 73.795 14.188 67.708 1.00 41.63  ? 357  GLU B OE1 1 
ATOM   2858 O OE2 . GLU B 1 183 ? 73.749 15.739 69.275 1.00 36.61  ? 357  GLU B OE2 1 
ATOM   2859 N N   . SER B 1 184 ? 69.275 12.693 67.053 1.00 24.94  ? 358  SER B N   1 
ATOM   2860 C CA  . SER B 1 184 ? 68.379 13.393 66.113 1.00 22.51  ? 358  SER B CA  1 
ATOM   2861 C C   . SER B 1 184 ? 66.936 13.321 66.613 1.00 26.22  ? 358  SER B C   1 
ATOM   2862 O O   . SER B 1 184 ? 66.249 14.335 66.575 1.00 25.81  ? 358  SER B O   1 
ATOM   2863 C CB  . SER B 1 184 ? 68.458 12.789 64.707 1.00 25.95  ? 358  SER B CB  1 
ATOM   2864 O OG  . SER B 1 184 ? 69.757 12.973 64.170 1.00 30.58  ? 358  SER B OG  1 
ATOM   2865 N N   . ILE B 1 185 ? 66.501 12.143 67.129 1.00 23.77  ? 359  ILE B N   1 
ATOM   2866 C CA  . ILE B 1 185 ? 65.146 11.968 67.656 1.00 23.19  ? 359  ILE B CA  1 
ATOM   2867 C C   . ILE B 1 185 ? 64.908 12.936 68.777 1.00 26.70  ? 359  ILE B C   1 
ATOM   2868 O O   . ILE B 1 185 ? 63.882 13.618 68.757 1.00 24.62  ? 359  ILE B O   1 
ATOM   2869 C CB  . ILE B 1 185 ? 64.805 10.498 68.028 1.00 26.30  ? 359  ILE B CB  1 
ATOM   2870 C CG1 . ILE B 1 185 ? 64.742 9.633  66.756 1.00 26.40  ? 359  ILE B CG1 1 
ATOM   2871 C CG2 . ILE B 1 185 ? 63.462 10.392 68.763 1.00 26.55  ? 359  ILE B CG2 1 
ATOM   2872 C CD1 . ILE B 1 185 ? 64.966 8.126  67.013 1.00 25.30  ? 359  ILE B CD1 1 
ATOM   2873 N N   . GLY B 1 186 ? 65.832 12.996 69.746 1.00 23.09  ? 360  GLY B N   1 
ATOM   2874 C CA  . GLY B 1 186 ? 65.682 13.918 70.862 1.00 21.73  ? 360  GLY B CA  1 
ATOM   2875 C C   . GLY B 1 186 ? 65.607 15.362 70.394 1.00 23.80  ? 360  GLY B C   1 
ATOM   2876 O O   . GLY B 1 186 ? 64.795 16.130 70.891 1.00 20.74  ? 360  GLY B O   1 
ATOM   2877 N N   . ILE B 1 187 ? 66.490 15.767 69.474 1.00 21.77  ? 361  ILE B N   1 
ATOM   2878 C CA  . ILE B 1 187 ? 66.496 17.155 68.945 1.00 22.17  ? 361  ILE B CA  1 
ATOM   2879 C C   . ILE B 1 187 ? 65.144 17.530 68.322 1.00 26.11  ? 361  ILE B C   1 
ATOM   2880 O O   . ILE B 1 187 ? 64.611 18.620 68.596 1.00 23.37  ? 361  ILE B O   1 
ATOM   2881 C CB  . ILE B 1 187 ? 67.703 17.426 67.973 1.00 25.54  ? 361  ILE B CB  1 
ATOM   2882 C CG1 . ILE B 1 187 ? 69.041 17.496 68.764 1.00 26.31  ? 361  ILE B CG1 1 
ATOM   2883 C CG2 . ILE B 1 187 ? 67.500 18.755 67.185 1.00 26.32  ? 361  ILE B CG2 1 
ATOM   2884 C CD1 . ILE B 1 187 ? 70.286 17.300 67.941 1.00 29.07  ? 361  ILE B CD1 1 
ATOM   2885 N N   A TYR B 1 188 ? 64.613 16.653 67.447 0.50 24.77  ? 362  TYR B N   1 
ATOM   2886 N N   B TYR B 1 188 ? 64.606 16.635 67.480 0.50 24.64  ? 362  TYR B N   1 
ATOM   2887 C CA  A TYR B 1 188 ? 63.324 16.879 66.771 0.50 25.07  ? 362  TYR B CA  1 
ATOM   2888 C CA  B TYR B 1 188 ? 63.317 16.836 66.809 0.50 24.90  ? 362  TYR B CA  1 
ATOM   2889 C C   A TYR B 1 188 ? 62.159 16.889 67.784 0.50 27.43  ? 362  TYR B C   1 
ATOM   2890 C C   B TYR B 1 188 ? 62.180 16.903 67.815 0.50 27.21  ? 362  TYR B C   1 
ATOM   2891 O O   A TYR B 1 188 ? 61.299 17.766 67.702 0.50 25.99  ? 362  TYR B O   1 
ATOM   2892 O O   B TYR B 1 188 ? 61.350 17.809 67.746 0.50 25.52  ? 362  TYR B O   1 
ATOM   2893 C CB  A TYR B 1 188 ? 63.118 15.892 65.595 0.50 26.68  ? 362  TYR B CB  1 
ATOM   2894 C CB  B TYR B 1 188 ? 63.072 15.740 65.761 0.50 26.41  ? 362  TYR B CB  1 
ATOM   2895 C CG  A TYR B 1 188 ? 63.846 16.304 64.328 0.50 27.46  ? 362  TYR B CG  1 
ATOM   2896 C CG  B TYR B 1 188 ? 63.126 16.283 64.355 0.50 27.11  ? 362  TYR B CG  1 
ATOM   2897 C CD1 A TYR B 1 188 ? 65.176 15.959 64.119 0.50 29.04  ? 362  TYR B CD1 1 
ATOM   2898 C CD1 B TYR B 1 188 ? 64.325 16.325 63.649 0.50 28.01  ? 362  TYR B CD1 1 
ATOM   2899 C CD2 A TYR B 1 188 ? 63.196 17.030 63.332 0.50 28.12  ? 362  TYR B CD2 1 
ATOM   2900 C CD2 B TYR B 1 188 ? 61.997 16.837 63.757 0.50 27.53  ? 362  TYR B CD2 1 
ATOM   2901 C CE1 A TYR B 1 188 ? 65.858 16.354 62.967 0.50 29.18  ? 362  TYR B CE1 1 
ATOM   2902 C CE1 B TYR B 1 188 ? 64.386 16.856 62.361 0.50 27.74  ? 362  TYR B CE1 1 
ATOM   2903 C CE2 A TYR B 1 188 ? 63.859 17.408 62.164 0.50 28.51  ? 362  TYR B CE2 1 
ATOM   2904 C CE2 B TYR B 1 188 ? 62.045 17.363 62.470 0.50 28.18  ? 362  TYR B CE2 1 
ATOM   2905 C CZ  A TYR B 1 188 ? 65.192 17.071 61.986 0.50 35.64  ? 362  TYR B CZ  1 
ATOM   2906 C CZ  B TYR B 1 188 ? 63.243 17.378 61.777 0.50 35.86  ? 362  TYR B CZ  1 
ATOM   2907 O OH  A TYR B 1 188 ? 65.853 17.481 60.849 0.50 33.31  ? 362  TYR B OH  1 
ATOM   2908 O OH  B TYR B 1 188 ? 63.286 17.909 60.510 0.50 35.01  ? 362  TYR B OH  1 
ATOM   2909 N N   . VAL B 1 189 ? 62.192 15.998 68.805 1.00 24.28  ? 363  VAL B N   1 
ATOM   2910 C CA  . VAL B 1 189 ? 61.157 15.973 69.879 1.00 22.86  ? 363  VAL B CA  1 
ATOM   2911 C C   . VAL B 1 189 ? 61.183 17.295 70.656 1.00 24.89  ? 363  VAL B C   1 
ATOM   2912 O O   . VAL B 1 189 ? 60.122 17.907 70.887 1.00 22.80  ? 363  VAL B O   1 
ATOM   2913 C CB  . VAL B 1 189 ? 61.342 14.726 70.794 1.00 27.85  ? 363  VAL B CB  1 
ATOM   2914 C CG1 . VAL B 1 189 ? 60.588 14.842 72.107 1.00 28.26  ? 363  VAL B CG1 1 
ATOM   2915 C CG2 . VAL B 1 189 ? 60.940 13.465 70.064 1.00 27.11  ? 363  VAL B CG2 1 
ATOM   2916 N N   . GLN B 1 190 ? 62.402 17.786 70.982 1.00 21.39  ? 364  GLN B N   1 
ATOM   2917 C CA  . GLN B 1 190 ? 62.567 19.074 71.678 1.00 20.98  ? 364  GLN B CA  1 
ATOM   2918 C C   . GLN B 1 190 ? 62.079 20.262 70.849 1.00 25.53  ? 364  GLN B C   1 
ATOM   2919 O O   . GLN B 1 190 ? 61.432 21.160 71.393 1.00 24.30  ? 364  GLN B O   1 
ATOM   2920 C CB  . GLN B 1 190 ? 64.026 19.266 72.063 1.00 22.80  ? 364  GLN B CB  1 
ATOM   2921 C CG  . GLN B 1 190 ? 64.441 18.470 73.275 1.00 21.68  ? 364  GLN B CG  1 
ATOM   2922 C CD  . GLN B 1 190 ? 65.951 18.526 73.420 1.00 26.94  ? 364  GLN B CD  1 
ATOM   2923 O OE1 . GLN B 1 190 ? 66.699 18.225 72.503 1.00 28.08  ? 364  GLN B OE1 1 
ATOM   2924 N NE2 . GLN B 1 190 ? 66.438 18.898 74.579 1.00 28.25  ? 364  GLN B NE2 1 
ATOM   2925 N N   . GLU B 1 191 ? 62.332 20.243 69.528 1.00 23.00  ? 365  GLU B N   1 
ATOM   2926 C CA  . GLU B 1 191 ? 61.879 21.335 68.667 1.00 23.09  ? 365  GLU B CA  1 
ATOM   2927 C C   . GLU B 1 191 ? 60.360 21.275 68.433 1.00 27.66  ? 365  GLU B C   1 
ATOM   2928 O O   . GLU B 1 191 ? 59.697 22.303 68.472 1.00 27.58  ? 365  GLU B O   1 
ATOM   2929 C CB  . GLU B 1 191 ? 62.643 21.378 67.333 1.00 25.25  ? 365  GLU B CB  1 
ATOM   2930 C CG  . GLU B 1 191 ? 64.138 21.684 67.449 1.00 31.90  ? 365  GLU B CG  1 
ATOM   2931 C CD  . GLU B 1 191 ? 64.591 22.949 68.156 1.00 47.17  ? 365  GLU B CD  1 
ATOM   2932 O OE1 . GLU B 1 191 ? 63.858 23.963 68.125 1.00 35.91  ? 365  GLU B OE1 1 
ATOM   2933 O OE2 . GLU B 1 191 ? 65.707 22.933 68.722 1.00 54.11  ? 365  GLU B OE2 1 
