data_6G0L
# 
_entry.id   6G0L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6G0L         
WWPDB D_1200009234 
EMDB  EMD-4336     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB .                                                                                          EMD-4318 'other EM volume'      
EMDB 'Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome' EMD-4336 'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6G0L 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Sundaramoorthy, R.' 1 0000-0003-4895-0980 
'Owen-hughes, T.'    2 ?                   
'Norman, D.G.'       3 ?                   
'Hughes, A.'         4 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.35720 
_citation.pdbx_database_id_PubMed   30079888 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Sundaramoorthy, R.' 1 ?                   
primary 'Hughes, A.L.'       2 ?                   
primary 'El-Mkami, H.'       3 ?                   
primary 'Norman, D.G.'       4 0000-0002-7658-7720 
primary 'Ferreira, H.'       5 ?                   
primary 'Owen-Hughes, T.'    6 0000-0002-0618-8185 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Histone H3'                         15407.075  2 ?       ? ? 
'Histone H3 sequence from X. Laevis. The N-terminal region from 1-39 is not resolved.' 
2  polymer     man 'Histone H4'                         11394.426  2 ?       ? ? 
'Histone H4 sequence from X. Laevis. The N-terminal region from 1-19 is not resolved.' 
3  polymer     man 'Histone H2A type 1'                 14193.578  1 ?       ? ? ? 
4  polymer     man 'Histone H4'                         13939.228  2 ?       ? ? ? 
5  polymer     man 'Histone H2A type 1'                 14093.436  1 ?       ? ? ? 
6  polymer     syn 'DNA (176-MER)'                      54088.469  1 ?       ? ? ? 
7  polymer     syn 'DNA (177-MER)'                      54885.938  1 ?       ? ? ? 
8  polymer     man 'Chromo domain-containing protein 1' 168496.609 2 3.6.4.- ? ? ? 
9  non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"           427.201    2 ?       ? ? ? 
10 non-polymer syn 'BERYLLIUM TRIFLUORIDE ION'          66.007     2 ?       ? ? ? 
# 
_entity_name_com.entity_id   8 
_entity_name_com.name        'ATP-dependent helicase CHD1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIRGERA
;
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGRVLPNIQSVLLPKKTESAKSAKSK
;
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGRVLPNIQSVLLPKKTESAKSAKSK
;
C   ? 
4 'polypeptide(L)'        no no 
;MPDPAKSAPAAKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;MPDPAKSAPAAKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 'polypeptide(L)'        no no 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
G   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DA)(DC)(DG)(DC)(DG)(DG)(DC)(DC)(DG)(DC)(DC)(DC)(DA)(DT)(DC)(DA)(DG)(DA)
(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)(DG)(DG)(DC)(DC)(DG)(DC)(DT)
(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)(DA)(DC)(DA)(DG)(DC)(DT)(DC)
(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)(DA)(DC)(DG)(DC)(DA)(DC)(DG)
(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)(DC)(DC)(DG)(DC)(DG)(DT)(DT)
(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)(DG)(DG)(DA)(DT)(DT)(DA)(DC)
(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DC)(DA)(DC)(DG)(DT)
(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)(DT)(DC)(DG)(DA)(DT)(DT)
(DA)(DA)(DC)(DG)(DA)(DT)(DG)(DC)(DT)(DG)(DG)(DG)(DC)(DA)(DT)(DA)
;
;ATACGCGGCCGCCCATCAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACG
TACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCGATT
AACGATGCTGGGCATA
;
I   ? 
7 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DG)(DC)(DC)(DC)(DA)(DG)(DC)(DA)(DT)(DC)(DG)(DT)(DT)(DA)(DA)(DT)(DC)
(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)(DA)(DC)(DG)(DT)
(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)(DG)(DT)(DA)(DA)
(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)(DA)(DA)(DC)(DG)
(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)(DC)(DG)(DT)(DG)
(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)(DG)(DA)(DG)(DC)
(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)(DA)(DG)(DC)(DG)
(DG)(DC)(DC)(DT)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)(DT)(DC)(DT)
(DG)(DA)(DT)(DG)(DG)(DG)(DC)(DG)(DG)(DC)(DC)(DG)(DC)(DG)(DT)(DA)(DT)
;
;TATGCCCAGCATCGTTAATCGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACG
CGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTTCGGCACCGGGATTCT
GATGGGCGGCCGCGTAT
;
J   ? 
8 'polypeptide(L)'        no no 
;MAAKDISTEVLQNPELYGLRRSHRAAAHQQNYFNDSDDEDDEDNIKQSRRKRMTTIEDDEDEFEDEEGEEDSGEDEDEED
FEEDDDYYGSPIKQNRSKPKSRTKSKSKSKPKSQSEKQSTVKIPTRFSNRQNKTVNYNIDYSDDDLLESEDDYGSEEALS
EENVHEASANPQPEDFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLK
RLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEAT
WENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILA
DEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK
KTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLM
PGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG
AKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM
VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQ
AMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTAT
DNQKKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDDIIPEEELKKLQDEEQKRKDEEYVKEQ
LEMMNRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARANDMDSIGESEVRALYKAILKFGNLKEILDELIADGT
LPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLF
NFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRD
DPFLGITDKIFLNEVHNPVAKKSASSSDTTPTPSKKGKGITGSSKKVPGAIHLGRRVDYLLSFLRGGLNTKSPSADIGSK
KLPTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSKRMKALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNP
SSGSAHEKEYDSMDEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASPEKYRKHLWS
YSANFWPADVKSTKLMAMYDKITESQKK
;
;MAAKDISTEVLQNPELYGLRRSHRAAAHQQNYFNDSDDEDDEDNIKQSRRKRMTTIEDDEDEFEDEEGEEDSGEDEDEED
FEEDDDYYGSPIKQNRSKPKSRTKSKSKSKPKSQSEKQSTVKIPTRFSNRQNKTVNYNIDYSDDDLLESEDDYGSEEALS
EENVHEASANPQPEDFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLK
RLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEAT
WENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILA
DEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK
KTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLM
PGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG
AKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM
VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQ
AMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTAT
DNQKKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDDIIPEEELKKLQDEEQKRKDEEYVKEQ
LEMMNRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARANDMDSIGESEVRALYKAILKFGNLKEILDELIADGT
LPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLF
NFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRD
DPFLGITDKIFLNEVHNPVAKKSASSSDTTPTPSKKGKGITGSSKKVPGAIHLGRRVDYLLSFLRGGLNTKSPSADIGSK
KLPTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSKRMKALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNP
SSGSAHEKEYDSMDEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASPEKYRKHLWS
YSANFWPADVKSTKLMAMYDKITESQKK
;
M,W ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    ALA n 
1 3    ARG n 
1 4    THR n 
1 5    LYS n 
1 6    GLN n 
1 7    THR n 
1 8    ALA n 
1 9    ARG n 
1 10   LYS n 
1 11   SER n 
1 12   THR n 
1 13   GLY n 
1 14   GLY n 
1 15   LYS n 
1 16   ALA n 
1 17   PRO n 
1 18   ARG n 
1 19   LYS n 
1 20   GLN n 
1 21   LEU n 
1 22   ALA n 
1 23   THR n 
1 24   LYS n 
1 25   ALA n 
1 26   ALA n 
1 27   ARG n 
1 28   LYS n 
1 29   SER n 
1 30   ALA n 
1 31   PRO n 
1 32   ALA n 
1 33   THR n 
1 34   GLY n 
1 35   GLY n 
1 36   VAL n 
1 37   LYS n 
1 38   LYS n 
1 39   PRO n 
1 40   HIS n 
1 41   ARG n 
1 42   TYR n 
1 43   ARG n 
1 44   PRO n 
1 45   GLY n 
1 46   THR n 
1 47   VAL n 
1 48   ALA n 
1 49   LEU n 
1 50   ARG n 
1 51   GLU n 
1 52   ILE n 
1 53   ARG n 
1 54   ARG n 
1 55   TYR n 
1 56   GLN n 
1 57   LYS n 
1 58   SER n 
1 59   THR n 
1 60   GLU n 
1 61   LEU n 
1 62   LEU n 
1 63   ILE n 
1 64   ARG n 
1 65   LYS n 
1 66   LEU n 
1 67   PRO n 
1 68   PHE n 
1 69   GLN n 
1 70   ARG n 
1 71   LEU n 
1 72   VAL n 
1 73   ARG n 
1 74   GLU n 
1 75   ILE n 
1 76   ALA n 
1 77   GLN n 
1 78   ASP n 
1 79   PHE n 
1 80   LYS n 
1 81   THR n 
1 82   ASP n 
1 83   LEU n 
1 84   ARG n 
1 85   PHE n 
1 86   GLN n 
1 87   SER n 
1 88   SER n 
1 89   ALA n 
1 90   VAL n 
1 91   MET n 
1 92   ALA n 
1 93   LEU n 
1 94   GLN n 
1 95   GLU n 
1 96   ALA n 
1 97   SER n 
1 98   GLU n 
1 99   ALA n 
1 100  TYR n 
1 101  LEU n 
1 102  VAL n 
1 103  GLY n 
1 104  LEU n 
1 105  PHE n 
1 106  GLU n 
1 107  ASP n 
1 108  THR n 
1 109  ASN n 
1 110  LEU n 
1 111  CYS n 
1 112  GLY n 
1 113  ILE n 
1 114  HIS n 
1 115  ALA n 
1 116  LYS n 
1 117  ARG n 
1 118  VAL n 
1 119  THR n 
1 120  ILE n 
1 121  MET n 
1 122  PRO n 
1 123  LYS n 
1 124  ASP n 
1 125  ILE n 
1 126  GLN n 
1 127  LEU n 
1 128  ALA n 
1 129  ARG n 
1 130  ARG n 
1 131  ILE n 
1 132  ARG n 
1 133  GLY n 
1 134  GLU n 
1 135  ARG n 
1 136  ALA n 
2 1    MET n 
2 2    SER n 
2 3    GLY n 
2 4    ARG n 
2 5    GLY n 
2 6    LYS n 
2 7    GLY n 
2 8    GLY n 
2 9    LYS n 
2 10   GLY n 
2 11   LEU n 
2 12   GLY n 
2 13   LYS n 
2 14   GLY n 
2 15   GLY n 
2 16   ALA n 
2 17   LYS n 
2 18   ARG n 
2 19   HIS n 
2 20   ARG n 
2 21   LYS n 
2 22   VAL n 
2 23   LEU n 
2 24   ARG n 
2 25   ASP n 
2 26   ASN n 
2 27   ILE n 
2 28   GLN n 
2 29   GLY n 
2 30   ILE n 
2 31   THR n 
2 32   LYS n 
2 33   PRO n 
2 34   ALA n 
2 35   ILE n 
2 36   ARG n 
2 37   ARG n 
2 38   LEU n 
2 39   ALA n 
2 40   ARG n 
2 41   ARG n 
2 42   GLY n 
2 43   GLY n 
2 44   VAL n 
2 45   LYS n 
2 46   ARG n 
2 47   ILE n 
2 48   SER n 
2 49   GLY n 
2 50   LEU n 
2 51   ILE n 
2 52   TYR n 
2 53   GLU n 
2 54   GLU n 
2 55   THR n 
2 56   ARG n 
2 57   GLY n 
2 58   VAL n 
2 59   LEU n 
2 60   LYS n 
2 61   VAL n 
2 62   PHE n 
2 63   LEU n 
2 64   GLU n 
2 65   ASN n 
2 66   VAL n 
2 67   ILE n 
2 68   ARG n 
2 69   ASP n 
2 70   ALA n 
2 71   VAL n 
2 72   THR n 
2 73   TYR n 
2 74   THR n 
2 75   GLU n 
2 76   HIS n 
2 77   ALA n 
2 78   LYS n 
2 79   ARG n 
2 80   LYS n 
2 81   THR n 
2 82   VAL n 
2 83   THR n 
2 84   ALA n 
2 85   MET n 
2 86   ASP n 
2 87   VAL n 
2 88   VAL n 
2 89   TYR n 
2 90   ALA n 
2 91   LEU n 
2 92   LYS n 
2 93   ARG n 
2 94   GLN n 
2 95   GLY n 
2 96   ARG n 
2 97   THR n 
2 98   LEU n 
2 99   TYR n 
2 100  GLY n 
2 101  PHE n 
2 102  GLY n 
2 103  GLY n 
3 1    MET n 
3 2    SER n 
3 3    GLY n 
3 4    ARG n 
3 5    GLY n 
3 6    LYS n 
3 7    GLN n 
3 8    GLY n 
3 9    GLY n 
3 10   LYS n 
3 11   THR n 
3 12   ARG n 
3 13   ALA n 
3 14   LYS n 
3 15   ALA n 
3 16   LYS n 
3 17   THR n 
3 18   ARG n 
3 19   SER n 
3 20   SER n 
3 21   ARG n 
3 22   ALA n 
3 23   GLY n 
3 24   LEU n 
3 25   GLN n 
3 26   PHE n 
3 27   PRO n 
3 28   VAL n 
3 29   GLY n 
3 30   ARG n 
3 31   VAL n 
3 32   HIS n 
3 33   ARG n 
3 34   LEU n 
3 35   LEU n 
3 36   ARG n 
3 37   LYS n 
3 38   GLY n 
3 39   ASN n 
3 40   TYR n 
3 41   ALA n 
3 42   GLU n 
3 43   ARG n 
3 44   VAL n 
3 45   GLY n 
3 46   ALA n 
3 47   GLY n 
3 48   ALA n 
3 49   PRO n 
3 50   VAL n 
3 51   TYR n 
3 52   LEU n 
3 53   ALA n 
3 54   ALA n 
3 55   VAL n 
3 56   LEU n 
3 57   GLU n 
3 58   TYR n 
3 59   LEU n 
3 60   THR n 
3 61   ALA n 
3 62   GLU n 
3 63   ILE n 
3 64   LEU n 
3 65   GLU n 
3 66   LEU n 
3 67   ALA n 
3 68   GLY n 
3 69   ASN n 
3 70   ALA n 
3 71   ALA n 
3 72   ARG n 
3 73   ASP n 
3 74   ASN n 
3 75   LYS n 
3 76   LYS n 
3 77   THR n 
3 78   ARG n 
3 79   ILE n 
3 80   ILE n 
3 81   PRO n 
3 82   ARG n 
3 83   HIS n 
3 84   LEU n 
3 85   GLN n 
3 86   LEU n 
3 87   ALA n 
3 88   VAL n 
3 89   ARG n 
3 90   ASN n 
3 91   ASP n 
3 92   GLU n 
3 93   GLU n 
3 94   LEU n 
3 95   ASN n 
3 96   LYS n 
3 97   LEU n 
3 98   LEU n 
3 99   GLY n 
3 100  ARG n 
3 101  VAL n 
3 102  THR n 
3 103  ILE n 
3 104  ALA n 
3 105  GLN n 
3 106  GLY n 
3 107  ARG n 
3 108  VAL n 
3 109  LEU n 
3 110  PRO n 
3 111  ASN n 
3 112  ILE n 
3 113  GLN n 
3 114  SER n 
3 115  VAL n 
3 116  LEU n 
3 117  LEU n 
3 118  PRO n 
3 119  LYS n 
3 120  LYS n 
3 121  THR n 
3 122  GLU n 
3 123  SER n 
3 124  ALA n 
3 125  LYS n 
3 126  SER n 
3 127  ALA n 
3 128  LYS n 
3 129  SER n 
3 130  LYS n 
4 1    MET n 
4 2    PRO n 
4 3    ASP n 
4 4    PRO n 
4 5    ALA n 
4 6    LYS n 
4 7    SER n 
4 8    ALA n 
4 9    PRO n 
4 10   ALA n 
4 11   ALA n 
4 12   LYS n 
4 13   LYS n 
4 14   GLY n 
4 15   SER n 
4 16   LYS n 
4 17   LYS n 
4 18   ALA n 
4 19   VAL n 
4 20   THR n 
4 21   LYS n 
4 22   THR n 
4 23   GLN n 
4 24   LYS n 
4 25   LYS n 
4 26   ASP n 
4 27   GLY n 
4 28   LYS n 
4 29   LYS n 
4 30   ARG n 
4 31   ARG n 
4 32   LYS n 
4 33   THR n 
4 34   ARG n 
4 35   LYS n 
4 36   GLU n 
4 37   SER n 
4 38   TYR n 
4 39   ALA n 
4 40   ILE n 
4 41   TYR n 
4 42   VAL n 
4 43   TYR n 
4 44   LYS n 
4 45   VAL n 
4 46   LEU n 
4 47   LYS n 
4 48   GLN n 
4 49   VAL n 
4 50   HIS n 
4 51   PRO n 
4 52   ASP n 
4 53   THR n 
4 54   GLY n 
4 55   ILE n 
4 56   SER n 
4 57   SER n 
4 58   LYS n 
4 59   ALA n 
4 60   MET n 
4 61   SER n 
4 62   ILE n 
4 63   MET n 
4 64   ASN n 
4 65   SER n 
4 66   PHE n 
4 67   VAL n 
4 68   ASN n 
4 69   ASP n 
4 70   VAL n 
4 71   PHE n 
4 72   GLU n 
4 73   ARG n 
4 74   ILE n 
4 75   ALA n 
4 76   GLY n 
4 77   GLU n 
4 78   ALA n 
4 79   SER n 
4 80   ARG n 
4 81   LEU n 
4 82   ALA n 
4 83   HIS n 
4 84   TYR n 
4 85   ASN n 
4 86   LYS n 
4 87   ARG n 
4 88   SER n 
4 89   THR n 
4 90   ILE n 
4 91   THR n 
4 92   SER n 
4 93   ARG n 
4 94   GLU n 
4 95   ILE n 
4 96   GLN n 
4 97   THR n 
4 98   ALA n 
4 99   VAL n 
4 100  ARG n 
4 101  LEU n 
4 102  LEU n 
4 103  LEU n 
4 104  PRO n 
4 105  GLY n 
4 106  GLU n 
4 107  LEU n 
4 108  ALA n 
4 109  LYS n 
4 110  HIS n 
4 111  ALA n 
4 112  VAL n 
4 113  SER n 
4 114  GLU n 
4 115  GLY n 
4 116  THR n 
4 117  LYS n 
4 118  ALA n 
4 119  VAL n 
4 120  THR n 
4 121  LYS n 
4 122  TYR n 
4 123  THR n 
4 124  SER n 
4 125  ALA n 
4 126  LYS n 
5 1    MET n 
5 2    SER n 
5 3    GLY n 
5 4    ARG n 
5 5    GLY n 
5 6    LYS n 
5 7    GLN n 
5 8    GLY n 
5 9    GLY n 
5 10   LYS n 
5 11   THR n 
5 12   ARG n 
5 13   ALA n 
5 14   LYS n 
5 15   ALA n 
5 16   LYS n 
5 17   THR n 
5 18   ARG n 
5 19   SER n 
5 20   SER n 
5 21   ARG n 
5 22   ALA n 
5 23   GLY n 
5 24   LEU n 
5 25   GLN n 
5 26   PHE n 
5 27   PRO n 
5 28   VAL n 
5 29   GLY n 
5 30   ARG n 
5 31   VAL n 
5 32   HIS n 
5 33   ARG n 
5 34   LEU n 
5 35   LEU n 
5 36   ARG n 
5 37   LYS n 
5 38   GLY n 
5 39   ASN n 
5 40   TYR n 
5 41   ALA n 
5 42   GLU n 
5 43   ARG n 
5 44   VAL n 
5 45   GLY n 
5 46   ALA n 
5 47   GLY n 
5 48   ALA n 
5 49   PRO n 
5 50   VAL n 
5 51   TYR n 
5 52   LEU n 
5 53   ALA n 
5 54   ALA n 
5 55   VAL n 
5 56   LEU n 
5 57   GLU n 
5 58   TYR n 
5 59   LEU n 
5 60   THR n 
5 61   ALA n 
5 62   GLU n 
5 63   ILE n 
5 64   LEU n 
5 65   GLU n 
5 66   LEU n 
5 67   ALA n 
5 68   GLY n 
5 69   ASN n 
5 70   ALA n 
5 71   ALA n 
5 72   ARG n 
5 73   ASP n 
5 74   ASN n 
5 75   LYS n 
5 76   LYS n 
5 77   THR n 
5 78   ARG n 
5 79   ILE n 
5 80   ILE n 
5 81   PRO n 
5 82   ARG n 
5 83   HIS n 
5 84   LEU n 
5 85   GLN n 
5 86   LEU n 
5 87   ALA n 
5 88   VAL n 
5 89   ARG n 
5 90   ASN n 
5 91   ASP n 
5 92   GLU n 
5 93   GLU n 
5 94   LEU n 
5 95   ASN n 
5 96   LYS n 
5 97   LEU n 
5 98   LEU n 
5 99   GLY n 
5 100  ARG n 
5 101  VAL n 
5 102  THR n 
5 103  ILE n 
5 104  ALA n 
5 105  GLN n 
5 106  GLY n 
5 107  GLY n 
5 108  VAL n 
5 109  LEU n 
5 110  PRO n 
5 111  ASN n 
5 112  ILE n 
5 113  GLN n 
5 114  SER n 
5 115  VAL n 
5 116  LEU n 
5 117  LEU n 
5 118  PRO n 
5 119  LYS n 
5 120  LYS n 
5 121  THR n 
5 122  GLU n 
5 123  SER n 
5 124  ALA n 
5 125  LYS n 
5 126  SER n 
5 127  ALA n 
5 128  LYS n 
5 129  SER n 
5 130  LYS n 
6 1    DA  n 
6 2    DT  n 
6 3    DA  n 
6 4    DC  n 
6 5    DG  n 
6 6    DC  n 
6 7    DG  n 
6 8    DG  n 
6 9    DC  n 
6 10   DC  n 
6 11   DG  n 
6 12   DC  n 
6 13   DC  n 
6 14   DC  n 
6 15   DA  n 
6 16   DT  n 
6 17   DC  n 
6 18   DA  n 
6 19   DG  n 
6 20   DA  n 
6 21   DA  n 
6 22   DT  n 
6 23   DC  n 
6 24   DC  n 
6 25   DC  n 
6 26   DG  n 
6 27   DG  n 
6 28   DT  n 
6 29   DG  n 
6 30   DC  n 
6 31   DC  n 
6 32   DG  n 
6 33   DA  n 
6 34   DG  n 
6 35   DG  n 
6 36   DC  n 
6 37   DC  n 
6 38   DG  n 
6 39   DC  n 
6 40   DT  n 
6 41   DC  n 
6 42   DA  n 
6 43   DA  n 
6 44   DT  n 
6 45   DT  n 
6 46   DG  n 
6 47   DG  n 
6 48   DT  n 
6 49   DC  n 
6 50   DG  n 
6 51   DT  n 
6 52   DA  n 
6 53   DG  n 
6 54   DA  n 
6 55   DC  n 
6 56   DA  n 
6 57   DG  n 
6 58   DC  n 
6 59   DT  n 
6 60   DC  n 
6 61   DT  n 
6 62   DA  n 
6 63   DG  n 
6 64   DC  n 
6 65   DA  n 
6 66   DC  n 
6 67   DC  n 
6 68   DG  n 
6 69   DC  n 
6 70   DT  n 
6 71   DT  n 
6 72   DA  n 
6 73   DA  n 
6 74   DA  n 
6 75   DC  n 
6 76   DG  n 
6 77   DC  n 
6 78   DA  n 
6 79   DC  n 
6 80   DG  n 
6 81   DT  n 
6 82   DA  n 
6 83   DC  n 
6 84   DG  n 
6 85   DC  n 
6 86   DG  n 
6 87   DC  n 
6 88   DT  n 
6 89   DG  n 
6 90   DT  n 
6 91   DC  n 
6 92   DC  n 
6 93   DC  n 
6 94   DC  n 
6 95   DC  n 
6 96   DG  n 
6 97   DC  n 
6 98   DG  n 
6 99   DT  n 
6 100  DT  n 
6 101  DT  n 
6 102  DT  n 
6 103  DA  n 
6 104  DA  n 
6 105  DC  n 
6 106  DC  n 
6 107  DG  n 
6 108  DC  n 
6 109  DC  n 
6 110  DA  n 
6 111  DA  n 
6 112  DG  n 
6 113  DG  n 
6 114  DG  n 
6 115  DG  n 
6 116  DA  n 
6 117  DT  n 
6 118  DT  n 
6 119  DA  n 
6 120  DC  n 
6 121  DT  n 
6 122  DC  n 
6 123  DC  n 
6 124  DC  n 
6 125  DT  n 
6 126  DA  n 
6 127  DG  n 
6 128  DT  n 
6 129  DC  n 
6 130  DT  n 
6 131  DC  n 
6 132  DC  n 
6 133  DA  n 
6 134  DG  n 
6 135  DG  n 
6 136  DC  n 
6 137  DA  n 
6 138  DC  n 
6 139  DG  n 
6 140  DT  n 
6 141  DG  n 
6 142  DT  n 
6 143  DC  n 
6 144  DA  n 
6 145  DG  n 
6 146  DA  n 
6 147  DT  n 
6 148  DA  n 
6 149  DT  n 
6 150  DA  n 
6 151  DT  n 
6 152  DA  n 
6 153  DC  n 
6 154  DA  n 
6 155  DT  n 
6 156  DC  n 
6 157  DG  n 
6 158  DA  n 
6 159  DT  n 
6 160  DT  n 
6 161  DA  n 
6 162  DA  n 
6 163  DC  n 
6 164  DG  n 
6 165  DA  n 
6 166  DT  n 
6 167  DG  n 
6 168  DC  n 
6 169  DT  n 
6 170  DG  n 
6 171  DG  n 
6 172  DG  n 
6 173  DC  n 
6 174  DA  n 
6 175  DT  n 
6 176  DA  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DG  n 
7 5    DC  n 
7 6    DC  n 
7 7    DC  n 
7 8    DA  n 
7 9    DG  n 
7 10   DC  n 
7 11   DA  n 
7 12   DT  n 
7 13   DC  n 
7 14   DG  n 
7 15   DT  n 
7 16   DT  n 
7 17   DA  n 
7 18   DA  n 
7 19   DT  n 
7 20   DC  n 
7 21   DG  n 
7 22   DA  n 
7 23   DT  n 
7 24   DG  n 
7 25   DT  n 
7 26   DA  n 
7 27   DT  n 
7 28   DA  n 
7 29   DT  n 
7 30   DA  n 
7 31   DT  n 
7 32   DC  n 
7 33   DT  n 
7 34   DG  n 
7 35   DA  n 
7 36   DC  n 
7 37   DA  n 
7 38   DC  n 
7 39   DG  n 
7 40   DT  n 
7 41   DG  n 
7 42   DC  n 
7 43   DC  n 
7 44   DT  n 
7 45   DG  n 
7 46   DG  n 
7 47   DA  n 
7 48   DG  n 
7 49   DA  n 
7 50   DC  n 
7 51   DT  n 
7 52   DA  n 
7 53   DG  n 
7 54   DG  n 
7 55   DG  n 
7 56   DA  n 
7 57   DG  n 
7 58   DT  n 
7 59   DA  n 
7 60   DA  n 
7 61   DT  n 
7 62   DC  n 
7 63   DC  n 
7 64   DC  n 
7 65   DC  n 
7 66   DT  n 
7 67   DT  n 
7 68   DG  n 
7 69   DG  n 
7 70   DC  n 
7 71   DG  n 
7 72   DG  n 
7 73   DT  n 
7 74   DT  n 
7 75   DA  n 
7 76   DA  n 
7 77   DA  n 
7 78   DA  n 
7 79   DC  n 
7 80   DG  n 
7 81   DC  n 
7 82   DG  n 
7 83   DG  n 
7 84   DG  n 
7 85   DG  n 
7 86   DG  n 
7 87   DA  n 
7 88   DC  n 
7 89   DA  n 
7 90   DG  n 
7 91   DC  n 
7 92   DG  n 
7 93   DC  n 
7 94   DG  n 
7 95   DT  n 
7 96   DA  n 
7 97   DC  n 
7 98   DG  n 
7 99   DT  n 
7 100  DG  n 
7 101  DC  n 
7 102  DG  n 
7 103  DT  n 
7 104  DT  n 
7 105  DT  n 
7 106  DA  n 
7 107  DA  n 
7 108  DG  n 
7 109  DC  n 
7 110  DG  n 
7 111  DG  n 
7 112  DT  n 
7 113  DG  n 
7 114  DC  n 
7 115  DT  n 
7 116  DA  n 
7 117  DG  n 
7 118  DA  n 
7 119  DG  n 
7 120  DC  n 
7 121  DT  n 
7 122  DG  n 
7 123  DT  n 
7 124  DC  n 
7 125  DT  n 
7 126  DA  n 
7 127  DC  n 
7 128  DG  n 
7 129  DA  n 
7 130  DC  n 
7 131  DC  n 
7 132  DA  n 
7 133  DA  n 
7 134  DT  n 
7 135  DT  n 
7 136  DG  n 
7 137  DA  n 
7 138  DG  n 
7 139  DC  n 
7 140  DG  n 
7 141  DG  n 
7 142  DC  n 
7 143  DC  n 
7 144  DT  n 
7 145  DT  n 
7 146  DC  n 
7 147  DG  n 
7 148  DG  n 
7 149  DC  n 
7 150  DA  n 
7 151  DC  n 
7 152  DC  n 
7 153  DG  n 
7 154  DG  n 
7 155  DG  n 
7 156  DA  n 
7 157  DT  n 
7 158  DT  n 
7 159  DC  n 
7 160  DT  n 
7 161  DG  n 
7 162  DA  n 
7 163  DT  n 
7 164  DG  n 
7 165  DG  n 
7 166  DG  n 
7 167  DC  n 
7 168  DG  n 
7 169  DG  n 
7 170  DC  n 
7 171  DC  n 
7 172  DG  n 
7 173  DC  n 
7 174  DG  n 
7 175  DT  n 
7 176  DA  n 
7 177  DT  n 
8 1    MET n 
8 2    ALA n 
8 3    ALA n 
8 4    LYS n 
8 5    ASP n 
8 6    ILE n 
8 7    SER n 
8 8    THR n 
8 9    GLU n 
8 10   VAL n 
8 11   LEU n 
8 12   GLN n 
8 13   ASN n 
8 14   PRO n 
8 15   GLU n 
8 16   LEU n 
8 17   TYR n 
8 18   GLY n 
8 19   LEU n 
8 20   ARG n 
8 21   ARG n 
8 22   SER n 
8 23   HIS n 
8 24   ARG n 
8 25   ALA n 
8 26   ALA n 
8 27   ALA n 
8 28   HIS n 
8 29   GLN n 
8 30   GLN n 
8 31   ASN n 
8 32   TYR n 
8 33   PHE n 
8 34   ASN n 
8 35   ASP n 
8 36   SER n 
8 37   ASP n 
8 38   ASP n 
8 39   GLU n 
8 40   ASP n 
8 41   ASP n 
8 42   GLU n 
8 43   ASP n 
8 44   ASN n 
8 45   ILE n 
8 46   LYS n 
8 47   GLN n 
8 48   SER n 
8 49   ARG n 
8 50   ARG n 
8 51   LYS n 
8 52   ARG n 
8 53   MET n 
8 54   THR n 
8 55   THR n 
8 56   ILE n 
8 57   GLU n 
8 58   ASP n 
8 59   ASP n 
8 60   GLU n 
8 61   ASP n 
8 62   GLU n 
8 63   PHE n 
8 64   GLU n 
8 65   ASP n 
8 66   GLU n 
8 67   GLU n 
8 68   GLY n 
8 69   GLU n 
8 70   GLU n 
8 71   ASP n 
8 72   SER n 
8 73   GLY n 
8 74   GLU n 
8 75   ASP n 
8 76   GLU n 
8 77   ASP n 
8 78   GLU n 
8 79   GLU n 
8 80   ASP n 
8 81   PHE n 
8 82   GLU n 
8 83   GLU n 
8 84   ASP n 
8 85   ASP n 
8 86   ASP n 
8 87   TYR n 
8 88   TYR n 
8 89   GLY n 
8 90   SER n 
8 91   PRO n 
8 92   ILE n 
8 93   LYS n 
8 94   GLN n 
8 95   ASN n 
8 96   ARG n 
8 97   SER n 
8 98   LYS n 
8 99   PRO n 
8 100  LYS n 
8 101  SER n 
8 102  ARG n 
8 103  THR n 
8 104  LYS n 
8 105  SER n 
8 106  LYS n 
8 107  SER n 
8 108  LYS n 
8 109  SER n 
8 110  LYS n 
8 111  PRO n 
8 112  LYS n 
8 113  SER n 
8 114  GLN n 
8 115  SER n 
8 116  GLU n 
8 117  LYS n 
8 118  GLN n 
8 119  SER n 
8 120  THR n 
8 121  VAL n 
8 122  LYS n 
8 123  ILE n 
8 124  PRO n 
8 125  THR n 
8 126  ARG n 
8 127  PHE n 
8 128  SER n 
8 129  ASN n 
8 130  ARG n 
8 131  GLN n 
8 132  ASN n 
8 133  LYS n 
8 134  THR n 
8 135  VAL n 
8 136  ASN n 
8 137  TYR n 
8 138  ASN n 
8 139  ILE n 
8 140  ASP n 
8 141  TYR n 
8 142  SER n 
8 143  ASP n 
8 144  ASP n 
8 145  ASP n 
8 146  LEU n 
8 147  LEU n 
8 148  GLU n 
8 149  SER n 
8 150  GLU n 
8 151  ASP n 
8 152  ASP n 
8 153  TYR n 
8 154  GLY n 
8 155  SER n 
8 156  GLU n 
8 157  GLU n 
8 158  ALA n 
8 159  LEU n 
8 160  SER n 
8 161  GLU n 
8 162  GLU n 
8 163  ASN n 
8 164  VAL n 
8 165  HIS n 
8 166  GLU n 
8 167  ALA n 
8 168  SER n 
8 169  ALA n 
8 170  ASN n 
8 171  PRO n 
8 172  GLN n 
8 173  PRO n 
8 174  GLU n 
8 175  ASP n 
8 176  PHE n 
8 177  HIS n 
8 178  GLY n 
8 179  ILE n 
8 180  ASP n 
8 181  ILE n 
8 182  VAL n 
8 183  ILE n 
8 184  ASN n 
8 185  HIS n 
8 186  ARG n 
8 187  LEU n 
8 188  LYS n 
8 189  THR n 
8 190  SER n 
8 191  LEU n 
8 192  GLU n 
8 193  GLU n 
8 194  GLY n 
8 195  LYS n 
8 196  VAL n 
8 197  LEU n 
8 198  GLU n 
8 199  LYS n 
8 200  THR n 
8 201  VAL n 
8 202  PRO n 
8 203  ASP n 
8 204  LEU n 
8 205  ASN n 
8 206  ASN n 
8 207  CYS n 
8 208  LYS n 
8 209  GLU n 
8 210  ASN n 
8 211  TYR n 
8 212  GLU n 
8 213  PHE n 
8 214  LEU n 
8 215  ILE n 
8 216  LYS n 
8 217  TRP n 
8 218  THR n 
8 219  ASP n 
8 220  GLU n 
8 221  SER n 
8 222  HIS n 
8 223  LEU n 
8 224  HIS n 
8 225  ASN n 
8 226  THR n 
8 227  TRP n 
8 228  GLU n 
8 229  THR n 
8 230  TYR n 
8 231  GLU n 
8 232  SER n 
8 233  ILE n 
8 234  GLY n 
8 235  GLN n 
8 236  VAL n 
8 237  ARG n 
8 238  GLY n 
8 239  LEU n 
8 240  LYS n 
8 241  ARG n 
8 242  LEU n 
8 243  ASP n 
8 244  ASN n 
8 245  TYR n 
8 246  CYS n 
8 247  LYS n 
8 248  GLN n 
8 249  PHE n 
8 250  ILE n 
8 251  ILE n 
8 252  GLU n 
8 253  ASP n 
8 254  GLN n 
8 255  GLN n 
8 256  VAL n 
8 257  ARG n 
8 258  LEU n 
8 259  ASP n 
8 260  PRO n 
8 261  TYR n 
8 262  VAL n 
8 263  THR n 
8 264  ALA n 
8 265  GLU n 
8 266  ASP n 
8 267  ILE n 
8 268  GLU n 
8 269  ILE n 
8 270  MET n 
8 271  ASP n 
8 272  MET n 
8 273  GLU n 
8 274  ARG n 
8 275  GLU n 
8 276  ARG n 
8 277  ARG n 
8 278  LEU n 
8 279  ASP n 
8 280  GLU n 
8 281  PHE n 
8 282  GLU n 
8 283  GLU n 
8 284  PHE n 
8 285  HIS n 
8 286  VAL n 
8 287  PRO n 
8 288  GLU n 
8 289  ARG n 
8 290  ILE n 
8 291  ILE n 
8 292  ASP n 
8 293  SER n 
8 294  GLN n 
8 295  ARG n 
8 296  ALA n 
8 297  SER n 
8 298  LEU n 
8 299  GLU n 
8 300  ASP n 
8 301  GLY n 
8 302  THR n 
8 303  SER n 
8 304  GLN n 
8 305  LEU n 
8 306  GLN n 
8 307  TYR n 
8 308  LEU n 
8 309  VAL n 
8 310  LYS n 
8 311  TRP n 
8 312  ARG n 
8 313  ARG n 
8 314  LEU n 
8 315  ASN n 
8 316  TYR n 
8 317  ASP n 
8 318  GLU n 
8 319  ALA n 
8 320  THR n 
8 321  TRP n 
8 322  GLU n 
8 323  ASN n 
8 324  ALA n 
8 325  THR n 
8 326  ASP n 
8 327  ILE n 
8 328  VAL n 
8 329  LYS n 
8 330  LEU n 
8 331  ALA n 
8 332  PRO n 
8 333  GLU n 
8 334  GLN n 
8 335  VAL n 
8 336  LYS n 
8 337  HIS n 
8 338  PHE n 
8 339  GLN n 
8 340  ASN n 
8 341  ARG n 
8 342  GLU n 
8 343  ASN n 
8 344  SER n 
8 345  LYS n 
8 346  ILE n 
8 347  LEU n 
8 348  PRO n 
8 349  GLN n 
8 350  TYR n 
8 351  SER n 
8 352  SER n 
8 353  ASN n 
8 354  TYR n 
8 355  THR n 
8 356  SER n 
8 357  GLN n 
8 358  ARG n 
8 359  PRO n 
8 360  ARG n 
8 361  PHE n 
8 362  GLU n 
8 363  LYS n 
8 364  LEU n 
8 365  SER n 
8 366  VAL n 
8 367  GLN n 
8 368  PRO n 
8 369  PRO n 
8 370  PHE n 
8 371  ILE n 
8 372  LYS n 
8 373  GLY n 
8 374  GLY n 
8 375  GLU n 
8 376  LEU n 
8 377  ARG n 
8 378  ASP n 
8 379  PHE n 
8 380  GLN n 
8 381  LEU n 
8 382  THR n 
8 383  GLY n 
8 384  ILE n 
8 385  ASN n 
8 386  TRP n 
8 387  MET n 
8 388  ALA n 
8 389  PHE n 
8 390  LEU n 
8 391  TRP n 
8 392  SER n 
8 393  LYS n 
8 394  GLY n 
8 395  ASP n 
8 396  ASN n 
8 397  GLY n 
8 398  ILE n 
8 399  LEU n 
8 400  ALA n 
8 401  ASP n 
8 402  GLU n 
8 403  MET n 
8 404  GLY n 
8 405  LEU n 
8 406  GLY n 
8 407  LYS n 
8 408  THR n 
8 409  VAL n 
8 410  GLN n 
8 411  THR n 
8 412  VAL n 
8 413  ALA n 
8 414  PHE n 
8 415  ILE n 
8 416  SER n 
8 417  TRP n 
8 418  LEU n 
8 419  ILE n 
8 420  PHE n 
8 421  ALA n 
8 422  ARG n 
8 423  ARG n 
8 424  GLN n 
8 425  ASN n 
8 426  GLY n 
8 427  PRO n 
8 428  HIS n 
8 429  ILE n 
8 430  ILE n 
8 431  VAL n 
8 432  VAL n 
8 433  PRO n 
8 434  LEU n 
8 435  SER n 
8 436  THR n 
8 437  MET n 
8 438  PRO n 
8 439  ALA n 
8 440  TRP n 
8 441  LEU n 
8 442  ASP n 
8 443  THR n 
8 444  PHE n 
8 445  GLU n 
8 446  LYS n 
8 447  TRP n 
8 448  ALA n 
8 449  PRO n 
8 450  ASP n 
8 451  LEU n 
8 452  ASN n 
8 453  CYS n 
8 454  ILE n 
8 455  CYS n 
8 456  TYR n 
8 457  MET n 
8 458  GLY n 
8 459  ASN n 
8 460  GLN n 
8 461  LYS n 
8 462  SER n 
8 463  ARG n 
8 464  ASP n 
8 465  THR n 
8 466  ILE n 
8 467  ARG n 
8 468  GLU n 
8 469  TYR n 
8 470  GLU n 
8 471  PHE n 
8 472  TYR n 
8 473  THR n 
8 474  ASN n 
8 475  PRO n 
8 476  ARG n 
8 477  ALA n 
8 478  LYS n 
8 479  GLY n 
8 480  LYS n 
8 481  LYS n 
8 482  THR n 
8 483  MET n 
8 484  LYS n 
8 485  PHE n 
8 486  ASN n 
8 487  VAL n 
8 488  LEU n 
8 489  LEU n 
8 490  THR n 
8 491  THR n 
8 492  TYR n 
8 493  GLU n 
8 494  TYR n 
8 495  ILE n 
8 496  LEU n 
8 497  LYS n 
8 498  ASP n 
8 499  ARG n 
8 500  ALA n 
8 501  GLU n 
8 502  LEU n 
8 503  GLY n 
8 504  SER n 
8 505  ILE n 
8 506  LYS n 
8 507  TRP n 
8 508  GLN n 
8 509  PHE n 
8 510  MET n 
8 511  ALA n 
8 512  VAL n 
8 513  ASP n 
8 514  GLU n 
8 515  ALA n 
8 516  HIS n 
8 517  ARG n 
8 518  LEU n 
8 519  LYS n 
8 520  ASN n 
8 521  ALA n 
8 522  GLU n 
8 523  SER n 
8 524  SER n 
8 525  LEU n 
8 526  TYR n 
8 527  GLU n 
8 528  SER n 
8 529  LEU n 
8 530  ASN n 
8 531  SER n 
8 532  PHE n 
8 533  LYS n 
8 534  VAL n 
8 535  ALA n 
8 536  ASN n 
8 537  ARG n 
8 538  MET n 
8 539  LEU n 
8 540  ILE n 
8 541  THR n 
8 542  GLY n 
8 543  THR n 
8 544  PRO n 
8 545  LEU n 
8 546  GLN n 
8 547  ASN n 
8 548  ASN n 
8 549  ILE n 
8 550  LYS n 
8 551  GLU n 
8 552  LEU n 
8 553  ALA n 
8 554  ALA n 
8 555  LEU n 
8 556  VAL n 
8 557  ASN n 
8 558  PHE n 
8 559  LEU n 
8 560  MET n 
8 561  PRO n 
8 562  GLY n 
8 563  ARG n 
8 564  PHE n 
8 565  THR n 
8 566  ILE n 
8 567  ASP n 
8 568  GLN n 
8 569  GLU n 
8 570  ILE n 
8 571  ASP n 
8 572  PHE n 
8 573  GLU n 
8 574  ASN n 
8 575  GLN n 
8 576  ASP n 
8 577  GLU n 
8 578  GLU n 
8 579  GLN n 
8 580  GLU n 
8 581  GLU n 
8 582  TYR n 
8 583  ILE n 
8 584  HIS n 
8 585  ASP n 
8 586  LEU n 
8 587  HIS n 
8 588  ARG n 
8 589  ARG n 
8 590  ILE n 
8 591  GLN n 
8 592  PRO n 
8 593  PHE n 
8 594  ILE n 
8 595  LEU n 
8 596  ARG n 
8 597  ARG n 
8 598  LEU n 
8 599  LYS n 
8 600  LYS n 
8 601  ASP n 
8 602  VAL n 
8 603  GLU n 
8 604  LYS n 
8 605  SER n 
8 606  LEU n 
8 607  PRO n 
8 608  SER n 
8 609  LYS n 
8 610  THR n 
8 611  GLU n 
8 612  ARG n 
8 613  ILE n 
8 614  LEU n 
8 615  ARG n 
8 616  VAL n 
8 617  GLU n 
8 618  LEU n 
8 619  SER n 
8 620  ASP n 
8 621  VAL n 
8 622  GLN n 
8 623  THR n 
8 624  GLU n 
8 625  TYR n 
8 626  TYR n 
8 627  LYS n 
8 628  ASN n 
8 629  ILE n 
8 630  LEU n 
8 631  THR n 
8 632  LYS n 
8 633  ASN n 
8 634  TYR n 
8 635  SER n 
8 636  ALA n 
8 637  LEU n 
8 638  THR n 
8 639  ALA n 
8 640  GLY n 
8 641  ALA n 
8 642  LYS n 
8 643  GLY n 
8 644  GLY n 
8 645  HIS n 
8 646  PHE n 
8 647  SER n 
8 648  LEU n 
8 649  LEU n 
8 650  ASN n 
8 651  ILE n 
8 652  MET n 
8 653  ASN n 
8 654  GLU n 
8 655  LEU n 
8 656  LYS n 
8 657  LYS n 
8 658  ALA n 
8 659  SER n 
8 660  ASN n 
8 661  HIS n 
8 662  PRO n 
8 663  TYR n 
8 664  LEU n 
8 665  PHE n 
8 666  ASP n 
8 667  ASN n 
8 668  ALA n 
8 669  GLU n 
8 670  GLU n 
8 671  ARG n 
8 672  VAL n 
8 673  LEU n 
8 674  GLN n 
8 675  LYS n 
8 676  PHE n 
8 677  GLY n 
8 678  ASP n 
8 679  GLY n 
8 680  LYS n 
8 681  MET n 
8 682  THR n 
8 683  ARG n 
8 684  GLU n 
8 685  ASN n 
8 686  VAL n 
8 687  LEU n 
8 688  ARG n 
8 689  GLY n 
8 690  LEU n 
8 691  ILE n 
8 692  MET n 
8 693  SER n 
8 694  SER n 
8 695  GLY n 
8 696  LYS n 
8 697  MET n 
8 698  VAL n 
8 699  LEU n 
8 700  LEU n 
8 701  ASP n 
8 702  GLN n 
8 703  LEU n 
8 704  LEU n 
8 705  THR n 
8 706  ARG n 
8 707  LEU n 
8 708  LYS n 
8 709  LYS n 
8 710  ASP n 
8 711  GLY n 
8 712  HIS n 
8 713  ARG n 
8 714  VAL n 
8 715  LEU n 
8 716  ILE n 
8 717  PHE n 
8 718  SER n 
8 719  GLN n 
8 720  MET n 
8 721  VAL n 
8 722  ARG n 
8 723  MET n 
8 724  LEU n 
8 725  ASP n 
8 726  ILE n 
8 727  LEU n 
8 728  GLY n 
8 729  ASP n 
8 730  TYR n 
8 731  LEU n 
8 732  SER n 
8 733  ILE n 
8 734  LYS n 
8 735  GLY n 
8 736  ILE n 
8 737  ASN n 
8 738  PHE n 
8 739  GLN n 
8 740  ARG n 
8 741  LEU n 
8 742  ASP n 
8 743  GLY n 
8 744  THR n 
8 745  VAL n 
8 746  PRO n 
8 747  SER n 
8 748  ALA n 
8 749  GLN n 
8 750  ARG n 
8 751  ARG n 
8 752  ILE n 
8 753  SER n 
8 754  ILE n 
8 755  ASP n 
8 756  HIS n 
8 757  PHE n 
8 758  ASN n 
8 759  SER n 
8 760  PRO n 
8 761  ASP n 
8 762  SER n 
8 763  ASN n 
8 764  ASP n 
8 765  PHE n 
8 766  VAL n 
8 767  PHE n 
8 768  LEU n 
8 769  LEU n 
8 770  SER n 
8 771  THR n 
8 772  ARG n 
8 773  ALA n 
8 774  GLY n 
8 775  GLY n 
8 776  LEU n 
8 777  GLY n 
8 778  ILE n 
8 779  ASN n 
8 780  LEU n 
8 781  MET n 
8 782  THR n 
8 783  ALA n 
8 784  ASP n 
8 785  THR n 
8 786  VAL n 
8 787  VAL n 
8 788  ILE n 
8 789  PHE n 
8 790  ASP n 
8 791  SER n 
8 792  ASP n 
8 793  TRP n 
8 794  ASN n 
8 795  PRO n 
8 796  GLN n 
8 797  ALA n 
8 798  ASP n 
8 799  LEU n 
8 800  GLN n 
8 801  ALA n 
8 802  MET n 
8 803  ALA n 
8 804  ARG n 
8 805  ALA n 
8 806  HIS n 
8 807  ARG n 
8 808  ILE n 
8 809  GLY n 
8 810  GLN n 
8 811  LYS n 
8 812  ASN n 
8 813  HIS n 
8 814  VAL n 
8 815  MET n 
8 816  VAL n 
8 817  TYR n 
8 818  ARG n 
8 819  LEU n 
8 820  VAL n 
8 821  SER n 
8 822  LYS n 
8 823  ASP n 
8 824  THR n 
8 825  VAL n 
8 826  GLU n 
8 827  GLU n 
8 828  GLU n 
8 829  VAL n 
8 830  LEU n 
8 831  GLU n 
8 832  ARG n 
8 833  ALA n 
8 834  ARG n 
8 835  LYS n 
8 836  LYS n 
8 837  MET n 
8 838  ILE n 
8 839  LEU n 
8 840  GLU n 
8 841  TYR n 
8 842  ALA n 
8 843  ILE n 
8 844  ILE n 
8 845  SER n 
8 846  LEU n 
8 847  GLY n 
8 848  VAL n 
8 849  THR n 
8 850  ASP n 
8 851  GLY n 
8 852  ASN n 
8 853  LYS n 
8 854  TYR n 
8 855  THR n 
8 856  LYS n 
8 857  LYS n 
8 858  ASN n 
8 859  GLU n 
8 860  PRO n 
8 861  ASN n 
8 862  ALA n 
8 863  GLY n 
8 864  GLU n 
8 865  LEU n 
8 866  SER n 
8 867  ALA n 
8 868  ILE n 
8 869  LEU n 
8 870  LYS n 
8 871  PHE n 
8 872  GLY n 
8 873  ALA n 
8 874  GLY n 
8 875  ASN n 
8 876  MET n 
8 877  PHE n 
8 878  THR n 
8 879  ALA n 
8 880  THR n 
8 881  ASP n 
8 882  ASN n 
8 883  GLN n 
8 884  LYS n 
8 885  LYS n 
8 886  LEU n 
8 887  GLU n 
8 888  ASP n 
8 889  LEU n 
8 890  ASN n 
8 891  LEU n 
8 892  ASP n 
8 893  ASP n 
8 894  VAL n 
8 895  LEU n 
8 896  ASN n 
8 897  HIS n 
8 898  ALA n 
8 899  GLU n 
8 900  ASP n 
8 901  HIS n 
8 902  VAL n 
8 903  THR n 
8 904  THR n 
8 905  PRO n 
8 906  ASP n 
8 907  LEU n 
8 908  GLY n 
8 909  GLU n 
8 910  SER n 
8 911  HIS n 
8 912  LEU n 
8 913  GLY n 
8 914  GLY n 
8 915  GLU n 
8 916  GLU n 
8 917  PHE n 
8 918  LEU n 
8 919  LYS n 
8 920  GLN n 
8 921  PHE n 
8 922  GLU n 
8 923  VAL n 
8 924  THR n 
8 925  ASP n 
8 926  TYR n 
8 927  LYS n 
8 928  ALA n 
8 929  ASP n 
8 930  ILE n 
8 931  ASP n 
8 932  TRP n 
8 933  ASP n 
8 934  ASP n 
8 935  ILE n 
8 936  ILE n 
8 937  PRO n 
8 938  GLU n 
8 939  GLU n 
8 940  GLU n 
8 941  LEU n 
8 942  LYS n 
8 943  LYS n 
8 944  LEU n 
8 945  GLN n 
8 946  ASP n 
8 947  GLU n 
8 948  GLU n 
8 949  GLN n 
8 950  LYS n 
8 951  ARG n 
8 952  LYS n 
8 953  ASP n 
8 954  GLU n 
8 955  GLU n 
8 956  TYR n 
8 957  VAL n 
8 958  LYS n 
8 959  GLU n 
8 960  GLN n 
8 961  LEU n 
8 962  GLU n 
8 963  MET n 
8 964  MET n 
8 965  ASN n 
8 966  ARG n 
8 967  ARG n 
8 968  ASP n 
8 969  ASN n 
8 970  ALA n 
8 971  LEU n 
8 972  LYS n 
8 973  LYS n 
8 974  ILE n 
8 975  LYS n 
8 976  ASN n 
8 977  SER n 
8 978  VAL n 
8 979  ASN n 
8 980  GLY n 
8 981  ASP n 
8 982  GLY n 
8 983  THR n 
8 984  ALA n 
8 985  ALA n 
8 986  ASN n 
8 987  SER n 
8 988  ASP n 
8 989  SER n 
8 990  ASP n 
8 991  ASP n 
8 992  ASP n 
8 993  SER n 
8 994  THR n 
8 995  SER n 
8 996  ARG n 
8 997  SER n 
8 998  SER n 
8 999  ARG n 
8 1000 ARG n 
8 1001 ARG n 
8 1002 ALA n 
8 1003 ARG n 
8 1004 ALA n 
8 1005 ASN n 
8 1006 ASP n 
8 1007 MET n 
8 1008 ASP n 
8 1009 SER n 
8 1010 ILE n 
8 1011 GLY n 
8 1012 GLU n 
8 1013 SER n 
8 1014 GLU n 
8 1015 VAL n 
8 1016 ARG n 
8 1017 ALA n 
8 1018 LEU n 
8 1019 TYR n 
8 1020 LYS n 
8 1021 ALA n 
8 1022 ILE n 
8 1023 LEU n 
8 1024 LYS n 
8 1025 PHE n 
8 1026 GLY n 
8 1027 ASN n 
8 1028 LEU n 
8 1029 LYS n 
8 1030 GLU n 
8 1031 ILE n 
8 1032 LEU n 
8 1033 ASP n 
8 1034 GLU n 
8 1035 LEU n 
8 1036 ILE n 
8 1037 ALA n 
8 1038 ASP n 
8 1039 GLY n 
8 1040 THR n 
8 1041 LEU n 
8 1042 PRO n 
8 1043 VAL n 
8 1044 LYS n 
8 1045 SER n 
8 1046 PHE n 
8 1047 GLU n 
8 1048 LYS n 
8 1049 TYR n 
8 1050 GLY n 
8 1051 GLU n 
8 1052 THR n 
8 1053 TYR n 
8 1054 ASP n 
8 1055 GLU n 
8 1056 MET n 
8 1057 MET n 
8 1058 GLU n 
8 1059 ALA n 
8 1060 ALA n 
8 1061 LYS n 
8 1062 ASP n 
8 1063 CYS n 
8 1064 VAL n 
8 1065 HIS n 
8 1066 GLU n 
8 1067 GLU n 
8 1068 GLU n 
8 1069 LYS n 
8 1070 ASN n 
8 1071 ARG n 
8 1072 LYS n 
8 1073 GLU n 
8 1074 ILE n 
8 1075 LEU n 
8 1076 GLU n 
8 1077 LYS n 
8 1078 LEU n 
8 1079 GLU n 
8 1080 LYS n 
8 1081 HIS n 
8 1082 ALA n 
8 1083 THR n 
8 1084 ALA n 
8 1085 TYR n 
8 1086 ARG n 
8 1087 ALA n 
8 1088 LYS n 
8 1089 LEU n 
8 1090 LYS n 
8 1091 SER n 
8 1092 GLY n 
8 1093 GLU n 
8 1094 ILE n 
8 1095 LYS n 
8 1096 ALA n 
8 1097 GLU n 
8 1098 ASN n 
8 1099 GLN n 
8 1100 PRO n 
8 1101 LYS n 
8 1102 ASP n 
8 1103 ASN n 
8 1104 PRO n 
8 1105 LEU n 
8 1106 THR n 
8 1107 ARG n 
8 1108 LEU n 
8 1109 SER n 
8 1110 LEU n 
8 1111 LYS n 
8 1112 LYS n 
8 1113 ARG n 
8 1114 GLU n 
8 1115 LYS n 
8 1116 LYS n 
8 1117 ALA n 
8 1118 VAL n 
8 1119 LEU n 
8 1120 PHE n 
8 1121 ASN n 
8 1122 PHE n 
8 1123 LYS n 
8 1124 GLY n 
8 1125 VAL n 
8 1126 LYS n 
8 1127 SER n 
8 1128 LEU n 
8 1129 ASN n 
8 1130 ALA n 
8 1131 GLU n 
8 1132 SER n 
8 1133 LEU n 
8 1134 LEU n 
8 1135 SER n 
8 1136 ARG n 
8 1137 VAL n 
8 1138 GLU n 
8 1139 ASP n 
8 1140 LEU n 
8 1141 LYS n 
8 1142 TYR n 
8 1143 LEU n 
8 1144 LYS n 
8 1145 ASN n 
8 1146 LEU n 
8 1147 ILE n 
8 1148 ASN n 
8 1149 SER n 
8 1150 ASN n 
8 1151 TYR n 
8 1152 LYS n 
8 1153 ASP n 
8 1154 ASP n 
8 1155 PRO n 
8 1156 LEU n 
8 1157 LYS n 
8 1158 PHE n 
8 1159 SER n 
8 1160 LEU n 
8 1161 GLY n 
8 1162 ASN n 
8 1163 ASN n 
8 1164 THR n 
8 1165 PRO n 
8 1166 LYS n 
8 1167 PRO n 
8 1168 VAL n 
8 1169 GLN n 
8 1170 ASN n 
8 1171 TRP n 
8 1172 SER n 
8 1173 SER n 
8 1174 ASN n 
8 1175 TRP n 
8 1176 THR n 
8 1177 LYS n 
8 1178 GLU n 
8 1179 GLU n 
8 1180 ASP n 
8 1181 GLU n 
8 1182 LYS n 
8 1183 LEU n 
8 1184 LEU n 
8 1185 ILE n 
8 1186 GLY n 
8 1187 VAL n 
8 1188 PHE n 
8 1189 LYS n 
8 1190 TYR n 
8 1191 GLY n 
8 1192 TYR n 
8 1193 GLY n 
8 1194 SER n 
8 1195 TRP n 
8 1196 THR n 
8 1197 GLN n 
8 1198 ILE n 
8 1199 ARG n 
8 1200 ASP n 
8 1201 ASP n 
8 1202 PRO n 
8 1203 PHE n 
8 1204 LEU n 
8 1205 GLY n 
8 1206 ILE n 
8 1207 THR n 
8 1208 ASP n 
8 1209 LYS n 
8 1210 ILE n 
8 1211 PHE n 
8 1212 LEU n 
8 1213 ASN n 
8 1214 GLU n 
8 1215 VAL n 
8 1216 HIS n 
8 1217 ASN n 
8 1218 PRO n 
8 1219 VAL n 
8 1220 ALA n 
8 1221 LYS n 
8 1222 LYS n 
8 1223 SER n 
8 1224 ALA n 
8 1225 SER n 
8 1226 SER n 
8 1227 SER n 
8 1228 ASP n 
8 1229 THR n 
8 1230 THR n 
8 1231 PRO n 
8 1232 THR n 
8 1233 PRO n 
8 1234 SER n 
8 1235 LYS n 
8 1236 LYS n 
8 1237 GLY n 
8 1238 LYS n 
8 1239 GLY n 
8 1240 ILE n 
8 1241 THR n 
8 1242 GLY n 
8 1243 SER n 
8 1244 SER n 
8 1245 LYS n 
8 1246 LYS n 
8 1247 VAL n 
8 1248 PRO n 
8 1249 GLY n 
8 1250 ALA n 
8 1251 ILE n 
8 1252 HIS n 
8 1253 LEU n 
8 1254 GLY n 
8 1255 ARG n 
8 1256 ARG n 
8 1257 VAL n 
8 1258 ASP n 
8 1259 TYR n 
8 1260 LEU n 
8 1261 LEU n 
8 1262 SER n 
8 1263 PHE n 
8 1264 LEU n 
8 1265 ARG n 
8 1266 GLY n 
8 1267 GLY n 
8 1268 LEU n 
8 1269 ASN n 
8 1270 THR n 
8 1271 LYS n 
8 1272 SER n 
8 1273 PRO n 
8 1274 SER n 
8 1275 ALA n 
8 1276 ASP n 
8 1277 ILE n 
8 1278 GLY n 
8 1279 SER n 
8 1280 LYS n 
8 1281 LYS n 
8 1282 LEU n 
8 1283 PRO n 
8 1284 THR n 
8 1285 GLY n 
8 1286 PRO n 
8 1287 SER n 
8 1288 LYS n 
8 1289 LYS n 
8 1290 ARG n 
8 1291 GLN n 
8 1292 ARG n 
8 1293 LYS n 
8 1294 PRO n 
8 1295 ALA n 
8 1296 ASN n 
8 1297 HIS n 
8 1298 SER n 
8 1299 LYS n 
8 1300 SER n 
8 1301 MET n 
8 1302 THR n 
8 1303 PRO n 
8 1304 GLU n 
8 1305 ILE n 
8 1306 THR n 
8 1307 SER n 
8 1308 SER n 
8 1309 GLU n 
8 1310 PRO n 
8 1311 ALA n 
8 1312 ASN n 
8 1313 GLY n 
8 1314 PRO n 
8 1315 PRO n 
8 1316 SER n 
8 1317 LYS n 
8 1318 ARG n 
8 1319 MET n 
8 1320 LYS n 
8 1321 ALA n 
8 1322 LEU n 
8 1323 PRO n 
8 1324 LYS n 
8 1325 GLY n 
8 1326 PRO n 
8 1327 ALA n 
8 1328 ALA n 
8 1329 LEU n 
8 1330 ILE n 
8 1331 ASN n 
8 1332 ASN n 
8 1333 THR n 
8 1334 ARG n 
8 1335 LEU n 
8 1336 SER n 
8 1337 PRO n 
8 1338 ASN n 
8 1339 SER n 
8 1340 PRO n 
8 1341 THR n 
8 1342 PRO n 
8 1343 PRO n 
8 1344 LEU n 
8 1345 LYS n 
8 1346 SER n 
8 1347 LYS n 
8 1348 VAL n 
8 1349 SER n 
8 1350 ARG n 
8 1351 ASP n 
8 1352 ASN n 
8 1353 GLY n 
8 1354 THR n 
8 1355 ARG n 
8 1356 GLN n 
8 1357 SER n 
8 1358 SER n 
8 1359 ASN n 
8 1360 PRO n 
8 1361 SER n 
8 1362 SER n 
8 1363 GLY n 
8 1364 SER n 
8 1365 ALA n 
8 1366 HIS n 
8 1367 GLU n 
8 1368 LYS n 
8 1369 GLU n 
8 1370 TYR n 
8 1371 ASP n 
8 1372 SER n 
8 1373 MET n 
8 1374 ASP n 
8 1375 GLU n 
8 1376 GLU n 
8 1377 ASP n 
8 1378 CYS n 
8 1379 ARG n 
8 1380 HIS n 
8 1381 THR n 
8 1382 MET n 
8 1383 SER n 
8 1384 ALA n 
8 1385 ILE n 
8 1386 ARG n 
8 1387 THR n 
8 1388 SER n 
8 1389 LEU n 
8 1390 LYS n 
8 1391 ARG n 
8 1392 LEU n 
8 1393 ARG n 
8 1394 ARG n 
8 1395 GLY n 
8 1396 GLY n 
8 1397 LYS n 
8 1398 SER n 
8 1399 LEU n 
8 1400 ASP n 
8 1401 ARG n 
8 1402 LYS n 
8 1403 GLU n 
8 1404 TRP n 
8 1405 ALA n 
8 1406 LYS n 
8 1407 ILE n 
8 1408 LEU n 
8 1409 LYS n 
8 1410 THR n 
8 1411 GLU n 
8 1412 LEU n 
8 1413 THR n 
8 1414 THR n 
8 1415 ILE n 
8 1416 GLY n 
8 1417 ASN n 
8 1418 HIS n 
8 1419 ILE n 
8 1420 GLU n 
8 1421 SER n 
8 1422 GLN n 
8 1423 LYS n 
8 1424 GLY n 
8 1425 SER n 
8 1426 SER n 
8 1427 ARG n 
8 1428 LYS n 
8 1429 ALA n 
8 1430 SER n 
8 1431 PRO n 
8 1432 GLU n 
8 1433 LYS n 
8 1434 TYR n 
8 1435 ARG n 
8 1436 LYS n 
8 1437 HIS n 
8 1438 LEU n 
8 1439 TRP n 
8 1440 SER n 
8 1441 TYR n 
8 1442 SER n 
8 1443 ALA n 
8 1444 ASN n 
8 1445 PHE n 
8 1446 TRP n 
8 1447 PRO n 
8 1448 ALA n 
8 1449 ASP n 
8 1450 VAL n 
8 1451 LYS n 
8 1452 SER n 
8 1453 THR n 
8 1454 LYS n 
8 1455 LEU n 
8 1456 MET n 
8 1457 ALA n 
8 1458 MET n 
8 1459 TYR n 
8 1460 ASP n 
8 1461 LYS n 
8 1462 ILE n 
8 1463 THR n 
8 1464 GLU n 
8 1465 SER n 
8 1466 GLN n 
8 1467 LYS n 
8 1468 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 136  'African clawed frog' ? 'hist1h3g, H3l'            ? ? ? ? ? ? 'Xenopus laevis' 8355   ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 103  'African clawed frog' ? ?                          ? ? ? ? ? ? 'Xenopus laevis' 8355   ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 130  'African clawed frog' ? ?                          ? ? ? ? ? ? 'Xenopus laevis' 8355   ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 126  'African clawed frog' ? XELAEV_18028549mg          ? ? ? ? ? ? 'Xenopus laevis' 8355   ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 130  'African clawed frog' ? ?                          ? ? ? ? ? ? 'Xenopus laevis' 8355   ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8 1 sample 'Biological sequence' 1 1468 ?                     ? 'CHD1, YER164W, SYGP-ORF4' ? ? ? ? ? ? 
'Saccharomyces cerevisiae S288C' 559292 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample ? ? 'synthetic construct' ? 32630 ? 
7 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q92133_XENLA     Q92133     ? 1 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIRGERA
;
1 
2 UNP H4_XENLA         P62799     ? 2 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1 
3 UNP H2A1_XENLA       P06897     ? 3 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
1 
4 UNP A0A1L8G0X3_XENLA A0A1L8G0X3 ? 4 
;MPDPAKSAPAAKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
1 
5 UNP H2A1_XENLA       P06897     ? 5 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
1 
6 PDB 6G0L             6G0L       ? 6 ? 1 
7 PDB 6G0L             6G0L       ? 7 ? 1 
8 UNP CHD1_YEAST       P32657     ? 8 
;MAAKDISTEVLQNPELYGLRRSHRAAAHQQNYFNDSDDEDDEDNIKQSRRKRMTTIEDDEDEFEDEEGEEDSGEDEDEED
FEEDDDYYGSPIKQNRSKPKSRTKSKSKSKPKSQSEKQSTVKIPTRFSNRQNKTVNYNIDYSDDDLLESEDDYGSEEALS
EENVHEASANPQPEDFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLK
RLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEAT
WENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILA
DEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK
KTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLM
PGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG
AKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM
VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQ
AMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTAT
DNQKKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDDIIPEEELKKLQDEEQKRKDEEYVKEQ
LEMMNRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARANDMDSIGESEVRALYKAILKFGNLKEILDELIADGT
LPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLF
NFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRD
DPFLGITDKIFLNEVHNPVAKKSASSSDTTPTPSKKGKGITGSSKKVPGAIHLGRRVDYLLSFLRGGLNTKSPSADIGSK
KLPTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSKRMKALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNP
SSGSAHEKEYDSMDEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASPEKYRKHLWS
YSANFWPADVKSTKLMAMYDKITESQKK
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6G0L A 1 ? 136  ? Q92133     1   ? 136  ? 0   135  
2  2 6G0L B 1 ? 103  ? P62799     1   ? 103  ? 0   102  
3  3 6G0L C 1 ? 130  ? P06897     1   ? 130  ? 0   129  
4  4 6G0L D 1 ? 126  ? A0A1L8G0X3 1   ? 126  ? -3  122  
5  1 6G0L E 1 ? 136  ? Q92133     1   ? 136  ? 0   135  
6  2 6G0L F 1 ? 103  ? P62799     1   ? 103  ? 0   102  
7  5 6G0L G 1 ? 130  ? P06897     1   ? 130  ? 0   129  
8  4 6G0L H 1 ? 126  ? A0A1L8G0X3 1   ? 126  ? -3  122  
9  6 6G0L I 1 ? 176  ? 6G0L       -86 ? 89   ? -86 89   
10 7 6G0L J 1 ? 177  ? 6G0L       -89 ? 87   ? -89 87   
11 8 6G0L M 1 ? 1468 ? P32657     1   ? 1468 ? 1   1468 
12 8 6G0L W 1 ? 1468 ? P32657     1   ? 1468 ? 1   1467 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 6G0L ARG C 100 ? UNP P06897     GLY 100 conflict 99  1 
3 6G0L ARG C 107 ? UNP P06897     GLY 107 conflict 106 2 
4 6G0L THR D 33  ? UNP A0A1L8G0X3 SER 33  conflict 29  3 
7 6G0L ARG G 100 ? UNP P06897     GLY 100 conflict 99  4 
8 6G0L THR H 33  ? UNP A0A1L8G0X3 SER 33  conflict 29  5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"           ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
BEF non-polymer         . 'BERYLLIUM TRIFLUORIDE ION'          ? 'Be F3 -1'          66.007  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6G0L 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6G0L 
_struct.title                        'Structure of two molecules of the chromatin remodelling enzyme Chd1 bound to a nucleosome' 
_struct.pdbx_descriptor              
'Histone H3.3C, Histone H4, Histone H2A type 1, Histone H2B, Chromatin-remodeling ATPase, Polyubiquitin-B/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6G0L 
_struct_keywords.text            'Chromatin remodellers, MOTOR PROTEIN' 
_struct_keywords.pdbx_keywords   'MOTOR PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 1  ? 
F N N 2  ? 
G N N 5  ? 
H N N 4  ? 
I N N 6  ? 
J N N 7  ? 
K N N 8  ? 
L N N 8  ? 
M N N 9  ? 
N N N 10 ? 
O N N 10 ? 
P N N 9  ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 VAL A 47   ? SER A 58   ? VAL A 46   SER A 57   1 ? 12 
HELX_P HELX_P2   AA2 ARG A 64   ? LYS A 80   ? ARG A 63   LYS A 79   1 ? 17 
HELX_P HELX_P3   AA3 GLN A 86   ? ALA A 115  ? GLN A 85   ALA A 114  1 ? 30 
HELX_P HELX_P4   AA4 MET A 121  ? GLY A 133  ? MET A 120  GLY A 132  1 ? 13 
HELX_P HELX_P5   AA5 ASN B 26   ? ILE B 30   ? ASN B 25   ILE B 29   5 ? 5  
HELX_P HELX_P6   AA6 THR B 31   ? GLY B 43   ? THR B 30   GLY B 42   1 ? 13 
HELX_P HELX_P7   AA7 LEU B 50   ? ALA B 77   ? LEU B 49   ALA B 76   1 ? 28 
HELX_P HELX_P8   AA8 THR B 83   ? GLY B 95   ? THR B 82   GLY B 94   1 ? 13 
HELX_P HELX_P9   AA9 ARG C 18   ? GLY C 23   ? ARG C 17   GLY C 22   1 ? 6  
HELX_P HELX_P10  AB1 PRO C 27   ? GLY C 38   ? PRO C 26   GLY C 37   1 ? 12 
HELX_P HELX_P11  AB2 GLY C 47   ? ASN C 74   ? GLY C 46   ASN C 73   1 ? 28 
HELX_P HELX_P12  AB3 ILE C 80   ? ASP C 91   ? ILE C 79   ASP C 90   1 ? 12 
HELX_P HELX_P13  AB4 GLU C 92   ? LEU C 98   ? GLU C 91   LEU C 97   1 ? 7  
HELX_P HELX_P14  AB5 TYR D 38   ? HIS D 50   ? TYR D 34   HIS D 46   1 ? 13 
HELX_P HELX_P15  AB6 LYS D 58   ? HIS D 83   ? LYS D 54   HIS D 79   1 ? 26 
HELX_P HELX_P16  AB7 THR D 91   ? LEU D 103  ? THR D 87   LEU D 99   1 ? 13 
HELX_P HELX_P17  AB8 PRO D 104  ? ALA D 125  ? PRO D 100  ALA D 121  1 ? 22 
HELX_P HELX_P18  AB9 LEU E 49   ? SER E 58   ? LEU E 48   SER E 57   1 ? 10 
HELX_P HELX_P19  AC1 LEU E 66   ? LYS E 80   ? LEU E 65   LYS E 79   1 ? 15 
HELX_P HELX_P20  AC2 GLN E 86   ? ALA E 115  ? GLN E 85   ALA E 114  1 ? 30 
HELX_P HELX_P21  AC3 LYS E 123  ? GLY E 133  ? LYS E 122  GLY E 132  1 ? 11 
HELX_P HELX_P22  AC4 THR F 31   ? GLY F 43   ? THR F 30   GLY F 42   1 ? 13 
HELX_P HELX_P23  AC5 SER F 48   ? ALA F 77   ? SER F 47   ALA F 76   1 ? 30 
HELX_P HELX_P24  AC6 THR F 83   ? GLN F 94   ? THR F 82   GLN F 93   1 ? 12 
HELX_P HELX_P25  AC7 THR G 17   ? ALA G 22   ? THR G 16   ALA G 21   1 ? 6  
HELX_P HELX_P26  AC8 PRO G 27   ? LEU G 35   ? PRO G 26   LEU G 34   1 ? 9  
HELX_P HELX_P27  AC9 GLY G 47   ? ASN G 74   ? GLY G 46   ASN G 73   1 ? 28 
HELX_P HELX_P28  AD1 ILE G 80   ? ASP G 91   ? ILE G 79   ASP G 90   1 ? 12 
HELX_P HELX_P29  AD2 ASP G 91   ? GLY G 99   ? ASP G 90   GLY G 98   1 ? 9  
HELX_P HELX_P30  AD3 TYR H 38   ? HIS H 50   ? TYR H 34   HIS H 46   1 ? 13 
HELX_P HELX_P31  AD4 SER H 56   ? ASN H 85   ? SER H 52   ASN H 81   1 ? 30 
HELX_P HELX_P32  AD5 ARG H 93   ? LEU H 103  ? ARG H 89   LEU H 99   1 ? 11 
HELX_P HELX_P33  AD6 PRO H 104  ? ALA H 125  ? PRO H 100  ALA H 121  1 ? 22 
HELX_P HELX_P34  AD7 ASP K 203  ? ASN K 210  ? ASP M 203  ASN M 210  1 ? 8  
HELX_P HELX_P35  AD8 SER K 221  ? ASN K 225  ? SER M 221  ASN M 225  5 ? 5  
HELX_P HELX_P36  AD9 LEU K 239  ? ARG K 257  ? LEU M 239  ARG M 257  1 ? 19 
HELX_P HELX_P37  AE1 ALA K 264  ? GLU K 282  ? ALA M 264  GLU M 282  1 ? 19 
HELX_P HELX_P38  AE2 GLU K 283  ? HIS K 285  ? GLU M 283  HIS M 285  5 ? 3  
HELX_P HELX_P39  AE3 ALA K 331  ? SER K 344  ? ALA M 331  SER M 344  1 ? 14 
HELX_P HELX_P40  AE4 LEU K 347  ? SER K 351  ? LEU M 347  SER M 351  5 ? 5  
HELX_P HELX_P41  AE5 ASP K 378  ? SER K 392  ? ASP M 378  SER M 392  1 ? 15 
HELX_P HELX_P42  AE6 GLY K 406  ? ARG K 422  ? GLY M 406  ARG M 422  1 ? 17 
HELX_P HELX_P43  AE7 THR K 436  ? ALA K 448  ? THR M 436  ALA M 448  1 ? 13 
HELX_P HELX_P44  AE8 GLN K 460  ? PHE K 471  ? GLN M 460  PHE M 471  1 ? 12 
HELX_P HELX_P45  AE9 THR K 491  ? ASP K 498  ? THR M 491  ASP M 498  1 ? 8  
HELX_P HELX_P46  AF1 ARG K 499  ? SER K 504  ? ARG M 499  SER M 504  1 ? 6  
HELX_P HELX_P47  AF2 ALA K 515  ? ASN K 520  ? ALA M 515  ASN M 520  5 ? 6  
HELX_P HELX_P48  AF3 SER K 523  ? ASN K 530  ? SER M 523  ASN M 530  1 ? 8  
HELX_P HELX_P49  AF4 ASN K 548  ? MET K 560  ? ASN M 548  MET M 560  1 ? 13 
HELX_P HELX_P50  AF5 GLU K 578  ? GLN K 591  ? GLU M 578  GLN M 591  1 ? 14 
HELX_P HELX_P51  AF6 LEU K 598  ? LEU K 606  ? LEU M 598  LEU M 606  5 ? 9  
HELX_P HELX_P52  AF7 SER K 619  ? ASN K 628  ? SER M 619  ASN M 628  1 ? 10 
HELX_P HELX_P53  AF8 MET K 652  ? ALA K 658  ? MET M 652  ALA M 658  1 ? 7  
HELX_P HELX_P54  AF9 ALA K 668  ? LEU K 673  ? ALA M 668  LEU M 673  1 ? 6  
HELX_P HELX_P55  AG1 ARG K 683  ? MET K 692  ? ARG M 683  MET M 692  1 ? 10 
HELX_P HELX_P56  AG2 SER K 694  ? LYS K 709  ? SER M 694  LYS M 709  1 ? 16 
HELX_P HELX_P57  AG3 MET K 720  ? LEU K 731  ? MET M 720  LEU M 731  1 ? 12 
HELX_P HELX_P58  AG4 PRO K 746  ? ASN K 758  ? PRO M 746  ASN M 758  1 ? 13 
HELX_P HELX_P59  AG5 GLN K 796  ? ALA K 803  ? GLN M 796  ALA M 803  1 ? 8  
HELX_P HELX_P60  AG6 VAL K 825  ? LYS K 836  ? VAL M 825  LYS M 836  1 ? 12 
HELX_P HELX_P61  AG7 GLY K 1011 ? GLY K 1026 ? GLY M 1011 GLY M 1026 1 ? 16 
HELX_P HELX_P62  AG8 ILE K 1031 ? ALA K 1037 ? ILE M 1031 ALA M 1037 1 ? 7  
HELX_P HELX_P63  AG9 SER K 1045 ? LYS K 1090 ? SER M 1045 LYS M 1090 1 ? 46 
HELX_P HELX_P64  AH1 ASN K 1103 ? ARG K 1113 ? ASN M 1103 ARG M 1113 1 ? 11 
HELX_P HELX_P65  AH2 ALA K 1130 ? SER K 1149 ? ALA M 1130 SER M 1149 1 ? 20 
HELX_P HELX_P66  AH3 ASP K 1154 ? PHE K 1158 ? ASP M 1154 PHE M 1158 5 ? 5  
HELX_P HELX_P67  AH4 THR K 1176 ? TYR K 1190 ? THR M 1176 TYR M 1190 1 ? 15 
HELX_P HELX_P68  AH5 SER K 1194 ? ARG K 1199 ? SER M 1194 ARG M 1199 1 ? 6  
HELX_P HELX_P69  AH6 ILE K 1206 ? ILE K 1210 ? ILE M 1206 ILE M 1210 5 ? 5  
HELX_P HELX_P70  AH7 GLY K 1249 ? GLY K 1266 ? GLY M 1249 GLY M 1266 1 ? 18 
HELX_P HELX_P71  AH8 ASP L 203  ? ASN L 210  ? ASP W 203  ASN W 210  1 ? 8  
HELX_P HELX_P72  AH9 LEU L 239  ? GLN L 255  ? LEU W 239  GLN W 255  1 ? 17 
HELX_P HELX_P73  AI1 ALA L 264  ? GLU L 283  ? ALA W 264  GLU W 283  1 ? 20 
HELX_P HELX_P74  AI2 ALA L 331  ? SER L 344  ? ALA W 331  SER W 344  1 ? 14 
HELX_P HELX_P75  AI3 GLY L 383  ? ALA L 388  ? GLY W 383  ALA W 388  1 ? 6  
HELX_P HELX_P76  AI4 GLY L 406  ? TRP L 417  ? GLY W 406  TRP W 417  1 ? 12 
HELX_P HELX_P77  AI5 THR L 436  ? LYS L 446  ? THR W 436  LYS W 446  1 ? 11 
HELX_P HELX_P78  AI6 GLN L 460  ? TYR L 469  ? GLN W 460  TYR W 469  1 ? 10 
HELX_P HELX_P79  AI7 THR L 491  ? ASP L 498  ? THR W 491  ASP W 498  1 ? 8  
HELX_P HELX_P80  AI8 ASP L 498  ? ILE L 505  ? ASP W 498  ILE W 505  1 ? 8  
HELX_P HELX_P81  AI9 ASN L 548  ? MET L 560  ? ASN W 548  MET W 560  1 ? 13 
HELX_P HELX_P82  AJ1 GLU L 578  ? GLN L 591  ? GLU W 578  GLN W 591  1 ? 14 
HELX_P HELX_P83  AJ2 SER L 619  ? ASN L 628  ? SER W 619  ASN W 628  1 ? 10 
HELX_P HELX_P84  AJ3 ILE L 629  ? THR L 631  ? ILE W 629  THR W 631  5 ? 3  
HELX_P HELX_P85  AJ4 ALA L 639  ? ASN L 653  ? ALA W 639  ASN W 653  1 ? 15 
HELX_P HELX_P86  AJ5 ALA L 668  ? LEU L 673  ? ALA W 668  LEU W 673  1 ? 6  
HELX_P HELX_P87  AJ6 ARG L 683  ? SER L 693  ? ARG W 683  SER W 693  1 ? 11 
HELX_P HELX_P88  AJ7 SER L 694  ? LYS L 709  ? SER W 694  LYS W 709  1 ? 16 
HELX_P HELX_P89  AJ8 MET L 720  ? SER L 732  ? MET W 720  SER W 732  1 ? 13 
HELX_P HELX_P90  AJ9 PRO L 746  ? SER L 759  ? PRO W 746  SER W 759  1 ? 14 
HELX_P HELX_P91  AK1 GLN L 796  ? MET L 802  ? GLN W 796  MET W 802  1 ? 7  
HELX_P HELX_P92  AK2 VAL L 825  ? ILE L 838  ? VAL W 825  ILE W 838  1 ? 14 
HELX_P HELX_P93  AK3 GLY L 1011 ? GLY L 1026 ? GLY W 1010 GLY W 1025 1 ? 16 
HELX_P HELX_P94  AK4 ILE L 1031 ? ASP L 1038 ? ILE W 1030 ASP W 1037 1 ? 8  
HELX_P HELX_P95  AK5 SER L 1045 ? GLY L 1092 ? SER W 1044 GLY W 1091 1 ? 48 
HELX_P HELX_P96  AK6 ASN L 1103 ? ARG L 1113 ? ASN W 1102 ARG W 1112 1 ? 11 
HELX_P HELX_P97  AK7 ALA L 1130 ? SER L 1149 ? ALA W 1129 SER W 1148 1 ? 20 
HELX_P HELX_P98  AK8 ASP L 1154 ? PHE L 1158 ? ASP W 1153 PHE W 1157 5 ? 5  
HELX_P HELX_P99  AK9 THR L 1176 ? GLY L 1191 ? THR W 1175 GLY W 1190 1 ? 16 
HELX_P HELX_P100 AL1 TRP L 1195 ? ASP L 1201 ? TRP W 1194 ASP W 1200 1 ? 7  
HELX_P HELX_P101 AL2 GLY L 1249 ? GLY L 1266 ? GLY W 1248 GLY W 1265 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1   disulf ? ? L CYS 207 SG  ? ? ? 1_555 L CYS 246 SG  ? ? W CYS 207  W CYS 246  1_555 ? ? ? ? ? ? ?                       
2.823 ? 
metalc1   metalc ? ? M ADP .   O2B ? ? ? 1_555 N BEF .   BE  ? ? M ADP 1501 M BEF 1502 1_555 ? ? ? ? ? ? ?                       
1.908 ? 
metalc2   metalc ? ? O BEF .   BE  ? ? ? 1_555 P ADP .   O2B ? ? W BEF 1501 W ADP 1502 1_555 ? ? ? ? ? ? ?                       
1.835 ? 
hydrog1   hydrog ? ? I DA  1   N3  ? ? ? 1_555 J DT  177 N3  ? ? I DA  -86  J DT  87   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog2   hydrog ? ? I DA  3   N1  ? ? ? 1_555 J DA  176 N6  ? ? I DA  -84  J DA  86   1_555 ? ? ? ? ? ? 'DA-DA MISPAIR'         ? 
? 
hydrog3   hydrog ? ? I DC  4   O2  ? ? ? 1_555 J DG  174 N2  ? ? I DC  -83  J DG  84   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog4   hydrog ? ? I DC  6   O2  ? ? ? 1_555 J DG  172 N2  ? ? I DC  -81  J DG  82   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog5   hydrog ? ? I DG  7   N2  ? ? ? 1_555 J DG  172 N3  ? ? I DG  -80  J DG  82   1_555 ? ? ? ? ? ? TYPE_4_PAIR             ? 
? 
hydrog6   hydrog ? ? I DG  7   N3  ? ? ? 1_555 J DG  172 N2  ? ? I DG  -80  J DG  82   1_555 ? ? ? ? ? ? TYPE_4_PAIR             ? 
? 
hydrog7   hydrog ? ? I DG  8   O6  ? ? ? 1_555 J DG  169 N1  ? ? I DG  -79  J DG  79   1_555 ? ? ? ? ? ? 'DG-DG MISPAIR'         ? 
? 
hydrog8   hydrog ? ? I DG  8   N2  ? ? ? 1_555 J DC  170 N3  ? ? I DG  -79  J DC  80   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog9   hydrog ? ? I DC  9   N3  ? ? ? 1_555 J DG  168 N1  ? ? I DC  -78  J DG  78   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog10  hydrog ? ? I DC  9   N4  ? ? ? 1_555 J DG  168 O6  ? ? I DC  -78  J DG  78   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog11  hydrog ? ? I DC  9   O2  ? ? ? 1_555 J DG  168 N2  ? ? I DC  -78  J DG  78   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog12  hydrog ? ? I DC  9   N3  ? ? ? 1_555 J DG  169 N1  ? ? I DC  -78  J DG  79   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog13  hydrog ? ? I DC  9   N4  ? ? ? 1_555 J DG  169 O6  ? ? I DC  -78  J DG  79   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog14  hydrog ? ? I DC  9   O2  ? ? ? 1_555 J DG  169 N2  ? ? I DC  -78  J DG  79   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog15  hydrog ? ? I DC  10  N3  ? ? ? 1_555 J DG  168 N2  ? ? I DC  -77  J DG  78   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog16  hydrog ? ? I DC  10  O2  ? ? ? 1_555 J DG  168 N1  ? ? I DC  -77  J DG  78   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog17  hydrog ? ? I DG  11  O6  ? ? ? 1_555 J DG  166 N1  ? ? I DG  -76  J DG  76   1_555 ? ? ? ? ? ? 'DG-DG MISPAIR'         ? 
? 
hydrog18  hydrog ? ? I DG  11  N2  ? ? ? 1_555 J DC  167 O2  ? ? I DG  -76  J DC  77   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog19  hydrog ? ? I DC  12  O2  ? ? ? 1_555 J DG  166 N2  ? ? I DC  -75  J DG  76   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog20  hydrog ? ? I DC  13  N3  ? ? ? 1_555 J DG  164 N1  ? ? I DC  -74  J DG  74   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog21  hydrog ? ? I DC  13  N4  ? ? ? 1_555 J DG  164 O6  ? ? I DC  -74  J DG  74   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog22  hydrog ? ? I DC  13  O2  ? ? ? 1_555 J DG  164 N2  ? ? I DC  -74  J DG  74   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog23  hydrog ? ? I DC  14  N3  ? ? ? 1_555 J DG  164 N2  ? ? I DC  -73  J DG  74   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog24  hydrog ? ? I DC  14  O2  ? ? ? 1_555 J DG  164 N1  ? ? I DC  -73  J DG  74   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog25  hydrog ? ? I DA  15  N1  ? ? ? 1_555 J DT  163 N3  ? ? I DA  -72  J DT  73   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog26  hydrog ? ? I DC  17  N3  ? ? ? 1_555 J DG  161 N2  ? ? I DC  -70  J DG  71   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog27  hydrog ? ? I DC  17  O2  ? ? ? 1_555 J DG  161 N1  ? ? I DC  -70  J DG  71   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog28  hydrog ? ? I DA  18  N1  ? ? ? 1_555 J DT  160 N3  ? ? I DA  -69  J DT  70   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog29  hydrog ? ? I DA  18  N3  ? ? ? 1_555 J DG  161 N2  ? ? I DA  -69  J DG  71   1_555 ? ? ? ? ? ? 'DA-DG MISPAIR'         ? 
? 
hydrog30  hydrog ? ? I DG  19  N2  ? ? ? 1_555 J DT  158 O2  ? ? I DG  -68  J DT  68   1_555 ? ? ? ? ? ? 'DG-DT MISPAIR'         ? 
? 
hydrog31  hydrog ? ? I DA  20  N1  ? ? ? 1_555 J DT  157 N3  ? ? I DA  -67  J DT  67   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog32  hydrog ? ? I DA  20  N1  ? ? ? 1_555 J DT  158 N3  ? ? I DA  -67  J DT  68   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog33  hydrog ? ? I DT  22  O2  ? ? ? 1_555 J DG  155 N2  ? ? I DT  -65  J DG  65   1_555 ? ? ? ? ? ? 'DT-DG MISPAIR'         ? 
? 
hydrog34  hydrog ? ? I DC  23  O2  ? ? ? 1_555 J DG  155 N2  ? ? I DC  -64  J DG  65   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog35  hydrog ? ? I DC  24  N3  ? ? ? 1_555 J DG  153 N1  ? ? I DC  -63  J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog36  hydrog ? ? I DC  24  N4  ? ? ? 1_555 J DG  153 O6  ? ? I DC  -63  J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog37  hydrog ? ? I DC  24  O2  ? ? ? 1_555 J DG  153 N2  ? ? I DC  -63  J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog38  hydrog ? ? I DC  25  N3  ? ? ? 1_555 J DG  153 N2  ? ? I DC  -62  J DG  63   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog39  hydrog ? ? I DC  25  O2  ? ? ? 1_555 J DG  153 N1  ? ? I DC  -62  J DG  63   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog40  hydrog ? ? I DG  26  N2  ? ? ? 1_555 J DC  151 O2  ? ? I DG  -61  J DC  61   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog41  hydrog ? ? I DG  27  N1  ? ? ? 1_555 J DA  150 N1  ? ? I DG  -60  J DA  60   1_555 ? ? ? ? ? ? 'DG-DA MISPAIR'         ? 
? 
hydrog42  hydrog ? ? I DG  27  N2  ? ? ? 1_555 J DC  151 O2  ? ? I DG  -60  J DC  61   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog43  hydrog ? ? I DG  29  N2  ? ? ? 1_555 J DC  149 N3  ? ? I DG  -58  J DC  59   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog44  hydrog ? ? I DG  29  N2  ? ? ? 1_555 J DA  150 N1  ? ? I DG  -58  J DA  60   1_555 ? ? ? ? ? ? 'DG-DA MISPAIR'         ? 
? 
hydrog45  hydrog ? ? I DC  30  O2  ? ? ? 1_555 J DG  147 N2  ? ? I DC  -57  J DG  57   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog46  hydrog ? ? I DC  30  O2  ? ? ? 1_555 J DG  148 N2  ? ? I DC  -57  J DG  58   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog47  hydrog ? ? I DC  31  N3  ? ? ? 1_555 J DG  147 N2  ? ? I DC  -56  J DG  57   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog48  hydrog ? ? I DG  32  N2  ? ? ? 1_555 J DT  145 O2  ? ? I DG  -55  J DT  55   1_555 ? ? ? ? ? ? 'DG-DT MISPAIR'         ? 
? 
hydrog49  hydrog ? ? I DG  32  N2  ? ? ? 1_555 J DC  146 O2  ? ? I DG  -55  J DC  56   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog50  hydrog ? ? I DA  33  N1  ? ? ? 1_555 J DT  144 N3  ? ? I DA  -54  J DT  54   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog51  hydrog ? ? I DG  34  N1  ? ? ? 1_555 J DT  144 O2  ? ? I DG  -53  J DT  54   1_555 ? ? ? ? ? ? 'DG-DT MISPAIR'         ? 
? 
hydrog52  hydrog ? ? I DC  37  O2  ? ? ? 1_555 J DG  141 N2  ? ? I DC  -50  J DG  51   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog53  hydrog ? ? I DG  38  N1  ? ? ? 1_555 J DC  139 N3  ? ? I DG  -49  J DC  49   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog54  hydrog ? ? I DG  38  N2  ? ? ? 1_555 J DC  139 O2  ? ? I DG  -49  J DC  49   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog55  hydrog ? ? I DG  38  O6  ? ? ? 1_555 J DC  139 N4  ? ? I DG  -49  J DC  49   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog56  hydrog ? ? I DC  39  O2  ? ? ? 1_555 J DG  138 N2  ? ? I DC  -48  J DG  48   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog57  hydrog ? ? I DT  40  N3  ? ? ? 1_555 J DA  137 N1  ? ? I DT  -47  J DA  47   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog58  hydrog ? ? I DT  40  O4  ? ? ? 1_555 J DA  137 N6  ? ? I DT  -47  J DA  47   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog59  hydrog ? ? I DC  41  O2  ? ? ? 1_555 J DG  136 N2  ? ? I DC  -46  J DG  46   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog60  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J DT  135 N3  ? ? I DA  -45  J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog61  hydrog ? ? I DA  42  N6  ? ? ? 1_555 J DT  135 O4  ? ? I DA  -45  J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog62  hydrog ? ? I DA  43  N1  ? ? ? 1_555 J DT  134 N3  ? ? I DA  -44  J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog63  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J DT  134 O4  ? ? I DA  -44  J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog64  hydrog ? ? I DT  44  N3  ? ? ? 1_555 J DA  133 N1  ? ? I DT  -43  J DA  43   1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? 
? 
hydrog65  hydrog ? ? I DT  45  N3  ? ? ? 1_555 J DA  132 N1  ? ? I DT  -42  J DA  42   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog66  hydrog ? ? I DT  45  O4  ? ? ? 1_555 J DA  132 N6  ? ? I DT  -42  J DA  42   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog67  hydrog ? ? I DG  46  N2  ? ? ? 1_555 J DC  131 O2  ? ? I DG  -41  J DC  41   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog68  hydrog ? ? I DG  47  N1  ? ? ? 1_555 J DC  130 N3  ? ? I DG  -40  J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog69  hydrog ? ? I DG  47  N2  ? ? ? 1_555 J DC  130 O2  ? ? I DG  -40  J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog70  hydrog ? ? I DG  47  O6  ? ? ? 1_555 J DC  130 N4  ? ? I DG  -40  J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog71  hydrog ? ? I DT  48  N3  ? ? ? 1_555 J DA  129 N1  ? ? I DT  -39  J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog72  hydrog ? ? I DT  48  O4  ? ? ? 1_555 J DA  129 N6  ? ? I DT  -39  J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog73  hydrog ? ? I DC  49  N3  ? ? ? 1_555 J DG  128 N1  ? ? I DC  -38  J DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog74  hydrog ? ? I DC  49  N4  ? ? ? 1_555 J DG  128 O6  ? ? I DC  -38  J DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog75  hydrog ? ? I DC  49  O2  ? ? ? 1_555 J DG  128 N2  ? ? I DC  -38  J DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog76  hydrog ? ? I DG  50  N2  ? ? ? 1_555 J DC  127 O2  ? ? I DG  -37  J DC  37   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog77  hydrog ? ? I DT  51  N3  ? ? ? 1_555 J DA  126 N1  ? ? I DT  -36  J DA  36   1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? 