ATOM   2934 N N   . MET B 1 192 ? 59.803 20.077 68.245 1.00 24.76  ? 366  MET B N   1 
ATOM   2935 C CA  . MET B 1 192 ? 58.348 19.944 68.077 1.00 25.27  ? 366  MET B CA  1 
ATOM   2936 C C   . MET B 1 192 ? 57.539 20.395 69.297 1.00 31.68  ? 366  MET B C   1 
ATOM   2937 O O   . MET B 1 192 ? 56.419 20.880 69.121 1.00 30.58  ? 366  MET B O   1 
ATOM   2938 C CB  . MET B 1 192 ? 57.978 18.530 67.720 1.00 28.40  ? 366  MET B CB  1 
ATOM   2939 C CG  . MET B 1 192 ? 58.155 18.250 66.295 1.00 34.68  ? 366  MET B CG  1 
ATOM   2940 S SD  . MET B 1 192 ? 58.037 16.502 66.061 1.00 41.11  ? 366  MET B SD  1 
ATOM   2941 C CE  . MET B 1 192 ? 56.342 16.308 65.924 1.00 34.47  ? 366  MET B CE  1 
ATOM   2942 N N   . ALA B 1 193 ? 58.091 20.242 70.535 1.00 29.89  ? 367  ALA B N   1 
ATOM   2943 C CA  . ALA B 1 193 ? 57.423 20.655 71.782 1.00 29.59  ? 367  ALA B CA  1 
ATOM   2944 C C   . ALA B 1 193 ? 57.110 22.140 71.842 1.00 36.88  ? 367  ALA B C   1 
ATOM   2945 O O   . ALA B 1 193 ? 56.296 22.549 72.674 1.00 36.88  ? 367  ALA B O   1 
ATOM   2946 C CB  . ALA B 1 193 ? 58.242 20.243 72.999 1.00 29.48  ? 367  ALA B CB  1 
ATOM   2947 N N   . LYS B 1 194 ? 57.746 22.950 70.967 1.00 33.85  ? 368  LYS B N   1 
ATOM   2948 C CA  . LYS B 1 194 ? 57.521 24.405 70.903 1.00 34.89  ? 368  LYS B CA  1 
ATOM   2949 C C   . LYS B 1 194 ? 56.287 24.813 70.047 1.00 40.67  ? 368  LYS B C   1 
ATOM   2950 O O   . LYS B 1 194 ? 55.696 25.870 70.264 1.00 40.30  ? 368  LYS B O   1 
ATOM   2951 C CB  . LYS B 1 194 ? 58.789 25.126 70.423 1.00 36.73  ? 368  LYS B CB  1 
ATOM   2952 C CG  . LYS B 1 194 ? 59.957 24.926 71.379 1.00 43.36  ? 368  LYS B CG  1 
ATOM   2953 C CD  . LYS B 1 194 ? 61.300 25.299 70.783 1.00 45.94  ? 368  LYS B CD  1 
ATOM   2954 C CE  . LYS B 1 194 ? 62.404 24.856 71.717 1.00 56.82  ? 368  LYS B CE  1 
ATOM   2955 N NZ  . LYS B 1 194 ? 63.753 25.177 71.189 1.00 67.44  ? 368  LYS B NZ  1 
ATOM   2956 N N   . LEU B 1 195 ? 55.919 23.996 69.069 1.00 38.58  ? 369  LEU B N   1 
ATOM   2957 C CA  . LEU B 1 195 ? 54.815 24.289 68.140 1.00 37.36  ? 369  LEU B CA  1 
ATOM   2958 C C   . LEU B 1 195 ? 53.419 24.300 68.797 1.00 42.81  ? 369  LEU B C   1 
ATOM   2959 O O   . LEU B 1 195 ? 53.133 23.469 69.662 1.00 41.63  ? 369  LEU B O   1 
ATOM   2960 C CB  . LEU B 1 195 ? 54.806 23.245 67.010 1.00 36.80  ? 369  LEU B CB  1 
ATOM   2961 C CG  . LEU B 1 195 ? 56.091 23.021 66.200 1.00 40.74  ? 369  LEU B CG  1 
ATOM   2962 C CD1 . LEU B 1 195 ? 55.984 21.752 65.419 1.00 40.47  ? 369  LEU B CD1 1 
ATOM   2963 C CD2 . LEU B 1 195 ? 56.363 24.171 65.251 1.00 43.62  ? 369  LEU B CD2 1 
ATOM   2964 N N   . ASP B 1 196 ? 52.537 25.225 68.363 1.00 39.23  ? 370  ASP B N   1 
ATOM   2965 C CA  . ASP B 1 196 ? 51.153 25.251 68.807 1.00 38.70  ? 370  ASP B CA  1 
ATOM   2966 C C   . ASP B 1 196 ? 50.480 24.096 68.064 1.00 41.94  ? 370  ASP B C   1 
ATOM   2967 O O   . ASP B 1 196 ? 50.749 23.904 66.869 1.00 41.32  ? 370  ASP B O   1 
ATOM   2968 C CB  . ASP B 1 196 ? 50.485 26.606 68.446 1.00 40.55  ? 370  ASP B CB  1 
ATOM   2969 C CG  . ASP B 1 196 ? 50.681 27.718 69.476 1.00 50.56  ? 370  ASP B CG  1 
ATOM   2970 O OD1 . ASP B 1 196 ? 50.663 27.418 70.685 1.00 51.80  ? 370  ASP B OD1 1 
ATOM   2971 O OD2 . ASP B 1 196 ? 50.823 28.893 69.068 1.00 52.29  ? 370  ASP B OD2 1 
ATOM   2972 N N   . ALA B 1 197 ? 49.665 23.287 68.778 1.00 38.39  ? 371  ALA B N   1 
ATOM   2973 C CA  . ALA B 1 197 ? 48.966 22.132 68.214 1.00 37.93  ? 371  ALA B CA  1 
ATOM   2974 C C   . ALA B 1 197 ? 47.723 21.769 69.035 1.00 42.17  ? 371  ALA B C   1 
ATOM   2975 O O   . ALA B 1 197 ? 47.239 22.587 69.824 1.00 44.16  ? 371  ALA B O   1 
ATOM   2976 C CB  . ALA B 1 197 ? 49.911 20.941 68.112 1.00 38.45  ? 371  ALA B CB  1 
ATOM   2977 N N   . LYS B 1 198 ? 47.184 20.571 68.817 1.00 36.20  ? 372  LYS B N   1 
ATOM   2978 C CA  . LYS B 1 198 ? 46.002 20.078 69.511 1.00 39.46  ? 372  LYS B CA  1 
ATOM   2979 C C   . LYS B 1 198 ? 46.454 19.348 70.776 1.00 47.46  ? 372  LYS B C   1 
ATOM   2980 O O   . LYS B 1 198 ? 47.563 18.762 70.761 1.00 49.72  ? 372  LYS B O   1 
ATOM   2981 C CB  . LYS B 1 198 ? 45.160 19.166 68.587 1.00 41.96  ? 372  LYS B CB  1 
ATOM   2982 C CG  . LYS B 1 198 ? 44.622 19.879 67.328 1.00 52.96  ? 372  LYS B CG  1 
ATOM   2983 C CD  . LYS B 1 198 ? 43.799 18.936 66.450 1.00 62.69  ? 372  LYS B CD  1 
ATOM   2984 C CE  . LYS B 1 198 ? 43.478 19.507 65.081 1.00 72.38  ? 372  LYS B CE  1 
ATOM   2985 N NZ  . LYS B 1 198 ? 42.373 20.499 65.102 1.00 79.13  ? 372  LYS B NZ  1 
ATOM   2986 O OXT . LYS B 1 198 ? 45.732 19.404 71.793 1.00 62.18  ? 372  LYS B OXT 1 
HETATM 2987 C C   . ACT C 2 .   ? 29.749 13.912 83.487 1.00 75.92  ? 1000 ACT A C   1 
HETATM 2988 O O   . ACT C 2 .   ? 29.311 13.871 82.315 1.00 75.80  ? 1000 ACT A O   1 
HETATM 2989 O OXT . ACT C 2 .   ? 30.914 14.252 83.803 1.00 76.21  ? 1000 ACT A OXT 1 
HETATM 2990 C CH3 . ACT C 2 .   ? 28.790 13.513 84.629 1.00 75.13  ? 1000 ACT A CH3 1 
HETATM 2991 C C1  . EDO D 3 .   ? 29.181 29.271 82.957 1.00 36.63  ? 1001 EDO A C1  1 
HETATM 2992 O O1  . EDO D 3 .   ? 28.226 29.574 83.965 1.00 36.66  ? 1001 EDO A O1  1 
HETATM 2993 C C2  . EDO D 3 .   ? 30.423 30.165 83.158 1.00 35.12  ? 1001 EDO A C2  1 
HETATM 2994 O O2  . EDO D 3 .   ? 30.010 31.495 83.012 1.00 36.18  ? 1001 EDO A O2  1 
HETATM 2995 C C   . ACT E 2 .   ? 75.181 30.887 59.707 1.00 68.81  ? 1000 ACT B C   1 
HETATM 2996 O O   . ACT E 2 .   ? 75.984 30.276 58.969 1.00 68.45  ? 1000 ACT B O   1 
HETATM 2997 O OXT . ACT E 2 .   ? 74.006 31.190 59.397 1.00 69.26  ? 1000 ACT B OXT 1 
HETATM 2998 C CH3 . ACT E 2 .   ? 75.677 31.296 61.107 1.00 68.91  ? 1000 ACT B CH3 1 
HETATM 2999 C C1  . EDO F 3 .   ? 63.913 14.158 59.147 1.00 46.76  ? 1001 EDO B C1  1 
HETATM 3000 O O1  . EDO F 3 .   ? 65.082 13.378 59.109 1.00 48.59  ? 1001 EDO B O1  1 
HETATM 3001 C C2  . EDO F 3 .   ? 64.076 15.434 58.308 1.00 46.78  ? 1001 EDO B C2  1 
HETATM 3002 O O2  . EDO F 3 .   ? 65.439 15.793 58.243 1.00 47.50  ? 1001 EDO B O2  1 
HETATM 3003 C C1  . EDO G 3 .   ? 68.286 14.069 61.033 1.00 55.13  ? 1002 EDO B C1  1 
HETATM 3004 O O1  . EDO G 3 .   ? 69.455 13.354 61.380 1.00 53.31  ? 1002 EDO B O1  1 
HETATM 3005 C C2  . EDO G 3 .   ? 68.630 15.539 60.707 1.00 58.68  ? 1002 EDO B C2  1 
HETATM 3006 O O2  . EDO G 3 .   ? 67.771 15.997 59.674 1.00 60.09  ? 1002 EDO B O2  1 
HETATM 3007 O O   . HOH H 4 .   ? 48.709 16.979 79.091 1.00 50.82  ? 1101 HOH A O   1 
HETATM 3008 O O   . HOH H 4 .   ? 42.249 46.154 83.625 1.00 116.97 ? 1102 HOH A O   1 
HETATM 3009 O O   . HOH H 4 .   ? 21.896 35.211 93.385 1.00 28.71  ? 1103 HOH A O   1 
HETATM 3010 O O   . HOH H 4 .   ? 54.258 21.029 73.321 1.00 44.30  ? 1104 HOH A O   1 
HETATM 3011 O O   . HOH H 4 .   ? 33.579 44.571 87.386 1.00 45.86  ? 1105 HOH A O   1 
HETATM 3012 O O   . HOH H 4 .   ? 47.924 25.358 77.448 1.00 31.62  ? 1106 HOH A O   1 
HETATM 3013 O O   . HOH H 4 .   ? 22.301 32.793 72.115 1.00 42.26  ? 1107 HOH A O   1 
HETATM 3014 O O   . HOH H 4 .   ? 38.095 45.318 87.696 1.00 36.22  ? 1108 HOH A O   1 
HETATM 3015 O O   . HOH H 4 .   ? 32.029 39.089 61.467 1.00 60.35  ? 1109 HOH A O   1 
HETATM 3016 O O   . HOH H 4 .   ? 41.184 47.767 87.845 1.00 39.64  ? 1110 HOH A O   1 
HETATM 3017 O O   . HOH H 4 .   ? 38.558 15.948 84.398 1.00 38.39  ? 1111 HOH A O   1 
HETATM 3018 O O   . HOH H 4 .   ? 44.256 36.433 79.595 1.00 37.01  ? 1112 HOH A O   1 
HETATM 3019 O O   . HOH H 4 .   ? 37.265 37.610 95.852 1.00 32.31  ? 1113 HOH A O   1 
HETATM 3020 O O   . HOH H 4 .   ? 21.733 38.223 90.064 1.00 31.06  ? 1114 HOH A O   1 
HETATM 3021 O O   . HOH H 4 .   ? 30.577 33.210 58.147 1.00 39.47  ? 1115 HOH A O   1 
HETATM 3022 O O   . HOH H 4 .   ? 23.545 36.092 80.874 1.00 37.57  ? 1116 HOH A O   1 
HETATM 3023 O O   . HOH H 4 .   ? 33.891 23.133 97.947 1.00 34.22  ? 1117 HOH A O   1 
HETATM 3024 O O   . HOH H 4 .   ? 30.747 30.492 56.865 1.00 45.66  ? 1118 HOH A O   1 
HETATM 3025 O O   . HOH H 4 .   ? 38.123 29.639 92.815 1.00 49.40  ? 1119 HOH A O   1 
HETATM 3026 O O   . HOH H 4 .   ? 17.047 11.565 79.820 1.00 52.83  ? 1120 HOH A O   1 
HETATM 3027 O O   . HOH H 4 .   ? 45.488 20.366 87.545 1.00 28.36  ? 1121 HOH A O   1 
HETATM 3028 O O   . HOH H 4 .   ? 28.176 26.523 84.496 1.00 59.00  ? 1122 HOH A O   1 
HETATM 3029 O O   . HOH H 4 .   ? 31.561 37.051 64.952 1.00 66.09  ? 1123 HOH A O   1 
HETATM 3030 O O   . HOH H 4 .   ? 15.284 20.865 79.240 1.00 31.60  ? 1124 HOH A O   1 
HETATM 3031 O O   . HOH H 4 .   ? 24.775 45.604 81.709 1.00 42.81  ? 1125 HOH A O   1 
HETATM 3032 O O   . HOH H 4 .   ? 38.357 45.665 84.956 1.00 31.16  ? 1126 HOH A O   1 
HETATM 3033 O O   . HOH H 4 .   ? 45.733 33.503 67.040 1.00 55.70  ? 1127 HOH A O   1 
HETATM 3034 O O   . HOH H 4 .   ? 25.985 15.126 69.590 1.00 51.75  ? 1128 HOH A O   1 
HETATM 3035 O O   . HOH H 4 .   ? 27.304 7.227  77.061 1.00 37.69  ? 1129 HOH A O   1 
HETATM 3036 O O   . HOH H 4 .   ? 26.300 7.116  81.336 1.00 49.05  ? 1130 HOH A O   1 
HETATM 3037 O O   . HOH H 4 .   ? 29.994 45.392 73.839 1.00 40.88  ? 1131 HOH A O   1 
HETATM 3038 O O   . HOH H 4 .   ? 39.302 46.708 76.043 1.00 51.23  ? 1132 HOH A O   1 
HETATM 3039 O O   . HOH H 4 .   ? 44.499 28.962 63.235 1.00 48.30  ? 1133 HOH A O   1 
HETATM 3040 O O   . HOH H 4 .   ? 5.690  23.334 80.976 1.00 37.98  ? 1134 HOH A O   1 
HETATM 3041 O O   . HOH H 4 .   ? 54.655 21.059 75.911 1.00 27.64  ? 1135 HOH A O   1 
HETATM 3042 O O   . HOH H 4 .   ? 23.355 31.985 75.234 1.00 61.27  ? 1136 HOH A O   1 
HETATM 3043 O O   . HOH H 4 .   ? 46.419 34.275 77.854 1.00 41.79  ? 1137 HOH A O   1 
HETATM 3044 O O   . HOH H 4 .   ? 15.563 28.112 85.213 1.00 62.80  ? 1138 HOH A O   1 
HETATM 3045 O O   . HOH H 4 .   ? 23.546 19.367 60.812 1.00 33.44  ? 1139 HOH A O   1 
HETATM 3046 O O   . HOH H 4 .   ? 29.077 28.905 78.646 1.00 42.63  ? 1140 HOH A O   1 
HETATM 3047 O O   . HOH H 4 .   ? 32.188 47.644 75.616 1.00 47.65  ? 1141 HOH A O   1 
HETATM 3048 O O   . HOH H 4 .   ? 41.181 13.155 79.944 1.00 47.62  ? 1142 HOH A O   1 
HETATM 3049 O O   . HOH H 4 .   ? 43.386 37.561 77.190 1.00 34.20  ? 1143 HOH A O   1 
HETATM 3050 O O   . HOH H 4 .   ? 39.751 15.269 77.392 1.00 56.33  ? 1144 HOH A O   1 
HETATM 3051 O O   . HOH H 4 .   ? 20.518 24.345 72.994 1.00 39.38  ? 1145 HOH A O   1 
HETATM 3052 O O   . HOH H 4 .   ? 25.507 40.295 91.883 1.00 36.24  ? 1146 HOH A O   1 
HETATM 3053 O O   . HOH H 4 .   ? 38.264 27.081 65.102 1.00 46.18  ? 1147 HOH A O   1 
HETATM 3054 O O   . HOH H 4 .   ? 50.129 29.619 74.586 1.00 46.82  ? 1148 HOH A O   1 
HETATM 3055 O O   . HOH H 4 .   ? 41.932 21.244 68.893 1.00 39.17  ? 1149 HOH A O   1 
HETATM 3056 O O   . HOH H 4 .   ? 30.012 41.185 67.960 1.00 40.73  ? 1150 HOH A O   1 
HETATM 3057 O O   . HOH H 4 .   ? 48.870 29.617 85.873 1.00 46.64  ? 1151 HOH A O   1 
HETATM 3058 O O   . HOH H 4 .   ? 20.275 41.258 77.674 1.00 56.90  ? 1152 HOH A O   1 
HETATM 3059 O O   . HOH H 4 .   ? 22.754 16.336 88.425 1.00 52.79  ? 1153 HOH A O   1 
HETATM 3060 O O   . HOH H 4 .   ? 31.611 13.036 77.458 1.00 45.79  ? 1154 HOH A O   1 
HETATM 3061 O O   . HOH H 4 .   ? 46.477 34.140 69.678 1.00 55.27  ? 1155 HOH A O   1 
HETATM 3062 O O   . HOH H 4 .   ? 39.361 17.448 74.556 1.00 38.23  ? 1156 HOH A O   1 
HETATM 3063 O O   . HOH H 4 .   ? 20.569 32.515 91.400 1.00 42.11  ? 1157 HOH A O   1 
HETATM 3064 O O   . HOH H 4 .   ? 19.322 20.408 71.560 1.00 33.48  ? 1158 HOH A O   1 
HETATM 3065 O O   . HOH H 4 .   ? 35.946 41.315 73.115 1.00 32.57  ? 1159 HOH A O   1 
HETATM 3066 O O   . HOH H 4 .   ? 31.534 41.806 91.704 1.00 48.42  ? 1160 HOH A O   1 
HETATM 3067 O O   . HOH H 4 .   ? 49.621 26.185 79.867 1.00 34.88  ? 1161 HOH A O   1 
HETATM 3068 O O   . HOH H 4 .   ? 21.320 19.785 64.533 1.00 39.66  ? 1162 HOH A O   1 
HETATM 3069 O O   . HOH H 4 .   ? 10.884 22.105 79.045 1.00 47.35  ? 1163 HOH A O   1 
HETATM 3070 O O   . HOH H 4 .   ? 23.827 32.493 77.839 1.00 46.71  ? 1164 HOH A O   1 
HETATM 3071 O O   . HOH H 4 .   ? 37.822 40.826 63.259 1.00 56.37  ? 1165 HOH A O   1 
HETATM 3072 O O   . HOH H 4 .   ? 27.992 23.945 94.737 1.00 44.45  ? 1166 HOH A O   1 
HETATM 3073 O O   . HOH H 4 .   ? 18.521 22.734 79.292 1.00 39.84  ? 1167 HOH A O   1 
HETATM 3074 O O   . HOH H 4 .   ? 32.752 21.046 67.176 1.00 45.18  ? 1168 HOH A O   1 
HETATM 3075 O O   . HOH H 4 .   ? 45.782 31.087 91.126 1.00 44.10  ? 1169 HOH A O   1 
HETATM 3076 O O   . HOH H 4 .   ? 26.192 26.603 86.374 1.00 42.93  ? 1170 HOH A O   1 
HETATM 3077 O O   . HOH H 4 .   ? 42.326 32.902 83.681 1.00 27.20  ? 1171 HOH A O   1 
HETATM 3078 O O   . HOH H 4 .   ? 22.726 16.591 66.882 1.00 39.79  ? 1172 HOH A O   1 
HETATM 3079 O O   . HOH H 4 .   ? 36.007 42.645 66.223 1.00 42.91  ? 1173 HOH A O   1 
HETATM 3080 O O   . HOH H 4 .   ? 48.434 30.770 82.699 1.00 44.69  ? 1174 HOH A O   1 
HETATM 3081 O O   . HOH H 4 .   ? 20.061 25.448 89.500 1.00 38.62  ? 1175 HOH A O   1 
HETATM 3082 O O   . HOH H 4 .   ? 29.599 25.902 80.846 1.00 48.28  ? 1176 HOH A O   1 
HETATM 3083 O O   . HOH H 4 .   ? 35.414 21.972 67.813 1.00 34.94  ? 1177 HOH A O   1 
HETATM 3084 O O   . HOH H 4 .   ? 19.658 18.471 73.423 1.00 39.25  ? 1178 HOH A O   1 
HETATM 3085 O O   . HOH H 4 .   ? 31.557 16.149 69.582 1.00 46.47  ? 1179 HOH A O   1 
HETATM 3086 O O   . HOH H 4 .   ? 21.121 42.951 70.010 1.00 46.94  ? 1180 HOH A O   1 
HETATM 3087 O O   . HOH H 4 .   ? 22.130 14.946 75.263 1.00 37.86  ? 1181 HOH A O   1 
HETATM 3088 O O   . HOH H 4 .   ? 34.160 28.649 60.577 1.00 61.26  ? 1182 HOH A O   1 