? 
hydrog78  hydrog ? ? I DA  52  N1  ? ? ? 1_555 J DT  125 N3  ? ? I DA  -35  J DT  35   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog79  hydrog ? ? I DA  52  N6  ? ? ? 1_555 J DT  125 O4  ? ? I DA  -35  J DT  35   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog80  hydrog ? ? I DG  53  N2  ? ? ? 1_555 J DC  124 O2  ? ? I DG  -34  J DC  34   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog81  hydrog ? ? I DA  54  N1  ? ? ? 1_555 J DG  122 N1  ? ? I DA  -33  J DG  32   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog82  hydrog ? ? I DA  54  N6  ? ? ? 1_555 J DG  122 O6  ? ? I DA  -33  J DG  32   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog83  hydrog ? ? I DC  55  N3  ? ? ? 1_555 J DG  122 N1  ? ? I DC  -32  J DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog84  hydrog ? ? I DC  55  N4  ? ? ? 1_555 J DG  122 O6  ? ? I DC  -32  J DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog85  hydrog ? ? I DC  55  O2  ? ? ? 1_555 J DG  122 N2  ? ? I DC  -32  J DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog86  hydrog ? ? I DA  56  N1  ? ? ? 1_555 J DT  121 N3  ? ? I DA  -31  J DT  31   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog87  hydrog ? ? I DG  57  N1  ? ? ? 1_555 J DC  120 N3  ? ? I DG  -30  J DC  30   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog88  hydrog ? ? I DG  57  N2  ? ? ? 1_555 J DC  120 O2  ? ? I DG  -30  J DC  30   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog89  hydrog ? ? I DG  57  O6  ? ? ? 1_555 J DC  120 N4  ? ? I DG  -30  J DC  30   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog90  hydrog ? ? I DC  58  O2  ? ? ? 1_555 J DG  119 N2  ? ? I DC  -29  J DG  29   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog91  hydrog ? ? I DT  59  O2  ? ? ? 1_555 J DG  119 N2  ? ? I DT  -28  J DG  29   1_555 ? ? ? ? ? ? 'DT-DG MISPAIR'         ? 
? 
hydrog92  hydrog ? ? I DC  60  O2  ? ? ? 1_555 J DG  117 N2  ? ? I DC  -27  J DG  27   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog93  hydrog ? ? I DT  61  N3  ? ? ? 1_555 J DA  116 N1  ? ? I DT  -26  J DA  26   1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? 
? 
hydrog94  hydrog ? ? I DA  62  N1  ? ? ? 1_555 J DT  115 N3  ? ? I DA  -25  J DT  25   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog95  hydrog ? ? I DG  63  N1  ? ? ? 1_555 J DC  114 N3  ? ? I DG  -24  J DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog96  hydrog ? ? I DG  63  N2  ? ? ? 1_555 J DC  114 O2  ? ? I DG  -24  J DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog97  hydrog ? ? I DG  63  O6  ? ? ? 1_555 J DC  114 N4  ? ? I DG  -24  J DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog98  hydrog ? ? I DC  64  N3  ? ? ? 1_555 J DG  113 N1  ? ? I DC  -23  J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog99  hydrog ? ? I DC  64  N4  ? ? ? 1_555 J DG  113 O6  ? ? I DC  -23  J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog100 hydrog ? ? I DC  64  O2  ? ? ? 1_555 J DG  113 N2  ? ? I DC  -23  J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog101 hydrog ? ? I DA  65  N1  ? ? ? 1_555 J DT  112 N3  ? ? I DA  -22  J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog102 hydrog ? ? I DA  65  N6  ? ? ? 1_555 J DT  112 O4  ? ? I DA  -22  J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog103 hydrog ? ? I DC  66  N3  ? ? ? 1_555 J DG  111 N1  ? ? I DC  -21  J DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog104 hydrog ? ? I DC  66  N4  ? ? ? 1_555 J DG  111 O6  ? ? I DC  -21  J DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog105 hydrog ? ? I DC  66  O2  ? ? ? 1_555 J DG  111 N2  ? ? I DC  -21  J DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog106 hydrog ? ? I DC  67  N3  ? ? ? 1_555 J DG  110 N2  ? ? I DC  -20  J DG  20   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog107 hydrog ? ? I DC  67  N3  ? ? ? 1_555 J DG  111 N1  ? ? I DC  -20  J DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog108 hydrog ? ? I DC  67  N4  ? ? ? 1_555 J DG  111 O6  ? ? I DC  -20  J DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog109 hydrog ? ? I DC  67  O2  ? ? ? 1_555 J DG  111 N2  ? ? I DC  -20  J DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog110 hydrog ? ? I DG  68  N1  ? ? ? 1_555 J DC  109 N3  ? ? I DG  -19  J DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog111 hydrog ? ? I DG  68  N2  ? ? ? 1_555 J DC  109 O2  ? ? I DG  -19  J DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog112 hydrog ? ? I DG  68  O6  ? ? ? 1_555 J DC  109 N4  ? ? I DG  -19  J DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog113 hydrog ? ? I DT  71  N3  ? ? ? 1_555 J DA  106 N1  ? ? I DT  -16  J DA  16   1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? 
? 
hydrog114 hydrog ? ? I DA  72  N6  ? ? ? 1_555 J DT  104 O4  ? ? I DA  -15  J DT  14   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog115 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J DT  104 N3  ? ? I DA  -14  J DT  14   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog116 hydrog ? ? I DA  74  N1  ? ? ? 1_555 J DT  103 N3  ? ? I DA  -13  J DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog117 hydrog ? ? I DA  74  N6  ? ? ? 1_555 J DT  103 O4  ? ? I DA  -13  J DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog118 hydrog ? ? I DC  75  N3  ? ? ? 1_555 J DG  102 N1  ? ? I DC  -12  J DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog119 hydrog ? ? I DC  75  N4  ? ? ? 1_555 J DG  102 O6  ? ? I DC  -12  J DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog120 hydrog ? ? I DC  75  O2  ? ? ? 1_555 J DG  102 N2  ? ? I DC  -12  J DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog121 hydrog ? ? I DG  76  N1  ? ? ? 1_555 J DC  101 N3  ? ? I DG  -11  J DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog122 hydrog ? ? I DG  76  N2  ? ? ? 1_555 J DC  101 O2  ? ? I DG  -11  J DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog123 hydrog ? ? I DG  76  O6  ? ? ? 1_555 J DC  101 N4  ? ? I DG  -11  J DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog124 hydrog ? ? I DC  77  N3  ? ? ? 1_555 J DG  100 N1  ? ? I DC  -10  J DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog125 hydrog ? ? I DC  77  N4  ? ? ? 1_555 J DG  100 O6  ? ? I DC  -10  J DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog126 hydrog ? ? I DC  77  O2  ? ? ? 1_555 J DG  100 N2  ? ? I DC  -10  J DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog127 hydrog ? ? I DC  79  O2  ? ? ? 1_555 J DG  98  N2  ? ? I DC  -8   J DG  8    1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog128 hydrog ? ? I DG  80  N2  ? ? ? 1_555 J DC  97  O2  ? ? I DG  -7   J DC  7    1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog129 hydrog ? ? I DT  81  N3  ? ? ? 1_555 J DA  96  N1  ? ? I DT  -6   J DA  6    1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? 
? 
hydrog130 hydrog ? ? I DA  82  N1  ? ? ? 1_555 J DT  95  N3  ? ? I DA  -5   J DT  5    1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog131 hydrog ? ? I DC  83  N3  ? ? ? 1_555 J DG  94  N1  ? ? I DC  -4   J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog132 hydrog ? ? I DC  83  N4  ? ? ? 1_555 J DG  94  O6  ? ? I DC  -4   J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog133 hydrog ? ? I DC  83  O2  ? ? ? 1_555 J DG  94  N2  ? ? I DC  -4   J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog134 hydrog ? ? I DG  84  N1  ? ? ? 1_555 J DC  93  N3  ? ? I DG  -3   J DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog135 hydrog ? ? I DG  84  N2  ? ? ? 1_555 J DC  93  O2  ? ? I DG  -3   J DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog136 hydrog ? ? I DG  84  O6  ? ? ? 1_555 J DC  93  N4  ? ? I DG  -3   J DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog137 hydrog ? ? I DC  85  O2  ? ? ? 1_555 J DG  92  N2  ? ? I DC  -2   J DG  2    1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog138 hydrog ? ? I DG  86  N1  ? ? ? 1_555 J DC  91  N3  ? ? I DG  -1   J DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog139 hydrog ? ? I DG  86  N2  ? ? ? 1_555 J DC  91  O2  ? ? I DG  -1   J DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog140 hydrog ? ? I DG  86  O6  ? ? ? 1_555 J DC  91  N4  ? ? I DG  -1   J DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog141 hydrog ? ? I DC  87  N3  ? ? ? 1_555 J DG  90  N1  ? ? I DC  0    J DG  0    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog142 hydrog ? ? I DC  87  N4  ? ? ? 1_555 J DG  90  O6  ? ? I DC  0    J DG  0    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog143 hydrog ? ? I DC  87  O2  ? ? ? 1_555 J DG  90  N2  ? ? I DC  0    J DG  0    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog144 hydrog ? ? I DT  88  N3  ? ? ? 1_555 J DA  89  N1  ? ? I DT  1    J DA  -1   1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? 
? 
hydrog145 hydrog ? ? I DG  89  N2  ? ? ? 1_555 J DC  88  O2  ? ? I DG  2    J DC  -2   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog146 hydrog ? ? I DT  90  N3  ? ? ? 1_555 J DA  87  N1  ? ? I DT  3    J DA  -3   1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? 
? 
hydrog147 hydrog ? ? I DC  91  N4  ? ? ? 1_555 J DG  85  O6  ? ? I DC  4    J DG  -5   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog148 hydrog ? ? I DC  92  N3  ? ? ? 1_555 J DG  84  N1  ? ? I DC  5    J DG  -6   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog149 hydrog ? ? I DC  92  N4  ? ? ? 1_555 J DG  84  O6  ? ? I DC  5    J DG  -6   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog150 hydrog ? ? I DC  92  O2  ? ? ? 1_555 J DG  84  N2  ? ? I DC  5    J DG  -6   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog151 hydrog ? ? I DC  93  O2  ? ? ? 1_555 J DG  84  N2  ? ? I DC  6    J DG  -6   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog152 hydrog ? ? I DC  94  N3  ? ? ? 1_555 J DG  83  N1  ? ? I DC  7    J DG  -7   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog153 hydrog ? ? I DC  94  N4  ? ? ? 1_555 J DG  83  O6  ? ? I DC  7    J DG  -7   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog154 hydrog ? ? I DC  94  O2  ? ? ? 1_555 J DG  83  N2  ? ? I DC  7    J DG  -7   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog155 hydrog ? ? I DC  95  N3  ? ? ? 1_555 J DG  82  N1  ? ? I DC  8    J DG  -8   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog156 hydrog ? ? I DC  95  N4  ? ? ? 1_555 J DG  82  O6  ? ? I DC  8    J DG  -8   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog157 hydrog ? ? I DC  95  O2  ? ? ? 1_555 J DG  82  N2  ? ? I DC  8    J DG  -8   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog158 hydrog ? ? I DG  96  N2  ? ? ? 1_555 J DC  81  O2  ? ? I DG  9    J DC  -9   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog159 hydrog ? ? I DC  97  N3  ? ? ? 1_555 J DG  80  N1  ? ? I DC  10   J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog160 hydrog ? ? I DC  97  N4  ? ? ? 1_555 J DG  80  O6  ? ? I DC  10   J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog161 hydrog ? ? I DC  97  O2  ? ? ? 1_555 J DG  80  N2  ? ? I DC  10   J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog162 hydrog ? ? I DG  98  N1  ? ? ? 1_555 J DC  79  N3  ? ? I DG  11   J DC  -11  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog163 hydrog ? ? I DG  98  N2  ? ? ? 1_555 J DC  79  O2  ? ? I DG  11   J DC  -11  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog164 hydrog ? ? I DG  98  O6  ? ? ? 1_555 J DC  79  N4  ? ? I DG  11   J DC  -11  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog165 hydrog ? ? I DT  99  N3  ? ? ? 1_555 J DA  78  N1  ? ? I DT  12   J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog166 hydrog ? ? I DT  99  O4  ? ? ? 1_555 J DA  78  N6  ? ? I DT  12   J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog167 hydrog ? ? I DT  100 N3  ? ? ? 1_555 J DA  77  N1  ? ? I DT  13   J DA  -13  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog168 hydrog ? ? I DT  100 O4  ? ? ? 1_555 J DA  77  N6  ? ? I DT  13   J DA  -13  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog169 hydrog ? ? I DT  101 N3  ? ? ? 1_555 J DA  76  N1  ? ? I DT  14   J DA  -14  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog170 hydrog ? ? I DT  101 O4  ? ? ? 1_555 J DA  76  N6  ? ? I DT  14   J DA  -14  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog171 hydrog ? ? I DC  105 N3  ? ? ? 1_555 J DG  72  N1  ? ? I DC  18   J DG  -18  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog172 hydrog ? ? I DC  105 N4  ? ? ? 1_555 J DG  72  O6  ? ? I DC  18   J DG  -18  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog173 hydrog ? ? I DC  105 O2  ? ? ? 1_555 J DG  72  N2  ? ? I DC  18   J DG  -18  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog174 hydrog ? ? I DC  106 N3  ? ? ? 1_555 J DG  71  N2  ? ? I DC  19   J DG  -19  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog175 hydrog ? ? I DG  107 N1  ? ? ? 1_555 J DC  70  N3  ? ? I DG  20   J DC  -20  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog176 hydrog ? ? I DG  107 N2  ? ? ? 1_555 J DC  70  O2  ? ? I DG  20   J DC  -20  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog177 hydrog ? ? I DG  107 O6  ? ? ? 1_555 J DC  70  N4  ? ? I DG  20   J DC  -20  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog178 hydrog ? ? I DC  108 O2  ? ? ? 1_555 J DG  69  N2  ? ? I DC  21   J DG  -21  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog179 hydrog ? ? I DC  109 N3  ? ? ? 1_555 J DG  68  N1  ? ? I DC  22   J DG  -22  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog180 hydrog ? ? I DC  109 N4  ? ? ? 1_555 J DG  68  O6  ? ? I DC  22   J DG  -22  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog181 hydrog ? ? I DC  109 O2  ? ? ? 1_555 J DG  68  N2  ? ? I DC  22   J DG  -22  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog182 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J DT  67  N3  ? ? I DA  23   J DT  -23  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog183 hydrog ? ? I DA  111 N1  ? ? ? 1_555 J DT  66  N3  ? ? I DA  24   J DT  -24  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog184 hydrog ? ? I DG  112 N2  ? ? ? 1_555 J DC  65  O2  ? ? I DG  25   J DC  -25  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog185 hydrog ? ? I DG  113 N2  ? ? ? 1_555 J DC  64  O2  ? ? I DG  26   J DC  -26  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog186 hydrog ? ? I DG  114 N2  ? ? ? 1_555 J DC  63  O2  ? ? I DG  27   J DC  -27  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog187 hydrog ? ? I DG  115 N2  ? ? ? 1_555 J DC  62  O2  ? ? I DG  28   J DC  -28  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog188 hydrog ? ? I DG  115 N2  ? ? ? 1_555 J DC  63  O2  ? ? I DG  28   J DC  -27  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog189 hydrog ? ? I DA  116 N1  ? ? ? 1_555 J DT  61  N3  ? ? I DA  29   J DT  -29  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog190 hydrog ? ? I DA  116 N6  ? ? ? 1_555 J DT  61  O4  ? ? I DA  29   J DT  -29  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog191 hydrog ? ? I DT  117 N3  ? ? ? 1_555 J DA  60  N1  ? ? I DT  30   J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog192 hydrog ? ? I DT  117 O4  ? ? ? 1_555 J DA  60  N6  ? ? I DT  30   J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog193 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J DA  59  N1  ? ? I DT  31   J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog194 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J DA  59  N6  ? ? I DT  31   J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog195 hydrog ? ? I DA  119 N1  ? ? ? 1_555 J DG  57  N1  ? ? I DA  32   J DG  -33  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog196 hydrog ? ? I DA  119 N6  ? ? ? 1_555 J DG  57  O6  ? ? I DA  32   J DG  -33  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog197 hydrog ? ? I DA  119 N1  ? ? ? 1_555 J DT  58  N3  ? ? I DA  32   J DT  -32  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog198 hydrog ? ? I DA  119 N6  ? ? ? 1_555 J DT  58  O4  ? ? I DA  32   J DT  -32  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog199 hydrog ? ? I DC  120 N4  ? ? ? 1_555 J DA  56  N1  ? ? I DC  33   J DA  -34  1_555 ? ? ? ? ? ? 'DC-DA MISPAIR'         ? 
? 
hydrog200 hydrog ? ? I DC  120 O2  ? ? ? 1_555 J DG  57  N2  ? ? I DC  33   J DG  -33  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog201 hydrog ? ? I DT  121 N3  ? ? ? 1_555 J DG  55  O6  ? ? I DT  34   J DG  -35  1_555 ? ? ? ? ? ? 'DT-DG MISPAIR'         ? 
? 
hydrog202 hydrog ? ? I DT  121 N3  ? ? ? 1_555 J DA  56  N1  ? ? I DT  34   J DA  -34  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? 
? 
hydrog203 hydrog ? ? I DC  122 O2  ? ? ? 1_555 J DG  55  N2  ? ? I DC  35   J DG  -35  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog204 hydrog ? ? I DC  123 N4  ? ? ? 1_555 J DG  53  O6  ? ? I DC  36   J DG  -37  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog205 hydrog ? ? I DC  123 N3  ? ? ? 1_555 J DG  54  N2  ? ? I DC  36   J DG  -36  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog206 hydrog ? ? I DC  124 N3  ? ? ? 1_555 J DA  52  N6  ? ? I DC  37   J DA  -38  1_555 ? ? ? ? ? ? 'DC-DA MISPAIR'         ? 
? 
hydrog207 hydrog ? ? I DC  124 O2  ? ? ? 1_555 J DG  53  N2  ? ? I DC  37   J DG  -37  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog208 hydrog ? ? I DT  125 N3  ? ? ? 1_555 J DA  52  N1  ? ? I DT  38   J DA  -38  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? 
? 
hydrog209 hydrog ? ? I DA  126 N1  ? ? ? 1_555 J DT  51  N3  ? ? I DA  39   J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog210 hydrog ? ? I DA  126 N6  ? ? ? 1_555 J DT  51  O4  ? ? I DA  39   J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog211 hydrog ? ? I DG  127 N1  ? ? ? 1_555 J DC  50  N3  ? ? I DG  40   J DC  -40  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog212 hydrog ? ? I DG  127 N2  ? ? ? 1_555 J DC  50  O2  ? ? I DG  40   J DC  -40  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog213 hydrog ? ? I DG  127 O6  ? ? ? 1_555 J DC  50  N4  ? ? I DG  40   J DC  -40  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog214 hydrog ? ? I DT  128 N3  ? ? ? 1_555 J DA  49  N1  ? ? I DT  41   J DA  -41  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog215 hydrog ? ? I DT  128 O4  ? ? ? 1_555 J DA  49  N6  ? ? I DT  41   J DA  -41  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog216 hydrog ? ? I DC  129 N3  ? ? ? 1_555 J DG  48  N1  ? ? I DC  42   J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog217 hydrog ? ? I DC  129 N4  ? ? ? 1_555 J DG  48  O6  ? ? I DC  42   J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog218 hydrog ? ? I DC  129 O2  ? ? ? 1_555 J DG  48  N2  ? ? I DC  42   J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog219 hydrog ? ? I DT  130 N3  ? ? ? 1_555 J DA  47  N1  ? ? I DT  43   J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog220 hydrog ? ? I DT  130 O4  ? ? ? 1_555 J DA  47  N6  ? ? I DT  43   J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog221 hydrog ? ? I DC  131 N3  ? ? ? 1_555 J DG  46  N2  ? ? I DC  44   J DG  -44  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog222 hydrog ? ? I DC  131 O2  ? ? ? 1_555 J DG  46  N1  ? ? I DC  44   J DG  -44  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog223 hydrog ? ? I DC  132 O2  ? ? ? 1_555 J DG  45  N2  ? ? I DC  45   J DG  -45  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog224 hydrog ? ? I DA  133 N1  ? ? ? 1_555 J DT  44  N3  ? ? I DA  46   J DT  -46  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog225 hydrog ? ? I DA  133 N6  ? ? ? 1_555 J DT  44  O4  ? ? I DA  46   J DT  -46  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog226 hydrog ? ? I DG  134 N1  ? ? ? 1_555 J DC  43  N3  ? ? I DG  47   J DC  -47  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog227 hydrog ? ? I DG  134 N2  ? ? ? 1_555 J DC  43  O2  ? ? I DG  47   J DC  -47  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog228 hydrog ? ? I DG  134 O6  ? ? ? 1_555 J DC  43  N4  ? ? I DG  47   J DC  -47  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog229 hydrog ? ? I DG  135 N1  ? ? ? 1_555 J DC  42  N3  ? ? I DG  48   J DC  -48  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog230 hydrog ? ? I DG  135 N2  ? ? ? 1_555 J DC  42  O2  ? ? I DG  48   J DC  -48  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog231 hydrog ? ? I DG  135 O6  ? ? ? 1_555 J DC  42  N4  ? ? I DG  48   J DC  -48  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog232 hydrog ? ? I DC  136 N3  ? ? ? 1_555 J DG  41  N1  ? ? I DC  49   J DG  -49  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog233 hydrog ? ? I DC  136 N4  ? ? ? 1_555 J DG  41  O6  ? ? I DC  49   J DG  -49  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog234 hydrog ? ? I DC  136 O2  ? ? ? 1_555 J DG  41  N2  ? ? I DC  49   J DG  -49  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog235 hydrog ? ? I DA  137 N1  ? ? ? 1_555 J DT  40  N3  ? ? I DA  50   J DT  -50  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog236 hydrog ? ? I DA  137 N6  ? ? ? 1_555 J DT  40  O4  ? ? I DA  50   J DT  -50  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog237 hydrog ? ? I DC  138 N3  ? ? ? 1_555 J DG  39  N1  ? ? I DC  51   J DG  -51  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog238 hydrog ? ? I DC  138 N4  ? ? ? 1_555 J DG  39  O6  ? ? I DC  51   J DG  -51  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog239 hydrog ? ? I DC  138 O2  ? ? ? 1_555 J DG  39  N2  ? ? I DC  51   J DG  -51  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog240 hydrog ? ? I DG  139 N1  ? ? ? 1_555 J DC  38  N3  ? ? I DG  52   J DC  -52  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog241 hydrog ? ? I DG  139 N2  ? ? ? 1_555 J DC  38  O2  ? ? I DG  52   J DC  -52  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog242 hydrog ? ? I DG  139 O6  ? ? ? 1_555 J DC  38  N4  ? ? I DG  52   J DC  -52  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog243 hydrog ? ? I DT  140 N3  ? ? ? 1_555 J DA  37  N1  ? ? I DT  53   J DA  -53  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog244 hydrog ? ? I DT  140 O4  ? ? ? 1_555 J DA  37  N6  ? ? I DT  53   J DA  -53  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog245 hydrog ? ? I DG  141 N1  ? ? ? 1_555 J DC  36  N3  ? ? I DG  54   J DC  -54  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog246 hydrog ? ? I DG  141 N2  ? ? ? 1_555 J DC  36  O2  ? ? I DG  54   J DC  -54  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog247 hydrog ? ? I DG  141 O6  ? ? ? 1_555 J DC  36  N4  ? ? I DG  54   J DC  -54  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog248 hydrog ? ? I DT  142 N3  ? ? ? 1_555 J DA  35  N1  ? ? I DT  55   J DA  -55  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog249 hydrog ? ? I DT  142 O4  ? ? ? 1_555 J DA  35  N6  ? ? I DT  55   J DA  -55  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog250 hydrog ? ? I DC  143 N3  ? ? ? 1_555 J DG  34  N1  ? ? I DC  56   J DG  -56  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog251 hydrog ? ? I DC  143 N4  ? ? ? 1_555 J DG  34  O6  ? ? I DC  56   J DG  -56  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog252 hydrog ? ? I DC  143 O2  ? ? ? 1_555 J DG  34  N2  ? ? I DC  56   J DG  -56  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog253 hydrog ? ? I DA  144 N1  ? ? ? 1_555 J DT  33  N3  ? ? I DA  57   J DT  -57  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog254 hydrog ? ? I DA  144 N6  ? ? ? 1_555 J DT  33  O4  ? ? I DA  57   J DT  -57  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog255 hydrog ? ? I DG  145 N1  ? ? ? 1_555 J DC  32  N3  ? ? I DG  58   J DC  -58  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog256 hydrog ? ? I DG  145 N2  ? ? ? 1_555 J DC  32  O2  ? ? I DG  58   J DC  -58  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog257 hydrog ? ? I DG  145 O6  ? ? ? 1_555 J DC  32  N4  ? ? I DG  58   J DC  -58  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog258 hydrog ? ? I DA  146 N1  ? ? ? 1_555 J DT  31  N3  ? ? I DA  59   J DT  -59  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog259 hydrog ? ? I DA  146 N6  ? ? ? 1_555 J DT  31  O4  ? ? I DA  59   J DT  -59  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog260 hydrog ? ? I DT  147 N3  ? ? ? 1_555 J DA  30  N1  ? ? I DT  60   J DA  -60  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog261 hydrog ? ? I DT  147 O4  ? ? ? 1_555 J DA  30  N6  ? ? I DT  60   J DA  -60  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog262 hydrog ? ? I DA  148 N1  ? ? ? 1_555 J DT  29  N3  ? ? I DA  61   J DT  -61  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog263 hydrog ? ? I DA  148 N6  ? ? ? 1_555 J DT  29  O4  ? ? I DA  61   J DT  -61  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog264 hydrog ? ? I DT  149 N3  ? ? ? 1_555 J DA  28  N1  ? ? I DT  62   J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog265 hydrog ? ? I DT  149 O4  ? ? ? 1_555 J DA  28  N6  ? ? I DT  62   J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog266 hydrog ? ? I DA  150 N1  ? ? ? 1_555 J DT  27  N3  ? ? I DA  63   J DT  -63  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog267 hydrog ? ? I DA  150 N6  ? ? ? 1_555 J DT  27  O4  ? ? I DA  63   J DT  -63  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog268 hydrog ? ? I DT  151 N3  ? ? ? 1_555 J DA  26  N1  ? ? I DT  64   J DA  -64  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog269 hydrog ? ? I DT  151 O4  ? ? ? 1_555 J DA  26  N6  ? ? I DT  64   J DA  -64  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog270 hydrog ? ? I DA  152 N1  ? ? ? 1_555 J DT  25  N3  ? ? I DA  65   J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog271 hydrog ? ? I DA  152 N6  ? ? ? 1_555 J DT  25  O4  ? ? I DA  65   J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog272 hydrog ? ? I DC  153 N3  ? ? ? 1_555 J DG  24  N1  ? ? I DC  66   J DG  -66  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog273 hydrog ? ? I DC  153 N4  ? ? ? 1_555 J DG  24  O6  ? ? I DC  66   J DG  -66  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog274 hydrog ? ? I DC  153 O2  ? ? ? 1_555 J DG  24  N2  ? ? I DC  66   J DG  -66  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog275 hydrog ? ? I DA  154 N1  ? ? ? 1_555 J DT  23  N3  ? ? I DA  67   J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog276 hydrog ? ? I DA  154 N6  ? ? ? 1_555 J DT  23  O4  ? ? I DA  67   J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog277 hydrog ? ? I DT  155 N3  ? ? ? 1_555 J DA  22  N1  ? ? I DT  68   J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog278 hydrog ? ? I DT  155 O4  ? ? ? 1_555 J DA  22  N6  ? ? I DT  68   J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog279 hydrog ? ? I DC  156 N3  ? ? ? 1_555 J DG  21  N1  ? ? I DC  69   J DG  -69  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog280 hydrog ? ? I DC  156 N4  ? ? ? 1_555 J DG  21  O6  ? ? I DC  69   J DG  -69  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog281 hydrog ? ? I DC  156 O2  ? ? ? 1_555 J DG  21  N2  ? ? I DC  69   J DG  -69  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog282 hydrog ? ? I DG  157 N1  ? ? ? 1_555 J DC  20  N3  ? ? I DG  70   J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog283 hydrog ? ? I DG  157 N2  ? ? ? 1_555 J DC  20  O2  ? ? I DG  70   J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog284 hydrog ? ? I DG  157 O6  ? ? ? 1_555 J DC  20  N4  ? ? I DG  70   J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog285 hydrog ? ? I DA  158 N1  ? ? ? 1_555 J DT  19  N3  ? ? I DA  71   J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog286 hydrog ? ? I DA  158 N6  ? ? ? 1_555 J DT  19  O4  ? ? I DA  71   J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog287 hydrog ? ? I DT  159 N3  ? ? ? 1_555 J DA  18  N1  ? ? I DT  72   J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog288 hydrog ? ? I DT  159 O4  ? ? ? 1_555 J DA  18  N6  ? ? I DT  72   J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog289 hydrog ? ? I DT  160 N3  ? ? ? 1_555 J DA  17  N1  ? ? I DT  73   J DA  -73  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog290 hydrog ? ? I DT  160 O4  ? ? ? 1_555 J DA  17  N6  ? ? I DT  73   J DA  -73  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog291 hydrog ? ? I DA  161 N1  ? ? ? 1_555 J DT  16  N3  ? ? I DA  74   J DT  -74  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog292 hydrog ? ? I DA  161 N6  ? ? ? 1_555 J DT  16  O4  ? ? I DA  74   J DT  -74  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog293 hydrog ? ? I DA  162 N1  ? ? ? 1_555 J DT  15  N3  ? ? I DA  75   J DT  -75  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog294 hydrog ? ? I DA  162 N6  ? ? ? 1_555 J DT  15  O4  ? ? I DA  75   J DT  -75  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog295 hydrog ? ? I DC  163 N3  ? ? ? 1_555 J DG  14  N1  ? ? I DC  76   J DG  -76  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog296 hydrog ? ? I DC  163 N4  ? ? ? 1_555 J DG  14  O6  ? ? I DC  76   J DG  -76  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog297 hydrog ? ? I DC  163 O2  ? ? ? 1_555 J DG  14  N2  ? ? I DC  76   J DG  -76  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog298 hydrog ? ? I DG  164 N1  ? ? ? 1_555 J DC  13  N3  ? ? I DG  77   J DC  -77  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog299 hydrog ? ? I DG  164 N2  ? ? ? 1_555 J DC  13  O2  ? ? I DG  77   J DC  -77  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog300 hydrog ? ? I DG  164 O6  ? ? ? 1_555 J DC  13  N4  ? ? I DG  77   J DC  -77  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog301 hydrog ? ? I DA  165 N1  ? ? ? 1_555 J DT  12  N3  ? ? I DA  78   J DT  -78  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog302 hydrog ? ? I DA  165 N6  ? ? ? 1_555 J DT  12  O4  ? ? I DA  78   J DT  -78  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog303 hydrog ? ? I DT  166 N3  ? ? ? 1_555 J DA  11  N1  ? ? I DT  79   J DA  -79  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog304 hydrog ? ? I DT  166 O4  ? ? ? 1_555 J DA  11  N6  ? ? I DT  79   J DA  -79  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog305 hydrog ? ? I DG  167 N1  ? ? ? 1_555 J DC  10  N3  ? ? I DG  80   J DC  -80  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog306 hydrog ? ? I DG  167 N2  ? ? ? 1_555 J DC  10  O2  ? ? I DG  80   J DC  -80  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog307 hydrog ? ? I DG  167 O6  ? ? ? 1_555 J DC  10  N4  ? ? I DG  80   J DC  -80  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog308 hydrog ? ? I DC  168 N3  ? ? ? 1_555 J DG  9   N1  ? ? I DC  81   J DG  -81  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog309 hydrog ? ? I DC  168 N4  ? ? ? 1_555 J DG  9   O6  ? ? I DC  81   J DG  -81  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog310 hydrog ? ? I DC  168 O2  ? ? ? 1_555 J DG  9   N2  ? ? I DC  81   J DG  -81  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog311 hydrog ? ? I DT  169 N3  ? ? ? 1_555 J DA  8   N1  ? ? I DT  82   J DA  -82  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog312 hydrog ? ? I DT  169 O4  ? ? ? 1_555 J DA  8   N6  ? ? I DT  82   J DA  -82  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog313 hydrog ? ? I DG  170 N1  ? ? ? 1_555 J DC  7   N3  ? ? I DG  83   J DC  -83  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog314 hydrog ? ? I DG  170 N2  ? ? ? 1_555 J DC  7   O2  ? ? I DG  83   J DC  -83  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog315 hydrog ? ? I DG  170 O6  ? ? ? 1_555 J DC  7   N4  ? ? I DG  83   J DC  -83  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog316 hydrog ? ? I DG  171 N1  ? ? ? 1_555 J DC  6   N3  ? ? I DG  84   J DC  -84  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog317 hydrog ? ? I DG  171 N2  ? ? ? 1_555 J DC  6   O2  ? ? I DG  84   J DC  -84  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog318 hydrog ? ? I DG  171 O6  ? ? ? 1_555 J DC  6   N4  ? ? I DG  84   J DC  -84  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog319 hydrog ? ? I DG  172 N1  ? ? ? 1_555 J DC  5   N3  ? ? I DG  85   J DC  -85  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog320 hydrog ? ? I DG  172 N2  ? ? ? 1_555 J DC  5   O2  ? ? I DG  85   J DC  -85  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog321 hydrog ? ? I DG  172 O6  ? ? ? 1_555 J DC  5   N4  ? ? I DG  85   J DC  -85  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog322 hydrog ? ? I DC  173 N3  ? ? ? 1_555 J DG  4   N1  ? ? I DC  86   J DG  -86  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog323 hydrog ? ? I DC  173 N4  ? ? ? 1_555 J DG  4   O6  ? ? I DC  86   J DG  -86  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog324 hydrog ? ? I DC  173 O2  ? ? ? 1_555 J DG  4   N2  ? ? I DC  86   J DG  -86  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog325 hydrog ? ? I DA  174 N1  ? ? ? 1_555 J DT  3   N3  ? ? I DA  87   J DT  -87  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog326 hydrog ? ? I DA  174 N6  ? ? ? 1_555 J DT  3   O4  ? ? I DA  87   J DT  -87  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog327 hydrog ? ? I DT  175 N3  ? ? ? 1_555 J DA  2   N1  ? ? I DT  88   J DA  -88  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog328 hydrog ? ? I DT  175 O4  ? ? ? 1_555 J DA  2   N6  ? ? I DT  88   J DA  -88  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog329 hydrog ? ? I DA  176 N1  ? ? ? 1_555 J DT  1   N3  ? ? I DA  89   J DT  -89  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog330 hydrog ? ? I DA  176 N6  ? ? ? 1_555 J DT  1   O4  ? ? I DA  89   J DT  -89  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          VAL 
_struct_mon_prot_cis.label_seq_id           1247 
_struct_mon_prot_cis.label_asym_id          L 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           VAL 
_struct_mon_prot_cis.auth_seq_id            1246 
_struct_mon_prot_cis.auth_asym_id           W 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    1248 
_struct_mon_prot_cis.pdbx_label_asym_id_2   L 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     1247 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    W 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       7.96 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 3 ? 
AA8 ? 3 ? 
AA9 ? 6 ? 
AB1 ? 6 ? 
AB2 ? 3 ? 
AB3 ? 3 ? 
AB4 ? 5 ? 
AB5 ? 5 ? 
AB6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA3 1 2 ? parallel      
AA4 1 2 ? parallel      
AA5 1 2 ? parallel      
AA6 1 2 ? parallel      
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AA9 4 5 ? parallel      
AA9 5 6 ? parallel      
AB1 1 2 ? parallel      
AB1 2 3 ? parallel      
AB1 3 4 ? parallel      
AB1 4 5 ? parallel      
AB1 5 6 ? parallel      
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? parallel      
AB4 2 3 ? parallel      
AB4 3 4 ? parallel      
AB4 4 5 ? parallel      
AB5 1 2 ? parallel      
AB5 2 3 ? parallel      
AB5 3 4 ? parallel      
AB5 4 5 ? parallel      
AB6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 119  ? ILE A 120  ? THR A 118  ILE A 119  
AA1 2 ARG B 46   ? ILE B 47   ? ARG B 45   ILE B 46   
AA2 1 LEU B 98   ? TYR B 99   ? LEU B 97   TYR B 98   
AA2 2 THR G 102  ? ILE G 103  ? THR G 101  ILE G 102  
AA3 1 ARG C 78   ? ILE C 79   ? ARG C 77   ILE C 78   
AA3 2 GLY D 54   ? ILE D 55   ? GLY D 50   ILE D 51   
AA4 1 THR C 102  ? ILE C 103  ? THR C 101  ILE C 102  
AA4 2 LEU F 98   ? TYR F 99   ? LEU F 97   TYR F 98   
AA5 1 ARG E 84   ? PHE E 85   ? ARG E 83   PHE E 84   
AA5 2 THR F 81   ? VAL F 82   ? THR F 80   VAL F 81   
AA6 1 THR E 119  ? ILE E 120  ? THR E 118  ILE E 119  
AA6 2 ARG F 46   ? ILE F 47   ? ARG F 45   ILE F 46   
AA7 1 ILE K 179  ? LEU K 187  ? ILE M 179  LEU M 187  
AA7 2 TYR K 211  ? TRP K 217  ? TYR M 211  TRP M 217  
AA7 3 THR K 226  ? GLU K 228  ? THR M 226  GLU M 228  
AA8 1 PRO K 287  ? SER K 297  ? PRO M 287  SER M 297  
AA8 2 SER K 303  ? TRP K 311  ? SER M 303  TRP M 311  
AA8 3 TRP K 321  ? ASN K 323  ? TRP M 321  ASN M 323  
AA9 1 VAL K 487  ? THR K 490  ? VAL M 487  THR M 490  
AA9 2 HIS K 428  ? VAL K 431  ? HIS M 428  VAL M 431  
AA9 3 PHE K 509  ? ASP K 513  ? PHE M 509  ASP M 513  
AA9 4 ASN K 536  ? ILE K 540  ? ASN M 536  ILE M 540  
AA9 5 GLY K 397  ? LEU K 399  ? GLY M 397  LEU M 399  
AA9 6 ILE K 594  ? LEU K 595  ? ILE M 594  LEU M 595  
AB1 1 ARG K 612  ? VAL K 616  ? ARG M 612  VAL M 616  
AB1 2 MET K 815  ? SER K 821  ? MET M 815  SER M 821  
AB1 3 THR K 785  ? ILE K 788  ? THR M 785  ILE M 788  
AB1 4 VAL K 714  ? PHE K 717  ? VAL M 714  PHE M 717  
AB1 5 VAL K 766  ? LEU K 768  ? VAL M 766  LEU M 768  
AB1 6 PHE K 738  ? GLN K 739  ? PHE M 738  GLN M 739  
AB2 1 ILE L 179  ? LEU L 187  ? ILE W 179  LEU W 187  
AB2 2 TYR L 211  ? TRP L 217  ? TYR W 211  TRP W 217  
AB2 3 THR L 226  ? GLU L 228  ? THR W 226  GLU W 228  
AB3 1 PRO L 287  ? SER L 297  ? PRO W 287  SER W 297  
AB3 2 SER L 303  ? TRP L 311  ? SER W 303  TRP W 311  
AB3 3 TRP L 321  ? ASN L 323  ? TRP W 321  ASN W 323  
AB4 1 GLY L 397  ? LEU L 399  ? GLY W 397  LEU W 399  
AB4 2 MET L 538  ? ILE L 540  ? MET W 538  ILE W 540  
AB4 3 MET L 510  ? ASP L 513  ? MET W 510  ASP W 513  
AB4 4 ILE L 429  ? VAL L 431  ? ILE W 429  VAL W 431  
AB4 5 LEU L 488  ? THR L 490  ? LEU W 488  THR W 490  
AB5 1 ARG L 612  ? ILE L 613  ? ARG W 612  ILE W 613  
AB5 2 MET L 815  ? ARG L 818  ? MET W 815  ARG W 818  
AB5 3 THR L 785  ? ILE L 788  ? THR W 785  ILE W 788  
AB5 4 VAL L 714  ? PHE L 717  ? VAL W 714  PHE W 717  
AB5 5 VAL L 766  ? LEU L 769  ? VAL W 766  LEU W 769  
AB6 1 LEU L 1119 ? PHE L 1120 ? LEU W 1118 PHE W 1119 
AB6 2 LEU L 1128 ? ASN L 1129 ? LEU W 1127 ASN W 1128 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 120  ? N ILE A 119  O ARG B 46   ? O ARG B 45   
AA2 1 2 N TYR B 99   ? N TYR B 98   O THR G 102  ? O THR G 101  
AA3 1 2 N ILE C 79   ? N ILE C 78   O GLY D 54   ? O GLY D 50   
AA4 1 2 N THR C 102  ? N THR C 101  O TYR F 99   ? O TYR F 98   
AA5 1 2 N ARG E 84   ? N ARG E 83   O VAL F 82   ? O VAL F 81   
AA6 1 2 N ILE E 120  ? N ILE E 119  O ARG F 46   ? O ARG F 45   
AA7 1 2 N ASN K 184  ? N ASN M 184  O LEU K 214  ? O LEU M 214  
AA7 2 3 N ILE K 215  ? N ILE M 215  O THR K 226  ? O THR M 226  
AA8 1 2 N ARG K 289  ? N ARG M 289  O LYS K 310  ? O LYS M 310  
AA8 2 3 N TYR K 307  ? N TYR M 307  O GLU K 322  ? O GLU M 322  
AA9 1 2 O LEU K 488  ? O LEU M 488  N ILE K 430  ? N ILE M 430  
AA9 2 3 N VAL K 431  ? N VAL M 431  O ALA K 511  ? O ALA M 511  
AA9 3 4 N VAL K 512  ? N VAL M 512  O ILE K 540  ? O ILE M 540  
AA9 4 5 O LEU K 539  ? O LEU M 539  N LEU K 399  ? N LEU M 399  
AA9 5 6 N ILE K 398  ? N ILE M 398  O LEU K 595  ? O LEU M 595  
AB1 1 2 N VAL K 616  ? N VAL M 616  O VAL K 820  ? O VAL M 820  
AB1 2 3 O LEU K 819  ? O LEU M 819  N ILE K 788  ? N ILE M 788  
AB1 3 4 O VAL K 787  ? O VAL M 787  N LEU K 715  ? N LEU M 715  
AB1 4 5 N VAL K 714  ? N VAL M 714  O PHE K 767  ? O PHE M 767  
AB1 5 6 O LEU K 768  ? O LEU M 768  N GLN K 739  ? N GLN M 739  
AB2 1 2 N ASN L 184  ? N ASN W 184  O LEU L 214  ? O LEU W 214  
AB2 2 3 N ILE L 215  ? N ILE W 215  O THR L 226  ? O THR W 226  
AB3 1 2 N GLU L 288  ? N GLU W 288  O LYS L 310  ? O LYS W 310  
AB3 2 3 N TYR L 307  ? N TYR W 307  O GLU L 322  ? O GLU W 322  
AB4 1 2 N LEU L 399  ? N LEU W 399  O LEU L 539  ? O LEU W 539  
AB4 2 3 O MET L 538  ? O MET W 538  N VAL L 512  ? N VAL W 512  
AB4 3 4 O ALA L 511  ? O ALA W 511  N VAL L 431  ? N VAL W 431  
AB4 4 5 N ILE L 430  ? N ILE W 430  O THR L 490  ? O THR W 490  
AB5 1 2 N ARG L 612  ? N ARG W 612  O VAL L 816  ? O VAL W 816  
AB5 2 3 O TYR L 817  ? O TYR W 817  N ILE L 788  ? N ILE W 788  
AB5 3 4 O VAL L 787  ? O VAL W 787  N LEU L 715  ? N LEU W 715  
AB5 4 5 N ILE L 716  ? N ILE W 716  O LEU L 769  ? O LEU W 769  
AB6 1 2 N PHE L 1120 ? N PHE W 1119 O LEU L 1128 ? O LEU W 1127 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software M ADP 1501 ? 12 'binding site for residue ADP M 1501'                   
AC2 Software M BEF 1502 ? 6  'binding site for residue BEF M 1502'                   
AC3 Software W BEF 1501 ? 3  'binding site for residue BEF W 1501'                   
AC4 Software W ADP 1502 ? 8  'binding site for residue ADP W 1502'                   
AC5 Software I DG  -3   ? 8  'binding site for Di-nucleotide DG I -3 and DC I -2'    
AC6 Software I DC  21   ? 8  'binding site for Di-nucleotide DC I 21 and SER W 524'  
AC7 Software I DC  22   ? 10 'binding site for Di-nucleotide DC I 22 and ASN W 520'  
AC8 Software I DC  45   ? 6  'binding site for Di-nucleotide DC I 45 and DA I 46'    
AC9 Software I DC  45   ? 6  'binding site for Di-nucleotide DC I 45 and DA I 46'    
AD1 Software I DC  45   ? 6  'binding site for Di-nucleotide DC I 45 and DA I 46'    
AD2 Software I DC  45   ? 6  'binding site for Di-nucleotide DC I 45 and DA I 46'    
AD3 Software I DC  45   ? 6  'binding site for Di-nucleotide DC I 45 and DA I 46'    
AD4 Software I DC  45   ? 6  'binding site for Di-nucleotide DC I 45 and DA I 46'    
AD5 Software I DC  45   ? 6  'binding site for Di-nucleotide DC I 45 and DA I 46'    
AD6 Software I DC  45   ? 6  'binding site for Di-nucleotide DC I 45 and DA I 46'    
AD7 Software I DG  -53  ? 9  'binding site for Di-nucleotide DG I -53 and DT J 54'   
AD8 Software J DT  -17  ? 10 'binding site for Di-nucleotide DT J -17 and GLU W 493' 
AD9 Software J DG  -18  ? 12 'binding site for Di-nucleotide DG J -18 and GLU W 493' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 12 GLU K 375 ? GLU M 375  . ? 1_555 ? 
2   AC1 12 LEU K 376 ? LEU M 376  . ? 1_555 ? 
3   AC1 12 ARG K 377 ? ARG M 377  . ? 1_555 ? 
4   AC1 12 GLY K 406 ? GLY M 406  . ? 1_555 ? 
5   AC1 12 LYS K 407 ? LYS M 407  . ? 1_555 ? 
6   AC1 12 THR K 408 ? THR M 408  . ? 1_555 ? 
7   AC1 12 VAL K 409 ? VAL M 409  . ? 1_555 ? 
8   AC1 12 TRP K 447 ? TRP M 447  . ? 1_555 ? 
9   AC1 12 ASN K 779 ? ASN M 779  . ? 1_555 ? 
10  AC1 12 MET K 781 ? MET M 781  . ? 1_555 ? 
11  AC1 12 ARG K 807 ? ARG M 807  . ? 1_555 ? 
12  AC1 12 BEF N .   ? BEF M 1502 . ? 1_555 ? 
13  AC2 6  MET K 403 ? MET M 403  . ? 1_555 ? 
14  AC2 6  LYS K 407 ? LYS M 407  . ? 1_555 ? 
15  AC2 6  GLU K 514 ? GLU M 514  . ? 1_555 ? 
16  AC2 6  ARG K 804 ? ARG M 804  . ? 1_555 ? 
17  AC2 6  ARG K 807 ? ARG M 807  . ? 1_555 ? 
18  AC2 6  ADP M .   ? ADP M 1501 . ? 1_555 ? 
19  AC3 3  THR L 436 ? THR W 436  . ? 1_555 ? 
20  AC3 3  ARG L 804 ? ARG W 804  . ? 1_555 ? 
21  AC3 3  ADP P .   ? ADP W 1502 . ? 1_555 ? 
22  AC4 8  LEU L 376 ? LEU W 376  . ? 1_555 ? 
23  AC4 8  GLN L 380 ? GLN W 380  . ? 1_555 ? 
24  AC4 8  GLY L 404 ? GLY W 404  . ? 1_555 ? 
25  AC4 8  GLY L 406 ? GLY W 406  . ? 1_555 ? 
26  AC4 8  ASN L 779 ? ASN W 779  . ? 1_555 ? 
27  AC4 8  MET L 781 ? MET W 781  . ? 1_555 ? 
28  AC4 8  ARG L 807 ? ARG W 807  . ? 1_555 ? 
29  AC4 8  BEF O .   ? BEF W 1501 . ? 1_555 ? 
30  AC5 8  ARG A 117 ? ARG A 116  . ? 1_555 ? 
31  AC5 8  VAL A 118 ? VAL A 117  . ? 1_555 ? 
32  AC5 8  THR A 119 ? THR A 118  . ? 1_555 ? 
33  AC5 8  DC  I 83  ? DC  I -4   . ? 1_555 ? 
34  AC5 8  DG  I 86  ? DG  I -1   . ? 1_555 ? 
35  AC5 8  DG  J 92  ? DG  J 2    . ? 1_555 ? 
36  AC5 8  DC  J 93  ? DC  J 3    . ? 1_555 ? 
37  AC5 8  DG  J 94  ? DG  J 4    . ? 1_555 ? 
38  AC6 8  DG  I 107 ? DG  I 20   . ? 1_555 ? 
39  AC6 8  DC  I 109 ? DC  I 22   . ? 1_555 ? 
40  AC6 8  DG  J 69  ? DG  J -21  . ? 1_555 ? 
41  AC6 8  GLU L 522 ? GLU W 522  . ? 1_555 ? 
42  AC6 8  SER L 523 ? SER W 523  . ? 1_555 ? 
43  AC6 8  LEU L 525 ? LEU W 525  . ? 1_555 ? 
44  AC6 8  TYR L 526 ? TYR W 526  . ? 1_555 ? 
45  AC6 8  SER L 528 ? SER W 528  . ? 1_555 ? 
46  AC7 10 DC  I 108 ? DC  I 21   . ? 1_555 ? 
47  AC7 10 DA  I 110 ? DA  I 23   . ? 1_555 ? 
48  AC7 10 DG  J 69  ? DG  J -21  . ? 1_555 ? 
49  AC7 10 DG  J 68  ? DG  J -22  . ? 1_555 ? 
50  AC7 10 LEU L 518 ? LEU W 518  . ? 1_555 ? 
51  AC7 10 LYS L 519 ? LYS W 519  . ? 1_555 ? 
52  AC7 10 ALA L 521 ? ALA W 521  . ? 1_555 ? 
53  AC7 10 GLU L 522 ? GLU W 522  . ? 1_555 ? 
54  AC7 10 SER L 523 ? SER W 523  . ? 1_555 ? 
55  AC7 10 LYS L 550 ? LYS W 550  . ? 1_555 ? 
56  AC8 6  LYS G 16  ? LYS G 15   . ? 1_555 ? 
57  AC8 6  DC  I 131 ? DC  I 44   . ? 1_555 ? 
58  AC8 6  DG  I 134 ? DG  I 47   . ? 1_555 ? 
59  AC8 6  DG  J 46  ? DG  J -44  . ? 1_555 ? 
60  AC8 6  DT  J 44  ? DT  J -46  . ? 1_555 ? 
61  AC8 6  DG  J 45  ? DG  J -45  . ? 1_555 ? 
62  AC9 6  LYS G 16  ? LYS G 15   . ? 1_555 ? 
63  AC9 6  DC  I 131 ? DC  I 44   . ? 1_555 ? 
64  AC9 6  DG  I 134 ? DG  I 47   . ? 1_555 ? 
65  AC9 6  DG  J 46  ? DG  J -44  . ? 1_555 ? 
66  AC9 6  DT  J 44  ? DT  J -46  . ? 1_555 ? 
67  AC9 6  DG  J 45  ? DG  J -45  . ? 1_555 ? 
68  AD1 6  LYS G 16  ? LYS G 15   . ? 1_555 ? 
69  AD1 6  DC  I 131 ? DC  I 44   . ? 1_555 ? 
70  AD1 6  DG  I 134 ? DG  I 47   . ? 1_555 ? 
71  AD1 6  DG  J 46  ? DG  J -44  . ? 1_555 ? 
72  AD1 6  DT  J 44  ? DT  J -46  . ? 1_555 ? 
73  AD1 6  DG  J 45  ? DG  J -45  . ? 1_555 ? 
74  AD2 6  LYS G 16  ? LYS G 15   . ? 1_555 ? 
75  AD2 6  DC  I 131 ? DC  I 44   . ? 1_555 ? 
76  AD2 6  DG  I 134 ? DG  I 47   . ? 1_555 ? 
77  AD2 6  DG  J 46  ? DG  J -44  . ? 1_555 ? 
78  AD2 6  DT  J 44  ? DT  J -46  . ? 1_555 ? 
79  AD2 6  DG  J 45  ? DG  J -45  . ? 1_555 ? 
80  AD3 6  LYS G 16  ? LYS G 15   . ? 1_555 ? 
81  AD3 6  DC  I 131 ? DC  I 44   . ? 1_555 ? 
82  AD3 6  DG  I 134 ? DG  I 47   . ? 1_555 ? 
83  AD3 6  DG  J 46  ? DG  J -44  . ? 1_555 ? 
84  AD3 6  DT  J 44  ? DT  J -46  . ? 1_555 ? 
85  AD3 6  DG  J 45  ? DG  J -45  . ? 1_555 ? 
86  AD4 6  LYS G 16  ? LYS G 15   . ? 1_555 ? 
87  AD4 6  DC  I 131 ? DC  I 44   . ? 1_555 ? 
88  AD4 6  DG  I 134 ? DG  I 47   . ? 1_555 ? 
89  AD4 6  DG  J 46  ? DG  J -44  . ? 1_555 ? 
90  AD4 6  DT  J 44  ? DT  J -46  . ? 1_555 ? 
91  AD4 6  DG  J 45  ? DG  J -45  . ? 1_555 ? 
92  AD5 6  LYS G 16  ? LYS G 15   . ? 1_555 ? 
93  AD5 6  DC  I 131 ? DC  I 44   . ? 1_555 ? 
94  AD5 6  DG  I 134 ? DG  I 47   . ? 1_555 ? 
95  AD5 6  DG  J 46  ? DG  J -44  . ? 1_555 ? 
96  AD5 6  DT  J 44  ? DT  J -46  . ? 1_555 ? 
97  AD5 6  DG  J 45  ? DG  J -45  . ? 1_555 ? 
98  AD6 6  LYS G 16  ? LYS G 15   . ? 1_555 ? 
99  AD6 6  DC  I 131 ? DC  I 44   . ? 1_555 ? 
100 AD6 6  DG  I 134 ? DG  I 47   . ? 1_555 ? 
101 AD6 6  DG  J 46  ? DG  J -44  . ? 1_555 ? 
102 AD6 6  DT  J 44  ? DT  J -46  . ? 1_555 ? 
103 AD6 6  DG  J 45  ? DG  J -45  . ? 1_555 ? 
104 AD7 9  LYS D 47  ? LYS D 43   . ? 1_555 ? 
105 AD7 9  DA  I 33  ? DA  I -54  . ? 1_555 ? 
106 AD7 9  DG  I 35  ? DG  I -52  . ? 1_555 ? 
107 AD7 9  DT  I 140 ? DT  I 53   . ? 1_555 ? 
108 AD7 9  DT  I 142 ? DT  I 55   . ? 1_555 ? 
109 AD7 9  DC  J 38  ? DC  J -52  . ? 1_555 ? 
110 AD7 9  DC  J 36  ? DC  J -54  . ? 1_555 ? 
111 AD7 9  DC  J 143 ? DC  J 53   . ? 1_555 ? 
112 AD7 9  DT  J 145 ? DT  J 55   . ? 1_555 ? 
113 AD8 10 DA  I 103 ? DA  I 16   . ? 1_555 ? 
114 AD8 10 DT  J 74  ? DT  J -16  . ? 1_555 ? 
115 AD8 10 DG  J 72  ? DG  J -18  . ? 1_555 ? 
116 AD8 10 LEU L 434 ? LEU W 434  . ? 1_555 ? 
117 AD8 10 THR L 491 ? THR W 491  . ? 1_555 ? 
118 AD8 10 TYR L 492 ? TYR W 492  . ? 1_555 ? 
119 AD8 10 TYR L 494 ? TYR W 494  . ? 1_555 ? 
120 AD8 10 ILE L 495 ? ILE W 495  . ? 1_555 ? 
121 AD8 10 LEU L 496 ? LEU W 496  . ? 1_555 ? 
122 AD8 10 LYS L 497 ? LYS W 497  . ? 1_555 ? 
123 AD9 12 DA  I 104 ? DA  I 17   . ? 1_555 ? 
124 AD9 12 DC  I 105 ? DC  I 18   . ? 1_555 ? 
125 AD9 12 DC  I 106 ? DC  I 19   . ? 1_555 ? 
126 AD9 12 DT  J 73  ? DT  J -17  . ? 1_555 ? 
127 AD9 12 DG  J 71  ? DG  J -19  . ? 1_555 ? 
128 AD9 12 DT  J 74  ? DT  J -16  . ? 1_555 ? 
129 AD9 12 THR L 491 ? THR W 491  . ? 1_555 ? 
130 AD9 12 TYR L 492 ? TYR W 492  . ? 1_555 ? 
131 AD9 12 TYR L 494 ? TYR W 494  . ? 1_555 ? 
132 AD9 12 ILE L 495 ? ILE W 495  . ? 1_555 ? 
133 AD9 12 LEU L 496 ? LEU W 496  . ? 1_555 ? 
134 AD9 12 LYS L 497 ? LYS W 497  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6G0L 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BE 
C  
F  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1  39   ? 200.762 228.483 157.643 1.00 288.88 ?  38   PRO A N     1 
ATOM   2     C  CA    . PRO A 1  39   ? 201.234 227.609 158.714 1.00 275.51 ?  38   PRO A CA    1 
ATOM   3     C  C     . PRO A 1  39   ? 200.159 226.676 159.300 1.00 221.17 ?  38   PRO A C     1 
ATOM   4     O  O     . PRO A 1  39   ? 198.995 226.988 159.403 1.00 178.69 ?  38   PRO A O     1 
ATOM   5     C  CB    . PRO A 1  39   ? 201.714 228.519 159.841 1.00 290.26 ?  38   PRO A CB    1 
ATOM   6     C  CG    . PRO A 1  39   ? 200.971 229.800 159.569 1.00 282.21 ?  38   PRO A CG    1 
ATOM   7     C  CD    . PRO A 1  39   ? 200.916 229.878 158.060 1.00 274.74 ?  38   PRO A CD    1 
ATOM   8     N  N     . HIS A 1  40   ? 200.616 225.505 159.733 1.00 194.89 ?  39   HIS A N     1 
ATOM   9     C  CA    . HIS A 1  40   ? 199.815 224.311 159.791 1.00 172.29 ?  39   HIS A CA    1 
ATOM   10    C  C     . HIS A 1  40   ? 199.921 223.681 161.180 1.00 164.68 ?  39   HIS A C     1 
ATOM   11    O  O     . HIS A 1  40   ? 201.012 223.601 161.803 1.00 173.05 ?  39   HIS A O     1 
ATOM   12    C  CB    . HIS A 1  40   ? 200.295 223.331 158.722 1.00 170.90 ?  39   HIS A CB    1 
ATOM   13    C  CG    . HIS A 1  40   ? 199.910 221.896 158.903 1.00 152.27 ?  39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A 1  40   ? 198.662 221.498 159.280 1.00 111.29 ?  39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A 1  40   ? 200.599 220.743 158.694 1.00 172.99 ?  39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A 1  40   ? 198.603 220.167 159.311 1.00 110.26 ?  39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A 1  40   ? 199.764 219.689 158.960 1.00 139.76 ?  39   HIS A NE2   1 
ATOM   18    N  N     . ARG A 1  41   ? 198.782 223.245 161.652 1.00 163.96 ?  40   ARG A N     1 
ATOM   19    C  CA    . ARG A 1  41   ? 198.663 222.431 162.892 1.00 189.18 ?  40   ARG A CA    1 
ATOM   20    C  C     . ARG A 1  41   ? 197.444 221.543 162.697 1.00 171.95 ?  40   ARG A C     1 
ATOM   21    O  O     . ARG A 1  41   ? 196.338 222.058 162.303 1.00 199.08 ?  40   ARG A O     1 
ATOM   22    C  CB    . ARG A 1  41   ? 198.435 223.359 164.077 1.00 226.80 ?  40   ARG A CB    1 
ATOM   23    C  CG    . ARG A 1  41   ? 199.044 222.965 165.418 1.00 204.36 ?  40   ARG A CG    1 
ATOM   24    C  CD    . ARG A 1  41   ? 198.741 224.093 166.395 1.00 162.79 ?  40   ARG A CD    1 
ATOM   25    N  NE    . ARG A 1  41   ? 198.994 223.831 167.819 1.00 146.98 ?  40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A 1  41   ? 198.114 223.968 168.827 1.00 128.86 ?  40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A 1  41   ? 196.791 223.930 168.619 1.00 79.46  1  40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A 1  41   ? 198.604 224.121 170.064 1.00 123.99 ?  40   ARG A NH2   1 
ATOM   29    N  N     . TYR A 1  42   ? 197.612 220.247 162.967 1.00 154.02 ?  41   TYR A N     1 
ATOM   30    C  CA    . TYR A 1  42   ? 196.555 219.240 162.685 1.00 179.08 ?  41   TYR A CA    1 
ATOM   31    C  C     . TYR A 1  42   ? 195.255 219.598 163.406 1.00 251.78 ?  41   TYR A C     1 
ATOM   32    O  O     . TYR A 1  42   ? 195.298 220.061 164.563 1.00 320.00 ?  41   TYR A O     1 
ATOM   33    C  CB    . TYR A 1  42   ? 197.036 217.838 163.068 1.00 159.58 ?  41   TYR A CB    1 
ATOM   34    C  CG    . TYR A 1  42   ? 197.827 217.129 161.998 1.00 137.52 ?  41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A 1  42   ? 197.235 216.755 160.803 1.00 137.42 ?  41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A 1  42   ? 199.165 216.828 162.178 1.00 159.14 ?  41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A 1  42   ? 197.952 216.104 159.813 1.00 159.19 ?  41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A 1  42   ? 199.899 216.179 161.200 1.00 200.44 ?  41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A 1  42   ? 199.290 215.814 160.011 1.00 191.00 ?  41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A 1  42   ? 200.005 215.172 159.043 1.00 279.78 ?  41   TYR A OH    1 
ATOM   41    N  N     . ARG A 1  43   ? 194.131 219.381 162.715 1.00 213.51 ?  42   ARG A N     1 
ATOM   42    C  CA    . ARG A 1  43   ? 192.780 219.656 163.268 1.00 185.41 ?  42   ARG A CA    1 
ATOM   43    C  C     . ARG A 1  43   ? 192.584 218.752 164.487 1.00 167.58 ?  42   ARG A C     1 
ATOM   44    O  O     . ARG A 1  43   ? 192.982 217.570 164.421 1.00 115.33 ?  42   ARG A O     1 
ATOM   45    C  CB    . ARG A 1  43   ? 191.704 219.397 162.209 1.00 213.14 ?  42   ARG A CB    1 
ATOM   46    C  CG    . ARG A 1  43   ? 190.284 219.679 162.681 1.00 246.95 ?  42   ARG A CG    1 
ATOM   47    C  CD    . ARG A 1  43   ? 189.259 219.481 161.582 1.00 306.09 ?  42   ARG A CD    1 
ATOM   48    N  NE    . ARG A 1  43   ? 189.176 218.095 161.143 1.00 327.43 ?  42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A 1  43   ? 188.463 217.154 161.751 1.00 285.14 ?  42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A 1  43   ? 188.066 217.330 162.999 1.00 374.51 1  42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A 1  43   ? 188.149 216.043 161.110 1.00 153.64 ?  42   ARG A NH2   1 
ATOM   52    N  N     . PRO A 1  44   ? 191.937 219.222 165.573 1.00 177.17 ?  43   PRO A N     1 
ATOM   53    C  CA    . PRO A 1  44   ? 191.824 218.411 166.781 1.00 184.16 ?  43   PRO A CA    1 
ATOM   54    C  C     . PRO A 1  44   ? 191.156 217.050 166.543 1.00 178.06 ?  43   PRO A C     1 
ATOM   55    O  O     . PRO A 1  44   ? 190.113 216.987 165.920 1.00 195.08 ?  43   PRO A O     1 
ATOM   56    C  CB    . PRO A 1  44   ? 190.931 219.264 167.695 1.00 200.32 ?  43   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1  44   ? 191.123 220.680 167.194 1.00 174.20 ?  43   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1  44   ? 191.310 220.539 165.698 1.00 163.56 ?  43   PRO A CD    1 
ATOM   59    N  N     . GLY A 1  45   ? 191.804 216.005 167.065 1.00 173.08 ?  44   GLY A N     1 
ATOM   60    C  CA    . GLY A 1  45   ? 191.328 214.609 167.031 1.00 165.43 ?  44   GLY A CA    1 
ATOM   61    C  C     . GLY A 1  45   ? 191.831 213.833 165.833 1.00 150.22 ?  44   GLY A C     1 
ATOM   62    O  O     . GLY A 1  45   ? 191.312 212.756 165.510 1.00 112.53 ?  44   GLY A O     1 
ATOM   63    N  N     . THR A 1  46   ? 192.851 214.375 165.174 1.00 152.91 ?  45   THR A N     1 
ATOM   64    C  CA    . THR A 1  46   ? 193.383 213.764 163.960 1.00 174.98 ?  45   THR A CA    1 
ATOM   65    C  C     . THR A 1  46   ? 194.631 212.913 164.265 1.00 161.08 ?  45   THR A C     1 
ATOM   66    O  O     . THR A 1  46   ? 195.048 212.096 163.457 1.00 207.97 ?  45   THR A O     1 
ATOM   67    C  CB    . THR A 1  46   ? 193.776 214.850 162.970 1.00 164.48 ?  45   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  46   ? 194.411 214.264 161.833 1.00 253.38 ?  45   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  46   ? 194.716 215.800 163.673 1.00 141.18 ?  45   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  47   ? 195.274 213.173 165.407 1.00 124.58 ?  46   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  47   ? 196.516 212.566 165.708 1.00 138.93 ?  46   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  47   ? 196.200 211.329 166.565 1.00 130.22 ?  46   VAL A C     1 
ATOM   73    O  O     . VAL A 1  47   ? 197.001 210.363 166.654 1.00 121.07 ?  46   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  47   ? 197.386 213.599 166.463 1.00 178.07 ?  46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  47   ? 198.733 213.087 166.951 1.00 268.48 ?  46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  47   ? 197.601 214.795 165.610 1.00 135.21 ?  46   VAL A CG2   1 
ATOM   77    N  N     . ALA A 1  48   ? 195.153 211.409 167.415 1.00 127.27 ?  47   ALA A N     1 
ATOM   78    C  CA    . ALA A 1  48   ? 195.030 210.601 168.606 1.00 153.18 ?  47   ALA A CA    1 
ATOM   79    C  C     . ALA A 1  48   ? 194.608 209.177 168.222 1.00 117.27 ?  47   ALA A C     1 
ATOM   80    O  O     . ALA A 1  48   ? 194.908 208.258 168.852 1.00 99.13  ?  47   ALA A O     1 
ATOM   81    C  CB    . ALA A 1  48   ? 194.067 211.232 169.600 1.00 177.72 ?  47   ALA A CB    1 
ATOM   82    N  N     . LEU A 1  49   ? 193.723 209.124 167.225 1.00 116.90 ?  48   LEU A N     1 
ATOM   83    C  CA    . LEU A 1  49   ? 193.151 207.913 166.717 1.00 155.09 ?  48   LEU A CA    1 
ATOM   84    C  C     . LEU A 1  49   ? 194.249 207.124 166.015 1.00 168.44 ?  48   LEU A C     1 
ATOM   85    O  O     . LEU A 1  49   ? 194.278 205.867 166.083 1.00 139.21 ?  48   LEU A O     1 
ATOM   86    C  CB    . LEU A 1  49   ? 191.980 208.269 165.789 1.00 184.61 ?  48   LEU A CB    1 
ATOM   87    C  CG    . LEU A 1  49   ? 190.705 208.665 166.514 1.00 193.84 ?  48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A 1  49   ? 190.910 209.890 167.375 1.00 199.19 ?  48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A 1  49   ? 189.565 208.850 165.547 1.00 228.04 ?  48   LEU A CD2   1 
ATOM   90    N  N     . ARG A 1  50   ? 195.101 207.867 165.295 1.00 179.47 ?  49   ARG A N     1 
ATOM   91    C  CA    . ARG A 1  50   ? 196.145 207.344 164.404 1.00 194.85 ?  49   ARG A CA    1 
ATOM   92    C  C     . ARG A 1  50   ? 197.100 206.476 165.198 1.00 147.75 ?  49   ARG A C     1 
ATOM   93    O  O     . ARG A 1  50   ? 197.506 205.332 164.826 1.00 147.72 ?  49   ARG A O     1 
ATOM   94    C  CB    . ARG A 1  50   ? 196.838 208.516 163.710 1.00 216.54 ?  49   ARG A CB    1 
ATOM   95    C  CG    . ARG A 1  50   ? 195.775 209.256 162.908 1.00 409.69 ?  49   ARG A CG    1 
ATOM   96    C  CD    . ARG A 1  50   ? 195.867 209.774 161.491 1.00 440.00 ?  49   ARG A CD    1 
ATOM   97    N  NE    . ARG A 1  50   ? 194.509 210.072 160.923 1.00 440.00 ?  49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A 1  50   ? 193.724 209.213 160.165 1.00 440.00 ?  49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A 1  50   ? 193.850 207.905 160.308 1.00 440.00 1  49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A 1  50   ? 192.807 209.629 159.276 1.00 210.75 ?  49   ARG A NH2   1 
ATOM   101   N  N     . GLU A 1  51   ? 197.446 207.010 166.355 1.00 131.08 ?  50   GLU A N     1 
ATOM   102   C  CA    . GLU A 1  51   ? 198.261 206.307 167.259 1.00 174.52 ?  50   GLU A CA    1 
ATOM   103   C  C     . GLU A 1  51   ? 197.549 205.138 167.931 1.00 158.51 ?  50   GLU A C     1 
ATOM   104   O  O     . GLU A 1  51   ? 198.238 204.069 168.073 1.00 192.40 ?  50   GLU A O     1 
ATOM   105   C  CB    . GLU A 1  51   ? 198.719 207.278 168.333 1.00 211.84 ?  50   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1  51   ? 199.025 208.682 167.881 1.00 255.47 ?  50   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1  51   ? 199.288 209.587 169.091 1.00 324.46 ?  50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1  51   ? 198.649 209.343 170.104 1.00 422.56 ?  50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1  51   ? 200.203 210.417 169.092 1.00 134.57 -1 50   GLU A OE2   1 
ATOM   110   N  N     . ILE A 1  52   ? 196.248 205.321 168.257 1.00 116.30 ?  51   ILE A N     1 
ATOM   111   C  CA    . ILE A 1  52   ? 195.457 204.360 168.984 1.00 103.89 ?  51   ILE A CA    1 
ATOM   112   C  C     . ILE A 1  52   ? 195.760 202.978 168.403 1.00 89.74  ?  51   ILE A C     1 
ATOM   113   O  O     . ILE A 1  52   ? 195.977 202.027 169.115 1.00 87.36  ?  51   ILE A O     1 
ATOM   114   C  CB    . ILE A 1  52   ? 193.935 204.646 168.943 1.00 85.50  ?  51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A 1  52   ? 193.647 205.904 169.783 1.00 95.65  ?  51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A 1  52   ? 193.079 203.515 169.444 1.00 57.29  ?  51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A 1  52   ? 192.309 206.527 169.640 1.00 81.97  ?  51   ILE A CD1   1 
ATOM   118   N  N     . ARG A 1  53   ? 195.631 202.987 167.073 1.00 83.56  ?  52   ARG A N     1 
ATOM   119   C  CA    . ARG A 1  53   ? 195.754 201.813 166.293 1.00 128.09 ?  52   ARG A CA    1 
ATOM   120   C  C     . ARG A 1  53   ? 197.217 201.337 166.297 1.00 147.84 ?  52   ARG A C     1 
ATOM   121   O  O     . ARG A 1  53   ? 197.468 200.091 166.411 1.00 186.78 ?  52   ARG A O     1 
ATOM   122   C  CB    . ARG A 1  53   ? 195.150 202.104 164.906 1.00 193.69 ?  52   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1  53   ? 193.645 202.378 164.948 1.00 245.98 ?  52   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1  53   ? 192.963 202.769 163.644 1.00 236.31 ?  52   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1  53   ? 193.023 201.688 162.659 1.00 227.10 ?  52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1  53   ? 192.614 201.782 161.401 1.00 203.32 ?  52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1  53   ? 192.153 202.947 160.980 1.00 185.72 1  52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1  53   ? 192.683 200.732 160.585 1.00 173.36 ?  52   ARG A NH2   1 
ATOM   129   N  N     . ARG A 1  54   ? 198.121 202.288 166.015 1.00 146.80 ?  53   ARG A N     1 
ATOM   130   C  CA    . ARG A 1  54   ? 199.540 201.953 165.873 1.00 148.48 ?  53   ARG A CA    1 
ATOM   131   C  C     . ARG A 1  54   ? 199.896 201.173 167.143 1.00 132.37 ?  53   ARG A C     1 
ATOM   132   O  O     . ARG A 1  54   ? 200.651 200.125 167.256 1.00 117.84 ?  53   ARG A O     1 
ATOM   133   C  CB    . ARG A 1  54   ? 200.397 203.193 165.740 1.00 133.65 ?  53   ARG A CB    1 
ATOM   134   C  CG    . ARG A 1  54   ? 200.342 203.739 164.318 1.00 136.25 ?  53   ARG A CG    1 
ATOM   135   C  CD    . ARG A 1  54   ? 201.098 204.971 164.008 1.00 157.80 ?  53   ARG A CD    1 
ATOM   136   N  NE    . ARG A 1  54   ? 201.932 205.545 165.060 1.00 199.36 ?  53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A 1  54   ? 202.206 206.847 165.217 1.00 209.36 ?  53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A 1  54   ? 201.727 207.781 164.404 1.00 190.88 1  53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A 1  54   ? 202.987 207.221 166.218 1.00 172.10 ?  53   ARG A NH2   1 
ATOM   140   N  N     . TYR A 1  55   ? 199.343 201.780 168.189 1.00 138.74 ?  54   TYR A N     1 
ATOM   141   C  CA    . TYR A 1  55   ? 199.603 201.292 169.546 1.00 149.44 ?  54   TYR A CA    1 
ATOM   142   C  C     . TYR A 1  55   ? 198.809 200.045 169.802 1.00 140.28 ?  54   TYR A C     1 
ATOM   143   O  O     . TYR A 1  55   ? 199.295 199.102 170.451 1.00 165.40 ?  54   TYR A O     1 
ATOM   144   C  CB    . TYR A 1  55   ? 199.329 202.437 170.504 1.00 169.05 ?  54   TYR A CB    1 
ATOM   145   C  CG    . TYR A 1  55   ? 200.433 203.491 170.411 1.00 281.66 ?  54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A 1  55   ? 201.685 203.319 169.784 1.00 331.87 ?  54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A 1  55   ? 200.259 204.702 171.064 1.00 386.72 ?  54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A 1  55   ? 202.647 204.329 169.716 1.00 330.88 ?  54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A 1  55   ? 201.231 205.698 171.052 1.00 371.66 ?  54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A 1  55   ? 202.424 205.529 170.368 1.00 312.91 ?  54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A 1  55   ? 203.329 206.547 170.347 1.00 198.84 ?  54   TYR A OH    1 
ATOM   152   N  N     . GLN A 1  56   ? 197.664 199.924 169.151 1.00 127.85 ?  55   GLN A N     1 
ATOM   153   C  CA    . GLN A 1  56   ? 196.885 198.659 169.211 1.00 113.03 ?  55   GLN A CA    1 
ATOM   154   C  C     . GLN A 1  56   ? 197.519 197.447 168.520 1.00 137.38 ?  55   GLN A C     1 
ATOM   155   O  O     . GLN A 1  56   ? 197.325 196.347 169.009 1.00 113.70 ?  55   GLN A O     1 
ATOM   156   C  CB    . GLN A 1  56   ? 195.544 198.869 168.529 1.00 100.17 ?  55   GLN A CB    1 
ATOM   157   C  CG    . GLN A 1  56   ? 194.502 199.613 169.366 1.00 99.16  ?  55   GLN A CG    1 
ATOM   158   C  CD    . GLN A 1  56   ? 193.297 199.868 168.497 1.00 101.84 ?  55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A 1  56   ? 193.381 199.774 167.286 1.00 119.60 ?  55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A 1  56   ? 192.143 200.003 169.107 1.00 123.29 ?  55   GLN A NE2   1 
ATOM   161   N  N     . LYS A 1  57   ? 198.200 197.663 167.400 1.00 186.47 ?  56   LYS A N     1 
ATOM   162   C  CA    . LYS A 1  57   ? 198.801 196.570 166.642 1.00 189.26 ?  56   LYS A CA    1 
ATOM   163   C  C     . LYS A 1  57   ? 199.927 195.810 167.374 1.00 190.46 ?  56   LYS A C     1 
ATOM   164   O  O     . LYS A 1  57   ? 200.051 194.572 167.283 1.00 144.07 ?  56   LYS A O     1 
ATOM   165   C  CB    . LYS A 1  57   ? 199.455 197.102 165.385 1.00 196.44 ?  56   LYS A CB    1 
ATOM   166   C  CG    . LYS A 1  57   ? 198.587 197.418 164.199 1.00 236.51 ?  56   LYS A CG    1 
ATOM   167   C  CD    . LYS A 1  57   ? 199.376 198.247 163.172 1.00 266.80 ?  56   LYS A CD    1 
ATOM   168   C  CE    . LYS A 1  57   ? 200.436 197.539 162.331 1.00 230.05 ?  56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A 1  57   ? 200.968 198.392 161.229 1.00 195.26 1  56   LYS A NZ    1 
ATOM   170   N  N     . SER A 1  58   ? 200.735 196.563 168.138 1.00 216.74 ?  57   SER A N     1 
ATOM   171   C  CA    . SER A 1  58   ? 202.013 196.141 168.813 1.00 192.32 ?  57   SER A CA    1 
ATOM   172   C  C     . SER A 1  58   ? 201.822 195.418 170.158 1.00 178.25 ?  57   SER A C     1 
ATOM   173   O  O     . SER A 1  58   ? 200.818 195.550 170.827 1.00 246.92 ?  57   SER A O     1 
ATOM   174   C  CB    . SER A 1  58   ? 202.891 197.396 168.953 1.00 180.52 ?  57   SER A CB    1 
ATOM   175   O  OG    . SER A 1  58   ? 202.470 198.332 169.960 1.00 190.30 ?  57   SER A OG    1 
ATOM   176   N  N     . THR A 1  59   ? 202.856 194.781 170.671 1.00 153.85 ?  58   THR A N     1 
ATOM   177   C  CA    . THR A 1  59   ? 202.689 194.044 171.950 1.00 158.95 ?  58   THR A CA    1 
ATOM   178   C  C     . THR A 1  59   ? 203.415 194.668 173.160 1.00 161.18 ?  58   THR A C     1 
ATOM   179   O  O     . THR A 1  59   ? 202.856 194.676 174.280 1.00 179.27 ?  58   THR A O     1 
ATOM   180   C  CB    . THR A 1  59   ? 203.154 192.594 171.844 1.00 164.42 ?  58   THR A CB    1 
ATOM   181   O  OG1   . THR A 1  59   ? 204.525 192.555 171.450 1.00 223.39 ?  58   THR A OG1   1 
ATOM   182   C  CG2   . THR A 1  59   ? 202.368 191.731 170.896 1.00 148.90 ?  58   THR A CG2   1 
ATOM   183   N  N     . GLU A 1  60   ? 204.521 195.336 172.849 1.00 181.91 ?  59   GLU A N     1 
ATOM   184   C  CA    . GLU A 1  60   ? 205.493 195.907 173.741 1.00 241.55 ?  59   GLU A CA    1 
ATOM   185   C  C     . GLU A 1  60   ? 204.951 196.804 174.875 1.00 306.51 ?  59   GLU A C     1 
ATOM   186   O  O     . GLU A 1  60   ? 204.107 197.718 174.701 1.00 404.36 ?  59   GLU A O     1 
ATOM   187   C  CB    . GLU A 1  60   ? 206.463 196.797 172.952 1.00 280.34 ?  59   GLU A CB    1 
ATOM   188   C  CG    . GLU A 1  60   ? 207.391 197.645 173.829 1.00 272.39 ?  59   GLU A CG    1 
ATOM   189   C  CD    . GLU A 1  60   ? 206.880 198.966 174.345 1.00 161.28 ?  59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A 1  60   ? 206.070 199.519 173.630 1.00 103.66 ?  59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A 1  60   ? 207.381 199.358 175.435 1.00 184.54 -1 59   GLU A OE2   1 
ATOM   192   N  N     . LEU A 1  61   ? 205.527 196.616 176.079 1.00 308.98 ?  60   LEU A N     1 
ATOM   193   C  CA    . LEU A 1  61   ? 204.986 197.212 177.303 1.00 254.39 ?  60   LEU A CA    1 
ATOM   194   C  C     . LEU A 1  61   ? 205.180 198.740 177.300 1.00 187.22 ?  60   LEU A C     1 
ATOM   195   O  O     . LEU A 1  61   ? 206.128 199.333 176.783 1.00 134.52 ?  60   LEU A O     1 