HETATM 3089 O O   . HOH H 4 .   ? 34.446 19.315 88.638 1.00 39.40  ? 1183 HOH A O   1 
HETATM 3090 O O   . HOH H 4 .   ? 39.472 47.963 78.947 1.00 46.39  ? 1184 HOH A O   1 
HETATM 3091 O O   . HOH H 4 .   ? 34.190 26.745 62.505 1.00 37.97  ? 1185 HOH A O   1 
HETATM 3092 O O   . HOH H 4 .   ? 39.425 38.880 64.340 1.00 54.36  ? 1186 HOH A O   1 
HETATM 3093 O O   . HOH H 4 .   ? 20.735 23.712 78.110 1.00 44.16  ? 1187 HOH A O   1 
HETATM 3094 O O   . HOH H 4 .   ? 20.099 33.303 58.322 1.00 43.44  ? 1188 HOH A O   1 
HETATM 3095 O O   . HOH H 4 .   ? 23.185 41.946 76.614 1.00 50.98  ? 1189 HOH A O   1 
HETATM 3096 O O   . HOH H 4 .   ? 29.038 16.994 67.960 1.00 43.36  ? 1190 HOH A O   1 
HETATM 3097 O O   . HOH H 4 .   ? 22.343 23.952 91.551 1.00 39.03  ? 1191 HOH A O   1 
HETATM 3098 O O   . HOH H 4 .   ? 41.513 45.931 85.871 1.00 34.33  ? 1192 HOH A O   1 
HETATM 3099 O O   . HOH H 4 .   ? 23.085 13.221 81.978 1.00 44.97  ? 1193 HOH A O   1 
HETATM 3100 O O   . HOH H 4 .   ? 42.906 17.922 74.379 1.00 31.76  ? 1194 HOH A O   1 
HETATM 3101 O O   . HOH H 4 .   ? 48.209 34.724 81.992 1.00 47.61  ? 1195 HOH A O   1 
HETATM 3102 O O   . HOH H 4 .   ? 46.736 21.213 83.694 1.00 32.59  ? 1196 HOH A O   1 
HETATM 3103 O O   . HOH H 4 .   ? 23.366 42.345 57.978 1.00 50.58  ? 1197 HOH A O   1 
HETATM 3104 O O   . HOH H 4 .   ? 20.979 24.894 80.589 1.00 40.58  ? 1198 HOH A O   1 
HETATM 3105 O O   . HOH H 4 .   ? 23.254 38.689 92.377 1.00 40.59  ? 1199 HOH A O   1 
HETATM 3106 O O   . HOH H 4 .   ? 20.531 30.920 71.435 1.00 37.95  ? 1200 HOH A O   1 
HETATM 3107 O O   . HOH H 4 .   ? 42.278 33.619 93.677 1.00 41.59  ? 1201 HOH A O   1 
HETATM 3108 O O   . HOH H 4 .   ? 35.808 47.228 85.253 1.00 41.50  ? 1202 HOH A O   1 
HETATM 3109 O O   . HOH H 4 .   ? 27.037 45.032 73.467 1.00 41.91  ? 1203 HOH A O   1 
HETATM 3110 O O   . HOH H 4 .   ? 18.522 23.224 68.752 1.00 31.95  ? 1204 HOH A O   1 
HETATM 3111 O O   . HOH H 4 .   ? 22.262 27.156 96.363 1.00 51.39  ? 1205 HOH A O   1 
HETATM 3112 O O   . HOH H 4 .   ? 39.818 46.733 83.000 1.00 48.26  ? 1206 HOH A O   1 
HETATM 3113 O O   . HOH H 4 .   ? 31.461 39.212 66.700 1.00 42.85  ? 1207 HOH A O   1 
HETATM 3114 O O   . HOH H 4 .   ? 13.820 14.221 81.442 1.00 36.03  ? 1208 HOH A O   1 
HETATM 3115 O O   . HOH H 4 .   ? 24.701 35.264 78.421 1.00 38.37  ? 1209 HOH A O   1 
HETATM 3116 O O   . HOH H 4 .   ? 44.388 19.920 84.259 1.00 36.77  ? 1210 HOH A O   1 
HETATM 3117 O O   . HOH H 4 .   ? 44.339 15.484 90.201 1.00 52.03  ? 1211 HOH A O   1 
HETATM 3118 O O   . HOH H 4 .   ? 17.197 25.726 67.022 1.00 58.14  ? 1212 HOH A O   1 
HETATM 3119 O O   . HOH H 4 .   ? 18.365 35.367 66.296 1.00 49.38  ? 1213 HOH A O   1 
HETATM 3120 O O   . HOH H 4 .   ? 20.529 36.069 82.330 1.00 48.75  ? 1214 HOH A O   1 
HETATM 3121 O O   . HOH H 4 .   ? 25.789 34.584 86.497 1.00 29.63  ? 1215 HOH A O   1 
HETATM 3122 O O   . HOH H 4 .   ? 20.542 35.800 79.605 1.00 42.53  ? 1216 HOH A O   1 
HETATM 3123 O O   . HOH H 4 .   ? 16.722 32.865 81.245 1.00 54.64  ? 1217 HOH A O   1 
HETATM 3124 O O   . HOH H 4 .   ? 28.468 12.631 74.641 1.00 54.11  ? 1218 HOH A O   1 
HETATM 3125 O O   . HOH H 4 .   ? 37.548 23.956 65.336 1.00 64.31  ? 1219 HOH A O   1 
HETATM 3126 O O   . HOH H 4 .   ? 27.069 10.451 75.236 1.00 51.96  ? 1220 HOH A O   1 
HETATM 3127 O O   . HOH H 4 .   ? 35.212 24.775 64.095 1.00 53.83  ? 1221 HOH A O   1 
HETATM 3128 O O   . HOH H 4 .   ? 25.295 11.659 81.717 1.00 45.46  ? 1222 HOH A O   1 
HETATM 3129 O O   . HOH H 4 .   ? 36.783 47.709 89.462 1.00 44.65  ? 1223 HOH A O   1 
HETATM 3130 O O   . HOH H 4 .   ? 22.226 43.718 74.766 1.00 54.32  ? 1224 HOH A O   1 
HETATM 3131 O O   . HOH H 4 .   ? 18.219 23.638 71.654 1.00 54.56  ? 1225 HOH A O   1 
HETATM 3132 O O   . HOH H 4 .   ? 37.909 13.343 83.924 1.00 65.21  ? 1226 HOH A O   1 
HETATM 3133 O O   . HOH H 4 .   ? 41.494 15.833 73.560 1.00 47.79  ? 1227 HOH A O   1 
HETATM 3134 O O   . HOH H 4 .   ? 19.486 26.917 74.156 1.00 51.09  ? 1228 HOH A O   1 
HETATM 3135 O O   . HOH H 4 .   ? 49.134 32.231 85.221 1.00 53.01  ? 1229 HOH A O   1 
HETATM 3136 O O   . HOH H 4 .   ? 38.382 16.241 87.101 1.00 48.60  ? 1230 HOH A O   1 
HETATM 3137 O O   . HOH I 4 .   ? 55.282 3.409  43.744 1.00 31.90  ? 1101 HOH B O   1 
HETATM 3138 O O   . HOH I 4 .   ? 61.751 24.914 66.915 1.00 53.70  ? 1102 HOH B O   1 
HETATM 3139 O O   . HOH I 4 .   ? 61.980 1.009  59.092 1.00 54.65  ? 1103 HOH B O   1 
HETATM 3140 O O   . HOH I 4 .   ? 54.125 21.266 70.734 1.00 43.30  ? 1104 HOH B O   1 
HETATM 3141 O O   . HOH I 4 .   ? 61.391 22.115 73.889 1.00 50.86  ? 1105 HOH B O   1 
HETATM 3142 O O   . HOH I 4 .   ? 51.932 12.481 60.262 1.00 40.99  ? 1106 HOH B O   1 
HETATM 3143 O O   . HOH I 4 .   ? 74.427 28.636 51.343 1.00 50.86  ? 1107 HOH B O   1 
HETATM 3144 O O   . HOH I 4 .   ? 47.888 23.678 60.784 1.00 37.92  ? 1108 HOH B O   1 
HETATM 3145 O O   . HOH I 4 .   ? 55.384 18.480 41.614 1.00 47.31  ? 1109 HOH B O   1 
HETATM 3146 O O   . HOH I 4 .   ? 57.481 7.486  72.134 1.00 31.26  ? 1110 HOH B O   1 
HETATM 3147 O O   . HOH I 4 .   ? 45.799 14.382 59.406 1.00 60.43  ? 1111 HOH B O   1 
HETATM 3148 O O   . HOH I 4 .   ? 49.208 23.893 64.649 1.00 36.23  ? 1112 HOH B O   1 
HETATM 3149 O O   . HOH I 4 .   ? 68.770 10.071 61.838 1.00 34.18  ? 1113 HOH B O   1 
HETATM 3150 O O   . HOH I 4 .   ? 71.986 17.822 59.051 1.00 41.57  ? 1114 HOH B O   1 
HETATM 3151 O O   . HOH I 4 .   ? 55.019 5.154  41.770 1.00 40.26  ? 1115 HOH B O   1 
HETATM 3152 O O   . HOH I 4 .   ? 51.783 29.067 66.538 1.00 44.32  ? 1116 HOH B O   1 
HETATM 3153 O O   . HOH I 4 .   ? 63.750 -0.431 50.458 1.00 58.29  ? 1117 HOH B O   1 
HETATM 3154 O O   . HOH I 4 .   ? 44.882 13.777 46.867 1.00 45.15  ? 1118 HOH B O   1 
HETATM 3155 O O   . HOH I 4 .   ? 61.092 25.728 64.513 1.00 50.72  ? 1119 HOH B O   1 
HETATM 3156 O O   . HOH I 4 .   ? 73.803 20.925 53.105 1.00 44.00  ? 1120 HOH B O   1 
HETATM 3157 O O   . HOH I 4 .   ? 50.648 7.771  54.126 1.00 58.58  ? 1121 HOH B O   1 
HETATM 3158 O O   . HOH I 4 .   ? 55.918 15.549 69.438 1.00 53.17  ? 1122 HOH B O   1 
HETATM 3159 O O   . HOH I 4 .   ? 57.801 3.756  50.016 1.00 38.25  ? 1123 HOH B O   1 
HETATM 3160 O O   . HOH I 4 .   ? 47.624 11.504 54.632 1.00 45.74  ? 1124 HOH B O   1 
HETATM 3161 O O   . HOH I 4 .   ? 72.819 17.234 71.437 1.00 55.43  ? 1125 HOH B O   1 
HETATM 3162 O O   . HOH I 4 .   ? 54.585 18.422 73.727 1.00 33.94  ? 1126 HOH B O   1 
HETATM 3163 O O   . HOH I 4 .   ? 46.853 29.214 61.998 1.00 49.05  ? 1127 HOH B O   1 
HETATM 3164 O O   . HOH I 4 .   ? 61.834 11.344 34.413 1.00 50.68  ? 1128 HOH B O   1 
HETATM 3165 O O   . HOH I 4 .   ? 71.624 10.821 47.474 1.00 59.62  ? 1129 HOH B O   1 
HETATM 3166 O O   . HOH I 4 .   ? 49.102 17.044 68.970 1.00 38.08  ? 1130 HOH B O   1 
HETATM 3167 O O   . HOH I 4 .   ? 59.060 24.605 66.956 1.00 51.53  ? 1131 HOH B O   1 
HETATM 3168 O O   . HOH I 4 .   ? 80.270 16.974 53.955 1.00 51.90  ? 1132 HOH B O   1 
HETATM 3169 O O   . HOH I 4 .   ? 58.507 2.674  36.382 1.00 53.18  ? 1133 HOH B O   1 
HETATM 3170 O O   . HOH I 4 .   ? 71.705 13.779 59.671 1.00 57.55  ? 1134 HOH B O   1 
HETATM 3171 O O   . HOH I 4 .   ? 46.680 25.394 69.883 1.00 35.40  ? 1135 HOH B O   1 
HETATM 3172 O O   . HOH I 4 .   ? 59.390 17.848 38.457 1.00 51.94  ? 1136 HOH B O   1 
HETATM 3173 O O   . HOH I 4 .   ? 71.170 6.069  67.983 1.00 48.33  ? 1137 HOH B O   1 
HETATM 3174 O O   . HOH I 4 .   ? 49.623 30.889 70.813 1.00 41.33  ? 1138 HOH B O   1 
HETATM 3175 O O   . HOH I 4 .   ? 72.844 20.393 66.626 1.00 33.19  ? 1139 HOH B O   1 
HETATM 3176 O O   . HOH I 4 .   ? 72.819 19.640 55.548 1.00 33.97  ? 1140 HOH B O   1 
HETATM 3177 O O   . HOH I 4 .   ? 76.663 16.134 69.279 1.00 49.84  ? 1141 HOH B O   1 
HETATM 3178 O O   . HOH I 4 .   ? 68.897 4.430  67.089 1.00 40.92  ? 1142 HOH B O   1 
HETATM 3179 O O   . HOH I 4 .   ? 72.420 9.085  68.958 1.00 46.12  ? 1143 HOH B O   1 
HETATM 3180 O O   . HOH I 4 .   ? 58.828 10.511 36.531 1.00 53.20  ? 1144 HOH B O   1 
HETATM 3181 O O   . HOH I 4 .   ? 46.950 20.648 47.272 1.00 52.48  ? 1145 HOH B O   1 
HETATM 3182 O O   . HOH I 4 .   ? 64.702 28.894 62.714 1.00 62.44  ? 1146 HOH B O   1 
HETATM 3183 O O   . HOH I 4 .   ? 46.381 32.934 56.198 1.00 52.15  ? 1147 HOH B O   1 
HETATM 3184 O O   . HOH I 4 .   ? 74.938 18.204 64.408 1.00 34.08  ? 1148 HOH B O   1 
HETATM 3185 O O   . HOH I 4 .   ? 75.770 12.791 55.222 1.00 49.74  ? 1149 HOH B O   1 
HETATM 3186 O O   . HOH I 4 .   ? 76.583 18.550 60.498 1.00 48.81  ? 1150 HOH B O   1 
HETATM 3187 O O   . HOH I 4 .   ? 66.900 21.120 30.266 1.00 64.17  ? 1151 HOH B O   1 
HETATM 3188 O O   . HOH I 4 .   ? 60.102 4.372  38.335 1.00 51.28  ? 1152 HOH B O   1 
HETATM 3189 O O   . HOH I 4 .   ? 76.858 19.964 51.748 1.00 61.79  ? 1153 HOH B O   1 
HETATM 3190 O O   . HOH I 4 .   ? 71.450 11.349 33.188 1.00 63.26  ? 1154 HOH B O   1 
HETATM 3191 O O   . HOH I 4 .   ? 51.371 8.565  63.198 1.00 49.15  ? 1155 HOH B O   1 
HETATM 3192 O O   . HOH I 4 .   ? 56.750 15.353 37.127 1.00 71.76  ? 1156 HOH B O   1 
HETATM 3193 O O   . HOH I 4 .   ? 70.381 0.479  50.608 1.00 59.01  ? 1157 HOH B O   1 
HETATM 3194 O O   . HOH I 4 .   ? 78.911 18.901 61.946 1.00 48.47  ? 1158 HOH B O   1 
HETATM 3195 O O   . HOH I 4 .   ? 73.677 13.986 27.424 1.00 48.55  ? 1159 HOH B O   1 
HETATM 3196 O O   . HOH I 4 .   ? 62.237 -5.966 38.406 1.00 61.50  ? 1160 HOH B O   1 
HETATM 3197 O O   . HOH I 4 .   ? 76.505 20.420 64.536 1.00 41.67  ? 1161 HOH B O   1 
HETATM 3198 O O   . HOH I 4 .   ? 46.792 29.237 49.137 1.00 51.02  ? 1162 HOH B O   1 
HETATM 3199 O O   . HOH I 4 .   ? 64.055 32.041 63.053 1.00 70.57  ? 1163 HOH B O   1 
HETATM 3200 O O   . HOH I 4 .   ? 69.427 -3.208 51.327 1.00 62.01  ? 1164 HOH B O   1 
HETATM 3201 O O   . HOH I 4 .   ? 74.642 12.176 52.863 1.00 54.89  ? 1165 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   175 175 ALA ALA A . n 
A 1 2   GLY 2   176 176 GLY GLY A . n 
A 1 3   MET 3   177 177 MET MET A . n 
A 1 4   GLY 4   178 178 GLY GLY A . n 
A 1 5   PRO 5   179 179 PRO PRO A . n 
A 1 6   GLY 6   180 180 GLY GLY A . n 
A 1 7   ASP 7   181 181 ASP ASP A . n 
A 1 8   GLY 8   182 182 GLY GLY A . n 
A 1 9   PHE 9   183 183 PHE PHE A . n 
A 1 10  THR 10  184 184 THR THR A . n 
A 1 11  ILE 11  185 185 ILE ILE A . n 
A 1 12  LEU 12  186 186 LEU LEU A . n 
A 1 13  SER 13  187 187 SER SER A . n 
A 1 14  SER 14  188 188 SER SER A . n 
A 1 15  LYS 15  189 189 LYS LYS A . n 
A 1 16  SER 16  190 190 SER SER A . n 
A 1 17  LEU 17  191 191 LEU LEU A . n 
A 1 18  VAL 18  192 192 VAL VAL A . n 
A 1 19  LEU 19  193 193 LEU LEU A . n 
A 1 20  GLY 20  194 194 GLY GLY A . n 
A 1 21  GLN 21  195 195 GLN GLN A . n 
A 1 22  LYS 22  196 196 LYS LYS A . n 
A 1 23  LEU 23  197 197 LEU LEU A . n 
A 1 24  SER 24  198 198 SER SER A . n 
A 1 25  LEU 25  199 199 LEU LEU A . n 
A 1 26  THR 26  200 200 THR THR A . n 
A 1 27  GLN 27  201 201 GLN GLN A . n 
A 1 28  SER 28  202 202 SER SER A . n 
A 1 29  ASP 29  203 203 ASP ASP A . n 
A 1 30  ILE 30  204 204 ILE ILE A . n 
A 1 31  SER 31  205 205 SER SER A . n 
A 1 32  HIS 32  206 206 HIS HIS A . n 
A 1 33  ILE 33  207 207 ILE ILE A . n 
A 1 34  GLY 34  208 208 GLY GLY A . n 
A 1 35  SER 35  209 209 SER SER A . n 
A 1 36  MET 36  210 210 MET MET A . n 
A 1 37  ARG 37  211 211 ARG ARG A . n 
A 1 38  VAL 38  212 212 VAL VAL A . n 
A 1 39  GLU 39  213 213 GLU GLU A . n 
A 1 40  GLY 40  214 214 GLY GLY A . n 
A 1 41  ILE 41  215 215 ILE ILE A . n 
A 1 42  VAL 42  216 216 VAL VAL A . n 
A 1 43  HIS 43  217 217 HIS HIS A . n 
A 1 44  PRO 44  218 218 PRO PRO A . n 
A 1 45  THR 45  219 219 THR THR A . n 
A 1 46  THR 46  220 220 THR THR A . n 
A 1 47  ALA 47  221 221 ALA ALA A . n 
A 1 48  GLU 48  222 222 GLU GLU A . n 
A 1 49  ILE 49  223 223 ILE ILE A . n 
A 1 50  ASP 50  224 224 ASP ASP A . n 
A 1 51  LEU 51  225 225 LEU LEU A . n 
A 1 52  LYS 52  226 226 LYS LYS A . n 
A 1 53  GLU 53  227 227 GLU GLU A . n 
A 1 54  ASP 54  228 228 ASP ASP A . n 
A 1 55  ILE 55  229 229 ILE ILE A . n 
A 1 56  GLY 56  230 230 GLY GLY A . n 
A 1 57  LYS 57  231 231 LYS LYS A . n 
A 1 58  ALA 58  232 232 ALA ALA A . n 
A 1 59  LEU 59  233 233 LEU LEU A . n 
A 1 60  GLU 60  234 234 GLU GLU A . n 
A 1 61  LYS 61  235 235 LYS LYS A . n 
A 1 62  ALA 62  236 236 ALA ALA A . n 
A 1 63  GLY 63  237 237 GLY GLY A . n 
A 1 64  GLY 64  238 238 GLY GLY A . n 
A 1 65  LYS 65  239 239 LYS LYS A . n 
A 1 66  GLU 66  240 240 GLU GLU A . n 
A 1 67  PHE 67  241 241 PHE PHE A . n 
A 1 68  LEU 68  242 242 LEU LEU A . n 
A 1 69  GLU 69  243 243 GLU GLU A . n 
A 1 70  THR 70  244 244 THR THR A . n 
A 1 71  VAL 71  245 245 VAL VAL A . n 
A 1 72  LYS 72  246 246 LYS LYS A . n 
A 1 73  GLU 73  247 247 GLU GLU A . n 
A 1 74  LEU 74  248 248 LEU LEU A . n 
A 1 75  ARG 75  249 249 ARG ARG A . n 
A 1 76  LYS 76  250 250 LYS LYS A . n 
A 1 77  SER 77  251 251 SER SER A . n 
A 1 78  GLN 78  252 252 GLN GLN A . n 
A 1 79  GLY 79  253 253 GLY GLY A . n 
A 1 80  PRO 80  254 254 PRO PRO A . n 
A 1 81  LEU 81  255 255 LEU LEU A . n 
A 1 82  GLU 82  256 256 GLU GLU A . n 
A 1 83  VAL 83  257 257 VAL VAL A . n 
A 1 84  ALA 84  258 258 ALA ALA A . n 
A 1 85  GLU 85  259 259 GLU GLU A . n 
A 1 86  ALA 86  260 260 ALA ALA A . n 
A 1 87  ALA 87  261 261 ALA ALA A . n 
A 1 88  VAL 88  262 262 VAL VAL A . n 
A 1 89  SER 89  263 263 SER SER A . n 
A 1 90  GLN 90  264 264 GLN GLN A . n 