ATOM   196   C  CB    . LEU A 1  61   ? 205.635 196.577 178.536 1.00 315.93 ?  60   LEU A CB    1 
ATOM   197   C  CG    . LEU A 1  61   ? 205.065 195.247 179.037 1.00 256.53 ?  60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A 1  61   ? 205.733 194.847 180.347 1.00 304.09 ?  60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A 1  61   ? 203.585 195.327 179.264 1.00 195.44 ?  60   LEU A CD2   1 
ATOM   200   N  N     . LEU A 1  62   ? 204.232 199.401 177.967 1.00 185.24 ?  61   LEU A N     1 
ATOM   201   C  CA    . LEU A 1  62   ? 204.152 200.828 177.999 1.00 207.99 ?  61   LEU A CA    1 
ATOM   202   C  C     . LEU A 1  62   ? 204.772 201.453 179.261 1.00 226.84 ?  61   LEU A C     1 
ATOM   203   O  O     . LEU A 1  62   ? 205.304 202.623 179.178 1.00 171.93 ?  61   LEU A O     1 
ATOM   204   C  CB    . LEU A 1  62   ? 202.669 201.140 177.900 1.00 209.55 ?  61   LEU A CB    1 
ATOM   205   C  CG    . LEU A 1  62   ? 201.979 200.876 176.554 1.00 182.67 ?  61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A 1  62   ? 200.573 201.391 176.556 1.00 204.01 ?  61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A 1  62   ? 202.742 201.482 175.405 1.00 167.87 ?  61   LEU A CD2   1 
ATOM   208   N  N     . ILE A 1  63   ? 204.743 200.694 180.366 1.00 223.79 ?  62   ILE A N     1 
ATOM   209   C  CA    . ILE A 1  63   ? 205.280 201.128 181.630 1.00 194.12 ?  62   ILE A CA    1 
ATOM   210   C  C     . ILE A 1  63   ? 206.805 201.036 181.677 1.00 212.68 ?  62   ILE A C     1 
ATOM   211   O  O     . ILE A 1  63   ? 207.429 200.196 181.081 1.00 314.99 ?  62   ILE A O     1 
ATOM   212   C  CB    . ILE A 1  63   ? 204.815 200.244 182.801 1.00 152.57 ?  62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A 1  63   ? 203.324 199.937 182.842 1.00 155.32 ?  62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A 1  63   ? 205.328 200.845 184.108 1.00 166.14 ?  62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A 1  63   ? 202.999 198.887 183.774 1.00 117.38 ?  62   ILE A CD1   1 
ATOM   216   N  N     . ARG A 1  64   ? 207.401 201.864 182.528 1.00 210.19 ?  63   ARG A N     1 
ATOM   217   C  CA    . ARG A 1  64   ? 208.867 201.943 182.593 1.00 234.45 ?  63   ARG A CA    1 
ATOM   218   C  C     . ARG A 1  64   ? 209.416 200.840 183.479 1.00 296.57 ?  63   ARG A C     1 
ATOM   219   O  O     . ARG A 1  64   ? 208.845 200.500 184.554 1.00 355.93 ?  63   ARG A O     1 
ATOM   220   C  CB    . ARG A 1  64   ? 209.339 203.341 183.065 1.00 209.53 ?  63   ARG A CB    1 
ATOM   221   C  CG    . ARG A 1  64   ? 208.987 204.465 182.075 1.00 139.62 ?  63   ARG A CG    1 
ATOM   222   C  CD    . ARG A 1  64   ? 209.299 205.877 182.438 1.00 116.47 ?  63   ARG A CD    1 
ATOM   223   N  NE    . ARG A 1  64   ? 210.753 206.154 182.587 1.00 121.33 ?  63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A 1  64   ? 211.261 207.284 183.009 1.00 119.28 ?  63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A 1  64   ? 210.628 207.926 183.969 1.00 131.47 1  63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A 1  64   ? 212.398 207.750 182.489 1.00 129.41 ?  63   ARG A NH2   1 
ATOM   227   N  N     . LYS A 1  65   ? 210.516 200.252 183.016 1.00 280.00 ?  64   LYS A N     1 
ATOM   228   C  CA    . LYS A 1  65   ? 211.312 199.247 183.749 1.00 229.97 ?  64   LYS A CA    1 
ATOM   229   C  C     . LYS A 1  65   ? 211.857 199.709 185.122 1.00 192.75 ?  64   LYS A C     1 
ATOM   230   O  O     . LYS A 1  65   ? 211.708 198.931 186.091 1.00 141.50 ?  64   LYS A O     1 
ATOM   231   C  CB    . LYS A 1  65   ? 212.458 198.805 182.839 1.00 251.33 ?  64   LYS A CB    1 
ATOM   232   C  CG    . LYS A 1  65   ? 213.259 197.576 183.206 1.00 297.38 ?  64   LYS A CG    1 
ATOM   233   C  CD    . LYS A 1  65   ? 213.905 196.903 181.984 1.00 351.81 ?  64   LYS A CD    1 
ATOM   234   C  CE    . LYS A 1  65   ? 215.098 197.636 181.380 1.00 339.64 ?  64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A 1  65   ? 215.969 196.725 180.604 1.00 300.78 1  64   LYS A NZ    1 
ATOM   236   N  N     . LEU A 1  66   ? 212.425 200.916 185.225 1.00 175.40 ?  65   LEU A N     1 
ATOM   237   C  CA    . LEU A 1  66   ? 213.034 201.375 186.509 1.00 149.61 ?  65   LEU A CA    1 
ATOM   238   C  C     . LEU A 1  66   ? 212.055 201.788 187.602 1.00 106.91 ?  65   LEU A C     1 
ATOM   239   O  O     . LEU A 1  66   ? 212.202 201.390 188.715 1.00 94.14  ?  65   LEU A O     1 
ATOM   240   C  CB    . LEU A 1  66   ? 213.946 202.569 186.225 1.00 146.19 ?  65   LEU A CB    1 
ATOM   241   C  CG    . LEU A 1  66   ? 214.835 203.118 187.336 1.00 175.87 ?  65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A 1  66   ? 216.149 203.658 186.755 1.00 166.27 ?  65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A 1  66   ? 214.148 204.195 188.140 1.00 203.10 ?  65   LEU A CD2   1 
ATOM   244   N  N     . PRO A 1  67   ? 211.167 202.765 187.322 1.00 90.71  ?  66   PRO A N     1 
ATOM   245   C  CA    . PRO A 1  67   ? 210.215 203.276 188.277 1.00 82.59  ?  66   PRO A CA    1 
ATOM   246   C  C     . PRO A 1  67   ? 209.257 202.216 188.806 1.00 82.90  ?  66   PRO A C     1 
ATOM   247   O  O     . PRO A 1  67   ? 208.922 202.228 190.001 1.00 75.68  ?  66   PRO A O     1 
ATOM   248   C  CB    . PRO A 1  67   ? 209.394 204.263 187.464 1.00 93.12  ?  66   PRO A CB    1 
ATOM   249   C  CG    . PRO A 1  67   ? 210.222 204.637 186.284 1.00 106.03 ?  66   PRO A CG    1 
ATOM   250   C  CD    . PRO A 1  67   ? 211.079 203.421 186.000 1.00 101.82 ?  66   PRO A CD    1 
ATOM   251   N  N     . PHE A 1  68   ? 208.708 201.407 187.886 1.00 122.54 ?  67   PHE A N     1 
ATOM   252   C  CA    . PHE A 1  68   ? 207.869 200.293 188.220 1.00 195.84 ?  67   PHE A CA    1 
ATOM   253   C  C     . PHE A 1  68   ? 208.498 199.497 189.362 1.00 164.24 ?  67   PHE A C     1 
ATOM   254   O  O     . PHE A 1  68   ? 207.826 199.150 190.346 1.00 175.76 ?  67   PHE A O     1 
ATOM   255   C  CB    . PHE A 1  68   ? 207.544 199.396 187.010 1.00 227.35 ?  67   PHE A CB    1 
ATOM   256   C  CG    . PHE A 1  68   ? 206.591 198.257 187.271 1.00 201.58 ?  67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A 1  68   ? 205.221 198.396 187.271 1.00 128.01 ?  67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A 1  68   ? 207.052 197.015 187.644 1.00 186.62 ?  67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A 1  68   ? 204.360 197.337 187.493 1.00 81.00  ?  67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A 1  68   ? 206.175 195.982 187.968 1.00 109.40 ?  67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A 1  68   ? 204.829 196.172 188.026 1.00 69.91  ?  67   PHE A CZ    1 
ATOM   262   N  N     . GLN A 1  69   ? 209.752 199.103 189.085 1.00 128.20 ?  68   GLN A N     1 
ATOM   263   C  CA    . GLN A 1  69   ? 210.543 198.241 189.912 1.00 145.00 ?  68   GLN A CA    1 
ATOM   264   C  C     . GLN A 1  69   ? 210.655 198.881 191.299 1.00 148.48 ?  68   GLN A C     1 
ATOM   265   O  O     . GLN A 1  69   ? 210.542 198.107 192.255 1.00 165.12 ?  68   GLN A O     1 
ATOM   266   C  CB    . GLN A 1  69   ? 211.845 197.948 189.184 1.00 199.05 ?  68   GLN A CB    1 
ATOM   267   C  CG    . GLN A 1  69   ? 212.682 196.880 189.922 1.00 280.00 ?  68   GLN A CG    1 
ATOM   268   C  CD    . GLN A 1  69   ? 214.068 196.697 189.384 1.00 314.70 ?  68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A 1  69   ? 214.939 196.092 190.050 1.00 360.00 ?  68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A 1  69   ? 214.290 197.197 188.169 1.00 285.05 ?  68   GLN A NE2   1 
ATOM   271   N  N     . ARG A 1  70   ? 211.059 200.143 191.353 1.00 133.33 ?  69   ARG A N     1 
ATOM   272   C  CA    . ARG A 1  70   ? 211.232 200.855 192.593 1.00 105.26 ?  69   ARG A CA    1 
ATOM   273   C  C     . ARG A 1  70   ? 209.925 200.784 193.389 1.00 92.49  ?  69   ARG A C     1 
ATOM   274   O  O     . ARG A 1  70   ? 209.927 200.610 194.663 1.00 84.40  ?  69   ARG A O     1 
ATOM   275   C  CB    . ARG A 1  70   ? 211.447 202.356 192.423 1.00 96.69  ?  69   ARG A CB    1 
ATOM   276   C  CG    . ARG A 1  70   ? 212.733 202.824 191.756 1.00 111.94 ?  69   ARG A CG    1 
ATOM   277   C  CD    . ARG A 1  70   ? 212.905 204.354 191.662 1.00 112.02 ?  69   ARG A CD    1 
ATOM   278   N  NE    . ARG A 1  70   ? 214.121 204.886 190.952 1.00 125.11 ?  69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A 1  70   ? 214.467 206.155 190.630 1.00 116.03 ?  69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A 1  70   ? 213.620 207.152 190.487 1.00 82.75  1  69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A 1  70   ? 215.734 206.421 190.426 1.00 119.17 ?  69   ARG A NH2   1 
ATOM   282   N  N     . LEU A 1  71   ? 208.822 201.022 192.663 1.00 112.58 ?  70   LEU A N     1 
ATOM   283   C  CA    . LEU A 1  71   ? 207.536 201.076 193.315 1.00 173.40 ?  70   LEU A CA    1 
ATOM   284   C  C     . LEU A 1  71   ? 207.201 199.723 193.930 1.00 150.43 ?  70   LEU A C     1 
ATOM   285   O  O     . LEU A 1  71   ? 206.616 199.646 195.063 1.00 176.54 ?  70   LEU A O     1 
ATOM   286   C  CB    . LEU A 1  71   ? 206.398 201.450 192.378 1.00 255.16 ?  70   LEU A CB    1 
ATOM   287   C  CG    . LEU A 1  71   ? 205.052 201.672 193.126 1.00 241.95 ?  70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1  71   ? 205.141 202.586 194.351 1.00 220.22 ?  70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1  71   ? 203.985 202.293 192.236 1.00 232.72 ?  70   LEU A CD2   1 
ATOM   290   N  N     . VAL A 1  72   ? 207.507 198.672 193.199 1.00 122.37 ?  71   VAL A N     1 
ATOM   291   C  CA    . VAL A 1  72   ? 207.198 197.301 193.665 1.00 139.21 ?  71   VAL A CA    1 
ATOM   292   C  C     . VAL A 1  72   ? 207.976 197.051 194.951 1.00 168.49 ?  71   VAL A C     1 
ATOM   293   O  O     . VAL A 1  72   ? 207.431 196.488 195.929 1.00 206.53 ?  71   VAL A O     1 
ATOM   294   C  CB    . VAL A 1  72   ? 207.529 196.228 192.626 1.00 133.78 ?  71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A 1  72   ? 207.317 194.887 193.328 1.00 134.22 ?  71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A 1  72   ? 206.610 196.316 191.428 1.00 162.90 ?  71   VAL A CG2   1 
ATOM   297   N  N     . ARG A 1  73   ? 209.244 197.463 194.928 1.00 185.78 ?  72   ARG A N     1 
ATOM   298   C  CA    . ARG A 1  73   ? 210.136 197.355 196.091 1.00 211.12 ?  72   ARG A CA    1 
ATOM   299   C  C     . ARG A 1  73   ? 209.572 198.147 197.260 1.00 218.14 ?  72   ARG A C     1 
ATOM   300   O  O     . ARG A 1  73   ? 209.604 197.575 198.421 1.00 245.55 ?  72   ARG A O     1 
ATOM   301   C  CB    . ARG A 1  73   ? 211.575 197.733 195.735 1.00 198.11 ?  72   ARG A CB    1 
ATOM   302   C  CG    . ARG A 1  73   ? 212.252 197.019 194.568 1.00 200.51 ?  72   ARG A CG    1 
ATOM   303   C  CD    . ARG A 1  73   ? 212.507 195.524 194.688 1.00 203.21 ?  72   ARG A CD    1 
ATOM   304   N  NE    . ARG A 1  73   ? 212.997 194.833 193.508 1.00 172.08 ?  72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A 1  73   ? 214.262 194.646 193.178 1.00 125.32 ?  72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A 1  73   ? 215.183 195.007 194.032 1.00 133.75 1  72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A 1  73   ? 214.579 194.155 191.980 1.00 98.81  ?  72   ARG A NH2   1 
ATOM   308   N  N     . GLU A 1  74   ? 209.018 199.349 197.002 1.00 201.45 ?  73   GLU A N     1 
ATOM   309   C  CA    . GLU A 1  74   ? 208.524 200.224 198.065 1.00 179.13 ?  73   GLU A CA    1 
ATOM   310   C  C     . GLU A 1  74   ? 207.498 199.554 199.002 1.00 142.07 ?  73   GLU A C     1 
ATOM   311   O  O     . GLU A 1  74   ? 207.608 199.650 200.236 1.00 130.07 ?  73   GLU A O     1 
ATOM   312   C  CB    . GLU A 1  74   ? 207.989 201.528 197.452 1.00 200.85 ?  73   GLU A CB    1 
ATOM   313   C  CG    . GLU A 1  74   ? 207.472 202.498 198.470 1.00 217.75 ?  73   GLU A CG    1 
ATOM   314   C  CD    . GLU A 1  74   ? 206.109 202.236 199.025 1.00 298.14 ?  73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1  74   ? 205.363 201.651 198.306 1.00 339.41 ?  73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1  74   ? 205.855 202.608 200.190 1.00 440.00 -1 73   GLU A OE2   1 
ATOM   317   N  N     . ILE A 1  75   ? 206.469 198.964 198.424 1.00 148.58 ?  74   ILE A N     1 
ATOM   318   C  CA    . ILE A 1  75   ? 205.418 198.281 199.175 1.00 180.88 ?  74   ILE A CA    1 
ATOM   319   C  C     . ILE A 1  75   ? 205.916 196.953 199.771 1.00 137.88 ?  74   ILE A C     1 
ATOM   320   O  O     . ILE A 1  75   ? 205.529 196.529 200.843 1.00 99.48  ?  74   ILE A O     1 
ATOM   321   C  CB    . ILE A 1  75   ? 204.168 198.001 198.305 1.00 228.79 ?  74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A 1  75   ? 203.471 199.316 197.953 1.00 269.93 ?  74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A 1  75   ? 203.259 197.007 199.041 1.00 282.95 ?  74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A 1  75   ? 204.093 200.057 196.844 1.00 219.76 ?  74   ILE A CD1   1 
ATOM   325   N  N     . ALA A 1  76   ? 206.651 196.208 198.953 1.00 163.96 ?  75   ALA A N     1 
ATOM   326   C  CA    . ALA A 1  76   ? 207.072 194.862 199.446 1.00 187.82 ?  75   ALA A CA    1 
ATOM   327   C  C     . ALA A 1  76   ? 207.818 195.044 200.745 1.00 150.62 ?  75   ALA A C     1 
ATOM   328   O  O     . ALA A 1  76   ? 207.711 194.226 201.660 1.00 99.68  ?  75   ALA A O     1 
ATOM   329   C  CB    . ALA A 1  76   ? 208.005 194.245 198.420 1.00 262.41 ?  75   ALA A CB    1 
ATOM   330   N  N     . GLN A 1  77   ? 208.630 196.107 200.804 1.00 183.80 ?  76   GLN A N     1 
ATOM   331   C  CA    . GLN A 1  77   ? 209.379 196.438 202.046 1.00 232.95 ?  76   GLN A CA    1 
ATOM   332   C  C     . GLN A 1  77   ? 208.361 196.631 203.172 1.00 196.04 ?  76   GLN A C     1 
ATOM   333   O  O     . GLN A 1  77   ? 208.602 196.235 204.301 1.00 179.09 ?  76   GLN A O     1 
ATOM   334   C  CB    . GLN A 1  77   ? 210.192 197.715 201.820 1.00 291.94 ?  76   GLN A CB    1 
ATOM   335   C  CG    . GLN A 1  77   ? 210.906 198.334 203.024 1.00 299.58 ?  76   GLN A CG    1 
ATOM   336   C  CD    . GLN A 1  77   ? 211.850 199.498 202.761 1.00 266.29 ?  76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1  77   ? 211.451 200.426 202.071 1.00 216.77 ?  76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1  77   ? 213.068 199.501 203.346 1.00 234.66 ?  76   GLN A NE2   1 
ATOM   339   N  N     . ASP A 1  78   ? 207.235 197.293 202.844 1.00 207.41 ?  77   ASP A N     1 
ATOM   340   C  CA    . ASP A 1  78   ? 206.283 197.651 203.891 1.00 240.07 ?  77   ASP A CA    1 
ATOM   341   C  C     . ASP A 1  78   ? 205.611 196.426 204.548 1.00 212.01 ?  77   ASP A C     1 
ATOM   342   O  O     . ASP A 1  78   ? 204.955 196.655 205.573 1.00 275.10 ?  77   ASP A O     1 
ATOM   343   C  CB    . ASP A 1  78   ? 205.179 198.571 203.379 1.00 320.27 ?  77   ASP A CB    1 
ATOM   344   C  CG    . ASP A 1  78   ? 205.627 199.994 203.063 1.00 353.30 ?  77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A 1  78   ? 206.692 200.405 203.604 1.00 257.14 ?  77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A 1  78   ? 204.874 200.673 202.318 1.00 440.00 -1 77   ASP A OD2   1 
ATOM   347   N  N     . PHE A 1  79   ? 205.647 195.229 203.966 1.00 163.98 ?  78   PHE A N     1 
ATOM   348   C  CA    . PHE A 1  79   ? 205.291 194.080 204.747 1.00 178.45 ?  78   PHE A CA    1 
ATOM   349   C  C     . PHE A 1  79   ? 206.535 193.570 205.504 1.00 167.87 ?  78   PHE A C     1 
ATOM   350   O  O     . PHE A 1  79   ? 206.605 193.517 206.770 1.00 202.65 ?  78   PHE A O     1 
ATOM   351   C  CB    . PHE A 1  79   ? 204.736 192.871 203.977 1.00 197.41 ?  78   PHE A CB    1 
ATOM   352   C  CG    . PHE A 1  79   ? 204.200 191.819 204.924 1.00 265.46 ?  78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A 1  79   ? 202.955 192.001 205.516 1.00 267.03 ?  78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A 1  79   ? 204.947 190.681 205.292 1.00 352.89 ?  78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A 1  79   ? 202.475 191.091 206.450 1.00 264.59 ?  78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A 1  79   ? 204.497 189.836 206.274 1.00 330.22 ?  78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A 1  79   ? 203.237 190.007 206.820 1.00 265.17 ?  78   PHE A CZ    1 
ATOM   358   N  N     . LYS A 1  80   ? 207.525 193.197 204.696 1.00 157.36 ?  79   LYS A N     1 
ATOM   359   C  CA    . LYS A 1  80   ? 208.850 192.822 205.149 1.00 183.85 ?  79   LYS A CA    1 
ATOM   360   C  C     . LYS A 1  80   ? 209.848 193.553 204.294 1.00 216.37 ?  79   LYS A C     1 
ATOM   361   O  O     . LYS A 1  80   ? 209.692 193.729 203.100 1.00 256.23 ?  79   LYS A O     1 
ATOM   362   C  CB    . LYS A 1  80   ? 209.087 191.319 205.078 1.00 198.87 ?  79   LYS A CB    1 
ATOM   363   C  CG    . LYS A 1  80   ? 208.358 190.633 206.196 1.00 234.19 ?  79   LYS A CG    1 
ATOM   364   C  CD    . LYS A 1  80   ? 208.553 189.120 206.174 1.00 258.56 ?  79   LYS A CD    1 
ATOM   365   C  CE    . LYS A 1  80   ? 207.653 188.351 207.128 1.00 314.94 ?  79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A 1  80   ? 208.283 187.108 207.699 1.00 326.06 1  79   LYS A NZ    1 
ATOM   367   N  N     . THR A 1  81   ? 210.906 194.009 204.982 1.00 248.84 ?  80   THR A N     1 
ATOM   368   C  CA    . THR A 1  81   ? 211.939 194.917 204.392 1.00 336.84 ?  80   THR A CA    1 
ATOM   369   C  C     . THR A 1  81   ? 213.142 194.194 203.767 1.00 368.81 ?  80   THR A C     1 
ATOM   370   O  O     . THR A 1  81   ? 213.688 193.156 204.298 1.00 321.53 ?  80   THR A O     1 
ATOM   371   C  CB    . THR A 1  81   ? 212.398 195.935 205.446 1.00 392.76 ?  80   THR A CB    1 
ATOM   372   O  OG1   . THR A 1  81   ? 212.917 195.233 206.578 1.00 396.35 ?  80   THR A OG1   1 
ATOM   373   C  CG2   . THR A 1  81   ? 211.251 196.811 205.898 1.00 422.44 ?  80   THR A CG2   1 
ATOM   374   N  N     . ASP A 1  82   ? 213.579 194.748 202.614 1.00 393.88 ?  81   ASP A N     1 
ATOM   375   C  CA    . ASP A 1  82   ? 214.776 194.358 201.826 1.00 386.52 ?  81   ASP A CA    1 
ATOM   376   C  C     . ASP A 1  82   ? 214.760 192.942 201.185 1.00 402.01 ?  81   ASP A C     1 
ATOM   377   O  O     . ASP A 1  82   ? 215.651 192.110 201.483 1.00 439.37 ?  81   ASP A O     1 
ATOM   378   C  CB    . ASP A 1  82   ? 216.007 194.533 202.721 1.00 404.15 ?  81   ASP A CB    1 
ATOM   379   C  CG    . ASP A 1  82   ? 217.323 193.998 202.187 1.00 425.37 ?  81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A 1  82   ? 217.853 194.604 201.241 1.00 440.00 ?  81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A 1  82   ? 217.790 192.954 202.711 1.00 405.41 -1 81   ASP A OD2   1 
ATOM   382   N  N     . LEU A 1  83   ? 213.836 192.674 200.263 1.00 347.89 ?  82   LEU A N     1 
ATOM   383   C  CA    . LEU A 1  83   ? 213.717 191.359 199.587 1.00 285.72 ?  82   LEU A CA    1 
ATOM   384   C  C     . LEU A 1  83   ? 213.890 191.538 198.071 1.00 232.37 ?  82   LEU A C     1 
ATOM   385   O  O     . LEU A 1  83   ? 213.726 192.663 197.496 1.00 181.71 ?  82   LEU A O     1 
ATOM   386   C  CB    . LEU A 1  83   ? 212.341 190.733 199.871 1.00 344.15 ?  82   LEU A CB    1 
ATOM   387   C  CG    . LEU A 1  83   ? 212.194 189.877 201.125 1.00 327.52 ?  82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A 1  83   ? 212.022 190.776 202.335 1.00 396.06 ?  82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A 1  83   ? 210.994 188.930 201.073 1.00 270.29 ?  82   LEU A CD2   1 
ATOM   390   N  N     . ARG A 1  84   ? 214.198 190.424 197.382 1.00 178.32 ?  83   ARG A N     1 
ATOM   391   C  CA    . ARG A 1  84   ? 214.739 190.392 196.061 1.00 158.64 ?  83   ARG A CA    1 
ATOM   392   C  C     . ARG A 1  84   ? 213.790 189.678 195.081 1.00 168.20 ?  83   ARG A C     1 
ATOM   393   O  O     . ARG A 1  84   ? 213.050 188.778 195.438 1.00 210.58 ?  83   ARG A O     1 
ATOM   394   C  CB    . ARG A 1  84   ? 216.020 189.594 196.157 1.00 151.95 ?  83   ARG A CB    1 
ATOM   395   C  CG    . ARG A 1  84   ? 217.259 190.323 196.648 1.00 200.50 ?  83   ARG A CG    1 
ATOM   396   C  CD    . ARG A 1  84   ? 218.473 189.437 196.438 1.00 189.73 ?  83   ARG A CD    1 
ATOM   397   N  NE    . ARG A 1  84   ? 219.733 190.166 196.709 1.00 192.23 ?  83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A 1  84   ? 220.720 189.720 197.484 1.00 178.03 ?  83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A 1  84   ? 220.833 188.406 197.585 1.00 160.48 1  83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A 1  84   ? 221.505 190.568 198.166 1.00 148.32 ?  83   ARG A NH2   1 
ATOM   401   N  N     . PHE A 1  85   ? 213.900 190.013 193.800 1.00 161.40 ?  84   PHE A N     1 
ATOM   402   C  CA    . PHE A 1  85   ? 213.122 189.266 192.802 1.00 161.92 ?  84   PHE A CA    1 
ATOM   403   C  C     . PHE A 1  85   ? 213.904 189.138 191.497 1.00 182.39 ?  84   PHE A C     1 
ATOM   404   O  O     . PHE A 1  85   ? 214.498 190.114 190.958 1.00 217.44 ?  84   PHE A O     1 
ATOM   405   C  CB    . PHE A 1  85   ? 211.758 189.926 192.526 1.00 158.14 ?  84   PHE A CB    1 
ATOM   406   C  CG    . PHE A 1  85   ? 210.894 190.125 193.726 1.00 147.73 ?  84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1  85   ? 211.288 189.594 194.932 1.00 177.17 ?  84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1  85   ? 209.735 190.878 193.693 1.00 149.95 ?  84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1  85   ? 210.603 189.860 196.119 1.00 266.98 ?  84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1  85   ? 209.006 191.072 194.856 1.00 198.82 ?  84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1  85   ? 209.417 190.527 196.051 1.00 260.40 ?  84   PHE A CZ    1 
ATOM   412   N  N     . GLN A 1  86   ? 213.850 187.950 190.894 1.00 139.94 ?  85   GLN A N     1 
ATOM   413   C  CA    . GLN A 1  86   ? 214.418 187.749 189.576 1.00 117.57 ?  85   GLN A CA    1 
ATOM   414   C  C     . GLN A 1  86   ? 213.893 188.806 188.604 1.00 125.10 ?  85   GLN A C     1 
ATOM   415   O  O     . GLN A 1  86   ? 212.722 189.144 188.699 1.00 221.95 ?  85   GLN A O     1 
ATOM   416   C  CB    . GLN A 1  86   ? 214.025 186.389 189.008 1.00 103.40 ?  85   GLN A CB    1 
ATOM   417   C  CG    . GLN A 1  86   ? 214.608 185.199 189.734 1.00 104.45 ?  85   GLN A CG    1 
ATOM   418   C  CD    . GLN A 1  86   ? 214.066 183.956 189.095 1.00 111.74 ?  85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A 1  86   ? 212.987 183.913 188.476 1.00 121.95 ?  85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A 1  86   ? 214.904 182.936 189.196 1.00 108.85 ?  85   GLN A NE2   1 
ATOM   421   N  N     . SER A 1  87   ? 214.782 189.371 187.768 1.00 105.91 ?  86   SER A N     1 
ATOM   422   C  CA    . SER A 1  87   ? 214.340 190.420 186.833 1.00 116.66 ?  86   SER A CA    1 
ATOM   423   C  C     . SER A 1  87   ? 213.037 190.073 186.094 1.00 159.65 ?  86   SER A C     1 
ATOM   424   O  O     . SER A 1  87   ? 212.114 190.874 186.005 1.00 185.45 ?  86   SER A O     1 
ATOM   425   C  CB    . SER A 1  87   ? 215.439 190.818 185.881 1.00 113.75 ?  86   SER A CB    1 
ATOM   426   O  OG    . SER A 1  87   ? 215.187 192.103 185.366 1.00 93.35  ?  86   SER A OG    1 
ATOM   427   N  N     . SER A 1  88   ? 212.866 188.838 185.613 1.00 187.97 ?  87   SER A N     1 
ATOM   428   C  CA    . SER A 1  88   ? 211.671 188.394 184.976 1.00 198.15 ?  87   SER A CA    1 
ATOM   429   C  C     . SER A 1  88   ? 210.449 188.466 185.943 1.00 167.50 ?  87   SER A C     1 
ATOM   430   O  O     . SER A 1  88   ? 209.291 188.864 185.534 1.00 163.22 ?  87   SER A O     1 
ATOM   431   C  CB    . SER A 1  88   ? 211.907 186.974 184.397 1.00 223.14 ?  87   SER A CB    1 
ATOM   432   O  OG    . SER A 1  88   ? 212.487 186.112 185.375 1.00 148.47 ?  87   SER A OG    1 
ATOM   433   N  N     . ALA A 1  89   ? 210.643 187.991 187.201 1.00 107.25 ?  88   ALA A N     1 
ATOM   434   C  CA    . ALA A 1  89   ? 209.592 187.965 188.146 1.00 68.60  ?  88   ALA A CA    1 
ATOM   435   C  C     . ALA A 1  89   ? 208.917 189.321 188.173 1.00 66.33  ?  88   ALA A C     1 
ATOM   436   O  O     . ALA A 1  89   ? 207.677 189.383 188.192 1.00 72.90  ?  88   ALA A O     1 
ATOM   437   C  CB    . ALA A 1  89   ? 210.134 187.587 189.492 1.00 63.88  ?  88   ALA A CB    1 
ATOM   438   N  N     . VAL A 1  90   ? 209.711 190.382 187.953 1.00 90.59  ?  89   VAL A N     1 
ATOM   439   C  CA    . VAL A 1  90   ? 209.244 191.748 187.896 1.00 133.85 ?  89   VAL A CA    1 
ATOM   440   C  C     . VAL A 1  90   ? 208.342 191.936 186.661 1.00 223.16 ?  89   VAL A C     1 
ATOM   441   O  O     . VAL A 1  90   ? 207.280 192.562 186.673 1.00 321.42 ?  89   VAL A O     1 
ATOM   442   C  CB    . VAL A 1  90   ? 210.403 192.776 187.909 1.00 113.62 ?  89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A 1  90   ? 210.053 194.184 187.415 1.00 93.80  ?  89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A 1  90   ? 211.039 192.933 189.295 1.00 109.60 ?  89   VAL A CG2   1 
ATOM   445   N  N     . MET A 1  91   ? 208.807 191.471 185.502 1.00 195.75 ?  90   MET A N     1 
ATOM   446   C  CA    . MET A 1  91   ? 208.010 191.547 184.281 1.00 179.36 ?  90   MET A CA    1 
ATOM   447   C  C     . MET A 1  91   ? 206.667 190.794 184.421 1.00 200.97 ?  90   MET A C     1 
ATOM   448   O  O     . MET A 1  91   ? 205.642 191.329 184.010 1.00 229.91 ?  90   MET A O     1 
ATOM   449   C  CB    . MET A 1  91   ? 208.828 191.064 183.073 1.00 156.02 ?  90   MET A CB    1 
ATOM   450   C  CG    . MET A 1  91   ? 210.061 191.912 182.813 1.00 165.39 ?  90   MET A CG    1 
ATOM   451   S  SD    . MET A 1  91   ? 209.999 193.796 182.713 1.00 141.93 ?  90   MET A SD    1 
ATOM   452   C  CE    . MET A 1  91   ? 210.101 194.156 184.457 1.00 101.43 ?  90   MET A CE    1 
ATOM   453   N  N     . ALA A 1  92   ? 206.698 189.592 185.026 1.00 199.80 ?  91   ALA A N     1 
ATOM   454   C  CA    . ALA A 1  92   ? 205.546 188.750 185.227 1.00 164.71 ?  91   ALA A CA    1 
ATOM   455   C  C     . ALA A 1  92   ? 204.395 189.599 185.828 1.00 106.14 ?  91   ALA A C     1 
ATOM   456   O  O     . ALA A 1  92   ? 203.261 189.704 185.339 1.00 86.56  ?  91   ALA A O     1 
ATOM   457   C  CB    . ALA A 1  92   ? 205.806 187.590 186.153 1.00 148.34 ?  91   ALA A CB    1 
ATOM   458   N  N     . LEU A 1  93   ? 204.813 190.331 186.854 1.00 94.74  ?  92   LEU A N     1 
ATOM   459   C  CA    . LEU A 1  93   ? 204.030 191.281 187.540 1.00 88.93  ?  92   LEU A CA    1 
ATOM   460   C  C     . LEU A 1  93   ? 203.662 192.460 186.612 1.00 98.75  ?  92   LEU A C     1 
ATOM   461   O  O     . LEU A 1  93   ? 202.545 192.924 186.596 1.00 216.12 ?  92   LEU A O     1 
ATOM   462   C  CB    . LEU A 1  93   ? 204.810 191.749 188.772 1.00 82.03  ?  92   LEU A CB    1 
ATOM   463   C  CG    . LEU A 1  93   ? 203.941 192.627 189.627 1.00 81.51  ?  92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A 1  93   ? 202.795 191.714 189.949 1.00 111.49 ?  92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A 1  93   ? 204.563 193.130 190.889 1.00 82.10  ?  92   LEU A CD2   1 
ATOM   466   N  N     . GLN A 1  94   ? 204.608 192.957 185.806 1.00 74.59  ?  93   GLN A N     1 
ATOM   467   C  CA    . GLN A 1  94   ? 204.399 194.152 184.983 1.00 78.21  ?  93   GLN A CA    1 
ATOM   468   C  C     . GLN A 1  94   ? 203.333 194.007 183.931 1.00 130.17 ?  93   GLN A C     1 
ATOM   469   O  O     . GLN A 1  94   ? 202.420 194.899 183.730 1.00 176.09 ?  93   GLN A O     1 
ATOM   470   C  CB    . GLN A 1  94   ? 205.641 194.578 184.278 1.00 84.85  ?  93   GLN A CB    1 
ATOM   471   C  CG    . GLN A 1  94   ? 205.341 195.837 183.431 1.00 98.16  ?  93   GLN A CG    1 
ATOM   472   C  CD    . GLN A 1  94   ? 206.661 196.445 183.078 1.00 158.28 ?  93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A 1  94   ? 207.673 196.049 183.636 1.00 241.30 ?  93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A 1  94   ? 206.792 197.270 182.042 1.00 172.93 ?  93   GLN A NE2   1 
ATOM   475   N  N     . GLU A 1  95   ? 203.385 192.856 183.277 1.00 185.43 ?  94   GLU A N     1 
ATOM   476   C  CA    . GLU A 1  95   ? 202.335 192.520 182.239 1.00 204.12 ?  94   GLU A CA    1 
ATOM   477   C  C     . GLU A 1  95   ? 200.894 192.459 182.794 1.00 189.86 ?  94   GLU A C     1 
ATOM   478   O  O     . GLU A 1  95   ? 199.928 193.055 182.145 1.00 188.81 ?  94   GLU A O     1 
ATOM   479   C  CB    . GLU A 1  95   ? 202.763 191.237 181.522 1.00 220.07 ?  94   GLU A CB    1 
ATOM   480   C  CG    . GLU A 1  95   ? 201.761 190.704 180.534 1.00 281.14 ?  94   GLU A CG    1 
ATOM   481   C  CD    . GLU A 1  95   ? 201.532 191.541 179.290 1.00 381.62 ?  94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A 1  95   ? 202.440 192.328 178.945 1.00 358.89 ?  94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A 1  95   ? 200.412 191.420 178.704 1.00 437.21 -1 94   GLU A OE2   1 
ATOM   484   N  N     . ALA A 1  96   ? 200.733 191.746 183.933 1.00 147.32 ?  95   ALA A N     1 
ATOM   485   C  CA    . ALA A 1  96   ? 199.380 191.442 184.448 1.00 95.56  ?  95   ALA A CA    1 
ATOM   486   C  C     . ALA A 1  96   ? 198.558 192.690 184.739 1.00 87.81  ?  95   ALA A C     1 
ATOM   487   O  O     . ALA A 1  96   ? 197.338 192.637 184.649 1.00 110.67 ?  95   ALA A O     1 
ATOM   488   C  CB    . ALA A 1  96   ? 199.470 190.637 185.705 1.00 78.48  ?  95   ALA A CB    1 
ATOM   489   N  N     . SER A 1  97   ? 199.218 193.802 185.049 1.00 103.56 ?  96   SER A N     1 
ATOM   490   C  CA    . SER A 1  97   ? 198.574 195.056 185.348 1.00 145.00 ?  96   SER A CA    1 
ATOM   491   C  C     . SER A 1  97   ? 198.490 196.087 184.175 1.00 134.73 ?  96   SER A C     1 
ATOM   492   O  O     . SER A 1  97   ? 197.513 196.893 184.081 1.00 199.20 ?  96   SER A O     1 
ATOM   493   C  CB    . SER A 1  97   ? 199.309 195.591 186.548 1.00 143.78 ?  96   SER A CB    1 
ATOM   494   O  OG    . SER A 1  97   ? 200.510 196.199 186.134 1.00 187.79 ?  96   SER A OG    1 
ATOM   495   N  N     . GLU A 1  98   ? 199.495 196.106 183.309 1.00 102.44 ?  97   GLU A N     1 
ATOM   496   C  CA    . GLU A 1  98   ? 199.476 196.967 182.211 1.00 120.65 ?  97   GLU A CA    1 
ATOM   497   C  C     . GLU A 1  98   ? 198.221 196.729 181.327 1.00 219.47 ?  97   GLU A C     1 
ATOM   498   O  O     . GLU A 1  98   ? 197.507 197.699 180.914 1.00 220.75 ?  97   GLU A O     1 
ATOM   499   C  CB    . GLU A 1  98   ? 200.772 196.896 181.399 1.00 168.68 ?  97   GLU A CB    1 
ATOM   500   C  CG    . GLU A 1  98   ? 200.877 197.927 180.284 1.00 208.21 ?  97   GLU A CG    1 
ATOM   501   C  CD    . GLU A 1  98   ? 200.044 197.644 179.041 1.00 255.58 ?  97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A 1  98   ? 199.666 196.509 178.816 1.00 348.85 ?  97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A 1  98   ? 199.706 198.562 178.295 1.00 233.84 -1 97   GLU A OE2   1 
ATOM   504   N  N     . ALA A 1  99   ? 197.964 195.430 181.075 1.00 331.81 ?  98   ALA A N     1 
ATOM   505   C  CA    . ALA A 1  99   ? 196.791 195.009 180.306 1.00 300.15 ?  98   ALA A CA    1 
ATOM   506   C  C     . ALA A 1  99   ? 195.522 195.331 181.104 1.00 212.51 ?  98   ALA A C     1 
ATOM   507   O  O     . ALA A 1  99   ? 194.492 195.824 180.513 1.00 167.53 ?  98   ALA A O     1 
ATOM   508   C  CB    . ALA A 1  99   ? 196.855 193.552 179.987 1.00 246.20 ?  98   ALA A CB    1 
ATOM   509   N  N     . TYR A 1  100  ? 195.666 195.186 182.437 1.00 182.66 ?  99   TYR A N     1 
ATOM   510   C  CA    . TYR A 1  100  ? 194.471 195.293 183.329 1.00 125.44 ?  99   TYR A CA    1 
ATOM   511   C  C     . TYR A 1  100  ? 193.779 196.639 183.234 1.00 108.77 ?  99   TYR A C     1 
ATOM   512   O  O     . TYR A 1  100  ? 192.518 196.618 183.210 1.00 126.62 ?  99   TYR A O     1 
ATOM   513   C  CB    . TYR A 1  100  ? 194.902 195.136 184.792 1.00 145.72 ?  99   TYR A CB    1 
ATOM   514   C  CG    . TYR A 1  100  ? 193.795 195.552 185.738 1.00 90.13  ?  99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A 1  100  ? 193.683 196.884 186.187 1.00 74.15  ?  99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A 1  100  ? 192.918 194.591 186.228 1.00 93.18  ?  99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A 1  100  ? 192.653 197.279 186.990 1.00 108.29 ?  99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A 1  100  ? 191.904 194.953 187.100 1.00 142.49 ?  99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A 1  100  ? 191.774 196.297 187.464 1.00 180.43 ?  99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A 1  100  ? 190.737 196.642 188.295 1.00 249.97 ?  99   TYR A OH    1 
ATOM   521   N  N     . LEU A 1  101  ? 194.524 197.753 183.184 1.00 96.77  ?  100  LEU A N     1 
ATOM   522   C  CA    . LEU A 1  101  ? 194.032 199.082 183.037 1.00 104.40 ?  100  LEU A CA    1 
ATOM   523   C  C     . LEU A 1  101  ? 193.297 199.304 181.711 1.00 128.60 ?  100  LEU A C     1 
ATOM   524   O  O     . LEU A 1  101  ? 192.286 199.965 181.569 1.00 166.64 ?  100  LEU A O     1 
ATOM   525   C  CB    . LEU A 1  101  ? 195.192 200.072 183.032 1.00 88.32  ?  100  LEU A CB    1 
ATOM   526   C  CG    . LEU A 1  101  ? 195.345 200.713 184.379 1.00 116.09 ?  100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1  101  ? 195.331 199.555 185.402 1.00 103.91 ?  100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1  101  ? 196.545 201.627 184.391 1.00 145.58 ?  100  LEU A CD2   1 
ATOM   529   N  N     . VAL A 1  102  ? 194.002 198.852 180.675 1.00 107.70 ?  101  VAL A N     1 
ATOM   530   C  CA    . VAL A 1  102  ? 193.586 199.123 179.306 1.00 111.52 ?  101  VAL A CA    1 
ATOM   531   C  C     . VAL A 1  102  ? 192.155 198.596 179.178 1.00 195.98 ?  101  VAL A C     1 
ATOM   532   O  O     . VAL A 1  102  ? 191.242 199.264 178.677 1.00 264.98 ?  101  VAL A O     1 
ATOM   533   C  CB    . VAL A 1  102  ? 194.628 198.582 178.332 1.00 90.02  ?  101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A 1  102  ? 194.176 198.878 176.905 1.00 70.23  ?  101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A 1  102  ? 196.002 199.124 178.731 1.00 88.76  ?  101  VAL A CG2   1 
ATOM   536   N  N     . GLY A 1  103  ? 191.917 197.414 179.712 1.00 226.30 ?  102  GLY A N     1 
ATOM   537   C  CA    . GLY A 1  103  ? 190.533 196.875 179.856 1.00 198.83 ?  102  GLY A CA    1 
ATOM   538   C  C     . GLY A 1  103  ? 189.485 197.743 180.605 1.00 145.35 ?  102  GLY A C     1 
ATOM   539   O  O     . GLY A 1  103  ? 188.334 198.007 180.205 1.00 159.97 ?  102  GLY A O     1 
ATOM   540   N  N     . LEU A 1  104  ? 189.907 198.299 181.718 1.00 111.44 ?  103  LEU A N     1 
ATOM   541   C  CA    . LEU A 1  104  ? 189.030 199.192 182.490 1.00 94.79  ?  103  LEU A CA    1 
ATOM   542   C  C     . LEU A 1  104  ? 188.755 200.471 181.696 1.00 103.44 ?  103  LEU A C     1 
ATOM   543   O  O     . LEU A 1  104  ? 187.601 200.979 181.702 1.00 186.87 ?  103  LEU A O     1 
ATOM   544   C  CB    . LEU A 1  104  ? 189.773 199.656 183.745 1.00 108.82 ?  103  LEU A CB    1 
ATOM   545   C  CG    . LEU A 1  104  ? 189.099 200.747 184.552 1.00 137.14 ?  103  LEU A CG    1 
ATOM   546   C  CD1   . LEU A 1  104  ? 187.987 200.078 185.352 1.00 206.60 ?  103  LEU A CD1   1 
ATOM   547   C  CD2   . LEU A 1  104  ? 190.126 201.437 185.407 1.00 136.23 ?  103  LEU A CD2   1 
ATOM   548   N  N     . PHE A 1  105  ? 189.792 201.050 181.098 1.00 88.29  ?  104  PHE A N     1 
ATOM   549   C  CA    . PHE A 1  105  ? 189.609 202.240 180.290 1.00 92.42  ?  104  PHE A CA    1 
ATOM   550   C  C     . PHE A 1  105  ? 188.543 201.996 179.221 1.00 126.26 ?  104  PHE A C     1 
ATOM   551   O  O     . PHE A 1  105  ? 187.696 202.807 178.949 1.00 135.38 ?  104  PHE A O     1 
ATOM   552   C  CB    . PHE A 1  105  ? 190.941 202.641 179.671 1.00 86.51  ?  104  PHE A CB    1 
ATOM   553   C  CG    . PHE A 1  105  ? 191.909 203.108 180.701 1.00 95.23  ?  104  PHE A CG    1 
ATOM   554   C  CD1   . PHE A 1  105  ? 191.441 203.672 181.860 1.00 89.75  ?  104  PHE A CD1   1 
ATOM   555   C  CD2   . PHE A 1  105  ? 193.284 203.066 180.476 1.00 157.35 ?  104  PHE A CD2   1 
ATOM   556   C  CE1   . PHE A 1  105  ? 192.357 204.181 182.783 1.00 184.18 ?  104  PHE A CE1   1 
ATOM   557   C  CE2   . PHE A 1  105  ? 194.194 203.514 181.413 1.00 198.19 ?  104  PHE A CE2   1 
ATOM   558   C  CZ    . PHE A 1  105  ? 193.725 204.052 182.573 1.00 221.54 ?  104  PHE A CZ    1 
ATOM   559   N  N     . GLU A 1  106  ? 188.538 200.779 178.679 1.00 159.68 ?  105  GLU A N     1 
ATOM   560   C  CA    . GLU A 1  106  ? 187.534 200.393 177.667 1.00 170.09 ?  105  GLU A CA    1 
ATOM   561   C  C     . GLU A 1  106  ? 186.097 200.438 178.240 1.00 229.45 ?  105  GLU A C     1 
ATOM   562   O  O     . GLU A 1  106  ? 185.161 200.845 177.564 1.00 274.18 ?  105  GLU A O     1 
ATOM   563   C  CB    . GLU A 1  106  ? 187.954 199.016 177.106 1.00 191.45 ?  105  GLU A CB    1 
ATOM   564   C  CG    . GLU A 1  106  ? 186.913 198.394 176.208 1.00 224.85 ?  105  GLU A CG    1 
ATOM   565   C  CD    . GLU A 1  106  ? 185.583 198.014 176.857 1.00 315.22 ?  105  GLU A CD    1 
ATOM   566   O  OE1   . GLU A 1  106  ? 185.554 197.604 178.044 1.00 362.67 ?  105  GLU A OE1   1 
ATOM   567   O  OE2   . GLU A 1  106  ? 184.589 198.137 176.147 1.00 209.83 -1 105  GLU A OE2   1 
ATOM   568   N  N     . ASP A 1  107  ? 185.868 199.973 179.465 1.00 222.06 ?  106  ASP A N     1 
ATOM   569   C  CA    . ASP A 1  107  ? 184.577 200.039 180.096 1.00 154.35 ?  106  ASP A CA    1 
ATOM   570   C  C     . ASP A 1  107  ? 184.204 201.498 180.410 1.00 128.53 ?  106  ASP A C     1 
ATOM   571   O  O     . ASP A 1  107  ? 182.956 201.917 180.196 1.00 131.32 ?  106  ASP A O     1 
ATOM   572   C  CB    . ASP A 1  107  ? 184.530 199.256 181.396 1.00 138.28 ?  106  ASP A CB    1 
ATOM   573   C  CG    . ASP A 1  107  ? 184.541 197.771 181.212 1.00 175.80 ?  106  ASP A CG    1 
ATOM   574   O  OD1   . ASP A 1  107  ? 184.316 197.309 180.122 1.00 200.29 ?  106  ASP A OD1   1 
ATOM   575   O  OD2   . ASP A 1  107  ? 184.764 197.135 182.174 1.00 440.00 -1 106  ASP A OD2   1 
ATOM   576   N  N     . THR A 1  108  ? 185.221 202.288 180.792 1.00 158.78 ?  107  THR A N     1 
ATOM   577   C  CA    . THR A 1  108  ? 185.000 203.662 181.118 1.00 180.79 ?  107  THR A CA    1 
ATOM   578   C  C     . THR A 1  108  ? 184.469 204.427 179.920 1.00 158.75 ?  107  THR A C     1 
ATOM   579   O  O     . THR A 1  108  ? 183.504 205.227 180.051 1.00 236.50 ?  107  THR A O     1 
ATOM   580   C  CB    . THR A 1  108  ? 186.242 204.354 181.670 1.00 247.42 ?  107  THR A CB    1 
ATOM   581   O  OG1   . THR A 1  108  ? 186.649 203.720 182.882 1.00 417.99 ?  107  THR A OG1   1 
ATOM   582   C  CG2   . THR A 1  108  ? 185.955 205.797 181.984 1.00 178.45 ?  107  THR A CG2   1 
ATOM   583   N  N     . ASN A 1  109  ? 185.016 204.114 178.750 1.00 145.95 ?  108  ASN A N     1 
ATOM   584   C  CA    . ASN A 1  109  ? 184.638 204.738 177.504 1.00 160.48 ?  108  ASN A CA    1 
ATOM   585   C  C     . ASN A 1  109  ? 183.200 204.511 177.039 1.00 193.97 ?  108  ASN A C     1 
ATOM   586   O  O     . ASN A 1  109  ? 182.491 205.557 176.686 1.00 245.33 ?  108  ASN A O     1 
ATOM   587   C  CB    . ASN A 1  109  ? 185.590 204.298 176.407 1.00 133.31 ?  108  ASN A CB    1 
ATOM   588   C  CG    . ASN A 1  109  ? 185.576 205.260 175.247 1.00 146.44 ?  108  ASN A CG    1 
ATOM   589   O  OD1   . ASN A 1  109  ? 185.024 206.354 175.296 1.00 157.45 ?  108  ASN A OD1   1 
ATOM   590   N  ND2   . ASN A 1  109  ? 186.197 204.846 174.182 1.00 162.79 ?  108  ASN A ND2   1 
ATOM   591   N  N     . LEU A 1  110  ? 182.682 203.271 177.125 1.00 199.66 ?  109  LEU A N     1 
ATOM   592   C  CA    . LEU A 1  110  ? 181.330 202.962 176.739 1.00 188.62 ?  109  LEU A CA    1 
ATOM   593   C  C     . LEU A 1  110  ? 180.335 203.851 177.491 1.00 181.41 ?  109  LEU A C     1 
ATOM   594   O  O     . LEU A 1  110  ? 179.339 204.376 177.030 1.00 171.04 ?  109  LEU A O     1 
ATOM   595   C  CB    . LEU A 1  110  ? 180.969 201.526 177.150 1.00 193.90 ?  109  LEU A CB    1 
ATOM   596   C  CG    . LEU A 1  110  ? 181.735 200.379 176.483 1.00 204.93 ?  109  LEU A CG    1 
ATOM   597   C  CD1   . LEU A 1  110  ? 181.896 199.138 177.342 1.00 165.40 ?  109  LEU A CD1   1 
ATOM   598   C  CD2   . LEU A 1  110  ? 181.073 199.931 175.195 1.00 245.45 ?  109  LEU A CD2   1 
ATOM   599   N  N     . CYS A 1  111  ? 180.615 203.919 178.786 1.00 193.08 ?  110  CYS A N     1 
ATOM   600   C  CA    . CYS A 1  111  ? 179.729 204.704 179.693 1.00 150.55 ?  110  CYS A CA    1 
ATOM   601   C  C     . CYS A 1  111  ? 179.797 206.187 179.361 1.00 130.55 ?  110  CYS A C     1 
ATOM   602   O  O     . CYS A 1  111  ? 178.785 206.844 179.352 1.00 113.17 ?  110  CYS A O     1 
ATOM   603   C  CB    . CYS A 1  111  ? 180.089 204.352 181.124 1.00 213.43 ?  110  CYS A CB    1 
ATOM   604   S  SG    . CYS A 1  111  ? 179.579 202.589 181.389 1.00 135.39 ?  110  CYS A SG    1 
ATOM   605   N  N     . GLY A 1  112  ? 180.970 206.664 178.991 1.00 128.28 ?  111  GLY A N     1 
ATOM   606   C  CA    . GLY A 1  112  ? 181.140 208.053 178.493 1.00 92.39  ?  111  GLY A CA    1 
ATOM   607   C  C     . GLY A 1  112  ? 180.278 208.222 177.255 1.00 96.32  ?  111  GLY A C     1 
ATOM   608   O  O     . GLY A 1  112  ? 179.525 209.052 177.142 1.00 87.95  ?  111  GLY A O     1 
ATOM   609   N  N     . ILE A 1  113  ? 180.303 207.226 176.403 1.00 142.81 ?  112  ILE A N     1 
ATOM   610   C  CA    . ILE A 1  113  ? 179.482 207.234 175.175 1.00 187.25 ?  112  ILE A CA    1 
ATOM   611   C  C     . ILE A 1  113  ? 178.004 207.208 175.501 1.00 211.76 ?  112  ILE A C     1 
ATOM   612   O  O     . ILE A 1  113  ? 177.247 207.873 174.786 1.00 176.16 ?  112  ILE A O     1 
ATOM   613   C  CB    . ILE A 1  113  ? 179.893 206.019 174.293 1.00 320.00 ?  112  ILE A CB    1 
ATOM   614   C  CG1   . ILE A 1  113  ? 181.310 206.175 173.811 1.00 388.66 ?  112  ILE A CG1   1 
ATOM   615   C  CG2   . ILE A 1  113  ? 178.900 205.832 173.171 1.00 401.15 ?  112  ILE A CG2   1 
ATOM   616   C  CD1   . ILE A 1  113  ? 181.882 204.845 173.377 1.00 440.00 ?  112  ILE A CD1   1 
ATOM   617   N  N     . HIS A 1  114  ? 177.620 206.357 176.468 1.00 201.88 ?  113  HIS A N     1 
ATOM   618   C  CA    . HIS A 1  114  ? 176.192 206.122 176.780 1.00 124.80 ?  113  HIS A CA    1 
ATOM   619   C  C     . HIS A 1  114  ? 175.475 207.457 177.081 1.00 75.22  ?  113  HIS A C     1 
ATOM   620   O  O     . HIS A 1  114  ? 174.305 207.559 176.918 1.00 52.74  ?  113  HIS A O     1 
ATOM   621   C  CB    . HIS A 1  114  ? 176.105 205.181 177.951 1.00 95.26  ?  113  HIS A CB    1 
ATOM   622   C  CG    . HIS A 1  114  ? 174.731 204.873 178.416 1.00 81.02  ?  113  HIS A CG    1 
ATOM   623   N  ND1   . HIS A 1  114  ? 174.203 205.490 179.501 1.00 68.30  ?  113  HIS A ND1   1 
ATOM   624   C  CD2   . HIS A 1  114  ? 173.739 204.201 177.818 1.00 85.31  ?  113  HIS A CD2   1 
ATOM   625   C  CE1   . HIS A 1  114  ? 172.938 205.120 179.628 1.00 76.39  ?  113  HIS A CE1   1 
ATOM   626   N  NE2   . HIS A 1  114  ? 172.622 204.322 178.593 1.00 77.22  ?  113  HIS A NE2   1 
ATOM   627   N  N     . ALA A 1  115  ? 176.250 208.440 177.556 1.00 76.38  ?  114  ALA A N     1 
ATOM   628   C  CA    . ALA A 1  115  ? 175.670 209.678 178.037 1.00 78.74  ?  114  ALA A CA    1 
ATOM   629   C  C     . ALA A 1  115  ? 175.591 210.713 176.924 1.00 81.31  ?  114  ALA A C     1 
ATOM   630   O  O     . ALA A 1  115  ? 175.322 211.896 177.173 1.00 76.33  ?  114  ALA A O     1 
ATOM   631   C  CB    . ALA A 1  115  ? 176.543 210.204 179.178 1.00 116.85 ?  114  ALA A CB    1 
ATOM   632   N  N     . LYS A 1  116  ? 175.983 210.362 175.713 1.00 112.09 ?  115  LYS A N     1 
ATOM   633   C  CA    . LYS A 1  116  ? 176.202 211.402 174.645 1.00 176.37 ?  115  LYS A CA    1 
ATOM   634   C  C     . LYS A 1  116  ? 177.502 212.174 174.922 1.00 164.49 ?  115  LYS A C     1 
ATOM   635   O  O     . LYS A 1  116  ? 177.686 213.337 174.529 1.00 127.07 ?  115  LYS A O     1 
ATOM   636   C  CB    . LYS A 1  116  ? 175.202 212.577 174.535 1.00 236.76 ?  115  LYS A CB    1 
ATOM   637   C  CG    . LYS A 1  116  ? 175.303 213.290 173.205 1.00 267.54 ?  115  LYS A CG    1 
ATOM   638   C  CD    . LYS A 1  116  ? 174.152 214.203 172.913 1.00 291.22 ?  115  LYS A CD    1 
ATOM   639   C  CE    . LYS A 1  116  ? 174.484 215.627 173.277 1.00 276.23 ?  115  LYS A CE    1 
ATOM   640   N  NZ    . LYS A 1  116  ? 175.689 216.102 172.550 1.00 224.56 1  115  LYS A NZ    1 
ATOM   641   N  N     . ARG A 1  117  ? 178.424 211.600 175.698 1.00 152.56 ?  116  ARG A N     1 
ATOM   642   C  CA    . ARG A 1  117  ? 179.662 212.317 175.920 1.00 142.85 ?  116  ARG A CA    1 
ATOM   643   C  C     . ARG A 1  117  ? 180.810 211.708 175.103 1.00 125.07 ?  116  ARG A C     1 
ATOM   644   O  O     . ARG A 1  117  ? 180.625 210.958 174.195 1.00 78.20  ?  116  ARG A O     1 
ATOM   645   C  CB    . ARG A 1  117  ? 180.139 212.356 177.352 1.00 142.98 ?  116  ARG A CB    1 
ATOM   646   C  CG    . ARG A 1  117  ? 180.353 213.769 177.853 1.00 132.07 ?  116  ARG A CG    1 
ATOM   647   C  CD    . ARG A 1  117  ? 180.834 213.822 179.296 1.00 145.12 ?  116  ARG A CD    1 
ATOM   648   N  NE    . ARG A 1  117  ? 180.179 212.952 180.304 1.00 155.28 ?  116  ARG A NE    1 
ATOM   649   C  CZ    . ARG A 1  117  ? 180.715 211.820 180.825 1.00 199.56 ?  116  ARG A CZ    1 
ATOM   650   N  NH1   . ARG A 1  117  ? 182.049 211.623 180.810 1.00 358.94 1  116  ARG A NH1   1 
ATOM   651   N  NH2   . ARG A 1  117  ? 179.857 210.883 181.268 1.00 119.59 ?  116  ARG A NH2   1 
ATOM   652   N  N     . VAL A 1  118  ? 181.978 212.302 175.325 1.00 158.17 ?  117  VAL A N     1 
ATOM   653   C  CA    . VAL A 1  118  ? 183.041 212.354 174.394 1.00 183.00 ?  117  VAL A CA    1 
ATOM   654   C  C     . VAL A 1  118  ? 184.366 212.189 175.140 1.00 222.15 ?  117  VAL A C     1 
ATOM   655   O  O     . VAL A 1  118  ? 185.358 211.918 174.523 1.00 328.35 ?  117  VAL A O     1 
ATOM   656   C  CB    . VAL A 1  118  ? 182.817 213.678 173.601 1.00 169.78 ?  117  VAL A CB    1 
ATOM   657   C  CG1   . VAL A 1  118  ? 183.988 214.301 172.914 1.00 139.58 ?  117  VAL A CG1   1 
ATOM   658   C  CG2   . VAL A 1  118  ? 181.678 213.497 172.636 1.00 217.18 ?  117  VAL A CG2   1 
ATOM   659   N  N     . THR A 1  119  ? 184.406 212.426 176.441 1.00 192.16 ?  118  THR A N     1 
ATOM   660   C  CA    . THR A 1  119  ? 185.614 212.394 177.190 1.00 126.93 ?  118  THR A CA    1 
ATOM   661   C  C     . THR A 1  119  ? 185.277 211.593 178.438 1.00 119.55 ?  118  THR A C     1 
ATOM   662   O  O     . THR A 1  119  ? 184.197 211.857 179.162 1.00 223.70 ?  118  THR A O     1 
ATOM   663   C  CB    . THR A 1  119  ? 186.088 213.805 177.609 1.00 103.95 ?  118  THR A CB    1 
ATOM   664   O  OG1   . THR A 1  119  ? 186.395 214.627 176.487 1.00 74.37  ?  118  THR A OG1   1 
ATOM   665   C  CG2   . THR A 1  119  ? 187.234 213.724 178.596 1.00 103.87 ?  118  THR A CG2   1 
ATOM   666   N  N     . ILE A 1  120  ? 186.137 210.579 178.744 1.00 98.30  ?  119  ILE A N     1 
ATOM   667   C  CA    . ILE A 1  120  ? 185.991 209.767 179.913 1.00 113.81 ?  119  ILE A CA    1 
ATOM   668   C  C     . ILE A 1  120  ? 186.140 210.595 181.161 1.00 137.57 ?  119  ILE A C     1 
ATOM   669   O  O     . ILE A 1  120  ? 187.229 210.979 181.462 1.00 174.03 ?  119  ILE A O     1 
ATOM   670   C  CB    . ILE A 1  120  ? 187.032 208.677 179.882 1.00 141.84 ?  119  ILE A CB    1 
ATOM   671   C  CG1   . ILE A 1  120  ? 188.445 209.232 179.752 1.00 157.40 ?  119  ILE A CG1   1 
ATOM   672   C  CG2   . ILE A 1  120  ? 186.642 207.753 178.774 1.00 178.21 ?  119  ILE A CG2   1 
ATOM   673   C  CD1   . ILE A 1  120  ? 189.299 208.919 180.912 1.00 150.73 ?  119  ILE A CD1   1 
ATOM   674   N  N     . MET A 1  121  ? 185.051 210.743 181.936 1.00 166.78 ?  120  MET A N     1 
ATOM   675   C  CA    . MET A 1  121  ? 185.057 211.545 183.137 1.00 179.20 ?  120  MET A CA    1 
ATOM   676   C  C     . MET A 1  121  ? 185.352 210.653 184.308 1.00 121.91 ?  120  MET A C     1 
ATOM   677   O  O     . MET A 1  121  ? 185.744 209.506 184.124 1.00 88.02  ?  120  MET A O     1 
ATOM   678   C  CB    . MET A 1  121  ? 183.726 212.229 183.433 1.00 269.23 ?  120  MET A CB    1 
ATOM   679   C  CG    . MET A 1  121  ? 183.277 213.307 182.433 1.00 269.30 ?  120  MET A CG    1 
ATOM   680   S  SD    . MET A 1  121  ? 184.400 214.738 182.229 1.00 229.00 ?  120  MET A SD    1 
ATOM   681   C  CE    . MET A 1  121  ? 184.237 215.479 183.850 1.00 247.81 ?  120  MET A CE    1 
ATOM   682   N  N     . PRO A 1  122  ? 185.337 211.227 185.524 1.00 117.12 ?  121  PRO A N     1 
ATOM   683   C  CA    . PRO A 1  122  ? 185.884 210.501 186.674 1.00 128.02 ?  121  PRO A CA    1 
ATOM   684   C  C     . PRO A 1  122  ? 184.941 209.397 187.088 1.00 84.99  ?  121  PRO A C     1 
ATOM   685   O  O     . PRO A 1  122  ? 185.248 208.342 187.051 1.00 59.54  ?  121  PRO A O     1 
ATOM   686   C  CB    . PRO A 1  122  ? 185.976 211.564 187.767 1.00 156.32 ?  121  PRO A CB    1 
ATOM   687   C  CG    . PRO A 1  122  ? 184.966 212.631 187.342 1.00 148.03 ?  121  PRO A CG    1 
ATOM   688   C  CD    . PRO A 1  122  ? 185.099 212.655 185.865 1.00 115.75 ?  121  PRO A CD    1 
ATOM   689   N  N     . LYS A 1  123  ? 183.759 209.785 187.510 1.00 98.38  ?  122  LYS A N     1 
ATOM   690   C  CA    . LYS A 1  123  ? 182.699 208.992 187.965 1.00 113.35 ?  122  LYS A CA    1 
ATOM   691   C  C     . LYS A 1  123  ? 182.645 207.785 187.045 1.00 85.70  ?  122  LYS A C     1 
ATOM   692   O  O     . LYS A 1  123  ? 182.391 206.705 187.555 1.00 67.52  ?  122  LYS A O     1 
ATOM   693   C  CB    . LYS A 1  123  ? 181.362 209.747 187.992 1.00 180.87 ?  122  LYS A CB    1 
ATOM   694   C  CG    . LYS A 1  123  ? 181.085 210.602 186.751 1.00 257.49 ?  122  LYS A CG    1 
ATOM   695   C  CD    . LYS A 1  123  ? 180.374 211.949 186.935 1.00 277.61 ?  122  LYS A CD    1 
ATOM   696   C  CE    . LYS A 1  123  ? 179.916 212.560 185.605 1.00 255.51 ?  122  LYS A CE    1 
ATOM   697   N  NZ    . LYS A 1  123  ? 179.870 214.051 185.554 1.00 205.15 1  122  LYS A NZ    1 
ATOM   698   N  N     . ASP A 1  124  ? 182.739 207.901 185.717 1.00 91.40  ?  123  ASP A N     1 
ATOM   699   C  CA    . ASP A 1  124  ? 182.500 206.835 184.855 1.00 112.85 ?  123  ASP A CA    1 
ATOM   700   C  C     . ASP A 1  124  ? 183.367 205.682 185.340 1.00 88.23  ?  123  ASP A C     1 
ATOM   701   O  O     . ASP A 1  124  ? 183.016 204.548 185.328 1.00 76.45  ?  123  ASP A O     1 
ATOM   702   C  CB    . ASP A 1  124  ? 182.645 207.138 183.368 1.00 141.32 ?  123  ASP A CB    1 
ATOM   703   C  CG    . ASP A 1  124  ? 181.484 207.895 182.767 1.00 178.06 ?  123  ASP A CG    1 
ATOM   704   O  OD1   . ASP A 1  124  ? 180.658 208.351 183.554 1.00 176.56 ?  123  ASP A OD1   1 
ATOM   705   O  OD2   . ASP A 1  124  ? 181.488 208.161 181.574 1.00 297.83 -1 123  ASP A OD2   1 
ATOM   706   N  N     . ILE A 1  125  ? 184.590 205.982 185.638 1.00 82.93  ?  124  ILE A N     1 
ATOM   707   C  CA    . ILE A 1  125  ? 185.559 204.989 186.126 1.00 101.15 ?  124  ILE A CA    1 
ATOM   708   C  C     . ILE A 1  125  ? 185.040 204.362 187.397 1.00 70.47  ?  124  ILE A C     1 
ATOM   709   O  O     . ILE A 1  125  ? 185.122 203.191 187.628 1.00 49.07  ?  124  ILE A O     1 
ATOM   710   C  CB    . ILE A 1  125  ? 186.942 205.671 186.342 1.00 140.20 ?  124  ILE A CB    1 
ATOM   711   C  CG1   . ILE A 1  125  ? 187.609 205.902 184.968 1.00 210.05 ?  124  ILE A CG1   1 
ATOM   712   C  CG2   . ILE A 1  125  ? 187.778 204.914 187.388 1.00 134.63 ?  124  ILE A CG2   1 
ATOM   713   C  CD1   . ILE A 1  125  ? 189.053 206.365 185.019 1.00 216.20 ?  124  ILE A CD1   1 
ATOM   714   N  N     . GLN A 1  126  ? 184.621 205.219 188.297 1.00 80.72  ?  125  GLN A N     1 
ATOM   715   C  CA    . GLN A 1  126  ? 184.102 204.740 189.573 1.00 106.02 ?  125  GLN A CA    1 
ATOM   716   C  C     . GLN A 1  126  ? 182.806 203.946 189.330 1.00 84.13  ?  125  GLN A C     1 
ATOM   717   O  O     . GLN A 1  126  ? 182.552 202.953 189.922 1.00 80.43  ?  125  GLN A O     1 
ATOM   718   C  CB    . GLN A 1  126  ? 183.914 205.924 190.510 1.00 142.06 ?  125  GLN A CB    1 
ATOM   719   C  CG    . GLN A 1  126  ? 185.267 206.591 190.762 1.00 189.96 ?  125  GLN A CG    1 
ATOM   720   C  CD    . GLN A 1  126  ? 185.204 207.788 191.651 1.00 237.99 ?  125  GLN A CD    1 
ATOM   721   O  OE1   . GLN A 1  126  ? 184.184 208.463 191.738 1.00 273.95 ?  125  GLN A OE1   1 
ATOM   722   N  NE2   . GLN A 1  126  ? 186.309 208.053 192.336 1.00 323.60 ?  125  GLN A NE2   1 
ATOM   723   N  N     . LEU A 1  127  ? 181.976 204.515 188.481 1.00 81.18  ?  126  LEU A N     1 
ATOM   724   C  CA    . LEU A 1  127  ? 180.690 203.912 188.128 1.00 97.47  ?  126  LEU A CA    1 
ATOM   725   C  C     . LEU A 1  127  ? 180.959 202.501 187.655 1.00 73.31  ?  126  LEU A C     1 
ATOM   726   O  O     . LEU A 1  127  ? 180.241 201.612 187.886 1.00 55.20  ?  126  LEU A O     1 
ATOM   727   C  CB    . LEU A 1  127  ? 180.012 204.741 187.033 1.00 125.52 ?  126  LEU A CB    1 
ATOM   728   C  CG    . LEU A 1  127  ? 178.924 204.068 186.200 1.00 150.87 ?  126  LEU A CG    1 
ATOM   729   C  CD1   . LEU A 1  127  ? 177.559 204.225 186.852 1.00 189.57 ?  126  LEU A CD1   1 
ATOM   730   C  CD2   . LEU A 1  127  ? 178.919 204.689 184.831 1.00 150.94 ?  126  LEU A CD2   1 
ATOM   731   N  N     . ALA A 1  128  ? 182.008 202.382 186.877 1.00 72.89  ?  127  ALA A N     1 
ATOM   732   C  CA    . ALA A 1  128  ? 182.406 201.206 186.311 1.00 92.65  ?  127  ALA A CA    1 
ATOM   733   C  C     . ALA A 1  128  ? 182.871 200.287 187.426 1.00 87.32  ?  127  ALA A C     1 
ATOM   734   O  O     . ALA A 1  128  ? 182.725 199.165 187.402 1.00 75.82  ?  127  ALA A O     1 
ATOM   735   C  CB    . ALA A 1  128  ? 183.506 201.443 185.288 1.00 101.66 ?  127  ALA A CB    1 
ATOM   736   N  N     . ARG A 1  129  ? 183.645 200.851 188.344 1.00 95.81  ?  128  ARG A N     1 
ATOM   737   C  CA    . ARG A 1  129  ? 184.215 200.070 189.422 1.00 126.13 ?  128  ARG A CA    1 
ATOM   738   C  C     . ARG A 1  129  ? 183.124 199.459 190.293 1.00 118.34 ?  128  ARG A C     1 
ATOM   739   O  O     . ARG A 1  129  ? 183.264 198.325 190.745 1.00 79.20  ?  128  ARG A O     1 
ATOM   740   C  CB    . ARG A 1  129  ? 185.162 200.965 190.223 1.00 162.39 ?  128  ARG A CB    1 
ATOM   741   C  CG    . ARG A 1  129  ? 186.028 200.210 191.217 1.00 197.27 ?  128  ARG A CG    1 
ATOM   742   C  CD    . ARG A 1  129  ? 187.129 201.067 191.862 1.00 260.75 ?  128  ARG A CD    1 
ATOM   743   N  NE    . ARG A 1  129  ? 186.608 202.207 192.613 1.00 383.15 ?  128  ARG A NE    1 
ATOM   744   C  CZ    . ARG A 1  129  ? 186.594 203.473 192.211 1.00 421.76 ?  128  ARG A CZ    1 
ATOM   745   N  NH1   . ARG A 1  129  ? 187.002 203.796 191.002 1.00 367.98 1  128  ARG A NH1   1 
ATOM   746   N  NH2   . ARG A 1  129  ? 186.178 204.414 193.044 1.00 440.00 ?  128  ARG A NH2   1 
ATOM   747   N  N     . ARG A 1  130  ? 182.110 200.258 190.584 1.00 149.82 ?  129  ARG A N     1 
ATOM   748   C  CA    . ARG A 1  130  ? 181.003 199.887 191.437 1.00 181.56 ?  129  ARG A CA    1 
ATOM   749   C  C     . ARG A 1  130  ? 180.161 198.793 190.793 1.00 141.64 ?  129  ARG A C     1 
ATOM   750   O  O     . ARG A 1  130  ? 179.705 197.924 191.515 1.00 158.86 ?  129  ARG A O     1 
ATOM   751   C  CB    . ARG A 1  130  ? 180.126 201.098 191.799 1.00 210.38 ?  129  ARG A CB    1 
ATOM   752   C  CG    . ARG A 1  130  ? 180.776 202.209 192.623 1.00 268.71 ?  129  ARG A CG    1 
ATOM   753   C  CD    . ARG A 1  130  ? 181.029 201.891 194.088 1.00 320.25 ?  129  ARG A CD    1 
ATOM   754   N  NE    . ARG A 1  130  ? 181.750 202.940 194.825 1.00 298.40 ?  129  ARG A NE    1 
ATOM   755   C  CZ    . ARG A 1  130  ? 183.089 203.059 194.913 1.00 202.82 ?  129  ARG A CZ    1 
ATOM   756   N  NH1   . ARG A 1  130  ? 183.870 202.384 194.082 1.00 240.79 1  129  ARG A NH1   1 
ATOM   757   N  NH2   . ARG A 1  130  ? 183.646 203.846 195.816 1.00 161.73 ?  129  ARG A NH2   1 
ATOM   758   N  N     . ILE A 1  131  ? 179.887 198.902 189.496 1.00 113.85 ?  130  ILE A N     1 
ATOM   759   C  CA    . ILE A 1  131  ? 179.044 197.963 188.815 1.00 135.25 ?  130  ILE A CA    1 
ATOM   760   C  C     . ILE A 1  131  ? 179.682 196.570 188.677 1.00 174.75 ?  130  ILE A C     1 
ATOM   761   O  O     . ILE A 1  131  ? 178.973 195.538 188.803 1.00 173.17 ?  130  ILE A O     1 
ATOM   762   C  CB    . ILE A 1  131  ? 178.612 198.492 187.445 1.00 117.63 ?  130  ILE A CB    1 
ATOM   763   C  CG1   . ILE A 1  131  ? 179.779 198.738 186.518 1.00 144.39 ?  130  ILE A CG1   1 
ATOM   764   C  CG2   . ILE A 1  131  ? 177.842 199.769 187.516 1.00 99.85  ?  130  ILE A CG2   1 
ATOM   765   C  CD1   . ILE A 1  131  ? 179.945 197.697 185.478 1.00 207.36 ?  130  ILE A CD1   1 
ATOM   766   N  N     . ARG A 1  132  ? 180.964 196.533 188.313 1.00 185.30 ?  131  ARG A N     1 
ATOM   767   C  CA    . ARG A 1  132  ? 181.703 195.313 188.213 1.00 194.49 ?  131  ARG A CA    1 
ATOM   768   C  C     . ARG A 1  132  ? 181.658 194.627 189.577 1.00 174.24 ?  131  ARG A C     1 
ATOM   769   O  O     . ARG A 1  132  ? 181.795 193.397 189.678 1.00 139.03 ?  131  ARG A O     1 
ATOM   770   C  CB    . ARG A 1  132  ? 183.147 195.570 187.789 1.00 176.92 ?  131  ARG A CB    1 
ATOM   771   C  CG    . ARG A 1  132  ? 183.987 194.334 187.540 1.00 244.52 ?  131  ARG A CG    1 
ATOM   772   C  CD    . ARG A 1  132  ? 185.394 194.667 187.061 1.00 288.05 ?  131  ARG A CD    1 
ATOM   773   N  NE    . ARG A 1  132  ? 185.390 195.341 185.771 1.00 209.90 ?  131  ARG A NE    1 
ATOM   774   C  CZ    . ARG A 1  132  ? 186.475 195.747 185.097 1.00 153.99 ?  131  ARG A CZ    1 
ATOM   775   N  NH1   . ARG A 1  132  ? 187.697 195.655 185.584 1.00 140.96 1  131  ARG A NH1   1 
ATOM   776   N  NH2   . ARG A 1  132  ? 186.394 196.269 183.896 1.00 106.10 ?  131  ARG A NH2   1 
ATOM   777   N  N     . GLY A 1  133  ? 181.451 195.457 190.601 1.00 213.12 ?  132  GLY A N     1 
ATOM   778   C  CA    . GLY A 1  133  ? 181.278 194.978 191.950 1.00 315.12 ?  132  GLY A CA    1 
ATOM   779   C  C     . GLY A 1  133  ? 182.492 194.133 192.293 1.00 407.84 ?  132  GLY A C     1 
ATOM   780   O  O     . GLY A 1  133  ? 182.436 193.176 193.107 1.00 425.28 ?  132  GLY A O     1 
ATOM   781   N  N     . GLU A 1  134  ? 183.666 194.560 191.815 1.00 440.00 ?  133  GLU A N     1 
ATOM   782   C  CA    . GLU A 1  134  ? 184.914 193.946 192.302 1.00 440.00 ?  133  GLU A CA    1 
ATOM   783   C  C     . GLU A 1  134  ? 185.081 194.322 193.770 1.00 440.00 ?  133  GLU A C     1 
ATOM   784   O  O     . GLU A 1  134  ? 185.083 193.449 194.641 1.00 440.00 ?  133  GLU A O     1 
ATOM   785   C  CB    . GLU A 1  134  ? 186.066 194.300 191.355 1.00 440.00 ?  133  GLU A CB    1 
ATOM   786   C  CG    . GLU A 1  134  ? 186.554 193.150 190.458 1.00 440.00 ?  133  GLU A CG    1 
ATOM   787   C  CD    . GLU A 1  134  ? 187.235 192.115 191.346 1.00 440.00 ?  133  GLU A CD    1 
ATOM   788   O  OE1   . GLU A 1  134  ? 188.257 192.457 191.962 1.00 440.00 ?  133  GLU A OE1   1 
ATOM   789   O  OE2   . GLU A 1  134  ? 186.707 191.013 191.468 1.00 440.00 -1 133  GLU A OE2   1 
ATOM   790   N  N     . ARG A 1  135  ? 185.103 195.637 193.999 1.00 440.00 ?  134  ARG A N     1 
ATOM   791   C  CA    . ARG A 1  135  ? 185.195 196.237 195.312 1.00 440.00 ?  134  ARG A CA    1 
ATOM   792   C  C     . ARG A 1  135  ? 183.952 195.976 196.181 1.00 440.00 ?  134  ARG A C     1 
ATOM   793   O  O     . ARG A 1  135  ? 182.849 195.739 195.717 1.00 440.00 ?  134  ARG A O     1 
ATOM   794   C  CB    . ARG A 1  135  ? 185.393 197.745 195.163 1.00 440.00 ?  134  ARG A CB    1 
ATOM   795   C  CG    . ARG A 1  135  ? 186.803 198.145 194.739 1.00 440.00 ?  134  ARG A CG    1 
ATOM   796   C  CD    . ARG A 1  135  ? 187.231 199.376 195.499 1.00 440.00 ?  134  ARG A CD    1 
ATOM   797   N  NE    . ARG A 1  135  ? 188.352 200.125 194.932 1.00 440.00 ?  134  ARG A NE    1 
ATOM   798   C  CZ    . ARG A 1  135  ? 188.527 201.445 195.088 1.00 440.00 ?  134  ARG A CZ    1 
ATOM   799   N  NH1   . ARG A 1  135  ? 187.648 202.167 195.771 1.00 440.00 1  134  ARG A NH1   1 
ATOM   800   N  NH2   . ARG A 1  135  ? 189.585 202.058 194.570 1.00 440.00 ?  134  ARG A NH2   1 
ATOM   801   N  N     . LYS B 2  21   ? 216.984 202.160 202.233 1.00 440.00 ?  20   LYS B N     1 
ATOM   802   C  CA    . LYS B 2  21   ? 216.148 203.417 202.092 1.00 440.00 ?  20   LYS B CA    1 
ATOM   803   C  C     . LYS B 2  21   ? 214.707 203.052 201.660 1.00 440.00 ?  20   LYS B C     1 
ATOM   804   O  O     . LYS B 2  21   ? 214.519 202.499 200.590 1.00 440.00 ?  20   LYS B O     1 
ATOM   805   C  CB    . LYS B 2  21   ? 216.807 204.393 201.097 1.00 440.00 ?  20   LYS B CB    1 
ATOM   806   C  CG    . LYS B 2  21   ? 216.014 205.660 200.748 1.00 440.00 ?  20   LYS B CG    1 
ATOM   807   C  CD    . LYS B 2  21   ? 215.384 206.355 201.961 1.00 440.00 ?  20   LYS B CD    1 
ATOM   808   C  CE    . LYS B 2  21   ? 214.735 207.710 201.712 1.00 440.00 ?  20   LYS B CE    1 
ATOM   809   N  NZ    . LYS B 2  21   ? 213.599 207.922 202.657 1.00 440.00 1  20   LYS B NZ    1 
ATOM   810   N  N     . VAL B 2  22   ? 213.686 203.375 202.481 1.00 440.00 ?  21   VAL B N     1 
ATOM   811   C  CA    . VAL B 2  22   ? 212.241 203.033 202.150 1.00 440.00 ?  21   VAL B CA    1 
ATOM   812   C  C     . VAL B 2  22   ? 211.850 203.758 200.858 1.00 440.00 ?  21   VAL B C     1 
ATOM   813   O  O     . VAL B 2  22   ? 211.865 204.969 200.806 1.00 440.00 ?  21   VAL B O     1 
ATOM   814   C  CB    . VAL B 2  22   ? 211.200 203.338 203.258 1.00 440.00 ?  21   VAL B CB    1 
ATOM   815   C  CG1   . VAL B 2  22   ? 211.087 204.848 203.551 1.00 440.00 ?  21   VAL B CG1   1 
ATOM   816   C  CG2   . VAL B 2  22   ? 209.836 202.718 202.905 1.00 429.63 ?  21   VAL B CG2   1 
ATOM   817   N  N     . LEU B 2  23   ? 211.455 203.019 199.826 1.00 440.00 ?  22   LEU B N     1 
ATOM   818   C  CA    . LEU B 2  23   ? 211.116 203.671 198.558 1.00 440.00 ?  22   LEU B CA    1 
ATOM   819   C  C     . LEU B 2  23   ? 209.780 204.424 198.656 1.00 440.00 ?  22   LEU B C     1 
ATOM   820   O  O     . LEU B 2  23   ? 208.800 203.895 199.175 1.00 440.00 ?  22   LEU B O     1 
ATOM   821   C  CB    . LEU B 2  23   ? 211.152 202.604 197.466 1.00 440.00 ?  22   LEU B CB    1 
ATOM   822   C  CG    . LEU B 2  23   ? 212.532 202.376 196.858 1.00 440.00 ?  22   LEU B CG    1 
ATOM   823   C  CD1   . LEU B 2  23   ? 213.497 201.821 197.894 1.00 440.00 ?  22   LEU B CD1   1 
ATOM   824   C  CD2   . LEU B 2  23   ? 212.472 201.472 195.633 1.00 440.00 ?  22   LEU B CD2   1 
ATOM   825   N  N     . ARG B 2  24   ? 209.834 205.694 198.217 1.00 440.00 ?  23   ARG B N     1 
ATOM   826   C  CA    . ARG B 2  24   ? 208.779 206.724 198.232 1.00 440.00 ?  23   ARG B CA    1 
ATOM   827   C  C     . ARG B 2  24   ? 209.063 207.721 197.087 1.00 440.00 ?  23   ARG B C     1 
ATOM   828   O  O     . ARG B 2  24   ? 210.019 207.510 196.337 1.00 440.00 ?  23   ARG B O     1 
ATOM   829   C  CB    . ARG B 2  24   ? 208.746 207.444 199.588 1.00 440.00 ?  23   ARG B CB    1 
ATOM   830   C  CG    . ARG B 2  24   ? 208.443 206.517 200.758 1.00 440.00 ?  23   ARG B CG    1 
ATOM   831   C  CD    . ARG B 2  24   ? 207.997 207.180 202.045 1.00 440.00 ?  23   ARG B CD    1 
ATOM   832   N  NE    . ARG B 2  24   ? 207.841 206.142 203.047 1.00 440.00 ?  23   ARG B NE    1 
ATOM   833   C  CZ    . ARG B 2  24   ? 207.428 206.337 204.287 1.00 440.00 ?  23   ARG B CZ    1 
ATOM   834   N  NH1   . ARG B 2  24   ? 206.962 207.517 204.665 1.00 440.00 1  23   ARG B NH1   1 
ATOM   835   N  NH2   . ARG B 2  24   ? 207.541 205.344 205.152 1.00 440.00 ?  23   ARG B NH2   1 
ATOM   836   N  N     . ASP B 2  25   ? 208.195 208.721 196.858 1.00 440.00 ?  24   ASP B N     1 
ATOM   837   C  CA    . ASP B 2  25   ? 208.136 209.484 195.558 1.00 418.99 ?  24   ASP B CA    1 
ATOM   838   C  C     . ASP B 2  25   ? 208.115 208.479 194.381 1.00 421.20 ?  24   ASP B C     1 
ATOM   839   O  O     . ASP B 2  25   ? 208.734 208.689 193.357 1.00 436.98 ?  24   ASP B O     1 
ATOM   840   C  CB    . ASP B 2  25   ? 209.292 210.484 195.444 1.00 301.72 ?  24   ASP B CB    1 
ATOM   841   C  CG    . ASP B 2  25   ? 209.214 211.349 194.199 1.00 224.77 ?  24   ASP B CG    1 
ATOM   842   O  OD1   . ASP B 2  25   ? 208.347 212.209 194.161 1.00 181.76 ?  24   ASP B OD1   1 
ATOM   843   O  OD2   . ASP B 2  25   ? 209.996 211.100 193.260 1.00 310.07 -1 24   ASP B OD2   1 
ATOM   844   N  N     . ASN B 2  26   ? 207.400 207.367 194.573 1.00 381.97 ?  25   ASN B N     1 
ATOM   845   C  CA    . ASN B 2  26   ? 207.320 206.192 193.692 1.00 343.71 ?  25   ASN B CA    1 
ATOM   846   C  C     . ASN B 2  26   ? 206.050 206.347 192.832 1.00 303.95 ?  25   ASN B C     1 
ATOM   847   O  O     . ASN B 2  26   ? 206.026 206.195 191.589 1.00 352.52 ?  25   ASN B O     1 
ATOM   848   C  CB    . ASN B 2  26   ? 207.338 204.930 194.574 1.00 294.19 ?  25   ASN B CB    1 
ATOM   849   C  CG    . ASN B 2  26   ? 206.136 204.830 195.477 1.00 268.38 ?  25   ASN B CG    1 
ATOM   850   O  OD1   . ASN B 2  26   ? 205.061 205.246 195.098 1.00 244.98 ?  25   ASN B OD1   1 
ATOM   851   N  ND2   . ASN B 2  26   ? 206.295 204.183 196.620 1.00 283.48 ?  25   ASN B ND2   1 
ATOM   852   N  N     . ILE B 2  27   ? 204.985 206.603 193.595 1.00 253.35 ?  26   ILE B N     1 
ATOM   853   C  CA    . ILE B 2  27   ? 203.676 206.684 193.077 1.00 243.84 ?  26   ILE B CA    1 
ATOM   854   C  C     . ILE B 2  27   ? 203.729 207.514 191.816 1.00 312.87 ?  26   ILE B C     1 
ATOM   855   O  O     . ILE B 2  27   ? 203.033 207.157 190.847 1.00 440.00 ?  26   ILE B O     1 
ATOM   856   C  CB    . ILE B 2  27   ? 202.662 207.283 194.077 1.00 299.61 ?  26   ILE B CB    1 
ATOM   857   C  CG1   . ILE B 2  27   ? 201.245 206.845 193.676 1.00 296.53 ?  26   ILE B CG1   1 
ATOM   858   C  CG2   . ILE B 2  27   ? 202.859 208.821 194.172 1.00 355.81 ?  26   ILE B CG2   1 
ATOM   859   C  CD1   . ILE B 2  27   ? 201.103 205.379 193.392 1.00 234.03 ?  26   ILE B CD1   1 
ATOM   860   N  N     . GLN B 2  28   ? 204.485 208.631 191.828 1.00 268.78 ?  27   GLN B N     1 
ATOM   861   C  CA    . GLN B 2  28   ? 204.540 209.479 190.615 1.00 266.89 ?  27   GLN B CA    1 
ATOM   862   C  C     . GLN B 2  28   ? 205.197 208.810 189.396 1.00 329.45 ?  27   GLN B C     1 
ATOM   863   O  O     . GLN B 2  28   ? 204.674 208.991 188.258 1.00 396.51 ?  27   GLN B O     1 
ATOM   864   C  CB    . GLN B 2  28   ? 205.327 210.749 190.887 1.00 173.53 ?  27   GLN B CB    1 
ATOM   865   C  CG    . GLN B 2  28   ? 204.627 211.752 191.792 1.00 183.77 ?  27   GLN B CG    1 
ATOM   866   C  CD    . GLN B 2  28   ? 205.455 212.997 191.449 1.00 226.79 ?  27   GLN B CD    1 
ATOM   867   O  OE1   . GLN B 2  28   ? 206.681 212.868 191.314 1.00 234.73 ?  27   GLN B OE1   1 
ATOM   868   N  NE2   . GLN B 2  28   ? 204.848 214.184 191.288 1.00 312.18 ?  27   GLN B NE2   1 
ATOM   869   N  N     . GLY B 2  29   ? 206.225 207.987 189.660 1.00 327.82 ?  28   GLY B N     1 
ATOM   870   C  CA    . GLY B 2  29   ? 207.052 207.431 188.599 1.00 284.44 ?  28   GLY B CA    1 
ATOM   871   C  C     . GLY B 2  29   ? 206.195 207.220 187.367 1.00 233.35 ?  28   GLY B C     1 
ATOM   872   O  O     . GLY B 2  29   ? 206.594 207.644 186.254 1.00 222.66 ?  28   GLY B O     1 
ATOM   873   N  N     . ILE B 2  30   ? 204.998 206.630 187.600 1.00 173.39 ?  29   ILE B N     1 
ATOM   874   C  CA    . ILE B 2  30   ? 203.990 206.463 186.570 1.00 126.41 ?  29   ILE B CA    1 
ATOM   875   C  C     . ILE B 2  30   ? 203.383 207.834 186.155 1.00 101.55 ?  29   ILE B C     1 
ATOM   876   O  O     . ILE B 2  30   ? 202.245 208.138 186.430 1.00 68.48  ?  29   ILE B O     1 