A 1 91  SER 91  265 265 SER SER A . n 
A 1 92  SER 92  266 266 SER SER A . n 
A 1 93  GLY 93  267 267 GLY GLY A . n 
A 1 94  LEU 94  268 268 LEU LEU A . n 
A 1 95  ALA 95  269 269 ALA ALA A . n 
A 1 96  ALA 96  270 270 ALA ALA A . n 
A 1 97  LYS 97  271 271 LYS LYS A . n 
A 1 98  PHE 98  272 272 PHE PHE A . n 
A 1 99  VAL 99  273 273 VAL VAL A . n 
A 1 100 ILE 100 274 274 ILE ILE A . n 
A 1 101 HIS 101 275 275 HIS HIS A . n 
A 1 102 CYS 102 276 276 CYS CYS A . n 
A 1 103 HIS 103 277 277 HIS HIS A . n 
A 1 104 ILE 104 278 278 ILE ILE A . n 
A 1 105 PRO 105 279 279 PRO PRO A . n 
A 1 106 GLN 106 280 280 GLN GLN A . n 
A 1 107 TRP 107 281 281 TRP TRP A . n 
A 1 108 GLY 108 282 282 GLY GLY A . n 
A 1 109 SER 109 283 283 SER SER A . n 
A 1 110 ASP 110 284 284 ASP ASP A . n 
A 1 111 LYS 111 285 285 LYS LYS A . n 
A 1 112 CYS 112 286 286 CYS CYS A . n 
A 1 113 GLU 113 287 287 GLU GLU A . n 
A 1 114 GLU 114 288 288 GLU GLU A . n 
A 1 115 GLN 115 289 289 GLN GLN A . n 
A 1 116 LEU 116 290 290 LEU LEU A . n 
A 1 117 GLU 117 291 291 GLU GLU A . n 
A 1 118 GLU 118 292 292 GLU GLU A . n 
A 1 119 THR 119 293 293 THR THR A . n 
A 1 120 ILE 120 294 294 ILE ILE A . n 
A 1 121 LYS 121 295 295 LYS LYS A . n 
A 1 122 ASN 122 296 296 ASN ASN A . n 
A 1 123 CYS 123 297 297 CYS CYS A . n 
A 1 124 LEU 124 298 298 LEU LEU A . n 
A 1 125 SER 125 299 299 SER SER A . n 
A 1 126 ALA 126 300 300 ALA ALA A . n 
A 1 127 ALA 127 301 301 ALA ALA A . n 
A 1 128 GLU 128 302 302 GLU GLU A . n 
A 1 129 ASP 129 303 303 ASP ASP A . n 
A 1 130 LYS 130 304 304 LYS LYS A . n 
A 1 131 LYS 131 305 305 LYS LYS A . n 
A 1 132 LEU 132 306 306 LEU LEU A . n 
A 1 133 LYS 133 307 307 LYS LYS A . n 
A 1 134 SER 134 308 308 SER SER A . n 
A 1 135 VAL 135 309 309 VAL VAL A . n 
A 1 136 ALA 136 310 310 ALA ALA A . n 
A 1 137 PHE 137 311 311 PHE PHE A . n 
A 1 138 PRO 138 312 312 PRO PRO A . n 
A 1 139 PRO 139 313 313 PRO PRO A . n 
A 1 140 PHE 140 314 314 PHE PHE A . n 
A 1 141 PRO 141 315 315 PRO PRO A . n 
A 1 142 SER 142 316 316 SER SER A . n 
A 1 143 GLY 143 317 317 GLY GLY A . n 
A 1 144 ARG 144 318 318 ARG ARG A . n 
A 1 145 ASN 145 319 319 ASN ASN A . n 
A 1 146 CYS 146 320 320 CYS CYS A . n 
A 1 147 PHE 147 321 321 PHE PHE A . n 
A 1 148 PRO 148 322 322 PRO PRO A . n 
A 1 149 LYS 149 323 323 LYS LYS A . n 
A 1 150 GLN 150 324 324 GLN GLN A . n 
A 1 151 THR 151 325 325 THR THR A . n 
A 1 152 ALA 152 326 326 ALA ALA A . n 
A 1 153 ALA 153 327 327 ALA ALA A . n 
A 1 154 GLN 154 328 328 GLN GLN A . n 
A 1 155 VAL 155 329 329 VAL VAL A . n 
A 1 156 THR 156 330 330 THR THR A . n 
A 1 157 LEU 157 331 331 LEU LEU A . n 
A 1 158 LYS 158 332 332 LYS LYS A . n 
A 1 159 ALA 159 333 333 ALA ALA A . n 
A 1 160 ILE 160 334 334 ILE ILE A . n 
A 1 161 SER 161 335 335 SER SER A . n 
A 1 162 ALA 162 336 336 ALA ALA A . n 
A 1 163 HIS 163 337 337 HIS HIS A . n 
A 1 164 PHE 164 338 338 PHE PHE A . n 
A 1 165 ASP 165 339 339 ASP ASP A . n 
A 1 166 ASP 166 340 340 ASP ASP A . n 
A 1 167 SER 167 341 341 SER SER A . n 
A 1 168 SER 168 342 342 SER SER A . n 
A 1 169 ALA 169 343 343 ALA ALA A . n 
A 1 170 SER 170 344 344 SER SER A . n 
A 1 171 SER 171 345 345 SER SER A . n 
A 1 172 LEU 172 346 346 LEU LEU A . n 
A 1 173 LYS 173 347 347 LYS LYS A . n 
A 1 174 ASN 174 348 348 ASN ASN A . n 
A 1 175 VAL 175 349 349 VAL VAL A . n 
A 1 176 TYR 176 350 350 TYR TYR A . n 
A 1 177 PHE 177 351 351 PHE PHE A . n 
A 1 178 LEU 178 352 352 LEU LEU A . n 
A 1 179 LEU 179 353 353 LEU LEU A . n 
A 1 180 PHE 180 354 354 PHE PHE A . n 
A 1 181 ASP 181 355 355 ASP ASP A . n 
A 1 182 SER 182 356 356 SER SER A . n 
A 1 183 GLU 183 357 357 GLU GLU A . n 
A 1 184 SER 184 358 358 SER SER A . n 
A 1 185 ILE 185 359 359 ILE ILE A . n 
A 1 186 GLY 186 360 360 GLY GLY A . n 
A 1 187 ILE 187 361 361 ILE ILE A . n 
A 1 188 TYR 188 362 362 TYR TYR A . n 
A 1 189 VAL 189 363 363 VAL VAL A . n 
A 1 190 GLN 190 364 364 GLN GLN A . n 
A 1 191 GLU 191 365 365 GLU GLU A . n 
A 1 192 MET 192 366 366 MET MET A . n 
A 1 193 ALA 193 367 367 ALA ALA A . n 
A 1 194 LYS 194 368 368 LYS LYS A . n 
A 1 195 LEU 195 369 369 LEU LEU A . n 
A 1 196 ASP 196 370 370 ASP ASP A . n 
A 1 197 ALA 197 371 371 ALA ALA A . n 
A 1 198 LYS 198 372 372 LYS LYS A . n 
B 1 1   ALA 1   175 ?   ?   ?   B . n 
B 1 2   GLY 2   176 ?   ?   ?   B . n 
B 1 3   MET 3   177 ?   ?   ?   B . n 
B 1 4   GLY 4   178 ?   ?   ?   B . n 
B 1 5   PRO 5   179 ?   ?   ?   B . n 
B 1 6   GLY 6   180 180 GLY GLY B . n 
B 1 7   ASP 7   181 181 ASP ASP B . n 
B 1 8   GLY 8   182 182 GLY GLY B . n 
B 1 9   PHE 9   183 183 PHE PHE B . n 
B 1 10  THR 10  184 184 THR THR B . n 
B 1 11  ILE 11  185 185 ILE ILE B . n 
B 1 12  LEU 12  186 186 LEU LEU B . n 
B 1 13  SER 13  187 187 SER SER B . n 
B 1 14  SER 14  188 188 SER SER B . n 
B 1 15  LYS 15  189 189 LYS LYS B . n 
B 1 16  SER 16  190 190 SER SER B . n 
B 1 17  LEU 17  191 191 LEU LEU B . n 
B 1 18  VAL 18  192 192 VAL VAL B . n 
B 1 19  LEU 19  193 193 LEU LEU B . n 
B 1 20  GLY 20  194 194 GLY GLY B . n 
B 1 21  GLN 21  195 195 GLN GLN B . n 
B 1 22  LYS 22  196 196 LYS LYS B . n 
B 1 23  LEU 23  197 197 LEU LEU B . n 
B 1 24  SER 24  198 198 SER SER B . n 
B 1 25  LEU 25  199 199 LEU LEU B . n 
B 1 26  THR 26  200 200 THR THR B . n 
B 1 27  GLN 27  201 201 GLN GLN B . n 
B 1 28  SER 28  202 202 SER SER B . n 
B 1 29  ASP 29  203 203 ASP ASP B . n 
B 1 30  ILE 30  204 204 ILE ILE B . n 
B 1 31  SER 31  205 205 SER SER B . n 
B 1 32  HIS 32  206 206 HIS HIS B . n 
B 1 33  ILE 33  207 207 ILE ILE B . n 
B 1 34  GLY 34  208 208 GLY GLY B . n 
B 1 35  SER 35  209 209 SER SER B . n 
B 1 36  MET 36  210 210 MET MET B . n 
B 1 37  ARG 37  211 211 ARG ARG B . n 
B 1 38  VAL 38  212 212 VAL VAL B . n 
B 1 39  GLU 39  213 213 GLU GLU B . n 
B 1 40  GLY 40  214 214 GLY GLY B . n 
B 1 41  ILE 41  215 215 ILE ILE B . n 
B 1 42  VAL 42  216 216 VAL VAL B . n 
B 1 43  HIS 43  217 217 HIS HIS B . n 
B 1 44  PRO 44  218 218 PRO PRO B . n 
B 1 45  THR 45  219 219 THR THR B . n 
B 1 46  THR 46  220 220 THR THR B . n 
B 1 47  ALA 47  221 221 ALA ALA B . n 
B 1 48  GLU 48  222 222 GLU GLU B . n 
B 1 49  ILE 49  223 223 ILE ILE B . n 
B 1 50  ASP 50  224 224 ASP ASP B . n 
B 1 51  LEU 51  225 225 LEU LEU B . n 
B 1 52  LYS 52  226 226 LYS LYS B . n 
B 1 53  GLU 53  227 227 GLU GLU B . n 
B 1 54  ASP 54  228 228 ASP ASP B . n 
B 1 55  ILE 55  229 229 ILE ILE B . n 
B 1 56  GLY 56  230 230 GLY GLY B . n 
B 1 57  LYS 57  231 231 LYS LYS B . n 
B 1 58  ALA 58  232 232 ALA ALA B . n 
B 1 59  LEU 59  233 233 LEU LEU B . n 
B 1 60  GLU 60  234 234 GLU GLU B . n 
B 1 61  LYS 61  235 235 LYS LYS B . n 
B 1 62  ALA 62  236 236 ALA ALA B . n 
B 1 63  GLY 63  237 237 GLY GLY B . n 
B 1 64  GLY 64  238 238 GLY GLY B . n 