ATOM   877   C  CB    . ILE B 2  30   ? 202.926 205.432 186.965 1.00 110.26 ?  29   ILE B CB    1 
ATOM   878   C  CG1   . ILE B 2  30   ? 201.951 205.230 185.811 1.00 118.02 ?  29   ILE B CG1   1 
ATOM   879   C  CG2   . ILE B 2  30   ? 202.146 205.825 188.199 1.00 130.43 ?  29   ILE B CG2   1 
ATOM   880   C  CD1   . ILE B 2  30   ? 201.106 204.013 185.899 1.00 113.39 ?  29   ILE B CD1   1 
ATOM   881   N  N     . THR B 2  31   ? 204.187 208.528 185.379 1.00 116.97 ?  30   THR B N     1 
ATOM   882   C  CA    . THR B 2  31   ? 203.932 209.879 184.911 1.00 119.99 ?  30   THR B CA    1 
ATOM   883   C  C     . THR B 2  31   ? 202.821 209.925 183.847 1.00 117.77 ?  30   THR B C     1 
ATOM   884   O  O     . THR B 2  31   ? 202.476 208.965 183.132 1.00 84.83  ?  30   THR B O     1 
ATOM   885   C  CB    . THR B 2  31   ? 205.160 210.566 184.326 1.00 117.38 ?  30   THR B CB    1 
ATOM   886   O  OG1   . THR B 2  31   ? 205.464 209.891 183.108 1.00 169.58 ?  30   THR B OG1   1 
ATOM   887   C  CG2   . THR B 2  31   ? 206.361 210.578 185.277 1.00 81.95  ?  30   THR B CG2   1 
ATOM   888   N  N     . LYS B 2  32   ? 202.384 211.194 183.742 1.00 154.64 ?  31   LYS B N     1 
ATOM   889   C  CA    . LYS B 2  32   ? 201.278 211.693 182.890 1.00 182.52 ?  31   LYS B CA    1 
ATOM   890   C  C     . LYS B 2  32   ? 201.139 210.798 181.655 1.00 131.84 ?  31   LYS B C     1 
ATOM   891   O  O     . LYS B 2  32   ? 200.050 210.309 181.381 1.00 104.08 ?  31   LYS B O     1 
ATOM   892   C  CB    . LYS B 2  32   ? 201.544 213.161 182.548 1.00 227.01 ?  31   LYS B CB    1 
ATOM   893   C  CG    . LYS B 2  32   ? 200.863 213.760 181.337 1.00 259.20 ?  31   LYS B CG    1 
ATOM   894   C  CD    . LYS B 2  32   ? 201.613 215.113 181.062 1.00 211.98 ?  31   LYS B CD    1 
ATOM   895   C  CE    . LYS B 2  32   ? 202.742 215.048 180.047 1.00 179.36 ?  31   LYS B CE    1 
ATOM   896   N  NZ    . LYS B 2  32   ? 202.304 214.239 178.862 1.00 221.65 1  31   LYS B NZ    1 
ATOM   897   N  N     . PRO B 2  33   ? 202.198 210.726 180.823 1.00 141.36 ?  32   PRO B N     1 
ATOM   898   C  CA    . PRO B 2  33   ? 202.039 210.078 179.518 1.00 177.55 ?  32   PRO B CA    1 
ATOM   899   C  C     . PRO B 2  33   ? 201.656 208.601 179.613 1.00 214.74 ?  32   PRO B C     1 
ATOM   900   O  O     . PRO B 2  33   ? 200.891 208.149 178.744 1.00 273.17 ?  32   PRO B O     1 
ATOM   901   C  CB    . PRO B 2  33   ? 203.403 210.239 178.855 1.00 173.75 ?  32   PRO B CB    1 
ATOM   902   C  CG    . PRO B 2  33   ? 204.116 211.297 179.633 1.00 180.53 ?  32   PRO B CG    1 
ATOM   903   C  CD    . PRO B 2  33   ? 203.544 211.291 181.040 1.00 167.25 ?  32   PRO B CD    1 
ATOM   904   N  N     . ALA B 2  34   ? 202.290 207.867 180.551 1.00 201.29 ?  33   ALA B N     1 
ATOM   905   C  CA    . ALA B 2  34   ? 202.212 206.398 180.531 1.00 225.86 ?  33   ALA B CA    1 
ATOM   906   C  C     . ALA B 2  34   ? 200.768 205.967 180.892 1.00 170.86 ?  33   ALA B C     1 
ATOM   907   O  O     . ALA B 2  34   ? 200.123 205.029 180.283 1.00 198.92 ?  33   ALA B O     1 
ATOM   908   C  CB    . ALA B 2  34   ? 203.218 205.755 181.421 1.00 195.25 ?  33   ALA B CB    1 
ATOM   909   N  N     . ILE B 2  35   ? 200.215 206.645 181.901 1.00 111.61 ?  34   ILE B N     1 
ATOM   910   C  CA    . ILE B 2  35   ? 198.817 206.330 182.266 1.00 113.97 ?  34   ILE B CA    1 
ATOM   911   C  C     . ILE B 2  35   ? 197.952 206.533 181.027 1.00 103.38 ?  34   ILE B C     1 
ATOM   912   O  O     . ILE B 2  35   ? 196.939 205.826 180.863 1.00 131.39 ?  34   ILE B O     1 
ATOM   913   C  CB    . ILE B 2  35   ? 198.310 207.146 183.472 1.00 170.87 ?  34   ILE B CB    1 
ATOM   914   C  CG1   . ILE B 2  35   ? 199.288 207.085 184.648 1.00 240.17 ?  34   ILE B CG1   1 
ATOM   915   C  CG2   . ILE B 2  35   ? 196.908 206.624 183.743 1.00 118.52 ?  34   ILE B CG2   1 
ATOM   916   C  CD1   . ILE B 2  35   ? 199.008 208.002 185.889 1.00 283.70 ?  34   ILE B CD1   1 
ATOM   917   N  N     . ARG B 2  36   ? 198.255 207.590 180.246 1.00 99.59  ?  35   ARG B N     1 
ATOM   918   C  CA    . ARG B 2  36   ? 197.463 207.983 179.105 1.00 113.56 ?  35   ARG B CA    1 
ATOM   919   C  C     . ARG B 2  36   ? 197.515 206.933 177.969 1.00 93.85  ?  35   ARG B C     1 
ATOM   920   O  O     . ARG B 2  36   ? 196.447 206.514 177.278 1.00 100.44 ?  35   ARG B O     1 
ATOM   921   C  CB    . ARG B 2  36   ? 197.904 209.320 178.554 1.00 94.67  ?  35   ARG B CB    1 
ATOM   922   C  CG    . ARG B 2  36   ? 196.940 209.955 177.557 1.00 104.72 ?  35   ARG B CG    1 
ATOM   923   C  CD    . ARG B 2  36   ? 197.430 211.282 176.982 1.00 88.22  ?  35   ARG B CD    1 
ATOM   924   N  NE    . ARG B 2  36   ? 198.745 211.172 176.390 1.00 101.91 ?  35   ARG B NE    1 
ATOM   925   C  CZ    . ARG B 2  36   ? 199.891 211.349 177.068 1.00 183.84 ?  35   ARG B CZ    1 
ATOM   926   N  NH1   . ARG B 2  36   ? 199.855 211.974 178.232 1.00 246.22 1  35   ARG B NH1   1 
ATOM   927   N  NH2   . ARG B 2  36   ? 201.065 210.932 176.585 1.00 302.68 ?  35   ARG B NH2   1 
ATOM   928   N  N     . ARG B 2  37   ? 198.730 206.447 177.738 1.00 89.72  ?  36   ARG B N     1 
ATOM   929   C  CA    . ARG B 2  37   ? 198.876 205.534 176.646 1.00 119.26 ?  36   ARG B CA    1 
ATOM   930   C  C     . ARG B 2  37   ? 197.987 204.326 176.914 1.00 105.54 ?  36   ARG B C     1 
ATOM   931   O  O     . ARG B 2  37   ? 197.384 203.847 175.833 1.00 193.41 ?  36   ARG B O     1 
ATOM   932   C  CB    . ARG B 2  37   ? 200.347 205.251 176.374 1.00 238.84 ?  36   ARG B CB    1 
ATOM   933   C  CG    . ARG B 2  37   ? 201.133 205.015 177.649 1.00 404.22 ?  36   ARG B CG    1 
ATOM   934   C  CD    . ARG B 2  37   ? 202.602 204.649 177.451 1.00 407.99 ?  36   ARG B CD    1 
ATOM   935   N  NE    . ARG B 2  37   ? 203.547 205.642 176.892 1.00 274.46 ?  36   ARG B NE    1 
ATOM   936   C  CZ    . ARG B 2  37   ? 204.881 205.629 176.997 1.00 133.25 ?  36   ARG B CZ    1 
ATOM   937   N  NH1   . ARG B 2  37   ? 205.509 204.581 177.502 1.00 98.45  1  36   ARG B NH1   1 
ATOM   938   N  NH2   . ARG B 2  37   ? 205.542 206.716 176.652 1.00 106.34 ?  36   ARG B NH2   1 
ATOM   939   N  N     . LEU B 2  38   ? 197.940 203.803 178.184 1.00 76.96  ?  37   LEU B N     1 
ATOM   940   C  CA    . LEU B 2  38   ? 197.118 202.663 178.498 1.00 74.64  ?  37   LEU B CA    1 
ATOM   941   C  C     . LEU B 2  38   ? 195.719 202.870 177.896 1.00 83.83  ?  37   LEU B C     1 
ATOM   942   O  O     . LEU B 2  38   ? 195.085 201.936 177.370 1.00 62.33  ?  37   LEU B O     1 
ATOM   943   C  CB    . LEU B 2  38   ? 196.961 202.526 180.013 1.00 70.71  ?  37   LEU B CB    1 
ATOM   944   C  CG    . LEU B 2  38   ? 198.114 201.903 180.778 1.00 78.56  ?  37   LEU B CG    1 
ATOM   945   C  CD1   . LEU B 2  38   ? 198.028 202.234 182.224 1.00 80.79  ?  37   LEU B CD1   1 
ATOM   946   C  CD2   . LEU B 2  38   ? 198.041 200.444 180.558 1.00 72.43  ?  37   LEU B CD2   1 
ATOM   947   N  N     . ALA B 2  39   ? 195.209 204.078 178.197 1.00 145.98 ?  38   ALA B N     1 
ATOM   948   C  CA    . ALA B 2  39   ? 193.829 204.418 177.902 1.00 215.69 ?  38   ALA B CA    1 
ATOM   949   C  C     . ALA B 2  39   ? 193.549 204.374 176.378 1.00 217.59 ?  38   ALA B C     1 
ATOM   950   O  O     . ALA B 2  39   ? 192.472 203.921 175.926 1.00 360.39 ?  38   ALA B O     1 
ATOM   951   C  CB    . ALA B 2  39   ? 193.464 205.712 178.529 1.00 221.54 ?  38   ALA B CB    1 
ATOM   952   N  N     . ARG B 2  40   ? 194.551 204.794 175.573 1.00 102.57 ?  39   ARG B N     1 
ATOM   953   C  CA    . ARG B 2  40   ? 194.409 204.735 174.142 1.00 66.75  ?  39   ARG B CA    1 
ATOM   954   C  C     . ARG B 2  40   ? 194.361 203.276 173.734 1.00 60.47  ?  39   ARG B C     1 
ATOM   955   O  O     . ARG B 2  40   ? 193.538 202.854 172.941 1.00 58.10  ?  39   ARG B O     1 
ATOM   956   C  CB    . ARG B 2  40   ? 195.558 205.498 173.577 1.00 52.22  ?  39   ARG B CB    1 
ATOM   957   C  CG    . ARG B 2  40   ? 195.402 206.959 174.012 1.00 53.87  ?  39   ARG B CG    1 
ATOM   958   C  CD    . ARG B 2  40   ? 196.264 207.776 173.174 1.00 72.07  ?  39   ARG B CD    1 
ATOM   959   N  NE    . ARG B 2  40   ? 195.792 209.146 173.244 1.00 95.38  ?  39   ARG B NE    1 
ATOM   960   C  CZ    . ARG B 2  40   ? 194.626 209.554 172.774 1.00 110.59 ?  39   ARG B CZ    1 
ATOM   961   N  NH1   . ARG B 2  40   ? 193.631 208.654 172.668 1.00 91.11  1  39   ARG B NH1   1 
ATOM   962   N  NH2   . ARG B 2  40   ? 194.478 210.867 172.477 1.00 111.97 ?  39   ARG B NH2   1 
ATOM   963   N  N     . ARG B 2  41   ? 195.201 202.521 174.396 1.00 76.66  ?  40   ARG B N     1 
ATOM   964   C  CA    . ARG B 2  41   ? 195.168 201.087 174.165 1.00 115.82 ?  40   ARG B CA    1 
ATOM   965   C  C     . ARG B 2  41   ? 193.750 200.654 174.444 1.00 104.27 ?  40   ARG B C     1 
ATOM   966   O  O     . ARG B 2  41   ? 193.214 199.846 173.812 1.00 89.46  ?  40   ARG B O     1 
ATOM   967   C  CB    . ARG B 2  41   ? 196.234 200.408 175.017 1.00 240.92 ?  40   ARG B CB    1 
ATOM   968   C  CG    . ARG B 2  41   ? 197.576 200.736 174.366 1.00 291.15 ?  40   ARG B CG    1 
ATOM   969   C  CD    . ARG B 2  41   ? 197.825 200.103 172.956 1.00 185.10 ?  40   ARG B CD    1 
ATOM   970   N  NE    . ARG B 2  41   ? 198.240 198.676 173.145 1.00 119.05 ?  40   ARG B NE    1 
ATOM   971   C  CZ    . ARG B 2  41   ? 199.454 198.284 173.602 1.00 73.95  ?  40   ARG B CZ    1 
ATOM   972   N  NH1   . ARG B 2  41   ? 200.420 199.158 173.296 1.00 52.40  1  40   ARG B NH1   1 
ATOM   973   N  NH2   . ARG B 2  41   ? 199.527 197.275 174.534 1.00 55.84  ?  40   ARG B NH2   1 
ATOM   974   N  N     . GLY B 2  42   ? 193.151 201.281 175.426 1.00 143.50 ?  41   GLY B N     1 
ATOM   975   C  CA    . GLY B 2  42   ? 191.799 200.914 175.874 1.00 178.21 ?  41   GLY B CA    1 
ATOM   976   C  C     . GLY B 2  42   ? 190.759 201.174 174.806 1.00 158.90 ?  41   GLY B C     1 
ATOM   977   O  O     . GLY B 2  42   ? 189.745 200.376 174.716 1.00 102.27 ?  41   GLY B O     1 
ATOM   978   N  N     . GLY B 2  43   ? 190.996 202.219 173.999 1.00 172.32 ?  42   GLY B N     1 
ATOM   979   C  CA    . GLY B 2  43   ? 190.034 202.692 173.017 1.00 139.11 ?  42   GLY B CA    1 
ATOM   980   C  C     . GLY B 2  43   ? 189.208 203.885 173.524 1.00 111.74 ?  42   GLY B C     1 
ATOM   981   O  O     . GLY B 2  43   ? 188.191 204.306 173.044 1.00 138.81 ?  42   GLY B O     1 
ATOM   982   N  N     . VAL B 2  44   ? 189.691 204.508 174.561 1.00 98.39  ?  43   VAL B N     1 
ATOM   983   C  CA    . VAL B 2  44   ? 189.216 205.827 174.950 1.00 97.17  ?  43   VAL B CA    1 
ATOM   984   C  C     . VAL B 2  44   ? 189.699 206.821 173.872 1.00 65.75  ?  43   VAL B C     1 
ATOM   985   O  O     . VAL B 2  44   ? 190.875 206.648 173.378 1.00 54.17  ?  43   VAL B O     1 
ATOM   986   C  CB    . VAL B 2  44   ? 189.832 206.175 176.316 1.00 160.01 ?  43   VAL B CB    1 
ATOM   987   C  CG1   . VAL B 2  44   ? 189.380 207.523 176.826 1.00 239.14 ?  43   VAL B CG1   1 
ATOM   988   C  CG2   . VAL B 2  44   ? 189.559 205.079 177.329 1.00 145.95 ?  43   VAL B CG2   1 
ATOM   989   N  N     . LYS B 2  45   ? 188.911 207.849 173.563 1.00 57.69  ?  44   LYS B N     1 
ATOM   990   C  CA    . LYS B 2  45   ? 189.494 208.910 172.750 1.00 64.43  ?  44   LYS B CA    1 
ATOM   991   C  C     . LYS B 2  45   ? 190.188 209.966 173.612 1.00 87.80  ?  44   LYS B C     1 
ATOM   992   O  O     . LYS B 2  45   ? 191.385 210.146 173.370 1.00 95.26  ?  44   LYS B O     1 
ATOM   993   C  CB    . LYS B 2  45   ? 188.534 209.558 171.772 1.00 66.19  ?  44   LYS B CB    1 
ATOM   994   C  CG    . LYS B 2  45   ? 189.274 210.525 170.839 1.00 72.30  ?  44   LYS B CG    1 
ATOM   995   C  CD    . LYS B 2  45   ? 188.469 211.253 169.791 1.00 79.09  ?  44   LYS B CD    1 
ATOM   996   C  CE    . LYS B 2  45   ? 189.224 212.497 169.331 1.00 80.64  ?  44   LYS B CE    1 
ATOM   997   N  NZ    . LYS B 2  45   ? 188.405 213.349 168.434 1.00 84.72  1  44   LYS B NZ    1 
ATOM   998   N  N     . ARG B 2  46   ? 189.504 210.651 174.516 1.00 129.63 ?  45   ARG B N     1 
ATOM   999   C  CA    . ARG B 2  46   ? 190.224 211.797 175.298 1.00 164.40 ?  45   ARG B CA    1 
ATOM   1000  C  C     . ARG B 2  46   ? 190.149 211.670 176.813 1.00 179.28 ?  45   ARG B C     1 
ATOM   1001  O  O     . ARG B 2  46   ? 189.623 210.677 177.312 1.00 210.09 ?  45   ARG B O     1 
ATOM   1002  C  CB    . ARG B 2  46   ? 189.771 213.202 174.807 1.00 157.90 ?  45   ARG B CB    1 
ATOM   1003  C  CG    . ARG B 2  46   ? 190.253 213.502 173.381 1.00 140.72 ?  45   ARG B CG    1 
ATOM   1004  C  CD    . ARG B 2  46   ? 190.120 215.007 173.111 1.00 164.08 ?  45   ARG B CD    1 
ATOM   1005  N  NE    . ARG B 2  46   ? 190.465 215.408 171.754 1.00 194.49 ?  45   ARG B NE    1 
ATOM   1006  C  CZ    . ARG B 2  46   ? 189.921 216.450 171.118 1.00 277.65 ?  45   ARG B CZ    1 
ATOM   1007  N  NH1   . ARG B 2  46   ? 189.263 217.382 171.805 1.00 375.83 1  45   ARG B NH1   1 
ATOM   1008  N  NH2   . ARG B 2  46   ? 190.045 216.585 169.794 1.00 258.02 ?  45   ARG B NH2   1 
ATOM   1009  N  N     . ILE B 2  47   ? 190.684 212.674 177.590 1.00 146.80 ?  46   ILE B N     1 
ATOM   1010  C  CA    . ILE B 2  47   ? 190.930 212.500 179.025 1.00 137.34 ?  46   ILE B CA    1 
ATOM   1011  C  C     . ILE B 2  47   ? 191.055 213.829 179.811 1.00 115.31 ?  46   ILE B C     1 
ATOM   1012  O  O     . ILE B 2  47   ? 191.900 214.681 179.561 1.00 71.91  ?  46   ILE B O     1 
ATOM   1013  C  CB    . ILE B 2  47   ? 192.167 211.586 179.246 1.00 175.24 ?  46   ILE B CB    1 
ATOM   1014  C  CG1   . ILE B 2  47   ? 191.873 210.094 179.053 1.00 173.03 ?  46   ILE B CG1   1 
ATOM   1015  C  CG2   . ILE B 2  47   ? 192.863 211.748 180.621 1.00 248.89 ?  46   ILE B CG2   1 
ATOM   1016  C  CD1   . ILE B 2  47   ? 193.129 209.305 178.585 1.00 189.16 ?  46   ILE B CD1   1 
ATOM   1017  N  N     . SER B 2  48   ? 190.223 213.934 180.852 1.00 138.69 ?  47   SER B N     1 
ATOM   1018  C  CA    . SER B 2  48   ? 190.282 215.073 181.816 1.00 154.58 ?  47   SER B CA    1 
ATOM   1019  C  C     . SER B 2  48   ? 191.500 214.974 182.718 1.00 154.67 ?  47   SER B C     1 
ATOM   1020  O  O     . SER B 2  48   ? 192.029 213.900 182.807 1.00 199.05 ?  47   SER B O     1 
ATOM   1021  C  CB    . SER B 2  48   ? 189.059 215.195 182.662 1.00 155.17 ?  47   SER B CB    1 
ATOM   1022  O  OG    . SER B 2  48   ? 188.956 216.545 183.078 1.00 151.47 ?  47   SER B OG    1 
ATOM   1023  N  N     . GLY B 2  49   ? 191.961 216.110 183.212 1.00 132.64 ?  48   GLY B N     1 
ATOM   1024  C  CA    . GLY B 2  49   ? 193.150 216.260 184.067 1.00 129.71 ?  48   GLY B CA    1 
ATOM   1025  C  C     . GLY B 2  49   ? 193.142 215.383 185.340 1.00 134.58 ?  48   GLY B C     1 
ATOM   1026  O  O     . GLY B 2  49   ? 194.172 214.820 185.717 1.00 138.22 ?  48   GLY B O     1 
ATOM   1027  N  N     . LEU B 2  50   ? 191.956 215.181 185.888 1.00 156.60 ?  49   LEU B N     1 
ATOM   1028  C  CA    . LEU B 2  50   ? 191.735 214.749 187.251 1.00 231.54 ?  49   LEU B CA    1 
ATOM   1029  C  C     . LEU B 2  50   ? 192.129 213.279 187.508 1.00 189.14 ?  49   LEU B C     1 
ATOM   1030  O  O     . LEU B 2  50   ? 192.335 212.879 188.650 1.00 162.18 ?  49   LEU B O     1 
ATOM   1031  C  CB    . LEU B 2  50   ? 190.221 214.922 187.516 1.00 331.45 ?  49   LEU B CB    1 
ATOM   1032  C  CG    . LEU B 2  50   ? 189.636 216.320 187.507 1.00 433.37 ?  49   LEU B CG    1 
ATOM   1033  C  CD1   . LEU B 2  50   ? 188.133 216.495 187.629 1.00 440.00 ?  49   LEU B CD1   1 
ATOM   1034  C  CD2   . LEU B 2  50   ? 190.329 217.225 188.557 1.00 440.00 ?  49   LEU B CD2   1 
ATOM   1035  N  N     . ILE B 2  51   ? 192.122 212.408 186.503 1.00 164.98 ?  50   ILE B N     1 
ATOM   1036  C  CA    . ILE B 2  51   ? 191.969 210.973 186.811 1.00 154.59 ?  50   ILE B CA    1 
ATOM   1037  C  C     . ILE B 2  51   ? 193.352 210.311 186.728 1.00 109.13 ?  50   ILE B C     1 
ATOM   1038  O  O     . ILE B 2  51   ? 193.509 209.126 186.857 1.00 69.61  ?  50   ILE B O     1 
ATOM   1039  C  CB    . ILE B 2  51   ? 191.045 210.371 185.760 1.00 198.39 ?  50   ILE B CB    1 
ATOM   1040  C  CG1   . ILE B 2  51   ? 189.776 211.229 185.617 1.00 180.76 ?  50   ILE B CG1   1 
ATOM   1041  C  CG2   . ILE B 2  51   ? 190.812 208.884 186.060 1.00 242.56 ?  50   ILE B CG2   1 
ATOM   1042  C  CD1   . ILE B 2  51   ? 189.679 212.081 184.348 1.00 117.31 ?  50   ILE B CD1   1 
ATOM   1043  N  N     . TYR B 2  52   ? 194.373 211.100 186.364 1.00 114.30 ?  51   TYR B N     1 
ATOM   1044  C  CA    . TYR B 2  52   ? 195.704 210.559 186.405 1.00 115.05 ?  51   TYR B CA    1 
ATOM   1045  C  C     . TYR B 2  52   ? 195.968 210.125 187.850 1.00 104.78 ?  51   TYR B C     1 
ATOM   1046  O  O     . TYR B 2  52   ? 196.728 209.270 188.098 1.00 81.15  ?  51   TYR B O     1 
ATOM   1047  C  CB    . TYR B 2  52   ? 196.665 211.687 186.071 1.00 157.51 ?  51   TYR B CB    1 
ATOM   1048  C  CG    . TYR B 2  52   ? 196.555 212.255 184.683 1.00 134.80 ?  51   TYR B CG    1 
ATOM   1049  C  CD1   . TYR B 2  52   ? 196.301 211.453 183.568 1.00 95.27  ?  51   TYR B CD1   1 
ATOM   1050  C  CD2   . TYR B 2  52   ? 196.775 213.629 184.506 1.00 134.23 ?  51   TYR B CD2   1 
ATOM   1051  C  CE1   . TYR B 2  52   ? 196.368 212.010 182.282 1.00 111.62 ?  51   TYR B CE1   1 
ATOM   1052  C  CE2   . TYR B 2  52   ? 196.876 214.205 183.235 1.00 120.63 ?  51   TYR B CE2   1 
ATOM   1053  C  CZ    . TYR B 2  52   ? 196.772 213.360 182.122 1.00 135.11 ?  51   TYR B CZ    1 
ATOM   1054  O  OH    . TYR B 2  52   ? 196.763 213.929 180.865 1.00 149.35 ?  51   TYR B OH    1 
ATOM   1055  N  N     . GLU B 2  53   ? 195.520 210.938 188.786 1.00 135.19 ?  52   GLU B N     1 
ATOM   1056  C  CA    . GLU B 2  53   ? 195.729 210.722 190.180 1.00 163.65 ?  52   GLU B CA    1 
ATOM   1057  C  C     . GLU B 2  53   ? 194.834 209.570 190.636 1.00 121.35 ?  52   GLU B C     1 
ATOM   1058  O  O     . GLU B 2  53   ? 195.222 208.765 191.471 1.00 115.22 ?  52   GLU B O     1 
ATOM   1059  C  CB    . GLU B 2  53   ? 195.486 212.034 190.930 1.00 232.78 ?  52   GLU B CB    1 
ATOM   1060  C  CG    . GLU B 2  53   ? 196.422 213.192 190.492 1.00 219.31 ?  52   GLU B CG    1 
ATOM   1061  C  CD    . GLU B 2  53   ? 196.176 213.711 189.084 1.00 206.86 ?  52   GLU B CD    1 
ATOM   1062  O  OE1   . GLU B 2  53   ? 195.199 213.192 188.485 1.00 231.99 ?  52   GLU B OE1   1 
ATOM   1063  O  OE2   . GLU B 2  53   ? 196.935 214.582 188.588 1.00 440.00 -1 52   GLU B OE2   1 
ATOM   1064  N  N     . GLU B 2  54   ? 193.605 209.466 190.118 1.00 96.58  ?  53   GLU B N     1 
ATOM   1065  C  CA    . GLU B 2  54   ? 192.676 208.479 190.613 1.00 120.13 ?  53   GLU B CA    1 
ATOM   1066  C  C     . GLU B 2  54   ? 193.163 207.037 190.353 1.00 93.25  ?  53   GLU B C     1 
ATOM   1067  O  O     . GLU B 2  54   ? 193.041 206.131 191.131 1.00 73.49  ?  53   GLU B O     1 
ATOM   1068  C  CB    . GLU B 2  54   ? 191.310 208.656 189.954 1.00 179.37 ?  53   GLU B CB    1 
ATOM   1069  C  CG    . GLU B 2  54   ? 190.351 207.486 190.255 1.00 258.35 ?  53   GLU B CG    1 
ATOM   1070  C  CD    . GLU B 2  54   ? 190.150 206.872 191.648 1.00 265.30 ?  53   GLU B CD    1 
ATOM   1071  O  OE1   . GLU B 2  54   ? 190.719 207.321 192.661 1.00 229.71 ?  53   GLU B OE1   1 
ATOM   1072  O  OE2   . GLU B 2  54   ? 189.298 205.977 191.722 1.00 428.94 -1 53   GLU B OE2   1 
ATOM   1073  N  N     . THR B 2  55   ? 193.708 206.807 189.177 1.00 81.05  ?  54   THR B N     1 
ATOM   1074  C  CA    . THR B 2  55   ? 194.110 205.514 188.747 1.00 79.68  ?  54   THR B CA    1 
ATOM   1075  C  C     . THR B 2  55   ? 195.320 204.998 189.504 1.00 68.44  ?  54   THR B C     1 
ATOM   1076  O  O     . THR B 2  55   ? 195.473 203.830 189.766 1.00 54.70  ?  54   THR B O     1 
ATOM   1077  C  CB    . THR B 2  55   ? 194.511 205.534 187.264 1.00 109.94 ?  54   THR B CB    1 
ATOM   1078  O  OG1   . THR B 2  55   ? 195.657 206.292 186.952 1.00 101.70 ?  54   THR B OG1   1 
ATOM   1079  C  CG2   . THR B 2  55   ? 193.472 206.219 186.415 1.00 160.19 ?  54   THR B CG2   1 
ATOM   1080  N  N     . ARG B 2  56   ? 196.255 205.857 189.822 1.00 75.79  ?  55   ARG B N     1 
ATOM   1081  C  CA    . ARG B 2  56   ? 197.470 205.535 190.516 1.00 77.62  ?  55   ARG B CA    1 
ATOM   1082  C  C     . ARG B 2  56   ? 197.103 204.844 191.819 1.00 70.82  ?  55   ARG B C     1 
ATOM   1083  O  O     . ARG B 2  56   ? 197.691 203.834 192.246 1.00 55.01  ?  55   ARG B O     1 
ATOM   1084  C  CB    . ARG B 2  56   ? 198.203 206.842 190.813 1.00 95.65  ?  55   ARG B CB    1 
ATOM   1085  C  CG    . ARG B 2  56   ? 198.740 207.464 189.543 1.00 129.77 ?  55   ARG B CG    1 
ATOM   1086  C  CD    . ARG B 2  56   ? 199.608 208.686 189.868 1.00 156.06 ?  55   ARG B CD    1 
ATOM   1087  N  NE    . ARG B 2  56   ? 200.129 209.328 188.676 1.00 188.23 ?  55   ARG B NE    1 
ATOM   1088  C  CZ    . ARG B 2  56   ? 200.852 210.464 188.635 1.00 211.02 ?  55   ARG B CZ    1 
ATOM   1089  N  NH1   . ARG B 2  56   ? 201.358 211.039 189.734 1.00 264.76 1  55   ARG B NH1   1 
ATOM   1090  N  NH2   . ARG B 2  56   ? 201.138 211.000 187.474 1.00 192.92 ?  55   ARG B NH2   1 
ATOM   1091  N  N     . GLY B 2  57   ? 196.053 205.391 192.416 1.00 93.12  ?  56   GLY B N     1 
ATOM   1092  C  CA    . GLY B 2  57   ? 195.502 204.879 193.670 1.00 116.39 ?  56   GLY B CA    1 
ATOM   1093  C  C     . GLY B 2  57   ? 195.046 203.438 193.505 1.00 96.90  ?  56   GLY B C     1 
ATOM   1094  O  O     . GLY B 2  57   ? 195.220 202.677 194.412 1.00 99.71  ?  56   GLY B O     1 
ATOM   1095  N  N     . VAL B 2  58   ? 194.332 203.103 192.433 1.00 79.88  ?  57   VAL B N     1 
ATOM   1096  C  CA    . VAL B 2  58   ? 193.874 201.822 192.168 1.00 87.07  ?  57   VAL B CA    1 
ATOM   1097  C  C     . VAL B 2  58   ? 195.029 200.912 191.830 1.00 67.82  ?  57   VAL B C     1 
ATOM   1098  O  O     . VAL B 2  58   ? 195.120 199.696 192.225 1.00 52.57  ?  57   VAL B O     1 
ATOM   1099  C  CB    . VAL B 2  58   ? 192.850 201.791 191.013 1.00 130.84 ?  57   VAL B CB    1 
ATOM   1100  C  CG1   . VAL B 2  58   ? 192.263 200.401 190.831 1.00 201.94 ?  57   VAL B CG1   1 
ATOM   1101  C  CG2   . VAL B 2  58   ? 191.776 202.831 191.155 1.00 129.20 ?  57   VAL B CG2   1 
ATOM   1102  N  N     . LEU B 2  59   ? 195.903 201.410 190.971 1.00 74.05  ?  58   LEU B N     1 
ATOM   1103  C  CA    . LEU B 2  59   ? 197.045 200.606 190.478 1.00 83.89  ?  58   LEU B CA    1 
ATOM   1104  C  C     . LEU B 2  59   ? 197.693 200.079 191.724 1.00 78.99  ?  58   LEU B C     1 
ATOM   1105  O  O     . LEU B 2  59   ? 198.145 198.887 191.734 1.00 61.29  ?  58   LEU B O     1 
ATOM   1106  C  CB    . LEU B 2  59   ? 198.048 201.561 189.822 1.00 98.55  ?  58   LEU B CB    1 
ATOM   1107  C  CG    . LEU B 2  59   ? 199.351 201.081 189.212 1.00 97.94  ?  58   LEU B CG    1 
ATOM   1108  C  CD1   . LEU B 2  59   ? 199.939 202.273 188.478 1.00 77.55  ?  58   LEU B CD1   1 
ATOM   1109  C  CD2   . LEU B 2  59   ? 200.428 200.665 190.113 1.00 110.04 ?  58   LEU B CD2   1 
ATOM   1110  N  N     . LYS B 2  60   ? 197.780 200.993 192.725 1.00 92.19  ?  59   LYS B N     1 
ATOM   1111  C  CA    . LYS B 2  60   ? 198.446 200.687 193.925 1.00 104.13 ?  59   LYS B CA    1 
ATOM   1112  C  C     . LYS B 2  60   ? 197.637 199.607 194.634 1.00 79.64  ?  59   LYS B C     1 
ATOM   1113  O  O     . LYS B 2  60   ? 198.210 198.759 195.248 1.00 69.61  ?  59   LYS B O     1 
ATOM   1114  C  CB    . LYS B 2  60   ? 198.595 201.919 194.823 1.00 126.70 ?  59   LYS B CB    1 
ATOM   1115  C  CG    . LYS B 2  60   ? 199.622 202.927 194.352 1.00 164.07 ?  59   LYS B CG    1 
ATOM   1116  C  CD    . LYS B 2  60   ? 199.809 204.009 195.403 1.00 228.07 ?  59   LYS B CD    1 
ATOM   1117  C  CE    . LYS B 2  60   ? 198.611 204.923 195.449 1.00 320.80 ?  59   LYS B CE    1 
ATOM   1118  N  NZ    . LYS B 2  60   ? 198.862 206.077 196.339 1.00 353.40 1  59   LYS B NZ    1 
ATOM   1119  N  N     . VAL B 2  61   ? 196.315 199.780 194.668 1.00 76.39  ?  60   VAL B N     1 
ATOM   1120  C  CA    . VAL B 2  61   ? 195.412 198.857 195.318 1.00 87.21  ?  60   VAL B CA    1 
ATOM   1121  C  C     . VAL B 2  61   ? 195.728 197.484 194.763 1.00 79.68  ?  60   VAL B C     1 
ATOM   1122  O  O     . VAL B 2  61   ? 195.725 196.482 195.493 1.00 71.38  ?  60   VAL B O     1 
ATOM   1123  C  CB    . VAL B 2  61   ? 193.924 199.189 195.087 1.00 111.46 ?  60   VAL B CB    1 
ATOM   1124  C  CG1   . VAL B 2  61   ? 193.041 197.976 195.419 1.00 136.99 ?  60   VAL B CG1   1 
ATOM   1125  C  CG2   . VAL B 2  61   ? 193.534 200.376 195.921 1.00 139.78 ?  60   VAL B CG2   1 
ATOM   1126  N  N     . PHE B 2  62   ? 195.819 197.395 193.442 1.00 87.94  ?  61   PHE B N     1 
ATOM   1127  C  CA    . PHE B 2  62   ? 195.894 196.114 192.791 1.00 116.39 ?  61   PHE B CA    1 
ATOM   1128  C  C     . PHE B 2  62   ? 197.225 195.413 193.083 1.00 118.49 ?  61   PHE B C     1 
ATOM   1129  O  O     . PHE B 2  62   ? 197.254 194.203 193.377 1.00 121.81 ?  61   PHE B O     1 
ATOM   1130  C  CB    . PHE B 2  62   ? 195.748 196.320 191.283 1.00 145.46 ?  61   PHE B CB    1 
ATOM   1131  C  CG    . PHE B 2  62   ? 195.909 195.061 190.488 1.00 222.35 ?  61   PHE B CG    1 
ATOM   1132  C  CD1   . PHE B 2  62   ? 194.824 194.227 190.301 1.00 230.20 ?  61   PHE B CD1   1 
ATOM   1133  C  CD2   . PHE B 2  62   ? 197.115 194.742 189.881 1.00 277.22 ?  61   PHE B CD2   1 
ATOM   1134  C  CE1   . PHE B 2  62   ? 194.929 193.154 189.425 1.00 231.00 ?  61   PHE B CE1   1 
ATOM   1135  C  CE2   . PHE B 2  62   ? 197.241 193.600 189.120 1.00 284.77 ?  61   PHE B CE2   1 
ATOM   1136  C  CZ    . PHE B 2  62   ? 196.151 192.805 188.894 1.00 273.18 ?  61   PHE B CZ    1 
ATOM   1137  N  N     . LEU B 2  63   ? 198.324 196.182 193.001 1.00 112.37 ?  62   LEU B N     1 
ATOM   1138  C  CA    . LEU B 2  63   ? 199.664 195.689 193.254 1.00 111.07 ?  62   LEU B CA    1 
ATOM   1139  C  C     . LEU B 2  63   ? 199.805 195.157 194.675 1.00 123.45 ?  62   LEU B C     1 
ATOM   1140  O  O     . LEU B 2  63   ? 200.375 194.074 194.890 1.00 127.86 ?  62   LEU B O     1 
ATOM   1141  C  CB    . LEU B 2  63   ? 200.655 196.837 193.087 1.00 110.17 ?  62   LEU B CB    1 
ATOM   1142  C  CG    . LEU B 2  63   ? 200.787 197.387 191.691 1.00 115.33 ?  62   LEU B CG    1 
ATOM   1143  C  CD1   . LEU B 2  63   ? 201.359 198.760 191.837 1.00 121.72 ?  62   LEU B CD1   1 
ATOM   1144  C  CD2   . LEU B 2  63   ? 201.739 196.548 190.861 1.00 127.51 ?  62   LEU B CD2   1 
ATOM   1145  N  N     . GLU B 2  64   ? 199.215 195.934 195.590 1.00 167.33 ?  63   GLU B N     1 
ATOM   1146  C  CA    . GLU B 2  64   ? 199.306 195.677 197.019 1.00 235.19 ?  63   GLU B CA    1 
ATOM   1147  C  C     . GLU B 2  64   ? 198.785 194.273 197.349 1.00 216.64 ?  63   GLU B C     1 
ATOM   1148  O  O     . GLU B 2  64   ? 199.448 193.494 198.117 1.00 311.22 ?  63   GLU B O     1 
ATOM   1149  C  CB    . GLU B 2  64   ? 198.506 196.748 197.775 1.00 250.53 ?  63   GLU B CB    1 
ATOM   1150  C  CG    . GLU B 2  64   ? 199.217 198.086 197.789 1.00 248.08 ?  63   GLU B CG    1 
ATOM   1151  C  CD    . GLU B 2  64   ? 198.745 199.332 198.536 1.00 165.10 ?  63   GLU B CD    1 
ATOM   1152  O  OE1   . GLU B 2  64   ? 197.553 199.601 198.693 1.00 139.44 ?  63   GLU B OE1   1 
ATOM   1153  O  OE2   . GLU B 2  64   ? 199.624 200.055 198.849 1.00 254.33 -1 63   GLU B OE2   1 
ATOM   1154  N  N     . ASN B 2  65   ? 197.601 193.976 196.788 1.00 170.03 ?  64   ASN B N     1 
ATOM   1155  C  CA    . ASN B 2  65   ? 196.835 192.782 197.114 1.00 180.99 ?  64   ASN B CA    1 
ATOM   1156  C  C     . ASN B 2  65   ? 197.523 191.523 196.550 1.00 212.37 ?  64   ASN B C     1 
ATOM   1157  O  O     . ASN B 2  65   ? 197.575 190.461 197.122 1.00 208.02 ?  64   ASN B O     1 
ATOM   1158  C  CB    . ASN B 2  65   ? 195.420 192.912 196.531 1.00 176.71 ?  64   ASN B CB    1 
ATOM   1159  C  CG    . ASN B 2  65   ? 194.589 193.893 197.360 1.00 179.82 ?  64   ASN B CG    1 
ATOM   1160  O  OD1   . ASN B 2  65   ? 194.293 193.602 198.525 1.00 282.14 ?  64   ASN B OD1   1 
ATOM   1161  N  ND2   . ASN B 2  65   ? 194.186 195.024 196.805 1.00 137.49 ?  64   ASN B ND2   1 
ATOM   1162  N  N     . VAL B 2  66   ? 197.966 191.665 195.305 1.00 206.27 ?  65   VAL B N     1 
ATOM   1163  C  CA    . VAL B 2  66   ? 198.671 190.638 194.579 1.00 195.12 ?  65   VAL B CA    1 
ATOM   1164  C  C     . VAL B 2  66   ? 200.025 190.366 195.271 1.00 161.09 ?  65   VAL B C     1 
ATOM   1165  O  O     . VAL B 2  66   ? 200.459 189.252 195.404 1.00 192.31 ?  65   VAL B O     1 
ATOM   1166  C  CB    . VAL B 2  66   ? 198.892 191.062 193.125 1.00 221.21 ?  65   VAL B CB    1 
ATOM   1167  C  CG1   . VAL B 2  66   ? 197.582 191.214 192.356 1.00 294.43 ?  65   VAL B CG1   1 
ATOM   1168  C  CG2   . VAL B 2  66   ? 199.633 192.377 193.084 1.00 210.48 ?  65   VAL B CG2   1 
ATOM   1169  N  N     . ILE B 2  67   ? 200.754 191.424 195.580 1.00 127.42 ?  66   ILE B N     1 
ATOM   1170  C  CA    . ILE B 2  67   ? 202.067 191.285 196.117 1.00 103.49 ?  66   ILE B CA    1 
ATOM   1171  C  C     . ILE B 2  67   ? 201.880 190.728 197.521 1.00 91.07  ?  66   ILE B C     1 
ATOM   1172  O  O     . ILE B 2  67   ? 202.669 190.014 198.021 1.00 57.31  ?  66   ILE B O     1 
ATOM   1173  C  CB    . ILE B 2  67   ? 202.771 192.653 196.184 1.00 129.96 ?  66   ILE B CB    1 
ATOM   1174  C  CG1   . ILE B 2  67   ? 201.988 193.604 197.076 1.00 233.87 ?  66   ILE B CG1   1 
ATOM   1175  C  CG2   . ILE B 2  67   ? 202.982 193.247 194.821 1.00 119.75 ?  66   ILE B CG2   1 
ATOM   1176  C  CD1   . ILE B 2  67   ? 202.632 193.914 198.382 1.00 302.51 ?  66   ILE B CD1   1 
ATOM   1177  N  N     . ARG B 2  68   ? 200.736 191.055 198.140 1.00 180.25 ?  67   ARG B N     1 
ATOM   1178  C  CA    . ARG B 2  68   ? 200.390 190.611 199.461 1.00 247.95 ?  67   ARG B CA    1 
ATOM   1179  C  C     . ARG B 2  68   ? 200.224 189.081 199.422 1.00 167.43 ?  67   ARG B C     1 
ATOM   1180  O  O     . ARG B 2  68   ? 200.600 188.401 200.346 1.00 136.52 ?  67   ARG B O     1 
ATOM   1181  C  CB    . ARG B 2  68   ? 199.125 191.348 199.953 1.00 305.39 ?  67   ARG B CB    1 
ATOM   1182  C  CG    . ARG B 2  68   ? 198.350 190.703 201.115 1.00 294.94 ?  67   ARG B CG    1 
ATOM   1183  C  CD    . ARG B 2  68   ? 199.055 190.854 202.445 1.00 268.56 ?  67   ARG B CD    1 
ATOM   1184  N  NE    . ARG B 2  68   ? 198.220 190.430 203.582 1.00 212.87 ?  67   ARG B NE    1 
ATOM   1185  C  CZ    . ARG B 2  68   ? 198.194 189.210 204.090 1.00 174.25 ?  67   ARG B CZ    1 
ATOM   1186  N  NH1   . ARG B 2  68   ? 199.014 188.257 203.661 1.00 179.56 1  67   ARG B NH1   1 
ATOM   1187  N  NH2   . ARG B 2  68   ? 197.411 188.966 205.140 1.00 126.93 ?  67   ARG B NH2   1 
ATOM   1188  N  N     . ASP B 2  69   ? 199.533 188.594 198.381 1.00 115.34 ?  68   ASP B N     1 
ATOM   1189  C  CA    . ASP B 2  69   ? 199.336 187.186 198.200 1.00 116.45 ?  68   ASP B CA    1 
ATOM   1190  C  C     . ASP B 2  69   ? 200.688 186.498 197.891 1.00 139.91 ?  68   ASP B C     1 
ATOM   1191  O  O     . ASP B 2  69   ? 200.971 185.388 198.358 1.00 168.86 ?  68   ASP B O     1 
ATOM   1192  C  CB    . ASP B 2  69   ? 198.333 186.957 197.041 1.00 137.62 ?  68   ASP B CB    1 
ATOM   1193  C  CG    . ASP B 2  69   ? 198.165 185.471 196.686 1.00 229.95 ?  68   ASP B CG    1 
ATOM   1194  O  OD1   . ASP B 2  69   ? 198.632 184.540 197.414 1.00 388.10 ?  68   ASP B OD1   1 
ATOM   1195  O  OD2   . ASP B 2  69   ? 197.645 185.213 195.606 1.00 129.55 -1 68   ASP B OD2   1 
ATOM   1196  N  N     . ALA B 2  70   ? 201.473 187.153 197.024 1.00 182.83 ?  69   ALA B N     1 
ATOM   1197  C  CA    . ALA B 2  70   ? 202.737 186.627 196.534 1.00 195.81 ?  69   ALA B CA    1 
ATOM   1198  C  C     . ALA B 2  70   ? 203.775 186.497 197.657 1.00 110.59 ?  69   ALA B C     1 
ATOM   1199  O  O     . ALA B 2  70   ? 204.568 185.518 197.756 1.00 91.32  ?  69   ALA B O     1 
ATOM   1200  C  CB    . ALA B 2  70   ? 203.325 187.369 195.348 1.00 262.72 ?  69   ALA B CB    1 
ATOM   1201  N  N     . VAL B 2  71   ? 203.841 187.511 198.475 1.00 83.03  ?  70   VAL B N     1 
ATOM   1202  C  CA    . VAL B 2  71   ? 204.931 187.600 199.389 1.00 98.17  ?  70   VAL B CA    1 
ATOM   1203  C  C     . VAL B 2  71   ? 204.840 186.465 200.377 1.00 101.51 ?  70   VAL B C     1 
ATOM   1204  O  O     . VAL B 2  71   ? 205.858 185.925 200.713 1.00 91.73  ?  70   VAL B O     1 
ATOM   1205  C  CB    . VAL B 2  71   ? 204.972 189.001 200.013 1.00 117.79 ?  70   VAL B CB    1 
ATOM   1206  C  CG1   . VAL B 2  71   ? 206.008 188.970 201.128 1.00 158.27 ?  70   VAL B CG1   1 
ATOM   1207  C  CG2   . VAL B 2  71   ? 205.251 190.057 198.934 1.00 98.80  ?  70   VAL B CG2   1 
ATOM   1208  N  N     . THR B 2  72   ? 203.664 186.255 200.954 1.00 115.73 ?  71   THR B N     1 
ATOM   1209  C  CA    . THR B 2  72   ? 203.418 185.143 201.914 1.00 145.28 ?  71   THR B CA    1 
ATOM   1210  C  C     . THR B 2  72   ? 203.991 183.773 201.501 1.00 170.29 ?  71   THR B C     1 
ATOM   1211  O  O     . THR B 2  72   ? 204.682 183.135 202.279 1.00 192.36 ?  71   THR B O     1 
ATOM   1212  C  CB    . THR B 2  72   ? 201.954 184.989 202.344 1.00 86.45  ?  71   THR B CB    1 
ATOM   1213  O  OG1   . THR B 2  72   ? 201.697 183.836 203.153 1.00 58.58  ?  71   THR B OG1   1 
ATOM   1214  C  CG2   . THR B 2  72   ? 201.049 184.658 201.212 1.00 86.22  ?  71   THR B CG2   1 
ATOM   1215  N  N     . TYR B 2  73   ? 203.734 183.333 200.258 1.00 142.28 ?  72   TYR B N     1 
ATOM   1216  C  CA    . TYR B 2  73   ? 204.238 182.061 199.813 1.00 119.66 ?  72   TYR B CA    1 
ATOM   1217  C  C     . TYR B 2  73   ? 205.792 182.093 199.904 1.00 113.12 ?  72   TYR B C     1 
ATOM   1218  O  O     . TYR B 2  73   ? 206.356 181.099 200.300 1.00 78.89  ?  72   TYR B O     1 
ATOM   1219  C  CB    . TYR B 2  73   ? 203.869 181.824 198.340 1.00 146.23 ?  72   TYR B CB    1 
ATOM   1220  C  CG    . TYR B 2  73   ? 202.385 181.761 198.020 1.00 180.44 ?  72   TYR B CG    1 
ATOM   1221  C  CD1   . TYR B 2  73   ? 201.648 182.883 197.660 1.00 226.92 ?  72   TYR B CD1   1 
ATOM   1222  C  CD2   . TYR B 2  73   ? 201.758 180.500 197.925 1.00 180.57 ?  72   TYR B CD2   1 
ATOM   1223  C  CE1   . TYR B 2  73   ? 200.364 182.720 197.103 1.00 231.98 ?  72   TYR B CE1   1 
ATOM   1224  C  CE2   . TYR B 2  73   ? 200.468 180.323 197.412 1.00 156.50 ?  72   TYR B CE2   1 
ATOM   1225  C  CZ    . TYR B 2  73   ? 199.770 181.451 196.992 1.00 180.85 ?  72   TYR B CZ    1 
ATOM   1226  O  OH    . TYR B 2  73   ? 198.491 181.345 196.538 1.00 155.96 ?  72   TYR B OH    1 
ATOM   1227  N  N     . THR B 2  74   ? 206.419 183.219 199.474 1.00 125.54 ?  73   THR B N     1 
ATOM   1228  C  CA    . THR B 2  74   ? 207.810 183.376 199.405 1.00 111.35 ?  73   THR B CA    1 
ATOM   1229  C  C     . THR B 2  74   ? 208.351 183.225 200.826 1.00 144.59 ?  73   THR B C     1 
ATOM   1230  O  O     . THR B 2  74   ? 209.397 182.547 201.137 1.00 258.33 ?  73   THR B O     1 
ATOM   1231  C  CB    . THR B 2  74   ? 208.336 184.721 198.895 1.00 76.57  ?  73   THR B CB    1 
ATOM   1232  O  OG1   . THR B 2  74   ? 207.931 184.907 197.531 1.00 65.21  ?  73   THR B OG1   1 
ATOM   1233  C  CG2   . THR B 2  74   ? 209.886 184.694 199.042 1.00 89.55  ?  73   THR B CG2   1 
ATOM   1234  N  N     . GLU B 2  75   ? 207.683 183.892 201.770 1.00 163.07 ?  74   GLU B N     1 
ATOM   1235  C  CA    . GLU B 2  75   ? 208.018 183.754 203.195 1.00 218.80 ?  74   GLU B CA    1 
ATOM   1236  C  C     . GLU B 2  75   ? 207.742 182.290 203.578 1.00 166.78 ?  74   GLU B C     1 
ATOM   1237  O  O     . GLU B 2  75   ? 208.524 181.649 204.336 1.00 263.75 ?  74   GLU B O     1 
ATOM   1238  C  CB    . GLU B 2  75   ? 207.192 184.754 204.016 1.00 297.32 ?  74   GLU B CB    1 
ATOM   1239  C  CG    . GLU B 2  75   ? 207.574 184.823 205.464 1.00 371.13 ?  74   GLU B CG    1 
ATOM   1240  C  CD    . GLU B 2  75   ? 207.371 183.558 206.265 1.00 420.07 ?  74   GLU B CD    1 
ATOM   1241  O  OE1   . GLU B 2  75   ? 206.470 182.718 205.946 1.00 437.96 ?  74   GLU B OE1   1 
ATOM   1242  O  OE2   . GLU B 2  75   ? 208.167 183.416 207.147 1.00 393.96 -1 74   GLU B OE2   1 
ATOM   1243  N  N     . HIS B 2  76   ? 206.626 181.772 203.070 1.00 98.17  ?  75   HIS B N     1 
ATOM   1244  C  CA    . HIS B 2  76   ? 206.323 180.442 203.407 1.00 98.44  ?  75   HIS B CA    1 
ATOM   1245  C  C     . HIS B 2  76   ? 207.536 179.577 203.025 1.00 141.04 ?  75   HIS B C     1 
ATOM   1246  O  O     . HIS B 2  76   ? 208.041 178.698 203.719 1.00 167.60 ?  75   HIS B O     1 
ATOM   1247  C  CB    . HIS B 2  76   ? 204.973 179.974 202.883 1.00 88.71  ?  75   HIS B CB    1 
ATOM   1248  C  CG    . HIS B 2  76   ? 204.654 178.730 203.665 1.00 114.69 ?  75   HIS B CG    1 
ATOM   1249  N  ND1   . HIS B 2  76   ? 204.767 178.652 205.087 1.00 112.11 ?  75   HIS B ND1   1 
ATOM   1250  C  CD2   . HIS B 2  76   ? 204.459 177.455 203.254 1.00 123.37 ?  75   HIS B CD2   1 
ATOM   1251  C  CE1   . HIS B 2  76   ? 204.648 177.403 205.455 1.00 108.37 ?  75   HIS B CE1   1 
ATOM   1252  N  NE2   . HIS B 2  76   ? 204.510 176.645 204.362 1.00 113.99 ?  75   HIS B NE2   1 
ATOM   1253  N  N     . ALA B 2  77   ? 208.129 179.911 201.898 1.00 201.46 ?  76   ALA B N     1 
ATOM   1254  C  CA    . ALA B 2  77   ? 209.242 179.121 201.341 1.00 291.46 ?  76   ALA B CA    1 
ATOM   1255  C  C     . ALA B 2  77   ? 210.605 179.341 201.953 1.00 246.56 ?  76   ALA B C     1 
ATOM   1256  O  O     . ALA B 2  77   ? 211.496 178.681 201.412 1.00 194.24 ?  76   ALA B O     1 
ATOM   1257  C  CB    . ALA B 2  77   ? 209.312 179.451 199.867 1.00 412.75 ?  76   ALA B CB    1 
ATOM   1258  N  N     . LYS B 2  78   ? 210.693 180.135 203.021 1.00 210.91 ?  77   LYS B N     1 
ATOM   1259  C  CA    . LYS B 2  78   ? 211.932 180.314 203.776 1.00 153.80 ?  77   LYS B CA    1 
ATOM   1260  C  C     . LYS B 2  78   ? 212.932 181.045 202.872 1.00 108.64 ?  77   LYS B C     1 
ATOM   1261  O  O     . LYS B 2  78   ? 214.062 180.620 202.692 1.00 123.91 ?  77   LYS B O     1 
ATOM   1262  C  CB    . LYS B 2  78   ? 212.489 178.940 204.233 1.00 185.58 ?  77   LYS B CB    1 
ATOM   1263  C  CG    . LYS B 2  78   ? 211.753 178.205 205.319 1.00 226.22 ?  77   LYS B CG    1 
ATOM   1264  C  CD    . LYS B 2  78   ? 211.478 176.679 205.017 1.00 247.32 ?  77   LYS B CD    1 
ATOM   1265  C  CE    . LYS B 2  78   ? 211.031 175.932 206.218 1.00 279.75 ?  77   LYS B CE    1 
ATOM   1266  N  NZ    . LYS B 2  78   ? 210.512 174.586 205.840 1.00 262.44 1  77   LYS B NZ    1 
ATOM   1267  N  N     . ARG B 2  79   ? 212.484 182.075 202.206 1.00 94.53  ?  78   ARG B N     1 
ATOM   1268  C  CA    . ARG B 2  79   ? 213.350 182.741 201.259 1.00 95.17  ?  78   ARG B CA    1 
ATOM   1269  C  C     . ARG B 2  79   ? 212.892 184.159 201.160 1.00 97.68  ?  78   ARG B C     1 
ATOM   1270  O  O     . ARG B 2  79   ? 211.668 184.509 201.526 1.00 221.31 ?  78   ARG B O     1 
ATOM   1271  C  CB    . ARG B 2  79   ? 213.191 182.249 199.803 1.00 113.24 ?  78   ARG B CB    1 
ATOM   1272  C  CG    . ARG B 2  79   ? 213.202 180.756 199.573 1.00 195.54 ?  78   ARG B CG    1 
ATOM   1273  C  CD    . ARG B 2  79   ? 212.641 180.488 198.153 1.00 224.39 ?  78   ARG B CD    1 
ATOM   1274  N  NE    . ARG B 2  79   ? 211.243 180.904 197.882 1.00 174.64 ?  78   ARG B NE    1 
ATOM   1275  C  CZ    . ARG B 2  79   ? 210.522 180.482 196.831 1.00 147.74 ?  78   ARG B CZ    1 
ATOM   1276  N  NH1   . ARG B 2  79   ? 211.029 179.711 195.893 1.00 186.16 1  78   ARG B NH1   1 
ATOM   1277  N  NH2   . ARG B 2  79   ? 209.236 180.603 196.786 1.00 122.33 ?  78   ARG B NH2   1 
ATOM   1278  N  N     . LYS B 2  80   ? 213.789 184.937 200.526 1.00 82.83  ?  79   LYS B N     1 
ATOM   1279  C  CA    . LYS B 2  80   ? 213.543 186.326 200.335 1.00 101.75 ?  79   LYS B CA    1 
ATOM   1280  C  C     . LYS B 2  80   ? 213.363 186.554 198.896 1.00 92.21  ?  79   LYS B C     1 
ATOM   1281  O  O     . LYS B 2  80   ? 212.384 187.212 198.478 1.00 183.34 ?  79   LYS B O     1 
ATOM   1282  C  CB    . LYS B 2  80   ? 214.683 187.168 200.874 1.00 120.14 ?  79   LYS B CB    1 
ATOM   1283  C  CG    . LYS B 2  80   ? 214.698 187.009 202.411 1.00 208.83 ?  79   LYS B CG    1 
ATOM   1284  C  CD    . LYS B 2  80   ? 215.770 187.727 203.331 1.00 317.71 ?  79   LYS B CD    1 
ATOM   1285  C  CE    . LYS B 2  80   ? 215.607 187.465 204.823 1.00 350.40 ?  79   LYS B CE    1 
ATOM   1286  N  NZ    . LYS B 2  80   ? 216.620 188.112 205.703 1.00 331.63 1  79   LYS B NZ    1 
ATOM   1287  N  N     . THR B 2  81   ? 214.339 186.121 198.152 1.00 76.37  ?  80   THR B N     1 
ATOM   1288  C  CA    . THR B 2  81   ? 214.216 186.447 196.773 1.00 109.64 ?  80   THR B CA    1 
ATOM   1289  C  C     . THR B 2  81   ? 212.961 185.775 196.146 1.00 136.34 ?  80   THR B C     1 
ATOM   1290  O  O     . THR B 2  81   ? 212.963 184.949 195.279 1.00 168.63 ?  80   THR B O     1 
ATOM   1291  C  CB    . THR B 2  81   ? 215.534 186.251 196.019 1.00 183.52 ?  80   THR B CB    1 
ATOM   1292  O  OG1   . THR B 2  81   ? 216.552 186.989 196.690 1.00 156.22 ?  80   THR B OG1   1 
ATOM   1293  C  CG2   . THR B 2  81   ? 215.452 186.697 194.567 1.00 264.76 ?  80   THR B CG2   1 
ATOM   1294  N  N     . VAL B 2  82   ? 211.812 186.336 196.520 1.00 155.84 ?  81   VAL B N     1 
ATOM   1295  C  CA    . VAL B 2  82   ? 210.490 186.165 195.909 1.00 120.67 ?  81   VAL B CA    1 
ATOM   1296  C  C     . VAL B 2  82   ? 210.641 185.947 194.414 1.00 134.35 ?  81   VAL B C     1 
ATOM   1297  O  O     . VAL B 2  82   ? 211.285 186.728 193.668 1.00 117.37 ?  81   VAL B O     1 
ATOM   1298  C  CB    . VAL B 2  82   ? 209.577 187.407 196.128 1.00 101.91 ?  81   VAL B CB    1 
ATOM   1299  C  CG1   . VAL B 2  82   ? 208.377 187.404 195.240 1.00 96.79  ?  81   VAL B CG1   1 
ATOM   1300  C  CG2   . VAL B 2  82   ? 209.106 187.564 197.554 1.00 103.66 ?  81   VAL B CG2   1 
ATOM   1301  N  N     . THR B 2  83   ? 210.018 184.859 193.952 1.00 169.31 ?  82   THR B N     1 
ATOM   1302  C  CA    . THR B 2  83   ? 210.130 184.439 192.519 1.00 219.43 ?  82   THR B CA    1 
ATOM   1303  C  C     . THR B 2  83   ? 209.078 185.048 191.528 1.00 217.14 ?  82   THR B C     1 
ATOM   1304  O  O     . THR B 2  83   ? 207.919 185.485 191.881 1.00 310.79 ?  82   THR B O     1 
ATOM   1305  C  CB    . THR B 2  83   ? 210.120 182.901 192.480 1.00 215.68 ?  82   THR B CB    1 
ATOM   1306  O  OG1   . THR B 2  83   ? 211.120 182.406 193.358 1.00 145.08 ?  82   THR B OG1   1 
ATOM   1307  C  CG2   . THR B 2  83   ? 210.426 182.358 191.106 1.00 267.69 ?  82   THR B CG2   1 
ATOM   1308  N  N     . ALA B 2  84   ? 209.416 185.092 190.242 1.00 121.33 ?  83   ALA B N     1 
ATOM   1309  C  CA    . ALA B 2  84   ? 208.370 185.374 189.260 1.00 78.27  ?  83   ALA B CA    1 
ATOM   1310  C  C     . ALA B 2  84   ? 207.212 184.429 189.499 1.00 109.12 ?  83   ALA B C     1 
ATOM   1311  O  O     . ALA B 2  84   ? 206.041 184.789 189.403 1.00 170.68 ?  83   ALA B O     1 
ATOM   1312  C  CB    . ALA B 2  84   ? 208.859 185.282 187.845 1.00 61.26  ?  83   ALA B CB    1 
ATOM   1313  N  N     . MET B 2  85   ? 207.530 183.177 189.838 1.00 147.15 ?  84   MET B N     1 
ATOM   1314  C  CA    . MET B 2  85   ? 206.546 182.096 189.987 1.00 165.74 ?  84   MET B CA    1 
ATOM   1315  C  C     . MET B 2  85   ? 205.392 182.470 190.959 1.00 144.57 ?  84   MET B C     1 
ATOM   1316  O  O     . MET B 2  85   ? 204.260 182.113 190.770 1.00 97.04  ?  84   MET B O     1 
ATOM   1317  C  CB    . MET B 2  85   ? 207.200 180.839 190.530 1.00 183.00 ?  84   MET B CB    1 
ATOM   1318  C  CG    . MET B 2  85   ? 207.886 180.007 189.463 1.00 212.18 ?  84   MET B CG    1 
ATOM   1319  S  SD    . MET B 2  85   ? 206.911 178.559 189.150 1.00 259.59 ?  84   MET B SD    1 
ATOM   1320  C  CE    . MET B 2  85   ? 206.529 178.143 190.850 1.00 191.41 ?  84   MET B CE    1 
ATOM   1321  N  N     . ASP B 2  86   ? 205.751 183.073 192.104 1.00 145.71 ?  85   ASP B N     1 
ATOM   1322  C  CA    . ASP B 2  86   ? 204.780 183.571 192.984 1.00 144.00 ?  85   ASP B CA    1 
ATOM   1323  C  C     . ASP B 2  86   ? 203.947 184.689 192.388 1.00 105.19 ?  85   ASP B C     1 
ATOM   1324  O  O     . ASP B 2  86   ? 202.775 184.632 192.656 1.00 115.49 ?  85   ASP B O     1 
ATOM   1325  C  CB    . ASP B 2  86   ? 205.460 183.877 194.340 1.00 205.36 ?  85   ASP B CB    1 
ATOM   1326  C  CG    . ASP B 2  86   ? 205.941 182.689 195.157 1.00 204.74 ?  85   ASP B CG    1 
ATOM   1327  O  OD1   . ASP B 2  86   ? 205.909 181.509 194.789 1.00 126.27 ?  85   ASP B OD1   1 
ATOM   1328  O  OD2   . ASP B 2  86   ? 206.320 183.078 196.249 1.00 129.14 -1 85   ASP B OD2   1 
ATOM   1329  N  N     . VAL B 2  87   ? 204.550 185.668 191.688 1.00 83.39  ?  86   VAL B N     1 
ATOM   1330  C  CA    . VAL B 2  87   ? 203.837 186.780 191.110 1.00 66.56  ?  86   VAL B CA    1 
ATOM   1331  C  C     . VAL B 2  87   ? 202.532 186.245 190.507 1.00 73.78  ?  86   VAL B C     1 
ATOM   1332  O  O     . VAL B 2  87   ? 201.452 186.788 190.638 1.00 67.47  ?  86   VAL B O     1 
ATOM   1333  C  CB    . VAL B 2  87   ? 204.601 187.515 189.988 1.00 49.70  ?  86   VAL B CB    1 
ATOM   1334  C  CG1   . VAL B 2  87   ? 203.685 188.414 189.146 1.00 33.84  ?  86   VAL B CG1   1 
ATOM   1335  C  CG2   . VAL B 2  87   ? 205.776 188.286 190.530 1.00 51.19  ?  86   VAL B CG2   1 
ATOM   1336  N  N     . VAL B 2  88   ? 202.721 185.186 189.700 1.00 77.33  ?  87   VAL B N     1 
ATOM   1337  C  CA    . VAL B 2  88   ? 201.721 184.527 188.889 1.00 76.55  ?  87   VAL B CA    1 
ATOM   1338  C  C     . VAL B 2  88   ? 200.681 183.771 189.721 1.00 69.04  ?  87   VAL B C     1 
ATOM   1339  O  O     . VAL B 2  88   ? 199.474 183.912 189.412 1.00 144.94 ?  87   VAL B O     1 
ATOM   1340  C  CB    . VAL B 2  88   ? 202.398 183.591 187.878 1.00 101.38 ?  87   VAL B CB    1 
ATOM   1341  C  CG1   . VAL B 2  88   ? 201.541 182.365 187.425 1.00 107.80 ?  87   VAL B CG1   1 
ATOM   1342  C  CG2   . VAL B 2  88   ? 202.964 184.562 186.791 1.00 118.27 ?  87   VAL B CG2   1 
ATOM   1343  N  N     . TYR B 2  89   ? 201.117 182.831 190.581 1.00 51.59  ?  88   TYR B N     1 
ATOM   1344  C  CA    . TYR B 2  89   ? 200.116 182.078 191.296 1.00 62.91  ?  88   TYR B CA    1 
ATOM   1345  C  C     . TYR B 2  89   ? 199.235 183.087 192.047 1.00 78.41  ?  88   TYR B C     1 
ATOM   1346  O  O     . TYR B 2  89   ? 198.005 182.943 192.208 1.00 90.60  ?  88   TYR B O     1 
ATOM   1347  C  CB    . TYR B 2  89   ? 200.725 181.260 192.386 1.00 63.60  ?  88   TYR B CB    1 
ATOM   1348  C  CG    . TYR B 2  89   ? 201.708 180.232 191.915 1.00 71.64  ?  88   TYR B CG    1 
ATOM   1349  C  CD1   . TYR B 2  89   ? 201.503 179.411 190.850 1.00 67.27  ?  88   TYR B CD1   1 
ATOM   1350  C  CD2   . TYR B 2  89   ? 202.812 180.006 192.704 1.00 125.40 ?  88   TYR B CD2   1 
ATOM   1351  C  CE1   . TYR B 2  89   ? 202.381 178.360 190.623 1.00 122.61 ?  88   TYR B CE1   1 
ATOM   1352  C  CE2   . TYR B 2  89   ? 203.754 179.009 192.455 1.00 126.79 ?  88   TYR B CE2   1 
ATOM   1353  C  CZ    . TYR B 2  89   ? 203.467 178.111 191.465 1.00 144.22 ?  88   TYR B CZ    1 
ATOM   1354  O  OH    . TYR B 2  89   ? 204.363 177.102 191.227 1.00 142.35 ?  88   TYR B OH    1 
ATOM   1355  N  N     . ALA B 2  90   ? 199.930 184.082 192.585 1.00 90.72  ?  89   ALA B N     1 
ATOM   1356  C  CA    . ALA B 2  90   ? 199.255 185.110 193.320 1.00 121.60 ?  89   ALA B CA    1 
ATOM   1357  C  C     . ALA B 2  90   ? 198.249 185.791 192.402 1.00 97.73  ?  89   ALA B C     1 
ATOM   1358  O  O     . ALA B 2  90   ? 197.143 186.094 192.804 1.00 116.55 ?  89   ALA B O     1 
ATOM   1359  C  CB    . ALA B 2  90   ? 200.267 186.131 193.772 1.00 250.69 ?  89   ALA B CB    1 
ATOM   1360  N  N     . LEU B 2  91   ? 198.612 185.960 191.125 1.00 68.92  ?  90   LEU B N     1 
ATOM   1361  C  CA    . LEU B 2  91   ? 197.661 186.500 190.197 1.00 61.08  ?  90   LEU B CA    1 
ATOM   1362  C  C     . LEU B 2  91   ? 196.509 185.511 189.978 1.00 79.15  ?  90   LEU B C     1 
ATOM   1363  O  O     . LEU B 2  91   ? 195.378 185.986 189.841 1.00 93.36  ?  90   LEU B O     1 
ATOM   1364  C  CB    . LEU B 2  91   ? 198.416 186.894 188.931 1.00 55.69  ?  90   LEU B CB    1 
ATOM   1365  C  CG    . LEU B 2  91   ? 198.982 188.306 188.938 1.00 54.17  ?  90   LEU B CG    1 
ATOM   1366  C  CD1   . LEU B 2  91   ? 199.458 188.690 187.567 1.00 63.29  ?  90   LEU B CD1   1 
ATOM   1367  C  CD2   . LEU B 2  91   ? 197.908 189.247 189.243 1.00 50.07  ?  90   LEU B CD2   1 
ATOM   1368  N  N     . LYS B 2  92   ? 196.795 184.194 189.898 1.00 120.17 ?  91   LYS B N     1 
ATOM   1369  C  CA    . LYS B 2  92   ? 195.780 183.212 189.682 1.00 139.05 ?  91   LYS B CA    1 
ATOM   1370  C  C     . LYS B 2  92   ? 194.744 183.214 190.808 1.00 144.32 ?  91   LYS B C     1 
ATOM   1371  O  O     . LYS B 2  92   ? 193.590 182.771 190.653 1.00 149.30 ?  91   LYS B O     1 
ATOM   1372  C  CB    . LYS B 2  92   ? 196.374 181.813 189.522 1.00 188.18 ?  91   LYS B CB    1 
ATOM   1373  C  CG    . LYS B 2  92   ? 195.428 180.612 189.642 1.00 179.40 ?  91   LYS B CG    1 
ATOM   1374  C  CD    . LYS B 2  92   ? 196.049 179.423 190.406 1.00 193.63 ?  91   LYS B CD    1 
ATOM   1375  C  CE    . LYS B 2  92   ? 195.876 179.410 191.927 1.00 173.43 ?  91   LYS B CE    1 
ATOM   1376  N  NZ    . LYS B 2  92   ? 194.459 179.473 192.275 1.00 158.98 1  91   LYS B NZ    1 
ATOM   1377  N  N     . ARG B 2  93   ? 195.142 183.640 192.002 1.00 159.60 ?  92   ARG B N     1 
ATOM   1378  C  CA    . ARG B 2  93   ? 194.280 183.671 193.142 1.00 168.51 ?  92   ARG B CA    1 
ATOM   1379  C  C     . ARG B 2  93   ? 193.215 184.763 193.057 1.00 212.42 ?  92   ARG B C     1 
ATOM   1380  O  O     . ARG B 2  93   ? 192.008 184.425 192.990 1.00 237.89 ?  92   ARG B O     1 
ATOM   1381  C  CB    . ARG B 2  93   ? 195.123 183.854 194.388 1.00 177.96 ?  92   ARG B CB    1 
ATOM   1382  C  CG    . ARG B 2  93   ? 194.326 183.681 195.659 1.00 187.68 ?  92   ARG B CG    1 
ATOM   1383  C  CD    . ARG B 2  93   ? 193.742 182.290 195.701 1.00 168.52 ?  92   ARG B CD    1 
ATOM   1384  N  NE    . ARG B 2  93   ? 192.306 182.218 195.424 1.00 245.92 ?  92   ARG B NE    1 
ATOM   1385  C  CZ    . ARG B 2  93   ? 191.676 181.113 195.093 1.00 289.94 ?  92   ARG B CZ    1 
ATOM   1386  N  NH1   . ARG B 2  93   ? 192.228 179.928 195.369 1.00 252.34 1  92   ARG B NH1   1 
ATOM   1387  N  NH2   . ARG B 2  93   ? 190.403 181.107 194.716 1.00 352.49 ?  92   ARG B NH2   1 
ATOM   1388  N  N     . GLN B 2  94   ? 193.677 186.023 193.007 1.00 209.96 ?  93   GLN B N     1 
ATOM   1389  C  CA    . GLN B 2  94   ? 192.797 187.164 192.741 1.00 185.89 ?  93   GLN B CA    1 
ATOM   1390  C  C     . GLN B 2  94   ? 191.835 186.932 191.548 1.00 189.06 ?  93   GLN B C     1 
ATOM   1391  O  O     . GLN B 2  94   ? 190.780 187.610 191.441 1.00 201.35 ?  93   GLN B O     1 
ATOM   1392  C  CB    . GLN B 2  94   ? 193.673 188.386 192.510 1.00 143.11 ?  93   GLN B CB    1 
ATOM   1393  C  CG    . GLN B 2  94   ? 193.054 189.714 192.845 1.00 176.53 ?  93   GLN B CG    1 
ATOM   1394  C  CD    . GLN B 2  94   ? 193.618 190.868 192.097 1.00 145.75 ?  93   GLN B CD    1 
ATOM   1395  O  OE1   . GLN B 2  94   ? 194.518 191.441 192.717 1.00 201.52 ?  93   GLN B OE1   1 
ATOM   1396  N  NE2   . GLN B 2  94   ? 192.999 191.279 190.990 1.00 88.82  ?  93   GLN B NE2   1 
ATOM   1397  N  N     . GLY B 2  95   ? 192.209 186.041 190.641 1.00 181.12 ?  94   GLY B N     1 
ATOM   1398  C  CA    . GLY B 2  95   ? 191.428 185.701 189.497 1.00 152.19 ?  94   GLY B CA    1 
ATOM   1399  C  C     . GLY B 2  95   ? 191.881 186.390 188.206 1.00 124.78 ?  94   GLY B C     1 
ATOM   1400  O  O     . GLY B 2  95   ? 191.031 186.693 187.360 1.00 123.48 ?  94   GLY B O     1 
ATOM   1401  N  N     . ARG B 2  96   ? 193.183 186.637 188.097 1.00 134.19 ?  95   ARG B N     1 
ATOM   1402  C  CA    . ARG B 2  96   ? 193.786 187.098 186.869 1.00 146.14 ?  95   ARG B CA    1 
ATOM   1403  C  C     . ARG B 2  96   ? 194.924 186.173 186.371 1.00 157.01 ?  95   ARG B C     1 
ATOM   1404  O  O     . ARG B 2  96   ? 196.095 186.583 186.455 1.00 129.31 ?  95   ARG B O     1 
ATOM   1405  C  CB    . ARG B 2  96   ? 194.158 188.574 187.035 1.00 133.84 ?  95   ARG B CB    1 
ATOM   1406  C  CG    . ARG B 2  96   ? 192.950 189.523 186.883 1.00 117.09 ?  95   ARG B CG    1 
ATOM   1407  C  CD    . ARG B 2  96   ? 193.057 191.011 186.874 1.00 104.97 ?  95   ARG B CD    1 
ATOM   1408  N  NE    . ARG B 2  96   ? 193.845 191.514 185.749 1.00 110.20 ?  95   ARG B NE    1 
ATOM   1409  C  CZ    . ARG B 2  96   ? 193.376 191.618 184.512 1.00 100.38 ?  95   ARG B CZ    1 
ATOM   1410  N  NH1   . ARG B 2  96   ? 192.147 191.199 184.288 1.00 112.06 1  95   ARG B NH1   1 
ATOM   1411  N  NH2   . ARG B 2  96   ? 194.078 192.145 183.511 1.00 84.02  ?  95   ARG B NH2   1 
ATOM   1412  N  N     . THR B 2  97   ? 194.523 184.969 185.936 1.00 189.89 ?  96   THR B N     1 
ATOM   1413  C  CA    . THR B 2  97   ? 195.438 183.974 185.377 1.00 169.59 ?  96   THR B CA    1 
ATOM   1414  C  C     . THR B 2  97   ? 196.207 184.535 184.181 1.00 175.90 ?  96   THR B C     1 
ATOM   1415  O  O     . THR B 2  97   ? 195.705 185.345 183.371 1.00 143.09 ?  96   THR B O     1 
ATOM   1416  C  CB    . THR B 2  97   ? 194.708 182.682 184.992 1.00 148.01 ?  96   THR B CB    1 
ATOM   1417  O  OG1   . THR B 2  97   ? 194.333 182.033 186.194 1.00 107.74 ?  96   THR B OG1   1 
ATOM   1418  C  CG2   . THR B 2  97   ? 195.620 181.769 184.191 1.00 147.59 ?  96   THR B CG2   1 
ATOM   1419  N  N     . LEU B 2  98   ? 197.482 184.159 184.111 1.00 167.26 ?  97   LEU B N     1 
ATOM   1420  C  CA    . LEU B 2  98   ? 198.378 184.633 183.048 1.00 178.31 ?  97   LEU B CA    1 
ATOM   1421  C  C     . LEU B 2  98   ? 199.020 183.481 182.274 1.00 173.54 ?  97   LEU B C     1 
ATOM   1422  O  O     . LEU B 2  98   ? 199.422 182.448 182.859 1.00 99.96  ?  97   LEU B O     1 
ATOM   1423  C  CB    . LEU B 2  98   ? 199.462 185.462 183.726 1.00 163.03 ?  97   LEU B CB    1 
ATOM   1424  C  CG    . LEU B 2  98   ? 199.202 186.797 184.473 1.00 136.46 ?  97   LEU B CG    1 
ATOM   1425  C  CD1   . LEU B 2  98   ? 200.386 187.367 185.178 1.00 124.42 ?  97   LEU B CD1   1 
ATOM   1426  C  CD2   . LEU B 2  98   ? 198.612 187.898 183.561 1.00 119.44 ?  97   LEU B CD2   1 
ATOM   1427  N  N     . TYR B 2  99   ? 199.045 183.652 180.945 1.00 177.16 ?  98   TYR B N     1 
ATOM   1428  C  CA    . TYR B 2  99   ? 199.654 182.656 180.048 1.00 135.96 ?  98   TYR B CA    1 
ATOM   1429  C  C     . TYR B 2  99   ? 200.954 183.221 179.528 1.00 112.87 ?  98   TYR B C     1 
ATOM   1430  O  O     . TYR B 2  99   ? 200.779 184.149 178.765 1.00 70.25  ?  98   TYR B O     1 
ATOM   1431  C  CB    . TYR B 2  99   ? 198.660 182.274 178.935 1.00 123.06 ?  98   TYR B CB    1 
ATOM   1432  C  CG    . TYR B 2  99   ? 197.802 181.091 179.341 1.00 197.86 ?  98   TYR B CG    1 
ATOM   1433  C  CD1   . TYR B 2  99   ? 198.264 179.794 179.179 1.00 217.85 ?  98   TYR B CD1   1 
ATOM   1434  C  CD2   . TYR B 2  99   ? 196.555 181.251 179.922 1.00 239.10 ?  98   TYR B CD2   1 
ATOM   1435  C  CE1   . TYR B 2  99   ? 197.506 178.699 179.569 1.00 175.67 ?  98   TYR B CE1   1 
ATOM   1436  C  CE2   . TYR B 2  99   ? 195.806 180.167 180.337 1.00 188.68 ?  98   TYR B CE2   1 
ATOM   1437  C  CZ    . TYR B 2  99   ? 196.258 178.875 180.124 1.00 132.23 ?  98   TYR B CZ    1 
ATOM   1438  O  OH    . TYR B 2  99   ? 195.505 177.814 180.433 1.00 77.18  ?  98   TYR B OH    1 
ATOM   1439  N  N     . GLY B 2  100  ? 202.130 182.571 179.762 1.00 156.77 ?  99   GLY B N     1 
ATOM   1440  C  CA    . GLY B 2  100  ? 203.321 183.209 179.351 1.00 198.94 ?  99   GLY B CA    1 
ATOM   1441  C  C     . GLY B 2  100  ? 204.631 182.862 180.073 1.00 171.34 ?  99   GLY B C     1 
ATOM   1442  O  O     . GLY B 2  100  ? 205.707 182.862 179.414 1.00 166.79 ?  99   GLY B O     1 
ATOM   1443  N  N     . PHE B 2  101  ? 204.688 182.747 181.406 1.00 105.02 ?  100  PHE B N     1 
ATOM   1444  C  CA    . PHE B 2  101  ? 205.983 182.849 182.031 1.00 76.98  ?  100  PHE B CA    1 
ATOM   1445  C  C     . PHE B 2  101  ? 206.230 181.805 183.080 1.00 62.35  ?  100  PHE B C     1 
ATOM   1446  O  O     . PHE B 2  101  ? 207.238 181.931 183.736 1.00 61.37  ?  100  PHE B O     1 
ATOM   1447  C  CB    . PHE B 2  101  ? 206.239 184.191 182.720 1.00 74.02  ?  100  PHE B CB    1 
ATOM   1448  C  CG    . PHE B 2  101  ? 206.413 185.336 181.742 1.00 108.70 ?  100  PHE B CG    1 
ATOM   1449  C  CD1   . PHE B 2  101  ? 206.832 185.116 180.430 1.00 167.42 ?  100  PHE B CD1   1 
ATOM   1450  C  CD2   . PHE B 2  101  ? 206.164 186.659 182.102 1.00 121.81 ?  100  PHE B CD2   1 
ATOM   1451  C  CE1   . PHE B 2  101  ? 206.943 186.166 179.513 1.00 196.54 ?  100  PHE B CE1   1 
ATOM   1452  C  CE2   . PHE B 2  101  ? 206.278 187.720 181.188 1.00 128.68 ?  100  PHE B CE2   1 
ATOM   1453  C  CZ    . PHE B 2  101  ? 206.666 187.475 179.889 1.00 162.22 ?  100  PHE B CZ    1 
ATOM   1454  N  N     . GLY B 2  102  ? 205.387 180.783 183.169 1.00 62.77  ?  101  GLY B N     1 
ATOM   1455  C  CA    . GLY B 2  102  ? 205.382 180.099 184.460 1.00 81.85  ?  101  GLY B CA    1 
ATOM   1456  C  C     . GLY B 2  102  ? 205.347 178.594 184.462 1.00 108.89 ?  101  GLY B C     1 
ATOM   1457  O  O     . GLY B 2  102  ? 204.646 178.095 183.711 1.00 120.48 ?  101  GLY B O     1 
ATOM   1458  N  N     . GLY B 2  103  ? 205.940 178.000 185.506 1.00 169.18 ?  102  GLY B N     1 
ATOM   1459  C  CA    . GLY B 2  103  ? 205.943 176.534 185.745 1.00 206.27 ?  102  GLY B CA    1 
ATOM   1460  C  C     . GLY B 2  103  ? 206.819 175.742 184.781 1.00 196.68 ?  102  GLY B C     1 
ATOM   1461  O  O     . GLY B 2  103  ? 206.734 174.499 184.736 1.00 153.66 ?  102  GLY B O     1 
ATOM   1462  O  OXT   . GLY B 2  103  ? 207.636 176.335 184.068 1.00 174.57 -1 102  GLY B OXT   1 
ATOM   1463  N  N     . THR C 3  17   ? 189.500 165.590 225.653 1.00 125.56 ?  16   THR C N     1 
ATOM   1464  C  CA    . THR C 3  17   ? 189.187 164.917 224.333 1.00 137.90 ?  16   THR C CA    1 
ATOM   1465  C  C     . THR C 3  17   ? 188.786 166.008 223.314 1.00 114.04 ?  16   THR C C     1 
ATOM   1466  O  O     . THR C 3  17   ? 187.771 166.653 223.393 1.00 94.10  ?  16   THR C O     1 
ATOM   1467  C  CB    . THR C 3  17   ? 188.128 163.800 224.356 1.00 129.07 ?  16   THR C CB    1 
ATOM   1468  O  OG1   . THR C 3  17   ? 186.956 164.434 224.842 1.00 143.50 ?  16   THR C OG1   1 
ATOM   1469  C  CG2   . THR C 3  17   ? 188.485 162.605 225.209 1.00 112.51 ?  16   THR C CG2   1 
ATOM   1470  N  N     . ARG C 3  18   ? 189.710 166.285 222.405 1.00 131.85 ?  17   ARG C N     1 
ATOM   1471  C  CA    . ARG C 3  18   ? 189.587 167.210 221.298 1.00 149.50 ?  17   ARG C CA    1 
ATOM   1472  C  C     . ARG C 3  18   ? 189.102 168.583 221.695 1.00 124.10 ?  17   ARG C C     1 
ATOM   1473  O  O     . ARG C 3  18   ? 189.958 169.408 221.835 1.00 136.77 ?  17   ARG C O     1 
ATOM   1474  C  CB    . ARG C 3  18   ? 188.821 166.489 220.206 1.00 212.27 ?  17   ARG C CB    1 
ATOM   1475  C  CG    . ARG C 3  18   ? 189.814 165.572 219.498 1.00 289.43 ?  17   ARG C CG    1 
ATOM   1476  C  CD    . ARG C 3  18   ? 189.318 164.778 218.327 1.00 321.85 ?  17   ARG C CD    1 
ATOM   1477  N  NE    . ARG C 3  18   ? 190.383 163.966 217.766 1.00 292.84 ?  17   ARG C NE    1 
ATOM   1478  C  CZ    . ARG C 3  18   ? 191.214 164.294 216.787 1.00 260.43 ?  17   ARG C CZ    1 
ATOM   1479  N  NH1   . ARG C 3  18   ? 191.157 165.445 216.191 1.00 245.68 1  17   ARG C NH1   1 
ATOM   1480  N  NH2   . ARG C 3  18   ? 192.260 163.524 216.528 1.00 219.07 ?  17   ARG C NH2   1 
ATOM   1481  N  N     . SER C 3  19   ? 187.812 168.767 221.932 1.00 142.92 ?  18   SER C N     1 
ATOM   1482  C  CA    . SER C 3  19   ? 187.287 170.065 222.293 1.00 173.67 ?  18   SER C CA    1 
ATOM   1483  C  C     . SER C 3  19   ? 188.018 170.416 223.590 1.00 149.30 ?  18   SER C C     1 
ATOM   1484  O  O     . SER C 3  19   ? 188.411 171.575 223.787 1.00 101.45 ?  18   SER C O     1 
ATOM   1485  C  CB    . SER C 3  19   ? 185.744 170.012 222.463 1.00 258.77 ?  18   SER C CB    1 
ATOM   1486  O  OG    . SER C 3  19   ? 185.418 169.653 223.785 1.00 315.37 ?  18   SER C OG    1 
ATOM   1487  N  N     . SER C 3  20   ? 188.061 169.463 224.525 1.00 175.30 ?  19   SER C N     1 
ATOM   1488  C  CA    . SER C 3  20   ? 188.674 169.663 225.801 1.00 199.04 ?  19   SER C CA    1 
ATOM   1489  C  C     . SER C 3  20   ? 190.132 170.099 225.668 1.00 165.63 ?  19   SER C C     1 
ATOM   1490  O  O     . SER C 3  20   ? 190.552 171.205 226.097 1.00 176.28 ?  19   SER C O     1 
ATOM   1491  C  CB    . SER C 3  20   ? 188.541 168.452 226.674 1.00 224.12 ?  19   SER C CB    1 
ATOM   1492  O  OG    . SER C 3  20   ? 187.280 168.523 227.363 1.00 345.47 ?  19   SER C OG    1 
ATOM   1493  N  N     . ARG C 3  21   ? 190.943 169.136 225.229 1.00 148.27 ?  20   ARG C N     1 
ATOM   1494  C  CA    . ARG C 3  21   ? 192.409 169.348 225.164 1.00 182.34 ?  20   ARG C CA    1 
ATOM   1495  C  C     . ARG C 3  21   ? 192.687 170.595 224.313 1.00 151.56 ?  20   ARG C C     1 
ATOM   1496  O  O     . ARG C 3  21   ? 193.573 171.398 224.621 1.00 118.27 ?  20   ARG C O     1 
ATOM   1497  C  CB    . ARG C 3  21   ? 193.080 168.061 224.702 1.00 245.31 ?  20   ARG C CB    1 
ATOM   1498  C  CG    . ARG C 3  21   ? 192.662 166.897 225.584 1.00 346.83 ?  20   ARG C CG    1 
ATOM   1499  C  CD    . ARG C 3  21   ? 193.154 165.555 225.091 1.00 440.00 ?  20   ARG C CD    1 
ATOM   1500  N  NE    . ARG C 3  21   ? 192.871 164.519 226.077 1.00 440.00 ?  20   ARG C NE    1 
ATOM   1501  C  CZ    . ARG C 3  21   ? 192.844 163.176 225.885 1.00 440.00 ?  20   ARG C CZ    1 
ATOM   1502  N  NH1   . ARG C 3  21   ? 193.306 162.609 224.778 1.00 440.00 1  20   ARG C NH1   1 
ATOM   1503  N  NH2   . ARG C 3  21   ? 192.316 162.420 226.829 1.00 440.00 ?  20   ARG C NH2   1 
ATOM   1504  N  N     . ALA C 3  22   ? 191.900 170.772 223.255 1.00 159.90 ?  21   ALA C N     1 
ATOM   1505  C  CA    . ALA C 3  22   ? 192.127 171.914 222.345 1.00 149.65 ?  21   ALA C CA    1 
ATOM   1506  C  C     . ALA C 3  22   ? 191.625 173.215 222.992 1.00 109.43 ?  21   ALA C C     1 
ATOM   1507  O  O     . ALA C 3  22   ? 192.293 174.282 222.940 1.00 68.30  ?  21   ALA C O     1 
ATOM   1508  C  CB    . ALA C 3  22   ? 191.402 171.736 221.026 1.00 185.85 ?  21   ALA C CB    1 
ATOM   1509  N  N     . GLY C 3  23   ? 190.450 173.066 223.588 1.00 120.19 ?  22   GLY C N     1 
ATOM   1510  C  CA    . GLY C 3  23   ? 189.673 174.118 224.197 1.00 162.27 ?  22   GLY C CA    1 
ATOM   1511  C  C     . GLY C 3  23   ? 188.854 174.891 223.189 1.00 194.13 ?  22   GLY C C     1 
ATOM   1512  O  O     . GLY C 3  23   ? 188.692 176.169 223.340 1.00 320.89 ?  22   GLY C O     1 
ATOM   1513  N  N     . LEU C 3  24   ? 188.246 174.203 222.216 1.00 169.97 ?  23   LEU C N     1 
ATOM   1514  C  CA    . LEU C 3  24   ? 187.321 174.863 221.348 1.00 240.31 ?  23   LEU C CA    1 
ATOM   1515  C  C     . LEU C 3  24   ? 185.887 174.318 221.320 1.00 325.39 ?  23   LEU C C     1 
ATOM   1516  O  O     . LEU C 3  24   ? 185.654 173.249 221.648 1.00 314.99 ?  23   LEU C O     1 
ATOM   1517  C  CB    . LEU C 3  24   ? 188.006 174.825 219.977 1.00 184.46 ?  23   LEU C CB    1 
ATOM   1518  C  CG    . LEU C 3  24   ? 189.074 175.926 219.814 1.00 175.57 ?  23   LEU C CG    1 
ATOM   1519  C  CD1   . LEU C 3  24   ? 189.709 175.869 218.470 1.00 172.20 ?  23   LEU C CD1   1 
ATOM   1520  C  CD2   . LEU C 3  24   ? 188.512 177.342 220.088 1.00 180.46 ?  23   LEU C CD2   1 
ATOM   1521  N  N     . GLN C 3  25   ? 185.009 175.080 220.699 1.00 379.68 ?  24   GLN C N     1 
ATOM   1522  C  CA    . GLN C 3  25   ? 183.608 174.742 220.606 1.00 351.41 ?  24   GLN C CA    1 
ATOM   1523  C  C     . GLN C 3  25   ? 183.287 173.884 219.371 1.00 335.91 ?  24   GLN C C     1 
ATOM   1524  O  O     . GLN C 3  25   ? 182.292 173.233 219.264 1.00 377.56 ?  24   GLN C O     1 
ATOM   1525  C  CB    . GLN C 3  25   ? 182.782 176.024 220.531 1.00 367.69 ?  24   GLN C CB    1 
ATOM   1526  C  CG    . GLN C 3  25   ? 183.161 177.085 221.555 1.00 396.84 ?  24   GLN C CG    1 
ATOM   1527  C  CD    . GLN C 3  25   ? 182.287 176.980 222.783 1.00 436.09 ?  24   GLN C CD    1 
ATOM   1528  O  OE1   . GLN C 3  25   ? 182.742 176.548 223.838 1.00 440.00 ?  24   GLN C OE1   1 
ATOM   1529  N  NE2   . GLN C 3  25   ? 181.016 177.318 222.638 1.00 413.32 ?  24   GLN C NE2   1 
ATOM   1530  N  N     . PHE C 3  26   ? 184.218 173.876 218.427 1.00 295.59 ?  25   PHE C N     1 
ATOM   1531  C  CA    . PHE C 3  26   ? 184.097 173.153 217.192 1.00 243.71 ?  25   PHE C CA    1 
ATOM   1532  C  C     . PHE C 3  26   ? 184.633 171.711 217.185 1.00 361.22 ?  25   PHE C C     1 
ATOM   1533  O  O     . PHE C 3  26   ? 185.528 171.357 217.990 1.00 440.00 ?  25   PHE C O     1 
ATOM   1534  C  CB    . PHE C 3  26   ? 184.917 173.923 216.170 1.00 163.28 ?  25   PHE C CB    1 
ATOM   1535  C  CG    . PHE C 3  26   ? 184.373 173.674 214.832 1.00 130.54 ?  25   PHE C CG    1 
ATOM   1536  C  CD1   . PHE C 3  26   ? 183.093 174.095 214.549 1.00 77.19  ?  25   PHE C CD1   1 
ATOM   1537  C  CD2   . PHE C 3  26   ? 185.132 172.911 213.962 1.00 217.45 ?  25   PHE C CD2   1 
ATOM   1538  C  CE1   . PHE C 3  26   ? 182.606 173.768 213.308 1.00 127.98 ?  25   PHE C CE1   1 
ATOM   1539  C  CE2   . PHE C 3  26   ? 184.648 172.528 212.750 1.00 264.57 ?  25   PHE C CE2   1 
ATOM   1540  C  CZ    . PHE C 3  26   ? 183.382 172.983 212.422 1.00 233.94 ?  25   PHE C CZ    1 
ATOM   1541  N  N     . PRO C 3  27   ? 184.095 170.806 216.339 1.00 265.87 ?  26   PRO C N     1 
ATOM   1542  C  CA    . PRO C 3  27   ? 184.616 169.422 216.269 1.00 198.29 ?  26   PRO C CA    1 
ATOM   1543  C  C     . PRO C 3  27   ? 185.996 169.215 215.599 1.00 213.89 ?  26   PRO C C     1 
ATOM   1544  O  O     . PRO C 3  27   ? 186.116 169.442 214.440 1.00 204.60 ?  26   PRO C O     1 
ATOM   1545  C  CB    . PRO C 3  27   ? 183.527 168.718 215.415 1.00 191.15 ?  26   PRO C CB    1 
ATOM   1546  C  CG    . PRO C 3  27   ? 183.045 169.873 214.507 1.00 209.17 ?  26   PRO C CG    1 
ATOM   1547  C  CD    . PRO C 3  27   ? 183.013 171.068 215.393 1.00 199.54 ?  26   PRO C CD    1 
ATOM   1548  N  N     . VAL C 3  28   ? 187.036 168.977 216.422 1.00 227.76 ?  27   VAL C N     1 
ATOM   1549  C  CA    . VAL C 3  28   ? 188.418 168.845 215.953 1.00 185.00 ?  27   VAL C CA    1 
ATOM   1550  C  C     . VAL C 3  28   ? 188.652 167.480 215.315 1.00 213.65 ?  27   VAL C C     1 
ATOM   1551  O  O     . VAL C 3  28   ? 189.522 167.345 214.504 1.00 238.24 ?  27   VAL C O     1 
ATOM   1552  C  CB    . VAL C 3  28   ? 189.410 169.075 217.118 1.00 150.45 ?  27   VAL C CB    1 
ATOM   1553  C  CG1   . VAL C 3  28   ? 190.849 168.932 216.772 1.00 111.98 ?  27   VAL C CG1   1 
ATOM   1554  C  CG2   . VAL C 3  28   ? 189.269 170.459 217.683 1.00 126.73 ?  27   VAL C CG2   1 
ATOM   1555  N  N     . GLY C 3  29   ? 187.885 166.447 215.719 1.00 171.40 ?  28   GLY C N     1 
ATOM   1556  C  CA    . GLY C 3  29   ? 188.033 165.093 215.212 1.00 113.43 ?  28   GLY C CA    1 
ATOM   1557  C  C     . GLY C 3  29   ? 187.003 164.735 214.143 1.00 81.66  ?  28   GLY C C     1 
ATOM   1558  O  O     . GLY C 3  29   ? 186.496 163.652 214.154 1.00 57.75  ?  28   GLY C O     1 
ATOM   1559  N  N     . ARG C 3  30   ? 186.630 165.750 213.329 1.00 101.12 ?  29   ARG C N     1 
ATOM   1560  C  CA    . ARG C 3  30   ? 185.622 165.626 212.302 1.00 146.49 ?  29   ARG C CA    1 
ATOM   1561  C  C     . ARG C 3  30   ? 186.153 166.216 210.999 1.00 115.15 ?  29   ARG C C     1 
ATOM   1562  O  O     . ARG C 3  30   ? 185.869 165.720 209.910 1.00 183.16 ?  29   ARG C O     1 
ATOM   1563  C  CB    . ARG C 3  30   ? 184.316 166.346 212.755 1.00 272.46 ?  29   ARG C CB    1 
ATOM   1564  C  CG    . ARG C 3  30   ? 183.174 166.132 211.741 1.00 246.74 ?  29   ARG C CG    1 
ATOM   1565  C  CD    . ARG C 3  30   ? 181.725 166.663 211.978 1.00 156.32 ?  29   ARG C CD    1 
ATOM   1566  N  NE    . ARG C 3  30   ? 180.695 166.383 210.844 1.00 109.20 ?  29   ARG C NE    1 
ATOM   1567  C  CZ    . ARG C 3  30   ? 179.986 165.241 210.653 1.00 96.42  ?  29   ARG C CZ    1 
ATOM   1568  N  NH1   . ARG C 3  30   ? 179.742 164.315 211.596 1.00 80.79  1  29   ARG C NH1   1 
ATOM   1569  N  NH2   . ARG C 3  30   ? 179.535 165.018 209.467 1.00 91.19  ?  29   ARG C NH2   1 
ATOM   1570  N  N     . VAL C 3  31   ? 186.879 167.336 211.086 1.00 88.12  ?  30   VAL C N     1 
ATOM   1571  C  CA    . VAL C 3  31   ? 187.406 168.024 209.942 1.00 94.45  ?  30   VAL C CA    1 
ATOM   1572  C  C     . VAL C 3  31   ? 188.736 167.372 209.531 1.00 131.63 ?  30   VAL C C     1 
ATOM   1573  O  O     . VAL C 3  31   ? 189.121 167.437 208.311 1.00 161.98 ?  30   VAL C O     1 
ATOM   1574  C  CB    . VAL C 3  31   ? 187.519 169.556 210.173 1.00 84.27  ?  30   VAL C CB    1 
ATOM   1575  C  CG1   . VAL C 3  31   ? 188.183 170.207 209.000 1.00 77.07  ?  30   VAL C CG1   1 
ATOM   1576  C  CG2   . VAL C 3  31   ? 186.174 170.203 210.427 1.00 89.88  ?  30   VAL C CG2   1 
ATOM   1577  N  N     . HIS C 3  32   ? 189.402 166.686 210.467 1.00 155.13 ?  31   HIS C N     1 
ATOM   1578  C  CA    . HIS C 3  32   ? 190.597 165.920 210.255 1.00 188.77 ?  31   HIS C CA    1 
ATOM   1579  C  C     . HIS C 3  32   ? 190.318 164.786 209.232 1.00 192.84 ?  31   HIS C C     1 
ATOM   1580  O  O     . HIS C 3  32   ? 191.191 164.472 208.394 1.00 230.54 ?  31   HIS C O     1 
ATOM   1581  C  CB    . HIS C 3  32   ? 191.145 165.373 211.594 1.00 247.95 ?  31   HIS C CB    1 
ATOM   1582  C  CG    . HIS C 3  32   ? 192.211 164.315 211.477 1.00 296.92 ?  31   HIS C CG    1 
ATOM   1583  N  ND1   . HIS C 3  32   ? 192.351 163.264 212.363 1.00 286.09 ?  31   HIS C ND1   1 
ATOM   1584  C  CD2   . HIS C 3  32   ? 193.143 164.145 210.503 1.00 404.31 ?  31   HIS C CD2   1 
ATOM   1585  C  CE1   . HIS C 3  32   ? 193.350 162.503 211.957 1.00 288.52 ?  31   HIS C CE1   1 
ATOM   1586  N  NE2   . HIS C 3  32   ? 193.885 163.046 210.812 1.00 379.04 ?  31   HIS C NE2   1 
ATOM   1587  N  N     . ARG C 3  33   ? 189.151 164.151 209.362 1.00 181.82 ?  32   ARG C N     1 
ATOM   1588  C  CA    . ARG C 3  33   ? 188.790 163.018 208.599 1.00 174.43 ?  32   ARG C CA    1 
ATOM   1589  C  C     . ARG C 3  33   ? 188.476 163.365 207.146 1.00 165.56 ?  32   ARG C C     1 
ATOM   1590  O  O     . ARG C 3  33   ? 188.850 162.635 206.166 1.00 211.48 ?  32   ARG C O     1 
ATOM   1591  C  CB    . ARG C 3  33   ? 187.474 162.415 209.061 1.00 143.63 ?  32   ARG C CB    1 
ATOM   1592  C  CG    . ARG C 3  33   ? 187.609 161.962 210.498 1.00 152.24 ?  32   ARG C CG    1 
ATOM   1593  C  CD    . ARG C 3  33   ? 186.586 160.983 210.840 1.00 180.58 ?  32   ARG C CD    1 
ATOM   1594  N  NE    . ARG C 3  33   ? 187.229 160.005 211.723 1.00 264.91 ?  32   ARG C NE    1 
ATOM   1595  C  CZ    . ARG C 3  33   ? 187.861 158.914 211.303 1.00 342.09 ?  32   ARG C CZ    1 
ATOM   1596  N  NH1   . ARG C 3  33   ? 187.721 158.525 210.048 1.00 380.19 1  32   ARG C NH1   1 
ATOM   1597  N  NH2   . ARG C 3  33   ? 188.663 158.234 212.114 1.00 360.00 ?  32   ARG C NH2   1 
ATOM   1598  N  N     . LEU C 3  34   ? 187.742 164.465 207.036 1.00 147.79 ?  33   LEU C N     1 
ATOM   1599  C  CA    . LEU C 3  34   ? 187.320 164.960 205.707 1.00 154.75 ?  33   LEU C CA    1 
ATOM   1600  C  C     . LEU C 3  34   ? 188.543 165.497 204.979 1.00 156.45 ?  33   LEU C C     1 
ATOM   1601  O  O     . LEU C 3  34   ? 188.672 165.322 203.724 1.00 204.74 ?  33   LEU C O     1 
ATOM   1602  C  CB    . LEU C 3  34   ? 186.259 166.037 205.843 1.00 165.89 ?  33   LEU C CB    1 
ATOM   1603  C  CG    . LEU C 3  34   ? 184.873 165.461 205.870 1.00 220.85 ?  33   LEU C CG    1 
ATOM   1604  C  CD1   . LEU C 3  34   ? 184.603 164.621 207.138 1.00 260.73 ?  33   LEU C CD1   1 
ATOM   1605  C  CD2   . LEU C 3  34   ? 183.878 166.615 205.725 1.00 247.22 ?  33   LEU C CD2   1 
ATOM   1606  N  N     . LEU C 3  35   ? 189.455 166.125 205.722 1.00 120.68 ?  34   LEU C N     1 
ATOM   1607  C  CA    . LEU C 3  35   ? 190.627 166.642 205.044 1.00 111.65 ?  34   LEU C CA    1 
ATOM   1608  C  C     . LEU C 3  35   ? 191.515 165.531 204.517 1.00 123.36 ?  34   LEU C C     1 
ATOM   1609  O  O     . LEU C 3  35   ? 192.156 165.766 203.555 1.00 114.95 ?  34   LEU C O     1 
ATOM   1610  C  CB    . LEU C 3  35   ? 191.398 167.571 205.981 1.00 106.64 ?  34   LEU C CB    1 
ATOM   1611  C  CG    . LEU C 3  35   ? 190.670 168.880 206.295 1.00 148.12 ?  34   LEU C CG    1 
ATOM   1612  C  CD1   . LEU C 3  35   ? 191.542 169.672 207.236 1.00 195.33 ?  34   LEU C CD1   1 
ATOM   1613  C  CD2   . LEU C 3  35   ? 190.292 169.732 205.066 1.00 149.33 ?  34   LEU C CD2   1 
ATOM   1614  N  N     . ARG C 3  36   ? 191.484 164.362 205.151 1.00 160.14 ?  35   ARG C N     1 
ATOM   1615  C  CA    . ARG C 3  36   ? 192.238 163.193 204.703 1.00 177.47 ?  35   ARG C CA    1 
ATOM   1616  C  C     . ARG C 3  36   ? 191.463 162.389 203.693 1.00 159.28 ?  35   ARG C C     1 
ATOM   1617  O  O     . ARG C 3  36   ? 192.000 161.546 203.135 1.00 150.98 ?  35   ARG C O     1 
ATOM   1618  C  CB    . ARG C 3  36   ? 192.583 162.221 205.825 1.00 211.97 ?  35   ARG C CB    1 
ATOM   1619  C  CG    . ARG C 3  36   ? 193.023 162.900 207.129 1.00 355.97 ?  35   ARG C CG    1 
ATOM   1620  C  CD    . ARG C 3  36   ? 192.790 161.911 208.266 1.00 418.08 ?  35   ARG C CD    1 
ATOM   1621  N  NE    . ARG C 3  36   ? 192.735 160.507 207.841 1.00 430.56 ?  35   ARG C NE    1 
ATOM   1622  C  CZ    . ARG C 3  36   ? 191.993 159.553 208.407 1.00 440.00 ?  35   ARG C CZ    1 
ATOM   1623  N  NH1   . ARG C 3  36   ? 191.611 159.647 209.673 1.00 440.00 1  35   ARG C NH1   1 
ATOM   1624  N  NH2   . ARG C 3  36   ? 191.649 158.476 207.709 1.00 440.00 ?  35   ARG C NH2   1 
ATOM   1625  N  N     . LYS C 3  37   ? 190.153 162.578 203.633 1.00 197.32 ?  36   LYS C N     1 
ATOM   1626  C  CA    . LYS C 3  37   ? 189.324 161.822 202.690 1.00 183.93 ?  36   LYS C CA    1 
ATOM   1627  C  C     . LYS C 3  37   ? 189.031 162.663 201.455 1.00 132.68 ?  36   LYS C C     1 
ATOM   1628  O  O     . LYS C 3  37   ? 188.761 162.114 200.492 1.00 91.49  ?  36   LYS C O     1 
ATOM   1629  C  CB    . LYS C 3  37   ? 188.048 161.371 203.404 1.00 273.70 ?  36   LYS C CB    1 
ATOM   1630  C  CG    . LYS C 3  37   ? 188.223 160.076 204.183 1.00 294.79 ?  36   LYS C CG    1 
ATOM   1631  C  CD    . LYS C 3  37   ? 188.044 158.834 203.265 1.00 282.24 ?  36   LYS C CD    1 
ATOM   1632  C  CE    . LYS C 3  37   ? 188.642 157.554 203.809 1.00 311.62 ?  36   LYS C CE    1 
ATOM   1633  N  NZ    . LYS C 3  37   ? 190.124 157.610 203.895 1.00 337.92 1  36   LYS C NZ    1 
ATOM   1634  N  N     . GLY C 3  38   ? 188.991 163.994 201.585 1.00 123.05 ?  37   GLY C N     1 
ATOM   1635  C  CA    . GLY C 3  38   ? 188.952 164.917 200.453 1.00 104.37 ?  37   GLY C CA    1 
ATOM   1636  C  C     . GLY C 3  38   ? 190.055 164.603 199.476 1.00 126.85 ?  37   GLY C C     1 
ATOM   1637  O  O     . GLY C 3  38   ? 189.906 164.820 198.238 1.00 180.21 ?  37   GLY C O     1 
ATOM   1638  N  N     . ASN C 3  39   ? 191.184 164.225 200.068 1.00 128.93 ?  38   ASN C N     1 
ATOM   1639  C  CA    . ASN C 3  39   ? 192.468 163.865 199.479 1.00 178.49 ?  38   ASN C CA    1 
ATOM   1640  C  C     . ASN C 3  39   ? 193.306 165.097 199.035 1.00 214.44 ?  38   ASN C C     1 
ATOM   1641  O  O     . ASN C 3  39   ? 193.734 165.223 197.842 1.00 383.59 ?  38   ASN C O     1 
ATOM   1642  C  CB    . ASN C 3  39   ? 192.286 162.975 198.243 1.00 254.18 ?  38   ASN C CB    1 
ATOM   1643  C  CG    . ASN C 3  39   ? 191.702 161.617 198.509 1.00 267.14 ?  38   ASN C CG    1 
ATOM   1644  O  OD1   . ASN C 3  39   ? 192.174 160.871 199.359 1.00 228.83 ?  38   ASN C OD1   1 
ATOM   1645  N  ND2   . ASN C 3  39   ? 190.746 161.234 197.680 1.00 318.97 ?  38   ASN C ND2   1 
ATOM   1646  N  N     . TYR C 3  40   ? 193.547 166.001 199.991 1.00 180.03 ?  39   TYR C N     1 
ATOM   1647  C  CA    . TYR C 3  40   ? 194.337 167.233 199.730 1.00 179.07 ?  39   TYR C CA    1 
ATOM   1648  C  C     . TYR C 3  40   ? 195.817 167.180 199.336 1.00 179.53 ?  39   TYR C C     1 
ATOM   1649  O  O     . TYR C 3  40   ? 196.155 167.584 198.206 1.00 195.24 ?  39   TYR C O     1 
ATOM   1650  C  CB    . TYR C 3  40   ? 194.368 168.122 200.976 1.00 169.09 ?  39   TYR C CB    1 
ATOM   1651  C  CG    . TYR C 3  40   ? 193.018 168.621 201.428 1.00 126.94 ?  39   TYR C CG    1 
ATOM   1652  C  CD1   . TYR C 3  40   ? 192.044 168.976 200.511 1.00 79.83  ?  39   TYR C CD1   1 
ATOM   1653  C  CD2   . TYR C 3  40   ? 192.712 168.736 202.774 1.00 132.63 ?  39   TYR C CD2   1 
ATOM   1654  C  CE1   . TYR C 3  40   ? 190.801 169.433 200.917 1.00 71.72  ?  39   TYR C CE1   1 
ATOM   1655  C  CE2   . TYR C 3  40   ? 191.476 169.192 203.197 1.00 112.31 ?  39   TYR C CE2   1 
ATOM   1656  C  CZ    . TYR C 3  40   ? 190.515 169.542 202.265 1.00 100.11 ?  39   TYR C CZ    1 
ATOM   1657  O  OH    . TYR C 3  40   ? 189.292 169.992 202.674 1.00 133.86 ?  39   TYR C OH    1 
ATOM   1658  N  N     . ALA C 3  41   ? 196.667 166.696 200.248 1.00 169.62 ?  40   ALA C N     1 
ATOM   1659  C  CA    . ALA C 3  41   ? 198.069 166.323 199.950 1.00 142.90 ?  40   ALA C CA    1 
ATOM   1660  C  C     . ALA C 3  41   ? 198.261 164.818 200.172 1.00 144.32 ?  40   ALA C C     1 
ATOM   1661  O  O     . ALA C 3  41   ? 197.249 164.114 200.365 1.00 119.33 ?  40   ALA C O     1 
ATOM   1662  C  CB    . ALA C 3  41   ? 199.010 167.132 200.808 1.00 119.26 ?  40   ALA C CB    1 
ATOM   1663  N  N     . GLU C 3  42   ? 199.514 164.353 200.146 1.00 167.51 ?  41   GLU C N     1 
ATOM   1664  C  CA    . GLU C 3  42   ? 199.829 162.913 200.348 1.00 207.47 ?  41   GLU C CA    1 
ATOM   1665  C  C     . GLU C 3  42   ? 199.337 162.482 201.735 1.00 164.65 ?  41   GLU C C     1 
ATOM   1666  O  O     . GLU C 3  42   ? 198.378 161.686 201.801 1.00 121.37 ?  41   GLU C O     1 
ATOM   1667  C  CB    . GLU C 3  42   ? 201.332 162.670 200.198 1.00 313.92 ?  41   GLU C CB    1 
ATOM   1668  C  CG    . GLU C 3  42   ? 201.722 161.208 200.321 1.00 419.84 ?  41   GLU C CG    1 
ATOM   1669  C  CD    . GLU C 3  42   ? 203.204 160.933 200.128 1.00 440.00 ?  41   GLU C CD    1 
ATOM   1670  O  OE1   . GLU C 3  42   ? 203.963 161.901 199.928 1.00 440.00 ?  41   GLU C OE1   1 
ATOM   1671  O  OE2   . GLU C 3  42   ? 203.594 159.750 200.177 1.00 371.86 -1 41   GLU C OE2   1 
ATOM   1672  N  N     . ARG C 3  43   ? 199.976 162.991 202.793 1.00 138.21 ?  42   ARG C N     1 
ATOM   1673  C  CA    . ARG C 3  43   ? 199.594 162.658 204.168 1.00 131.46 ?  42   ARG C CA    1 
ATOM   1674  C  C     . ARG C 3  43   ? 199.005 164.002 204.591 1.00 173.90 ?  42   ARG C C     1 
ATOM   1675  O  O     . ARG C 3  43   ? 198.622 164.683 203.689 1.00 295.39 ?  42   ARG C O     1 
ATOM   1676  C  CB    . ARG C 3  43   ? 200.779 162.554 205.125 1.00 115.65 ?  42   ARG C CB    1 
ATOM   1677  C  CG    . ARG C 3  43   ? 201.767 161.434 204.932 1.00 146.12 ?  42   ARG C CG    1 
ATOM   1678  C  CD    . ARG C 3  43   ? 202.853 161.495 206.043 1.00 180.69 ?  42   ARG C CD    1 
ATOM   1679  N  NE    . ARG C 3  43   ? 203.893 160.480 205.886 1.00 217.15 ?  42   ARG C NE    1 
ATOM   1680  C  CZ    . ARG C 3  43   ? 205.010 160.371 206.629 1.00 202.67 ?  42   ARG C CZ    1 
ATOM   1681  N  NH1   . ARG C 3  43   ? 205.500 161.426 207.277 1.00 177.57 1  42   ARG C NH1   1 
ATOM   1682  N  NH2   . ARG C 3  43   ? 205.655 159.209 206.663 1.00 155.94 ?  42   ARG C NH2   1 
ATOM   1683  N  N     . VAL C 3  44   ? 198.853 164.336 205.911 1.00 131.04 ?  43   VAL C N     1 
ATOM   1684  C  CA    . VAL C 3  44   ? 198.164 165.473 206.441 1.00 94.17  ?  43   VAL C CA    1 
ATOM   1685  C  C     . VAL C 3  44   ? 199.015 166.082 207.523 1.00 98.60  ?  43   VAL C C     1 
ATOM   1686  O  O     . VAL C 3  44   ? 199.547 165.299 208.379 1.00 127.87 ?  43   VAL C O     1 
ATOM   1687  C  CB    . VAL C 3  44   ? 196.900 164.843 207.102 1.00 94.49  ?  43   VAL C CB    1 
ATOM   1688  C  CG1   . VAL C 3  44   ? 197.123 164.059 208.462 1.00 67.60  ?  43   VAL C CG1   1 
ATOM   1689  C  CG2   . VAL C 3  44   ? 195.787 165.915 207.105 1.00 110.15 ?  43   VAL C CG2   1 
ATOM   1690  N  N     . GLY C 3  45   ? 199.152 167.405 207.605 1.00 100.02 ?  44   GLY C N     1 
ATOM   1691  C  CA    . GLY C 3  45   ? 199.983 167.956 208.754 1.00 137.81 ?  44   GLY C CA    1 
ATOM   1692  C  C     . GLY C 3  45   ? 199.266 168.076 210.112 1.00 173.41 ?  44   GLY C C     1 
ATOM   1693  O  O     . GLY C 3  45   ? 197.984 168.134 210.147 1.00 283.79 ?  44   GLY C O     1 
ATOM   1694  N  N     . ALA C 3  46   ? 200.016 167.918 211.212 1.00 169.39 ?  45   ALA C N     1 
ATOM   1695  C  CA    . ALA C 3  46   ? 199.271 167.591 212.489 1.00 176.08 ?  45   ALA C CA    1 
ATOM   1696  C  C     . ALA C 3  46   ? 198.610 168.867 212.957 1.00 123.00 ?  45   ALA C C     1 
ATOM   1697  O  O     . ALA C 3  46   ? 197.431 168.788 213.516 1.00 127.31 ?  45   ALA C O     1 
ATOM   1698  C  CB    . ALA C 3  46   ? 200.095 167.030 213.596 1.00 219.74 ?  45   ALA C CB    1 
ATOM   1699  N  N     . GLY C 3  47   ? 199.315 169.983 212.635 1.00 95.60  ?  46   GLY C N     1 
ATOM   1700  C  CA    . GLY C 3  47   ? 198.820 171.352 212.668 1.00 126.13 ?  46   GLY C CA    1 
ATOM   1701  C  C     . GLY C 3  47   ? 197.282 171.514 212.508 1.00 162.17 ?  46   GLY C C     1 
ATOM   1702  O  O     . GLY C 3  47   ? 196.478 171.969 213.437 1.00 222.30 ?  46   GLY C O     1 
ATOM   1703  N  N     . ALA C 3  48   ? 196.826 171.129 211.312 1.00 140.00 ?  47   ALA C N     1 
ATOM   1704  C  CA    . ALA C 3  48   ? 195.581 171.559 210.680 1.00 132.43 ?  47   ALA C CA    1 
ATOM   1705  C  C     . ALA C 3  48   ? 194.256 171.135 211.323 1.00 180.82 ?  47   ALA C C     1 
ATOM   1706  O  O     . ALA C 3  48   ? 193.357 171.988 211.263 1.00 234.47 ?  47   ALA C O     1 
ATOM   1707  C  CB    . ALA C 3  48   ? 195.624 171.164 209.223 1.00 136.25 ?  47   ALA C CB    1 
ATOM   1708  N  N     . PRO C 3  49   ? 193.929 169.871 211.696 1.00 197.39 ?  48   PRO C N     1 
ATOM   1709  C  CA    . PRO C 3  49   ? 192.527 169.611 212.025 1.00 188.20 ?  48   PRO C CA    1 
ATOM   1710  C  C     . PRO C 3  49   ? 191.991 170.570 213.123 1.00 150.09 ?  48   PRO C C     1 
ATOM   1711  O  O     . PRO C 3  49   ? 190.848 171.036 213.279 1.00 91.01  ?  48   PRO C O     1 
ATOM   1712  C  CB    . PRO C 3  49   ? 192.544 168.191 212.623 1.00 175.89 ?  48   PRO C CB    1 
ATOM   1713  C  CG    . PRO C 3  49   ? 193.803 167.533 212.129 1.00 164.34 ?  48   PRO C CG    1 
ATOM   1714  C  CD    . PRO C 3  49   ? 194.797 168.684 211.896 1.00 186.66 ?  48   PRO C CD    1 
ATOM   1715  N  N     . VAL C 3  50   ? 192.926 170.798 214.045 1.00 151.55 ?  49   VAL C N     1 
ATOM   1716  C  CA    . VAL C 3  50   ? 192.765 171.520 215.247 1.00 140.16 ?  49   VAL C CA    1 
ATOM   1717  C  C     . VAL C 3  50   ? 192.641 172.979 214.906 1.00 126.83 ?  49   VAL C C     1 
ATOM   1718  O  O     . VAL C 3  50   ? 191.618 173.636 215.365 1.00 206.90 ?  49   VAL C O     1 
ATOM   1719  C  CB    . VAL C 3  50   ? 193.942 171.237 216.185 1.00 152.43 ?  49   VAL C CB    1 
ATOM   1720  C  CG1   . VAL C 3  50   ? 193.648 171.758 217.604 1.00 174.77 ?  49   VAL C CG1   1 
ATOM   1721  C  CG2   . VAL C 3  50   ? 194.346 169.740 216.217 1.00 139.39 ?  49   VAL C CG2   1 
ATOM   1722  N  N     . TYR C 3  51   ? 193.631 173.540 214.182 1.00 69.81  ?  50   TYR C N     1 
ATOM   1723  C  CA    . TYR C 3  51   ? 193.681 174.898 213.757 1.00 63.74  ?  50   TYR C CA    1 
ATOM   1724  C  C     . TYR C 3  51   ? 192.417 175.235 212.914 1.00 105.85 ?  50   TYR C C     1 
ATOM   1725  O  O     . TYR C 3  51   ? 191.838 176.315 212.974 1.00 90.88  ?  50   TYR C O     1 
ATOM   1726  C  CB    . TYR C 3  51   ? 194.915 175.008 212.896 1.00 50.73  ?  50   TYR C CB    1 
ATOM   1727  C  CG    . TYR C 3  51   ? 195.363 176.343 212.481 1.00 64.22  ?  50   TYR C CG    1 
ATOM   1728  C  CD1   . TYR C 3  51   ? 196.111 176.944 213.422 1.00 77.59  ?  50   TYR C CD1   1 
ATOM   1729  C  CD2   . TYR C 3  51   ? 195.225 176.969 211.222 1.00 83.12  ?  50   TYR C CD2   1 
ATOM   1730  C  CE1   . TYR C 3  51   ? 196.733 178.160 213.158 1.00 93.14  ?  50   TYR C CE1   1 
ATOM   1731  C  CE2   . TYR C 3  51   ? 195.666 178.260 211.015 1.00 90.83  ?  50   TYR C CE2   1 
ATOM   1732  C  CZ    . TYR C 3  51   ? 196.499 178.853 211.971 1.00 89.55  ?  50   TYR C CZ    1 
ATOM   1733  O  OH    . TYR C 3  51   ? 197.112 180.088 211.850 1.00 78.43  ?  50   TYR C OH    1 
ATOM   1734  N  N     . LEU C 3  52   ? 192.038 174.250 212.085 1.00 177.27 ?  51   LEU C N     1 
ATOM   1735  C  CA    . LEU C 3  52   ? 191.024 174.404 211.082 1.00 213.25 ?  51   LEU C CA    1 
ATOM   1736  C  C     . LEU C 3  52   ? 189.649 174.452 211.750 1.00 230.20 ?  51   LEU C C     1 
ATOM   1737  O  O     . LEU C 3  52   ? 188.749 175.120 211.242 1.00 412.66 ?  51   LEU C O     1 
ATOM   1738  C  CB    . LEU C 3  52   ? 191.103 173.351 209.963 1.00 208.10 ?  51   LEU C CB    1 
ATOM   1739  C  CG    . LEU C 3  52   ? 190.326 173.782 208.654 1.00 146.86 ?  51   LEU C CG    1 
ATOM   1740  C  CD1   . LEU C 3  52   ? 190.557 175.280 208.463 1.00 127.33 ?  51   LEU C CD1   1 
ATOM   1741  C  CD2   . LEU C 3  52   ? 190.654 173.105 207.382 1.00 133.41 ?  51   LEU C CD2   1 
ATOM   1742  N  N     . ALA C 3  53   ? 189.532 173.769 212.910 1.00 140.94 ?  52   ALA C N     1 
ATOM   1743  C  CA    . ALA C 3  53   ? 188.260 173.831 213.691 1.00 99.23  ?  52   ALA C CA    1 
ATOM   1744  C  C     . ALA C 3  53   ? 188.141 175.239 214.335 1.00 96.00  ?  52   ALA C C     1 
ATOM   1745  O  O     . ALA C 3  53   ? 187.077 175.807 214.496 1.00 131.97 ?  52   ALA C O     1 
ATOM   1746  C  CB    . ALA C 3  53   ? 188.220 172.790 214.710 1.00 69.10  ?  52   ALA C CB    1 
ATOM   1747  N  N     . ALA C 3  54   ? 189.293 175.743 214.779 1.00 99.91  ?  53   ALA C N     1 
ATOM   1748  C  CA    . ALA C 3  54   ? 189.353 176.998 215.500 1.00 114.26 ?  53   ALA C CA    1 
ATOM   1749  C  C     . ALA C 3  54   ? 188.867 178.214 214.721 1.00 115.93 ?  53   ALA C C     1 
ATOM   1750  O  O     . ALA C 3  54   ? 188.069 179.038 215.366 1.00 195.55 ?  53   ALA C O     1 
ATOM   1751  C  CB    . ALA C 3  54   ? 190.773 177.219 215.988 1.00 175.80 ?  53   ALA C CB    1 
ATOM   1752  N  N     . VAL C 3  55   ? 189.380 178.466 213.496 1.00 99.58  ?  54   VAL C N     1 
ATOM   1753  C  CA    . VAL C 3  55   ? 188.993 179.651 212.793 1.00 130.85 ?  54   VAL C CA    1 
ATOM   1754  C  C     . VAL C 3  55   ? 187.492 179.569 212.421 1.00 189.16 ?  54   VAL C C     1 
ATOM   1755  O  O     . VAL C 3  55   ? 186.732 180.473 212.410 1.00 183.41 ?  54   VAL C O     1 
ATOM   1756  C  CB    . VAL C 3  55   ? 189.906 179.950 211.601 1.00 104.59 ?  54   VAL C CB    1 
ATOM   1757  C  CG1   . VAL C 3  55   ? 189.820 178.794 210.674 1.00 111.80 ?  54   VAL C CG1   1 
ATOM   1758  C  CG2   . VAL C 3  55   ? 189.641 181.269 210.880 1.00 96.44  ?  54   VAL C CG2   1 
ATOM   1759  N  N     . LEU C 3  56   ? 187.072 178.368 212.113 1.00 205.21 ?  55   LEU C N     1 
ATOM   1760  C  CA    . LEU C 3  56   ? 185.716 178.083 211.731 1.00 154.15 ?  55   LEU C CA    1 
ATOM   1761  C  C     . LEU C 3  56   ? 184.702 178.472 212.811 1.00 109.35 ?  55   LEU C C     1 
ATOM   1762  O  O     . LEU C 3  56   ? 183.740 179.021 212.594 1.00 84.58  ?  55   LEU C O     1 
ATOM   1763  C  CB    . LEU C 3  56   ? 185.534 176.587 211.508 1.00 238.41 ?  55   LEU C CB    1 
ATOM   1764  C  CG    . LEU C 3  56   ? 186.205 176.040 210.278 1.00 403.82 ?  55   LEU C CG    1 
ATOM   1765  C  CD1   . LEU C 3  56   ? 186.024 174.541 210.281 1.00 440.00 ?  55   LEU C CD1   1 
ATOM   1766  C  CD2   . LEU C 3  56   ? 185.615 176.755 209.085 1.00 404.79 ?  55   LEU C CD2   1 
ATOM   1767  N  N     . GLU C 3  57   ? 185.008 178.091 214.052 1.00 103.38 ?  56   GLU C N     1 
ATOM   1768  C  CA    . GLU C 3  57   ? 184.198 178.498 215.190 1.00 79.20  ?  56   GLU C CA    1 
ATOM   1769  C  C     . GLU C 3  57   ? 184.230 180.033 215.227 1.00 66.99  ?  56   GLU C C     1 
ATOM   1770  O  O     . GLU C 3  57   ? 183.174 180.664 215.468 1.00 75.94  ?  56   GLU C O     1 
ATOM   1771  C  CB    . GLU C 3  57   ? 184.718 177.917 216.505 1.00 98.50  ?  56   GLU C CB    1 
ATOM   1772  C  CG    . GLU C 3  57   ? 183.997 178.468 217.691 1.00 126.02 ?  56   GLU C CG    1 
ATOM   1773  C  CD    . GLU C 3  57   ? 184.489 179.838 218.182 1.00 158.28 ?  56   GLU C CD    1 
ATOM   1774  O  OE1   . GLU C 3  57   ? 185.553 180.230 217.680 1.00 140.92 ?  56   GLU C OE1   1 
ATOM   1775  O  OE2   . GLU C 3  57   ? 183.745 180.592 218.937 1.00 318.73 -1 56   GLU C OE2   1 
ATOM   1776  N  N     . TYR C 3  58   ? 185.412 180.657 215.061 1.00 73.66  ?  57   TYR C N     1 
ATOM   1777  C  CA    . TYR C 3  58   ? 185.557 182.051 215.170 1.00 90.09  ?  57   TYR C CA    1 
ATOM   1778  C  C     . TYR C 3  58   ? 184.621 182.762 214.184 1.00 97.39  ?  57   TYR C C     1 
ATOM   1779  O  O     . TYR C 3  58   ? 183.966 183.802 214.516 1.00 123.41 ?  57   TYR C O     1 
ATOM   1780  C  CB    . TYR C 3  58   ? 186.979 182.541 214.907 1.00 117.69 ?  57   TYR C CB    1 
ATOM   1781  C  CG    . TYR C 3  58   ? 187.119 184.034 214.712 1.00 139.25 ?  57   TYR C CG    1 
ATOM   1782  C  CD1   . TYR C 3  58   ? 187.283 184.896 215.766 1.00 151.01 ?  57   TYR C CD1   1 
ATOM   1783  C  CD2   . TYR C 3  58   ? 187.071 184.604 213.465 1.00 157.73 ?  57   TYR C CD2   1 
ATOM   1784  C  CE1   . TYR C 3  58   ? 187.451 186.257 215.578 1.00 152.47 ?  57   TYR C CE1   1 
ATOM   1785  C  CE2   . TYR C 3  58   ? 187.133 185.968 213.254 1.00 139.71 ?  57   TYR C CE2   1 
ATOM   1786  C  CZ    . TYR C 3  58   ? 187.353 186.808 214.316 1.00 133.89 ?  57   TYR C CZ    1 
ATOM   1787  O  OH    . TYR C 3  58   ? 187.474 188.148 214.149 1.00 115.85 ?  57   TYR C OH    1 
ATOM   1788  N  N     . LEU C 3  59   ? 184.555 182.308 212.934 1.00 96.41  ?  58   LEU C N     1 
ATOM   1789  C  CA    . LEU C 3  59   ? 183.685 182.895 211.938 1.00 123.03 ?  58   LEU C CA    1 
ATOM   1790  C  C     . LEU C 3  59   ? 182.216 182.645 212.328 1.00 151.96 ?  58   LEU C C     1 
ATOM   1791  O  O     . LEU C 3  59   ? 181.331 183.585 212.089 1.00 134.91 ?  58   LEU C O     1 
ATOM   1792  C  CB    . LEU C 3  59   ? 184.111 182.217 210.636 1.00 148.01 ?  58   LEU C CB    1 
ATOM   1793  C  CG    . LEU C 3  59   ? 185.482 182.656 210.173 1.00 156.02 ?  58   LEU C CG    1 
ATOM   1794  C  CD1   . LEU C 3  59   ? 185.960 182.020 208.886 1.00 194.22 ?  58   LEU C CD1   1 
ATOM   1795  C  CD2   . LEU C 3  59   ? 185.484 184.187 210.065 1.00 135.66 ?  58   LEU C CD2   1 
ATOM   1796  N  N     . THR C 3  60   ? 181.966 181.450 212.911 1.00 151.22 ?  59   THR C N     1 
ATOM   1797  C  CA    . THR C 3  60   ? 180.601 181.034 213.196 1.00 118.77 ?  59   THR C CA    1 
ATOM   1798  C  C     . THR C 3  60   ? 179.934 182.075 214.130 1.00 92.26  ?  59   THR C C     1 
ATOM   1799  O  O     . THR C 3  60   ? 178.797 182.472 214.065 1.00 64.22  ?  59   THR C O     1 
ATOM   1800  C  CB    . THR C 3  60   ? 180.485 179.688 213.936 1.00 91.83  ?  59   THR C CB    1 
ATOM   1801  O  OG1   . THR C 3  60   ? 180.978 178.546 213.242 1.00 72.60  ?  59   THR C OG1   1 
ATOM   1802  C  CG2   . THR C 3  60   ? 179.006 179.362 214.177 1.00 75.05  ?  59   THR C CG2   1 
ATOM   1803  N  N     . ALA C 3  61   ? 180.735 182.495 215.092 1.00 99.69  ?  60   ALA C N     1 
ATOM   1804  C  CA    . ALA C 3  61   ? 180.336 183.371 216.151 1.00 86.62  ?  60   ALA C CA    1 
ATOM   1805  C  C     . ALA C 3  61   ? 180.223 184.780 215.604 1.00 75.70  ?  60   ALA C C     1 
ATOM   1806  O  O     . ALA C 3  61   ? 179.413 185.514 216.050 1.00 85.77  ?  60   ALA C O     1 
ATOM   1807  C  CB    . ALA C 3  61   ? 181.308 183.356 217.283 1.00 112.56 ?  60   ALA C CB    1 
ATOM   1808  N  N     . GLU C 3  62   ? 181.067 185.173 214.640 1.00 76.93  ?  61   GLU C N     1 
ATOM   1809  C  CA    . GLU C 3  62   ? 181.081 186.543 214.180 1.00 101.24 ?  61   GLU C CA    1 
ATOM   1810  C  C     . GLU C 3  62   ? 179.771 186.978 213.533 1.00 136.53 ?  61   GLU C C     1 
ATOM   1811  O  O     . GLU C 3  62   ? 179.302 188.101 213.716 1.00 144.42 ?  61   GLU C O     1 
ATOM   1812  C  CB    . GLU C 3  62   ? 182.220 186.803 213.219 1.00 125.43 ?  61   GLU C CB    1 
ATOM   1813  C  CG    . GLU C 3  62   ? 182.246 188.277 212.837 1.00 147.13 ?  61   GLU C CG    1 
ATOM   1814  C  CD    . GLU C 3  62   ? 182.409 189.296 213.950 1.00 109.59 ?  61   GLU C CD    1 
ATOM   1815  O  OE1   . GLU C 3  62   ? 182.781 188.880 215.037 1.00 99.13  ?  61   GLU C OE1   1 
ATOM   1816  O  OE2   . GLU C 3  62   ? 182.143 190.454 213.732 1.00 149.04 -1 61   GLU C OE2   1 
ATOM   1817  N  N     . ILE C 3  63   ? 179.121 186.096 212.786 1.00 150.19 ?  62   ILE C N     1 
ATOM   1818  C  CA    . ILE C 3  63   ? 177.782 186.341 212.218 1.00 167.32 ?  62   ILE C CA    1 
ATOM   1819  C  C     . ILE C 3  63   ? 176.553 186.254 213.176 1.00 155.73 ?  62   ILE C C     1 
ATOM   1820  O  O     . ILE C 3  63   ? 175.681 187.104 213.027 1.00 144.91 ?  62   ILE C O     1 
ATOM   1821  C  CB    . ILE C 3  63   ? 177.587 185.402 210.997 1.00 201.44 ?  62   ILE C CB    1 
ATOM   1822  C  CG1   . ILE C 3  63   ? 176.391 185.870 210.174 1.00 233.37 ?  62   ILE C CG1   1 
ATOM   1823  C  CG2   . ILE C 3  63   ? 177.460 183.947 211.426 1.00 180.32 ?  62   ILE C CG2   1 
ATOM   1824  C  CD1   . ILE C 3  63   ? 176.242 185.173 208.816 1.00 202.62 ?  62   ILE C CD1   1 
ATOM   1825  N  N     . LEU C 3  64   ? 176.409 185.224 214.002 1.00 113.83 ?  63   LEU C N     1 
ATOM   1826  C  CA    . LEU C 3  64   ? 175.221 184.881 214.817 1.00 86.42  ?  63   LEU C CA    1 
ATOM   1827  C  C     . LEU C 3  64   ? 174.720 186.139 215.527 1.00 75.05  ?  63   LEU C C     1 
ATOM   1828  O  O     . LEU C 3  64   ? 173.583 186.515 215.628 1.00 73.68  ?  63   LEU C O     1 
ATOM   1829  C  CB    . LEU C 3  64   ? 175.605 183.891 215.912 1.00 74.41  ?  63   LEU C CB    1 
ATOM   1830  C  CG    . LEU C 3  64   ? 175.897 182.491 215.390 1.00 83.65  ?  63   LEU C CG    1 
ATOM   1831  C  CD1   . LEU C 3  64   ? 176.611 181.613 216.334 1.00 81.62  ?  63   LEU C CD1   1 
ATOM   1832  C  CD2   . LEU C 3  64   ? 174.682 181.765 214.943 1.00 92.72  ?  63   LEU C CD2   1 
ATOM   1833  N  N     . GLU C 3  65   ? 175.704 186.754 216.155 1.00 91.42  ?  64   GLU C N     1 
ATOM   1834  C  CA    . GLU C 3  65   ? 175.498 187.921 217.015 1.00 120.72 ?  64   GLU C CA    1 
ATOM   1835  C  C     . GLU C 3  65   ? 175.094 189.173 216.237 1.00 172.80 ?  64   GLU C C     1 
ATOM   1836  O  O     . GLU C 3  65   ? 174.241 189.951 216.727 1.00 236.48 ?  64   GLU C O     1 
ATOM   1837  C  CB    . GLU C 3  65   ? 176.760 188.187 217.812 1.00 87.99  ?  64   GLU C CB    1 
ATOM   1838  C  CG    . GLU C 3  65   ? 176.781 189.485 218.588 1.00 84.12  ?  64   GLU C CG    1 
ATOM   1839  C  CD    . GLU C 3  65   ? 178.232 189.862 218.751 1.00 99.92  ?  64   GLU C CD    1 
ATOM   1840  O  OE1   . GLU C 3  65   ? 179.092 188.949 218.842 1.00 121.46 ?  64   GLU C OE1   1 
ATOM   1841  O  OE2   . GLU C 3  65   ? 178.512 191.056 218.844 1.00 65.94  -1 64   GLU C OE2   1 
ATOM   1842  N  N     . LEU C 3  66   ? 175.790 189.480 215.163 1.00 144.09 ?  65   LEU C N     1 
ATOM   1843  C  CA    . LEU C 3  66   ? 175.359 190.656 214.349 1.00 162.65 ?  65   LEU C CA    1 
ATOM   1844  C  C     . LEU C 3  66   ? 173.965 190.395 213.757 1.00 231.47 ?  65   LEU C C     1 
ATOM   1845  O  O     . LEU C 3  66   ? 173.080 191.271 213.712 1.00 279.29 ?  65   LEU C O     1 
ATOM   1846  C  CB    . LEU C 3  66   ? 176.286 190.912 213.175 1.00 138.65 ?  65   LEU C CB    1 
ATOM   1847  C  CG    . LEU C 3  66   ? 177.205 192.066 213.447 1.00 153.44 ?  65   LEU C CG    1 
ATOM   1848  C  CD1   . LEU C 3  66   ? 178.259 191.659 214.458 1.00 145.43 ?  65   LEU C CD1   1 
ATOM   1849  C  CD2   . LEU C 3  66   ? 177.765 192.453 212.125 1.00 180.02 ?  65   LEU C CD2   1 
ATOM   1850  N  N     . ALA C 3  67   ? 173.707 189.136 213.385 1.00 324.29 ?  66   ALA C N     1 
ATOM   1851  C  CA    . ALA C 3  67   ? 172.391 188.708 213.040 1.00 440.00 ?  66   ALA C CA    1 
ATOM   1852  C  C     . ALA C 3  67   ? 171.447 189.012 214.228 1.00 440.00 ?  66   ALA C C     1 
ATOM   1853  O  O     . ALA C 3  67   ? 170.361 189.488 214.021 1.00 440.00 ?  66   ALA C O     1 
ATOM   1854  C  CB    . ALA C 3  67   ? 172.425 187.238 212.621 1.00 440.00 ?  66   ALA C CB    1 
ATOM   1855  N  N     . GLY C 3  68   ? 171.860 188.701 215.453 1.00 319.34 ?  67   GLY C N     1 
ATOM   1856  C  CA    . GLY C 3  68   ? 171.134 189.019 216.659 1.00 206.55 ?  67   GLY C CA    1 
ATOM   1857  C  C     . GLY C 3  68   ? 170.806 190.503 216.800 1.00 146.67 ?  67   GLY C C     1 
ATOM   1858  O  O     . GLY C 3  68   ? 169.586 190.852 217.002 1.00 143.13 ?  67   GLY C O     1 
ATOM   1859  N  N     . ASN C 3  69   ? 171.835 191.331 216.583 1.00 151.64 ?  68   ASN C N     1 
ATOM   1860  C  CA    . ASN C 3  69   ? 171.739 192.786 216.639 1.00 179.83 ?  68   ASN C CA    1 
ATOM   1861  C  C     . ASN C 3  69   ? 170.687 193.253 215.629 1.00 182.16 ?  68   ASN C C     1 
ATOM   1862  O  O     . ASN C 3  69   ? 169.850 194.136 215.879 1.00 267.22 ?  68   ASN C O     1 
ATOM   1863  C  CB    . ASN C 3  69   ? 173.068 193.509 216.376 1.00 197.35 ?  68   ASN C CB    1 
ATOM   1864  C  CG    . ASN C 3  69   ? 174.103 193.376 217.508 1.00 211.90 ?  68   ASN C CG    1 
ATOM   1865  O  OD1   . ASN C 3  69   ? 173.768 193.123 218.656 1.00 278.69 ?  68   ASN C OD1   1 
ATOM   1866  N  ND2   . ASN C 3  69   ? 175.386 193.531 217.234 1.00 167.41 ?  68   ASN C ND2   1 
ATOM   1867  N  N     . ALA C 3  70   ? 170.750 192.674 214.425 1.00 166.69 ?  69   ALA C N     1 
ATOM   1868  C  CA    . ALA C 3  70   ? 169.881 193.075 213.323 1.00 202.00 ?  69   ALA C CA    1 
ATOM   1869  C  C     . ALA C 3  70   ? 168.423 192.785 213.630 1.00 225.50 ?  69   ALA C C     1 
ATOM   1870  O  O     . ALA C 3  70   ? 167.544 193.671 213.311 1.00 191.47 ?  69   ALA C O     1 
ATOM   1871  C  CB    . ALA C 3  70   ? 170.289 192.340 212.085 1.00 336.43 ?  69   ALA C CB    1 
ATOM   1872  N  N     . ALA C 3  71   ? 168.173 191.641 214.280 1.00 284.19 ?  70   ALA C N     1 
ATOM   1873  C  CA    . ALA C 3  71   ? 166.810 191.243 214.665 1.00 284.16 ?  70   ALA C CA    1 
ATOM   1874  C  C     . ALA C 3  71   ? 166.308 192.181 215.766 1.00 296.47 ?  70   ALA C C     1 
ATOM   1875  O  O     . ALA C 3  71   ? 165.087 192.528 215.791 1.00 235.93 ?  70   ALA C O     1 
ATOM   1876  C  CB    . ALA C 3  71   ? 166.759 189.815 215.139 1.00 262.47 ?  70   ALA C CB    1 
ATOM   1877  N  N     . ARG C 3  72   ? 167.230 192.611 216.683 1.00 329.27 ?  71   ARG C N     1 
ATOM   1878  C  CA    . ARG C 3  72   ? 166.883 193.499 217.760 1.00 287.79 ?  71   ARG C CA    1 
ATOM   1879  C  C     . ARG C 3  72   ? 166.733 194.923 217.248 1.00 254.92 ?  71   ARG C C     1 
ATOM   1880  O  O     . ARG C 3  72   ? 165.915 195.660 217.863 1.00 171.54 ?  71   ARG C O     1 
ATOM   1881  C  CB    . ARG C 3  72   ? 167.867 193.415 218.930 1.00 319.01 ?  71   ARG C CB    1 
ATOM   1882  C  CG    . ARG C 3  72   ? 167.857 192.051 219.576 1.00 303.28 ?  71   ARG C CG    1 
ATOM   1883  C  CD    . ARG C 3  72   ? 166.890 191.699 220.712 1.00 260.68 ?  71   ARG C CD    1 
ATOM   1884  N  NE    . ARG C 3  72   ? 167.509 190.735 221.622 1.00 281.16 ?  71   ARG C NE    1 
ATOM   1885  C  CZ    . ARG C 3  72   ? 167.443 189.388 221.556 1.00 261.79 ?  71   ARG C CZ    1 
ATOM   1886  N  NH1   . ARG C 3  72   ? 167.096 188.790 220.425 1.00 212.52 1  71   ARG C NH1   1 
ATOM   1887  N  NH2   . ARG C 3  72   ? 167.782 188.658 222.611 1.00 204.87 ?  71   ARG C NH2   1 
ATOM   1888  N  N     . ASP C 3  73   ? 167.471 195.322 216.195 1.00 280.35 ?  72   ASP C N     1 
ATOM   1889  C  CA    . ASP C 3  73   ? 167.384 196.603 215.563 1.00 259.45 ?  72   ASP C CA    1 
ATOM   1890  C  C     . ASP C 3  73   ? 165.903 196.918 215.232 1.00 249.98 ?  72   ASP C C     1 
ATOM   1891  O  O     . ASP C 3  73   ? 165.355 198.061 215.514 1.00 210.69 ?  72   ASP C O     1 
ATOM   1892  C  CB    . ASP C 3  73   ? 168.235 196.716 214.297 1.00 268.07 ?  72   ASP C CB    1 
ATOM   1893  C  CG    . ASP C 3  73   ? 169.676 197.143 214.455 1.00 274.29 ?  72   ASP C CG    1 
ATOM   1894  O  OD1   . ASP C 3  73   ? 169.924 197.726 215.474 1.00 304.74 ?  72   ASP C OD1   1 
ATOM   1895  O  OD2   . ASP C 3  73   ? 170.462 196.867 213.572 1.00 440.00 -1 72   ASP C OD2   1 
ATOM   1896  N  N     . ASN C 3  74   ? 165.269 195.934 214.574 1.00 246.57 ?  73   ASN C N     1 
ATOM   1897  C  CA    . ASN C 3  74   ? 163.887 196.112 214.139 1.00 216.79 ?  73   ASN C CA    1 
ATOM   1898  C  C     . ASN C 3  74   ? 162.934 195.443 215.095 1.00 196.10 ?  73   ASN C C     1 
ATOM   1899  O  O     . ASN C 3  74   ? 161.715 195.397 214.815 1.00 206.39 ?  73   ASN C O     1 
ATOM   1900  C  CB    . ASN C 3  74   ? 163.586 195.780 212.652 1.00 206.14 ?  73   ASN C CB    1 
ATOM   1901  C  CG    . ASN C 3  74   ? 164.208 196.846 211.736 1.00 194.09 ?  73   ASN C CG    1 
ATOM   1902  O  OD1   . ASN C 3  74   ? 164.431 197.943 212.230 1.00 239.04 ?  73   ASN C OD1   1 
ATOM   1903  N  ND2   . ASN C 3  74   ? 164.568 196.575 210.468 1.00 112.87 ?  73   ASN C ND2   1 
ATOM   1904  N  N     . LYS C 3  75   ? 163.483 194.977 216.206 1.00 202.78 ?  74   LYS C N     1 
ATOM   1905  C  CA    . LYS C 3  75   ? 162.767 194.385 217.390 1.00 240.22 ?  74   LYS C CA    1 
ATOM   1906  C  C     . LYS C 3  75   ? 162.082 193.050 217.032 1.00 151.76 ?  74   LYS C C     1 
ATOM   1907  O  O     . LYS C 3  75   ? 160.949 193.045 216.586 1.00 118.81 ?  74   LYS C O     1 
ATOM   1908  C  CB    . LYS C 3  75   ? 161.877 195.446 218.077 1.00 383.84 ?  74   LYS C CB    1 
ATOM   1909  C  CG    . LYS C 3  75   ? 162.590 196.612 218.772 1.00 440.00 ?  74   LYS C CG    1 
ATOM   1910  C  CD    . LYS C 3  75   ? 161.671 197.646 219.415 1.00 440.00 ?  74   LYS C CD    1 
ATOM   1911  C  CE    . LYS C 3  75   ? 162.409 198.774 220.114 1.00 440.00 ?  74   LYS C CE    1 
ATOM   1912  N  NZ    . LYS C 3  75   ? 161.479 199.767 220.703 1.00 440.00 1  74   LYS C NZ    1 
ATOM   1913  N  N     . LYS C 3  76   ? 162.781 191.952 217.245 1.00 147.97 ?  75   LYS C N     1 
ATOM   1914  C  CA    . LYS C 3  76   ? 162.296 190.633 216.951 1.00 191.16 ?  75   LYS C CA    1 
ATOM   1915  C  C     . LYS C 3  76   ? 162.913 189.665 217.946 1.00 178.23 ?  75   LYS C C     1 
ATOM   1916  O  O     . LYS C 3  76   ? 164.010 189.840 218.395 1.00 144.17 ?  75   LYS C O     1 
ATOM   1917  C  CB    . LYS C 3  76   ? 162.747 190.230 215.531 1.00 296.99 ?  75   LYS C CB    1 
ATOM   1918  C  CG    . LYS C 3  76   ? 162.308 188.821 215.108 1.00 352.99 ?  75   LYS C CG    1 
ATOM   1919  C  CD    . LYS C 3  76   ? 160.789 188.609 215.046 1.00 391.15 ?  75   LYS C CD    1 
ATOM   1920  C  CE    . LYS C 3  76   ? 160.398 187.260 214.460 1.00 372.03 ?  75   LYS C CE    1 
ATOM   1921  N  NZ    . LYS C 3  76   ? 158.939 186.942 214.584 1.00 402.12 1  75   LYS C NZ    1 
ATOM   1922  N  N     . THR C 3  77   ? 162.148 188.602 218.264 1.00 215.42 ?  76   THR C N     1 
ATOM   1923  C  CA    . THR C 3  77   ? 162.526 187.614 219.244 1.00 282.59 ?  76   THR C CA    1 
ATOM   1924  C  C     . THR C 3  77   ? 163.382 186.530 218.573 1.00 320.19 ?  76   THR C C     1 
ATOM   1925  O  O     . THR C 3  77   ? 164.391 186.108 219.115 1.00 388.85 ?  76   THR C O     1 
ATOM   1926  C  CB    . THR C 3  77   ? 161.279 187.041 219.924 1.00 313.71 ?  76   THR C CB    1 
ATOM   1927  O  OG1   . THR C 3  77   ? 160.564 186.220 218.995 1.00 316.63 ?  76   THR C OG1   1 
ATOM   1928  C  CG2   . THR C 3  77   ? 160.327 188.112 220.430 1.00 328.61 ?  76   THR C CG2   1 
ATOM   1929  N  N     . ARG C 3  78   ? 162.993 186.156 217.357 1.00 345.40 ?  77   ARG C N     1 
ATOM   1930  C  CA    . ARG C 3  78   ? 163.657 185.050 216.621 1.00 357.86 ?  77   ARG C CA    1 
ATOM   1931  C  C     . ARG C 3  78   ? 164.326 185.674 215.405 1.00 343.17 ?  77   ARG C C     1 
ATOM   1932  O  O     . ARG C 3  78   ? 163.768 186.546 214.786 1.00 432.46 ?  77   ARG C O     1 
ATOM   1933  C  CB    . ARG C 3  78   ? 162.696 183.896 216.268 1.00 337.65 ?  77   ARG C CB    1 
ATOM   1934  C  CG    . ARG C 3  78   ? 163.391 182.746 215.558 1.00 330.37 ?  77   ARG C CG    1 
ATOM   1935  C  CD    . ARG C 3  78   ? 162.472 181.623 215.155 1.00 305.35 ?  77   ARG C CD    1 
ATOM   1936  N  NE    . ARG C 3  78   ? 161.416 181.844 214.153 1.00 296.13 ?  77   ARG C NE    1 
ATOM   1937  C  CZ    . ARG C 3  78   ? 160.334 181.095 213.923 1.00 280.33 ?  77   ARG C CZ    1 
ATOM   1938  N  NH1   . ARG C 3  78   ? 159.690 180.452 214.881 1.00 278.04 1  77   ARG C NH1   1 
ATOM   1939  N  NH2   . ARG C 3  78   ? 159.782 181.108 212.703 1.00 234.22 ?  77   ARG C NH2   1 
ATOM   1940  N  N     . ILE C 3  79   ? 165.499 185.144 215.016 1.00 229.30 ?  78   ILE C N     1 
ATOM   1941  C  CA    . ILE C 3  79   ? 166.246 185.532 213.834 1.00 154.38 ?  78   ILE C CA    1 
ATOM   1942  C  C     . ILE C 3  79   ? 165.821 184.626 212.680 1.00 119.58 ?  78   ILE C C     1 
ATOM   1943  O  O     . ILE C 3  79   ? 165.636 183.423 212.844 1.00 102.98 ?  78   ILE C O     1 
ATOM   1944  C  CB    . ILE C 3  79   ? 167.777 185.400 213.997 1.00 152.62 ?  78   ILE C CB    1 
ATOM   1945  C  CG1   . ILE C 3  79   ? 168.270 186.413 215.025 1.00 192.42 ?  78   ILE C CG1   1 
ATOM   1946  C  CG2   . ILE C 3  79   ? 168.467 185.569 212.647 1.00 136.37 ?  78   ILE C CG2   1 
ATOM   1947  C  CD1   . ILE C 3  79   ? 169.661 186.174 215.550 1.00 192.91 ?  78   ILE C CD1   1 
ATOM   1948  N  N     . ILE C 3  80   ? 165.719 185.245 211.508 1.00 98.82  ?  79   ILE C N     1 
ATOM   1949  C  CA    . ILE C 3  80   ? 165.327 184.557 210.302 1.00 115.12 ?  79   ILE C CA    1 
ATOM   1950  C  C     . ILE C 3  80   ? 166.025 185.108 209.090 1.00 89.28  ?  79   ILE C C     1 
ATOM   1951  O  O     . ILE C 3  80   ? 166.543 186.209 209.114 1.00 68.17  ?  79   ILE C O     1 
ATOM   1952  C  CB    . ILE C 3  80   ? 163.814 184.644 210.089 1.00 176.00 ?  79   ILE C CB    1 
ATOM   1953  C  CG1   . ILE C 3  80   ? 163.078 183.696 211.027 1.00 268.81 ?  79   ILE C CG1   1 
ATOM   1954  C  CG2   . ILE C 3  80   ? 163.387 184.365 208.660 1.00 197.82 ?  79   ILE C CG2   1 
ATOM   1955  C  CD1   . ILE C 3  80   ? 161.601 183.980 211.327 1.00 330.00 ?  79   ILE C CD1   1 
ATOM   1956  N  N     . PRO C 3  81   ? 166.105 184.259 208.023 1.00 93.31  ?  80   PRO C N     1 
ATOM   1957  C  CA    . PRO C 3  81   ? 166.862 184.533 206.803 1.00 89.02  ?  80   PRO C CA    1 
ATOM   1958  C  C     . PRO C 3  81   ? 167.075 186.001 206.522 1.00 84.81  ?  80   PRO C C     1 
ATOM   1959  O  O     . PRO C 3  81   ? 168.200 186.370 206.133 1.00 86.30  ?  80   PRO C O     1 
ATOM   1960  C  CB    . PRO C 3  81   ? 166.022 183.860 205.720 1.00 83.70  ?  80   PRO C CB    1 
ATOM   1961  C  CG    . PRO C 3  81   ? 165.545 182.628 206.446 1.00 81.16  ?  80   PRO C CG    1 
ATOM   1962  C  CD    . PRO C 3  81   ? 165.635 182.887 207.936 1.00 82.61  ?  80   PRO C CD    1 
ATOM   1963  N  N     . ARG C 3  82   ? 166.005 186.784 206.617 1.00 83.95  ?  81   ARG C N     1 
ATOM   1964  C  CA    . ARG C 3  82   ? 165.916 188.192 206.260 1.00 96.42  ?  81   ARG C CA    1 
ATOM   1965  C  C     . ARG C 3  82   ? 166.970 188.924 207.092 1.00 105.65 ?  81   ARG C C     1 
ATOM   1966  O  O     . ARG C 3  82   ? 167.659 189.874 206.657 1.00 131.82 ?  81   ARG C O     1 
ATOM   1967  C  CB    . ARG C 3  82   ? 164.551 188.727 206.602 1.00 133.86 ?  81   ARG C CB    1 
ATOM   1968  C  CG    . ARG C 3  82   ? 163.468 187.763 206.145 1.00 281.65 ?  81   ARG C CG    1 
ATOM   1969  C  CD    . ARG C 3  82   ? 162.253 188.401 206.725 1.00 415.04 ?  81   ARG C CD    1 
ATOM   1970  N  NE    . ARG C 3  82   ? 161.852 188.019 208.074 1.00 440.00 ?  81   ARG C NE    1 
ATOM   1971  C  CZ    . ARG C 3  82   ? 160.756 187.283 208.360 1.00 440.00 ?  81   ARG C CZ    1 
ATOM   1972  N  NH1   . ARG C 3  82   ? 160.286 186.416 207.474 1.00 423.47 1  81   ARG C NH1   1 
ATOM   1973  N  NH2   . ARG C 3  82   ? 160.096 187.418 209.524 1.00 440.00 ?  81   ARG C NH2   1 
ATOM   1974  N  N     . HIS C 3  83   ? 167.080 188.475 208.341 1.00 109.50 ?  82   HIS C N     1 
ATOM   1975  C  CA    . HIS C 3  83   ? 167.974 189.110 209.301 1.00 114.20 ?  82   HIS C CA    1 
ATOM   1976  C  C     . HIS C 3  83   ? 169.447 188.898 208.872 1.00 91.06  ?  82   HIS C C     1 
ATOM   1977  O  O     . HIS C 3  83   ? 170.243 189.794 209.053 1.00 63.96  ?  82   HIS C O     1 
ATOM   1978  C  CB    . HIS C 3  83   ? 167.731 188.526 210.703 1.00 123.15 ?  82   HIS C CB    1 
ATOM   1979  C  CG    . HIS C 3  83   ? 166.474 189.114 211.264 1.00 114.30 ?  82   HIS C CG    1 
ATOM   1980  N  ND1   . HIS C 3  83   ? 165.874 188.604 212.360 1.00 115.66 ?  82   HIS C ND1   1 
ATOM   1981  C  CD2   . HIS C 3  83   ? 165.705 190.126 210.775 1.00 138.31 ?  82   HIS C CD2   1 
ATOM   1982  C  CE1   . HIS C 3  83   ? 164.756 189.310 212.573 1.00 190.89 ?  82   HIS C CE1   1 
ATOM   1983  N  NE2   . HIS C 3  83   ? 164.616 190.234 211.590 1.00 194.27 ?  82   HIS C NE2   1 
ATOM   1984  N  N     . LEU C 3  84   ? 169.753 187.659 208.440 1.00 85.57  ?  83   LEU C N     1 
ATOM   1985  C  CA    . LEU C 3  84   ? 171.090 187.258 208.329 1.00 77.20  ?  83   LEU C CA    1 
ATOM   1986  C  C     . LEU C 3  84   ? 171.785 188.169 207.329 1.00 74.86  ?  83   LEU C C     1 
ATOM   1987  O  O     . LEU C 3  84   ? 172.873 188.550 207.505 1.00 60.56  ?  83   LEU C O     1 
ATOM   1988  C  CB    . LEU C 3  84   ? 171.193 185.822 207.821 1.00 78.82  ?  83   LEU C CB    1 
ATOM   1989  C  CG    . LEU C 3  84   ? 171.129 184.761 208.904 1.00 71.21  ?  83   LEU C CG    1 
ATOM   1990  C  CD1   . LEU C 3  84   ? 170.058 185.020 209.975 1.00 63.21  ?  83   LEU C CD1   1 
ATOM   1991  C  CD2   . LEU C 3  84   ? 170.897 183.424 208.258 1.00 74.88  ?  83   LEU C CD2   1 
ATOM   1992  N  N     . GLN C 3  85   ? 171.144 188.372 206.167 1.00 115.61 ?  84   GLN C N     1 
ATOM   1993  C  CA    . GLN C 3  85   ? 171.753 189.140 205.087 1.00 187.27 ?  84   GLN C CA    1 
ATOM   1994  C  C     . GLN C 3  85   ? 171.750 190.596 205.516 1.00 145.29 ?  84   GLN C C     1 
ATOM   1995  O  O     . GLN C 3  85   ? 172.624 191.342 205.172 1.00 186.57 ?  84   GLN C O     1 
ATOM   1996  C  CB    . GLN C 3  85   ? 171.004 188.962 203.767 1.00 310.12 ?  84   GLN C CB    1 
ATOM   1997  C  CG    . GLN C 3  85   ? 171.579 189.714 202.570 1.00 391.36 ?  84   GLN C CG    1 
ATOM   1998  C  CD    . GLN C 3  85   ? 170.677 189.646 201.355 1.00 440.00 ?  84   GLN C CD    1 
ATOM   1999  O  OE1   . GLN C 3  85   ? 169.762 188.798 201.264 1.00 440.00 ?  84   GLN C OE1   1 
ATOM   2000  N  NE2   . GLN C 3  85   ? 171.105 190.404 200.344 1.00 440.00 ?  84   GLN C NE2   1 
ATOM   2001  N  N     . LEU C 3  86   ? 170.678 191.038 206.190 1.00 111.45 ?  85   LEU C N     1 
ATOM   2002  C  CA    . LEU C 3  86   ? 170.600 192.430 206.644 1.00 106.28 ?  85   LEU C CA    1 
ATOM   2003  C  C     . LEU C 3  86   ? 171.875 192.709 207.451 1.00 107.37 ?  85   LEU C C     1 
ATOM   2004  O  O     . LEU C 3  86   ? 172.455 193.793 207.316 1.00 108.06 ?  85   LEU C O     1 
ATOM   2005  C  CB    . LEU C 3  86   ? 169.308 192.618 207.430 1.00 102.33 ?  85   LEU C CB    1 
ATOM   2006  C  CG    . LEU C 3  86   ? 168.056 192.311 206.577 1.00 138.86 ?  85   LEU C CG    1 
ATOM   2007  C  CD1   . LEU C 3  86   ? 166.779 192.272 207.429 1.00 119.50 ?  85   LEU C CD1   1 
ATOM   2008  C  CD2   . LEU C 3  86   ? 167.815 193.246 205.353 1.00 148.96 ?  85   LEU C CD2   1 
ATOM   2009  N  N     . ALA C 3  87   ? 172.296 191.721 208.224 1.00 116.17 ?  86   ALA C N     1 
ATOM   2010  C  CA    . ALA C 3  87   ? 173.417 191.820 209.134 1.00 139.77 ?  86   ALA C CA    1 
ATOM   2011  C  C     . ALA C 3  87   ? 174.729 191.977 208.364 1.00 99.46  ?  86   ALA C C     1 
ATOM   2012  O  O     . ALA C 3  87   ? 175.568 192.832 208.713 1.00 62.27  ?  86   ALA C O     1 
ATOM   2013  C  CB    . ALA C 3  87   ? 173.563 190.650 210.132 1.00 162.83 ?  86   ALA C CB    1 
ATOM   2014  N  N     . VAL C 3  88   ? 174.871 191.102 207.346 1.00 101.03 ?  87   VAL C N     1 
ATOM   2015  C  CA    . VAL C 3  88   ? 176.049 190.919 206.602 1.00 114.40 ?  87   VAL C CA    1 
ATOM   2016  C  C     . VAL C 3  88   ? 176.151 192.002 205.537 1.00 109.88 ?  87   VAL C C     1 
ATOM   2017  O  O     . VAL C 3  88   ? 177.259 192.531 205.190 1.00 136.08 ?  87   VAL C O     1 
ATOM   2018  C  CB    . VAL C 3  88   ? 176.119 189.517 205.957 1.00 126.00 ?  87   VAL C CB    1 
ATOM   2019  C  CG1   . VAL C 3  88   ? 177.379 189.388 205.030 1.00 179.98 ?  87   VAL C CG1   1 
ATOM   2020  C  CG2   . VAL C 3  88   ? 176.076 188.423 207.012 1.00 98.29  ?  87   VAL C CG2   1 
ATOM   2021  N  N     . ARG C 3  89   ? 175.037 192.240 204.854 1.00 143.44 ?  88   ARG C N     1 
ATOM   2022  C  CA    . ARG C 3  89   ? 175.020 193.198 203.768 1.00 176.84 ?  88   ARG C CA    1 
ATOM   2023  C  C     . ARG C 3  89   ? 175.443 194.570 204.287 1.00 134.99 ?  88   ARG C C     1 
ATOM   2024  O  O     . ARG C 3  89   ? 176.135 195.286 203.615 1.00 116.94 ?  88   ARG C O     1 
ATOM   2025  C  CB    . ARG C 3  89   ? 173.647 193.235 203.111 1.00 262.44 ?  88   ARG C CB    1 
ATOM   2026  C  CG    . ARG C 3  89   ? 173.513 194.156 201.927 1.00 340.80 ?  88   ARG C CG    1 
ATOM   2027  C  CD    . ARG C 3  89   ? 174.692 194.083 200.968 1.00 363.55 ?  88   ARG C CD    1 
ATOM   2028  N  NE    . ARG C 3  89   ? 174.612 195.029 199.859 1.00 395.72 ?  88   ARG C NE    1 
ATOM   2029  C  CZ    . ARG C 3  89   ? 175.288 196.177 199.757 1.00 434.40 ?  88   ARG C CZ    1 
ATOM   2030  N  NH1   . ARG C 3  89   ? 176.075 196.592 200.733 1.00 430.60 1  88   ARG C NH1   1 
ATOM   2031  N  NH2   . ARG C 3  89   ? 175.159 196.917 198.672 1.00 440.00 ?  88   ARG C NH2   1 
ATOM   2032  N  N     . ASN C 3  90   ? 174.951 194.967 205.450 1.00 122.78 ?  89   ASN C N     1 
ATOM   2033  C  CA    . ASN C 3  90   ? 175.320 196.203 206.082 1.00 139.70 ?  89   ASN C CA    1 
ATOM   2034  C  C     . ASN C 3  90   ? 176.763 196.230 206.562 1.00 150.08 ?  89   ASN C C     1 
ATOM   2035  O  O     . ASN C 3  90   ? 177.420 197.335 206.472 1.00 147.22 ?  89   ASN C O     1 
ATOM   2036  C  CB    . ASN C 3  90   ? 174.384 196.425 207.255 1.00 154.34 ?  89   ASN C CB    1 
ATOM   2037  C  CG    . ASN C 3  90   ? 173.024 196.920 206.812 1.00 205.29 ?  89   ASN C CG    1 
ATOM   2038  O  OD1   . ASN C 3  90   ? 172.902 198.117 206.508 1.00 253.32 ?  89   ASN C OD1   1 
ATOM   2039  N  ND2   . ASN C 3  90   ? 171.983 196.064 206.854 1.00 170.96 ?  89   ASN C ND2   1 
ATOM   2040  N  N     . ASP C 3  91   ? 177.189 195.131 207.152 1.00 159.26 ?  90   ASP C N     1 
ATOM   2041  C  CA    . ASP C 3  91   ? 178.586 195.043 207.634 1.00 204.50 ?  90   ASP C CA    1 
ATOM   2042  C  C     . ASP C 3  91   ? 179.491 195.274 206.413 1.00 293.87 ?  90   ASP C C     1 
ATOM   2043  O  O     . ASP C 3  91   ? 179.199 194.789 205.381 1.00 440.00 ?  90   ASP C O     1 
ATOM   2044  C  CB    . ASP C 3  91   ? 178.847 193.705 208.337 1.00 157.41 ?  90   ASP C CB    1 
ATOM   2045  C  CG    . ASP C 3  91   ? 178.055 193.468 209.582 1.00 156.08 ?  90   ASP C CG    1 
ATOM   2046  O  OD1   . ASP C 3  91   ? 177.552 194.421 210.178 1.00 179.89 ?  90   ASP C OD1   1 
ATOM   2047  O  OD2   . ASP C 3  91   ? 177.989 192.352 209.977 1.00 284.18 -1 90   ASP C OD2   1 
ATOM   2048  N  N     . GLU C 3  92   ? 180.558 196.071 206.543 1.00 238.99 ?  91   GLU C N     1 
ATOM   2049  C  CA    . GLU C 3  92   ? 181.611 196.217 205.501 1.00 201.66 ?  91   GLU C CA    1 
ATOM   2050  C  C     . GLU C 3  92   ? 182.474 194.978 205.154 1.00 153.00 ?  91   GLU C C     1 
ATOM   2051  O  O     . GLU C 3  92   ? 182.805 194.779 203.935 1.00 107.85 ?  91   GLU C O     1 
ATOM   2052  C  CB    . GLU C 3  92   ? 182.540 197.339 205.918 1.00 177.84 ?  91   GLU C CB    1 
ATOM   2053  C  CG    . GLU C 3  92   ? 183.628 197.582 204.882 1.00 172.85 ?  91   GLU C CG    1 
ATOM   2054  C  CD    . GLU C 3  92   ? 184.771 196.603 205.029 1.00 161.78 ?  91   GLU C CD    1 
ATOM   2055  O  OE1   . GLU C 3  92   ? 184.827 195.961 206.029 1.00 195.41 ?  91   GLU C OE1   1 
ATOM   2056  O  OE2   . GLU C 3  92   ? 185.594 196.530 204.201 1.00 267.39 -1 91   GLU C OE2   1 
ATOM   2057  N  N     . GLU C 3  93   ? 182.907 194.228 206.171 1.00 134.41 ?  92   GLU C N     1 
ATOM   2058  C  CA    . GLU C 3  93   ? 183.854 193.157 206.067 1.00 135.53 ?  92   GLU C CA    1 
ATOM   2059  C  C     . GLU C 3  93   ? 183.259 191.830 205.578 1.00 104.82 ?  92   GLU C C     1 
ATOM   2060  O  O     . GLU C 3  93   ? 183.823 191.200 204.521 1.00 151.58 ?  92   GLU C O     1 
ATOM   2061  C  CB    . GLU C 3  93   ? 184.435 192.831 207.444 1.00 166.15 ?  92   GLU C CB    1 
ATOM   2062  C  CG    . GLU C 3  93   ? 185.172 193.989 208.082 1.00 211.25 ?  92   GLU C CG    1 
ATOM   2063  C  CD    . GLU C 3  93   ? 184.253 195.038 208.647 1.00 230.62 ?  92   GLU C CD    1 
ATOM   2064  O  OE1   . GLU C 3  93   ? 183.041 194.827 208.583 1.00 224.24 ?  92   GLU C OE1   1 
ATOM   2065  O  OE2   . GLU C 3  93   ? 184.763 196.030 209.156 1.00 198.56 -1 92   GLU C OE2   1 
ATOM   2066  N  N     . LEU C 3  94   ? 182.372 191.248 206.442 1.00 88.36  ?  93   LEU C N     1 
ATOM   2067  C  CA    . LEU C 3  94   ? 181.720 190.003 206.057 1.00 109.09 ?  93   LEU C CA    1 
ATOM   2068  C  C     . LEU C 3  94   ? 181.215 190.141 204.610 1.00 141.56 ?  93   LEU C C     1 
ATOM   2069  O  O     . LEU C 3  94   ? 181.359 189.215 203.816 1.00 143.73 ?  93   LEU C O     1 
ATOM   2070  C  CB    . LEU C 3  94   ? 180.622 189.682 207.071 1.00 106.40 ?  93   LEU C CB    1 
ATOM   2071  C  CG    . LEU C 3  94   ? 181.146 189.094 208.379 1.00 102.03 ?  93   LEU C CG    1 
ATOM   2072  C  CD1   . LEU C 3  94   ? 180.037 188.780 209.410 1.00 99.72  ?  93   LEU C CD1   1 
ATOM   2073  C  CD2   . LEU C 3  94   ? 181.928 187.836 208.035 1.00 86.06  ?  93   LEU C CD2   1 
ATOM   2074  N  N     . ASN C 3  95   ? 180.615 191.306 204.348 1.00 190.56 ?  94   ASN C N     1 
ATOM   2075  C  CA    . ASN C 3  95   ? 179.964 191.565 203.058 1.00 204.31 ?  94   ASN C CA    1 
ATOM   2076  C  C     . ASN C 3  95   ? 180.919 191.312 201.897 1.00 158.43 ?  94   ASN C C     1 
ATOM   2077  O  O     . ASN C 3  95   ? 180.500 190.697 200.893 1.00 173.82 ?  94   ASN C O     1 
ATOM   2078  C  CB    . ASN C 3  95   ? 179.482 193.003 202.923 1.00 305.33 ?  94   ASN C CB    1 
ATOM   2079  C  CG    . ASN C 3  95   ? 178.521 193.223 201.774 1.00 364.13 ?  94   ASN C CG    1 
ATOM   2080  O  OD1   . ASN C 3  95   ? 177.746 192.359 201.367 1.00 384.29 ?  94   ASN C OD1   1 
ATOM   2081  N  ND2   . ASN C 3  95   ? 178.567 194.407 201.195 1.00 400.00 ?  94   ASN C ND2   1 
ATOM   2082  N  N     . LYS C 3  96   ? 182.188 191.670 202.063 1.00 143.29 ?  95   LYS C N     1 
ATOM   2083  C  CA    . LYS C 3  96   ? 183.120 191.430 201.003 1.00 130.35 ?  95   LYS C CA    1 
ATOM   2084  C  C     . LYS C 3  96   ? 183.543 189.971 200.934 1.00 106.19 ?  95   LYS C C     1 
ATOM   2085  O  O     . LYS C 3  96   ? 183.725 189.426 199.833 1.00 89.31  ?  95   LYS C O     1 
ATOM   2086  C  CB    . LYS C 3  96   ? 184.335 192.374 201.046 1.00 124.17 ?  95   LYS C CB    1 
ATOM   2087  C  CG    . LYS C 3  96   ? 183.935 193.821 200.811 1.00 125.79 ?  95   LYS C CG    1 
ATOM   2088  C  CD    . LYS C 3  96   ? 185.182 194.892 200.842 1.00 169.80 ?  95   LYS C CD    1 
ATOM   2089  C  CE    . LYS C 3  96   ? 184.813 196.390 200.654 1.00 207.60 ?  95   LYS C CE    1 
ATOM   2090  N  NZ    . LYS C 3  96   ? 184.191 196.634 199.262 1.00 255.89 1  95   LYS C NZ    1 
ATOM   2091  N  N     . LEU C 3  97   ? 183.704 189.350 202.087 1.00 103.74 ?  96   LEU C N     1 
ATOM   2092  C  CA    . LEU C 3  97   ? 184.091 187.934 202.119 1.00 94.44  ?  96   LEU C CA    1 
ATOM   2093  C  C     . LEU C 3  97   ? 183.054 187.106 201.357 1.00 111.80 ?  96   LEU C C     1 
ATOM   2094  O  O     . LEU C 3  97   ? 183.465 186.169 200.611 1.00 109.89 ?  96   LEU C O     1 
ATOM   2095  C  CB    . LEU C 3  97   ? 184.135 187.410 203.565 1.00 125.10 ?  96   LEU C CB    1 
ATOM   2096  C  CG    . LEU C 3  97   ? 183.926 185.863 203.744 1.00 119.55 ?  96   LEU C CG    1 
ATOM   2097  C  CD1   . LEU C 3  97   ? 185.064 185.007 203.270 1.00 121.74 ?  96   LEU C CD1   1 
ATOM   2098  C  CD2   . LEU C 3  97   ? 183.470 185.439 205.117 1.00 103.12 ?  96   LEU C CD2   1 
ATOM   2099  N  N     . LEU C 3  98   ? 181.731 187.404 201.570 1.00 110.65 ?  97   LEU C N     1 
ATOM   2100  C  CA    . LEU C 3  98   ? 180.676 186.753 200.851 1.00 109.15 ?  97   LEU C CA    1 
ATOM   2101  C  C     . LEU C 3  98   ? 180.092 187.786 199.913 1.00 133.35 ?  97   LEU C C     1 
ATOM   2102  O  O     . LEU C 3  98   ? 178.958 188.173 200.121 1.00 156.76 ?  97   LEU C O     1 
ATOM   2103  C  CB    . LEU C 3  98   ? 179.636 186.251 201.863 1.00 81.30  ?  97   LEU C CB    1 
ATOM   2104  C  CG    . LEU C 3  98   ? 180.083 185.207 202.903 1.00 68.85  ?  97   LEU C CG    1 
ATOM   2105  C  CD1   . LEU C 3  98   ? 178.933 184.895 203.789 1.00 70.78  ?  97   LEU C CD1   1 
ATOM   2106  C  CD2   . LEU C 3  98   ? 180.634 183.955 202.271 1.00 71.81  ?  97   LEU C CD2   1 
ATOM   2107  N  N     . GLY C 3  99   ? 180.903 188.334 199.026 1.00 172.50 ?  98   GLY C N     1 
ATOM   2108  C  CA    . GLY C 3  99   ? 180.555 189.345 198.038 1.00 148.86 ?  98   GLY C CA    1 
ATOM   2109  C  C     . GLY C 3  99   ? 179.549 188.874 196.965 1.00 121.56 ?  98   GLY C C     1 
ATOM   2110  O  O     . GLY C 3  99   ? 178.602 189.599 196.578 1.00 149.87 ?  98   GLY C O     1 
ATOM   2111  N  N     . ARG C 3  100  ? 179.777 187.692 196.423 1.00 113.10 ?  99   ARG C N     1 
ATOM   2112  C  CA    . ARG C 3  100  ? 178.973 187.202 195.286 1.00 128.64 ?  99   ARG C CA    1 
ATOM   2113  C  C     . ARG C 3  100  ? 178.261 185.906 195.671 1.00 109.15 ?  99   ARG C C     1 
ATOM   2114  O  O     . ARG C 3  100  ? 177.951 185.109 194.713 1.00 130.77 ?  99   ARG C O     1 
ATOM   2115  C  CB    . ARG C 3  100  ? 179.816 186.905 194.012 1.00 191.50 ?  99   ARG C CB    1 
ATOM   2116  C  CG    . ARG C 3  100  ? 180.897 187.915 193.683 1.00 245.43 ?  99   ARG C CG    1 
ATOM   2117  C  CD    . ARG C 3  100  ? 180.424 189.148 192.939 1.00 257.45 ?  99   ARG C CD    1 
ATOM   2118  N  NE    . ARG C 3  100  ? 181.541 189.785 192.264 1.00 244.58 ?  99   ARG C NE    1 
ATOM   2119  C  CZ    . ARG C 3  100  ? 182.345 190.716 192.793 1.00 207.65 ?  99   ARG C CZ    1 
ATOM   2120  N  NH1   . ARG C 3  100  ? 182.055 191.255 193.973 1.00 141.22 1  99   ARG C NH1   1 
ATOM   2121  N  NH2   . ARG C 3  100  ? 183.462 191.043 192.159 1.00 206.88 ?  99   ARG C NH2   1 
ATOM   2122  N  N     . VAL C 3  101  ? 178.114 185.619 196.955 1.00 95.18  ?  100  VAL C N     1 
ATOM   2123  C  CA    . VAL C 3  101  ? 177.363 184.388 197.321 1.00 103.61 ?  100  VAL C CA    1 
ATOM   2124  C  C     . VAL C 3  101  ? 175.979 184.761 197.738 1.00 150.08 ?  100  VAL C C     1 
ATOM   2125  O  O     . VAL C 3  101  ? 175.877 185.612 198.547 1.00 197.47 ?  100  VAL C O     1 
ATOM   2126  C  CB    . VAL C 3  101  ? 177.962 183.644 198.489 1.00 76.43  ?  100  VAL C CB    1 
ATOM   2127  C  CG1   . VAL C 3  101  ? 179.287 183.031 198.090 1.00 88.52  ?  100  VAL C CG1   1 
ATOM   2128  C  CG2   . VAL C 3  101  ? 178.096 184.490 199.755 1.00 66.68  ?  100  VAL C CG2   1 
ATOM   2129  N  N     . THR C 3  102  ? 174.977 184.242 197.024 1.00 190.36 ?  101  THR C N     1 
ATOM   2130  C  CA    . THR C 3  102  ? 173.670 184.927 197.001 1.00 206.65 ?  101  THR C CA    1 
ATOM   2131  C  C     . THR C 3  102  ? 172.575 184.094 197.690 1.00 179.50 ?  101  THR C C     1 
ATOM   2132  O  O     . THR C 3  102  ? 172.746 182.884 197.953 1.00 125.66 ?  101  THR C O     1 
ATOM   2133  C  CB    . THR C 3  102  ? 173.088 185.302 195.643 1.00 218.18 ?  101  THR C CB    1 
ATOM   2134  O  OG1   . THR C 3  102  ? 172.902 184.024 195.027 1.00 161.85 ?  101  THR C OG1   1 
ATOM   2135  C  CG2   . THR C 3  102  ? 173.930 186.343 194.926 1.00 193.88 ?  101  THR C CG2   1 
ATOM   2136  N  N     . ILE C 3  103  ? 171.507 184.798 198.129 1.00 168.44 ?  102  ILE C N     1 
ATOM   2137  C  CA    . ILE C 3  103  ? 170.988 184.384 199.397 1.00 158.85 ?  102  ILE C CA    1 
ATOM   2138  C  C     . ILE C 3  103  ? 169.458 184.279 199.505 1.00 178.85 ?  102  ILE C C     1 
ATOM   2139  O  O     . ILE C 3  103  ? 168.566 185.289 199.357 1.00 159.43 ?  102  ILE C O     1 
ATOM   2140  C  CB    . ILE C 3  103  ? 171.565 185.136 200.611 1.00 152.08 ?  102  ILE C CB    1 
ATOM   2141  C  CG1   . ILE C 3  103  ? 171.132 184.325 201.853 1.00 124.36 ?  102  ILE C CG1   1 
ATOM   2142  C  CG2   . ILE C 3  103  ? 171.253 186.612 200.582 1.00 172.02 ?  102  ILE C CG2   1 
ATOM   2143  C  CD1   . ILE C 3  103  ? 171.773 182.949 202.037 1.00 90.14  ?  102  ILE C CD1   1 
ATOM   2144  N  N     . ALA C 3  104  ? 169.154 183.066 200.055 1.00 184.34 ?  103  ALA C N     1 
ATOM   2145  C  CA    . ALA C 3  104  ? 167.858 182.446 200.380 1.00 165.39 ?  103  ALA C CA    1 
ATOM   2146  C  C     . ALA C 3  104  ? 166.903 183.493 200.967 1.00 197.85 ?  103  ALA C C     1 
ATOM   2147  O  O     . ALA C 3  104  ? 167.153 183.857 202.085 1.00 263.30 ?  103  ALA C O     1 
ATOM   2148  C  CB    . ALA C 3  104  ? 168.113 181.315 201.336 1.00 108.92 ?  103  ALA C CB    1 
ATOM   2149  N  N     . GLN C 3  105  ? 165.764 183.771 200.270 1.00 156.39 ?  104  GLN C N     1 
ATOM   2150  C  CA    . GLN C 3  105  ? 164.664 184.477 200.795 1.00 117.19 ?  104  GLN C CA    1 
ATOM   2151  C  C     . GLN C 3  105  ? 165.142 185.757 201.481 1.00 78.05  ?  104  GLN C C     1 
ATOM   2152  O  O     . GLN C 3  105  ? 164.974 185.839 202.746 1.00 61.73  ?  104  GLN C O     1 
ATOM   2153  C  CB    . GLN C 3  105  ? 164.024 183.550 201.849 1.00 152.96 ?  104  GLN C CB    1 
ATOM   2154  C  CG    . GLN C 3  105  ? 163.444 182.229 201.342 1.00 202.96 ?  104  GLN C CG    1 
ATOM   2155  C  CD    . GLN C 3  105  ? 163.582 180.991 202.207 1.00 184.33 ?  104  GLN C CD    1 
ATOM   2156  O  OE1   . GLN C 3  105  ? 164.560 180.673 202.886 1.00 107.01 ?  104  GLN C OE1   1 
ATOM   2157  N  NE2   . GLN C 3  105  ? 162.519 180.240 202.106 1.00 237.33 ?  104  GLN C NE2   1 
ATOM   2158  N  N     . GLY C 3  106  ? 165.886 186.603 200.769 1.00 76.12  ?  105  GLY C N     1 
ATOM   2159  C  CA    . GLY C 3  106  ? 166.746 187.556 201.498 1.00 90.03  ?  105  GLY C CA    1 
ATOM   2160  C  C     . GLY C 3  106  ? 166.342 188.987 201.475 1.00 85.81  ?  105  GLY C C     1 
ATOM   2161  O  O     . GLY C 3  106  ? 166.622 189.728 202.407 1.00 65.36  ?  105  GLY C O     1 
ATOM   2162  N  N     . ARG C 3  107  ? 165.810 189.327 200.313 1.00 112.21 ?  106  ARG C N     1 
ATOM   2163  C  CA    . ARG C 3  107  ? 165.469 190.695 200.057 1.00 152.34 ?  106  ARG C CA    1 
ATOM   2164  C  C     . ARG C 3  107  ? 166.670 191.606 200.253 1.00 141.66 ?  106  ARG C C     1 
ATOM   2165  O  O     . ARG C 3  107  ? 167.736 191.190 199.911 1.00 155.31 ?  106  ARG C O     1 
ATOM   2166  N  N     . VAL C 3  108  ? 166.488 192.860 200.674 1.00 150.52 ?  107  VAL C N     1 
ATOM   2167  C  CA    . VAL C 3  108  ? 167.530 193.849 200.434 1.00 171.06 ?  107  VAL C CA    1 
ATOM   2168  C  C     . VAL C 3  108  ? 167.387 195.062 201.363 1.00 200.89 ?  107  VAL C C     1 
ATOM   2169  O  O     . VAL C 3  108  ? 166.347 195.400 201.742 1.00 177.59 ?  107  VAL C O     1 
ATOM   2170  C  CB    . VAL C 3  108  ? 167.535 194.267 198.931 1.00 137.44 ?  107  VAL C CB    1 
ATOM   2171  C  CG1   . VAL C 3  108  ? 166.382 195.176 198.580 1.00 133.02 ?  107  VAL C CG1   1 
ATOM   2172  C  CG2   . VAL C 3  108  ? 168.798 194.980 198.517 1.00 138.06 ?  107  VAL C CG2   1 
ATOM   2173  N  N     . LEU C 3  109  ? 168.506 195.763 201.526 1.00 209.13 ?  108  LEU C N     1 
ATOM   2174  C  CA    . LEU C 3  109  ? 168.606 197.002 202.251 1.00 178.36 ?  108  LEU C CA    1 
ATOM   2175  C  C     . LEU C 3  109  ? 167.737 198.116 201.646 1.00 166.80 ?  108  LEU C C     1 
ATOM   2176  O  O     . LEU C 3  109  ? 167.503 198.276 200.432 1.00 164.19 ?  108  LEU C O     1 
ATOM   2177  C  CB    . LEU C 3  109  ? 170.082 197.429 202.264 1.00 214.41 ?  108  LEU C CB    1 
ATOM   2178  C  CG    . LEU C 3  109  ? 170.761 197.641 200.894 1.00 295.82 ?  108  LEU C CG    1 
ATOM   2179  C  CD1   . LEU C 3  109  ? 170.557 199.118 200.466 1.00 274.58 ?  108  LEU C CD1   1 
ATOM   2180  C  CD2   . LEU C 3  109  ? 172.286 197.188 200.858 1.00 397.35 ?  108  LEU C CD2   1 
ATOM   2181  N  N     . PRO C 3  110  ? 167.203 198.968 202.506 1.00 175.45 ?  109  PRO C N     1 
ATOM   2182  C  CA    . PRO C 3  110  ? 166.506 200.153 202.037 1.00 149.73 ?  109  PRO C CA    1 
ATOM   2183  C  C     . PRO C 3  110  ? 167.534 201.026 201.371 1.00 90.44  ?  109  PRO C C     1 
ATOM   2184  O  O     . PRO C 3  110  ? 168.505 201.214 201.910 1.00 81.08  ?  109  PRO C O     1 
ATOM   2185  C  CB    . PRO C 3  110  ? 166.029 200.844 203.319 1.00 237.54 ?  109  PRO C CB    1 
ATOM   2186  C  CG    . PRO C 3  110  ? 165.927 199.687 204.287 1.00 291.89 ?  109  PRO C CG    1 
ATOM   2187  C  CD    . PRO C 3  110  ? 167.144 198.846 203.965 1.00 250.17 ?  109  PRO C CD    1 
ATOM   2188  N  N     . ASN C 3  111  ? 167.232 201.468 200.195 1.00 85.52  ?  110  ASN C N     1 
ATOM   2189  C  CA    . ASN C 3  111  ? 168.070 202.297 199.506 1.00 107.69 ?  110  ASN C CA    1 
ATOM   2190  C  C     . ASN C 3  111  ? 167.252 203.311 198.710 1.00 99.34  ?  110  ASN C C     1 
ATOM   2191  O  O     . ASN C 3  111  ? 166.318 202.928 197.940 1.00 90.83  ?  110  ASN C O     1 
ATOM   2192  C  CB    . ASN C 3  111  ? 168.885 201.403 198.573 1.00 151.47 ?  110  ASN C CB    1 
ATOM   2193  C  CG    . ASN C 3  111  ? 170.112 202.026 197.932 1.00 201.81 ?  110  ASN C CG    1 
ATOM   2194  O  OD1   . ASN C 3  111  ? 170.276 203.235 197.872 1.00 235.76 ?  110  ASN C OD1   1 
ATOM   2195  N  ND2   . ASN C 3  111  ? 171.018 201.169 197.495 1.00 189.06 ?  110  ASN C ND2   1 
ATOM   2196  N  N     . ILE C 3  112  ? 167.519 204.607 198.890 1.00 121.25 ?  111  ILE C N     1 
ATOM   2197  C  CA    . ILE C 3  112  ? 166.884 205.627 198.039 1.00 162.32 ?  111  ILE C CA    1 
ATOM   2198  C  C     . ILE C 3  112  ? 167.986 206.444 197.383 1.00 143.21 ?  111  ILE C C     1 
ATOM   2199  O  O     . ILE C 3  112  ? 168.725 207.038 198.004 1.00 129.66 ?  111  ILE C O     1 
ATOM   2200  C  CB    . ILE C 3  112  ? 165.924 206.574 198.794 1.00 243.15 ?  111  ILE C CB    1 
ATOM   2201  C  CG1   . ILE C 3  112  ? 165.054 205.783 199.778 1.00 278.41 ?  111  ILE C CG1   1 
ATOM   2202  C  CG2   . ILE C 3  112  ? 165.130 207.422 197.821 1.00 229.45 ?  111  ILE C CG2   1 
ATOM   2203  C  CD1   . ILE C 3  112  ? 164.499 204.439 199.300 1.00 240.02 ?  111  ILE C CD1   1 
ATOM   2204  N  N     . GLN C 3  113  ? 168.008 206.431 196.053 1.00 155.16 ?  112  GLN C N     1 
ATOM   2205  C  CA    . GLN C 3  113  ? 168.946 207.128 195.235 1.00 197.42 ?  112  GLN C CA    1 
ATOM   2206  C  C     . GLN C 3  113  ? 168.651 208.621 195.280 1.00 159.62 ?  112  GLN C C     1 
ATOM   2207  O  O     . GLN C 3  113  ? 167.605 209.076 195.531 1.00 123.00 ?  112  GLN C O     1 
ATOM   2208  C  CB    . GLN C 3  113  ? 168.877 206.587 193.804 1.00 345.14 ?  112  GLN C CB    1 
ATOM   2209  C  CG    . GLN C 3  113  ? 169.461 205.172 193.701 1.00 440.00 ?  112  GLN C CG    1 
ATOM   2210  C  CD    . GLN C 3  113  ? 168.743 204.099 192.881 1.00 440.00 ?  112  GLN C CD    1 
ATOM   2211  O  OE1   . GLN C 3  113  ? 167.596 203.732 193.165 1.00 440.00 ?  112  GLN C OE1   1 
ATOM   2212  N  NE2   . GLN C 3  113  ? 169.423 203.530 191.879 1.00 440.00 ?  112  GLN C NE2   1 
ATOM   2213  N  N     . SER C 3  114  ? 169.680 209.426 195.052 1.00 196.61 ?  113  SER C N     1 
ATOM   2214  C  CA    . SER C 3  114  ? 169.743 210.844 195.519 1.00 268.83 ?  113  SER C CA    1 
ATOM   2215  C  C     . SER C 3  114  ? 168.733 211.801 194.892 1.00 298.88 ?  113  SER C C     1 
ATOM   2216  O  O     . SER C 3  114  ? 168.043 212.512 195.662 1.00 400.68 ?  113  SER C O     1 
ATOM   2217  C  CB    . SER C 3  114  ? 171.159 211.370 195.408 1.00 343.22 ?  113  SER C CB    1 
ATOM   2218  O  OG    . SER C 3  114  ? 171.608 211.316 194.066 1.00 366.30 ?  113  SER C OG    1 
ATOM   2219  N  N     . VAL C 3  115  ? 168.872 211.935 193.562 1.00 268.57 ?  114  VAL C N     1 
ATOM   2220  C  CA    . VAL C 3  115  ? 168.113 212.837 192.646 1.00 275.90 ?  114  VAL C CA    1 
ATOM   2221  C  C     . VAL C 3  115  ? 166.757 212.215 192.321 1.00 304.29 ?  114  VAL C C     1 
ATOM   2222  O  O     . VAL C 3  115  ? 166.091 212.687 191.378 1.00 365.68 ?  114  VAL C O     1 
ATOM   2223  C  CB    . VAL C 3  115  ? 168.914 213.137 191.362 1.00 226.48 ?  114  VAL C CB    1 
ATOM   2224  C  CG1   . VAL C 3  115  ? 168.277 214.252 190.547 1.00 184.00 ?  114  VAL C CG1   1 
ATOM   2225  C  CG2   . VAL C 3  115  ? 170.369 213.458 191.668 1.00 199.94 ?  114  VAL C CG2   1 
ATOM   2226  N  N     . LEU C 3  116  ? 166.377 211.191 193.090 1.00 307.21 ?  115  LEU C N     1 
ATOM   2227  C  CA    . LEU C 3  116  ? 165.038 210.552 192.983 1.00 440.00 ?  115  LEU C CA    1 
ATOM   2228  C  C     . LEU C 3  116  ? 164.225 211.029 194.195 1.00 440.00 ?  115  LEU C C     1 
ATOM   2229  O  O     . LEU C 3  116  ? 163.325 210.294 194.647 1.00 440.00 ?  115  LEU C O     1 
ATOM   2230  C  CB    . LEU C 3  116  ? 165.207 209.029 192.992 1.00 359.27 ?  115  LEU C CB    1 
ATOM   2231  C  CG    . LEU C 3  116  ? 165.834 208.432 191.734 1.00 368.91 ?  115  LEU C CG    1 
ATOM   2232  C  CD1   . LEU C 3  116  ? 166.271 206.996 191.975 1.00 396.19 ?  115  LEU C CD1   1 
ATOM   2233  C  CD2   . LEU C 3  116  ? 164.869 208.506 190.560 1.00 334.12 ?  115  LEU C CD2   1 
ATOM   2234  N  N     . LEU C 3  117  ? 164.562 212.229 194.684 1.00 440.00 ?  116  LEU C N     1 
ATOM   2235  C  CA    . LEU C 3  117  ? 163.963 212.881 195.870 1.00 440.00 ?  116  LEU C CA    1 
ATOM   2236  C  C     . LEU C 3  117  ? 162.603 213.484 195.518 1.00 440.00 ?  116  LEU C C     1 
ATOM   2237  O  O     . LEU C 3  117  ? 162.416 213.978 194.387 1.00 440.00 ?  116  LEU C O     1 
ATOM   2238  C  CB    . LEU C 3  117  ? 164.925 213.959 196.383 1.00 440.00 ?  116  LEU C CB    1 
ATOM   2239  C  CG    . LEU C 3  117  ? 165.201 215.107 195.413 1.00 440.00 ?  116  LEU C CG    1 
ATOM   2240  C  CD1   . LEU C 3  117  ? 164.104 216.158 195.490 1.00 440.00 ?  116  LEU C CD1   1 
ATOM   2241  C  CD2   . LEU C 3  117  ? 166.560 215.734 195.689 1.00 440.00 ?  116  LEU C CD2   1 
ATOM   2242  N  N     . PRO C 3  118  ? 161.667 213.440 196.481 1.00 371.33 ?  117  PRO C N     1 
ATOM   2243  C  CA    . PRO C 3  118  ? 160.320 213.981 196.350 1.00 317.32 ?  117  PRO C CA    1 
ATOM   2244  C  C     . PRO C 3  118  ? 160.156 215.465 196.644 1.00 308.55 ?  117  PRO C C     1 
ATOM   2245  O  O     . PRO C 3  118  ? 159.031 215.909 196.739 1.00 279.91 ?  117  PRO C O     1 
ATOM   2246  C  CB    . PRO C 3  118  ? 159.570 213.164 197.426 1.00 302.00 ?  117  PRO C CB    1 
ATOM   2247  C  CG    . PRO C 3  118  ? 160.594 213.022 198.519 1.00 278.89 ?  117  PRO C CG    1 
ATOM   2248  C  CD    . PRO C 3  118  ? 161.894 212.825 197.798 1.00 272.80 ?  117  PRO C CD    1 