B 1 65  LYS 65  239 239 LYS LYS B . n 
B 1 66  GLU 66  240 240 GLU GLU B . n 
B 1 67  PHE 67  241 241 PHE PHE B . n 
B 1 68  LEU 68  242 242 LEU LEU B . n 
B 1 69  GLU 69  243 243 GLU GLU B . n 
B 1 70  THR 70  244 244 THR THR B . n 
B 1 71  VAL 71  245 245 VAL VAL B . n 
B 1 72  LYS 72  246 246 LYS LYS B . n 
B 1 73  GLU 73  247 247 GLU GLU B . n 
B 1 74  LEU 74  248 248 LEU LEU B . n 
B 1 75  ARG 75  249 249 ARG ARG B . n 
B 1 76  LYS 76  250 250 LYS LYS B . n 
B 1 77  SER 77  251 251 SER SER B . n 
B 1 78  GLN 78  252 252 GLN GLN B . n 
B 1 79  GLY 79  253 253 GLY GLY B . n 
B 1 80  PRO 80  254 254 PRO PRO B . n 
B 1 81  LEU 81  255 255 LEU LEU B . n 
B 1 82  GLU 82  256 256 GLU GLU B . n 
B 1 83  VAL 83  257 257 VAL VAL B . n 
B 1 84  ALA 84  258 258 ALA ALA B . n 
B 1 85  GLU 85  259 259 GLU GLU B . n 
B 1 86  ALA 86  260 260 ALA ALA B . n 
B 1 87  ALA 87  261 261 ALA ALA B . n 
B 1 88  VAL 88  262 262 VAL VAL B . n 
B 1 89  SER 89  263 263 SER SER B . n 
B 1 90  GLN 90  264 264 GLN GLN B . n 
B 1 91  SER 91  265 265 SER SER B . n 
B 1 92  SER 92  266 266 SER SER B . n 
B 1 93  GLY 93  267 267 GLY GLY B . n 
B 1 94  LEU 94  268 268 LEU LEU B . n 
B 1 95  ALA 95  269 269 ALA ALA B . n 
B 1 96  ALA 96  270 270 ALA ALA B . n 
B 1 97  LYS 97  271 271 LYS LYS B . n 
B 1 98  PHE 98  272 272 PHE PHE B . n 
B 1 99  VAL 99  273 273 VAL VAL B . n 
B 1 100 ILE 100 274 274 ILE ILE B . n 
B 1 101 HIS 101 275 275 HIS HIS B . n 
B 1 102 CYS 102 276 276 CYS CYS B . n 
B 1 103 HIS 103 277 277 HIS HIS B . n 
B 1 104 ILE 104 278 278 ILE ILE B . n 
B 1 105 PRO 105 279 279 PRO PRO B . n 
B 1 106 GLN 106 280 280 GLN GLN B . n 
B 1 107 TRP 107 281 281 TRP TRP B . n 
B 1 108 GLY 108 282 282 GLY GLY B . n 
B 1 109 SER 109 283 283 SER SER B . n 
B 1 110 ASP 110 284 284 ASP ASP B . n 
B 1 111 LYS 111 285 285 LYS LYS B . n 
B 1 112 CYS 112 286 286 CYS CYS B . n 
B 1 113 GLU 113 287 287 GLU GLU B . n 
B 1 114 GLU 114 288 288 GLU GLU B . n 
B 1 115 GLN 115 289 289 GLN GLN B . n 
B 1 116 LEU 116 290 290 LEU LEU B . n 
B 1 117 GLU 117 291 291 GLU GLU B . n 
B 1 118 GLU 118 292 292 GLU GLU B . n 
B 1 119 THR 119 293 293 THR THR B . n 
B 1 120 ILE 120 294 294 ILE ILE B . n 
B 1 121 LYS 121 295 295 LYS LYS B . n 
B 1 122 ASN 122 296 296 ASN ASN B . n 
B 1 123 CYS 123 297 297 CYS CYS B . n 
B 1 124 LEU 124 298 298 LEU LEU B . n 
B 1 125 SER 125 299 299 SER SER B . n 
B 1 126 ALA 126 300 300 ALA ALA B . n 
B 1 127 ALA 127 301 301 ALA ALA B . n 
B 1 128 GLU 128 302 302 GLU GLU B . n 
B 1 129 ASP 129 303 303 ASP ASP B . n 
B 1 130 LYS 130 304 304 LYS LYS B . n 
B 1 131 LYS 131 305 305 LYS LYS B . n 
B 1 132 LEU 132 306 306 LEU LEU B . n 
B 1 133 LYS 133 307 307 LYS LYS B . n 
B 1 134 SER 134 308 308 SER SER B . n 
B 1 135 VAL 135 309 309 VAL VAL B . n 
B 1 136 ALA 136 310 310 ALA ALA B . n 
B 1 137 PHE 137 311 311 PHE PHE B . n 
B 1 138 PRO 138 312 312 PRO PRO B . n 
B 1 139 PRO 139 313 313 PRO PRO B . n 
B 1 140 PHE 140 314 314 PHE PHE B . n 
B 1 141 PRO 141 315 315 PRO PRO B . n 
B 1 142 SER 142 316 316 SER SER B . n 
B 1 143 GLY 143 317 317 GLY GLY B . n 
B 1 144 ARG 144 318 318 ARG ARG B . n 
B 1 145 ASN 145 319 319 ASN ASN B . n 
B 1 146 CYS 146 320 320 CYS CYS B . n 
B 1 147 PHE 147 321 321 PHE PHE B . n 
B 1 148 PRO 148 322 322 PRO PRO B . n 
B 1 149 LYS 149 323 323 LYS LYS B . n 
B 1 150 GLN 150 324 324 GLN GLN B . n 
B 1 151 THR 151 325 325 THR THR B . n 
B 1 152 ALA 152 326 326 ALA ALA B . n 
B 1 153 ALA 153 327 327 ALA ALA B . n 
B 1 154 GLN 154 328 328 GLN GLN B . n 
B 1 155 VAL 155 329 329 VAL VAL B . n 
B 1 156 THR 156 330 330 THR THR B . n 
B 1 157 LEU 157 331 331 LEU LEU B . n 
B 1 158 LYS 158 332 332 LYS LYS B . n 
B 1 159 ALA 159 333 333 ALA ALA B . n 
B 1 160 ILE 160 334 334 ILE ILE B . n 
B 1 161 SER 161 335 335 SER SER B . n 
B 1 162 ALA 162 336 336 ALA ALA B . n 
B 1 163 HIS 163 337 337 HIS HIS B . n 
B 1 164 PHE 164 338 338 PHE PHE B . n 
B 1 165 ASP 165 339 339 ASP ASP B . n 
B 1 166 ASP 166 340 340 ASP ASP B . n 
B 1 167 SER 167 341 341 SER SER B . n 
B 1 168 SER 168 342 342 SER SER B . n 
B 1 169 ALA 169 343 343 ALA ALA B . n 
B 1 170 SER 170 344 344 SER SER B . n 
B 1 171 SER 171 345 345 SER SER B . n 
B 1 172 LEU 172 346 346 LEU LEU B . n 
B 1 173 LYS 173 347 347 LYS LYS B . n 
B 1 174 ASN 174 348 348 ASN ASN B . n 
B 1 175 VAL 175 349 349 VAL VAL B . n 
B 1 176 TYR 176 350 350 TYR TYR B . n 
B 1 177 PHE 177 351 351 PHE PHE B . n 
B 1 178 LEU 178 352 352 LEU LEU B . n 
B 1 179 LEU 179 353 353 LEU LEU B . n 
B 1 180 PHE 180 354 354 PHE PHE B . n 
B 1 181 ASP 181 355 355 ASP ASP B . n 
B 1 182 SER 182 356 356 SER SER B . n 
B 1 183 GLU 183 357 357 GLU GLU B . n 
B 1 184 SER 184 358 358 SER SER B . n 
B 1 185 ILE 185 359 359 ILE ILE B . n 
B 1 186 GLY 186 360 360 GLY GLY B . n 
B 1 187 ILE 187 361 361 ILE ILE B . n 
B 1 188 TYR 188 362 362 TYR TYR B . n 
B 1 189 VAL 189 363 363 VAL VAL B . n 
B 1 190 GLN 190 364 364 GLN GLN B . n 
B 1 191 GLU 191 365 365 GLU GLU B . n 
B 1 192 MET 192 366 366 MET MET B . n 
B 1 193 ALA 193 367 367 ALA ALA B . n 
B 1 194 LYS 194 368 368 LYS LYS B . n 
B 1 195 LEU 195 369 369 LEU LEU B . n 
B 1 196 ASP 196 370 370 ASP ASP B . n 
B 1 197 ALA 197 371 371 ALA ALA B . n 
B 1 198 LYS 198 372 372 LYS LYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ACT 1   1000 1000 ACT ACT A . 
D 3 EDO 1   1001 1001 EDO EDO A . 
E 2 ACT 1   1000 1000 ACT ACT B . 
F 3 EDO 1   1001 1001 EDO EDO B . 
G 3 EDO 1   1002 1002 EDO EDO B . 
H 4 HOH 1   1101 197  HOH HOH A . 
H 4 HOH 2   1102 4    HOH HOH A . 
H 4 HOH 3   1103 2    HOH HOH A . 
H 4 HOH 4   1104 115  HOH HOH A . 
H 4 HOH 5   1105 69   HOH HOH A . 
H 4 HOH 6   1106 23   HOH HOH A . 
H 4 HOH 7   1107 18   HOH HOH A . 
H 4 HOH 8   1108 28   HOH HOH A . 
H 4 HOH 9   1109 123  HOH HOH A . 
H 4 HOH 10  1110 129  HOH HOH A . 
H 4 HOH 11  1111 32   HOH HOH A . 
H 4 HOH 12  1112 15   HOH HOH A . 
H 4 HOH 13  1113 7    HOH HOH A . 
H 4 HOH 14  1114 26   HOH HOH A . 
H 4 HOH 15  1115 53   HOH HOH A . 
H 4 HOH 16  1116 165  HOH HOH A . 
H 4 HOH 17  1117 62   HOH HOH A . 
H 4 HOH 18  1118 81   HOH HOH A . 
H 4 HOH 19  1119 175  HOH HOH A . 
H 4 HOH 20  1120 101  HOH HOH A . 
H 4 HOH 21  1121 8    HOH HOH A . 
H 4 HOH 22  1122 170  HOH HOH A . 
H 4 HOH 23  1123 183  HOH HOH A . 
H 4 HOH 24  1124 14   HOH HOH A . 
H 4 HOH 25  1125 56   HOH HOH A . 
H 4 HOH 26  1126 9    HOH HOH A . 
H 4 HOH 27  1127 158  HOH HOH A . 
H 4 HOH 28  1128 52   HOH HOH A . 
H 4 HOH 29  1129 178  HOH HOH A . 
H 4 HOH 30  1130 43   HOH HOH A . 
H 4 HOH 31  1131 90   HOH HOH A . 
H 4 HOH 32  1132 196  HOH HOH A . 
H 4 HOH 33  1133 142  HOH HOH A . 
H 4 HOH 34  1134 35   HOH HOH A . 
H 4 HOH 35  1135 13   HOH HOH A . 
H 4 HOH 36  1136 82   HOH HOH A . 