ATOM   2249  N  N     . LYS C 3  119  ? 161.272 216.194 196.744 1.00 390.98 ?  118  LYS C N     1 
ATOM   2250  C  CA    . LYS C 3  119  ? 161.286 217.647 196.851 1.00 440.00 ?  118  LYS C CA    1 
ATOM   2251  C  C     . LYS C 3  119  ? 159.896 218.262 197.049 1.00 440.00 ?  118  LYS C C     1 
ATOM   2252  O  O     . LYS C 3  119  ? 159.435 218.320 198.151 1.00 440.00 ?  118  LYS C O     1 
ATOM   2253  C  CB    . LYS C 3  119  ? 161.845 218.293 195.584 1.00 440.00 ?  118  LYS C CB    1 
ATOM   2254  C  CG    . LYS C 3  119  ? 161.966 219.821 195.631 1.00 440.00 ?  118  LYS C CG    1 
ATOM   2255  C  CD    . LYS C 3  119  ? 162.296 220.523 194.304 1.00 440.00 ?  118  LYS C CD    1 
ATOM   2256  C  CE    . LYS C 3  119  ? 162.473 222.029 194.433 1.00 440.00 ?  118  LYS C CE    1 
ATOM   2257  N  NZ    . LYS C 3  119  ? 163.698 222.386 195.185 1.00 440.00 1  118  LYS C NZ    1 
ATOM   2258  N  N     . LYS D 4  32   ? 168.844 153.919 208.393 1.00 440.00 ?  28   LYS D N     1 
ATOM   2259  C  CA    . LYS D 4  32   ? 168.048 154.960 207.688 1.00 440.00 ?  28   LYS D CA    1 
ATOM   2260  C  C     . LYS D 4  32   ? 168.979 155.787 206.793 1.00 440.00 ?  28   LYS D C     1 
ATOM   2261  O  O     . LYS D 4  32   ? 169.965 155.220 206.283 1.00 424.85 ?  28   LYS D O     1 
ATOM   2262  C  CB    . LYS D 4  32   ? 167.323 155.853 208.700 1.00 440.00 ?  28   LYS D CB    1 
ATOM   2263  C  CG    . LYS D 4  32   ? 166.228 155.167 209.508 1.00 440.00 ?  28   LYS D CG    1 
ATOM   2264  C  CD    . LYS D 4  32   ? 165.559 156.084 210.509 1.00 440.00 ?  28   LYS D CD    1 
ATOM   2265  C  CE    . LYS D 4  32   ? 164.457 155.401 211.292 1.00 440.00 ?  28   LYS D CE    1 
ATOM   2266  N  NZ    . LYS D 4  32   ? 163.837 156.318 212.279 1.00 440.00 1  28   LYS D NZ    1 
ATOM   2267  N  N     . THR D 4  33   ? 168.666 157.075 206.616 1.00 422.77 ?  29   THR D N     1 
ATOM   2268  C  CA    . THR D 4  33   ? 169.491 157.978 205.770 1.00 384.85 ?  29   THR D CA    1 
ATOM   2269  C  C     . THR D 4  33   ? 170.554 158.661 206.638 1.00 339.12 ?  29   THR D C     1 
ATOM   2270  O  O     . THR D 4  33   ? 170.490 158.511 207.875 1.00 358.57 ?  29   THR D O     1 
ATOM   2271  C  CB    . THR D 4  33   ? 168.616 159.007 205.041 1.00 378.07 ?  29   THR D CB    1 
ATOM   2272  O  OG1   . THR D 4  33   ? 167.909 159.763 206.024 1.00 362.03 ?  29   THR D OG1   1 
ATOM   2273  C  CG2   . THR D 4  33   ? 167.635 158.368 204.081 1.00 368.03 ?  29   THR D CG2   1 
ATOM   2274  N  N     . ARG D 4  34   ? 171.488 159.380 206.007 1.00 273.53 ?  30   ARG D N     1 
ATOM   2275  C  CA    . ARG D 4  34   ? 172.572 160.087 206.741 1.00 237.72 ?  30   ARG D CA    1 
ATOM   2276  C  C     . ARG D 4  34   ? 172.328 161.599 206.671 1.00 224.73 ?  30   ARG D C     1 
ATOM   2277  O  O     . ARG D 4  34   ? 171.678 162.135 207.592 1.00 333.65 ?  30   ARG D O     1 
ATOM   2278  C  CB    . ARG D 4  34   ? 173.939 159.723 206.154 1.00 244.58 ?  30   ARG D CB    1 
ATOM   2279  C  CG    . ARG D 4  34   ? 174.340 158.270 206.368 1.00 260.79 ?  30   ARG D CG    1 
ATOM   2280  C  CD    . ARG D 4  34   ? 175.720 157.965 205.816 1.00 332.53 ?  30   ARG D CD    1 
ATOM   2281  N  NE    . ARG D 4  34   ? 176.076 156.561 205.956 1.00 402.99 ?  30   ARG D NE    1 
ATOM   2282  C  CZ    . ARG D 4  34   ? 177.174 156.008 205.455 1.00 440.00 ?  30   ARG D CZ    1 
ATOM   2283  N  NH1   . ARG D 4  34   ? 177.148 155.451 204.256 1.00 440.00 1  30   ARG D NH1   1 
ATOM   2284  N  NH2   . ARG D 4  34   ? 178.296 156.016 206.152 1.00 440.00 ?  30   ARG D NH2   1 
ATOM   2285  N  N     . LYS D 4  35   ? 172.833 162.250 205.617 1.00 200.87 ?  31   LYS D N     1 
ATOM   2286  C  CA    . LYS D 4  35   ? 172.671 163.717 205.430 1.00 238.19 ?  31   LYS D CA    1 
ATOM   2287  C  C     . LYS D 4  35   ? 173.087 164.440 206.718 1.00 320.51 ?  31   LYS D C     1 
ATOM   2288  O  O     . LYS D 4  35   ? 172.235 165.128 207.313 1.00 427.83 ?  31   LYS D O     1 
ATOM   2289  C  CB    . LYS D 4  35   ? 171.226 164.052 205.044 1.00 300.95 ?  31   LYS D CB    1 
ATOM   2290  C  CG    . LYS D 4  35   ? 170.678 163.284 203.850 1.00 386.61 ?  31   LYS D CG    1 
ATOM   2291  C  CD    . LYS D 4  35   ? 169.254 163.656 203.497 1.00 428.96 ?  31   LYS D CD    1 
ATOM   2292  C  CE    . LYS D 4  35   ? 168.776 163.017 202.210 1.00 402.29 ?  31   LYS D CE    1 
ATOM   2293  N  NZ    . LYS D 4  35   ? 167.364 163.357 201.920 1.00 342.00 1  31   LYS D NZ    1 
ATOM   2294  N  N     . GLU D 4  36   ? 174.353 164.281 207.119 1.00 363.11 ?  32   GLU D N     1 
ATOM   2295  C  CA    . GLU D 4  36   ? 174.879 164.922 208.356 1.00 352.35 ?  32   GLU D CA    1 
ATOM   2296  C  C     . GLU D 4  36   ? 175.111 166.415 208.100 1.00 328.05 ?  32   GLU D C     1 
ATOM   2297  O  O     . GLU D 4  36   ? 175.268 166.798 206.924 1.00 357.37 ?  32   GLU D O     1 
ATOM   2298  C  CB    . GLU D 4  36   ? 176.170 164.234 208.803 1.00 332.66 ?  32   GLU D CB    1 
ATOM   2299  C  CG    . GLU D 4  36   ? 175.962 162.804 209.271 1.00 255.34 ?  32   GLU D CG    1 
ATOM   2300  C  CD    . GLU D 4  36   ? 177.238 162.074 209.653 1.00 254.30 ?  32   GLU D CD    1 
ATOM   2301  O  OE1   . GLU D 4  36   ? 178.330 162.610 209.381 1.00 253.56 ?  32   GLU D OE1   1 
ATOM   2302  O  OE2   . GLU D 4  36   ? 177.136 160.968 210.222 1.00 196.33 -1 32   GLU D OE2   1 
ATOM   2303  N  N     . SER D 4  37   ? 175.130 167.216 209.171 1.00 225.28 ?  33   SER D N     1 
ATOM   2304  C  CA    . SER D 4  37   ? 175.344 168.646 209.074 1.00 187.05 ?  33   SER D CA    1 
ATOM   2305  C  C     . SER D 4  37   ? 176.031 169.174 210.344 1.00 183.92 ?  33   SER D C     1 
ATOM   2306  O  O     . SER D 4  37   ? 176.254 168.491 211.271 1.00 132.49 ?  33   SER D O     1 
ATOM   2307  C  CB    . SER D 4  37   ? 174.019 169.314 208.800 1.00 208.36 ?  33   SER D CB    1 
ATOM   2308  O  OG    . SER D 4  37   ? 173.006 169.191 209.854 1.00 267.02 ?  33   SER D OG    1 
ATOM   2309  N  N     . TYR D 4  38   ? 176.338 170.457 210.364 1.00 231.97 ?  34   TYR D N     1 
ATOM   2310  C  CA    . TYR D 4  38   ? 177.064 171.077 211.453 1.00 257.73 ?  34   TYR D CA    1 
ATOM   2311  C  C     . TYR D 4  38   ? 176.126 171.705 212.480 1.00 305.56 ?  34   TYR D C     1 
ATOM   2312  O  O     . TYR D 4  38   ? 176.631 172.517 213.363 1.00 440.00 ?  34   TYR D O     1 
ATOM   2313  C  CB    . TYR D 4  38   ? 177.874 172.213 210.846 1.00 197.54 ?  34   TYR D CB    1 
ATOM   2314  C  CG    . TYR D 4  38   ? 178.878 171.834 209.787 1.00 127.38 ?  34   TYR D CG    1 
ATOM   2315  C  CD1   . TYR D 4  38   ? 180.154 171.425 210.172 1.00 114.63 ?  34   TYR D CD1   1 
ATOM   2316  C  CD2   . TYR D 4  38   ? 178.623 171.935 208.435 1.00 103.79 ?  34   TYR D CD2   1 
ATOM   2317  C  CE1   . TYR D 4  38   ? 181.089 171.001 209.251 1.00 114.74 ?  34   TYR D CE1   1 
ATOM   2318  C  CE2   . TYR D 4  38   ? 179.548 171.520 207.518 1.00 104.35 ?  34   TYR D CE2   1 
ATOM   2319  C  CZ    . TYR D 4  38   ? 180.784 171.050 207.915 1.00 110.89 ?  34   TYR D CZ    1 
ATOM   2320  O  OH    . TYR D 4  38   ? 181.831 170.680 207.141 1.00 129.76 ?  34   TYR D OH    1 
ATOM   2321  N  N     . ALA D 4  39   ? 174.869 171.257 212.522 1.00 213.76 ?  35   ALA D N     1 
ATOM   2322  C  CA    . ALA D 4  39   ? 173.827 171.927 213.336 1.00 146.76 ?  35   ALA D CA    1 
ATOM   2323  C  C     . ALA D 4  39   ? 174.225 172.045 214.812 1.00 107.03 ?  35   ALA D C     1 
ATOM   2324  O  O     . ALA D 4  39   ? 173.932 173.103 215.405 1.00 99.94  ?  35   ALA D O     1 
ATOM   2325  C  CB    . ALA D 4  39   ? 172.512 171.205 213.178 1.00 183.80 ?  35   ALA D CB    1 
ATOM   2326  N  N     . ILE D 4  40   ? 174.861 171.025 215.392 1.00 101.40 ?  36   ILE D N     1 
ATOM   2327  C  CA    . ILE D 4  40   ? 175.232 171.114 216.835 1.00 105.11 ?  36   ILE D CA    1 
ATOM   2328  C  C     . ILE D 4  40   ? 176.220 172.271 217.059 1.00 90.93  ?  36   ILE D C     1 
ATOM   2329  O  O     . ILE D 4  40   ? 176.039 173.008 218.048 1.00 85.48  ?  36   ILE D O     1 
ATOM   2330  C  CB    . ILE D 4  40   ? 175.805 169.772 217.336 1.00 105.69 ?  36   ILE D CB    1 
ATOM   2331  C  CG1   . ILE D 4  40   ? 176.662 169.088 216.266 1.00 117.31 ?  36   ILE D CG1   1 
ATOM   2332  C  CG2   . ILE D 4  40   ? 174.692 168.863 217.833 1.00 95.81  ?  36   ILE D CG2   1 
ATOM   2333  C  CD1   . ILE D 4  40   ? 177.402 167.867 216.762 1.00 116.30 ?  36   ILE D CD1   1 
ATOM   2334  N  N     . TYR D 4  41   ? 177.217 172.420 216.180 1.00 107.46 ?  37   TYR D N     1 
ATOM   2335  C  CA    . TYR D 4  41   ? 178.262 173.472 216.332 1.00 147.15 ?  37   TYR D CA    1 
ATOM   2336  C  C     . TYR D 4  41   ? 177.708 174.900 216.197 1.00 135.31 ?  37   TYR D C     1 
ATOM   2337  O  O     . TYR D 4  41   ? 178.081 175.756 217.023 1.00 194.48 ?  37   TYR D O     1 
ATOM   2338  C  CB    . TYR D 4  41   ? 179.403 173.235 215.337 1.00 173.23 ?  37   TYR D CB    1 
ATOM   2339  C  CG    . TYR D 4  41   ? 179.668 171.787 215.014 1.00 162.51 ?  37   TYR D CG    1 
ATOM   2340  C  CD1   . TYR D 4  41   ? 179.659 170.818 216.003 1.00 184.66 ?  37   TYR D CD1   1 
ATOM   2341  C  CD2   . TYR D 4  41   ? 179.931 171.381 213.716 1.00 132.38 ?  37   TYR D CD2   1 
ATOM   2342  C  CE1   . TYR D 4  41   ? 179.902 169.486 215.714 1.00 136.46 ?  37   TYR D CE1   1 
ATOM   2343  C  CE2   . TYR D 4  41   ? 180.177 170.052 213.408 1.00 103.91 ?  37   TYR D CE2   1 
ATOM   2344  C  CZ    . TYR D 4  41   ? 180.162 169.101 214.412 1.00 94.61  ?  37   TYR D CZ    1 
ATOM   2345  O  OH    . TYR D 4  41   ? 180.404 167.790 214.118 1.00 70.05  ?  37   TYR D OH    1 
ATOM   2346  N  N     . VAL D 4  42   ? 176.854 175.149 215.198 1.00 101.48 ?  38   VAL D N     1 
ATOM   2347  C  CA    . VAL D 4  42   ? 176.306 176.519 214.944 1.00 90.88  ?  38   VAL D CA    1 
ATOM   2348  C  C     . VAL D 4  42   ? 175.430 176.977 216.118 1.00 110.10 ?  38   VAL D C     1 
ATOM   2349  O  O     . VAL D 4  42   ? 175.526 178.156 216.512 1.00 92.25  ?  38   VAL D O     1 
ATOM   2350  C  CB    . VAL D 4  42   ? 175.532 176.576 213.613 1.00 92.45  ?  38   VAL D CB    1 
ATOM   2351  C  CG1   . VAL D 4  42   ? 174.988 177.969 213.335 1.00 80.34  ?  38   VAL D CG1   1 
ATOM   2352  C  CG2   . VAL D 4  42   ? 176.378 176.088 212.447 1.00 112.50 ?  38   VAL D CG2   1 
ATOM   2353  N  N     . TYR D 4  43   ? 174.613 176.060 216.637 1.00 179.91 ?  39   TYR D N     1 
ATOM   2354  C  CA    . TYR D 4  43   ? 173.662 176.303 217.739 1.00 227.56 ?  39   TYR D CA    1 
ATOM   2355  C  C     . TYR D 4  43   ? 174.279 176.768 219.062 1.00 193.93 ?  39   TYR D C     1 
ATOM   2356  O  O     . TYR D 4  43   ? 173.734 177.668 219.644 1.00 162.18 ?  39   TYR D O     1 
ATOM   2357  C  CB    . TYR D 4  43   ? 172.820 175.040 217.972 1.00 319.89 ?  39   TYR D CB    1 
ATOM   2358  C  CG    . TYR D 4  43   ? 171.996 174.898 219.240 1.00 331.94 ?  39   TYR D CG    1 
ATOM   2359  C  CD1   . TYR D 4  43   ? 170.709 175.406 219.357 1.00 358.46 ?  39   TYR D CD1   1 
ATOM   2360  C  CD2   . TYR D 4  43   ? 172.484 174.127 220.286 1.00 335.67 ?  39   TYR D CD2   1 
ATOM   2361  C  CE1   . TYR D 4  43   ? 169.996 175.242 220.523 1.00 369.65 ?  39   TYR D CE1   1 
ATOM   2362  C  CE2   . TYR D 4  43   ? 171.772 173.948 221.453 1.00 344.39 ?  39   TYR D CE2   1 
ATOM   2363  C  CZ    . TYR D 4  43   ? 170.513 174.504 221.578 1.00 360.00 ?  39   TYR D CZ    1 
ATOM   2364  O  OH    . TYR D 4  43   ? 169.791 174.321 222.727 1.00 367.79 ?  39   TYR D OH    1 
ATOM   2365  N  N     . LYS D 4  44   ? 175.330 176.075 219.533 1.00 160.34 ?  40   LYS D N     1 
ATOM   2366  C  CA    . LYS D 4  44   ? 175.987 176.503 220.771 1.00 132.35 ?  40   LYS D CA    1 
ATOM   2367  C  C     . LYS D 4  44   ? 176.647 177.860 220.554 1.00 137.29 ?  40   LYS D C     1 
ATOM   2368  O  O     . LYS D 4  44   ? 176.518 178.744 221.428 1.00 229.92 ?  40   LYS D O     1 
ATOM   2369  C  CB    . LYS D 4  44   ? 177.004 175.468 221.220 1.00 114.79 ?  40   LYS D CB    1 
ATOM   2370  C  CG    . LYS D 4  44   ? 176.386 174.102 221.454 1.00 168.37 ?  40   LYS D CG    1 
ATOM   2371  C  CD    . LYS D 4  44   ? 176.327 173.480 222.829 1.00 209.44 ?  40   LYS D CD    1 
ATOM   2372  C  CE    . LYS D 4  44   ? 176.325 171.966 222.695 1.00 199.16 ?  40   LYS D CE    1 
ATOM   2373  N  NZ    . LYS D 4  44   ? 175.151 171.399 221.969 1.00 162.46 1  40   LYS D NZ    1 
ATOM   2374  N  N     . VAL D 4  45   ? 177.214 178.083 219.367 1.00 109.08 ?  41   VAL D N     1 
ATOM   2375  C  CA    . VAL D 4  45   ? 177.852 179.366 219.083 1.00 108.95 ?  41   VAL D CA    1 
ATOM   2376  C  C     . VAL D 4  45   ? 176.870 180.541 219.293 1.00 160.02 ?  41   VAL D C     1 
ATOM   2377  O  O     . VAL D 4  45   ? 177.120 181.572 219.877 1.00 195.40 ?  41   VAL D O     1 
ATOM   2378  C  CB    . VAL D 4  45   ? 178.425 179.492 217.691 1.00 99.48  ?  41   VAL D CB    1 
ATOM   2379  C  CG1   . VAL D 4  45   ? 179.023 180.890 217.526 1.00 75.47  ?  41   VAL D CG1   1 
ATOM   2380  C  CG2   . VAL D 4  45   ? 179.524 178.489 217.442 1.00 159.75 ?  41   VAL D CG2   1 
ATOM   2381  N  N     . LEU D 4  46   ? 175.657 180.380 218.757 1.00 168.83 ?  42   LEU D N     1 
ATOM   2382  C  CA    . LEU D 4  46   ? 174.604 181.342 218.907 1.00 150.79 ?  42   LEU D CA    1 
ATOM   2383  C  C     . LEU D 4  46   ? 174.184 181.481 220.366 1.00 159.24 ?  42   LEU D C     1 
ATOM   2384  O  O     . LEU D 4  46   ? 174.033 182.630 220.897 1.00 173.78 ?  42   LEU D O     1 
ATOM   2385  C  CB    . LEU D 4  46   ? 173.375 180.917 218.099 1.00 162.97 ?  42   LEU D CB    1 
ATOM   2386  C  CG    . LEU D 4  46   ? 172.260 181.960 218.122 1.00 264.71 ?  42   LEU D CG    1 
ATOM   2387  C  CD1   . LEU D 4  46   ? 172.721 183.240 217.430 1.00 196.89 ?  42   LEU D CD1   1 
ATOM   2388  C  CD2   . LEU D 4  46   ? 170.899 181.468 217.591 1.00 406.13 ?  42   LEU D CD2   1 
ATOM   2389  N  N     . LYS D 4  47   ? 174.127 180.328 221.043 1.00 163.92 ?  43   LYS D N     1 
ATOM   2390  C  CA    . LYS D 4  47   ? 173.873 180.352 222.526 1.00 149.75 ?  43   LYS D CA    1 
ATOM   2391  C  C     . LYS D 4  47   ? 174.938 181.220 223.219 1.00 127.58 ?  43   LYS D C     1 
ATOM   2392  O  O     . LYS D 4  47   ? 174.715 181.981 224.100 1.00 94.85  ?  43   LYS D O     1 
ATOM   2393  C  CB    . LYS D 4  47   ? 173.996 178.918 223.050 1.00 152.83 ?  43   LYS D CB    1 
ATOM   2394  C  CG    . LYS D 4  47   ? 173.740 178.801 224.534 1.00 159.33 ?  43   LYS D CG    1 
ATOM   2395  C  CD    . LYS D 4  47   ? 172.251 179.051 224.776 1.00 232.24 ?  43   LYS D CD    1 
ATOM   2396  C  CE    . LYS D 4  47   ? 171.783 178.854 226.203 1.00 313.06 ?  43   LYS D CE    1 
ATOM   2397  N  NZ    . LYS D 4  47   ? 171.877 177.424 226.596 1.00 344.55 1  43   LYS D NZ    1 
ATOM   2398  N  N     . GLN D 4  48   ? 176.166 181.038 222.780 1.00 171.41 ?  44   GLN D N     1 
ATOM   2399  C  CA    . GLN D 4  48   ? 177.282 181.781 223.349 1.00 198.82 ?  44   GLN D CA    1 
ATOM   2400  C  C     . GLN D 4  48   ? 177.060 183.277 223.152 1.00 158.67 ?  44   GLN D C     1 
ATOM   2401  O  O     . GLN D 4  48   ? 177.422 184.064 224.015 1.00 265.68 ?  44   GLN D O     1 
ATOM   2402  C  CB    . GLN D 4  48   ? 178.628 181.378 222.762 1.00 305.71 ?  44   GLN D CB    1 
ATOM   2403  C  CG    . GLN D 4  48   ? 179.800 181.988 223.554 1.00 335.17 ?  44   GLN D CG    1 
ATOM   2404  C  CD    . GLN D 4  48   ? 179.886 181.668 225.041 1.00 350.11 ?  44   GLN D CD    1 
ATOM   2405  O  OE1   . GLN D 4  48   ? 179.811 180.511 225.460 1.00 354.02 ?  44   GLN D OE1   1 
ATOM   2406  N  NE2   . GLN D 4  48   ? 180.024 182.710 225.859 1.00 313.67 ?  44   GLN D NE2   1 
ATOM   2407  N  N     . VAL D 4  49   ? 176.345 183.701 222.120 1.00 116.91 ?  45   VAL D N     1 
ATOM   2408  C  CA    . VAL D 4  49   ? 176.268 185.143 221.811 1.00 113.52 ?  45   VAL D CA    1 
ATOM   2409  C  C     . VAL D 4  49   ? 174.907 185.815 222.008 1.00 140.73 ?  45   VAL D C     1 
ATOM   2410  O  O     . VAL D 4  49   ? 174.882 186.974 222.076 1.00 171.58 ?  45   VAL D O     1 
ATOM   2411  C  CB    . VAL D 4  49   ? 176.778 185.483 220.412 1.00 94.25  ?  45   VAL D CB    1 
ATOM   2412  C  CG1   . VAL D 4  49   ? 178.260 185.208 220.311 1.00 126.14 ?  45   VAL D CG1   1 
ATOM   2413  C  CG2   . VAL D 4  49   ? 176.004 184.758 219.344 1.00 76.53  ?  45   VAL D CG2   1 
ATOM   2414  N  N     . HIS D 4  50   ? 173.844 185.046 222.152 1.00 142.79 ?  46   HIS D N     1 
ATOM   2415  C  CA    . HIS D 4  50   ? 172.609 185.578 222.786 1.00 124.22 ?  46   HIS D CA    1 
ATOM   2416  C  C     . HIS D 4  50   ? 171.879 184.303 223.173 1.00 162.00 ?  46   HIS D C     1 
ATOM   2417  O  O     . HIS D 4  50   ? 171.373 183.596 222.300 1.00 261.35 ?  46   HIS D O     1 
ATOM   2418  C  CB    . HIS D 4  50   ? 171.648 186.458 221.948 1.00 115.07 ?  46   HIS D CB    1 
ATOM   2419  C  CG    . HIS D 4  50   ? 172.133 187.689 221.290 1.00 113.24 ?  46   HIS D CG    1 
ATOM   2420  N  ND1   . HIS D 4  50   ? 173.183 188.452 221.776 1.00 101.92 ?  46   HIS D ND1   1 
ATOM   2421  C  CD2   . HIS D 4  50   ? 171.655 188.316 220.169 1.00 85.42  ?  46   HIS D CD2   1 
ATOM   2422  C  CE1   . HIS D 4  50   ? 173.334 189.525 220.965 1.00 81.99  ?  46   HIS D CE1   1 
ATOM   2423  N  NE2   . HIS D 4  50   ? 172.418 189.439 219.935 1.00 69.94  ?  46   HIS D NE2   1 
ATOM   2424  N  N     . PRO D 4  51   ? 171.986 183.907 224.466 1.00 197.29 ?  47   PRO D N     1 
ATOM   2425  C  CA    . PRO D 4  51   ? 171.459 182.619 224.939 1.00 242.64 ?  47   PRO D CA    1 
ATOM   2426  C  C     . PRO D 4  51   ? 169.959 182.312 224.773 1.00 224.22 ?  47   PRO D C     1 
ATOM   2427  O  O     . PRO D 4  51   ? 169.617 181.260 224.308 1.00 191.34 ?  47   PRO D O     1 
ATOM   2428  C  CB    . PRO D 4  51   ? 171.817 182.637 226.420 1.00 287.36 ?  47   PRO D CB    1 
ATOM   2429  C  CG    . PRO D 4  51   ? 172.046 184.093 226.803 1.00 306.37 ?  47   PRO D CG    1 
ATOM   2430  C  CD    . PRO D 4  51   ? 172.582 184.742 225.536 1.00 218.22 ?  47   PRO D CD    1 
ATOM   2431  N  N     . ASP D 4  52   ? 169.125 183.308 225.047 1.00 248.77 ?  48   ASP D N     1 
ATOM   2432  C  CA    . ASP D 4  52   ? 167.701 183.208 224.935 1.00 301.26 ?  48   ASP D CA    1 
ATOM   2433  C  C     . ASP D 4  52   ? 167.343 184.152 223.800 1.00 332.98 ?  48   ASP D C     1 
ATOM   2434  O  O     . ASP D 4  52   ? 166.679 185.170 223.969 1.00 342.97 ?  48   ASP D O     1 
ATOM   2435  C  CB    . ASP D 4  52   ? 167.041 183.473 226.274 1.00 338.31 ?  48   ASP D CB    1 
ATOM   2436  C  CG    . ASP D 4  52   ? 166.623 182.181 226.908 1.00 318.62 ?  48   ASP D CG    1 
ATOM   2437  O  OD1   . ASP D 4  52   ? 167.253 181.102 226.620 1.00 236.90 ?  48   ASP D OD1   1 
ATOM   2438  O  OD2   . ASP D 4  52   ? 165.673 182.286 227.749 1.00 239.64 -1 48   ASP D OD2   1 
ATOM   2439  N  N     . THR D 4  53   ? 167.899 183.818 222.635 1.00 353.24 ?  49   THR D N     1 
ATOM   2440  C  CA    . THR D 4  53   ? 167.692 184.418 221.313 1.00 384.00 ?  49   THR D CA    1 
ATOM   2441  C  C     . THR D 4  53   ? 167.482 183.263 220.322 1.00 434.65 ?  49   THR D C     1 
ATOM   2442  O  O     . THR D 4  53   ? 168.119 182.182 220.494 1.00 429.12 ?  49   THR D O     1 
ATOM   2443  C  CB    . THR D 4  53   ? 168.860 185.325 220.912 1.00 336.44 ?  49   THR D CB    1 
ATOM   2444  O  OG1   . THR D 4  53   ? 169.179 186.308 221.892 1.00 251.88 ?  49   THR D OG1   1 
ATOM   2445  C  CG2   . THR D 4  53   ? 168.531 186.030 219.624 1.00 318.95 ?  49   THR D CG2   1 
ATOM   2446  N  N     . GLY D 4  54   ? 166.625 183.475 219.301 1.00 431.68 ?  50   GLY D N     1 
ATOM   2447  C  CA    . GLY D 4  54   ? 166.144 182.400 218.437 1.00 342.32 ?  50   GLY D CA    1 
ATOM   2448  C  C     . GLY D 4  54   ? 166.465 182.531 216.932 1.00 252.53 ?  50   GLY D C     1 
ATOM   2449  O  O     . GLY D 4  54   ? 166.940 183.527 216.331 1.00 187.72 ?  50   GLY D O     1 
ATOM   2450  N  N     . ILE D 4  55   ? 166.105 181.452 216.217 1.00 208.71 ?  51   ILE D N     1 
ATOM   2451  C  CA    . ILE D 4  55   ? 166.479 181.181 214.836 1.00 185.31 ?  51   ILE D CA    1 
ATOM   2452  C  C     . ILE D 4  55   ? 165.387 180.390 214.124 1.00 202.16 ?  51   ILE D C     1 
ATOM   2453  O  O     . ILE D 4  55   ? 164.821 179.466 214.638 1.00 242.93 ?  51   ILE D O     1 
ATOM   2454  C  CB    . ILE D 4  55   ? 167.792 180.389 214.810 1.00 193.91 ?  51   ILE D CB    1 
ATOM   2455  C  CG1   . ILE D 4  55   ? 167.790 179.157 215.752 1.00 198.13 ?  51   ILE D CG1   1 
ATOM   2456  C  CG2   . ILE D 4  55   ? 168.915 181.366 215.017 1.00 173.42 ?  51   ILE D CG2   1 
ATOM   2457  C  CD1   . ILE D 4  55   ? 167.085 177.925 215.242 1.00 190.69 ?  51   ILE D CD1   1 
ATOM   2458  N  N     . SER D 4  56   ? 165.228 180.648 212.822 1.00 156.42 ?  52   SER D N     1 
ATOM   2459  C  CA    . SER D 4  56   ? 164.367 179.866 211.923 1.00 131.49 ?  52   SER D CA    1 
ATOM   2460  C  C     . SER D 4  56   ? 165.098 178.642 211.366 1.00 156.15 ?  52   SER D C     1 
ATOM   2461  O  O     . SER D 4  56   ? 166.365 178.575 211.298 1.00 274.57 ?  52   SER D O     1 
ATOM   2462  C  CB    . SER D 4  56   ? 163.860 180.733 210.830 1.00 94.71  ?  52   SER D CB    1 
ATOM   2463  O  OG    . SER D 4  56   ? 164.922 181.327 210.138 1.00 71.33  ?  52   SER D OG    1 
ATOM   2464  N  N     . SER D 4  57   ? 164.304 177.648 210.954 1.00 136.73 ?  53   SER D N     1 
ATOM   2465  C  CA    . SER D 4  57   ? 164.847 176.387 210.385 1.00 110.73 ?  53   SER D CA    1 
ATOM   2466  C  C     . SER D 4  57   ? 165.343 176.631 208.955 1.00 103.42 ?  53   SER D C     1 
ATOM   2467  O  O     . SER D 4  57   ? 165.882 175.685 208.346 1.00 114.19 ?  53   SER D O     1 
ATOM   2468  C  CB    . SER D 4  57   ? 163.815 175.288 210.429 1.00 106.75 ?  53   SER D CB    1 
ATOM   2469  O  OG    . SER D 4  57   ? 164.212 174.192 209.618 1.00 82.33  ?  53   SER D OG    1 
ATOM   2470  N  N     . LYS D 4  58   ? 165.163 177.856 208.451 1.00 92.99  ?  54   LYS D N     1 
ATOM   2471  C  CA    . LYS D 4  58   ? 165.603 178.217 207.075 1.00 103.78 ?  54   LYS D CA    1 
ATOM   2472  C  C     . LYS D 4  58   ? 167.002 178.838 207.138 1.00 101.95 ?  54   LYS D C     1 
ATOM   2473  O  O     . LYS D 4  58   ? 167.795 178.607 206.204 1.00 160.12 ?  54   LYS D O     1 
ATOM   2474  C  CB    . LYS D 4  58   ? 164.602 179.182 206.431 1.00 115.46 ?  54   LYS D CB    1 
ATOM   2475  C  CG    . LYS D 4  58   ? 163.222 178.600 206.154 1.00 177.50 ?  54   LYS D CG    1 
ATOM   2476  C  CD    . LYS D 4  58   ? 162.327 179.532 205.363 1.00 279.03 ?  54   LYS D CD    1 
ATOM   2477  C  CE    . LYS D 4  58   ? 161.832 180.709 206.176 1.00 310.20 ?  54   LYS D CE    1 
ATOM   2478  N  NZ    . LYS D 4  58   ? 160.879 181.544 205.406 1.00 317.24 1  54   LYS D NZ    1 
ATOM   2479  N  N     . ALA D 4  59   ? 167.285 179.595 208.204 1.00 76.09  ?  55   ALA D N     1 
ATOM   2480  C  CA    . ALA D 4  59   ? 168.603 180.249 208.378 1.00 73.46  ?  55   ALA D CA    1 
ATOM   2481  C  C     . ALA D 4  59   ? 169.619 179.228 208.902 1.00 76.21  ?  55   ALA D C     1 
ATOM   2482  O  O     . ALA D 4  59   ? 170.832 179.503 208.823 1.00 64.79  ?  55   ALA D O     1 
ATOM   2483  C  CB    . ALA D 4  59   ? 168.472 181.428 209.311 1.00 71.17  ?  55   ALA D CB    1 
ATOM   2484  N  N     . MET D 4  60   ? 169.131 178.094 209.416 1.00 101.63 ?  56   MET D N     1 
ATOM   2485  C  CA    . MET D 4  60   ? 169.980 177.065 209.935 1.00 104.42 ?  56   MET D CA    1 
ATOM   2486  C  C     . MET D 4  60   ? 170.752 176.344 208.822 1.00 101.44 ?  56   MET D C     1 
ATOM   2487  O  O     . MET D 4  60   ? 171.923 175.994 208.988 1.00 120.14 ?  56   MET D O     1 
ATOM   2488  C  CB    . MET D 4  60   ? 169.199 175.987 210.707 1.00 122.37 ?  56   MET D CB    1 
ATOM   2489  C  CG    . MET D 4  60   ? 169.933 174.630 210.519 1.00 129.01 ?  56   MET D CG    1 
ATOM   2490  S  SD    . MET D 4  60   ? 169.190 173.171 211.274 1.00 219.25 ?  56   MET D SD    1 
ATOM   2491  C  CE    . MET D 4  60   ? 168.195 172.493 209.954 1.00 168.83 ?  56   MET D CE    1 
ATOM   2492  N  N     . SER D 4  61   ? 170.079 176.009 207.709 1.00 94.18  ?  57   SER D N     1 
ATOM   2493  C  CA    . SER D 4  61   ? 170.735 175.434 206.615 1.00 96.04  ?  57   SER D CA    1 
ATOM   2494  C  C     . SER D 4  61   ? 171.653 176.470 205.922 1.00 119.92 ?  57   SER D C     1 
ATOM   2495  O  O     . SER D 4  61   ? 172.877 176.047 205.556 1.00 249.73 ?  57   SER D O     1 
ATOM   2496  C  CB    . SER D 4  61   ? 169.791 174.671 205.693 1.00 82.86  ?  57   SER D CB    1 
ATOM   2497  O  OG    . SER D 4  61   ? 169.573 173.392 206.275 1.00 74.67  ?  57   SER D OG    1 
ATOM   2498  N  N     . ILE D 4  62   ? 171.137 177.736 205.788 1.00 85.65  ?  58   ILE D N     1 
ATOM   2499  C  CA    . ILE D 4  62   ? 171.993 178.742 205.190 1.00 102.60 ?  58   ILE D CA    1 
ATOM   2500  C  C     . ILE D 4  62   ? 173.351 178.642 205.875 1.00 170.40 ?  58   ILE D C     1 
ATOM   2501  O  O     . ILE D 4  62   ? 174.380 178.728 205.167 1.00 224.76 ?  58   ILE D O     1 
ATOM   2502  C  CB    . ILE D 4  62   ? 171.454 180.165 205.302 1.00 78.89  ?  58   ILE D CB    1 
ATOM   2503  C  CG1   . ILE D 4  62   ? 170.068 180.268 204.705 1.00 85.24  ?  58   ILE D CG1   1 
ATOM   2504  C  CG2   . ILE D 4  62   ? 172.305 181.254 204.705 1.00 73.12  ?  58   ILE D CG2   1 
ATOM   2505  C  CD1   . ILE D 4  62   ? 169.423 181.572 205.013 1.00 97.36  ?  58   ILE D CD1   1 
ATOM   2506  N  N     . MET D 4  63   ? 173.316 178.505 207.219 1.00 181.31 ?  59   MET D N     1 
ATOM   2507  C  CA    . MET D 4  63   ? 174.526 178.441 208.012 1.00 150.30 ?  59   MET D CA    1 
ATOM   2508  C  C     . MET D 4  63   ? 175.459 177.267 207.692 1.00 106.31 ?  59   MET D C     1 
ATOM   2509  O  O     . MET D 4  63   ? 176.621 177.491 207.537 1.00 80.41  ?  59   MET D O     1 
ATOM   2510  C  CB    . MET D 4  63   ? 174.159 178.474 209.494 1.00 162.23 ?  59   MET D CB    1 
ATOM   2511  C  CG    . MET D 4  63   ? 173.734 179.848 209.964 1.00 185.69 ?  59   MET D CG    1 
ATOM   2512  S  SD    . MET D 4  63   ? 174.942 181.160 209.687 1.00 185.20 ?  59   MET D SD    1 
ATOM   2513  C  CE    . MET D 4  63   ? 176.172 180.643 210.880 1.00 156.33 ?  59   MET D CE    1 
ATOM   2514  N  N     . ASN D 4  64   ? 174.942 176.068 207.557 1.00 88.89  ?  60   ASN D N     1 
ATOM   2515  C  CA    . ASN D 4  64   ? 175.721 174.890 207.246 1.00 62.73  ?  60   ASN D CA    1 
ATOM   2516  C  C     . ASN D 4  64   ? 176.189 175.005 205.811 1.00 56.98  ?  60   ASN D C     1 
ATOM   2517  O  O     . ASN D 4  64   ? 177.368 174.681 205.535 1.00 66.30  ?  60   ASN D O     1 
ATOM   2518  C  CB    . ASN D 4  64   ? 174.904 173.598 207.281 1.00 58.55  ?  60   ASN D CB    1 
ATOM   2519  C  CG    . ASN D 4  64   ? 174.152 173.468 208.567 1.00 75.91  ?  60   ASN D CG    1 
ATOM   2520  O  OD1   . ASN D 4  64   ? 172.949 173.278 208.552 1.00 95.69  ?  60   ASN D OD1   1 
ATOM   2521  N  ND2   . ASN D 4  64   ? 174.808 173.721 209.681 1.00 82.23  ?  60   ASN D ND2   1 
ATOM   2522  N  N     . SER D 4  65   ? 175.297 175.484 204.909 1.00 59.03  ?  61   SER D N     1 
ATOM   2523  C  CA    . SER D 4  65   ? 175.693 175.750 203.538 1.00 60.84  ?  61   SER D CA    1 
ATOM   2524  C  C     . SER D 4  65   ? 176.901 176.673 203.526 1.00 75.71  ?  61   SER D C     1 
ATOM   2525  O  O     . SER D 4  65   ? 177.943 176.382 202.904 1.00 150.02 ?  61   SER D O     1 
ATOM   2526  C  CB    . SER D 4  65   ? 174.602 176.332 202.715 1.00 57.69  ?  61   SER D CB    1 
ATOM   2527  O  OG    . SER D 4  65   ? 175.083 176.507 201.373 1.00 50.95  ?  61   SER D OG    1 
ATOM   2528  N  N     . PHE D 4  66   ? 176.879 177.671 204.407 1.00 66.03  ?  62   PHE D N     1 
ATOM   2529  C  CA    . PHE D 4  66   ? 177.917 178.672 204.495 1.00 68.08  ?  62   PHE D CA    1 
ATOM   2530  C  C     . PHE D 4  66   ? 179.288 178.179 204.991 1.00 79.05  ?  62   PHE D C     1 
ATOM   2531  O  O     . PHE D 4  66   ? 180.277 178.417 204.387 1.00 83.01  ?  62   PHE D O     1 
ATOM   2532  C  CB    . PHE D 4  66   ? 177.451 179.886 205.278 1.00 67.29  ?  62   PHE D CB    1 
ATOM   2533  C  CG    . PHE D 4  66   ? 178.578 180.825 205.631 1.00 76.76  ?  62   PHE D CG    1 
ATOM   2534  C  CD1   . PHE D 4  66   ? 179.321 180.582 206.799 1.00 69.83  ?  62   PHE D CD1   1 
ATOM   2535  C  CD2   . PHE D 4  66   ? 178.937 181.880 204.780 1.00 78.91  ?  62   PHE D CD2   1 
ATOM   2536  C  CE1   . PHE D 4  66   ? 180.315 181.506 207.144 1.00 73.00  ?  62   PHE D CE1   1 
ATOM   2537  C  CE2   . PHE D 4  66   ? 179.957 182.755 205.126 1.00 72.43  ?  62   PHE D CE2   1 
ATOM   2538  C  CZ    . PHE D 4  66   ? 180.611 182.605 206.319 1.00 74.72  ?  62   PHE D CZ    1 
ATOM   2539  N  N     . VAL D 4  67   ? 179.222 177.348 206.049 1.00 77.77  ?  63   VAL D N     1 
ATOM   2540  C  CA    . VAL D 4  67   ? 180.382 176.671 206.609 1.00 78.86  ?  63   VAL D CA    1 
ATOM   2541  C  C     . VAL D 4  67   ? 181.068 175.675 205.625 1.00 83.82  ?  63   VAL D C     1 
ATOM   2542  O  O     . VAL D 4  67   ? 182.294 175.582 205.473 1.00 99.52  ?  63   VAL D O     1 
ATOM   2543  C  CB    . VAL D 4  67   ? 179.981 175.950 207.908 1.00 72.94  ?  63   VAL D CB    1 
ATOM   2544  C  CG1   . VAL D 4  67   ? 181.089 175.117 208.475 1.00 83.10  ?  63   VAL D CG1   1 
ATOM   2545  C  CG2   . VAL D 4  67   ? 179.701 177.026 208.938 1.00 82.19  ?  63   VAL D CG2   1 
ATOM   2546  N  N     . ASN D 4  68   ? 180.243 174.853 204.998 1.00 81.16  ?  64   ASN D N     1 
ATOM   2547  C  CA    . ASN D 4  68   ? 180.780 173.780 204.171 1.00 66.14  ?  64   ASN D CA    1 
ATOM   2548  C  C     . ASN D 4  68   ? 181.494 174.469 203.005 1.00 52.68  ?  64   ASN D C     1 
ATOM   2549  O  O     . ASN D 4  68   ? 182.491 174.089 202.591 1.00 56.41  ?  64   ASN D O     1 
ATOM   2550  C  CB    . ASN D 4  68   ? 179.649 172.862 203.694 1.00 96.69  ?  64   ASN D CB    1 
ATOM   2551  C  CG    . ASN D 4  68   ? 180.129 171.446 203.462 1.00 119.92 ?  64   ASN D CG    1 
ATOM   2552  O  OD1   . ASN D 4  68   ? 181.300 171.140 203.432 1.00 139.75 ?  64   ASN D OD1   1 
ATOM   2553  N  ND2   . ASN D 4  68   ? 179.233 170.468 203.544 1.00 144.17 ?  64   ASN D ND2   1 
ATOM   2554  N  N     . ASP D 4  69   ? 180.933 175.568 202.542 1.00 54.23  ?  65   ASP D N     1 
ATOM   2555  C  CA    . ASP D 4  69   ? 181.458 176.439 201.512 1.00 62.89  ?  65   ASP D CA    1 
ATOM   2556  C  C     . ASP D 4  69   ? 182.795 177.041 201.873 1.00 62.47  ?  65   ASP D C     1 
ATOM   2557  O  O     . ASP D 4  69   ? 183.670 177.138 201.099 1.00 58.77  ?  65   ASP D O     1 
ATOM   2558  C  CB    . ASP D 4  69   ? 180.537 177.609 201.200 1.00 74.61  ?  65   ASP D CB    1 
ATOM   2559  C  CG    . ASP D 4  69   ? 181.167 178.820 200.562 1.00 79.95  ?  65   ASP D CG    1 
ATOM   2560  O  OD1   . ASP D 4  69   ? 181.448 178.837 199.390 1.00 83.00  ?  65   ASP D OD1   1 
ATOM   2561  O  OD2   . ASP D 4  69   ? 181.247 179.719 201.202 1.00 193.98 -1 65   ASP D OD2   1 
ATOM   2562  N  N     . VAL D 4  70   ? 182.952 177.449 203.139 1.00 67.67  ?  66   VAL D N     1 
ATOM   2563  C  CA    . VAL D 4  70   ? 184.200 178.071 203.524 1.00 82.21  ?  66   VAL D CA    1 
ATOM   2564  C  C     . VAL D 4  70   ? 185.234 176.947 203.710 1.00 96.31  ?  66   VAL D C     1 
ATOM   2565  O  O     . VAL D 4  70   ? 186.401 177.087 203.514 1.00 112.97 ?  66   VAL D O     1 
ATOM   2566  C  CB    . VAL D 4  70   ? 183.982 178.897 204.817 1.00 104.48 ?  66   VAL D CB    1 
ATOM   2567  C  CG1   . VAL D 4  70   ? 185.267 179.450 205.369 1.00 142.61 ?  66   VAL D CG1   1 
ATOM   2568  C  CG2   . VAL D 4  70   ? 183.004 179.988 204.596 1.00 93.99  ?  66   VAL D CG2   1 
ATOM   2569  N  N     . PHE D 4  71   ? 184.721 175.782 204.115 1.00 77.81  ?  67   PHE D N     1 
ATOM   2570  C  CA    . PHE D 4  71   ? 185.567 174.583 204.363 1.00 50.90  ?  67   PHE D CA    1 
ATOM   2571  C  C     . PHE D 4  71   ? 186.431 174.288 203.130 1.00 39.46  ?  67   PHE D C     1 
ATOM   2572  O  O     . PHE D 4  71   ? 187.672 174.336 203.240 1.00 28.22  ?  67   PHE D O     1 
ATOM   2573  C  CB    . PHE D 4  71   ? 184.696 173.379 204.731 1.00 54.19  ?  67   PHE D CB    1 
ATOM   2574  C  CG    . PHE D 4  71   ? 185.462 172.116 205.038 1.00 58.09  ?  67   PHE D CG    1 
ATOM   2575  C  CD1   . PHE D 4  71   ? 186.113 171.955 206.250 1.00 62.58  ?  67   PHE D CD1   1 
ATOM   2576  C  CD2   . PHE D 4  71   ? 185.534 171.087 204.112 1.00 60.13  ?  67   PHE D CD2   1 
ATOM   2577  C  CE1   . PHE D 4  71   ? 186.818 170.795 206.529 1.00 68.11  ?  67   PHE D CE1   1 
ATOM   2578  C  CE2   . PHE D 4  71   ? 186.238 169.927 204.393 1.00 63.85  ?  67   PHE D CE2   1 
ATOM   2579  C  CZ    . PHE D 4  71   ? 186.878 169.784 205.601 1.00 68.97  ?  67   PHE D CZ    1 
ATOM   2580  N  N     . GLU D 4  72   ? 185.786 173.994 201.998 1.00 54.58  ?  68   GLU D N     1 
ATOM   2581  C  CA    . GLU D 4  72   ? 186.502 173.671 200.733 1.00 84.89  ?  68   GLU D CA    1 
ATOM   2582  C  C     . GLU D 4  72   ? 187.399 174.847 200.325 1.00 94.10  ?  68   GLU D C     1 
ATOM   2583  O  O     . GLU D 4  72   ? 188.540 174.593 199.891 1.00 227.75 ?  68   GLU D O     1 
ATOM   2584  C  CB    . GLU D 4  72   ? 185.499 173.341 199.624 1.00 118.93 ?  68   GLU D CB    1 
ATOM   2585  C  CG    . GLU D 4  72   ? 185.027 171.899 199.647 1.00 135.80 ?  68   GLU D CG    1 
ATOM   2586  C  CD    . GLU D 4  72   ? 183.699 171.656 198.948 1.00 119.40 ?  68   GLU D CD    1 
ATOM   2587  O  OE1   . GLU D 4  72   ? 183.303 172.505 198.126 1.00 121.13 ?  68   GLU D OE1   1 
ATOM   2588  O  OE2   . GLU D 4  72   ? 183.065 170.620 199.231 1.00 118.91 -1 68   GLU D OE2   1 
ATOM   2589  N  N     . ARG D 4  73   ? 186.891 176.077 200.458 1.00 68.94  ?  69   ARG D N     1 
ATOM   2590  C  CA    . ARG D 4  73   ? 187.655 177.299 200.086 1.00 81.04  ?  69   ARG D CA    1 
ATOM   2591  C  C     . ARG D 4  73   ? 189.050 177.259 200.721 1.00 113.86 ?  69   ARG D C     1 
ATOM   2592  O  O     . ARG D 4  73   ? 190.042 177.374 199.974 1.00 124.24 ?  69   ARG D O     1 
ATOM   2593  C  CB    . ARG D 4  73   ? 186.893 178.556 200.516 1.00 85.77  ?  69   ARG D CB    1 
ATOM   2594  C  CG    . ARG D 4  73   ? 187.415 179.845 199.899 1.00 127.35 ?  69   ARG D CG    1 
ATOM   2595  C  CD    . ARG D 4  73   ? 186.441 180.996 200.054 1.00 178.38 ?  69   ARG D CD    1 
ATOM   2596  N  NE    . ARG D 4  73   ? 185.094 180.644 199.628 1.00 155.73 ?  69   ARG D NE    1 
ATOM   2597  C  CZ    . ARG D 4  73   ? 183.982 181.149 200.151 1.00 106.77 ?  69   ARG D CZ    1 
ATOM   2598  N  NH1   . ARG D 4  73   ? 184.039 181.861 201.265 1.00 75.00  1  69   ARG D NH1   1 
ATOM   2599  N  NH2   . ARG D 4  73   ? 182.820 180.941 199.563 1.00 90.52  ?  69   ARG D NH2   1 
ATOM   2600  N  N     . ILE D 4  74   ? 189.113 177.102 202.047 1.00 145.41 ?  70   ILE D N     1 
ATOM   2601  C  CA    . ILE D 4  74   ? 190.410 177.066 202.779 1.00 157.42 ?  70   ILE D CA    1 
ATOM   2602  C  C     . ILE D 4  74   ? 191.232 175.767 202.549 1.00 213.55 ?  70   ILE D C     1 
ATOM   2603  O  O     . ILE D 4  74   ? 192.420 175.839 202.444 1.00 234.37 ?  70   ILE D O     1 
ATOM   2604  C  CB    . ILE D 4  74   ? 190.165 177.256 204.310 1.00 145.45 ?  70   ILE D CB    1 
ATOM   2605  C  CG1   . ILE D 4  74   ? 191.381 177.719 205.136 1.00 121.49 ?  70   ILE D CG1   1 
ATOM   2606  C  CG2   . ILE D 4  74   ? 189.681 175.967 204.980 1.00 139.57 ?  70   ILE D CG2   1 
ATOM   2607  C  CD1   . ILE D 4  74   ? 192.001 178.903 204.575 1.00 115.01 ?  70   ILE D CD1   1 
ATOM   2608  N  N     . ALA D 4  75   ? 190.622 174.586 202.592 1.00 166.01 ?  71   ALA D N     1 
ATOM   2609  C  CA    . ALA D 4  75   ? 191.392 173.303 202.655 1.00 84.77  ?  71   ALA D CA    1 
ATOM   2610  C  C     . ALA D 4  75   ? 191.933 172.973 201.253 1.00 63.39  ?  71   ALA D C     1 
ATOM   2611  O  O     . ALA D 4  75   ? 193.062 172.552 201.096 1.00 58.59  ?  71   ALA D O     1 
ATOM   2612  C  CB    . ALA D 4  75   ? 190.565 172.175 203.157 1.00 62.79  ?  71   ALA D CB    1 
ATOM   2613  N  N     . GLY D 4  76   ? 191.193 173.406 200.236 1.00 67.00  ?  72   GLY D N     1 
ATOM   2614  C  CA    . GLY D 4  76   ? 191.596 173.230 198.841 1.00 75.27  ?  72   GLY D CA    1 
ATOM   2615  C  C     . GLY D 4  76   ? 192.838 174.058 198.574 1.00 114.55 ?  72   GLY D C     1 
ATOM   2616  O  O     . GLY D 4  76   ? 193.775 173.563 197.940 1.00 267.86 ?  72   GLY D O     1 
ATOM   2617  N  N     . GLU D 4  77   ? 192.848 175.346 198.984 1.00 102.59 ?  73   GLU D N     1 
ATOM   2618  C  CA    . GLU D 4  77   ? 193.984 176.228 198.799 1.00 116.01 ?  73   GLU D CA    1 
ATOM   2619  C  C     . GLU D 4  77   ? 195.244 175.666 199.480 1.00 156.29 ?  73   GLU D C     1 
ATOM   2620  O  O     . GLU D 4  77   ? 196.325 175.683 198.892 1.00 167.50 ?  73   GLU D O     1 
ATOM   2621  C  CB    . GLU D 4  77   ? 193.543 177.550 199.372 1.00 105.32 ?  73   GLU D CB    1 
ATOM   2622  C  CG    . GLU D 4  77   ? 194.564 178.616 199.346 1.00 117.66 ?  73   GLU D CG    1 
ATOM   2623  C  CD    . GLU D 4  77   ? 194.626 179.368 198.102 1.00 86.98  ?  73   GLU D CD    1 
ATOM   2624  O  OE1   . GLU D 4  77   ? 194.245 178.773 197.045 1.00 65.30  ?  73   GLU D OE1   1 
ATOM   2625  O  OE2   . GLU D 4  77   ? 194.858 180.688 198.391 1.00 144.13 -1 73   GLU D OE2   1 
ATOM   2626  N  N     . ALA D 4  78   ? 195.103 175.062 200.652 1.00 158.30 ?  74   ALA D N     1 
ATOM   2627  C  CA    . ALA D 4  78   ? 196.156 174.422 201.320 1.00 170.27 ?  74   ALA D CA    1 
ATOM   2628  C  C     . ALA D 4  78   ? 196.798 173.310 200.476 1.00 161.15 ?  74   ALA D C     1 
ATOM   2629  O  O     . ALA D 4  78   ? 198.008 173.126 200.357 1.00 115.74 ?  74   ALA D O     1 
ATOM   2630  C  CB    . ALA D 4  78   ? 195.704 173.844 202.658 1.00 202.16 ?  74   ALA D CB    1 
ATOM   2631  N  N     . SER D 4  79   ? 195.914 172.564 199.860 1.00 167.74 ?  75   SER D N     1 
ATOM   2632  C  CA    . SER D 4  79   ? 196.322 171.489 198.953 1.00 113.49 ?  75   SER D CA    1 
ATOM   2633  C  C     . SER D 4  79   ? 197.176 172.007 197.790 1.00 117.23 ?  75   SER D C     1 
ATOM   2634  O  O     . SER D 4  79   ? 198.182 171.424 197.417 1.00 99.64  ?  75   SER D O     1 
ATOM   2635  C  CB    . SER D 4  79   ? 195.164 170.660 198.490 1.00 97.47  ?  75   SER D CB    1 
ATOM   2636  O  OG    . SER D 4  79   ? 195.697 169.518 197.878 1.00 67.73  ?  75   SER D OG    1 
ATOM   2637  N  N     . ARG D 4  80   ? 196.789 173.135 197.245 1.00 167.76 ?  76   ARG D N     1 
ATOM   2638  C  CA    . ARG D 4  80   ? 197.456 173.822 196.135 1.00 191.89 ?  76   ARG D CA    1 
ATOM   2639  C  C     . ARG D 4  80   ? 198.903 174.251 196.406 1.00 200.34 ?  76   ARG D C     1 
ATOM   2640  O  O     . ARG D 4  80   ? 199.689 174.163 195.566 1.00 314.35 ?  76   ARG D O     1 
ATOM   2641  C  CB    . ARG D 4  80   ? 196.629 175.031 195.689 1.00 302.53 ?  76   ARG D CB    1 
ATOM   2642  C  CG    . ARG D 4  80   ? 195.308 174.639 195.059 1.00 440.00 ?  76   ARG D CG    1 
ATOM   2643  C  CD    . ARG D 4  80   ? 195.613 173.972 193.735 1.00 440.00 ?  76   ARG D CD    1 
ATOM   2644  N  NE    . ARG D 4  80   ? 196.305 174.865 192.801 1.00 440.00 ?  76   ARG D NE    1 
ATOM   2645  C  CZ    . ARG D 4  80   ? 195.707 175.800 192.058 1.00 440.00 ?  76   ARG D CZ    1 
ATOM   2646  N  NH1   . ARG D 4  80   ? 194.430 176.093 192.263 1.00 440.00 1  76   ARG D NH1   1 
ATOM   2647  N  NH2   . ARG D 4  80   ? 196.386 176.424 191.104 1.00 440.00 ?  76   ARG D NH2   1 
ATOM   2648  N  N     . LEU D 4  81   ? 199.126 174.907 197.537 1.00 168.05 ?  77   LEU D N     1 
ATOM   2649  C  CA    . LEU D 4  81   ? 200.475 175.368 197.906 1.00 197.14 ?  77   LEU D CA    1 
ATOM   2650  C  C     . LEU D 4  81   ? 201.404 174.156 198.174 1.00 252.66 ?  77   LEU D C     1 
ATOM   2651  O  O     . LEU D 4  81   ? 202.556 174.078 197.752 1.00 371.35 ?  77   LEU D O     1 
ATOM   2652  C  CB    . LEU D 4  81   ? 200.394 176.384 199.062 1.00 156.84 ?  77   LEU D CB    1 
ATOM   2653  C  CG    . LEU D 4  81   ? 199.792 175.782 200.328 1.00 227.02 ?  77   LEU D CG    1 
ATOM   2654  C  CD1   . LEU D 4  81   ? 200.772 174.892 201.211 1.00 278.97 ?  77   LEU D CD1   1 
ATOM   2655  C  CD2   . LEU D 4  81   ? 199.252 176.932 201.127 1.00 324.88 ?  77   LEU D CD2   1 
ATOM   2656  N  N     . ALA D 4  82   ? 200.890 173.150 198.873 1.00 185.11 ?  78   ALA D N     1 
ATOM   2657  C  CA    . ALA D 4  82   ? 201.644 171.990 199.276 1.00 138.21 ?  78   ALA D CA    1 
ATOM   2658  C  C     . ALA D 4  82   ? 202.414 171.409 198.101 1.00 127.92 ?  78   ALA D C     1 
ATOM   2659  O  O     . ALA D 4  82   ? 203.496 171.021 198.247 1.00 111.14 ?  78   ALA D O     1 
ATOM   2660  C  CB    . ALA D 4  82   ? 200.742 170.957 199.892 1.00 102.00 ?  78   ALA D CB    1 
ATOM   2661  N  N     . HIS D 4  83   ? 201.800 171.312 196.929 1.00 139.30 ?  79   HIS D N     1 
ATOM   2662  C  CA    . HIS D 4  83   ? 202.361 170.663 195.751 1.00 144.37 ?  79   HIS D CA    1 
ATOM   2663  C  C     . HIS D 4  83   ? 202.709 171.757 194.743 1.00 121.75 ?  79   HIS D C     1 
ATOM   2664  O  O     . HIS D 4  83   ? 202.566 171.552 193.525 1.00 111.60 ?  79   HIS D O     1 
ATOM   2665  C  CB    . HIS D 4  83   ? 201.368 169.727 195.022 1.00 184.98 ?  79   HIS D CB    1 
ATOM   2666  C  CG    . HIS D 4  83   ? 200.955 168.527 195.804 1.00 194.12 ?  79   HIS D CG    1 
ATOM   2667  N  ND1   . HIS D 4  83   ? 201.839 167.531 196.123 1.00 167.59 ?  79   HIS D ND1   1 
ATOM   2668  C  CD2   . HIS D 4  83   ? 199.762 168.130 196.302 1.00 183.68 ?  79   HIS D CD2   1 
ATOM   2669  C  CE1   . HIS D 4  83   ? 201.225 166.574 196.798 1.00 125.96 ?  79   HIS D CE1   1 
ATOM   2670  N  NE2   . HIS D 4  83   ? 199.958 166.919 196.918 1.00 126.30 ?  79   HIS D NE2   1 
ATOM   2671  N  N     . TYR D 4  84   ? 203.075 172.945 195.231 1.00 116.25 ?  80   TYR D N     1 
ATOM   2672  C  CA    . TYR D 4  84   ? 203.756 173.936 194.436 1.00 139.25 ?  80   TYR D CA    1 
ATOM   2673  C  C     . TYR D 4  84   ? 205.190 173.883 194.916 1.00 165.87 ?  80   TYR D C     1 
ATOM   2674  O  O     . TYR D 4  84   ? 206.066 173.663 194.112 1.00 253.86 ?  80   TYR D O     1 
ATOM   2675  C  CB    . TYR D 4  84   ? 203.346 175.391 194.648 1.00 138.03 ?  80   TYR D CB    1 
ATOM   2676  C  CG    . TYR D 4  84   ? 202.037 175.722 194.022 1.00 169.69 ?  80   TYR D CG    1 
ATOM   2677  C  CD1   . TYR D 4  84   ? 201.734 175.148 192.795 1.00 201.94 ?  80   TYR D CD1   1 
ATOM   2678  C  CD2   . TYR D 4  84   ? 201.110 176.594 194.617 1.00 192.63 ?  80   TYR D CD2   1 
ATOM   2679  C  CE1   . TYR D 4  84   ? 200.530 175.476 192.166 1.00 263.00 ?  80   TYR D CE1   1 
ATOM   2680  C  CE2   . TYR D 4  84   ? 199.871 176.852 194.044 1.00 202.74 ?  80   TYR D CE2   1 
ATOM   2681  C  CZ    . TYR D 4  84   ? 199.611 176.322 192.788 1.00 277.81 ?  80   TYR D CZ    1 
ATOM   2682  O  OH    . TYR D 4  84   ? 198.428 176.569 192.153 1.00 368.51 ?  80   TYR D OH    1 
ATOM   2683  N  N     . ASN D 4  85   ? 205.419 174.279 196.167 1.00 154.58 ?  81   ASN D N     1 
ATOM   2684  C  CA    . ASN D 4  85   ? 206.897 174.528 196.379 1.00 171.97 ?  81   ASN D CA    1 
ATOM   2685  C  C     . ASN D 4  85   ? 207.552 173.211 196.728 1.00 142.13 ?  81   ASN D C     1 
ATOM   2686  O  O     . ASN D 4  85   ? 208.741 173.194 196.722 1.00 219.22 ?  81   ASN D O     1 
ATOM   2687  C  CB    . ASN D 4  85   ? 207.241 175.872 197.017 1.00 193.43 ?  81   ASN D CB    1 
ATOM   2688  C  CG    . ASN D 4  85   ? 207.828 176.876 195.991 1.00 185.12 ?  81   ASN D CG    1 
ATOM   2689  O  OD1   . ASN D 4  85   ? 209.001 176.734 195.649 1.00 209.55 ?  81   ASN D OD1   1 
ATOM   2690  N  ND2   . ASN D 4  85   ? 207.073 177.838 195.406 1.00 99.21  ?  81   ASN D ND2   1 
ATOM   2691  N  N     . LYS D 4  86   ? 206.819 172.127 196.587 1.00 125.76 ?  82   LYS D N     1 
ATOM   2692  C  CA    . LYS D 4  86   ? 207.370 170.730 196.285 1.00 173.40 ?  82   LYS D CA    1 
ATOM   2693  C  C     . LYS D 4  86   ? 207.214 169.730 197.446 1.00 123.16 ?  82   LYS D C     1 
ATOM   2694  O  O     . LYS D 4  86   ? 207.763 168.623 197.379 1.00 115.24 ?  82   LYS D O     1 
ATOM   2695  C  CB    . LYS D 4  86   ? 208.833 170.718 195.792 1.00 304.14 ?  82   LYS D CB    1 
ATOM   2696  C  CG    . LYS D 4  86   ? 209.060 171.220 194.378 1.00 366.79 ?  82   LYS D CG    1 
ATOM   2697  C  CD    . LYS D 4  86   ? 208.303 170.438 193.346 1.00 398.56 ?  82   LYS D CD    1 
ATOM   2698  C  CE    . LYS D 4  86   ? 208.705 168.981 193.276 1.00 398.38 ?  82   LYS D CE    1 
ATOM   2699  N  NZ    . LYS D 4  86   ? 208.320 168.409 191.973 1.00 375.60 1  82   LYS D NZ    1 
ATOM   2700  N  N     . ARG D 4  87   ? 206.273 169.973 198.359 1.00 96.21  ?  83   ARG D N     1 
ATOM   2701  C  CA    . ARG D 4  87   ? 206.068 169.088 199.436 1.00 105.37 ?  83   ARG D CA    1 
ATOM   2702  C  C     . ARG D 4  87   ? 204.643 168.557 199.523 1.00 97.35  ?  83   ARG D C     1 
ATOM   2703  O  O     . ARG D 4  87   ? 203.748 169.054 199.033 1.00 91.21  ?  83   ARG D O     1 
ATOM   2704  C  CB    . ARG D 4  87   ? 206.441 169.781 200.744 1.00 146.40 ?  83   ARG D CB    1 
ATOM   2705  C  CG    . ARG D 4  87   ? 207.935 169.651 201.047 1.00 192.58 ?  83   ARG D CG    1 
ATOM   2706  C  CD    . ARG D 4  87   ? 208.532 170.218 202.323 1.00 247.34 ?  83   ARG D CD    1 
ATOM   2707  N  NE    . ARG D 4  87   ? 209.928 169.770 202.302 1.00 295.28 ?  83   ARG D NE    1 
ATOM   2708  C  CZ    . ARG D 4  87   ? 210.983 170.511 201.946 1.00 339.79 ?  83   ARG D CZ    1 
ATOM   2709  N  NH1   . ARG D 4  87   ? 210.796 171.781 201.627 1.00 357.97 1  83   ARG D NH1   1 
ATOM   2710  N  NH2   . ARG D 4  87   ? 212.205 169.980 201.913 1.00 310.39 ?  83   ARG D NH2   1 
ATOM   2711  N  N     . SER D 4  88   ? 204.532 167.574 200.382 1.00 105.75 ?  84   SER D N     1 
ATOM   2712  C  CA    . SER D 4  88   ? 203.659 166.404 200.213 1.00 113.32 ?  84   SER D CA    1 
ATOM   2713  C  C     . SER D 4  88   ? 202.743 166.122 201.395 1.00 102.53 ?  84   SER D C     1 
ATOM   2714  O  O     . SER D 4  88   ? 202.156 165.034 201.410 1.00 78.04  ?  84   SER D O     1 
ATOM   2715  C  CB    . SER D 4  88   ? 204.546 165.211 199.953 1.00 132.22 ?  84   SER D CB    1 
ATOM   2716  O  OG    . SER D 4  88   ? 204.826 164.499 201.165 1.00 138.87 ?  84   SER D OG    1 
ATOM   2717  N  N     . THR D 4  89   ? 202.676 167.005 202.393 1.00 128.34 ?  85   THR D N     1 
ATOM   2718  C  CA    . THR D 4  89   ? 201.732 166.896 203.450 1.00 160.30 ?  85   THR D CA    1 
ATOM   2719  C  C     . THR D 4  89   ? 201.211 168.316 203.707 1.00 184.05 ?  85   THR D C     1 
ATOM   2720  O  O     . THR D 4  89   ? 201.944 169.296 203.456 1.00 185.47 ?  85   THR D O     1 
ATOM   2721  C  CB    . THR D 4  89   ? 202.353 166.205 204.686 1.00 173.70 ?  85   THR D CB    1 
ATOM   2722  O  OG1   . THR D 4  89   ? 201.292 165.836 205.570 1.00 173.29 ?  85   THR D OG1   1 
ATOM   2723  C  CG2   . THR D 4  89   ? 203.361 167.114 205.334 1.00 240.00 ?  85   THR D CG2   1 
ATOM   2724  N  N     . ILE D 4  90   ? 199.995 168.439 204.267 1.00 146.74 ?  86   ILE D N     1 
ATOM   2725  C  CA    . ILE D 4  90   ? 199.445 169.707 204.651 1.00 124.74 ?  86   ILE D CA    1 
ATOM   2726  C  C     . ILE D 4  90   ? 199.341 169.850 206.159 1.00 113.54 ?  86   ILE D C     1 
ATOM   2727  O  O     . ILE D 4  90   ? 198.442 169.283 206.768 1.00 81.14  ?  86   ILE D O     1 
ATOM   2728  C  CB    . ILE D 4  90   ? 198.092 169.983 203.935 1.00 136.55 ?  86   ILE D CB    1 
ATOM   2729  C  CG1   . ILE D 4  90   ? 198.327 170.368 202.482 1.00 139.32 ?  86   ILE D CG1   1 
ATOM   2730  C  CG2   . ILE D 4  90   ? 197.320 171.127 204.571 1.00 201.27 ?  86   ILE D CG2   1 
ATOM   2731  C  CD1   . ILE D 4  90   ? 198.439 169.214 201.588 1.00 159.58 ?  86   ILE D CD1   1 
ATOM   2732  N  N     . THR D 4  91   ? 200.189 170.721 206.757 1.00 113.02 ?  87   THR D N     1 
ATOM   2733  C  CA    . THR D 4  91   ? 200.106 171.090 208.142 1.00 95.12  ?  87   THR D CA    1 
ATOM   2734  C  C     . THR D 4  91   ? 199.300 172.346 208.429 1.00 69.50  ?  87   THR D C     1 
ATOM   2735  O  O     . THR D 4  91   ? 198.654 172.810 207.673 1.00 57.96  ?  87   THR D O     1 
ATOM   2736  C  CB    . THR D 4  91   ? 201.492 171.349 208.710 1.00 99.31  ?  87   THR D CB    1 
ATOM   2737  O  OG1   . THR D 4  91   ? 201.392 171.277 210.143 1.00 77.86  ?  87   THR D OG1   1 
ATOM   2738  C  CG2   . THR D 4  91   ? 202.142 172.594 208.115 1.00 90.80  ?  87   THR D CG2   1 
ATOM   2739  N  N     . SER D 4  92   ? 199.414 172.819 209.663 1.00 58.12  ?  88   SER D N     1 
ATOM   2740  C  CA    . SER D 4  92   ? 198.715 173.973 210.176 1.00 66.11  ?  88   SER D CA    1 
ATOM   2741  C  C     . SER D 4  92   ? 199.354 175.226 209.603 1.00 70.74  ?  88   SER D C     1 
ATOM   2742  O  O     . SER D 4  92   ? 198.669 176.280 209.516 1.00 89.73  ?  88   SER D O     1 
ATOM   2743  C  CB    . SER D 4  92   ? 198.772 174.021 211.696 1.00 94.37  ?  88   SER D CB    1 
ATOM   2744  O  OG    . SER D 4  92   ? 200.102 173.680 212.159 1.00 90.33  ?  88   SER D OG    1 
ATOM   2745  N  N     . ARG D 4  93   ? 200.713 175.223 209.414 1.00 94.09  ?  89   ARG D N     1 
ATOM   2746  C  CA    . ARG D 4  93   ? 201.360 176.426 208.955 1.00 131.15 ?  89   ARG D CA    1 
ATOM   2747  C  C     . ARG D 4  93   ? 200.705 176.933 207.656 1.00 98.42  ?  89   ARG D C     1 
ATOM   2748  O  O     . ARG D 4  93   ? 200.420 178.135 207.388 1.00 94.21  ?  89   ARG D O     1 
ATOM   2749  C  CB    . ARG D 4  93   ? 202.803 176.082 208.534 1.00 179.57 ?  89   ARG D CB    1 
ATOM   2750  C  CG    . ARG D 4  93   ? 203.819 176.198 209.634 1.00 226.08 ?  89   ARG D CG    1 
ATOM   2751  C  CD    . ARG D 4  93   ? 205.168 176.499 208.899 1.00 235.57 ?  89   ARG D CD    1 
ATOM   2752  N  NE    . ARG D 4  93   ? 206.157 177.369 209.572 1.00 271.24 ?  89   ARG D NE    1 
ATOM   2753  C  CZ    . ARG D 4  93   ? 207.412 177.046 209.906 1.00 333.78 ?  89   ARG D CZ    1 
ATOM   2754  N  NH1   . ARG D 4  93   ? 207.938 175.835 209.701 1.00 340.50 1  89   ARG D NH1   1 
ATOM   2755  N  NH2   . ARG D 4  93   ? 208.189 177.986 210.449 1.00 370.29 ?  89   ARG D NH2   1 
ATOM   2756  N  N     . GLU D 4  94   ? 200.467 175.992 206.758 1.00 82.00  ?  90   GLU D N     1 
ATOM   2757  C  CA    . GLU D 4  94   ? 199.974 176.319 205.474 1.00 95.66  ?  90   GLU D CA    1 
ATOM   2758  C  C     . GLU D 4  94   ? 198.623 177.016 205.667 1.00 69.44  ?  90   GLU D C     1 
ATOM   2759  O  O     . GLU D 4  94   ? 198.395 178.023 205.022 1.00 79.23  ?  90   GLU D O     1 
ATOM   2760  C  CB    . GLU D 4  94   ? 200.068 175.036 204.662 1.00 131.71 ?  90   GLU D CB    1 
ATOM   2761  C  CG    . GLU D 4  94   ? 201.473 174.323 204.576 1.00 101.33 ?  90   GLU D CG    1 
ATOM   2762  C  CD    . GLU D 4  94   ? 201.488 173.085 203.698 1.00 88.07  ?  90   GLU D CD    1 
ATOM   2763  O  OE1   . GLU D 4  94   ? 200.393 172.582 203.384 1.00 89.13  ?  90   GLU D OE1   1 
ATOM   2764  O  OE2   . GLU D 4  94   ? 202.416 172.887 203.043 1.00 225.10 -1 90   GLU D OE2   1 
ATOM   2765  N  N     . ILE D 4  95   ? 197.702 176.427 206.437 1.00 47.94  ?  91   ILE D N     1 
ATOM   2766  C  CA    . ILE D 4  95   ? 196.427 177.025 206.637 1.00 43.03  ?  91   ILE D CA    1 
ATOM   2767  C  C     . ILE D 4  95   ? 196.696 178.460 207.051 1.00 52.25  ?  91   ILE D C     1 
ATOM   2768  O  O     . ILE D 4  95   ? 196.017 179.428 206.642 1.00 39.51  ?  91   ILE D O     1 
ATOM   2769  C  CB    . ILE D 4  95   ? 195.560 176.378 207.713 1.00 34.33  ?  91   ILE D CB    1 
ATOM   2770  C  CG1   . ILE D 4  95   ? 195.543 174.846 207.578 1.00 18.90  ?  91   ILE D CG1   1 
ATOM   2771  C  CG2   . ILE D 4  95   ? 194.163 177.076 207.735 1.00 36.27  ?  91   ILE D CG2   1 
ATOM   2772  C  CD1   . ILE D 4  95   ? 195.143 174.173 208.779 1.00 13.49  ?  91   ILE D CD1   1 
ATOM   2773  N  N     . GLN D 4  96   ? 197.633 178.513 207.978 1.00 105.78 ?  92   GLN D N     1 
ATOM   2774  C  CA    . GLN D 4  96   ? 198.087 179.723 208.614 1.00 142.08 ?  92   GLN D CA    1 
ATOM   2775  C  C     . GLN D 4  96   ? 198.396 180.790 207.548 1.00 119.96 ?  92   GLN D C     1 
ATOM   2776  O  O     . GLN D 4  96   ? 197.903 181.912 207.688 1.00 113.48 ?  92   GLN D O     1 
ATOM   2777  C  CB    . GLN D 4  96   ? 199.284 179.450 209.516 1.00 174.48 ?  92   GLN D CB    1 
ATOM   2778  C  CG    . GLN D 4  96   ? 199.752 180.774 210.197 1.00 130.60 ?  92   GLN D CG    1 
ATOM   2779  C  CD    . GLN D 4  96   ? 200.834 180.465 211.200 1.00 125.63 ?  92   GLN D CD    1 
ATOM   2780  O  OE1   . GLN D 4  96   ? 201.652 179.567 210.900 1.00 170.21 ?  92   GLN D OE1   1 
ATOM   2781  N  NE2   . GLN D 4  96   ? 200.800 181.132 212.367 1.00 110.85 ?  92   GLN D NE2   1 
ATOM   2782  N  N     . THR D 4  97   ? 199.259 180.404 206.592 1.00 106.65 ?  93   THR D N     1 
ATOM   2783  C  CA    . THR D 4  97   ? 199.588 181.279 205.486 1.00 96.39  ?  93   THR D CA    1 
ATOM   2784  C  C     . THR D 4  97   ? 198.344 181.577 204.628 1.00 96.03  ?  93   THR D C     1 
ATOM   2785  O  O     . THR D 4  97   ? 198.120 182.712 204.155 1.00 88.70  ?  93   THR D O     1 
ATOM   2786  C  CB    . THR D 4  97   ? 200.606 180.671 204.506 1.00 78.52  ?  93   THR D CB    1 
ATOM   2787  O  OG1   . THR D 4  97   ? 200.072 179.469 203.992 1.00 85.79  ?  93   THR D OG1   1 
ATOM   2788  C  CG2   . THR D 4  97   ? 201.879 180.247 205.143 1.00 91.65  ?  93   THR D CG2   1 
ATOM   2789  N  N     . ALA D 4  98   ? 197.571 180.522 204.410 1.00 97.19  ?  94   ALA D N     1 
ATOM   2790  C  CA    . ALA D 4  98   ? 196.504 180.569 203.464 1.00 94.83  ?  94   ALA D CA    1 
ATOM   2791  C  C     . ALA D 4  98   ? 195.509 181.604 203.908 1.00 77.69  ?  94   ALA D C     1 
ATOM   2792  O  O     . ALA D 4  98   ? 194.913 182.325 203.057 1.00 67.63  ?  94   ALA D O     1 
ATOM   2793  C  CB    . ALA D 4  98   ? 195.803 179.221 203.404 1.00 119.17 ?  94   ALA D CB    1 
ATOM   2794  N  N     . VAL D 4  99   ? 195.229 181.501 205.222 1.00 75.11  ?  95   VAL D N     1 
ATOM   2795  C  CA    . VAL D 4  99   ? 194.238 182.295 205.755 1.00 103.53 ?  95   VAL D CA    1 
ATOM   2796  C  C     . VAL D 4  99   ? 194.578 183.755 205.510 1.00 95.99  ?  95   VAL D C     1 
ATOM   2797  O  O     . VAL D 4  99   ? 193.643 184.642 205.187 1.00 171.06 ?  95   VAL D O     1 
ATOM   2798  C  CB    . VAL D 4  99   ? 193.893 182.019 207.226 1.00 121.00 ?  95   VAL D CB    1 
ATOM   2799  C  CG1   . VAL D 4  99   ? 192.666 182.838 207.623 1.00 159.49 ?  95   VAL D CG1   1 
ATOM   2800  C  CG2   . VAL D 4  99   ? 193.576 180.574 207.487 1.00 108.78 ?  95   VAL D CG2   1 
ATOM   2801  N  N     . ARG D 4  100  ? 195.844 184.067 205.693 1.00 91.67  ?  96   ARG D N     1 
ATOM   2802  C  CA    . ARG D 4  100  ? 196.319 185.465 205.697 1.00 112.70 ?  96   ARG D CA    1 
ATOM   2803  C  C     . ARG D 4  100  ? 195.935 186.265 204.454 1.00 97.39  ?  96   ARG D C     1 
ATOM   2804  O  O     . ARG D 4  100  ? 195.541 187.440 204.524 1.00 82.22  ?  96   ARG D O     1 
ATOM   2805  C  CB    . ARG D 4  100  ? 197.821 185.515 205.937 1.00 171.13 ?  96   ARG D CB    1 
ATOM   2806  C  CG    . ARG D 4  100  ? 198.244 185.217 207.379 1.00 174.14 ?  96   ARG D CG    1 
ATOM   2807  C  CD    . ARG D 4  100  ? 199.740 184.942 207.507 1.00 172.09 ?  96   ARG D CD    1 
ATOM   2808  N  NE    . ARG D 4  100  ? 200.388 186.247 207.528 1.00 222.25 ?  96   ARG D NE    1 
ATOM   2809  C  CZ    . ARG D 4  100  ? 200.521 186.969 208.632 1.00 272.31 ?  96   ARG D CZ    1 
ATOM   2810  N  NH1   . ARG D 4  100  ? 200.297 186.353 209.774 1.00 284.12 1  96   ARG D NH1   1 
ATOM   2811  N  NH2   . ARG D 4  100  ? 200.854 188.262 208.613 1.00 302.13 ?  96   ARG D NH2   1 
ATOM   2812  N  N     . LEU D 4  101  ? 196.060 185.658 203.280 1.00 103.22 ?  97   LEU D N     1 
ATOM   2813  C  CA    . LEU D 4  101  ? 195.785 186.308 202.021 1.00 134.76 ?  97   LEU D CA    1 
ATOM   2814  C  C     . LEU D 4  101  ? 194.344 186.036 201.563 1.00 196.29 ?  97   LEU D C     1 
ATOM   2815  O  O     . LEU D 4  101  ? 193.949 186.722 200.608 1.00 181.69 ?  97   LEU D O     1 
ATOM   2816  C  CB    . LEU D 4  101  ? 196.785 185.854 200.934 1.00 118.89 ?  97   LEU D CB    1 
ATOM   2817  C  CG    . LEU D 4  101  ? 196.484 184.435 200.482 1.00 112.50 ?  97   LEU D CG    1 
ATOM   2818  C  CD1   . LEU D 4  101  ? 195.499 184.536 199.313 1.00 173.90 ?  97   LEU D CD1   1 
ATOM   2819  C  CD2   . LEU D 4  101  ? 197.659 183.577 200.147 1.00 121.21 ?  97   LEU D CD2   1 
ATOM   2820  N  N     . LEU D 4  102  ? 193.615 185.077 202.195 1.00 235.80 ?  98   LEU D N     1 
ATOM   2821  C  CA    . LEU D 4  102  ? 192.220 184.806 201.871 1.00 198.10 ?  98   LEU D CA    1 
ATOM   2822  C  C     . LEU D 4  102  ? 191.270 185.867 202.477 1.00 167.96 ?  98   LEU D C     1 
ATOM   2823  O  O     . LEU D 4  102  ? 190.082 185.857 202.234 1.00 158.00 ?  98   LEU D O     1 
ATOM   2824  C  CB    . LEU D 4  102  ? 191.765 183.496 202.520 1.00 155.83 ?  98   LEU D CB    1 
ATOM   2825  C  CG    . LEU D 4  102  ? 191.907 182.148 201.855 1.00 124.02 ?  98   LEU D CG    1 
ATOM   2826  C  CD1   . LEU D 4  102  ? 191.536 181.090 202.830 1.00 89.01  ?  98   LEU D CD1   1 
ATOM   2827  C  CD2   . LEU D 4  102  ? 190.892 182.023 200.746 1.00 92.59  ?  98   LEU D CD2   1 
ATOM   2828  N  N     . LEU D 4  103  ? 191.769 186.662 203.424 1.00 180.49 ?  99   LEU D N     1 
ATOM   2829  C  CA    . LEU D 4  103  ? 190.919 187.574 204.146 1.00 139.94 ?  99   LEU D CA    1 
ATOM   2830  C  C     . LEU D 4  103  ? 191.645 188.924 204.310 1.00 196.93 ?  99   LEU D C     1 
ATOM   2831  O  O     . LEU D 4  103  ? 192.883 189.015 204.319 1.00 327.19 ?  99   LEU D O     1 
ATOM   2832  C  CB    . LEU D 4  103  ? 190.602 186.927 205.485 1.00 93.85  ?  99   LEU D CB    1 
ATOM   2833  C  CG    . LEU D 4  103  ? 189.396 186.028 205.545 1.00 71.92  ?  99   LEU D CG    1 
ATOM   2834  C  CD1   . LEU D 4  103  ? 189.414 185.215 206.832 1.00 62.59  ?  99   LEU D CD1   1 
ATOM   2835  C  CD2   . LEU D 4  103  ? 188.279 186.995 205.202 1.00 67.61  ?  99   LEU D CD2   1 
ATOM   2836  N  N     . PRO D 4  104  ? 190.844 190.016 204.485 1.00 171.96 ?  100  PRO D N     1 
ATOM   2837  C  CA    . PRO D 4  104  ? 191.371 191.370 204.706 1.00 204.98 ?  100  PRO D CA    1 
ATOM   2838  C  C     . PRO D 4  104  ? 191.922 191.671 206.119 1.00 223.16 ?  100  PRO D C     1 
ATOM   2839  O  O     . PRO D 4  104  ? 191.627 190.952 207.105 1.00 175.52 ?  100  PRO D O     1 
ATOM   2840  C  CB    . PRO D 4  104  ? 190.190 192.300 204.361 1.00 204.81 ?  100  PRO D CB    1 
ATOM   2841  C  CG    . PRO D 4  104  ? 189.069 191.329 203.911 1.00 200.12 ?  100  PRO D CG    1 
ATOM   2842  C  CD    . PRO D 4  104  ? 189.386 189.943 204.433 1.00 140.36 ?  100  PRO D CD    1 
ATOM   2843  N  N     . GLY D 4  105  ? 192.761 192.723 206.139 1.00 234.07 ?  101  GLY D N     1 
ATOM   2844  C  CA    . GLY D 4  105  ? 193.752 193.077 207.228 1.00 223.69 ?  101  GLY D CA    1 
ATOM   2845  C  C     . GLY D 4  105  ? 193.349 192.789 208.691 1.00 211.87 ?  101  GLY D C     1 
ATOM   2846  O  O     . GLY D 4  105  ? 194.109 192.110 209.445 1.00 221.81 ?  101  GLY D O     1 
ATOM   2847  N  N     . GLU D 4  106  ? 192.263 193.436 209.149 1.00 203.15 ?  102  GLU D N     1 
ATOM   2848  C  CA    . GLU D 4  106  ? 191.901 193.513 210.539 1.00 222.68 ?  102  GLU D CA    1 
ATOM   2849  C  C     . GLU D 4  106  ? 191.340 192.209 211.082 1.00 166.56 ?  102  GLU D C     1 
ATOM   2850  O  O     . GLU D 4  106  ? 191.721 191.833 212.223 1.00 153.18 ?  102  GLU D O     1 
ATOM   2851  C  CB    . GLU D 4  106  ? 190.946 194.684 210.748 1.00 311.39 ?  102  GLU D CB    1 
ATOM   2852  C  CG    . GLU D 4  106  ? 191.678 196.032 210.654 1.00 326.03 ?  102  GLU D CG    1 
ATOM   2853  C  CD    . GLU D 4  106  ? 192.927 196.066 211.523 1.00 315.00 ?  102  GLU D CD    1 
ATOM   2854  O  OE1   . GLU D 4  106  ? 192.833 195.673 212.691 1.00 332.30 ?  102  GLU D OE1   1 
ATOM   2855  O  OE2   . GLU D 4  106  ? 193.996 196.391 211.020 1.00 440.00 -1 102  GLU D OE2   1 
ATOM   2856  N  N     . LEU D 4  107  ? 190.451 191.511 210.336 1.00 122.28 ?  103  LEU D N     1 
ATOM   2857  C  CA    . LEU D 4  107  ? 189.900 190.289 210.820 1.00 123.54 ?  103  LEU D CA    1 
ATOM   2858  C  C     . LEU D 4  107  ? 191.002 189.222 210.874 1.00 89.13  ?  103  LEU D C     1 
ATOM   2859  O  O     . LEU D 4  107  ? 191.013 188.330 211.754 1.00 67.04  ?  103  LEU D O     1 
ATOM   2860  C  CB    . LEU D 4  107  ? 188.760 189.876 209.891 1.00 135.53 ?  103  LEU D CB    1 
ATOM   2861  C  CG    . LEU D 4  107  ? 188.133 188.533 210.238 1.00 136.20 ?  103  LEU D CG    1 
ATOM   2862  C  CD1   . LEU D 4  107  ? 186.703 188.415 209.735 1.00 121.40 ?  103  LEU D CD1   1 
ATOM   2863  C  CD2   . LEU D 4  107  ? 188.938 187.353 209.689 1.00 152.97 ?  103  LEU D CD2   1 
ATOM   2864  N  N     . ALA D 4  108  ? 191.881 189.323 209.878 1.00 85.55  ?  104  ALA D N     1 
ATOM   2865  C  CA    . ALA D 4  108  ? 192.831 188.295 209.616 1.00 92.65  ?  104  ALA D CA    1 
ATOM   2866  C  C     . ALA D 4  108  ? 193.749 188.113 210.804 1.00 73.35  ?  104  ALA D C     1 
ATOM   2867  O  O     . ALA D 4  108  ? 194.131 187.066 211.179 1.00 55.10  ?  104  ALA D O     1 
ATOM   2868  C  CB    . ALA D 4  108  ? 193.585 188.629 208.326 1.00 137.35 ?  104  ALA D CB    1 
ATOM   2869  N  N     . LYS D 4  109  ? 194.209 189.209 211.381 1.00 98.50  ?  105  LYS D N     1 
ATOM   2870  C  CA    . LYS D 4  109  ? 195.198 189.142 212.456 1.00 118.47 ?  105  LYS D CA    1 
ATOM   2871  C  C     . LYS D 4  109  ? 194.553 188.510 213.684 1.00 113.30 ?  105  LYS D C     1 
ATOM   2872  O  O     . LYS D 4  109  ? 195.147 187.750 214.394 1.00 93.05  ?  105  LYS D O     1 
ATOM   2873  C  CB    . LYS D 4  109  ? 195.691 190.547 212.800 1.00 163.31 ?  105  LYS D CB    1 
ATOM   2874  C  CG    . LYS D 4  109  ? 196.275 191.301 211.623 1.00 211.90 ?  105  LYS D CG    1 
ATOM   2875  C  CD    . LYS D 4  109  ? 196.650 192.711 211.999 1.00 272.67 ?  105  LYS D CD    1 
ATOM   2876  C  CE    . LYS D 4  109  ? 195.536 193.529 212.635 1.00 284.40 ?  105  LYS D CE    1 
ATOM   2877  N  NZ    . LYS D 4  109  ? 195.985 194.874 213.071 1.00 286.82 1  105  LYS D NZ    1 
ATOM   2878  N  N     . HIS D 4  110  ? 193.363 188.989 214.038 1.00 133.81 ?  106  HIS D N     1 
ATOM   2879  C  CA    . HIS D 4  110  ? 192.660 188.450 215.189 1.00 152.94 ?  106  HIS D CA    1 
ATOM   2880  C  C     . HIS D 4  110  ? 192.381 186.968 214.974 1.00 122.34 ?  106  HIS D C     1 
ATOM   2881  O  O     . HIS D 4  110  ? 192.516 186.129 215.855 1.00 98.64  ?  106  HIS D O     1 
ATOM   2882  C  CB    . HIS D 4  110  ? 191.346 189.193 215.391 1.00 157.42 ?  106  HIS D CB    1 
ATOM   2883  C  CG    . HIS D 4  110  ? 191.554 190.608 215.835 1.00 224.82 ?  106  HIS D CG    1 
ATOM   2884  N  ND1   . HIS D 4  110  ? 190.509 191.482 216.008 1.00 346.44 ?  106  HIS D ND1   1 
ATOM   2885  C  CD2   . HIS D 4  110  ? 192.672 191.292 216.172 1.00 299.13 ?  106  HIS D CD2   1 
ATOM   2886  C  CE1   . HIS D 4  110  ? 190.971 192.647 216.428 1.00 417.38 ?  106  HIS D CE1   1 
ATOM   2887  N  NE2   . HIS D 4  110  ? 192.301 192.556 216.518 1.00 347.70 ?  106  HIS D NE2   1 
ATOM   2888  N  N     . ALA D 4  111  ? 192.022 186.664 213.737 1.00 102.82 ?  107  ALA D N     1 
ATOM   2889  C  CA    . ALA D 4  111  ? 191.715 185.295 213.394 1.00 93.70  ?  107  ALA D CA    1 
ATOM   2890  C  C     . ALA D 4  111  ? 192.937 184.392 213.598 1.00 84.96  ?  107  ALA D C     1 
ATOM   2891  O  O     . ALA D 4  111  ? 192.766 183.284 214.114 1.00 60.49  ?  107  ALA D O     1 
ATOM   2892  C  CB    . ALA D 4  111  ? 191.217 185.329 211.974 1.00 92.82  ?  107  ALA D CB    1 
ATOM   2893  N  N     . VAL D 4  112  ? 194.130 184.852 213.154 1.00 106.68 ?  108  VAL D N     1 
ATOM   2894  C  CA    . VAL D 4  112  ? 195.347 184.083 213.286 1.00 120.15 ?  108  VAL D CA    1 
ATOM   2895  C  C     . VAL D 4  112  ? 195.533 183.827 214.762 1.00 110.95 ?  108  VAL D C     1 
ATOM   2896  O  O     . VAL D 4  112  ? 195.908 182.729 215.226 1.00 88.20  ?  108  VAL D O     1 
ATOM   2897  C  CB    . VAL D 4  112  ? 196.634 184.803 212.805 1.00 132.29 ?  108  VAL D CB    1 
ATOM   2898  C  CG1   . VAL D 4  112  ? 197.843 183.946 213.099 1.00 152.25 ?  108  VAL D CG1   1 
ATOM   2899  C  CG2   . VAL D 4  112  ? 196.702 185.239 211.360 1.00 145.25 ?  108  VAL D CG2   1 
ATOM   2900  N  N     . SER D 4  113  ? 195.424 184.947 215.486 1.00 142.97 ?  109  SER D N     1 
ATOM   2901  C  CA    . SER D 4  113  ? 195.832 185.023 216.928 1.00 169.88 ?  109  SER D CA    1 
ATOM   2902  C  C     . SER D 4  113  ? 195.095 183.909 217.677 1.00 143.34 ?  109  SER D C     1 
ATOM   2903  O  O     . SER D 4  113  ? 195.645 183.105 218.464 1.00 120.61 ?  109  SER D O     1 
ATOM   2904  C  CB    . SER D 4  113  ? 195.498 186.437 217.414 1.00 217.15 ?  109  SER D CB    1 
ATOM   2905  O  OG    . SER D 4  113  ? 196.016 187.369 216.482 1.00 216.23 ?  109  SER D OG    1 
ATOM   2906  N  N     . GLU D 4  114  ? 193.773 183.970 217.493 1.00 128.65 ?  110  GLU D N     1 
ATOM   2907  C  CA    . GLU D 4  114  ? 192.846 183.018 218.057 1.00 132.92 ?  110  GLU D CA    1 
ATOM   2908  C  C     . GLU D 4  114  ? 193.292 181.596 217.681 1.00 97.85  ?  110  GLU D C     1 
ATOM   2909  O  O     . GLU D 4  114  ? 193.170 180.643 218.449 1.00 78.49  ?  110  GLU D O     1 
ATOM   2910  C  CB    . GLU D 4  114  ? 191.448 183.316 217.567 1.00 156.22 ?  110  GLU D CB    1 
ATOM   2911  C  CG    . GLU D 4  114  ? 190.454 182.323 218.067 1.00 223.28 ?  110  GLU D CG    1 
ATOM   2912  C  CD    . GLU D 4  114  ? 190.479 181.001 217.344 1.00 202.19 ?  110  GLU D CD    1 
ATOM   2913  O  OE1   . GLU D 4  114  ? 191.028 180.971 216.260 1.00 152.90 ?  110  GLU D OE1   1 
ATOM   2914  O  OE2   . GLU D 4  114  ? 189.996 180.004 217.893 1.00 168.92 -1 110  GLU D OE2   1 
ATOM   2915  N  N     . GLY D 4  115  ? 193.608 181.492 216.384 1.00 92.78  ?  111  GLY D N     1 
ATOM   2916  C  CA    . GLY D 4  115  ? 193.925 180.199 215.807 1.00 123.95 ?  111  GLY D CA    1 
ATOM   2917  C  C     . GLY D 4  115  ? 195.177 179.626 216.430 1.00 122.53 ?  111  GLY D C     1 
ATOM   2918  O  O     . GLY D 4  115  ? 195.322 178.423 216.680 1.00 94.65  ?  111  GLY D O     1 
ATOM   2919  N  N     . THR D 4  116  ? 196.169 180.521 216.550 1.00 136.70 ?  112  THR D N     1 
ATOM   2920  C  CA    . THR D 4  116  ? 197.533 180.101 216.956 1.00 132.96 ?  112  THR D CA    1 
ATOM   2921  C  C     . THR D 4  116  ? 197.483 179.605 218.396 1.00 95.34  ?  112  THR D C     1 
ATOM   2922  O  O     . THR D 4  116  ? 198.188 178.596 218.715 1.00 73.55  ?  112  THR D O     1 
ATOM   2923  C  CB    . THR D 4  116  ? 198.523 181.263 216.831 1.00 157.87 ?  112  THR D CB    1 
ATOM   2924  O  OG1   . THR D 4  116  ? 199.790 180.609 216.894 1.00 177.84 ?  112  THR D OG1   1 
ATOM   2925  C  CG2   . THR D 4  116  ? 198.274 182.352 217.852 1.00 164.51 ?  112  THR D CG2   1 
ATOM   2926  N  N     . LYS D 4  117  ? 196.715 180.328 219.237 1.00 107.45 ?  113  LYS D N     1 
ATOM   2927  C  CA    . LYS D 4  117  ? 196.650 180.097 220.678 1.00 155.39 ?  113  LYS D CA    1 
ATOM   2928  C  C     . LYS D 4  117  ? 195.908 178.789 220.850 1.00 138.21 ?  113  LYS D C     1 
ATOM   2929  O  O     . LYS D 4  117  ? 196.318 177.986 221.727 1.00 165.11 ?  113  LYS D O     1 
ATOM   2930  C  CB    . LYS D 4  117  ? 195.967 181.245 221.420 1.00 234.09 ?  113  LYS D CB    1 
ATOM   2931  C  CG    . LYS D 4  117  ? 195.467 180.996 222.839 1.00 313.77 ?  113  LYS D CG    1 
ATOM   2932  C  CD    . LYS D 4  117  ? 194.571 182.111 223.352 1.00 361.02 ?  113  LYS D CD    1 
ATOM   2933  C  CE    . LYS D 4  117  ? 195.295 183.409 223.676 1.00 369.20 ?  113  LYS D CE    1 
ATOM   2934  N  NZ    . LYS D 4  117  ? 194.403 184.339 224.400 1.00 334.88 1  113  LYS D NZ    1 