H 4 HOH 37  1137 84   HOH HOH A . 
H 4 HOH 38  1138 157  HOH HOH A . 
H 4 HOH 39  1139 60   HOH HOH A . 
H 4 HOH 40  1140 191  HOH HOH A . 
H 4 HOH 41  1141 121  HOH HOH A . 
H 4 HOH 42  1142 138  HOH HOH A . 
H 4 HOH 43  1143 65   HOH HOH A . 
H 4 HOH 44  1144 152  HOH HOH A . 
H 4 HOH 45  1145 63   HOH HOH A . 
H 4 HOH 46  1146 93   HOH HOH A . 
H 4 HOH 47  1147 103  HOH HOH A . 
H 4 HOH 48  1148 159  HOH HOH A . 
H 4 HOH 49  1149 163  HOH HOH A . 
H 4 HOH 50  1150 24   HOH HOH A . 
H 4 HOH 51  1151 64   HOH HOH A . 
H 4 HOH 52  1152 145  HOH HOH A . 
H 4 HOH 53  1153 108  HOH HOH A . 
H 4 HOH 54  1154 112  HOH HOH A . 
H 4 HOH 55  1155 105  HOH HOH A . 
H 4 HOH 56  1156 22   HOH HOH A . 
H 4 HOH 57  1157 34   HOH HOH A . 
H 4 HOH 58  1158 79   HOH HOH A . 
H 4 HOH 59  1159 6    HOH HOH A . 
H 4 HOH 60  1160 164  HOH HOH A . 
H 4 HOH 61  1161 168  HOH HOH A . 
H 4 HOH 62  1162 104  HOH HOH A . 
H 4 HOH 63  1163 192  HOH HOH A . 
H 4 HOH 64  1164 149  HOH HOH A . 
H 4 HOH 65  1165 109  HOH HOH A . 
H 4 HOH 66  1166 87   HOH HOH A . 
H 4 HOH 67  1167 50   HOH HOH A . 
H 4 HOH 68  1168 88   HOH HOH A . 
H 4 HOH 69  1169 160  HOH HOH A . 
H 4 HOH 70  1170 100  HOH HOH A . 
H 4 HOH 71  1171 3    HOH HOH A . 
H 4 HOH 72  1172 20   HOH HOH A . 
H 4 HOH 73  1173 19   HOH HOH A . 
H 4 HOH 74  1174 150  HOH HOH A . 
H 4 HOH 75  1175 44   HOH HOH A . 
H 4 HOH 76  1176 187  HOH HOH A . 
H 4 HOH 77  1177 31   HOH HOH A . 
H 4 HOH 78  1178 83   HOH HOH A . 
H 4 HOH 79  1179 73   HOH HOH A . 
H 4 HOH 80  1180 71   HOH HOH A . 
H 4 HOH 81  1181 125  HOH HOH A . 
H 4 HOH 82  1182 131  HOH HOH A . 
H 4 HOH 83  1183 99   HOH HOH A . 
H 4 HOH 84  1184 169  HOH HOH A . 
H 4 HOH 85  1185 133  HOH HOH A . 
H 4 HOH 86  1186 174  HOH HOH A . 
H 4 HOH 87  1187 94   HOH HOH A . 
H 4 HOH 88  1188 137  HOH HOH A . 
H 4 HOH 89  1189 135  HOH HOH A . 
H 4 HOH 90  1190 184  HOH HOH A . 
H 4 HOH 91  1191 27   HOH HOH A . 
H 4 HOH 92  1192 11   HOH HOH A . 
H 4 HOH 93  1193 147  HOH HOH A . 
H 4 HOH 94  1194 21   HOH HOH A . 
H 4 HOH 95  1195 76   HOH HOH A . 
H 4 HOH 96  1196 161  HOH HOH A . 
H 4 HOH 97  1197 194  HOH HOH A . 
H 4 HOH 98  1198 111  HOH HOH A . 
H 4 HOH 99  1199 25   HOH HOH A . 
H 4 HOH 100 1200 45   HOH HOH A . 
H 4 HOH 101 1201 36   HOH HOH A . 
H 4 HOH 102 1202 114  HOH HOH A . 
H 4 HOH 103 1203 49   HOH HOH A . 
H 4 HOH 104 1204 33   HOH HOH A . 
H 4 HOH 105 1205 127  HOH HOH A . 
H 4 HOH 106 1206 48   HOH HOH A . 
H 4 HOH 107 1207 162  HOH HOH A . 
H 4 HOH 108 1208 116  HOH HOH A . 
H 4 HOH 109 1209 16   HOH HOH A . 
H 4 HOH 110 1210 42   HOH HOH A . 
H 4 HOH 111 1211 136  HOH HOH A . 
H 4 HOH 112 1212 92   HOH HOH A . 
H 4 HOH 113 1213 176  HOH HOH A . 
H 4 HOH 114 1214 130  HOH HOH A . 
H 4 HOH 115 1215 5    HOH HOH A . 
H 4 HOH 116 1216 171  HOH HOH A . 
H 4 HOH 117 1217 146  HOH HOH A . 
H 4 HOH 118 1218 95   HOH HOH A . 
H 4 HOH 119 1219 102  HOH HOH A . 
H 4 HOH 120 1220 190  HOH HOH A . 
H 4 HOH 121 1221 107  HOH HOH A . 
H 4 HOH 122 1222 117  HOH HOH A . 
H 4 HOH 123 1223 85   HOH HOH A . 
H 4 HOH 124 1224 141  HOH HOH A . 
H 4 HOH 125 1225 37   HOH HOH A . 
H 4 HOH 126 1226 151  HOH HOH A . 
H 4 HOH 127 1227 134  HOH HOH A . 
H 4 HOH 128 1228 58   HOH HOH A . 
H 4 HOH 129 1229 143  HOH HOH A . 
H 4 HOH 130 1230 61   HOH HOH A . 
I 4 HOH 1   1101 1    HOH HOH B . 
I 4 HOH 2   1102 75   HOH HOH B . 
I 4 HOH 3   1103 167  HOH HOH B . 
I 4 HOH 4   1104 66   HOH HOH B . 
I 4 HOH 5   1105 153  HOH HOH B . 
I 4 HOH 6   1106 80   HOH HOH B . 
I 4 HOH 7   1107 148  HOH HOH B . 
I 4 HOH 8   1108 70   HOH HOH B . 
I 4 HOH 9   1109 59   HOH HOH B . 
I 4 HOH 10  1110 39   HOH HOH B . 
I 4 HOH 11  1111 179  HOH HOH B . 
I 4 HOH 12  1112 30   HOH HOH B . 
I 4 HOH 13  1113 29   HOH HOH B . 
I 4 HOH 14  1114 173  HOH HOH B . 
I 4 HOH 15  1115 166  HOH HOH B . 
I 4 HOH 16  1116 177  HOH HOH B . 
I 4 HOH 17  1117 140  HOH HOH B . 
I 4 HOH 18  1118 55   HOH HOH B . 
I 4 HOH 19  1119 128  HOH HOH B . 
I 4 HOH 20  1120 47   HOH HOH B . 
I 4 HOH 21  1121 182  HOH HOH B . 
I 4 HOH 22  1122 106  HOH HOH B . 
I 4 HOH 23  1123 10   HOH HOH B . 
I 4 HOH 24  1124 96   HOH HOH B . 
I 4 HOH 25  1125 89   HOH HOH B . 
I 4 HOH 26  1126 12   HOH HOH B . 
I 4 HOH 27  1127 193  HOH HOH B . 
I 4 HOH 28  1128 98   HOH HOH B . 
I 4 HOH 29  1129 38   HOH HOH B . 
I 4 HOH 30  1130 188  HOH HOH B . 
I 4 HOH 31  1131 124  HOH HOH B . 
I 4 HOH 32  1132 122  HOH HOH B . 
I 4 HOH 33  1133 120  HOH HOH B . 
I 4 HOH 34  1134 195  HOH HOH B . 
I 4 HOH 35  1135 40   HOH HOH B . 
I 4 HOH 36  1136 86   HOH HOH B . 
I 4 HOH 37  1137 97   HOH HOH B . 
I 4 HOH 38  1138 155  HOH HOH B . 
I 4 HOH 39  1139 41   HOH HOH B . 
I 4 HOH 40  1140 57   HOH HOH B . 
I 4 HOH 41  1141 118  HOH HOH B . 
I 4 HOH 42  1142 72   HOH HOH B . 
I 4 HOH 43  1143 113  HOH HOH B . 
I 4 HOH 44  1144 189  HOH HOH B . 
I 4 HOH 45  1145 67   HOH HOH B . 
I 4 HOH 46  1146 172  HOH HOH B . 
I 4 HOH 47  1147 186  HOH HOH B . 
I 4 HOH 48  1148 17   HOH HOH B . 
I 4 HOH 49  1149 91   HOH HOH B . 
I 4 HOH 50  1150 74   HOH HOH B . 
I 4 HOH 51  1151 180  HOH HOH B . 
I 4 HOH 52  1152 154  HOH HOH B . 
I 4 HOH 53  1153 185  HOH HOH B . 
I 4 HOH 54  1154 156  HOH HOH B . 
I 4 HOH 55  1155 77   HOH HOH B . 
I 4 HOH 56  1156 78   HOH HOH B . 
I 4 HOH 57  1157 132  HOH HOH B . 
I 4 HOH 58  1158 126  HOH HOH B . 
I 4 HOH 59  1159 46   HOH HOH B . 
I 4 HOH 60  1160 144  HOH HOH B . 
I 4 HOH 61  1161 51   HOH HOH B . 
I 4 HOH 62  1162 139  HOH HOH B . 
I 4 HOH 63  1163 68   HOH HOH B . 
I 4 HOH 64  1164 119  HOH HOH B . 
I 4 HOH 65  1165 110  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,H   
2 1 B,E,F,G,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-04-04 
2 'Structure model' 1 1 2018-09-12 
3 'Structure model' 1 2 2018-10-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 3 'Structure model' 'Data collection'     
4 3 'Structure model' 'Database references' 
5 3 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
4 3 'Structure model' entity          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_CSD'          
4  2 'Structure model' '_citation.journal_id_ISSN'         
5  2 'Structure model' '_citation.pdbx_database_id_DOI'    
6  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
7  2 'Structure model' '_citation.title'                   
8  2 'Structure model' '_citation.year'                    
9  3 'Structure model' '_citation.journal_volume'          
10 3 'Structure model' '_entity.formula_weight'            
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.3 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .      2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .      3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .      4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 225 ? ? -108.15 69.81   
2 1 GLU A 227 ? ? 68.86   164.29  
3 1 PHE A 354 ? ? -143.26 -15.28  
4 1 THR B 219 ? ? -147.72 -156.24 
5 1 THR B 220 ? ? -107.48 -168.18 
6 1 ALA B 258 ? ? 80.63   -6.02   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B ALA 175 ? B ALA 1 
2 1 Y 1 B GLY 176 ? B GLY 2 
3 1 Y 1 B MET 177 ? B MET 3 
4 1 Y 1 B GLY 178 ? B GLY 4 
5 1 Y 1 B PRO 179 ? B PRO 5 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ACETATE ION'  ACT 
3 1,2-ETHANEDIOL EDO 
4 water          HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#