ATOM   2935  N  N     . ALA D 4  118  ? 194.700 178.672 220.249 1.00 113.63 ?  114  ALA D N     1 
ATOM   2936  C  CA    . ALA D 4  118  ? 193.865 177.495 220.534 1.00 124.06 ?  114  ALA D CA    1 
ATOM   2937  C  C     . ALA D 4  118  ? 194.758 176.229 220.484 1.00 135.35 ?  114  ALA D C     1 
ATOM   2938  O  O     . ALA D 4  118  ? 194.614 175.234 221.244 1.00 121.78 ?  114  ALA D O     1 
ATOM   2939  C  CB    . ALA D 4  118  ? 192.702 177.478 219.570 1.00 113.35 ?  114  ALA D CB    1 
ATOM   2940  N  N     . VAL D 4  119  ? 195.593 176.185 219.443 1.00 130.25 ?  115  VAL D N     1 
ATOM   2941  C  CA    . VAL D 4  119  ? 196.389 174.988 219.177 1.00 142.19 ?  115  VAL D CA    1 
ATOM   2942  C  C     . VAL D 4  119  ? 197.533 174.906 220.168 1.00 103.54 ?  115  VAL D C     1 
ATOM   2943  O  O     . VAL D 4  119  ? 197.966 173.821 220.610 1.00 63.22  ?  115  VAL D O     1 
ATOM   2944  C  CB    . VAL D 4  119  ? 197.038 175.007 217.781 1.00 204.68 ?  115  VAL D CB    1 
ATOM   2945  C  CG1   . VAL D 4  119  ? 198.082 173.880 217.669 1.00 257.51 ?  115  VAL D CG1   1 
ATOM   2946  C  CG2   . VAL D 4  119  ? 195.965 175.042 216.675 1.00 227.08 ?  115  VAL D CG2   1 
ATOM   2947  N  N     . THR D 4  120  ? 198.139 176.060 220.385 1.00 114.16 ?  116  THR D N     1 
ATOM   2948  C  CA    . THR D 4  120  ? 199.236 176.209 221.320 1.00 144.33 ?  116  THR D CA    1 
ATOM   2949  C  C     . THR D 4  120  ? 198.844 175.610 222.662 1.00 139.29 ?  116  THR D C     1 
ATOM   2950  O  O     . THR D 4  120  ? 199.617 174.960 223.319 1.00 106.36 ?  116  THR D O     1 
ATOM   2951  C  CB    . THR D 4  120  ? 199.640 177.675 221.499 1.00 194.13 ?  116  THR D CB    1 
ATOM   2952  O  OG1   . THR D 4  120  ? 200.068 178.095 220.202 1.00 207.05 ?  116  THR D OG1   1 
ATOM   2953  C  CG2   . THR D 4  120  ? 200.749 177.784 222.510 1.00 233.48 ?  116  THR D CG2   1 
ATOM   2954  N  N     . LYS D 4  121  ? 197.636 175.938 223.148 1.00 185.35 ?  117  LYS D N     1 
ATOM   2955  C  CA    . LYS D 4  121  ? 197.110 175.392 224.376 1.00 238.65 ?  117  LYS D CA    1 
ATOM   2956  C  C     . LYS D 4  121  ? 196.964 173.881 224.215 1.00 198.83 ?  117  LYS D C     1 
ATOM   2957  O  O     . LYS D 4  121  ? 197.252 173.086 225.207 1.00 234.00 ?  117  LYS D O     1 
ATOM   2958  C  CB    . LYS D 4  121  ? 195.804 176.092 224.736 1.00 283.25 ?  117  LYS D CB    1 
ATOM   2959  C  CG    . LYS D 4  121  ? 195.045 175.448 225.880 1.00 356.81 ?  117  LYS D CG    1 
ATOM   2960  C  CD    . LYS D 4  121  ? 194.022 176.350 226.531 1.00 403.08 ?  117  LYS D CD    1 
ATOM   2961  C  CE    . LYS D 4  121  ? 192.610 176.214 225.993 1.00 418.91 ?  117  LYS D CE    1 
ATOM   2962  N  NZ    . LYS D 4  121  ? 191.643 176.782 226.961 1.00 436.33 1  117  LYS D NZ    1 
ATOM   2963  N  N     . TYR D 4  122  ? 196.456 173.456 223.071 1.00 146.37 ?  118  TYR D N     1 
ATOM   2964  C  CA    . TYR D 4  122  ? 196.183 172.079 222.789 1.00 135.18 ?  118  TYR D CA    1 
ATOM   2965  C  C     . TYR D 4  122  ? 197.464 171.293 223.075 1.00 136.84 ?  118  TYR D C     1 
ATOM   2966  O  O     . TYR D 4  122  ? 197.431 170.207 223.728 1.00 132.05 ?  118  TYR D O     1 
ATOM   2967  C  CB    . TYR D 4  122  ? 195.750 171.824 221.325 1.00 126.75 ?  118  TYR D CB    1 
ATOM   2968  C  CG    . TYR D 4  122  ? 195.720 170.320 221.065 1.00 151.63 ?  118  TYR D CG    1 
ATOM   2969  C  CD1   . TYR D 4  122  ? 194.722 169.545 221.663 1.00 199.20 ?  118  TYR D CD1   1 
ATOM   2970  C  CD2   . TYR D 4  122  ? 196.731 169.642 220.392 1.00 158.46 ?  118  TYR D CD2   1 
ATOM   2971  C  CE1   . TYR D 4  122  ? 194.777 168.156 221.669 1.00 204.17 ?  118  TYR D CE1   1 
ATOM   2972  C  CE2   . TYR D 4  122  ? 196.768 168.261 220.370 1.00 199.35 ?  118  TYR D CE2   1 
ATOM   2973  C  CZ    . TYR D 4  122  ? 195.788 167.509 220.994 1.00 184.90 ?  118  TYR D CZ    1 
ATOM   2974  O  OH    . TYR D 4  122  ? 195.786 166.148 220.925 1.00 153.18 ?  118  TYR D OH    1 
ATOM   2975  N  N     . THR D 4  123  ? 198.606 171.764 222.583 1.00 140.54 ?  119  THR D N     1 
ATOM   2976  C  CA    . THR D 4  123  ? 199.844 171.037 222.728 1.00 197.04 ?  119  THR D CA    1 
ATOM   2977  C  C     . THR D 4  123  ? 200.275 171.044 224.203 1.00 191.50 ?  119  THR D C     1 
ATOM   2978  O  O     . THR D 4  123  ? 200.823 170.032 224.701 1.00 200.13 ?  119  THR D O     1 
ATOM   2979  C  CB    . THR D 4  123  ? 200.977 171.640 221.869 1.00 268.10 ?  119  THR D CB    1 
ATOM   2980  O  OG1   . THR D 4  123  ? 202.098 170.758 221.847 1.00 362.16 ?  119  THR D OG1   1 
ATOM   2981  C  CG2   . THR D 4  123  ? 201.407 173.011 222.355 1.00 253.85 ?  119  THR D CG2   1 
ATOM   2982  N  N     . SER D 4  124  ? 200.111 172.203 224.868 1.00 214.65 ?  120  SER D N     1 
ATOM   2983  C  CA    . SER D 4  124  ? 200.543 172.389 226.226 1.00 289.46 ?  120  SER D CA    1 
ATOM   2984  C  C     . SER D 4  124  ? 200.067 171.175 227.027 1.00 324.39 ?  120  SER D C     1 
ATOM   2985  O  O     . SER D 4  124  ? 200.823 170.539 227.780 1.00 400.00 ?  120  SER D O     1 
ATOM   2986  C  CB    . SER D 4  124  ? 200.073 173.706 226.833 1.00 304.22 ?  120  SER D CB    1 
ATOM   2987  O  OG    . SER D 4  124  ? 200.586 174.750 226.044 1.00 277.06 ?  120  SER D OG    1 
ATOM   2988  N  N     . ALA D 4  125  ? 198.771 170.891 226.872 1.00 274.36 ?  121  ALA D N     1 
ATOM   2989  C  CA    . ALA D 4  125  ? 198.163 169.627 227.341 1.00 226.24 ?  121  ALA D CA    1 
ATOM   2990  C  C     . ALA D 4  125  ? 198.735 168.482 226.501 1.00 177.34 ?  121  ALA D C     1 
ATOM   2991  O  O     . ALA D 4  125  ? 199.122 168.733 225.343 1.00 118.59 ?  121  ALA D O     1 
ATOM   2992  C  CB    . ALA D 4  125  ? 196.648 169.705 227.179 1.00 259.20 ?  121  ALA D CB    1 
ATOM   2993  N  N     . LYS D 4  126  ? 198.762 167.233 227.027 1.00 210.27 ?  122  LYS D N     1 
ATOM   2994  C  CA    . LYS D 4  126  ? 199.120 166.082 226.219 1.00 273.49 ?  122  LYS D CA    1 
ATOM   2995  C  C     . LYS D 4  126  ? 199.729 164.962 227.082 1.00 325.03 ?  122  LYS D C     1 
ATOM   2996  O  O     . LYS D 4  126  ? 199.178 163.891 227.061 1.00 361.54 ?  122  LYS D O     1 
ATOM   2997  C  CB    . LYS D 4  126  ? 200.091 166.501 225.123 1.00 294.59 ?  122  LYS D CB    1 
ATOM   2998  C  CG    . LYS D 4  126  ? 200.686 165.458 224.201 1.00 403.13 ?  122  LYS D CG    1 
ATOM   2999  C  CD    . LYS D 4  126  ? 202.101 165.849 223.847 1.00 440.00 ?  122  LYS D CD    1 
ATOM   3000  C  CE    . LYS D 4  126  ? 202.911 164.728 223.220 1.00 440.00 ?  122  LYS D CE    1 
ATOM   3001  N  NZ    . LYS D 4  126  ? 204.059 165.222 222.407 1.00 440.00 1  122  LYS D NZ    1 
ATOM   3002  O  OXT   . LYS D 4  126  ? 200.769 165.042 227.719 1.00 440.00 -1 122  LYS D OXT   1 
ATOM   3003  N  N     . HIS E 1  40   ? 148.688 212.981 203.274 1.00 440.00 ?  39   HIS E N     1 
ATOM   3004  C  CA    . HIS E 1  40   ? 149.889 212.497 202.540 1.00 440.00 ?  39   HIS E CA    1 
ATOM   3005  C  C     . HIS E 1  40   ? 150.322 213.543 201.505 1.00 440.00 ?  39   HIS E C     1 
ATOM   3006  O  O     . HIS E 1  40   ? 150.301 213.223 200.299 1.00 252.08 ?  39   HIS E O     1 
ATOM   3007  C  CB    . HIS E 1  40   ? 149.611 211.131 201.898 1.00 280.74 ?  39   HIS E CB    1 
ATOM   3008  C  CG    . HIS E 1  40   ? 150.147 209.980 202.680 1.00 279.68 ?  39   HIS E CG    1 
ATOM   3009  N  ND1   . HIS E 1  40   ? 151.431 209.969 203.192 1.00 305.78 ?  39   HIS E ND1   1 
ATOM   3010  C  CD2   . HIS E 1  40   ? 149.584 208.806 203.041 1.00 282.56 ?  39   HIS E CD2   1 
ATOM   3011  C  CE1   . HIS E 1  40   ? 151.636 208.836 203.835 1.00 299.70 ?  39   HIS E CE1   1 
ATOM   3012  N  NE2   . HIS E 1  40   ? 150.519 208.105 203.757 1.00 326.85 ?  39   HIS E NE2   1 
ATOM   3013  N  N     . ARG E 1  41   ? 150.699 214.739 201.968 1.00 440.00 ?  40   ARG E N     1 
ATOM   3014  C  CA    . ARG E 1  41   ? 151.147 215.837 201.070 1.00 440.00 ?  40   ARG E CA    1 
ATOM   3015  C  C     . ARG E 1  41   ? 150.122 216.035 199.949 1.00 440.00 ?  40   ARG E C     1 
ATOM   3016  O  O     . ARG E 1  41   ? 148.921 216.160 200.260 1.00 440.00 ?  40   ARG E O     1 
ATOM   3017  C  CB    . ARG E 1  41   ? 152.537 215.531 200.502 1.00 440.00 ?  40   ARG E CB    1 
ATOM   3018  C  CG    . ARG E 1  41   ? 153.464 216.737 200.441 1.00 440.00 ?  40   ARG E CG    1 
ATOM   3019  C  CD    . ARG E 1  41   ? 154.923 216.355 200.605 1.00 363.09 ?  40   ARG E CD    1 
ATOM   3020  N  NE    . ARG E 1  41   ? 155.195 215.748 201.900 1.00 313.56 ?  40   ARG E NE    1 
ATOM   3021  C  CZ    . ARG E 1  41   ? 156.409 215.460 202.355 1.00 249.46 ?  40   ARG E CZ    1 
ATOM   3022  N  NH1   . ARG E 1  41   ? 157.426 216.255 202.076 1.00 256.21 1  40   ARG E NH1   1 
ATOM   3023  N  NH2   . ARG E 1  41   ? 156.601 214.378 203.090 1.00 197.79 ?  40   ARG E NH2   1 
ATOM   3024  N  N     . TYR E 1  42   ? 150.589 216.064 198.696 1.00 440.00 ?  41   TYR E N     1 
ATOM   3025  C  CA    . TYR E 1  42   ? 149.693 216.257 197.523 1.00 440.00 ?  41   TYR E CA    1 
ATOM   3026  C  C     . TYR E 1  42   ? 149.445 214.909 196.835 1.00 440.00 ?  41   TYR E C     1 
ATOM   3027  O  O     . TYR E 1  42   ? 148.932 213.983 197.494 1.00 402.75 ?  41   TYR E O     1 
ATOM   3028  C  CB    . TYR E 1  42   ? 150.290 217.284 196.557 1.00 440.00 ?  41   TYR E CB    1 
ATOM   3029  C  CG    . TYR E 1  42   ? 150.047 218.722 196.939 1.00 440.00 ?  41   TYR E CG    1 
ATOM   3030  C  CD1   . TYR E 1  42   ? 148.842 219.343 196.654 1.00 440.00 ?  41   TYR E CD1   1 
ATOM   3031  C  CD2   . TYR E 1  42   ? 151.019 219.465 197.585 1.00 440.00 ?  41   TYR E CD2   1 
ATOM   3032  C  CE1   . TYR E 1  42   ? 148.609 220.664 197.002 1.00 440.00 ?  41   TYR E CE1   1 
ATOM   3033  C  CE2   . TYR E 1  42   ? 150.803 220.786 197.940 1.00 440.00 ?  41   TYR E CE2   1 
ATOM   3034  C  CZ    . TYR E 1  42   ? 149.594 221.388 197.648 1.00 440.00 ?  41   TYR E CZ    1 
ATOM   3035  O  OH    . TYR E 1  42   ? 149.374 222.690 197.994 1.00 440.00 ?  41   TYR E OH    1 
ATOM   3036  N  N     . ARG E 1  43   ? 149.798 214.811 195.549 1.00 440.00 ?  42   ARG E N     1 
ATOM   3037  C  CA    . ARG E 1  43   ? 149.596 213.557 194.774 1.00 440.00 ?  42   ARG E CA    1 
ATOM   3038  C  C     . ARG E 1  43   ? 150.768 213.351 193.806 1.00 440.00 ?  42   ARG E C     1 
ATOM   3039  O  O     . ARG E 1  43   ? 151.080 212.182 193.503 1.00 440.00 ?  42   ARG E O     1 
ATOM   3040  C  CB    . ARG E 1  43   ? 148.264 213.606 194.018 1.00 440.00 ?  42   ARG E CB    1 
ATOM   3041  C  CG    . ARG E 1  43   ? 147.424 212.344 194.155 1.00 440.00 ?  42   ARG E CG    1 
ATOM   3042  C  CD    . ARG E 1  43   ? 146.293 212.294 193.145 1.00 440.00 ?  42   ARG E CD    1 
ATOM   3043  N  NE    . ARG E 1  43   ? 145.098 212.977 193.617 1.00 440.00 ?  42   ARG E NE    1 
ATOM   3044  C  CZ    . ARG E 1  43   ? 143.943 213.012 192.961 1.00 440.00 ?  42   ARG E CZ    1 
ATOM   3045  N  NH1   . ARG E 1  43   ? 143.818 212.377 191.808 1.00 440.00 1  42   ARG E NH1   1 
ATOM   3046  N  NH2   . ARG E 1  43   ? 142.920 213.684 193.458 1.00 440.00 ?  42   ARG E NH2   1 
ATOM   3047  N  N     . PRO E 1  44   ? 151.420 214.424 193.305 1.00 440.00 ?  43   PRO E N     1 
ATOM   3048  C  CA    . PRO E 1  44   ? 152.549 214.289 192.376 1.00 440.00 ?  43   PRO E CA    1 
ATOM   3049  C  C     . PRO E 1  44   ? 153.613 213.318 192.910 1.00 425.09 ?  43   PRO E C     1 
ATOM   3050  O  O     . PRO E 1  44   ? 154.001 213.451 194.057 1.00 343.29 ?  43   PRO E O     1 
ATOM   3051  C  CB    . PRO E 1  44   ? 153.124 215.711 192.312 1.00 440.00 ?  43   PRO E CB    1 
ATOM   3052  C  CG    . PRO E 1  44   ? 151.933 216.599 192.592 1.00 440.00 ?  43   PRO E CG    1 
ATOM   3053  C  CD    . PRO E 1  44   ? 151.103 215.825 193.595 1.00 440.00 ?  43   PRO E CD    1 
ATOM   3054  N  N     . GLY E 1  45   ? 154.048 212.373 192.070 1.00 301.93 ?  44   GLY E N     1 
ATOM   3055  C  CA    . GLY E 1  45   ? 155.028 211.412 192.463 1.00 244.20 ?  44   GLY E CA    1 
ATOM   3056  C  C     . GLY E 1  45   ? 154.826 211.007 193.914 1.00 195.43 ?  44   GLY E C     1 
ATOM   3057  O  O     . GLY E 1  45   ? 155.721 211.262 194.735 1.00 199.08 ?  44   GLY E O     1 
ATOM   3058  N  N     . THR E 1  46   ? 153.634 210.456 194.198 1.00 158.73 ?  45   THR E N     1 
ATOM   3059  C  CA    . THR E 1  46   ? 153.281 210.233 195.596 1.00 174.82 ?  45   THR E CA    1 
ATOM   3060  C  C     . THR E 1  46   ? 153.429 208.749 195.952 1.00 145.63 ?  45   THR E C     1 
ATOM   3061  O  O     . THR E 1  46   ? 153.746 208.365 197.093 1.00 126.77 ?  45   THR E O     1 
ATOM   3062  C  CB    . THR E 1  46   ? 151.846 210.638 195.936 1.00 210.50 ?  45   THR E CB    1 
ATOM   3063  O  OG1   . THR E 1  46   ? 151.515 210.593 197.331 1.00 241.78 ?  45   THR E OG1   1 
ATOM   3064  C  CG2   . THR E 1  46   ? 150.833 209.729 195.295 1.00 226.58 ?  45   THR E CG2   1 
ATOM   3065  N  N     . VAL E 1  47   ? 153.074 207.913 194.965 1.00 134.43 ?  46   VAL E N     1 
ATOM   3066  C  CA    . VAL E 1  47   ? 153.091 206.475 195.136 1.00 156.74 ?  46   VAL E CA    1 
ATOM   3067  C  C     . VAL E 1  47   ? 154.481 205.929 194.771 1.00 122.83 ?  46   VAL E C     1 
ATOM   3068  O  O     . VAL E 1  47   ? 155.023 205.007 195.440 1.00 95.94  ?  46   VAL E O     1 
ATOM   3069  C  CB    . VAL E 1  47   ? 151.997 205.755 194.308 1.00 200.28 ?  46   VAL E CB    1 
ATOM   3070  C  CG1   . VAL E 1  47   ? 151.975 204.283 194.594 1.00 195.24 ?  46   VAL E CG1   1 
ATOM   3071  C  CG2   . VAL E 1  47   ? 150.656 206.356 194.526 1.00 242.47 ?  46   VAL E CG2   1 
ATOM   3072  N  N     . ALA E 1  48   ? 154.994 206.523 193.652 1.00 126.24 ?  47   ALA E N     1 
ATOM   3073  C  CA    . ALA E 1  48   ? 156.287 206.322 193.070 1.00 153.46 ?  47   ALA E CA    1 
ATOM   3074  C  C     . ALA E 1  48   ? 157.229 205.745 194.129 1.00 137.71 ?  47   ALA E C     1 
ATOM   3075  O  O     . ALA E 1  48   ? 157.821 204.705 193.884 1.00 152.83 ?  47   ALA E O     1 
ATOM   3076  C  CB    . ALA E 1  48   ? 156.787 207.595 192.402 1.00 142.42 ?  47   ALA E CB    1 
ATOM   3077  N  N     . LEU E 1  49   ? 157.400 206.432 195.256 1.00 103.93 ?  48   LEU E N     1 
ATOM   3078  C  CA    . LEU E 1  49   ? 158.422 206.043 196.184 1.00 92.64  ?  48   LEU E CA    1 
ATOM   3079  C  C     . LEU E 1  49   ? 157.773 205.140 197.212 1.00 71.05  ?  48   LEU E C     1 
ATOM   3080  O  O     . LEU E 1  49   ? 158.414 204.543 198.029 1.00 53.88  ?  48   LEU E O     1 
ATOM   3081  C  CB    . LEU E 1  49   ? 159.001 207.286 196.856 1.00 133.33 ?  48   LEU E CB    1 
ATOM   3082  C  CG    . LEU E 1  49   ? 159.955 208.150 196.041 1.00 203.70 ?  48   LEU E CG    1 
ATOM   3083  C  CD1   . LEU E 1  49   ? 159.158 209.014 195.133 1.00 193.94 ?  48   LEU E CD1   1 
ATOM   3084  C  CD2   . LEU E 1  49   ? 160.856 209.015 196.924 1.00 247.71 ?  48   LEU E CD2   1 
ATOM   3085  N  N     . ARG E 1  50   ? 156.460 205.228 197.307 1.00 96.24  ?  49   ARG E N     1 
ATOM   3086  C  CA    . ARG E 1  50   ? 155.662 204.506 198.315 1.00 142.05 ?  49   ARG E CA    1 
ATOM   3087  C  C     . ARG E 1  50   ? 155.757 202.999 198.102 1.00 111.26 ?  49   ARG E C     1 
ATOM   3088  O  O     . ARG E 1  50   ? 155.996 202.200 199.051 1.00 88.85  ?  49   ARG E O     1 
ATOM   3089  C  CB    . ARG E 1  50   ? 154.179 204.805 198.159 1.00 191.55 ?  49   ARG E CB    1 
ATOM   3090  C  CG    . ARG E 1  50   ? 153.245 204.028 199.071 1.00 188.93 ?  49   ARG E CG    1 
ATOM   3091  C  CD    . ARG E 1  50   ? 151.852 204.141 198.561 1.00 199.55 ?  49   ARG E CD    1 
ATOM   3092  N  NE    . ARG E 1  50   ? 151.339 205.492 198.773 1.00 216.88 ?  49   ARG E NE    1 
ATOM   3093  C  CZ    . ARG E 1  50   ? 150.149 205.891 198.341 1.00 290.98 ?  49   ARG E CZ    1 
ATOM   3094  N  NH1   . ARG E 1  50   ? 149.344 205.013 197.770 1.00 335.94 1  49   ARG E NH1   1 
ATOM   3095  N  NH2   . ARG E 1  50   ? 149.731 207.138 198.514 1.00 308.29 ?  49   ARG E NH2   1 
ATOM   3096  N  N     . GLU E 1  51   ? 155.380 202.610 196.878 1.00 132.81 ?  50   GLU E N     1 
ATOM   3097  C  CA    . GLU E 1  51   ? 155.244 201.144 196.631 1.00 188.27 ?  50   GLU E CA    1 
ATOM   3098  C  C     . GLU E 1  51   ? 156.611 200.549 196.948 1.00 161.28 ?  50   GLU E C     1 
ATOM   3099  O  O     . GLU E 1  51   ? 156.705 199.430 197.442 1.00 124.22 ?  50   GLU E O     1 
ATOM   3100  C  CB    . GLU E 1  51   ? 154.815 200.858 195.206 1.00 270.24 ?  50   GLU E CB    1 
ATOM   3101  C  CG    . GLU E 1  51   ? 153.480 201.428 194.847 1.00 303.83 ?  50   GLU E CG    1 
ATOM   3102  C  CD    . GLU E 1  51   ? 152.925 201.050 193.466 1.00 352.66 ?  50   GLU E CD    1 
ATOM   3103  O  OE1   . GLU E 1  51   ? 153.687 201.074 192.479 1.00 413.17 ?  50   GLU E OE1   1 
ATOM   3104  O  OE2   . GLU E 1  51   ? 151.703 200.788 193.344 1.00 440.00 -1 50   GLU E OE2   1 
ATOM   3105  N  N     . ILE E 1  52   ? 157.663 201.313 196.602 1.00 139.17 ?  51   ILE E N     1 
ATOM   3106  C  CA    . ILE E 1  52   ? 159.053 200.871 196.667 1.00 121.51 ?  51   ILE E CA    1 
ATOM   3107  C  C     . ILE E 1  52   ? 159.337 200.361 198.060 1.00 80.69  ?  51   ILE E C     1 
ATOM   3108  O  O     . ILE E 1  52   ? 159.917 199.335 198.220 1.00 56.00  ?  51   ILE E O     1 
ATOM   3109  C  CB    . ILE E 1  52   ? 160.045 201.993 196.329 1.00 137.54 ?  51   ILE E CB    1 
ATOM   3110  C  CG1   . ILE E 1  52   ? 159.994 202.443 194.871 1.00 214.65 ?  51   ILE E CG1   1 
ATOM   3111  C  CG2   . ILE E 1  52   ? 161.467 201.681 196.668 1.00 123.12 ?  51   ILE E CG2   1 
ATOM   3112  C  CD1   . ILE E 1  52   ? 160.665 203.789 194.614 1.00 223.51 ?  51   ILE E CD1   1 
ATOM   3113  N  N     . ARG E 1  53   ? 158.913 201.182 199.014 1.00 91.14  ?  52   ARG E N     1 
ATOM   3114  C  CA    . ARG E 1  53   ? 159.217 200.930 200.387 1.00 129.95 ?  52   ARG E CA    1 
ATOM   3115  C  C     . ARG E 1  53   ? 158.488 199.676 200.842 1.00 129.63 ?  52   ARG E C     1 
ATOM   3116  O  O     . ARG E 1  53   ? 158.999 198.958 201.676 1.00 100.93 ?  52   ARG E O     1 
ATOM   3117  C  CB    . ARG E 1  53   ? 158.702 202.138 201.192 1.00 151.49 ?  52   ARG E CB    1 
ATOM   3118  C  CG    . ARG E 1  53   ? 159.448 203.421 200.857 1.00 141.94 ?  52   ARG E CG    1 
ATOM   3119  C  CD    . ARG E 1  53   ? 158.958 204.635 201.590 1.00 130.29 ?  52   ARG E CD    1 
ATOM   3120  N  NE    . ARG E 1  53   ? 159.910 205.745 201.520 1.00 141.47 ?  52   ARG E NE    1 
ATOM   3121  C  CZ    . ARG E 1  53   ? 159.811 206.756 200.684 1.00 154.36 ?  52   ARG E CZ    1 
ATOM   3122  N  NH1   . ARG E 1  53   ? 158.932 206.583 199.697 1.00 195.62 1  52   ARG E NH1   1 
ATOM   3123  N  NH2   . ARG E 1  53   ? 160.514 207.895 200.874 1.00 117.77 ?  52   ARG E NH2   1 
ATOM   3124  N  N     . ARG E 1  54   ? 157.205 199.534 200.426 1.00 143.28 ?  53   ARG E N     1 
ATOM   3125  C  CA    . ARG E 1  54   ? 156.416 198.425 200.942 1.00 186.85 ?  53   ARG E CA    1 
ATOM   3126  C  C     . ARG E 1  54   ? 156.970 197.116 200.358 1.00 187.43 ?  53   ARG E C     1 
ATOM   3127  O  O     . ARG E 1  54   ? 156.956 195.999 200.916 1.00 235.38 ?  53   ARG E O     1 
ATOM   3128  C  CB    . ARG E 1  54   ? 154.971 198.576 200.502 1.00 222.91 ?  53   ARG E CB    1 
ATOM   3129  C  CG    . ARG E 1  54   ? 154.330 199.833 201.072 1.00 241.00 ?  53   ARG E CG    1 
ATOM   3130  C  CD    . ARG E 1  54   ? 152.899 199.956 200.620 1.00 260.69 ?  53   ARG E CD    1 
ATOM   3131  N  NE    . ARG E 1  54   ? 152.840 200.007 199.156 1.00 250.30 ?  53   ARG E NE    1 
ATOM   3132  C  CZ    . ARG E 1  54   ? 152.663 198.978 198.325 1.00 250.69 ?  53   ARG E CZ    1 
ATOM   3133  N  NH1   . ARG E 1  54   ? 152.670 197.716 198.736 1.00 236.75 1  53   ARG E NH1   1 
ATOM   3134  N  NH2   . ARG E 1  54   ? 152.449 199.239 197.056 1.00 260.44 ?  53   ARG E NH2   1 
ATOM   3135  N  N     . TYR E 1  55   ? 157.406 197.239 199.120 1.00 169.53 ?  54   TYR E N     1 
ATOM   3136  C  CA    . TYR E 1  55   ? 157.960 196.080 198.455 1.00 181.97 ?  54   TYR E CA    1 
ATOM   3137  C  C     . TYR E 1  55   ? 159.245 195.633 199.141 1.00 141.34 ?  54   TYR E C     1 
ATOM   3138  O  O     . TYR E 1  55   ? 159.544 194.402 199.316 1.00 124.84 ?  54   TYR E O     1 
ATOM   3139  C  CB    . TYR E 1  55   ? 158.118 196.353 196.977 1.00 222.65 ?  54   TYR E CB    1 
ATOM   3140  C  CG    . TYR E 1  55   ? 156.780 196.421 196.309 1.00 265.46 ?  54   TYR E CG    1 
ATOM   3141  C  CD1   . TYR E 1  55   ? 155.921 195.320 196.273 1.00 292.86 ?  54   TYR E CD1   1 
ATOM   3142  C  CD2   . TYR E 1  55   ? 156.434 197.540 195.550 1.00 280.80 ?  54   TYR E CD2   1 
ATOM   3143  C  CE1   . TYR E 1  55   ? 154.724 195.360 195.565 1.00 293.98 ?  54   TYR E CE1   1 
ATOM   3144  C  CE2   . TYR E 1  55   ? 155.255 197.575 194.808 1.00 275.88 ?  54   TYR E CE2   1 
ATOM   3145  C  CZ    . TYR E 1  55   ? 154.404 196.482 194.812 1.00 289.05 ?  54   TYR E CZ    1 
ATOM   3146  O  OH    . TYR E 1  55   ? 153.237 196.547 194.093 1.00 355.69 ?  54   TYR E OH    1 
ATOM   3147  N  N     . GLN E 1  56   ? 160.041 196.622 199.580 1.00 102.00 ?  55   GLN E N     1 
ATOM   3148  C  CA    . GLN E 1  56   ? 161.266 196.299 200.291 1.00 102.51 ?  55   GLN E CA    1 
ATOM   3149  C  C     . GLN E 1  56   ? 161.040 195.560 201.623 1.00 111.60 ?  55   GLN E C     1 
ATOM   3150  O  O     . GLN E 1  56   ? 161.800 194.656 201.974 1.00 133.68 ?  55   GLN E O     1 
ATOM   3151  C  CB    . GLN E 1  56   ? 162.117 197.566 200.412 1.00 97.23  ?  55   GLN E CB    1 
ATOM   3152  C  CG    . GLN E 1  56   ? 162.891 197.782 199.095 1.00 105.95 ?  55   GLN E CG    1 
ATOM   3153  C  CD    . GLN E 1  56   ? 163.557 199.107 198.954 1.00 107.89 ?  55   GLN E CD    1 
ATOM   3154  O  OE1   . GLN E 1  56   ? 163.364 199.990 199.781 1.00 123.55 ?  55   GLN E OE1   1 
ATOM   3155  N  NE2   . GLN E 1  56   ? 164.287 199.172 197.883 1.00 100.12 ?  55   GLN E NE2   1 
ATOM   3156  N  N     . LYS E 1  57   ? 160.105 196.020 202.412 1.00 143.29 ?  56   LYS E N     1 
ATOM   3157  C  CA    . LYS E 1  57   ? 159.882 195.397 203.720 1.00 231.95 ?  56   LYS E CA    1 
ATOM   3158  C  C     . LYS E 1  57   ? 159.445 193.927 203.640 1.00 210.03 ?  56   LYS E C     1 
ATOM   3159  O  O     . LYS E 1  57   ? 159.555 193.195 204.604 1.00 157.46 ?  56   LYS E O     1 
ATOM   3160  C  CB    . LYS E 1  57   ? 158.771 196.079 204.510 1.00 376.50 ?  56   LYS E CB    1 
ATOM   3161  C  CG    . LYS E 1  57   ? 158.633 197.583 204.417 1.00 440.00 ?  56   LYS E CG    1 
ATOM   3162  C  CD    . LYS E 1  57   ? 157.686 198.251 205.439 1.00 440.00 ?  56   LYS E CD    1 
ATOM   3163  C  CE    . LYS E 1  57   ? 157.059 199.532 204.909 1.00 392.82 ?  56   LYS E CE    1 
ATOM   3164  N  NZ    . LYS E 1  57   ? 156.556 200.456 205.987 1.00 303.98 1  56   LYS E NZ    1 
ATOM   3165  N  N     . SER E 1  58   ? 158.763 193.614 202.556 1.00 232.03 ?  57   SER E N     1 
ATOM   3166  C  CA    . SER E 1  58   ? 158.212 192.325 202.222 1.00 239.39 ?  57   SER E CA    1 
ATOM   3167  C  C     . SER E 1  58   ? 159.378 191.515 201.680 1.00 144.80 ?  57   SER E C     1 
ATOM   3168  O  O     . SER E 1  58   ? 160.450 191.982 201.515 1.00 85.09  ?  57   SER E O     1 
ATOM   3169  C  CB    . SER E 1  58   ? 157.166 192.507 201.152 1.00 311.56 ?  57   SER E CB    1 
ATOM   3170  O  OG    . SER E 1  58   ? 157.764 192.449 199.862 1.00 283.31 ?  57   SER E OG    1 
ATOM   3171  N  N     . THR E 1  59   ? 159.101 190.236 201.404 1.00 181.81 ?  58   THR E N     1 
ATOM   3172  C  CA    . THR E 1  59   ? 160.128 189.303 200.869 1.00 226.19 ?  58   THR E CA    1 
ATOM   3173  C  C     . THR E 1  59   ? 159.444 188.218 200.029 1.00 308.42 ?  58   THR E C     1 
ATOM   3174  O  O     . THR E 1  59   ? 160.002 187.107 199.932 1.00 235.91 ?  58   THR E O     1 
ATOM   3175  C  CB    . THR E 1  59   ? 160.964 188.692 202.000 1.00 286.64 ?  58   THR E CB    1 
ATOM   3176  O  OG1   . THR E 1  59   ? 160.157 187.727 202.674 1.00 181.50 ?  58   THR E OG1   1 
ATOM   3177  C  CG2   . THR E 1  59   ? 161.461 189.725 202.988 1.00 403.91 ?  58   THR E CG2   1 
ATOM   3178  N  N     . GLU E 1  60   ? 158.282 188.537 199.450 1.00 412.77 ?  59   GLU E N     1 
ATOM   3179  C  CA    . GLU E 1  60   ? 157.524 187.568 198.612 1.00 440.00 ?  59   GLU E CA    1 
ATOM   3180  C  C     . GLU E 1  60   ? 158.063 187.607 197.178 1.00 348.13 ?  59   GLU E C     1 
ATOM   3181  O  O     . GLU E 1  60   ? 158.666 188.633 196.801 1.00 257.90 ?  59   GLU E O     1 
ATOM   3182  C  CB    . GLU E 1  60   ? 156.028 187.894 198.643 1.00 440.00 ?  59   GLU E CB    1 
ATOM   3183  C  CG    . GLU E 1  60   ? 155.474 188.057 200.047 1.00 440.00 ?  59   GLU E CG    1 
ATOM   3184  C  CD    . GLU E 1  60   ? 154.056 188.596 200.107 1.00 440.00 ?  59   GLU E CD    1 
ATOM   3185  O  OE1   . GLU E 1  60   ? 153.674 189.354 199.192 1.00 440.00 ?  59   GLU E OE1   1 
ATOM   3186  O  OE2   . GLU E 1  60   ? 153.335 188.256 201.068 1.00 440.00 -1 59   GLU E OE2   1 
ATOM   3187  N  N     . LEU E 1  61   ? 157.850 186.529 196.417 1.00 251.37 ?  60   LEU E N     1 
ATOM   3188  C  CA    . LEU E 1  61   ? 158.324 186.448 195.010 1.00 205.23 ?  60   LEU E CA    1 
ATOM   3189  C  C     . LEU E 1  61   ? 157.678 187.578 194.196 1.00 199.45 ?  60   LEU E C     1 
ATOM   3190  O  O     . LEU E 1  61   ? 156.456 187.780 194.335 1.00 222.25 ?  60   LEU E O     1 
ATOM   3191  C  CB    . LEU E 1  61   ? 157.957 185.076 194.438 1.00 206.62 ?  60   LEU E CB    1 
ATOM   3192  C  CG    . LEU E 1  61   ? 158.651 183.885 195.096 1.00 222.50 ?  60   LEU E CG    1 
ATOM   3193  C  CD1   . LEU E 1  61   ? 158.107 182.572 194.554 1.00 210.37 ?  60   LEU E CD1   1 
ATOM   3194  C  CD2   . LEU E 1  61   ? 160.158 183.959 194.901 1.00 227.80 ?  60   LEU E CD2   1 
ATOM   3195  N  N     . LEU E 1  62   ? 158.477 188.276 193.383 1.00 162.12 ?  61   LEU E N     1 
ATOM   3196  C  CA    . LEU E 1  62   ? 157.969 189.396 192.547 1.00 135.65 ?  61   LEU E CA    1 
ATOM   3197  C  C     . LEU E 1  62   ? 157.127 188.831 191.395 1.00 149.50 ?  61   LEU E C     1 
ATOM   3198  O  O     . LEU E 1  62   ? 156.035 189.375 191.142 1.00 143.40 ?  61   LEU E O     1 
ATOM   3199  C  CB    . LEU E 1  62   ? 159.158 190.202 192.017 1.00 96.42  ?  61   LEU E CB    1 
ATOM   3200  C  CG    . LEU E 1  62   ? 159.662 191.312 192.939 1.00 80.28  ?  61   LEU E CG    1 
ATOM   3201  C  CD1   . LEU E 1  62   ? 160.685 192.184 192.228 1.00 63.11  ?  61   LEU E CD1   1 
ATOM   3202  C  CD2   . LEU E 1  62   ? 158.506 192.156 193.452 1.00 79.17  ?  61   LEU E CD2   1 
ATOM   3203  N  N     . ILE E 1  63   ? 157.628 187.783 190.733 1.00 160.53 ?  62   ILE E N     1 
ATOM   3204  C  CA    . ILE E 1  63   ? 156.936 187.178 189.644 1.00 153.14 ?  62   ILE E CA    1 
ATOM   3205  C  C     . ILE E 1  63   ? 156.122 185.970 190.144 1.00 135.20 ?  62   ILE E C     1 
ATOM   3206  O  O     . ILE E 1  63   ? 156.497 185.222 191.083 1.00 87.48  ?  62   ILE E O     1 
ATOM   3207  C  CB    . ILE E 1  63   ? 157.951 186.772 188.548 1.00 173.17 ?  62   ILE E CB    1 
ATOM   3208  C  CG1   . ILE E 1  63   ? 159.174 187.695 188.544 1.00 122.57 ?  62   ILE E CG1   1 
ATOM   3209  C  CG2   . ILE E 1  63   ? 157.326 186.640 187.166 1.00 235.19 ?  62   ILE E CG2   1 
ATOM   3210  C  CD1   . ILE E 1  63   ? 158.926 189.151 188.195 1.00 82.27  ?  62   ILE E CD1   1 
ATOM   3211  N  N     . ARG E 1  64   ? 154.970 185.772 189.495 1.00 140.48 ?  63   ARG E N     1 
ATOM   3212  C  CA    . ARG E 1  64   ? 154.053 184.652 189.841 1.00 156.75 ?  63   ARG E CA    1 
ATOM   3213  C  C     . ARG E 1  64   ? 154.855 183.349 189.914 1.00 102.38 ?  63   ARG E C     1 
ATOM   3214  O  O     . ARG E 1  64   ? 156.032 183.355 189.505 1.00 85.08  ?  63   ARG E O     1 
ATOM   3215  C  CB    . ARG E 1  64   ? 152.926 184.548 188.807 1.00 210.24 ?  63   ARG E CB    1 
ATOM   3216  C  CG    . ARG E 1  64   ? 151.977 185.739 188.800 1.00 309.38 ?  63   ARG E CG    1 
ATOM   3217  C  CD    . ARG E 1  64   ? 150.836 185.561 187.815 1.00 440.00 ?  63   ARG E CD    1 
ATOM   3218  N  NE    . ARG E 1  64   ? 149.781 186.546 188.008 1.00 440.00 ?  63   ARG E NE    1 
ATOM   3219  C  CZ    . ARG E 1  64   ? 148.487 186.256 188.083 1.00 440.00 ?  63   ARG E CZ    1 
ATOM   3220  N  NH1   . ARG E 1  64   ? 147.983 185.279 187.350 1.00 440.00 1  63   ARG E NH1   1 
ATOM   3221  N  NH2   . ARG E 1  64   ? 147.701 186.943 188.893 1.00 440.00 ?  63   ARG E NH2   1 
ATOM   3222  N  N     . LYS E 1  65   ? 154.232 182.278 190.418 1.00 108.74 ?  64   LYS E N     1 
ATOM   3223  C  CA    . LYS E 1  65   ? 154.905 180.957 190.541 1.00 122.23 ?  64   LYS E CA    1 
ATOM   3224  C  C     . LYS E 1  65   ? 154.048 179.889 189.850 1.00 119.11 ?  64   LYS E C     1 
ATOM   3225  O  O     . LYS E 1  65   ? 153.914 178.785 190.412 1.00 147.99 ?  64   LYS E O     1 
ATOM   3226  C  CB    . LYS E 1  65   ? 155.135 180.608 192.014 1.00 141.29 ?  64   LYS E CB    1 
ATOM   3227  C  CG    . LYS E 1  65   ? 155.884 179.307 192.266 1.00 175.14 ?  64   LYS E CG    1 
ATOM   3228  C  CD    . LYS E 1  65   ? 156.318 179.133 193.706 1.00 234.34 ?  64   LYS E CD    1 
ATOM   3229  C  CE    . LYS E 1  65   ? 155.162 178.862 194.645 1.00 221.36 ?  64   LYS E CE    1 
ATOM   3230  N  NZ    . LYS E 1  65   ? 155.632 178.509 196.006 1.00 250.84 1  64   LYS E NZ    1 
ATOM   3231  N  N     . LEU E 1  66   ? 153.496 180.217 188.677 1.00 99.28  ?  65   LEU E N     1 
ATOM   3232  C  CA    . LEU E 1  66   ? 152.643 179.265 187.915 1.00 85.98  ?  65   LEU E CA    1 
ATOM   3233  C  C     . LEU E 1  66   ? 153.009 179.335 186.428 1.00 83.90  ?  65   LEU E C     1 
ATOM   3234  O  O     . LEU E 1  66   ? 153.046 178.270 185.780 1.00 128.74 ?  65   LEU E O     1 
ATOM   3235  C  CB    . LEU E 1  66   ? 151.172 179.628 188.138 1.00 92.35  ?  65   LEU E CB    1 
ATOM   3236  C  CG    . LEU E 1  66   ? 150.158 178.632 187.578 1.00 153.41 ?  65   LEU E CG    1 
ATOM   3237  C  CD1   . LEU E 1  66   ? 148.914 178.576 188.450 1.00 200.80 ?  65   LEU E CD1   1 
ATOM   3238  C  CD2   . LEU E 1  66   ? 149.788 178.982 186.146 1.00 167.24 ?  65   LEU E CD2   1 
ATOM   3239  N  N     . PRO E 1  67   ? 153.277 180.532 185.861 1.00 91.62  ?  66   PRO E N     1 
ATOM   3240  C  CA    . PRO E 1  67   ? 153.629 180.691 184.446 1.00 113.38 ?  66   PRO E CA    1 
ATOM   3241  C  C     . PRO E 1  67   ? 155.095 180.199 184.279 1.00 158.34 ?  66   PRO E C     1 
ATOM   3242  O  O     . PRO E 1  67   ? 155.467 179.403 183.455 1.00 168.92 ?  66   PRO E O     1 
ATOM   3243  C  CB    . PRO E 1  67   ? 153.559 182.173 184.163 1.00 78.79  ?  66   PRO E CB    1 
ATOM   3244  C  CG    . PRO E 1  67   ? 153.933 182.763 185.455 1.00 79.68  ?  66   PRO E CG    1 
ATOM   3245  C  CD    . PRO E 1  67   ? 153.261 181.860 186.525 1.00 87.94  ?  66   PRO E CD    1 
ATOM   3246  N  N     . PHE E 1  68   ? 155.919 180.711 185.195 1.00 152.70 ?  67   PHE E N     1 
ATOM   3247  C  CA    . PHE E 1  68   ? 157.300 180.383 185.343 1.00 114.43 ?  67   PHE E CA    1 
ATOM   3248  C  C     . PHE E 1  68   ? 157.472 178.851 185.355 1.00 83.21  ?  67   PHE E C     1 
ATOM   3249  O  O     . PHE E 1  68   ? 158.306 178.327 184.716 1.00 94.06  ?  67   PHE E O     1 
ATOM   3250  C  CB    . PHE E 1  68   ? 157.794 181.010 186.649 1.00 140.48 ?  67   PHE E CB    1 
ATOM   3251  C  CG    . PHE E 1  68   ? 159.264 180.797 186.795 1.00 168.85 ?  67   PHE E CG    1 
ATOM   3252  C  CD1   . PHE E 1  68   ? 160.131 181.599 186.050 1.00 209.85 ?  67   PHE E CD1   1 
ATOM   3253  C  CD2   . PHE E 1  68   ? 159.788 179.786 187.607 1.00 175.47 ?  67   PHE E CD2   1 
ATOM   3254  C  CE1   . PHE E 1  68   ? 161.518 181.424 186.122 1.00 289.75 ?  67   PHE E CE1   1 
ATOM   3255  C  CE2   . PHE E 1  68   ? 161.163 179.567 187.617 1.00 279.27 ?  67   PHE E CE2   1 
ATOM   3256  C  CZ    . PHE E 1  68   ? 162.015 180.347 186.831 1.00 310.25 ?  67   PHE E CZ    1 
ATOM   3257  N  N     . GLN E 1  69   ? 156.544 178.151 185.996 1.00 75.43  ?  68   GLN E N     1 
ATOM   3258  C  CA    . GLN E 1  69   ? 156.694 176.757 186.191 1.00 73.63  ?  68   GLN E CA    1 
ATOM   3259  C  C     . GLN E 1  69   ? 156.694 175.957 184.870 1.00 73.40  ?  68   GLN E C     1 
ATOM   3260  O  O     . GLN E 1  69   ? 157.469 175.072 184.615 1.00 64.28  ?  68   GLN E O     1 
ATOM   3261  C  CB    . GLN E 1  69   ? 155.578 176.141 187.038 1.00 87.99  ?  68   GLN E CB    1 
ATOM   3262  C  CG    . GLN E 1  69   ? 155.759 174.586 187.035 1.00 82.27  ?  68   GLN E CG    1 
ATOM   3263  C  CD    . GLN E 1  69   ? 155.509 173.824 188.337 1.00 102.37 ?  68   GLN E CD    1 
ATOM   3264  O  OE1   . GLN E 1  69   ? 155.387 174.385 189.428 1.00 178.64 ?  68   GLN E OE1   1 
ATOM   3265  N  NE2   . GLN E 1  69   ? 155.486 172.531 188.275 1.00 59.26  ?  68   GLN E NE2   1 
ATOM   3266  N  N     . ARG E 1  70   ? 155.770 176.308 183.995 1.00 95.83  ?  69   ARG E N     1 
ATOM   3267  C  CA    . ARG E 1  70   ? 155.751 175.760 182.655 1.00 128.18 ?  69   ARG E CA    1 
ATOM   3268  C  C     . ARG E 1  70   ? 156.868 176.298 181.778 1.00 129.08 ?  69   ARG E C     1 
ATOM   3269  O  O     . ARG E 1  70   ? 157.414 175.528 181.011 1.00 169.37 ?  69   ARG E O     1 
ATOM   3270  C  CB    . ARG E 1  70   ? 154.374 175.928 181.993 1.00 209.60 ?  69   ARG E CB    1 
ATOM   3271  C  CG    . ARG E 1  70   ? 153.256 175.088 182.618 1.00 290.23 ?  69   ARG E CG    1 
ATOM   3272  C  CD    . ARG E 1  70   ? 153.287 173.545 182.546 1.00 330.83 ?  69   ARG E CD    1 
ATOM   3273  N  NE    . ARG E 1  70   ? 151.980 172.903 182.325 1.00 325.24 ?  69   ARG E NE    1 
ATOM   3274  C  CZ    . ARG E 1  70   ? 151.607 171.681 182.738 1.00 276.68 ?  69   ARG E CZ    1 
ATOM   3275  N  NH1   . ARG E 1  70   ? 152.239 171.062 183.715 1.00 260.06 1  69   ARG E NH1   1 
ATOM   3276  N  NH2   . ARG E 1  70   ? 150.578 171.081 182.174 1.00 241.87 ?  69   ARG E NH2   1 
ATOM   3277  N  N     . LEU E 1  71   ? 157.219 177.581 181.846 1.00 95.99  ?  70   LEU E N     1 
ATOM   3278  C  CA    . LEU E 1  71   ? 158.210 178.165 180.960 1.00 93.24  ?  70   LEU E CA    1 
ATOM   3279  C  C     . LEU E 1  71   ? 159.467 177.283 180.798 1.00 90.91  ?  70   LEU E C     1 
ATOM   3280  O  O     . LEU E 1  71   ? 159.981 177.097 179.638 1.00 81.81  ?  70   LEU E O     1 
ATOM   3281  C  CB    . LEU E 1  71   ? 158.666 179.539 181.421 1.00 74.06  ?  70   LEU E CB    1 
ATOM   3282  C  CG    . LEU E 1  71   ? 159.716 180.185 180.502 1.00 84.22  ?  70   LEU E CG    1 
ATOM   3283  C  CD1   . LEU E 1  71   ? 159.135 180.308 179.134 1.00 115.84 ?  70   LEU E CD1   1 
ATOM   3284  C  CD2   . LEU E 1  71   ? 160.192 181.533 180.919 1.00 84.60  ?  70   LEU E CD2   1 
ATOM   3285  N  N     . VAL E 1  72   ? 159.893 176.790 181.956 1.00 104.23 ?  71   VAL E N     1 
ATOM   3286  C  CA    . VAL E 1  72   ? 161.037 175.880 182.100 1.00 110.47 ?  71   VAL E CA    1 
ATOM   3287  C  C     . VAL E 1  72   ? 160.713 174.525 181.507 1.00 103.39 ?  71   VAL E C     1 
ATOM   3288  O  O     . VAL E 1  72   ? 161.553 174.080 180.671 1.00 152.63 ?  71   VAL E O     1 
ATOM   3289  C  CB    . VAL E 1  72   ? 161.441 175.746 183.576 1.00 140.04 ?  71   VAL E CB    1 
ATOM   3290  C  CG1   . VAL E 1  72   ? 162.349 174.608 183.878 1.00 100.48 ?  71   VAL E CG1   1 
ATOM   3291  C  CG2   . VAL E 1  72   ? 162.006 177.063 184.127 1.00 245.84 ?  71   VAL E CG2   1 
ATOM   3292  N  N     . ARG E 1  73   ? 159.601 173.910 181.928 1.00 86.29  ?  72   ARG E N     1 
ATOM   3293  C  CA    . ARG E 1  73   ? 159.214 172.575 181.484 1.00 87.95  ?  72   ARG E CA    1 
ATOM   3294  C  C     . ARG E 1  73   ? 159.280 172.554 179.938 1.00 101.08 ?  72   ARG E C     1 
ATOM   3295  O  O     . ARG E 1  73   ? 159.877 171.639 179.268 1.00 132.48 ?  72   ARG E O     1 
ATOM   3296  C  CB    . ARG E 1  73   ? 157.810 172.217 181.945 1.00 74.33  ?  72   ARG E CB    1 
ATOM   3297  C  CG    . ARG E 1  73   ? 157.675 171.590 183.331 1.00 72.63  ?  72   ARG E CG    1 
ATOM   3298  C  CD    . ARG E 1  73   ? 156.362 170.923 183.544 1.00 72.58  ?  72   ARG E CD    1 
ATOM   3299  N  NE    . ARG E 1  73   ? 156.106 170.673 184.966 1.00 59.63  ?  72   ARG E NE    1 
ATOM   3300  C  CZ    . ARG E 1  73   ? 156.074 169.502 185.577 1.00 51.81  ?  72   ARG E CZ    1 
ATOM   3301  N  NH1   . ARG E 1  73   ? 156.713 168.464 185.059 1.00 47.30  1  72   ARG E NH1   1 
ATOM   3302  N  NH2   . ARG E 1  73   ? 155.532 169.444 186.794 1.00 42.83  ?  72   ARG E NH2   1 
ATOM   3303  N  N     . GLU E 1  74   ? 158.754 173.638 179.372 1.00 120.25 ?  73   GLU E N     1 
ATOM   3304  C  CA    . GLU E 1  74   ? 158.618 173.797 177.935 1.00 171.07 ?  73   GLU E CA    1 
ATOM   3305  C  C     . GLU E 1  74   ? 159.945 173.888 177.174 1.00 204.47 ?  73   GLU E C     1 
ATOM   3306  O  O     . GLU E 1  74   ? 160.102 173.295 176.043 1.00 272.73 ?  73   GLU E O     1 
ATOM   3307  C  CB    . GLU E 1  74   ? 157.759 175.005 177.572 1.00 252.33 ?  73   GLU E CB    1 
ATOM   3308  C  CG    . GLU E 1  74   ? 157.703 175.262 176.107 1.00 322.10 ?  73   GLU E CG    1 
ATOM   3309  C  CD    . GLU E 1  74   ? 158.891 175.991 175.540 1.00 335.85 ?  73   GLU E CD    1 
ATOM   3310  O  OE1   . GLU E 1  74   ? 159.728 176.577 176.277 1.00 277.02 ?  73   GLU E OE1   1 
ATOM   3311  O  OE2   . GLU E 1  74   ? 158.941 175.923 174.363 1.00 440.00 -1 73   GLU E OE2   1 
ATOM   3312  N  N     . ILE E 1  75   ? 160.886 174.726 177.640 1.00 165.66 ?  74   ILE E N     1 
ATOM   3313  C  CA    . ILE E 1  75   ? 162.187 174.767 176.943 1.00 133.30 ?  74   ILE E CA    1 
ATOM   3314  C  C     . ILE E 1  75   ? 163.031 173.509 177.259 1.00 109.92 ?  74   ILE E C     1 
ATOM   3315  O  O     . ILE E 1  75   ? 163.716 172.955 176.424 1.00 92.17  ?  74   ILE E O     1 
ATOM   3316  C  CB    . ILE E 1  75   ? 163.018 176.020 177.258 1.00 96.79  ?  74   ILE E CB    1 
ATOM   3317  C  CG1   . ILE E 1  75   ? 163.654 175.917 178.632 1.00 97.82  ?  74   ILE E CG1   1 
ATOM   3318  C  CG2   . ILE E 1  75   ? 162.214 177.294 177.138 1.00 73.12  ?  74   ILE E CG2   1 
ATOM   3319  C  CD1   . ILE E 1  75   ? 164.752 176.920 178.808 1.00 97.86  ?  74   ILE E CD1   1 
ATOM   3320  N  N     . ALA E 1  76   ? 162.878 173.043 178.509 1.00 92.03  ?  75   ALA E N     1 
ATOM   3321  C  CA    . ALA E 1  76   ? 163.687 171.939 179.004 1.00 85.18  ?  75   ALA E CA    1 
ATOM   3322  C  C     . ALA E 1  76   ? 163.466 170.745 178.082 1.00 98.99  ?  75   ALA E C     1 
ATOM   3323  O  O     . ALA E 1  76   ? 164.450 170.098 177.719 1.00 160.78 ?  75   ALA E O     1 
ATOM   3324  C  CB    . ALA E 1  76   ? 163.279 171.545 180.383 1.00 84.17  ?  75   ALA E CB    1 
ATOM   3325  N  N     . GLN E 1  77   ? 162.256 170.642 177.546 1.00 144.47 ?  76   GLN E N     1 
ATOM   3326  C  CA    . GLN E 1  77   ? 161.974 169.589 176.550 1.00 177.55 ?  76   GLN E CA    1 
ATOM   3327  C  C     . GLN E 1  77   ? 162.845 169.701 175.308 1.00 177.30 ?  76   GLN E C     1 
ATOM   3328  O  O     . GLN E 1  77   ? 163.370 168.674 174.833 1.00 120.90 ?  76   GLN E O     1 
ATOM   3329  C  CB    . GLN E 1  77   ? 160.500 169.565 176.166 1.00 220.56 ?  76   GLN E CB    1 
ATOM   3330  C  CG    . GLN E 1  77   ? 159.702 168.653 177.087 1.00 228.89 ?  76   GLN E CG    1 
ATOM   3331  C  CD    . GLN E 1  77   ? 160.512 167.575 177.767 1.00 170.32 ?  76   GLN E CD    1 
ATOM   3332  O  OE1   . GLN E 1  77   ? 160.783 167.647 178.939 1.00 122.57 ?  76   GLN E OE1   1 
ATOM   3333  N  NE2   . GLN E 1  77   ? 160.901 166.564 177.027 1.00 119.83 ?  76   GLN E NE2   1 
ATOM   3334  N  N     . ASP E 1  78   ? 163.144 170.917 174.838 1.00 210.57 ?  77   ASP E N     1 
ATOM   3335  C  CA    . ASP E 1  78   ? 163.794 171.087 173.535 1.00 231.60 ?  77   ASP E CA    1 
ATOM   3336  C  C     . ASP E 1  78   ? 165.218 170.530 173.503 1.00 213.89 ?  77   ASP E C     1 
ATOM   3337  O  O     . ASP E 1  78   ? 165.772 170.265 172.426 1.00 222.38 ?  77   ASP E O     1 
ATOM   3338  C  CB    . ASP E 1  78   ? 163.673 172.542 173.029 1.00 250.68 ?  77   ASP E CB    1 
ATOM   3339  C  CG    . ASP E 1  78   ? 162.251 172.904 172.607 1.00 309.92 ?  77   ASP E CG    1 
ATOM   3340  O  OD1   . ASP E 1  78   ? 161.407 171.998 172.495 1.00 333.33 ?  77   ASP E OD1   1 
ATOM   3341  O  OD2   . ASP E 1  78   ? 161.949 174.103 172.472 1.00 440.00 -1 77   ASP E OD2   1 
ATOM   3342  N  N     . PHE E 1  79   ? 165.879 170.517 174.662 1.00 189.55 ?  78   PHE E N     1 
ATOM   3343  C  CA    . PHE E 1  79   ? 167.252 170.047 174.850 1.00 132.86 ?  78   PHE E CA    1 
ATOM   3344  C  C     . PHE E 1  79   ? 167.328 168.583 175.283 1.00 92.55  ?  78   PHE E C     1 
ATOM   3345  O  O     . PHE E 1  79   ? 168.285 167.919 175.074 1.00 77.77  ?  78   PHE E O     1 
ATOM   3346  C  CB    . PHE E 1  79   ? 167.997 170.936 175.862 1.00 125.66 ?  78   PHE E CB    1 
ATOM   3347  C  CG    . PHE E 1  79   ? 168.433 172.284 175.345 1.00 155.74 ?  78   PHE E CG    1 
ATOM   3348  C  CD1   . PHE E 1  79   ? 167.526 173.111 174.671 1.00 191.73 ?  78   PHE E CD1   1 
ATOM   3349  C  CD2   . PHE E 1  79   ? 169.706 172.778 175.543 1.00 162.36 ?  78   PHE E CD2   1 
ATOM   3350  C  CE1   . PHE E 1  79   ? 167.870 174.344 174.160 1.00 193.32 ?  78   PHE E CE1   1 
ATOM   3351  C  CE2   . PHE E 1  79   ? 170.047 174.025 175.034 1.00 164.48 ?  78   PHE E CE2   1 
ATOM   3352  C  CZ    . PHE E 1  79   ? 169.140 174.815 174.350 1.00 163.25 ?  78   PHE E CZ    1 
ATOM   3353  N  N     . LYS E 1  80   ? 166.264 168.072 175.901 1.00 95.81  ?  79   LYS E N     1 
ATOM   3354  C  CA    . LYS E 1  80   ? 166.067 166.671 176.171 1.00 104.36 ?  79   LYS E CA    1 
ATOM   3355  C  C     . LYS E 1  80   ? 164.587 166.313 176.343 1.00 142.02 ?  79   LYS E C     1 
ATOM   3356  O  O     . LYS E 1  80   ? 163.720 167.032 176.709 1.00 145.73 ?  79   LYS E O     1 
ATOM   3357  C  CB    . LYS E 1  80   ? 166.801 166.420 177.485 1.00 106.22 ?  79   LYS E CB    1 
ATOM   3358  C  CG    . LYS E 1  80   ? 166.564 165.043 178.053 1.00 144.08 ?  79   LYS E CG    1 
ATOM   3359  C  CD    . LYS E 1  80   ? 167.010 163.917 177.110 1.00 159.98 ?  79   LYS E CD    1 
ATOM   3360  C  CE    . LYS E 1  80   ? 167.399 162.634 177.850 1.00 184.48 ?  79   LYS E CE    1 
ATOM   3361  N  NZ    . LYS E 1  80   ? 166.285 161.928 178.541 1.00 185.07 1  79   LYS E NZ    1 
ATOM   3362  N  N     . THR E 1  81   ? 164.300 165.027 176.164 1.00 191.76 ?  80   THR E N     1 
ATOM   3363  C  CA    . THR E 1  81   ? 162.959 164.431 176.280 1.00 202.42 ?  80   THR E CA    1 
ATOM   3364  C  C     . THR E 1  81   ? 162.665 163.731 177.635 1.00 237.51 ?  80   THR E C     1 
ATOM   3365  O  O     . THR E 1  81   ? 163.570 163.292 178.341 1.00 341.26 ?  80   THR E O     1 
ATOM   3366  C  CB    . THR E 1  81   ? 162.734 163.372 175.178 1.00 229.95 ?  80   THR E CB    1 
ATOM   3367  O  OG1   . THR E 1  81   ? 161.362 162.979 175.247 1.00 182.01 ?  80   THR E OG1   1 
ATOM   3368  C  CG2   . THR E 1  81   ? 163.694 162.183 175.266 1.00 253.71 ?  80   THR E CG2   1 
ATOM   3369  N  N     . ASP E 1  82   ? 161.383 163.509 177.889 1.00 190.70 ?  81   ASP E N     1 
ATOM   3370  C  CA    . ASP E 1  82   ? 160.919 162.746 179.057 1.00 227.50 ?  81   ASP E CA    1 
ATOM   3371  C  C     . ASP E 1  82   ? 161.506 163.360 180.328 1.00 252.18 ?  81   ASP E C     1 
ATOM   3372  O  O     . ASP E 1  82   ? 162.287 162.730 181.024 1.00 286.73 ?  81   ASP E O     1 
ATOM   3373  C  CB    . ASP E 1  82   ? 161.290 161.255 178.955 1.00 224.83 ?  81   ASP E CB    1 
ATOM   3374  C  CG    . ASP E 1  82   ? 160.474 160.328 179.850 1.00 201.25 ?  81   ASP E CG    1 
ATOM   3375  O  OD1   . ASP E 1  82   ? 160.033 160.717 181.016 1.00 174.88 ?  81   ASP E OD1   1 
ATOM   3376  O  OD2   . ASP E 1  82   ? 160.292 159.201 179.374 1.00 308.50 -1 81   ASP E OD2   1 
ATOM   3377  N  N     . LEU E 1  83   ? 161.144 164.619 180.597 1.00 225.31 ?  82   LEU E N     1 
ATOM   3378  C  CA    . LEU E 1  83   ? 161.723 165.359 181.752 1.00 189.15 ?  82   LEU E CA    1 
ATOM   3379  C  C     . LEU E 1  83   ? 160.826 165.275 182.993 1.00 216.45 ?  82   LEU E C     1 
ATOM   3380  O  O     . LEU E 1  83   ? 159.602 165.089 182.844 1.00 269.94 ?  82   LEU E O     1 
ATOM   3381  C  CB    . LEU E 1  83   ? 161.953 166.816 181.339 1.00 151.71 ?  82   LEU E CB    1 
ATOM   3382  C  CG    . LEU E 1  83   ? 162.927 167.600 182.219 1.00 192.40 ?  82   LEU E CG    1 
ATOM   3383  C  CD1   . LEU E 1  83   ? 164.161 166.769 182.535 1.00 220.84 ?  82   LEU E CD1   1 
ATOM   3384  C  CD2   . LEU E 1  83   ? 163.322 168.910 181.554 1.00 182.07 ?  82   LEU E CD2   1 
ATOM   3385  N  N     . ARG E 1  84   ? 161.452 165.414 184.166 1.00 207.29 ?  83   ARG E N     1 
ATOM   3386  C  CA    . ARG E 1  84   ? 160.782 165.416 185.497 1.00 163.04 ?  83   ARG E CA    1 
ATOM   3387  C  C     . ARG E 1  84   ? 161.330 166.611 186.289 1.00 117.96 ?  83   ARG E C     1 
ATOM   3388  O  O     . ARG E 1  84   ? 162.438 167.078 185.953 1.00 146.67 ?  83   ARG E O     1 
ATOM   3389  C  CB    . ARG E 1  84   ? 161.045 164.097 186.229 1.00 169.69 ?  83   ARG E CB    1 
ATOM   3390  C  CG    . ARG E 1  84   ? 160.760 162.855 185.396 1.00 169.82 ?  83   ARG E CG    1 
ATOM   3391  C  CD    . ARG E 1  84   ? 159.293 162.729 185.031 1.00 165.26 ?  83   ARG E CD    1 
ATOM   3392  N  NE    . ARG E 1  84   ? 159.028 161.576 184.183 1.00 140.68 ?  83   ARG E NE    1 
ATOM   3393  C  CZ    . ARG E 1  84   ? 158.705 160.369 184.635 1.00 128.94 ?  83   ARG E CZ    1 
ATOM   3394  N  NH1   . ARG E 1  84   ? 158.600 160.153 185.934 1.00 92.18  1  83   ARG E NH1   1 
ATOM   3395  N  NH2   . ARG E 1  84   ? 158.491 159.382 183.784 1.00 114.98 ?  83   ARG E NH2   1 
ATOM   3396  N  N     . PHE E 1  85   ? 160.603 167.084 187.306 1.00 89.80  ?  84   PHE E N     1 
ATOM   3397  C  CA    . PHE E 1  85   ? 161.099 168.267 188.058 1.00 108.49 ?  84   PHE E CA    1 
ATOM   3398  C  C     . PHE E 1  85   ? 160.787 168.161 189.556 1.00 126.77 ?  84   PHE E C     1 
ATOM   3399  O  O     . PHE E 1  85   ? 159.647 167.817 189.927 1.00 157.05 ?  84   PHE E O     1 
ATOM   3400  C  CB    . PHE E 1  85   ? 160.515 169.555 187.470 1.00 111.43 ?  84   PHE E CB    1 
ATOM   3401  C  CG    . PHE E 1  85   ? 161.269 170.103 186.283 1.00 88.31  ?  84   PHE E CG    1 
ATOM   3402  C  CD1   . PHE E 1  85   ? 162.566 170.571 186.418 1.00 87.61  ?  84   PHE E CD1   1 
ATOM   3403  C  CD2   . PHE E 1  85   ? 160.680 170.154 185.030 1.00 85.25  ?  84   PHE E CD2   1 
ATOM   3404  C  CE1   . PHE E 1  85   ? 163.256 171.076 185.328 1.00 96.10  ?  84   PHE E CE1   1 
ATOM   3405  C  CE2   . PHE E 1  85   ? 161.372 170.659 183.940 1.00 105.11 ?  84   PHE E CE2   1 
ATOM   3406  C  CZ    . PHE E 1  85   ? 162.658 171.118 184.091 1.00 127.68 ?  84   PHE E CZ    1 
ATOM   3407  N  N     . GLN E 1  86   ? 161.798 168.457 190.379 1.00 129.52 ?  85   GLN E N     1 
ATOM   3408  C  CA    . GLN E 1  86   ? 161.682 168.483 191.879 1.00 100.38 ?  85   GLN E CA    1 
ATOM   3409  C  C     . GLN E 1  86   ? 160.913 169.762 192.184 1.00 79.55  ?  85   GLN E C     1 
ATOM   3410  O  O     . GLN E 1  86   ? 161.106 170.853 191.636 1.00 56.49  ?  85   GLN E O     1 
ATOM   3411  C  CB    . GLN E 1  86   ? 163.019 168.548 192.634 1.00 152.30 ?  85   GLN E CB    1 
ATOM   3412  C  CG    . GLN E 1  86   ? 163.567 167.146 193.078 1.00 214.00 ?  85   GLN E CG    1 
ATOM   3413  C  CD    . GLN E 1  86   ? 165.036 167.056 193.505 1.00 221.28 ?  85   GLN E CD    1 
ATOM   3414  O  OE1   . GLN E 1  86   ? 165.596 168.006 194.068 1.00 172.14 ?  85   GLN E OE1   1 
ATOM   3415  N  NE2   . GLN E 1  86   ? 165.718 165.911 193.272 1.00 143.77 ?  85   GLN E NE2   1 
ATOM   3416  N  N     . SER E 1  87   ? 160.112 169.623 193.213 1.00 98.50  ?  86   SER E N     1 
ATOM   3417  C  CA    . SER E 1  87   ? 159.264 170.694 193.599 1.00 157.09 ?  86   SER E CA    1 
ATOM   3418  C  C     . SER E 1  87   ? 160.114 171.986 193.730 1.00 126.14 ?  86   SER E C     1 
ATOM   3419  O  O     . SER E 1  87   ? 159.758 173.157 193.298 1.00 93.31  ?  86   SER E O     1 
ATOM   3420  C  CB    . SER E 1  87   ? 158.571 170.297 194.912 1.00 263.21 ?  86   SER E CB    1 
ATOM   3421  O  OG    . SER E 1  87   ? 157.671 169.162 194.785 1.00 244.15 ?  86   SER E OG    1 
ATOM   3422  N  N     . SER E 1  88   ? 161.226 171.810 194.456 1.00 124.01 ?  87   SER E N     1 
ATOM   3423  C  CA    . SER E 1  88   ? 162.074 172.922 194.848 1.00 108.13 ?  87   SER E CA    1 
ATOM   3424  C  C     . SER E 1  88   ? 162.796 173.428 193.603 1.00 76.46  ?  87   SER E C     1 
ATOM   3425  O  O     . SER E 1  88   ? 163.149 174.625 193.528 1.00 58.62  ?  87   SER E O     1 
ATOM   3426  C  CB    . SER E 1  88   ? 163.063 172.530 195.930 1.00 123.14 ?  87   SER E CB    1 
ATOM   3427  O  OG    . SER E 1  88   ? 163.469 171.180 195.757 1.00 119.13 ?  87   SER E OG    1 
ATOM   3428  N  N     . ALA E 1  89   ? 163.171 172.520 192.689 1.00 78.27  ?  88   ALA E N     1 
ATOM   3429  C  CA    . ALA E 1  89   ? 164.186 172.861 191.724 1.00 85.04  ?  88   ALA E CA    1 
ATOM   3430  C  C     . ALA E 1  89   ? 163.854 174.168 191.030 1.00 62.11  ?  88   ALA E C     1 
ATOM   3431  O  O     . ALA E 1  89   ? 164.741 174.927 190.655 1.00 42.03  ?  88   ALA E O     1 
ATOM   3432  C  CB    . ALA E 1  89   ? 164.241 171.737 190.733 1.00 124.05 ?  88   ALA E CB    1 
ATOM   3433  N  N     . VAL E 1  90   ? 162.570 174.287 190.697 1.00 68.55  ?  89   VAL E N     1 
ATOM   3434  C  CA    . VAL E 1  90   ? 162.029 175.497 190.094 1.00 99.85  ?  89   VAL E CA    1 
ATOM   3435  C  C     . VAL E 1  90   ? 162.035 176.606 191.144 1.00 109.88 ?  89   VAL E C     1 
ATOM   3436  O  O     . VAL E 1  90   ? 162.323 177.769 190.850 1.00 104.61 ?  89   VAL E O     1 
ATOM   3437  C  CB    . VAL E 1  90   ? 160.580 175.256 189.623 1.00 119.70 ?  89   VAL E CB    1 
ATOM   3438  C  CG1   . VAL E 1  90   ? 159.757 174.714 190.770 1.00 119.16 ?  89   VAL E CG1   1 
ATOM   3439  C  CG2   . VAL E 1  90   ? 159.923 176.560 189.055 1.00 111.66 ?  89   VAL E CG2   1 
ATOM   3440  N  N     . MET E 1  91   ? 161.574 176.269 192.365 1.00 121.07 ?  90   MET E N     1 
ATOM   3441  C  CA    . MET E 1  91   ? 161.385 177.243 193.426 1.00 121.02 ?  90   MET E CA    1 
ATOM   3442  C  C     . MET E 1  91   ? 162.728 177.980 193.445 1.00 93.56  ?  90   MET E C     1 
ATOM   3443  O  O     . MET E 1  91   ? 162.876 179.145 193.707 1.00 79.96  ?  90   MET E O     1 
ATOM   3444  C  CB    . MET E 1  91   ? 161.137 176.518 194.772 1.00 169.54 ?  90   MET E CB    1 
ATOM   3445  C  CG    . MET E 1  91   ? 159.701 176.139 195.078 1.00 212.13 ?  90   MET E CG    1 
ATOM   3446  S  SD    . MET E 1  91   ? 159.551 175.453 196.765 1.00 263.37 ?  90   MET E SD    1 
ATOM   3447  C  CE    . MET E 1  91   ? 158.623 173.942 196.460 1.00 391.74 ?  90   MET E CE    1 
ATOM   3448  N  N     . ALA E 1  92   ? 163.752 177.142 193.322 1.00 80.22  ?  91   ALA E N     1 
ATOM   3449  C  CA    . ALA E 1  92   ? 165.078 177.584 193.446 1.00 76.21  ?  91   ALA E CA    1 
ATOM   3450  C  C     . ALA E 1  92   ? 165.412 178.471 192.274 1.00 59.33  ?  91   ALA E C     1 
ATOM   3451  O  O     . ALA E 1  92   ? 166.111 179.449 192.399 1.00 43.18  ?  91   ALA E O     1 
ATOM   3452  C  CB    . ALA E 1  92   ? 165.952 176.378 193.454 1.00 85.06  ?  91   ALA E CB    1 
ATOM   3453  N  N     . LEU E 1  93   ? 164.970 178.104 191.074 1.00 64.77  ?  92   LEU E N     1 
ATOM   3454  C  CA    . LEU E 1  93   ? 165.315 178.875 189.890 1.00 82.76  ?  92   LEU E CA    1 
ATOM   3455  C  C     . LEU E 1  93   ? 164.680 180.221 190.015 1.00 75.68  ?  92   LEU E C     1 
ATOM   3456  O  O     . LEU E 1  93   ? 165.188 181.225 189.620 1.00 54.74  ?  92   LEU E O     1 
ATOM   3457  C  CB    . LEU E 1  93   ? 164.732 178.177 188.666 1.00 98.43  ?  92   LEU E CB    1 
ATOM   3458  C  CG    . LEU E 1  93   ? 165.298 176.838 188.345 1.00 138.72 ?  92   LEU E CG    1 
ATOM   3459  C  CD1   . LEU E 1  93   ? 164.339 176.072 187.472 1.00 177.49 ?  92   LEU E CD1   1 
ATOM   3460  C  CD2   . LEU E 1  93   ? 166.594 177.119 187.631 1.00 183.84 ?  92   LEU E CD2   1 
ATOM   3461  N  N     . GLN E 1  94   ? 163.439 180.217 190.489 1.00 107.11 ?  93   GLN E N     1 
ATOM   3462  C  CA    . GLN E 1  94   ? 162.661 181.458 190.609 1.00 150.62 ?  93   GLN E CA    1 
ATOM   3463  C  C     . GLN E 1  94   ? 163.513 182.410 191.432 1.00 109.65 ?  93   GLN E C     1 
ATOM   3464  O  O     . GLN E 1  94   ? 163.540 183.601 191.146 1.00 92.48  ?  93   GLN E O     1 
ATOM   3465  C  CB    . GLN E 1  94   ? 161.301 181.107 191.222 1.00 222.67 ?  93   GLN E CB    1 
ATOM   3466  C  CG    . GLN E 1  94   ? 160.420 182.256 191.683 1.00 298.38 ?  93   GLN E CG    1 
ATOM   3467  C  CD    . GLN E 1  94   ? 159.003 181.841 192.058 1.00 270.93 ?  93   GLN E CD    1 
ATOM   3468  O  OE1   . GLN E 1  94   ? 158.776 180.707 192.496 1.00 225.08 ?  93   GLN E OE1   1 
ATOM   3469  N  NE2   . GLN E 1  94   ? 158.049 182.770 191.892 1.00 189.38 ?  93   GLN E NE2   1 
ATOM   3470  N  N     . GLU E 1  95   ? 164.093 181.880 192.506 1.00 92.78  ?  94   GLU E N     1 
ATOM   3471  C  CA    . GLU E 1  95   ? 164.806 182.630 193.479 1.00 98.68  ?  94   GLU E CA    1 
ATOM   3472  C  C     . GLU E 1  95   ? 166.004 183.254 192.775 1.00 68.15  ?  94   GLU E C     1 
ATOM   3473  O  O     . GLU E 1  95   ? 166.350 184.396 193.010 1.00 56.08  ?  94   GLU E O     1 
ATOM   3474  C  CB    . GLU E 1  95   ? 165.191 181.698 194.636 1.00 124.84 ?  94   GLU E CB    1 
ATOM   3475  C  CG    . GLU E 1  95   ? 166.047 182.409 195.607 1.00 189.96 ?  94   GLU E CG    1 
ATOM   3476  C  CD    . GLU E 1  95   ? 165.450 183.584 196.367 1.00 215.71 ?  94   GLU E CD    1 
ATOM   3477  O  OE1   . GLU E 1  95   ? 164.232 183.822 196.314 1.00 225.23 ?  94   GLU E OE1   1 
ATOM   3478  O  OE2   . GLU E 1  95   ? 166.251 184.123 197.187 1.00 237.24 -1 94   GLU E OE2   1 
ATOM   3479  N  N     . ALA E 1  96   ? 166.681 182.391 192.003 1.00 62.96  ?  95   ALA E N     1 
ATOM   3480  C  CA    . ALA E 1  96   ? 167.897 182.775 191.323 1.00 78.64  ?  95   ALA E CA    1 
ATOM   3481  C  C     . ALA E 1  96   ? 167.629 183.933 190.343 1.00 65.92  ?  95   ALA E C     1 
ATOM   3482  O  O     . ALA E 1  96   ? 168.415 184.811 190.134 1.00 49.34  ?  95   ALA E O     1 
ATOM   3483  C  CB    . ALA E 1  96   ? 168.452 181.574 190.571 1.00 101.60 ?  95   ALA E CB    1 
ATOM   3484  N  N     . SER E 1  97   ? 166.578 183.735 189.575 1.00 68.71  ?  96   SER E N     1 
ATOM   3485  C  CA    . SER E 1  97   ? 166.246 184.534 188.437 1.00 78.68  ?  96   SER E CA    1 
ATOM   3486  C  C     . SER E 1  97   ? 165.790 185.885 188.903 1.00 59.72  ?  96   SER E C     1 
ATOM   3487  O  O     . SER E 1  97   ? 166.121 186.878 188.274 1.00 46.24  ?  96   SER E O     1 
ATOM   3488  C  CB    . SER E 1  97   ? 165.171 183.850 187.595 1.00 102.14 ?  96   SER E CB    1 
ATOM   3489  O  OG    . SER E 1  97   ? 164.315 183.079 188.369 1.00 99.17  ?  96   SER E OG    1 
ATOM   3490  N  N     . GLU E 1  98   ? 164.856 185.908 189.820 1.00 77.59  ?  97   GLU E N     1 
ATOM   3491  C  CA    . GLU E 1  98   ? 164.313 187.080 190.334 1.00 116.16 ?  97   GLU E CA    1 
ATOM   3492  C  C     . GLU E 1  98   ? 165.512 187.889 190.844 1.00 80.80  ?  97   GLU E C     1 
ATOM   3493  O  O     . GLU E 1  98   ? 165.507 189.056 190.831 1.00 67.66  ?  97   GLU E O     1 
ATOM   3494  C  CB    . GLU E 1  98   ? 163.229 186.731 191.370 1.00 201.34 ?  97   GLU E CB    1 
ATOM   3495  C  CG    . GLU E 1  98   ? 163.713 186.357 192.773 1.00 276.04 ?  97   GLU E CG    1 
ATOM   3496  C  CD    . GLU E 1  98   ? 162.541 186.061 193.739 1.00 335.92 ?  97   GLU E CD    1 
ATOM   3497  O  OE1   . GLU E 1  98   ? 161.482 186.686 193.614 1.00 374.37 ?  97   GLU E OE1   1 
ATOM   3498  O  OE2   . GLU E 1  98   ? 162.591 185.127 194.602 1.00 167.60 -1 97   GLU E OE2   1 
ATOM   3499  N  N     . ALA E 1  99   ? 166.279 187.244 191.667 1.00 64.84  ?  98   ALA E N     1 
ATOM   3500  C  CA    . ALA E 1  99   ? 167.296 187.905 192.264 1.00 67.37  ?  98   ALA E CA    1 
ATOM   3501  C  C     . ALA E 1  99   ? 168.228 188.441 191.167 1.00 55.63  ?  98   ALA E C     1 
ATOM   3502  O  O     . ALA E 1  99   ? 168.870 189.481 191.314 1.00 46.41  ?  98   ALA E O     1 
ATOM   3503  C  CB    . ALA E 1  99   ? 167.963 186.914 193.172 1.00 97.06  ?  98   ALA E CB    1 
ATOM   3504  N  N     . TYR E 1  100  ? 168.415 187.663 190.098 1.00 58.40  ?  99   TYR E N     1 
ATOM   3505  C  CA    . TYR E 1  100  ? 169.265 188.003 189.001 1.00 79.02  ?  99   TYR E CA    1 
ATOM   3506  C  C     . TYR E 1  100  ? 168.901 189.295 188.279 1.00 61.75  ?  99   TYR E C     1 
ATOM   3507  O  O     . TYR E 1  100  ? 169.736 190.116 187.855 1.00 45.04  ?  99   TYR E O     1 
ATOM   3508  C  CB    . TYR E 1  100  ? 169.321 186.916 187.913 1.00 101.33 ?  99   TYR E CB    1 
ATOM   3509  C  CG    . TYR E 1  100  ? 170.122 187.332 186.698 1.00 167.63 ?  99   TYR E CG    1 
ATOM   3510  C  CD1   . TYR E 1  100  ? 171.503 187.210 186.658 1.00 252.21 ?  99   TYR E CD1   1 
ATOM   3511  C  CD2   . TYR E 1  100  ? 169.518 187.792 185.543 1.00 214.92 ?  99   TYR E CD2   1 
ATOM   3512  C  CE1   . TYR E 1  100  ? 172.245 187.596 185.553 1.00 260.79 ?  99   TYR E CE1   1 
ATOM   3513  C  CE2   . TYR E 1  100  ? 170.248 188.160 184.424 1.00 210.28 ?  99   TYR E CE2   1 
ATOM   3514  C  CZ    . TYR E 1  100  ? 171.619 188.068 184.421 1.00 190.56 ?  99   TYR E CZ    1 
ATOM   3515  O  OH    . TYR E 1  100  ? 172.346 188.368 183.332 1.00 123.59 ?  99   TYR E OH    1 
ATOM   3516  N  N     . LEU E 1  101  ? 167.605 189.460 188.038 1.00 57.93  ?  100  LEU E N     1 
ATOM   3517  C  CA    . LEU E 1  101  ? 167.063 190.631 187.404 1.00 62.92  ?  100  LEU E CA    1 
ATOM   3518  C  C     . LEU E 1  101  ? 167.159 191.904 188.250 1.00 53.99  ?  100  LEU E C     1 
ATOM   3519  O  O     . LEU E 1  101  ? 167.365 192.943 187.689 1.00 49.26  ?  100  LEU E O     1 
ATOM   3520  C  CB    . LEU E 1  101  ? 165.556 190.390 187.188 1.00 80.54  ?  100  LEU E CB    1 
ATOM   3521  C  CG    . LEU E 1  101  ? 165.149 189.268 186.215 1.00 86.32  ?  100  LEU E CG    1 
ATOM   3522  C  CD1   . LEU E 1  101  ? 163.825 188.577 186.535 1.00 87.15  ?  100  LEU E CD1   1 
ATOM   3523  C  CD2   . LEU E 1  101  ? 165.070 189.868 184.827 1.00 94.53  ?  100  LEU E CD2   1 
ATOM   3524  N  N     . VAL E 1  102  ? 166.803 191.821 189.515 1.00 59.77  ?  101  VAL E N     1 
ATOM   3525  C  CA    . VAL E 1  102  ? 166.746 192.928 190.388 1.00 76.69  ?  101  VAL E CA    1 
ATOM   3526  C  C     . VAL E 1  102  ? 168.131 193.567 190.346 1.00 54.98  ?  101  VAL E C     1 
ATOM   3527  O  O     . VAL E 1  102  ? 168.352 194.727 190.249 1.00 38.06  ?  101  VAL E O     1 
ATOM   3528  C  CB    . VAL E 1  102  ? 166.461 192.532 191.847 1.00 123.67 ?  101  VAL E CB    1 
ATOM   3529  C  CG1   . VAL E 1  102  ? 166.700 193.724 192.790 1.00 178.37 ?  101  VAL E CG1   1 
ATOM   3530  C  CG2   . VAL E 1  102  ? 165.068 191.968 192.075 1.00 185.09 ?  101  VAL E CG2   1 
ATOM   3531  N  N     . GLY E 1  103  ? 169.077 192.673 190.512 1.00 59.57  ?  102  GLY E N     1 
ATOM   3532  C  CA    . GLY E 1  103  ? 170.393 193.044 190.592 1.00 77.40  ?  102  GLY E CA    1 
ATOM   3533  C  C     . GLY E 1  103  ? 170.648 193.870 189.343 1.00 63.04  ?  102  GLY E C     1 
ATOM   3534  O  O     . GLY E 1  103  ? 171.316 194.866 189.305 1.00 58.08  ?  102  GLY E O     1 
ATOM   3535  N  N     . LEU E 1  104  ? 170.166 193.323 188.220 1.00 54.10  ?  103  LEU E N     1 
ATOM   3536  C  CA    . LEU E 1  104  ? 170.399 193.977 186.899 1.00 66.27  ?  103  LEU E CA    1 
ATOM   3537  C  C     . LEU E 1  104  ? 169.827 195.396 186.949 1.00 52.30  ?  103  LEU E C     1 
ATOM   3538  O  O     . LEU E 1  104  ? 170.335 196.307 186.344 1.00 40.91  ?  103  LEU E O     1 
ATOM   3539  C  CB    . LEU E 1  104  ? 169.749 193.125 185.808 1.00 75.37  ?  103  LEU E CB    1 
ATOM   3540  C  CG    . LEU E 1  104  ? 169.643 193.740 184.435 1.00 101.84 ?  103  LEU E CG    1 
ATOM   3541  C  CD1   . LEU E 1  104  ? 170.994 194.167 184.008 1.00 174.56 ?  103  LEU E CD1   1 
ATOM   3542  C  CD2   . LEU E 1  104  ? 169.019 192.733 183.504 1.00 79.29  ?  103  LEU E CD2   1 
ATOM   3543  N  N     . PHE E 1  105  ? 168.594 195.443 187.428 1.00 57.11  ?  104  PHE E N     1 
ATOM   3544  C  CA    . PHE E 1  105  ? 167.936 196.673 187.396 1.00 68.20  ?  104  PHE E CA    1 
ATOM   3545  C  C     . PHE E 1  105  ? 168.667 197.648 188.270 1.00 48.09  ?  104  PHE E C     1 
ATOM   3546  O  O     . PHE E 1  105  ? 168.685 198.841 188.012 1.00 41.83  ?  104  PHE E O     1 
ATOM   3547  C  CB    . PHE E 1  105  ? 166.501 196.488 187.869 1.00 117.14 ?  104  PHE E CB    1 
ATOM   3548  C  CG    . PHE E 1  105  ? 165.679 195.514 187.079 1.00 122.64 ?  104  PHE E CG    1 
ATOM   3549  C  CD1   . PHE E 1  105  ? 166.000 195.179 185.790 1.00 143.58 ?  104  PHE E CD1   1 
ATOM   3550  C  CD2   . PHE E 1  105  ? 164.551 194.923 187.636 1.00 102.57 ?  104  PHE E CD2   1 
ATOM   3551  C  CE1   . PHE E 1  105  ? 165.193 194.332 185.046 1.00 134.50 ?  104  PHE E CE1   1 
ATOM   3552  C  CE2   . PHE E 1  105  ? 163.771 194.039 186.920 1.00 93.02  ?  104  PHE E CE2   1 
ATOM   3553  C  CZ    . PHE E 1  105  ? 164.122 193.712 185.636 1.00 112.55 ?  104  PHE E CZ    1 
ATOM   3554  N  N     . GLU E 1  106  ? 169.201 197.169 189.362 1.00 50.52  ?  105  GLU E N     1 
ATOM   3555  C  CA    . GLU E 1  106  ? 169.819 197.988 190.321 1.00 77.64  ?  105  GLU E CA    1 
ATOM   3556  C  C     . GLU E 1  106  ? 170.908 198.820 189.661 1.00 67.05  ?  105  GLU E C     1 
ATOM   3557  O  O     . GLU E 1  106  ? 171.113 199.978 190.026 1.00 52.12  ?  105  GLU E O     1 
ATOM   3558  C  CB    . GLU E 1  106  ? 170.371 197.122 191.482 1.00 146.94 ?  105  GLU E CB    1 
ATOM   3559  C  CG    . GLU E 1  106  ? 171.223 197.907 192.480 1.00 235.64 ?  105  GLU E CG    1 
ATOM   3560  C  CD    . GLU E 1  106  ? 171.124 197.639 194.000 1.00 250.52 ?  105  GLU E CD    1 
ATOM   3561  O  OE1   . GLU E 1  106  ? 170.900 196.494 194.547 1.00 205.01 ?  105  GLU E OE1   1 
ATOM   3562  O  OE2   . GLU E 1  106  ? 171.306 198.626 194.639 1.00 311.55 -1 105  GLU E OE2   1 
ATOM   3563  N  N     . ASP E 1  107  ? 171.730 198.216 188.820 1.00 68.54  ?  106  ASP E N     1 
ATOM   3564  C  CA    . ASP E 1  107  ? 172.720 198.999 188.088 1.00 76.91  ?  106  ASP E CA    1 
ATOM   3565  C  C     . ASP E 1  107  ? 172.056 199.912 187.058 1.00 52.18  ?  106  ASP E C     1 
ATOM   3566  O  O     . ASP E 1  107  ? 172.450 201.037 186.808 1.00 41.72  ?  106  ASP E O     1 
ATOM   3567  C  CB    . ASP E 1  107  ? 173.643 198.067 187.293 1.00 125.96 ?  106  ASP E CB    1 
ATOM   3568  C  CG    . ASP E 1  107  ? 174.718 197.451 188.188 1.00 204.96 ?  106  ASP E CG    1 
ATOM   3569  O  OD1   . ASP E 1  107  ? 174.456 197.405 189.378 1.00 328.97 ?  106  ASP E OD1   1 
ATOM   3570  O  OD2   . ASP E 1  107  ? 175.871 197.346 187.760 1.00 156.91 -1 106  ASP E OD2   1 
ATOM   3571  N  N     . THR E 1  108  ? 171.101 199.279 186.360 1.00 49.11  ?  107  THR E N     1 
ATOM   3572  C  CA    . THR E 1  108  ? 170.463 199.899 185.269 1.00 52.06  ?  107  THR E CA    1 
ATOM   3573  C  C     . THR E 1  108  ? 170.099 201.280 185.822 1.00 47.74  ?  107  THR E C     1 
ATOM   3574  O  O     . THR E 1  108  ? 170.222 202.295 185.223 1.00 36.40  ?  107  THR E O     1 
ATOM   3575  C  CB    . THR E 1  108  ? 169.282 199.069 184.731 1.00 48.49  ?  107  THR E CB    1 
ATOM   3576  O  OG1   . THR E 1  108  ? 168.297 198.983 185.733 1.00 55.99  ?  107  THR E OG1   1 
ATOM   3577  C  CG2   . THR E 1  108  ? 169.568 197.725 184.131 1.00 39.08  ?  107  THR E CG2   1 
ATOM   3578  N  N     . ASN E 1  109  ? 169.493 201.251 187.001 1.00 60.83  ?  108  ASN E N     1 
ATOM   3579  C  CA    . ASN E 1  109  ? 169.092 202.483 187.619 1.00 80.28  ?  108  ASN E CA    1 
ATOM   3580  C  C     . ASN E 1  109  ? 170.170 203.545 187.638 1.00 73.20  ?  108  ASN E C     1 
ATOM   3581  O  O     . ASN E 1  109  ? 169.936 204.756 187.369 1.00 57.39  ?  108  ASN E O     1 
ATOM   3582  C  CB    . ASN E 1  109  ? 168.808 202.270 189.112 1.00 100.83 ?  108  ASN E CB    1 
ATOM   3583  C  CG    . ASN E 1  109  ? 168.116 203.459 189.682 1.00 145.08 ?  108  ASN E CG    1 
ATOM   3584  O  OD1   . ASN E 1  109  ? 168.271 204.557 189.134 1.00 173.33 ?  108  ASN E OD1   1 
ATOM   3585  N  ND2   . ASN E 1  109  ? 167.258 203.203 190.696 1.00 126.27 ?  108  ASN E ND2   1 
ATOM   3586  N  N     . LEU E 1  110  ? 171.347 203.138 188.087 1.00 78.13  ?  109  LEU E N     1 
ATOM   3587  C  CA    . LEU E 1  110  ? 172.513 204.023 188.196 1.00 89.22  ?  109  LEU E CA    1 
ATOM   3588  C  C     . LEU E 1  110  ? 172.843 204.648 186.859 1.00 65.78  ?  109  LEU E C     1 
ATOM   3589  O  O     . LEU E 1  110  ? 173.181 205.816 186.696 1.00 45.43  ?  109  LEU E O     1 
ATOM   3590  C  CB    . LEU E 1  110  ? 173.720 203.217 188.649 1.00 112.00 ?  109  LEU E CB    1 
ATOM   3591  C  CG    . LEU E 1  110  ? 173.593 202.613 190.061 1.00 198.98 ?  109  LEU E CG    1 
ATOM   3592  C  CD1   . LEU E 1  110  ? 174.766 201.722 190.390 1.00 249.75 ?  109  LEU E CD1   1 
ATOM   3593  C  CD2   . LEU E 1  110  ? 173.499 203.684 191.136 1.00 297.02 ?  109  LEU E CD2   1 
ATOM   3594  N  N     . CYS E 1  111  ? 172.868 203.757 185.879 1.00 69.37  ?  110  CYS E N     1 
ATOM   3595  C  CA    . CYS E 1  111  ? 173.182 204.163 184.506 1.00 77.14  ?  110  CYS E CA    1 
ATOM   3596  C  C     . CYS E 1  111  ? 172.179 205.236 184.122 1.00 64.12  ?  110  CYS E C     1 
ATOM   3597  O  O     . CYS E 1  111  ? 172.416 206.157 183.374 1.00 49.17  ?  110  CYS E O     1 
ATOM   3598  C  CB    . CYS E 1  111  ? 173.009 202.922 183.622 1.00 95.92  ?  110  CYS E CB    1 
ATOM   3599  S  SG    . CYS E 1  111  ? 174.222 201.640 184.049 1.00 81.38  ?  110  CYS E SG    1 
ATOM   3600  N  N     . GLY E 1  112  ? 170.940 204.914 184.497 1.00 69.50  ?  111  GLY E N     1 
ATOM   3601  C  CA    . GLY E 1  112  ? 169.835 205.707 184.169 1.00 89.58  ?  111  GLY E CA    1 
ATOM   3602  C  C     . GLY E 1  112  ? 170.060 207.074 184.810 1.00 94.58  ?  111  GLY E C     1 
ATOM   3603  O  O     . GLY E 1  112  ? 169.777 208.096 184.273 1.00 105.45 ?  111  GLY E O     1 
ATOM   3604  N  N     . ILE E 1  113  ? 170.522 207.054 186.046 1.00 83.20  ?  112  ILE E N     1 
ATOM   3605  C  CA    . ILE E 1  113  ? 170.746 208.305 186.762 1.00 88.63  ?  112  ILE E CA    1 
ATOM   3606  C  C     . ILE E 1  113  ? 171.873 209.031 186.068 1.00 89.33  ?  112  ILE E C     1 
ATOM   3607  O  O     . ILE E 1  113  ? 171.785 210.331 186.039 1.00 77.12  ?  112  ILE E O     1 
ATOM   3608  C  CB    . ILE E 1  113  ? 171.125 208.005 188.222 1.00 106.50 ?  112  ILE E CB    1 
ATOM   3609  C  CG1   . ILE E 1  113  ? 169.923 207.356 188.896 1.00 132.47 ?  112  ILE E CG1   1 
ATOM   3610  C  CG2   . ILE E 1  113  ? 171.610 209.291 188.892 1.00 125.81 ?  112  ILE E CG2   1 
ATOM   3611  C  CD1   . ILE E 1  113  ? 170.247 206.724 190.197 1.00 174.99 ?  112  ILE E CD1   1 
ATOM   3612  N  N     . HIS E 1  114  ? 172.959 208.289 185.761 1.00 112.11 ?  113  HIS E N     1 
ATOM   3613  C  CA    . HIS E 1  114  ? 174.061 208.945 185.184 1.00 188.60 ?  113  HIS E CA    1 
ATOM   3614  C  C     . HIS E 1  114  ? 173.542 209.879 184.057 1.00 181.25 ?  113  HIS E C     1 
ATOM   3615  O  O     . HIS E 1  114  ? 174.108 210.939 183.739 1.00 223.68 ?  113  HIS E O     1 
ATOM   3616  C  CB    . HIS E 1  114  ? 175.103 207.938 184.661 1.00 203.22 ?  113  HIS E CB    1 
ATOM   3617  C  CG    . HIS E 1  114  ? 176.372 208.494 184.118 1.00 288.68 ?  113  HIS E CG    1 
ATOM   3618  N  ND1   . HIS E 1  114  ? 176.571 209.557 183.203 1.00 347.64 ?  113  HIS E ND1   1 
ATOM   3619  C  CD2   . HIS E 1  114  ? 177.625 208.016 184.337 1.00 231.86 ?  113  HIS E CD2   1 
ATOM   3620  C  CE1   . HIS E 1  114  ? 177.855 209.718 182.974 1.00 227.15 ?  113  HIS E CE1   1 
ATOM   3621  N  NE2   . HIS E 1  114  ? 178.522 208.781 183.631 1.00 194.77 ?  113  HIS E NE2   1 
ATOM   3622  N  N     . ALA E 1  115  ? 172.519 209.433 183.349 1.00 161.18 ?  114  ALA E N     1 
ATOM   3623  C  CA    . ALA E 1  115  ? 172.107 209.994 182.087 1.00 284.05 ?  114  ALA E CA    1 
ATOM   3624  C  C     . ALA E 1  115  ? 171.248 211.234 182.259 1.00 346.16 ?  114  ALA E C     1 
ATOM   3625  O  O     . ALA E 1  115  ? 170.752 211.682 181.159 1.00 440.00 ?  114  ALA E O     1 
ATOM   3626  C  CB    . ALA E 1  115  ? 171.391 208.947 181.296 1.00 387.19 ?  114  ALA E CB    1 
ATOM   3627  N  N     . LYS E 1  116  ? 171.036 211.723 183.510 1.00 278.25 ?  115  LYS E N     1 
ATOM   3628  C  CA    . LYS E 1  116  ? 170.042 212.778 183.751 1.00 343.29 ?  115  LYS E CA    1 
ATOM   3629  C  C     . LYS E 1  116  ? 168.623 212.194 183.620 1.00 408.90 ?  115  LYS E C     1 
ATOM   3630  O  O     . LYS E 1  116  ? 167.605 212.871 183.311 1.00 310.40 ?  115  LYS E O     1 
ATOM   3631  C  CB    . LYS E 1  116  ? 170.159 214.002 182.823 1.00 338.56 ?  115  LYS E CB    1 
ATOM   3632  C  CG    . LYS E 1  116  ? 171.524 214.666 182.609 1.00 309.39 ?  115  LYS E CG    1 
ATOM   3633  C  CD    . LYS E 1  116  ? 172.005 215.613 183.694 1.00 316.95 ?  115  LYS E CD    1 
ATOM   3634  C  CE    . LYS E 1  116  ? 172.980 216.639 183.165 1.00 312.30 ?  115  LYS E CE    1 
ATOM   3635  N  NZ    . LYS E 1  116  ? 172.317 217.881 182.680 1.00 300.89 1  115  LYS E NZ    1 
ATOM   3636  N  N     . ARG E 1  117  ? 168.512 210.891 183.872 1.00 440.00 ?  116  ARG E N     1 
ATOM   3637  C  CA    . ARG E 1  117  ? 167.161 210.259 183.676 1.00 440.00 ?  116  ARG E CA    1 
ATOM   3638  C  C     . ARG E 1  117  ? 166.739 209.382 184.866 1.00 376.32 ?  116  ARG E C     1 
ATOM   3639  O  O     . ARG E 1  117  ? 167.609 208.742 185.562 1.00 439.84 ?  116  ARG E O     1 
ATOM   3640  C  CB    . ARG E 1  117  ? 167.154 209.319 182.479 1.00 440.00 ?  116  ARG E CB    1 
ATOM   3641  C  CG    . ARG E 1  117  ? 167.512 209.867 181.104 1.00 440.00 ?  116  ARG E CG    1 
ATOM   3642  C  CD    . ARG E 1  117  ? 167.119 208.760 180.096 1.00 440.00 ?  116  ARG E CD    1 
ATOM   3643  N  NE    . ARG E 1  117  ? 167.990 208.398 178.926 1.00 337.66 ?  116  ARG E NE    1 
ATOM   3644  C  CZ    . ARG E 1  117  ? 168.484 209.217 177.994 1.00 278.08 ?  116  ARG E CZ    1 
ATOM   3645  N  NH1   . ARG E 1  117  ? 168.915 210.421 178.348 1.00 305.27 1  116  ARG E NH1   1 
ATOM   3646  N  NH2   . ARG E 1  117  ? 168.587 208.832 176.725 1.00 220.83 ?  116  ARG E NH2   1 
ATOM   3647  N  N     . VAL E 1  118  ? 165.410 209.274 185.077 1.00 208.96 ?  117  VAL E N     1 
ATOM   3648  C  CA    . VAL E 1  118  ? 164.868 208.346 186.102 1.00 183.98 ?  117  VAL E CA    1 
ATOM   3649  C  C     . VAL E 1  118  ? 164.115 207.188 185.458 1.00 145.62 ?  117  VAL E C     1 
ATOM   3650  O  O     . VAL E 1  118  ? 163.318 206.520 186.072 1.00 109.41 ?  117  VAL E O     1 
ATOM   3651  C  CB    . VAL E 1  118  ? 163.884 209.044 187.017 1.00 251.22 ?  117  VAL E CB    1 
ATOM   3652  C  CG1   . VAL E 1  118  ? 164.557 210.205 187.703 1.00 365.55 ?  117  VAL E CG1   1 
ATOM   3653  C  CG2   . VAL E 1  118  ? 162.633 209.508 186.290 1.00 282.31 ?  117  VAL E CG2   1 
ATOM   3654  N  N     . THR E 1  119  ? 164.452 206.987 184.196 1.00 168.91 ?  118  THR E N     1 
ATOM   3655  C  CA    . THR E 1  119  ? 163.783 206.061 183.327 1.00 146.60 ?  118  THR E CA    1 
ATOM   3656  C  C     . THR E 1  119  ? 164.759 204.942 182.932 1.00 103.40 ?  118  THR E C     1 
ATOM   3657  O  O     . THR E 1  119  ? 165.762 205.199 182.159 1.00 65.27  ?  118  THR E O     1 
ATOM   3658  C  CB    . THR E 1  119  ? 163.223 206.801 182.128 1.00 150.61 ?  118  THR E CB    1 
ATOM   3659  O  OG1   . THR E 1  119  ? 162.229 207.702 182.613 1.00 98.23  ?  118  THR E OG1   1 
ATOM   3660  C  CG2   . THR E 1  119  ? 162.561 205.912 181.113 1.00 185.71 ?  118  THR E CG2   1 
ATOM   3661  N  N     . ILE E 1  120  ? 164.337 203.704 183.264 1.00 86.56  ?  119  ILE E N     1 
ATOM   3662  C  CA    . ILE E 1  120  ? 165.153 202.592 182.798 1.00 88.39  ?  119  ILE E CA    1 
ATOM   3663  C  C     . ILE E 1  120  ? 164.746 202.508 181.338 1.00 108.94 ?  119  ILE E C     1 
ATOM   3664  O  O     . ILE E 1  120  ? 163.617 202.668 181.025 1.00 126.85 ?  119  ILE E O     1 
ATOM   3665  C  CB    . ILE E 1  120  ? 165.214 201.259 183.548 1.00 78.86  ?  119  ILE E CB    1 
ATOM   3666  C  CG1   . ILE E 1  120  ? 163.960 200.472 183.780 1.00 54.07  ?  119  ILE E CG1   1 
ATOM   3667  C  CG2   . ILE E 1  120  ? 165.947 201.388 184.854 1.00 111.79 ?  119  ILE E CG2   1 
ATOM   3668  C  CD1   . ILE E 1  120  ? 164.342 199.071 184.426 1.00 39.19  ?  119  ILE E CD1   1 
ATOM   3669  N  N     . MET E 1  121  ? 165.745 202.324 180.475 1.00 157.30 ?  120  MET E N     1 
ATOM   3670  C  CA    . MET E 1  121  ? 165.667 202.242 179.047 1.00 153.92 ?  120  MET E CA    1 
ATOM   3671  C  C     . MET E 1  121  ? 166.147 200.884 178.484 1.00 121.20 ?  120  MET E C     1 
ATOM   3672  O  O     . MET E 1  121  ? 166.975 200.074 179.027 1.00 153.19 ?  120  MET E O     1 
ATOM   3673  C  CB    . MET E 1  121  ? 166.554 203.368 178.488 1.00 187.62 ?  120  MET E CB    1 
ATOM   3674  C  CG    . MET E 1  121  ? 166.117 204.736 178.818 1.00 140.68 ?  120  MET E CG    1 
ATOM   3675  S  SD    . MET E 1  121  ? 164.555 205.220 178.226 1.00 150.29 ?  120  MET E SD    1 
ATOM   3676  C  CE    . MET E 1  121  ? 164.813 205.117 176.458 1.00 137.53 ?  120  MET E CE    1 
ATOM   3677  N  N     . PRO E 1  122  ? 165.640 200.547 177.278 1.00 85.18  ?  121  PRO E N     1 
ATOM   3678  C  CA    . PRO E 1  122  ? 165.975 199.283 176.610 1.00 86.54  ?  121  PRO E CA    1 
ATOM   3679  C  C     . PRO E 1  122  ? 167.488 199.024 176.553 1.00 98.48  ?  121  PRO E C     1 
ATOM   3680  O  O     . PRO E 1  122  ? 167.888 197.880 176.677 1.00 77.52  ?  121  PRO E O     1 
ATOM   3681  C  CB    . PRO E 1  122  ? 165.398 199.436 175.192 1.00 109.34 ?  121  PRO E CB    1 
ATOM   3682  C  CG    . PRO E 1  122  ? 165.069 200.910 175.064 1.00 105.39 ?  121  PRO E CG    1 
ATOM   3683  C  CD    . PRO E 1  122  ? 164.741 201.367 176.468 1.00 84.48  ?  121  PRO E CD    1 
ATOM   3684  N  N     . LYS E 1  123  ? 168.282 200.083 176.367 1.00 130.05 ?  122  LYS E N     1 
ATOM   3685  C  CA    . LYS E 1  123  ? 169.763 199.953 176.292 1.00 122.61 ?  122  LYS E CA    1 
ATOM   3686  C  C     . LYS E 1  123  ? 170.338 199.889 177.710 1.00 83.64  ?  122  LYS E C     1 
ATOM   3687  O  O     . LYS E 1  123  ? 171.194 199.018 177.964 1.00 96.23  ?  122  LYS E O     1 
ATOM   3688  C  CB    . LYS E 1  123  ? 170.362 201.124 175.506 1.00 118.10 ?  122  LYS E CB    1 
ATOM   3689  C  CG    . LYS E 1  123  ? 169.700 202.474 175.745 1.00 106.62 ?  122  LYS E CG    1 
ATOM   3690  C  CD    . LYS E 1  123  ? 169.902 203.452 174.607 1.00 129.43 ?  122  LYS E CD    1 
ATOM   3691  C  CE    . LYS E 1  123  ? 169.995 204.891 175.070 1.00 174.97 ?  122  LYS E CE    1 
ATOM   3692  N  NZ    . LYS E 1  123  ? 170.513 205.777 174.002 1.00 184.78 1  122  LYS E NZ    1 
ATOM   3693  N  N     . ASP E 1  124  ? 169.880 200.784 178.591 1.00 66.90  ?  123  ASP E N     1 
ATOM   3694  C  CA    . ASP E 1  124  ? 170.330 200.835 179.928 1.00 63.68  ?  123  ASP E CA    1 
ATOM   3695  C  C     . ASP E 1  124  ? 170.564 199.399 180.341 1.00 54.93  ?  123  ASP E C     1 
ATOM   3696  O  O     . ASP E 1  124  ? 171.551 199.154 181.018 1.00 102.33 ?  123  ASP E O     1 
ATOM   3697  C  CB    . ASP E 1  124  ? 169.345 201.503 180.874 1.00 89.47  ?  123  ASP E CB    1 
ATOM   3698  C  CG    . ASP E 1  124  ? 169.467 202.997 180.934 1.00 112.61 ?  123  ASP E CG    1 
ATOM   3699  O  OD1   . ASP E 1  124  ? 170.307 203.579 180.214 1.00 119.18 ?  123  ASP E OD1   1 
ATOM   3700  O  OD2   . ASP E 1  124  ? 168.675 203.466 181.712 1.00 102.43 -1 123  ASP E OD2   1 
ATOM   3701  N  N     . ILE E 1  125  ? 169.699 198.503 179.918 1.00 46.68  ?  124  ILE E N     1 
ATOM   3702  C  CA    . ILE E 1  125  ? 169.879 197.107 180.158 1.00 59.48  ?  124  ILE E CA    1 
ATOM   3703  C  C     . ILE E 1  125  ? 171.192 196.563 179.549 1.00 103.92 ?  124  ILE E C     1 
ATOM   3704  O  O     . ILE E 1  125  ? 171.939 195.723 180.121 1.00 141.23 ?  124  ILE E O     1 
ATOM   3705  C  CB    . ILE E 1  125  ? 168.749 196.213 179.715 1.00 60.88  ?  124  ILE E CB    1 
ATOM   3706  C  CG1   . ILE E 1  125  ? 167.411 196.700 180.208 1.00 92.31  ?  124  ILE E CG1   1 
ATOM   3707  C  CG2   . ILE E 1  125  ? 169.016 194.791 180.185 1.00 54.15  ?  124  ILE E CG2   1 
ATOM   3708  C  CD1   . ILE E 1  125  ? 166.340 196.056 179.363 1.00 134.83 ?  124  ILE E CD1   1 
ATOM   3709  N  N     . GLN E 1  126  ? 171.413 196.910 178.282 1.00 126.12 ?  125  GLN E N     1 
ATOM   3710  C  CA    . GLN E 1  126  ? 172.562 196.373 177.529 1.00 128.90 ?  125  GLN E CA    1 
ATOM   3711  C  C     . GLN E 1  126  ? 173.925 196.743 178.128 1.00 101.26 ?  125  GLN E C     1 
ATOM   3712  O  O     . GLN E 1  126  ? 174.752 195.814 178.150 1.00 77.59  ?  125  GLN E O     1 
ATOM   3713  C  CB    . GLN E 1  126  ? 172.445 196.808 176.054 1.00 185.43 ?  125  GLN E CB    1 
ATOM   3714  C  CG    . GLN E 1  126  ? 171.041 196.619 175.520 1.00 241.57 ?  125  GLN E CG    1 
ATOM   3715  C  CD    . GLN E 1  126  ? 170.964 197.076 174.100 1.00 310.52 ?  125  GLN E CD    1 
ATOM   3716  O  OE1   . GLN E 1  126  ? 171.190 198.250 173.802 1.00 371.41 ?  125  GLN E OE1   1 
ATOM   3717  N  NE2   . GLN E 1  126  ? 170.585 196.161 173.219 1.00 330.90 ?  125  GLN E NE2   1 
ATOM   3718  N  N     . LEU E 1  127  ? 174.181 198.044 178.384 1.00 107.95 ?  126  LEU E N     1 
ATOM   3719  C  CA    . LEU E 1  127  ? 175.466 198.505 178.871 1.00 96.11  ?  126  LEU E CA    1 
ATOM   3720  C  C     . LEU E 1  127  ? 175.907 197.668 180.069 1.00 81.71  ?  126  LEU E C     1 
ATOM   3721  O  O     . LEU E 1  127  ? 177.110 197.249 180.187 1.00 125.53 ?  126  LEU E O     1 
ATOM   3722  C  CB    . LEU E 1  127  ? 175.386 199.915 179.460 1.00 77.72  ?  126  LEU E CB    1 
ATOM   3723  C  CG    . LEU E 1  127  ? 175.789 201.043 178.528 1.00 77.11  ?  126  LEU E CG    1 
ATOM   3724  C  CD1   . LEU E 1  127  ? 174.682 201.208 177.468 1.00 74.13  ?  126  LEU E CD1   1 
ATOM   3725  C  CD2   . LEU E 1  127  ? 176.117 202.253 179.376 1.00 63.58  ?  126  LEU E CD2   1 
ATOM   3726  N  N     . ALA E 1  128  ? 174.923 197.563 180.946 1.00 75.45  ?  127  ALA E N     1 
ATOM   3727  C  CA    . ALA E 1  128  ? 175.062 196.973 182.236 1.00 93.70  ?  127  ALA E CA    1 
ATOM   3728  C  C     . ALA E 1  128  ? 175.653 195.602 182.027 1.00 104.00 ?  127  ALA E C     1 
ATOM   3729  O  O     . ALA E 1  128  ? 176.715 195.356 182.633 1.00 173.22 ?  127  ALA E O     1 
ATOM   3730  C  CB    . ALA E 1  128  ? 173.710 196.815 182.886 1.00 134.11 ?  127  ALA E CB    1 
ATOM   3731  N  N     . ARG E 1  129  ? 174.934 194.852 181.181 1.00 96.10  ?  128  ARG E N     1 
ATOM   3732  C  CA    . ARG E 1  129  ? 175.318 193.483 180.847 1.00 140.14 ?  128  ARG E CA    1 
ATOM   3733  C  C     . ARG E 1  129  ? 176.645 193.429 180.083 1.00 233.05 ?  128  ARG E C     1 
ATOM   3734  O  O     . ARG E 1  129  ? 177.453 192.575 180.364 1.00 284.70 ?  128  ARG E O     1 
ATOM   3735  C  CB    . ARG E 1  129  ? 174.196 192.831 180.068 1.00 114.16 ?  128  ARG E CB    1 
ATOM   3736  C  CG    . ARG E 1  129  ? 172.986 192.709 180.930 1.00 119.23 ?  128  ARG E CG    1 
ATOM   3737  C  CD    . ARG E 1  129  ? 171.916 191.885 180.275 1.00 157.22 ?  128  ARG E CD    1 
ATOM   3738  N  NE    . ARG E 1  129  ? 172.430 190.563 180.013 1.00 174.99 ?  128  ARG E NE    1 
ATOM   3739  C  CZ    . ARG E 1  129  ? 172.728 190.032 178.843 1.00 225.60 ?  128  ARG E CZ    1 
ATOM   3740  N  NH1   . ARG E 1  129  ? 172.612 190.732 177.721 1.00 238.45 1  128  ARG E NH1   1 
ATOM   3741  N  NH2   . ARG E 1  129  ? 173.199 188.784 178.821 1.00 249.98 ?  128  ARG E NH2   1 
ATOM   3742  N  N     . ARG E 1  130  ? 176.845 194.318 179.127 1.00 246.83 ?  129  ARG E N     1 
ATOM   3743  C  CA    . ARG E 1  130  ? 177.969 194.369 178.253 1.00 197.71 ?  129  ARG E CA    1 
ATOM   3744  C  C     . ARG E 1  130  ? 179.221 194.493 179.138 1.00 137.63 ?  129  ARG E C     1 
ATOM   3745  O  O     . ARG E 1  130  ? 180.247 193.856 178.998 1.00 106.98 ?  129  ARG E O     1 
ATOM   3746  C  CB    . ARG E 1  130  ? 177.953 195.569 177.275 1.00 231.56 ?  129  ARG E CB    1 
ATOM   3747  C  CG    . ARG E 1  130  ? 179.346 196.069 176.844 1.00 190.04 ?  129  ARG E CG    1 
ATOM   3748  C  CD    . ARG E 1  130  ? 179.510 196.623 175.471 1.00 207.17 ?  129  ARG E CD    1 
ATOM   3749  N  NE    . ARG E 1  130  ? 180.926 196.491 175.160 1.00 211.18 ?  129  ARG E NE    1 
ATOM   3750  C  CZ    . ARG E 1  130  ? 181.520 196.887 174.011 1.00 232.96 ?  129  ARG E CZ    1 
ATOM   3751  N  NH1   . ARG E 1  130  ? 180.826 197.563 173.112 1.00 250.92 1  129  ARG E NH1   1 
ATOM   3752  N  NH2   . ARG E 1  130  ? 182.771 196.531 173.753 1.00 236.96 ?  129  ARG E NH2   1 
ATOM   3753  N  N     . ILE E 1  131  ? 179.102 195.374 180.139 1.00 133.30 ?  130  ILE E N     1 
ATOM   3754  C  CA    . ILE E 1  131  ? 180.312 195.669 180.917 1.00 103.39 ?  130  ILE E CA    1 
ATOM   3755  C  C     . ILE E 1  131  ? 180.549 194.569 181.942 1.00 77.91  ?  130  ILE E C     1 
ATOM   3756  O  O     . ILE E 1  131  ? 181.645 194.184 182.144 1.00 71.87  ?  130  ILE E O     1 
ATOM   3757  C  CB    . ILE E 1  131  ? 180.309 197.080 181.518 1.00 105.52 ?  130  ILE E CB    1 
ATOM   3758  C  CG1   . ILE E 1  131  ? 180.366 198.204 180.428 1.00 84.45  ?  130  ILE E CG1   1 
ATOM   3759  C  CG2   . ILE E 1  131  ? 181.432 197.039 182.552 1.00 101.79 ?  130  ILE E CG2   1 
ATOM   3760  C  CD1   . ILE E 1  131  ? 180.121 199.594 180.845 1.00 64.26  ?  130  ILE E CD1   1 
ATOM   3761  N  N     . ARG E 1  132  ? 179.494 194.031 182.490 1.00 100.28 ?  131  ARG E N     1 
ATOM   3762  C  CA    . ARG E 1  132  ? 179.594 192.775 183.290 1.00 157.01 ?  131  ARG E CA    1 
ATOM   3763  C  C     . ARG E 1  132  ? 180.166 191.643 182.451 1.00 165.07 ?  131  ARG E C     1 
ATOM   3764  O  O     . ARG E 1  132  ? 180.798 190.770 182.996 1.00 165.68 ?  131  ARG E O     1 
ATOM   3765  C  CB    . ARG E 1  132  ? 178.217 192.355 183.825 1.00 223.25 ?  131  ARG E CB    1 
ATOM   3766  C  CG    . ARG E 1  132  ? 177.966 190.934 184.279 1.00 256.30 ?  131  ARG E CG    1 
ATOM   3767  C  CD    . ARG E 1  132  ? 178.224 190.829 185.773 1.00 274.44 ?  131  ARG E CD    1 
ATOM   3768  N  NE    . ARG E 1  132  ? 178.437 189.445 186.165 1.00 295.31 ?  131  ARG E NE    1 
ATOM   3769  C  CZ    . ARG E 1  132  ? 179.158 189.020 187.217 1.00 289.95 ?  131  ARG E CZ    1 
ATOM   3770  N  NH1   . ARG E 1  132  ? 179.734 189.882 188.035 1.00 279.54 1  131  ARG E NH1   1 
ATOM   3771  N  NH2   . ARG E 1  132  ? 179.293 187.729 187.429 1.00 250.42 ?  131  ARG E NH2   1 
ATOM   3772  N  N     . GLY E 1  133  ? 179.824 191.628 181.170 1.00 204.02 ?  132  GLY E N     1 
ATOM   3773  C  CA    . GLY E 1  133  ? 180.404 190.713 180.184 1.00 304.13 ?  132  GLY E CA    1 
ATOM   3774  C  C     . GLY E 1  133  ? 179.597 189.544 179.619 1.00 392.07 ?  132  GLY E C     1 
ATOM   3775  O  O     . GLY E 1  133  ? 180.172 188.783 178.829 1.00 440.00 ?  132  GLY E O     1 
ATOM   3776  N  N     . GLU E 1  134  ? 178.323 189.340 179.975 1.00 440.00 ?  133  GLU E N     1 
ATOM   3777  C  CA    . GLU E 1  134  ? 177.619 188.251 179.338 1.00 440.00 ?  133  GLU E CA    1 
ATOM   3778  C  C     . GLU E 1  134  ? 177.246 188.814 177.980 1.00 440.00 ?  133  GLU E C     1 
ATOM   3779  O  O     . GLU E 1  134  ? 177.742 188.351 176.925 1.00 440.00 ?  133  GLU E O     1 
ATOM   3780  C  CB    . GLU E 1  134  ? 176.432 187.720 180.153 1.00 440.00 ?  133  GLU E CB    1 
ATOM   3781  C  CG    . GLU E 1  134  ? 176.872 186.980 181.415 1.00 436.49 ?  133  GLU E CG    1 
ATOM   3782  C  CD    . GLU E 1  134  ? 177.662 185.671 181.299 1.00 397.82 ?  133  GLU E CD    1 
ATOM   3783  O  OE1   . GLU E 1  134  ? 177.220 184.825 180.520 1.00 354.61 ?  133  GLU E OE1   1 
ATOM   3784  O  OE2   . GLU E 1  134  ? 178.740 185.506 181.955 1.00 440.00 -1 133  GLU E OE2   1 
ATOM   3785  N  N     . ARG E 1  135  ? 176.562 189.951 178.022 1.00 440.00 ?  134  ARG E N     1 
ATOM   3786  C  CA    . ARG E 1  135  ? 176.321 190.717 176.792 1.00 440.00 ?  134  ARG E CA    1 
ATOM   3787  C  C     . ARG E 1  135  ? 177.684 191.018 176.159 1.00 440.00 ?  134  ARG E C     1 
ATOM   3788  O  O     . ARG E 1  135  ? 178.623 191.345 176.847 1.00 401.20 ?  134  ARG E O     1 
ATOM   3789  C  CB    . ARG E 1  135  ? 175.533 191.998 177.089 1.00 440.00 ?  134  ARG E CB    1 
ATOM   3790  C  CG    . ARG E 1  135  ? 175.369 192.927 175.882 1.00 440.00 ?  134  ARG E CG    1 
ATOM   3791  C  CD    . ARG E 1  135  ? 174.676 192.251 174.707 1.00 440.00 ?  134  ARG E CD    1 
ATOM   3792  N  NE    . ARG E 1  135  ? 174.557 193.133 173.545 1.00 440.00 ?  134  ARG E NE    1 
ATOM   3793  C  CZ    . ARG E 1  135  ? 175.487 193.312 172.603 1.00 335.92 ?  134  ARG E CZ    1 
ATOM   3794  N  NH1   . ARG E 1  135  ? 176.552 192.542 172.574 1.00 272.84 1  134  ARG E NH1   1 
ATOM   3795  N  NH2   . ARG E 1  135  ? 175.358 194.263 171.689 1.00 295.26 ?  134  ARG E NH2   1 
ATOM   3796  N  N     . ALA E 1  136  ? 177.797 190.943 174.829 1.00 417.86 ?  135  ALA E N     1 
ATOM   3797  C  CA    . ALA E 1  136  ? 179.030 191.266 174.107 1.00 378.55 ?  135  ALA E CA    1 
ATOM   3798  C  C     . ALA E 1  136  ? 179.447 192.735 174.338 1.00 313.80 ?  135  ALA E C     1 
ATOM   3799  O  O     . ALA E 1  136  ? 180.355 192.960 175.134 1.00 240.45 ?  135  ALA E O     1 
ATOM   3800  C  CB    . ALA E 1  136  ? 178.868 190.938 172.630 1.00 422.02 ?  135  ALA E CB    1 
ATOM   3801  O  OXT   . ALA E 1  136  ? 178.886 193.652 173.715 1.00 296.32 -1 135  ALA E OXT   1 
ATOM   3802  N  N     . GLY F 2  12   ? 132.099 182.161 157.673 1.00 440.00 ?  11   GLY F N     1 
ATOM   3803  C  CA    . GLY F 2  12   ? 131.578 182.959 158.815 1.00 440.00 ?  11   GLY F CA    1 
ATOM   3804  C  C     . GLY F 2  12   ? 130.624 182.079 159.632 1.00 440.00 ?  11   GLY F C     1 
ATOM   3805  O  O     . GLY F 2  12   ? 129.477 182.404 159.827 1.00 440.00 ?  11   GLY F O     1 
ATOM   3806  N  N     . LYS F 2  13   ? 131.157 180.962 160.161 1.00 440.00 ?  12   LYS F N     1 
ATOM   3807  C  CA    . LYS F 2  13   ? 130.377 179.793 160.642 1.00 440.00 ?  12   LYS F CA    1 
ATOM   3808  C  C     . LYS F 2  13   ? 130.758 179.414 162.097 1.00 440.00 ?  12   LYS F C     1 
ATOM   3809  O  O     . LYS F 2  13   ? 131.936 179.563 162.470 1.00 440.00 ?  12   LYS F O     1 
ATOM   3810  C  CB    . LYS F 2  13   ? 130.631 178.656 159.658 1.00 440.00 ?  12   LYS F CB    1 
ATOM   3811  N  N     . GLY F 2  14   ? 129.818 178.892 162.935 1.00 440.00 ?  13   GLY F N     1 
ATOM   3812  C  CA    . GLY F 2  14   ? 130.156 178.202 164.300 1.00 440.00 ?  13   GLY F CA    1 
ATOM   3813  C  C     . GLY F 2  14   ? 131.153 177.024 164.102 1.00 440.00 ?  13   GLY F C     1 
ATOM   3814  O  O     . GLY F 2  14   ? 132.220 176.981 164.706 1.00 440.00 ?  13   GLY F O     1 
ATOM   3815  N  N     . GLY F 2  15   ? 130.870 176.220 163.069 1.00 440.00 ?  14   GLY F N     1 
ATOM   3816  C  CA    . GLY F 2  15   ? 131.784 175.141 162.519 1.00 440.00 ?  14   GLY F CA    1 
ATOM   3817  C  C     . GLY F 2  15   ? 132.412 174.242 163.599 1.00 440.00 ?  14   GLY F C     1 
ATOM   3818  O  O     . GLY F 2  15   ? 133.607 173.935 163.482 1.00 440.00 ?  14   GLY F O     1 
ATOM   3819  N  N     . ALA F 2  16   ? 131.647 173.924 164.648 1.00 440.00 ?  15   ALA F N     1 
ATOM   3820  C  CA    . ALA F 2  16   ? 132.153 173.056 165.736 1.00 440.00 ?  15   ALA F CA    1 
ATOM   3821  C  C     . ALA F 2  16   ? 133.467 173.653 166.246 1.00 440.00 ?  15   ALA F C     1 
ATOM   3822  O  O     . ALA F 2  16   ? 134.399 172.879 166.541 1.00 440.00 ?  15   ALA F O     1 
ATOM   3823  C  CB    . ALA F 2  16   ? 132.344 171.649 165.226 1.00 440.00 ?  15   ALA F CB    1 
ATOM   3824  N  N     . LYS F 2  17   ? 133.524 174.984 166.340 1.00 440.00 ?  16   LYS F N     1 
ATOM   3825  C  CA    . LYS F 2  17   ? 134.760 175.679 166.765 1.00 440.00 ?  16   LYS F CA    1 
ATOM   3826  C  C     . LYS F 2  17   ? 135.098 175.355 168.224 1.00 440.00 ?  16   LYS F C     1 
ATOM   3827  O  O     . LYS F 2  17   ? 134.194 175.413 169.082 1.00 238.02 ?  16   LYS F O     1 
ATOM   3828  C  CB    . LYS F 2  17   ? 134.612 177.166 166.551 1.00 440.00 ?  16   LYS F CB    1 
ATOM   3829  N  N     . ARG F 2  18   ? 136.370 175.030 168.470 1.00 440.00 ?  17   ARG F N     1 
ATOM   3830  C  CA    . ARG F 2  18   ? 136.909 174.755 169.822 1.00 440.00 ?  17   ARG F CA    1 
ATOM   3831  C  C     . ARG F 2  18   ? 138.128 175.664 169.997 1.00 440.00 ?  17   ARG F C     1 
ATOM   3832  O  O     . ARG F 2  18   ? 138.977 175.675 169.084 1.00 440.00 ?  17   ARG F O     1 
ATOM   3833  C  CB    . ARG F 2  18   ? 137.279 173.298 169.945 1.00 440.00 ?  17   ARG F CB    1 
ATOM   3834  N  N     . HIS F 2  19   ? 138.223 176.396 171.110 1.00 440.00 ?  18   HIS F N     1 
ATOM   3835  C  CA    . HIS F 2  19   ? 139.404 177.333 171.247 1.00 440.00 ?  18   HIS F CA    1 
ATOM   3836  C  C     . HIS F 2  19   ? 140.279 176.919 172.437 1.00 440.00 ?  18   HIS F C     1 
ATOM   3837  O  O     . HIS F 2  19   ? 139.812 176.943 173.551 1.00 440.00 ?  18   HIS F O     1 
ATOM   3838  C  CB    . HIS F 2  19   ? 138.961 178.765 171.410 1.00 440.00 ?  18   HIS F CB    1 
ATOM   3839  N  N     . ARG F 2  20   ? 141.547 176.573 172.184 1.00 440.00 ?  19   ARG F N     1 
ATOM   3840  C  CA    . ARG F 2  20   ? 142.557 176.173 173.205 1.00 440.00 ?  19   ARG F CA    1 
ATOM   3841  C  C     . ARG F 2  20   ? 143.910 176.815 172.831 1.00 440.00 ?  19   ARG F C     1 
ATOM   3842  O  O     . ARG F 2  20   ? 144.564 176.377 171.860 1.00 440.00 ?  19   ARG F O     1 
ATOM   3843  C  CB    . ARG F 2  20   ? 142.667 174.648 173.307 1.00 440.00 ?  19   ARG F CB    1 
ATOM   3844  N  N     . LYS F 2  21   ? 144.387 177.815 173.610 1.00 440.00 ?  20   LYS F N     1 
ATOM   3845  C  CA    . LYS F 2  21   ? 145.704 178.524 173.386 1.00 440.00 ?  20   LYS F CA    1 
ATOM   3846  C  C     . LYS F 2  21   ? 146.511 178.587 174.694 1.00 440.00 ?  20   LYS F C     1 
ATOM   3847  O  O     . LYS F 2  21   ? 145.935 178.422 175.764 1.00 439.26 ?  20   LYS F O     1 
ATOM   3848  C  CB    . LYS F 2  21   ? 145.433 179.894 172.810 1.00 440.00 ?  20   LYS F CB    1 
ATOM   3849  N  N     . VAL F 2  22   ? 147.825 178.867 174.613 1.00 436.14 ?  21   VAL F N     1 
ATOM   3850  C  CA    . VAL F 2  22   ? 148.758 178.429 175.662 1.00 440.00 ?  21   VAL F CA    1 
ATOM   3851  C  C     . VAL F 2  22   ? 149.479 179.619 176.346 1.00 440.00 ?  21   VAL F C     1 
ATOM   3852  O  O     . VAL F 2  22   ? 150.277 180.384 175.687 1.00 440.00 ?  21   VAL F O     1 
ATOM   3853  C  CB    . VAL F 2  22   ? 149.710 177.426 175.060 1.00 440.00 ?  21   VAL F CB    1 
ATOM   3854  N  N     . LEU F 2  23   ? 149.187 179.788 177.652 1.00 440.00 ?  22   LEU F N     1 
ATOM   3855  C  CA    . LEU F 2  23   ? 149.501 180.999 178.437 1.00 440.00 ?  22   LEU F CA    1 
ATOM   3856  C  C     . LEU F 2  23   ? 149.883 180.667 179.886 1.00 440.00 ?  22   LEU F C     1 
ATOM   3857  O  O     . LEU F 2  23   ? 149.737 181.504 180.783 1.00 440.00 ?  22   LEU F O     1 
ATOM   3858  C  CB    . LEU F 2  23   ? 148.327 181.958 178.409 1.00 440.00 ?  22   LEU F CB    1 
ATOM   3859  N  N     . ARG F 2  24   ? 150.448 179.491 180.158 1.00 401.46 ?  23   ARG F N     1 
ATOM   3860  C  CA    . ARG F 2  24   ? 151.167 179.355 181.480 1.00 274.64 ?  23   ARG F CA    1 
ATOM   3861  C  C     . ARG F 2  24   ? 152.664 179.626 181.249 1.00 262.83 ?  23   ARG F C     1 
ATOM   3862  O  O     . ARG F 2  24   ? 153.167 180.569 181.854 1.00 214.65 ?  23   ARG F O     1 
ATOM   3863  C  CB    . ARG F 2  24   ? 150.891 178.027 182.178 1.00 235.70 ?  23   ARG F CB    1 
ATOM   3864  N  N     . ASP F 2  25   ? 153.273 178.811 180.372 1.00 252.28 ?  24   ASP F N     1 
ATOM   3865  C  CA    . ASP F 2  25   ? 154.715 178.609 180.112 1.00 218.22 ?  24   ASP F CA    1 
ATOM   3866  C  C     . ASP F 2  25   ? 155.285 179.613 179.122 1.00 171.00 ?  24   ASP F C     1 
ATOM   3867  O  O     . ASP F 2  25   ? 156.391 180.112 179.242 1.00 138.76 ?  24   ASP F O     1 
ATOM   3868  C  CB    . ASP F 2  25   ? 154.865 177.255 179.466 1.00 229.03 ?  24   ASP F CB    1 
ATOM   3869  N  N     . ASN F 2  26   ? 154.498 179.755 178.071 1.00 147.58 ?  25   ASN F N     1 
ATOM   3870  C  CA    . ASN F 2  26   ? 154.812 180.568 176.996 1.00 140.85 ?  25   ASN F CA    1 
ATOM   3871  C  C     . ASN F 2  26   ? 154.869 182.000 177.568 1.00 150.63 ?  25   ASN F C     1 
ATOM   3872  O  O     . ASN F 2  26   ? 154.120 182.436 178.475 1.00 167.99 ?  25   ASN F O     1 
ATOM   3873  C  CB    . ASN F 2  26   ? 153.781 180.377 175.884 1.00 150.78 ?  25   ASN F CB    1 
ATOM   3874  C  CG    . ASN F 2  26   ? 154.178 181.142 174.639 1.00 177.19 ?  25   ASN F CG    1 
ATOM   3875  O  OD1   . ASN F 2  26   ? 155.132 181.922 174.667 1.00 199.59 ?  25   ASN F OD1   1 
ATOM   3876  N  ND2   . ASN F 2  26   ? 153.471 180.931 173.539 1.00 170.78 ?  25   ASN F ND2   1 
ATOM   3877  N  N     . ILE F 2  27   ? 155.655 182.843 176.938 1.00 159.40 ?  26   ILE F N     1 
ATOM   3878  C  CA    . ILE F 2  27   ? 155.934 184.160 177.485 1.00 216.21 ?  26   ILE F CA    1 
ATOM   3879  C  C     . ILE F 2  27   ? 154.729 185.110 177.439 1.00 256.52 ?  26   ILE F C     1 
ATOM   3880  O  O     . ILE F 2  27   ? 154.646 185.942 178.348 1.00 188.34 ?  26   ILE F O     1 
ATOM   3881  C  CB    . ILE F 2  27   ? 157.158 184.707 176.762 1.00 253.79 ?  26   ILE F CB    1 
ATOM   3882  C  CG1   . ILE F 2  27   ? 158.401 183.827 177.005 1.00 175.42 ?  26   ILE F CG1   1 
ATOM   3883  C  CG2   . ILE F 2  27   ? 157.314 186.177 177.117 1.00 323.08 ?  26   ILE F CG2   1 
ATOM   3884  C  CD1   . ILE F 2  27   ? 158.679 183.445 178.445 1.00 136.20 ?  26   ILE F CD1   1 
ATOM   3885  N  N     . GLN F 2  28   ? 153.814 184.979 176.447 1.00 440.00 ?  27   GLN F N     1 
ATOM   3886  C  CA    . GLN F 2  28   ? 152.482 185.712 176.453 1.00 440.00 ?  27   GLN F CA    1 
ATOM   3887  C  C     . GLN F 2  28   ? 151.734 185.531 177.786 1.00 440.00 ?  27   GLN F C     1 
ATOM   3888  O  O     . GLN F 2  28   ? 151.176 186.510 178.375 1.00 440.00 ?  27   GLN F O     1 
ATOM   3889  C  CB    . GLN F 2  28   ? 151.508 185.371 175.292 1.00 440.00 ?  27   GLN F CB    1 
ATOM   3890  C  CG    . GLN F 2  28   ? 150.862 183.967 175.250 1.00 440.00 ?  27   GLN F CG    1 
ATOM   3891  C  CD    . GLN F 2  28   ? 149.534 183.804 174.520 1.00 306.29 ?  27   GLN F CD    1 
ATOM   3892  O  OE1   . GLN F 2  28   ? 148.710 184.725 174.419 1.00 213.30 ?  27   GLN F OE1   1 
ATOM   3893  N  NE2   . GLN F 2  28   ? 149.273 182.600 174.028 1.00 175.88 ?  27   GLN F NE2   1 
ATOM   3894  N  N     . GLY F 2  29   ? 151.677 184.267 178.235 1.00 440.00 ?  28   GLY F N     1 
ATOM   3895  C  CA    . GLY F 2  29   ? 150.904 183.868 179.416 1.00 440.00 ?  28   GLY F CA    1 
ATOM   3896  C  C     . GLY F 2  29   ? 151.308 184.529 180.713 1.00 440.00 ?  28   GLY F C     1 
ATOM   3897  O  O     . GLY F 2  29   ? 150.420 185.008 181.515 1.00 440.00 ?  28   GLY F O     1 
ATOM   3898  N  N     . ILE F 2  30   ? 152.625 184.571 180.923 1.00 433.78 ?  29   ILE F N     1 
ATOM   3899  C  CA    . ILE F 2  30   ? 153.225 185.161 182.140 1.00 275.45 ?  29   ILE F CA    1 
ATOM   3900  C  C     . ILE F 2  30   ? 152.685 186.577 182.388 1.00 391.44 ?  29   ILE F C     1 
ATOM   3901  O  O     . ILE F 2  30   ? 152.147 187.265 181.418 1.00 440.00 ?  29   ILE F O     1 
ATOM   3902  C  CB    . ILE F 2  30   ? 154.728 185.188 182.094 1.00 161.43 ?  29   ILE F CB    1 
ATOM   3903  C  CG1   . ILE F 2  30   ? 155.211 183.743 182.107 1.00 117.67 ?  29   ILE F CG1   1 
ATOM   3904  C  CG2   . ILE F 2  30   ? 155.148 186.055 183.284 1.00 165.13 ?  29   ILE F CG2   1 
ATOM   3905  C  CD1   . ILE F 2  30   ? 156.652 183.581 181.809 1.00 114.34 ?  29   ILE F CD1   1 
ATOM   3906  N  N     . THR F 2  31   ? 152.818 187.088 183.640 1.00 385.05 ?  30   THR F N     1 
ATOM   3907  C  CA    . THR F 2  31   ? 152.111 188.378 183.934 1.00 365.80 ?  30   THR F CA    1 
ATOM   3908  C  C     . THR F 2  31   ? 153.071 189.574 183.796 1.00 239.08 ?  30   THR F C     1 
ATOM   3909  O  O     . THR F 2  31   ? 154.107 189.529 184.372 1.00 290.04 ?  30   THR F O     1 
ATOM   3910  C  CB    . THR F 2  31   ? 151.400 188.353 185.309 1.00 413.08 ?  30   THR F CB    1 
ATOM   3911  O  OG1   . THR F 2  31   ? 152.418 188.309 186.308 1.00 347.03 ?  30   THR F OG1   1 
ATOM   3912  C  CG2   . THR F 2  31   ? 150.363 187.272 185.435 1.00 431.33 ?  30   THR F CG2   1 
ATOM   3913  N  N     . LYS F 2  32   ? 152.703 190.635 183.073 1.00 171.75 ?  31   LYS F N     1 
ATOM   3914  C  CA    . LYS F 2  32   ? 153.505 191.815 183.008 1.00 169.71 ?  31   LYS F CA    1 
ATOM   3915  C  C     . LYS F 2  32   ? 153.690 192.495 184.357 1.00 227.00 ?  31   LYS F C     1 
ATOM   3916  O  O     . LYS F 2  32   ? 154.812 192.935 184.606 1.00 318.16 ?  31   LYS F O     1 
ATOM   3917  C  CB    . LYS F 2  32   ? 152.913 192.935 182.166 1.00 159.23 ?  31   LYS F CB    1 
ATOM   3918  C  CG    . LYS F 2  32   ? 153.862 194.126 181.971 1.00 136.01 ?  31   LYS F CG    1 
ATOM   3919  C  CD    . LYS F 2  32   ? 153.280 195.537 181.903 1.00 130.93 ?  31   LYS F CD    1 
ATOM   3920  C  CE    . LYS F 2  32   ? 154.471 196.442 181.805 1.00 131.08 ?  31   LYS F CE    1 
ATOM   3921  N  NZ    . LYS F 2  32   ? 154.221 197.828 181.337 1.00 122.03 1  31   LYS F NZ    1 
ATOM   3922  N  N     . PRO F 2  33   ? 152.660 192.717 185.201 1.00 236.11 ?  32   PRO F N     1 
ATOM   3923  C  CA    . PRO F 2  33   ? 152.924 193.348 186.488 1.00 229.23 ?  32   PRO F CA    1 
ATOM   3924  C  C     . PRO F 2  33   ? 153.999 192.536 187.198 1.00 318.46 ?  32   PRO F C     1 
ATOM   3925  O  O     . PRO F 2  33   ? 154.868 193.172 187.854 1.00 396.54 ?  32   PRO F O     1 
ATOM   3926  C  CB    . PRO F 2  33   ? 151.613 193.260 187.266 1.00 193.07 ?  32   PRO F CB    1 
ATOM   3927  C  CG    . PRO F 2  33   ? 150.595 193.072 186.166 1.00 217.65 ?  32   PRO F CG    1 
ATOM   3928  C  CD    . PRO F 2  33   ? 151.275 192.272 185.057 1.00 267.39 ?  32   PRO F CD    1 
ATOM   3929  N  N     . ALA F 2  34   ? 153.978 191.183 187.033 1.00 273.59 ?  33   ALA F N     1 
ATOM   3930  C  CA    . ALA F 2  34   ? 154.959 190.337 187.700 1.00 184.11 ?  33   ALA F CA    1 
ATOM   3931  C  C     . ALA F 2  34   ? 156.384 190.893 187.601 1.00 166.19 ?  33   ALA F C     1 
ATOM   3932  O  O     . ALA F 2  34   ? 157.093 190.973 188.611 1.00 127.46 ?  33   ALA F O     1 
ATOM   3933  C  CB    . ALA F 2  34   ? 154.815 188.913 187.273 1.00 145.62 ?  33   ALA F CB    1 
ATOM   3934  N  N     . ILE F 2  35   ? 156.679 191.443 186.419 1.00 202.21 ?  34   ILE F N     1 
ATOM   3935  C  CA    . ILE F 2  35   ? 157.917 192.228 186.128 1.00 177.49 ?  34   ILE F CA    1 
ATOM   3936  C  C     . ILE F 2  35   ? 157.965 193.570 186.859 1.00 188.36 ?  34   ILE F C     1 
ATOM   3937  O  O     . ILE F 2  35   ? 159.015 193.828 187.443 1.00 307.15 ?  34   ILE F O     1 
ATOM   3938  C  CB    . ILE F 2  35   ? 157.987 192.523 184.616 1.00 160.53 ?  34   ILE F CB    1 
ATOM   3939  C  CG1   . ILE F 2  35   ? 158.073 191.236 183.755 1.00 237.57 ?  34   ILE F CG1   1 
ATOM   3940  C  CG2   . ILE F 2  35   ? 158.955 193.612 184.194 1.00 112.62 ?  34   ILE F CG2   1 
ATOM   3941  C  CD1   . ILE F 2  35   ? 159.222 190.304 183.992 1.00 256.26 ?  34   ILE F CD1   1 
ATOM   3942  N  N     . ARG F 2  36   ? 156.929 194.439 186.718 1.00 137.67 ?  35   ARG F N     1 
ATOM   3943  C  CA    . ARG F 2  36   ? 157.063 195.756 187.266 1.00 114.12 ?  35   ARG F CA    1 
ATOM   3944  C  C     . ARG F 2  36   ? 157.273 195.552 188.770 1.00 134.83 ?  35   ARG F C     1 
ATOM   3945  O  O     . ARG F 2  36   ? 158.129 196.313 189.379 1.00 239.54 ?  35   ARG F O     1 
ATOM   3946  C  CB    . ARG F 2  36   ? 155.769 196.539 187.008 1.00 133.49 ?  35   ARG F CB    1 
ATOM   3947  C  CG    . ARG F 2  36   ? 155.660 197.251 185.672 1.00 171.19 ?  35   ARG F CG    1 
ATOM   3948  C  CD    . ARG F 2  36   ? 154.255 197.802 185.495 1.00 210.07 ?  35   ARG F CD    1 
ATOM   3949  N  NE    . ARG F 2  36   ? 153.945 198.990 186.284 1.00 189.81 ?  35   ARG F NE    1 
ATOM   3950  C  CZ    . ARG F 2  36   ? 154.026 200.233 185.819 1.00 124.56 ?  35   ARG F CZ    1 
ATOM   3951  N  NH1   . ARG F 2  36   ? 154.484 200.370 184.593 1.00 85.23  1  35   ARG F NH1   1 
ATOM   3952  N  NH2   . ARG F 2  36   ? 153.804 201.282 186.618 1.00 98.75  ?  35   ARG F NH2   1 
ATOM   3953  N  N     . ARG F 2  37   ? 156.581 194.501 189.294 1.00 127.00 ?  36   ARG F N     1 
ATOM   3954  C  CA    . ARG F 2  37   ? 156.687 194.180 190.723 1.00 114.46 ?  36   ARG F CA    1 
ATOM   3955  C  C     . ARG F 2  37   ? 158.212 194.193 190.983 1.00 117.58 ?  36   ARG F C     1 
ATOM   3956  O  O     . ARG F 2  37   ? 158.792 194.659 191.932 1.00 109.96 ?  36   ARG F O     1 
ATOM   3957  C  CB    . ARG F 2  37   ? 156.211 192.772 191.072 1.00 133.84 ?  36   ARG F CB    1 
ATOM   3958  C  CG    . ARG F 2  37   ? 155.173 192.159 190.160 1.00 187.40 ?  36   ARG F CG    1 
ATOM   3959  C  CD    . ARG F 2  37   ? 153.799 192.592 190.496 1.00 237.89 ?  36   ARG F CD    1 
ATOM   3960  N  NE    . ARG F 2  37   ? 153.729 192.161 191.877 1.00 242.63 ?  36   ARG F NE    1 
ATOM   3961  C  CZ    . ARG F 2  37   ? 153.539 190.896 192.306 1.00 225.72 ?  36   ARG F CZ    1 
ATOM   3962  N  NH1   . ARG F 2  37   ? 153.458 189.886 191.462 1.00 198.05 1  36   ARG F NH1   1 
ATOM   3963  N  NH2   . ARG F 2  37   ? 153.380 190.650 193.596 1.00 233.45 ?  36   ARG F NH2   1 
ATOM   3964  N  N     . LEU F 2  38   ? 158.898 193.578 190.023 1.00 114.37 ?  37   LEU F N     1 
ATOM   3965  C  CA    . LEU F 2  38   ? 160.343 193.362 190.121 1.00 84.38  ?  37   LEU F CA    1 
ATOM   3966  C  C     . LEU F 2  38   ? 161.109 194.660 189.961 1.00 65.27  ?  37   LEU F C     1 
ATOM   3967  O  O     . LEU F 2  38   ? 162.065 194.899 190.519 1.00 44.99  ?  37   LEU F O     1 
ATOM   3968  C  CB    . LEU F 2  38   ? 160.713 192.310 189.060 1.00 105.22 ?  37   LEU F CB    1 
ATOM   3969  C  CG    . LEU F 2  38   ? 162.078 191.760 189.269 1.00 113.89 ?  37   LEU F CG    1 
ATOM   3970  C  CD1   . LEU F 2  38   ? 162.201 191.183 190.653 1.00 129.81 ?  37   LEU F CD1   1 
ATOM   3971  C  CD2   . LEU F 2  38   ? 162.305 190.614 188.305 1.00 122.92 ?  37   LEU F CD2   1 
ATOM   3972  N  N     . ALA F 2  39   ? 160.578 195.525 189.134 1.00 92.94  ?  38   ALA F N     1 
ATOM   3973  C  CA    . ALA F 2  39   ? 161.296 196.736 188.678 1.00 109.75 ?  38   ALA F CA    1 
ATOM   3974  C  C     . ALA F 2  39   ? 161.484 197.783 189.804 1.00 83.94  ?  38   ALA F C     1 
ATOM   3975  O  O     . ALA F 2  39   ? 162.510 198.393 190.070 1.00 57.96  ?  38   ALA F O     1 
ATOM   3976  C  CB    . ALA F 2  39   ? 160.512 197.412 187.572 1.00 153.22 ?  38   ALA F CB    1 
ATOM   3977  N  N     . ARG F 2  40   ? 160.404 197.985 190.544 1.00 138.17 ?  39   ARG F N     1 
ATOM   3978  C  CA    . ARG F 2  40   ? 160.372 198.923 191.631 1.00 152.89 ?  39   ARG F CA    1 
ATOM   3979  C  C     . ARG F 2  40   ? 161.319 198.396 192.737 1.00 138.07 ?  39   ARG F C     1 
ATOM   3980  O  O     . ARG F 2  40   ? 161.833 199.228 193.407 1.00 217.78 ?  39   ARG F O     1 
ATOM   3981  C  CB    . ARG F 2  40   ? 158.986 199.111 192.251 1.00 234.89 ?  39   ARG F CB    1 
ATOM   3982  C  CG    . ARG F 2  40   ? 157.902 199.609 191.335 1.00 208.60 ?  39   ARG F CG    1 
ATOM   3983  C  CD    . ARG F 2  40   ? 157.793 201.052 191.155 1.00 179.32 ?  39   ARG F CD    1 
ATOM   3984  N  NE    . ARG F 2  40   ? 156.370 201.311 190.885 1.00 252.53 ?  39   ARG F NE    1 
ATOM   3985  C  CZ    . ARG F 2  40   ? 155.817 201.384 189.674 1.00 331.41 ?  39   ARG F CZ    1 
ATOM   3986  N  NH1   . ARG F 2  40   ? 156.602 201.705 188.677 1.00 329.26 1  39   ARG F NH1   1 
ATOM   3987  N  NH2   . ARG F 2  40   ? 154.521 201.175 189.478 1.00 376.20 ?  39   ARG F NH2   1 
ATOM   3988  N  N     . ARG F 2  41   ? 161.416 197.110 193.142 1.00 72.22  ?  40   ARG F N     1 
ATOM   3989  C  CA    . ARG F 2  41   ? 162.283 196.672 194.213 1.00 49.36  ?  40   ARG F CA    1 
ATOM   3990  C  C     . ARG F 2  41   ? 163.598 197.402 193.932 1.00 50.79  ?  40   ARG F C     1 
ATOM   3991  O  O     . ARG F 2  41   ? 164.295 197.861 194.764 1.00 41.53  ?  40   ARG F O     1 
ATOM   3992  C  CB    . ARG F 2  41   ? 162.488 195.185 194.187 1.00 39.08  ?  40   ARG F CB    1 
ATOM   3993  C  CG    . ARG F 2  41   ? 163.427 194.680 195.253 1.00 43.81  ?  40   ARG F CG    1 
ATOM   3994  C  CD    . ARG F 2  41   ? 162.412 194.575 196.300 1.00 47.61  ?  40   ARG F CD    1 
ATOM   3995  N  NE    . ARG F 2  41   ? 161.577 193.354 196.193 1.00 47.47  ?  40   ARG F NE    1 
ATOM   3996  C  CZ    . ARG F 2  41   ? 161.855 192.100 196.751 1.00 42.01  ?  40   ARG F CZ    1 
ATOM   3997  N  NH1   . ARG F 2  41   ? 163.019 191.503 196.542 1.00 37.92  1  40   ARG F NH1   1 
ATOM   3998  N  NH2   . ARG F 2  41   ? 161.018 191.421 197.591 1.00 34.46  ?  40   ARG F NH2   1 
ATOM   3999  N  N     . GLY F 2  42   ? 163.863 197.569 192.652 1.00 76.63  ?  41   GLY F N     1 
ATOM   4000  C  CA    . GLY F 2  42   ? 165.082 198.399 192.349 1.00 100.24 ?  41   GLY F CA    1 
ATOM   4001  C  C     . GLY F 2  42   ? 164.834 199.867 192.485 1.00 80.72  ?  41   GLY F C     1 
ATOM   4002  O  O     . GLY F 2  42   ? 165.633 200.611 192.841 1.00 50.92  ?  41   GLY F O     1 
ATOM   4003  N  N     . GLY F 2  43   ? 163.621 200.223 192.191 1.00 96.17  ?  42   GLY F N     1 
ATOM   4004  C  CA    . GLY F 2  43   ? 163.227 201.504 192.654 1.00 130.51 ?  42   GLY F CA    1 
ATOM   4005  C  C     . GLY F 2  43   ? 163.329 202.579 191.625 1.00 122.25 ?  42   GLY F C     1 
ATOM   4006  O  O     . GLY F 2  43   ? 163.147 203.801 191.882 1.00 160.47 ?  42   GLY F O     1 
ATOM   4007  N  N     . VAL F 2  44   ? 163.476 202.206 190.387 1.00 96.38  ?  43   VAL F N     1 
ATOM   4008  C  CA    . VAL F 2  44   ? 163.299 203.193 189.344 1.00 124.80 ?  43   VAL F CA    1 
ATOM   4009  C  C     . VAL F 2  44   ? 161.853 203.712 189.291 1.00 136.97 ?  43   VAL F C     1 
ATOM   4010  O  O     . VAL F 2  44   ? 160.919 203.043 189.332 1.00 113.73 ?  43   VAL F O     1 
ATOM   4011  C  CB    . VAL F 2  44   ? 163.794 202.661 187.994 1.00 172.31 ?  43   VAL F CB    1 
ATOM   4012  C  CG1   . VAL F 2  44   ? 163.463 203.633 186.863 1.00 212.87 ?  43   VAL F CG1   1 
ATOM   4013  C  CG2   . VAL F 2  44   ? 165.286 202.423 188.130 1.00 243.27 ?  43   VAL F CG2   1 
ATOM   4014  N  N     . LYS F 2  45   ? 161.743 204.980 188.942 1.00 161.22 ?  44   LYS F N     1 
ATOM   4015  C  CA    . LYS F 2  45   ? 160.473 205.702 188.811 1.00 186.02 ?  44   LYS F CA    1 
ATOM   4016  C  C     . LYS F 2  45   ? 159.649 205.281 187.582 1.00 176.31 ?  44   LYS F C     1 
ATOM   4017  O  O     . LYS F 2  45   ? 158.453 205.263 187.653 1.00 91.26  ?  44   LYS F O     1 
ATOM   4018  C  CB    . LYS F 2  45   ? 160.870 207.176 188.803 1.00 234.95 ?  44   LYS F CB    1 
ATOM   4019  C  CG    . LYS F 2  45   ? 159.759 208.210 188.503 1.00 258.17 ?  44   LYS F CG    1 
ATOM   4020  C  CD    . LYS F 2  45   ? 158.716 208.377 189.568 1.00 227.87 ?  44   LYS F CD    1 
ATOM   4021  C  CE    . LYS F 2  45   ? 158.069 209.764 189.518 1.00 191.99 ?  44   LYS F CE    1 
ATOM   4022  N  NZ    . LYS F 2  45   ? 157.681 210.148 188.122 1.00 216.66 1  44   LYS F NZ    1 
ATOM   4023  N  N     . ARG F 2  46   ? 160.300 205.012 186.444 1.00 228.05 ?  45   ARG F N     1 
ATOM   4024  C  CA    . ARG F 2  46   ? 159.644 204.843 185.167 1.00 199.34 ?  45   ARG F CA    1 
ATOM   4025  C  C     . ARG F 2  46   ? 160.002 203.492 184.493 1.00 200.63 ?  45   ARG F C     1 
ATOM   4026  O  O     . ARG F 2  46   ? 161.155 203.090 184.419 1.00 243.12 ?  45   ARG F O     1 
ATOM   4027  C  CB    . ARG F 2  46   ? 160.071 206.037 184.294 1.00 158.41 ?  45   ARG F CB    1 
ATOM   4028  C  CG    . ARG F 2  46   ? 159.737 207.446 184.770 1.00 147.26 ?  45   ARG F CG    1 
ATOM   4029  C  CD    . ARG F 2  46   ? 158.421 207.821 184.133 1.00 181.98 ?  45   ARG F CD    1 
ATOM   4030  N  NE    . ARG F 2  46   ? 157.836 209.158 184.327 1.00 200.01 ?  45   ARG F NE    1 
ATOM   4031  C  CZ    . ARG F 2  46   ? 157.664 210.040 183.323 1.00 185.87 ?  45   ARG F CZ    1 
ATOM   4032  N  NH1   . ARG F 2  46   ? 158.521 210.013 182.312 1.00 150.10 1  45   ARG F NH1   1 
ATOM   4033  N  NH2   . ARG F 2  46   ? 156.693 210.963 183.332 1.00 169.91 ?  45   ARG F NH2   1 
ATOM   4034  N  N     . ILE F 2  47   ? 159.013 202.840 183.841 1.00 210.22 ?  46   ILE F N     1 
ATOM   4035  C  CA    . ILE F 2  47   ? 159.205 201.653 182.957 1.00 204.38 ?  46   ILE F CA    1 
ATOM   4036  C  C     . ILE F 2  47   ? 158.796 201.942 181.499 1.00 267.91 ?  46   ILE F C     1 
ATOM   4037  O  O     . ILE F 2  47   ? 157.650 202.255 181.167 1.00 329.24 ?  46   ILE F O     1 
ATOM   4038  C  CB    . ILE F 2  47   ? 158.468 200.396 183.511 1.00 146.09 ?  46   ILE F CB    1 
ATOM   4039  C  CG1   . ILE F 2  47   ? 159.108 199.807 184.768 1.00 105.02 ?  46   ILE F CG1   1 
ATOM   4040  C  CG2   . ILE F 2  47   ? 158.394 199.264 182.490 1.00 149.51 ?  46   ILE F CG2   1 
ATOM   4041  C  CD1   . ILE F 2  47   ? 158.536 200.294 186.055 1.00 117.73 ?  46   ILE F CD1   1 
ATOM   4042  N  N     . SER F 2  48   ? 159.753 201.785 180.574 1.00 259.17 ?  47   SER F N     1 
ATOM   4043  C  CA    . SER F 2  48   ? 159.491 201.875 179.121 1.00 186.03 ?  47   SER F CA    1 
ATOM   4044  C  C     . SER F 2  48   ? 158.761 200.604 178.647 1.00 186.81 ?  47   SER F C     1 
ATOM   4045  O  O     . SER F 2  48   ? 159.038 199.488 179.151 1.00 265.89 ?  47   SER F O     1 
ATOM   4046  C  CB    . SER F 2  48   ? 160.795 202.059 178.339 1.00 173.65 ?  47   SER F CB    1 
ATOM   4047  O  OG    . SER F 2  48   ? 160.639 201.744 177.001 1.00 137.99 ?  47   SER F OG    1 
ATOM   4048  N  N     . GLY F 2  49   ? 157.898 200.715 177.626 1.00 173.30 ?  48   GLY F N     1 
ATOM   4049  C  CA    . GLY F 2  49   ? 157.281 199.521 177.098 1.00 181.92 ?  48   GLY F CA    1 
ATOM   4050  C  C     . GLY F 2  49   ? 158.322 198.598 176.446 1.00 165.87 ?  48   GLY F C     1 
ATOM   4051  O  O     . GLY F 2  49   ? 158.258 197.324 176.608 1.00 113.52 ?  48   GLY F O     1 
ATOM   4052  N  N     . LEU F 2  50   ? 159.226 199.227 175.675 1.00 156.08 ?  49   LEU F N     1 
ATOM   4053  C  CA    . LEU F 2  50   ? 160.221 198.553 174.887 1.00 125.18 ?  49   LEU F CA    1 
ATOM   4054  C  C     . LEU F 2  50   ? 161.054 197.654 175.831 1.00 101.42 ?  49   LEU F C     1 
ATOM   4055  O  O     . LEU F 2  50   ? 161.535 196.537 175.564 1.00 88.77  ?  49   LEU F O     1 
ATOM   4056  C  CB    . LEU F 2  50   ? 161.158 199.615 174.288 1.00 137.50 ?  49   LEU F CB    1 
ATOM   4057  C  CG    . LEU F 2  50   ? 160.738 200.294 172.975 1.00 143.89 ?  49   LEU F CG    1 
ATOM   4058  C  CD1   . LEU F 2  50   ? 159.655 201.310 173.231 1.00 148.70 ?  49   LEU F CD1   1 
ATOM   4059  C  CD2   . LEU F 2  50   ? 161.871 200.973 172.197 1.00 127.96 ?  49   LEU F CD2   1 
ATOM   4060  N  N     . ILE F 2  51   ? 161.450 198.337 176.919 1.00 133.31 ?  50   ILE F N     1 
ATOM   4061  C  CA    . ILE F 2  51   ? 162.483 197.788 177.821 1.00 159.88 ?  50   ILE F CA    1 
ATOM   4062  C  C     . ILE F 2  51   ? 162.160 196.380 178.412 1.00 198.68 ?  50   ILE F C     1 
ATOM   4063  O  O     . ILE F 2  51   ? 162.993 195.486 178.606 1.00 203.34 ?  50   ILE F O     1 
ATOM   4064  C  CB    . ILE F 2  51   ? 162.825 198.851 178.882 1.00 163.17 ?  50   ILE F CB    1 
ATOM   4065  C  CG1   . ILE F 2  51   ? 164.092 198.423 179.595 1.00 107.31 ?  50   ILE F CG1   1 
ATOM   4066  C  CG2   . ILE F 2  51   ? 161.602 199.193 179.808 1.00 334.91 ?  50   ILE F CG2   1 
ATOM   4067  C  CD1   . ILE F 2  51   ? 164.518 199.430 180.613 1.00 78.70  ?  50   ILE F CD1   1 
ATOM   4068  N  N     . TYR F 2  52   ? 160.965 196.285 178.933 1.00 233.33 ?  51   TYR F N     1 
ATOM   4069  C  CA    . TYR F 2  52   ? 160.580 195.109 179.758 1.00 222.09 ?  51   TYR F CA    1 
ATOM   4070  C  C     . TYR F 2  52   ? 160.533 193.883 178.844 1.00 229.58 ?  51   TYR F C     1 
ATOM   4071  O  O     . TYR F 2  52   ? 161.013 192.827 179.147 1.00 276.58 ?  51   TYR F O     1 
ATOM   4072  C  CB    . TYR F 2  52   ? 159.294 195.333 180.566 1.00 178.11 ?  51   TYR F CB    1 
ATOM   4073  C  CG    . TYR F 2  52   ? 158.125 195.471 179.634 1.00 157.68 ?  51   TYR F CG    1 
ATOM   4074  C  CD1   . TYR F 2  52   ? 157.558 194.370 178.995 1.00 199.97 ?  51   TYR F CD1   1 
ATOM   4075  C  CD2   . TYR F 2  52   ? 157.681 196.732 179.270 1.00 161.23 ?  51   TYR F CD2   1 
ATOM   4076  C  CE1   . TYR F 2  52   ? 156.510 194.522 178.091 1.00 358.08 ?  51   TYR F CE1   1 
ATOM   4077  C  CE2   . TYR F 2  52   ? 156.617 196.902 178.391 1.00 297.35 ?  51   TYR F CE2   1 
ATOM   4078  C  CZ    . TYR F 2  52   ? 156.024 195.795 177.812 1.00 440.00 ?  51   TYR F CZ    1 
ATOM   4079  O  OH    . TYR F 2  52   ? 154.995 195.972 176.912 1.00 440.00 ?  51   TYR F OH    1 
ATOM   4080  N  N     . GLU F 2  53   ? 160.093 194.058 177.607 1.00 195.60 ?  52   GLU F N     1 
ATOM   4081  C  CA    . GLU F 2  53   ? 160.187 193.027 176.590 1.00 199.91 ?  52   GLU F CA    1 
ATOM   4082  C  C     . GLU F 2  53   ? 161.636 192.519 176.450 1.00 230.17 ?  52   GLU F C     1 
ATOM   4083  O  O     . GLU F 2  53   ? 161.735 191.267 176.333 1.00 277.24 ?  52   GLU F O     1 
ATOM   4084  C  CB    . GLU F 2  53   ? 159.618 193.552 175.249 1.00 207.01 ?  52   GLU F CB    1 
ATOM   4085  C  CG    . GLU F 2  53   ? 159.626 192.574 174.060 1.00 233.42 ?  52   GLU F CG    1 
ATOM   4086  C  CD    . GLU F 2  53   ? 160.234 192.935 172.672 1.00 227.60 ?  52   GLU F CD    1 
ATOM   4087  O  OE1   . GLU F 2  53   ? 160.466 194.153 172.358 1.00 167.01 ?  52   GLU F OE1   1 
ATOM   4088  O  OE2   . GLU F 2  53   ? 160.597 191.931 171.936 1.00 113.66 -1 52   GLU F OE2   1 
ATOM   4089  N  N     . GLU F 2  54   ? 162.654 193.386 176.331 1.00 195.32 ?  53   GLU F N     1 
ATOM   4090  C  CA    . GLU F 2  54   ? 164.065 193.001 176.242 1.00 144.29 ?  53   GLU F CA    1 
ATOM   4091  C  C     . GLU F 2  54   ? 164.462 192.159 177.482 1.00 135.92 ?  53   GLU F C     1 
ATOM   4092  O  O     . GLU F 2  54   ? 165.127 191.093 177.433 1.00 117.60 ?  53   GLU F O     1 
ATOM   4093  C  CB    . GLU F 2  54   ? 164.972 194.229 176.206 1.00 109.13 ?  53   GLU F CB    1 
ATOM   4094  C  CG    . GLU F 2  54   ? 165.147 195.054 174.919 1.00 103.14 ?  53   GLU F CG    1 
ATOM   4095  C  CD    . GLU F 2  54   ? 165.929 196.353 175.212 1.00 84.86  ?  53   GLU F CD    1 
ATOM   4096  O  OE1   . GLU F 2  54   ? 166.172 196.568 176.376 1.00 68.62  ?  53   GLU F OE1   1 
ATOM   4097  O  OE2   . GLU F 2  54   ? 166.473 197.126 174.320 1.00 111.58 -1 53   GLU F OE2   1 
ATOM   4098  N  N     . THR F 2  55   ? 164.007 192.647 178.636 1.00 178.59 ?  54   THR F N     1 
ATOM   4099  C  CA    . THR F 2  55   ? 164.426 192.098 179.919 1.00 232.86 ?  54   THR F CA    1 
ATOM   4100  C  C     . THR F 2  55   ? 164.088 190.594 180.011 1.00 172.60 ?  54   THR F C     1 
ATOM   4101  O  O     . THR F 2  55   ? 164.776 189.768 180.516 1.00 136.26 ?  54   THR F O     1 
ATOM   4102  C  CB    . THR F 2  55   ? 163.761 192.887 181.057 1.00 338.13 ?  54   THR F CB    1 
ATOM   4103  O  OG1   . THR F 2  55   ? 162.343 192.760 180.969 1.00 390.37 ?  54   THR F OG1   1 
ATOM   4104  C  CG2   . THR F 2  55   ? 164.148 194.351 181.099 1.00 437.09 ?  54   THR F CG2   1 
ATOM   4105  N  N     . ARG F 2  56   ? 162.911 190.243 179.515 1.00 154.29 ?  55   ARG F N     1 
ATOM   4106  C  CA    . ARG F 2  56   ? 162.484 188.842 179.545 1.00 162.53 ?  55   ARG F CA    1 
ATOM   4107  C  C     . ARG F 2  56   ? 163.427 188.125 178.594 1.00 146.81 ?  55   ARG F C     1 
ATOM   4108  O  O     . ARG F 2  56   ? 163.809 186.978 178.809 1.00 121.33 ?  55   ARG F O     1 
ATOM   4109  C  CB    . ARG F 2  56   ? 160.986 188.718 179.254 1.00 213.27 ?  55   ARG F CB    1 
ATOM   4110  C  CG    . ARG F 2  56   ? 160.245 189.070 180.544 1.00 325.81 ?  55   ARG F CG    1 
ATOM   4111  C  CD    . ARG F 2  56   ? 158.807 188.777 180.790 1.00 369.16 ?  55   ARG F CD    1 
ATOM   4112  N  NE    . ARG F 2  56   ? 158.859 187.339 180.961 1.00 387.87 ?  55   ARG F NE    1 
ATOM   4113  C  CZ    . ARG F 2  56   ? 158.891 186.659 182.110 1.00 317.25 ?  55   ARG F CZ    1 
ATOM   4114  N  NH1   . ARG F 2  56   ? 158.831 187.259 183.293 1.00 176.30 1  55   ARG F NH1   1 
ATOM   4115  N  NH2   . ARG F 2  56   ? 158.881 185.333 182.030 1.00 336.81 ?  55   ARG F NH2   1 
ATOM   4116  N  N     . GLY F 2  57   ? 163.743 188.855 177.510 1.00 175.14 ?  56   GLY F N     1 
ATOM   4117  C  CA    . GLY F 2  57   ? 164.649 188.382 176.460 1.00 185.33 ?  56   GLY F CA    1 
ATOM   4118  C  C     . GLY F 2  57   ? 165.910 187.809 177.070 1.00 128.93 ?  56   GLY F C     1 
ATOM   4119  O  O     . GLY F 2  57   ? 166.348 186.689 176.749 1.00 135.74 ?  56   GLY F O     1 
ATOM   4120  N  N     . VAL F 2  58   ? 166.544 188.605 177.944 1.00 107.48 ?  57   VAL F N     1 
ATOM   4121  C  CA    . VAL F 2  58   ? 167.732 188.223 178.591 1.00 124.03 ?  57   VAL F CA    1 
ATOM   4122  C  C     . VAL F 2  58   ? 167.453 187.066 179.557 1.00 101.00 ?  57   VAL F C     1 
ATOM   4123  O  O     . VAL F 2  58   ? 168.308 186.120 179.643 1.00 130.30 ?  57   VAL F O     1 
ATOM   4124  C  CB    . VAL F 2  58   ? 168.431 189.432 179.250 1.00 155.21 ?  57   VAL F CB    1 
ATOM   4125  C  CG1   . VAL F 2  58   ? 169.625 188.940 180.078 1.00 184.33 ?  57   VAL F CG1   1 
ATOM   4126  C  CG2   . VAL F 2  58   ? 168.892 190.459 178.225 1.00 153.91 ?  57   VAL F CG2   1 
ATOM   4127  N  N     . LEU F 2  59   ? 166.348 187.173 180.326 1.00 78.08  ?  58   LEU F N     1 
ATOM   4128  C  CA    . LEU F 2  59   ? 165.988 186.119 181.242 1.00 88.40  ?  58   LEU F CA    1 
ATOM   4129  C  C     . LEU F 2  59   ? 166.088 184.778 180.514 1.00 96.63  ?  58   LEU F C     1 
ATOM   4130  O  O     . LEU F 2  59   ? 166.586 183.775 181.052 1.00 66.72  ?  58   LEU F O     1 
ATOM   4131  C  CB    . LEU F 2  59   ? 164.570 186.284 181.781 1.00 83.76  ?  58   LEU F CB    1 
ATOM   4132  C  CG    . LEU F 2  59   ? 163.874 185.099 182.539 1.00 85.61  ?  58   LEU F CG    1 
ATOM   4133  C  CD1   . LEU F 2  59   ? 164.499 184.428 183.768 1.00 79.34  ?  58   LEU F CD1   1 
ATOM   4134  C  CD2   . LEU F 2  59   ? 162.584 185.532 183.122 1.00 96.22  ?  58   LEU F CD2   1 
ATOM   4135  N  N     . LYS F 2  60   ? 165.629 184.803 179.260 1.00 149.83 ?  59   LYS F N     1 
ATOM   4136  C  CA    . LYS F 2  60   ? 165.584 183.586 178.486 1.00 207.98 ?  59   LYS F CA    1 
ATOM   4137  C  C     . LYS F 2  60   ? 167.020 183.069 178.291 1.00 165.71 ?  59   LYS F C     1 
ATOM   4138  O  O     . LYS F 2  60   ? 167.285 181.912 178.326 1.00 110.49 ?  59   LYS F O     1 
ATOM   4139  C  CB    . LYS F 2  60   ? 164.848 183.787 177.157 1.00 300.70 ?  59   LYS F CB    1 
ATOM   4140  C  CG    . LYS F 2  60   ? 164.642 182.443 176.411 1.00 331.82 ?  59   LYS F CG    1 
ATOM   4141  C  CD    . LYS F 2  60   ? 163.838 181.331 177.187 1.00 269.35 ?  59   LYS F CD    1 
ATOM   4142  C  CE    . LYS F 2  60   ? 164.069 179.893 176.726 1.00 181.61 ?  59   LYS F CE    1 
ATOM   4143  N  NZ    . LYS F 2  60   ? 163.242 179.522 175.553 1.00 140.85 1  59   LYS F NZ    1 
ATOM   4144  N  N     . VAL F 2  61   ? 167.927 183.989 178.004 1.00 161.38 ?  60   VAL F N     1 
ATOM   4145  C  CA    . VAL F 2  61   ? 169.340 183.701 177.718 1.00 139.69 ?  60   VAL F CA    1 
ATOM   4146  C  C     . VAL F 2  61   ? 170.011 183.145 178.959 1.00 116.40 ?  60   VAL F C     1 
ATOM   4147  O  O     . VAL F 2  61   ? 170.735 182.138 178.861 1.00 101.71 ?  60   VAL F O     1 
ATOM   4148  C  CB    . VAL F 2  61   ? 170.128 184.936 177.246 1.00 147.78 ?  60   VAL F CB    1 
ATOM   4149  C  CG1   . VAL F 2  61   ? 171.599 184.573 177.143 1.00 167.65 ?  60   VAL F CG1   1 
ATOM   4150  C  CG2   . VAL F 2  61   ? 169.552 185.452 175.945 1.00 135.25 ?  60   VAL F CG2   1 
ATOM   4151  N  N     . PHE F 2  62   ? 169.688 183.754 180.124 1.00 130.64 ?  61   PHE F N     1 
ATOM   4152  C  CA    . PHE F 2  62   ? 170.298 183.275 181.335 1.00 167.55 ?  61   PHE F CA    1 
ATOM   4153  C  C     . PHE F 2  62   ? 169.775 181.869 181.618 1.00 151.27 ?  61   PHE F C     1 
ATOM   4154  O  O     . PHE F 2  62   ? 170.489 181.025 182.071 1.00 192.08 ?  61   PHE F O     1 
ATOM   4155  C  CB    . PHE F 2  62   ? 169.979 184.196 182.512 1.00 206.11 ?  61   PHE F CB    1 
ATOM   4156  C  CG    . PHE F 2  62   ? 170.317 183.652 183.870 1.00 270.05 ?  61   PHE F CG    1 
ATOM   4157  C  CD1   . PHE F 2  62   ? 171.576 183.814 184.403 1.00 329.79 ?  61   PHE F CD1   1 
ATOM   4158  C  CD2   . PHE F 2  62   ? 169.387 182.990 184.661 1.00 276.58 ?  61   PHE F CD2   1 
ATOM   4159  C  CE1   . PHE F 2  62   ? 171.875 183.346 185.680 1.00 264.72 ?  61   PHE F CE1   1 
ATOM   4160  C  CE2   . PHE F 2  62   ? 169.703 182.479 185.913 1.00 190.11 ?  61   PHE F CE2   1 
ATOM   4161  C  CZ    . PHE F 2  62   ? 170.946 182.673 186.449 1.00 176.71 ?  61   PHE F CZ    1 
ATOM   4162  N  N     . LEU F 2  63   ? 168.486 181.609 181.395 1.00 103.91 ?  62   LEU F N     1 
ATOM   4163  C  CA    . LEU F 2  63   ? 167.780 180.472 181.876 1.00 109.95 ?  62   LEU F CA    1 
ATOM   4164  C  C     . LEU F 2  63   ? 168.235 179.203 181.184 1.00 106.45 ?  62   LEU F C     1 
ATOM   4165  O  O     . LEU F 2  63   ? 168.381 178.141 181.826 1.00 88.91  ?  62   LEU F O     1 
ATOM   4166  C  CB    . LEU F 2  63   ? 166.277 180.719 181.760 1.00 104.56 ?  62   LEU F CB    1 
ATOM   4167  C  CG    . LEU F 2  63   ? 165.433 179.665 182.417 1.00 122.04 ?  62   LEU F CG    1 
ATOM   4168  C  CD1   . LEU F 2  63   ? 165.930 179.140 183.785 1.00 117.67 ?  62   LEU F CD1   1 
ATOM   4169  C  CD2   . LEU F 2  63   ? 164.078 180.324 182.599 1.00 110.06 ?  62   LEU F CD2   1 
ATOM   4170  N  N     . GLU F 2  64   ? 168.419 179.305 179.893 1.00 120.10 ?  63   GLU F N     1 
ATOM   4171  C  CA    . GLU F 2  64   ? 168.892 178.159 179.091 1.00 150.52 ?  63   GLU F CA    1 
ATOM   4172  C  C     . GLU F 2  64   ? 170.213 177.514 179.566 1.00 123.86 ?  63   GLU F C     1 
ATOM   4173  O  O     . GLU F 2  64   ? 170.326 176.261 179.733 1.00 100.23 ?  63   GLU F O     1 
ATOM   4174  C  CB    . GLU F 2  64   ? 168.981 178.553 177.618 1.00 222.40 ?  63   GLU F CB    1 
ATOM   4175  C  CG    . GLU F 2  64   ? 169.901 179.736 177.227 1.00 233.98 ?  63   GLU F CG    1 
ATOM   4176  C  CD    . GLU F 2  64   ? 170.044 180.005 175.729 1.00 259.48 ?  63   GLU F CD    1 
ATOM   4177  O  OE1   . GLU F 2  64   ? 170.456 179.077 175.045 1.00 264.17 ?  63   GLU F OE1   1 
ATOM   4178  O  OE2   . GLU F 2  64   ? 169.788 181.182 175.229 1.00 440.00 -1 63   GLU F OE2   1 
ATOM   4179  N  N     . ASN F 2  65   ? 171.233 178.354 179.697 1.00 122.80 ?  64   ASN F N     1 
ATOM   4180  C  CA    . ASN F 2  65   ? 172.583 177.881 179.987 1.00 119.42 ?  64   ASN F CA    1 
ATOM   4181  C  C     . ASN F 2  65   ? 172.599 176.998 181.249 1.00 94.67  ?  64   ASN F C     1 
ATOM   4182  O  O     . ASN F 2  65   ? 173.246 175.961 181.291 1.00 71.26  ?  64   ASN F O     1 
ATOM   4183  C  CB    . ASN F 2  65   ? 173.574 179.036 180.111 1.00 133.40 ?  64   ASN F CB    1 
ATOM   4184  C  CG    . ASN F 2  65   ? 173.150 180.076 181.083 1.00 120.62 ?  64   ASN F CG    1 
ATOM   4185  O  OD1   . ASN F 2  65   ? 172.645 179.726 182.143 1.00 117.42 ?  64   ASN F OD1   1 
ATOM   4186  N  ND2   . ASN F 2  65   ? 173.396 181.317 180.714 1.00 105.64 ?  64   ASN F ND2   1 
ATOM   4187  N  N     . VAL F 2  66   ? 171.864 177.433 182.261 1.00 104.87 ?  65   VAL F N     1 
ATOM   4188  C  CA    . VAL F 2  66   ? 171.748 176.728 183.508 1.00 131.84 ?  65   VAL F CA    1 
ATOM   4189  C  C     . VAL F 2  66   ? 171.130 175.363 183.311 1.00 84.81  ?  65   VAL F C     1 
ATOM   4190  O  O     . VAL F 2  66   ? 171.512 174.382 183.917 1.00 67.93  ?  65   VAL F O     1 
ATOM   4191  C  CB    . VAL F 2  66   ? 170.831 177.481 184.489 1.00 237.61 ?  65   VAL F CB    1 
ATOM   4192  C  CG1   . VAL F 2  66   ? 170.589 176.658 185.762 1.00 253.94 ?  65   VAL F CG1   1 
ATOM   4193  C  CG2   . VAL F 2  66   ? 171.444 178.819 184.868 1.00 374.91 ?  65   VAL F CG2   1 
ATOM   4194  N  N     . ILE F 2  67   ? 169.981 175.400 182.652 1.00 94.45  ?  66   ILE F N     1 
ATOM   4195  C  CA    . ILE F 2  67   ? 169.281 174.198 182.459 1.00 136.28 ?  66   ILE F CA    1 
ATOM   4196  C  C     . ILE F 2  67   ? 170.180 173.293 181.607 1.00 139.62 ?  66   ILE F C     1 
ATOM   4197  O  O     . ILE F 2  67   ? 170.182 172.063 181.866 1.00 155.72 ?  66   ILE F O     1 
ATOM   4198  C  CB    . ILE F 2  67   ? 167.880 174.360 181.912 1.00 159.46 ?  66   ILE F CB    1 
ATOM   4199  C  CG1   . ILE F 2  67   ? 167.165 175.507 182.615 1.00 172.99 ?  66   ILE F CG1   1 
ATOM   4200  C  CG2   . ILE F 2  67   ? 167.231 172.998 182.133 1.00 165.87 ?  66   ILE F CG2   1 
ATOM   4201  C  CD1   . ILE F 2  67   ? 166.672 175.104 183.974 1.00 220.48 ?  66   ILE F CD1   1 
ATOM   4202  N  N     . ARG F 2  68   ? 170.937 173.901 180.705 1.00 121.70 ?  67   ARG F N     1 
ATOM   4203  C  CA    . ARG F 2  68   ? 171.835 173.147 179.836 1.00 116.06 ?  67   ARG F CA    1 
ATOM   4204  C  C     . ARG F 2  68   ? 172.680 172.189 180.670 1.00 87.60  ?  67   ARG F C     1 
ATOM   4205  O  O     . ARG F 2  68   ? 172.766 170.996 180.365 1.00 67.76  ?  67   ARG F O     1 
ATOM   4206  C  CB    . ARG F 2  68   ? 172.748 174.096 179.040 1.00 134.20 ?  67   ARG F CB    1 
ATOM   4207  C  CG    . ARG F 2  68   ? 173.734 173.351 178.142 1.00 153.65 ?  67   ARG F CG    1 
ATOM   4208  C  CD    . ARG F 2  68   ? 174.614 174.318 177.399 1.00 194.09 ?  67   ARG F CD    1 
ATOM   4209  N  NE    . ARG F 2  68   ? 173.957 174.777 176.171 1.00 207.61 ?  67   ARG F NE    1 
ATOM   4210  C  CZ    . ARG F 2  68   ? 173.661 176.043 175.869 1.00 183.55 ?  67   ARG F CZ    1 
ATOM   4211  N  NH1   . ARG F 2  68   ? 173.645 176.959 176.798 1.00 181.17 1  67   ARG F NH1   1 
ATOM   4212  N  NH2   . ARG F 2  68   ? 173.473 176.436 174.609 1.00 159.82 ?  67   ARG F NH2   1 
ATOM   4213  N  N     . ASP F 2  69   ? 173.300 172.828 181.669 1.00 96.31  ?  68   ASP F N     1 
ATOM   4214  C  CA    . ASP F 2  69   ? 174.187 172.135 182.595 1.00 113.98 ?  68   ASP F CA    1 
ATOM   4215  C  C     . ASP F 2  69   ? 173.368 171.166 183.452 1.00 95.79  ?  68   ASP F C     1 
ATOM   4216  O  O     . ASP F 2  69   ? 173.835 170.079 183.751 1.00 62.83  ?  68   ASP F O     1 
ATOM   4217  C  CB    . ASP F 2  69   ? 174.972 173.193 183.407 1.00 176.19 ?  68   ASP F CB    1 
ATOM   4218  C  CG    . ASP F 2  69   ? 176.070 173.892 182.632 1.00 179.18 ?  68   ASP F CG    1 
ATOM   4219  O  OD1   . ASP F 2  69   ? 176.316 173.556 181.470 1.00 202.21 ?  68   ASP F OD1   1 
ATOM   4220  O  OD2   . ASP F 2  69   ? 176.692 174.772 183.192 1.00 362.57 -1 68   ASP F OD2   1 
ATOM   4221  N  N     . ALA F 2  70   ? 172.214 171.632 183.926 1.00 108.25 ?  69   ALA F N     1 
ATOM   4222  C  CA    . ALA F 2  70   ? 171.362 170.904 184.875 1.00 105.71 ?  69   ALA F CA    1 
ATOM   4223  C  C     . ALA F 2  70   ? 171.080 169.525 184.298 1.00 83.98  ?  69   ALA F C     1 
ATOM   4224  O  O     . ALA F 2  70   ? 171.145 168.437 184.927 1.00 57.20  ?  69   ALA F O     1 
ATOM   4225  C  CB    . ALA F 2  70   ? 170.032 171.567 185.166 1.00 101.02 ?  69   ALA F CB    1 
ATOM   4226  N  N     . VAL F 2  71   ? 170.682 169.682 183.033 1.00 109.57 ?  70   VAL F N     1 
ATOM   4227  C  CA    . VAL F 2  71   ? 170.262 168.584 182.283 1.00 150.15 ?  70   VAL F CA    1 
ATOM   4228  C  C     . VAL F 2  71   ? 171.485 167.653 182.239 1.00 109.32 ?  70   VAL F C     1 
ATOM   4229  O  O     . VAL F 2  71   ? 171.424 166.425 182.305 1.00 78.01  ?  70   VAL F O     1 
ATOM   4230  C  CB    . VAL F 2  71   ? 169.831 169.035 180.873 1.00 234.40 ?  70   VAL F CB    1 
ATOM   4231  C  CG1   . VAL F 2  71   ? 169.460 167.867 179.957 1.00 320.54 ?  70   VAL F CG1   1 
ATOM   4232  C  CG2   . VAL F 2  71   ? 168.719 170.061 180.980 1.00 253.39 ?  70   VAL F CG2   1 
ATOM   4233  N  N     . THR F 2  72   ? 172.650 168.246 182.039 1.00 91.25  ?  71   THR F N     1 
ATOM   4234  C  CA    . THR F 2  72   ? 173.838 167.425 181.840 1.00 80.24  ?  71   THR F CA    1 
ATOM   4235  C  C     . THR F 2  72   ? 174.103 166.618 183.066 1.00 70.20  ?  71   THR F C     1 
ATOM   4236  O  O     . THR F 2  72   ? 174.547 165.490 182.979 1.00 52.37  ?  71   THR F O     1 
ATOM   4237  C  CB    . THR F 2  72   ? 175.022 168.319 181.459 1.00 98.55  ?  71   THR F CB    1 
ATOM   4238  O  OG1   . THR F 2  72   ? 174.720 169.127 180.324 1.00 72.44  ?  71   THR F OG1   1 
ATOM   4239  C  CG2   . THR F 2  72   ? 176.243 167.496 181.117 1.00 169.76 ?  71   THR F CG2   1 
ATOM   4240  N  N     . TYR F 2  73   ? 174.035 167.202 184.259 1.00 88.88  ?  72   TYR F N     1 
ATOM   4241  C  CA    . TYR F 2  73   ? 174.293 166.475 185.525 1.00 116.65 ?  72   TYR F CA    1 
ATOM   4242  C  C     . TYR F 2  73   ? 173.186 165.460 185.852 1.00 93.26  ?  72   TYR F C     1 
ATOM   4243  O  O     . TYR F 2  73   ? 173.462 164.339 186.366 1.00 88.13  ?  72   TYR F O     1 
ATOM   4244  C  CB    . TYR F 2  73   ? 174.499 167.467 186.706 1.00 146.72 ?  72   TYR F CB    1 
ATOM   4245  C  CG    . TYR F 2  73   ? 175.764 168.313 186.554 1.00 159.99 ?  72   TYR F CG    1 
ATOM   4246  C  CD1   . TYR F 2  73   ? 177.042 167.759 186.554 1.00 155.56 ?  72   TYR F CD1   1 
ATOM   4247  C  CD2   . TYR F 2  73   ? 175.692 169.703 186.408 1.00 186.37 ?  72   TYR F CD2   1 
ATOM   4248  C  CE1   . TYR F 2  73   ? 178.185 168.537 186.356 1.00 149.00 ?  72   TYR F CE1   1 
ATOM   4249  C  CE2   . TYR F 2  73   ? 176.827 170.480 186.198 1.00 147.91 ?  72   TYR F CE2   1 
ATOM   4250  C  CZ    . TYR F 2  73   ? 178.080 169.912 186.180 1.00 131.21 ?  72   TYR F CZ    1 
ATOM   4251  O  OH    . TYR F 2  73   ? 179.130 170.744 185.951 1.00 106.06 ?  72   TYR F OH    1 
ATOM   4252  N  N     . THR F 2  74   ? 171.956 165.786 185.552 1.00 79.17  ?  73   THR F N     1 
ATOM   4253  C  CA    . THR F 2  74   ? 170.930 164.815 185.691 1.00 93.07  ?  73   THR F CA    1 
ATOM   4254  C  C     . THR F 2  74   ? 171.332 163.568 184.884 1.00 81.74  ?  73   THR F C     1 
ATOM   4255  O  O     . THR F 2  74   ? 171.024 162.455 185.230 1.00 64.17  ?  73   THR F O     1 
ATOM   4256  C  CB    . THR F 2  74   ? 169.620 165.459 185.215 1.00 135.08 ?  73   THR F CB    1 
ATOM   4257  O  OG1   . THR F 2  74   ? 169.346 166.582 186.040 1.00 232.66 ?  73   THR F OG1   1 
ATOM   4258  C  CG2   . THR F 2  74   ? 168.441 164.537 185.371 1.00 118.90 ?  73   THR F CG2   1 
ATOM   4259  N  N     . GLU F 2  75   ? 171.882 163.783 183.680 1.00 92.69  ?  74   GLU F N     1 
ATOM   4260  C  CA    . GLU F 2  75   ? 172.095 162.772 182.685 1.00 133.52 ?  74   GLU F CA    1 
ATOM   4261  C  C     . GLU F 2  75   ? 173.433 162.081 182.809 1.00 106.76 ?  74   GLU F C     1 
ATOM   4262  O  O     . GLU F 2  75   ? 173.541 161.017 182.253 1.00 142.57 ?  74   GLU F O     1 
ATOM   4263  C  CB    . GLU F 2  75   ? 171.923 163.340 181.277 1.00 230.09 ?  74   GLU F CB    1 
ATOM   4264  C  CG    . GLU F 2  75   ? 172.071 162.366 180.133 1.00 349.14 ?  74   GLU F CG    1 
ATOM   4265  C  CD    . GLU F 2  75   ? 173.452 162.200 179.525 1.00 368.25 ?  74   GLU F CD    1 
ATOM   4266  O  OE1   . GLU F 2  75   ? 174.358 163.022 179.798 1.00 307.35 ?  74   GLU F OE1   1 
ATOM   4267  O  OE2   . GLU F 2  75   ? 173.603 161.213 178.788 1.00 431.73 -1 74   GLU F OE2   1 
ATOM   4268  N  N     . HIS F 2  76   ? 174.448 162.623 183.443 1.00 102.93 ?  75   HIS F N     1 
ATOM   4269  C  CA    . HIS F 2  76   ? 175.701 161.946 183.605 1.00 160.89 ?  75   HIS F CA    1 
ATOM   4270  C  C     . HIS F 2  76   ? 175.587 160.823 184.643 1.00 189.19 ?  75   HIS F C     1 
ATOM   4271  O  O     . HIS F 2  76   ? 176.501 159.991 184.819 1.00 250.75 ?  75   HIS F O     1 
ATOM   4272  C  CB    . HIS F 2  76   ? 176.798 162.935 184.016 1.00 167.58 ?  75   HIS F CB    1 
ATOM   4273  C  CG    . HIS F 2  76   ? 178.166 162.318 184.164 1.00 181.92 ?  75   HIS F CG    1 
ATOM   4274  N  ND1   . HIS F 2  76   ? 179.156 162.511 183.211 1.00 168.88 ?  75   HIS F ND1   1 
ATOM   4275  C  CD2   . HIS F 2  76   ? 178.701 161.507 185.116 1.00 197.83 ?  75   HIS F CD2   1 
ATOM   4276  C  CE1   . HIS F 2  76   ? 180.226 161.845 183.566 1.00 190.66 ?  75   HIS F CE1   1 
ATOM   4277  N  NE2   . HIS F 2  76   ? 179.976 161.227 184.740 1.00 189.61 ?  75   HIS F NE2   1 
ATOM   4278  N  N     . ALA F 2  77   ? 174.475 160.820 185.344 1.00 150.33 ?  76   ALA F N     1 
ATOM   4279  C  CA    . ALA F 2  77   ? 174.230 159.903 186.449 1.00 164.33 ?  76   ALA F CA    1 
ATOM   4280  C  C     . ALA F 2  77   ? 173.130 158.915 186.073 1.00 134.56 ?  76   ALA F C     1 
ATOM   4281  O  O     . ALA F 2  77   ? 172.853 158.038 186.909 1.00 135.49 ?  76   ALA F O     1 
ATOM   4282  C  CB    . ALA F 2  77   ? 173.834 160.735 187.645 1.00 252.02 ?  76   ALA F CB    1 
ATOM   4283  N  N     . LYS F 2  78   ? 172.545 159.048 184.882 1.00 120.47 ?  77   LYS F N     1 
ATOM   4284  C  CA    . LYS F 2  78   ? 171.457 158.279 184.432 1.00 161.88 ?  77   LYS F CA    1 
ATOM   4285  C  C     . LYS F 2  78   ? 170.279 158.388 185.401 1.00 257.37 ?  77   LYS F C     1 
ATOM   4286  O  O     . LYS F 2  78   ? 169.751 157.360 185.900 1.00 253.29 ?  77   LYS F O     1 
ATOM   4287  C  CB    . LYS F 2  78   ? 171.925 156.829 184.239 1.00 155.24 ?  77   LYS F CB    1 
ATOM   4288  C  CG    . LYS F 2  78   ? 172.418 156.094 185.482 1.00 168.53 ?  77   LYS F CG    1 
ATOM   4289  C  CD    . LYS F 2  78   ? 172.421 154.612 185.298 1.00 236.94 ?  77   LYS F CD    1 
ATOM   4290  C  CE    . LYS F 2  78   ? 173.367 154.163 184.189 1.00 282.56 ?  77   LYS F CE    1 
ATOM   4291  N  NZ    . LYS F 2  78   ? 173.671 152.694 184.188 1.00 263.93 1  77   LYS F NZ    1 
ATOM   4292  N  N     . ARG F 2  79   ? 169.846 159.619 185.616 1.00 360.44 ?  78   ARG F N     1 
ATOM   4293  C  CA    . ARG F 2  79   ? 168.688 159.882 186.480 1.00 440.00 ?  78   ARG F CA    1 
ATOM   4294  C  C     . ARG F 2  79   ? 167.571 160.612 185.702 1.00 430.77 ?  78   ARG F C     1 
ATOM   4295  O  O     . ARG F 2  79   ? 167.819 161.542 184.825 1.00 440.00 ?  78   ARG F O     1 
ATOM   4296  C  CB    . ARG F 2  79   ? 169.117 160.759 187.668 1.00 440.00 ?  78   ARG F CB    1 
ATOM   4297  C  CG    . ARG F 2  79   ? 169.881 160.171 188.828 1.00 440.00 ?  78   ARG F CG    1 
ATOM   4298  C  CD    . ARG F 2  79   ? 170.191 161.333 189.812 1.00 349.27 ?  78   ARG F CD    1 
ATOM   4299  N  NE    . ARG F 2  79   ? 169.132 161.732 190.747 1.00 272.97 ?  78   ARG F NE    1 
ATOM   4300  C  CZ    . ARG F 2  79   ? 168.889 161.134 191.907 1.00 236.59 ?  78   ARG F CZ    1 
ATOM   4301  N  NH1   . ARG F 2  79   ? 169.713 160.187 192.302 1.00 234.72 1  78   ARG F NH1   1 
ATOM   4302  N  NH2   . ARG F 2  79   ? 167.847 161.473 192.664 1.00 149.39 ?  78   ARG F NH2   1 
ATOM   4303  N  N     . LYS F 2  80   ? 166.328 160.219 185.999 1.00 297.07 ?  79   LYS F N     1 
ATOM   4304  C  CA    . LYS F 2  80   ? 165.132 160.818 185.349 1.00 217.68 ?  79   LYS F CA    1 
ATOM   4305  C  C     . LYS F 2  80   ? 164.689 162.050 186.147 1.00 156.77 ?  79   LYS F C     1 
ATOM   4306  O  O     . LYS F 2  80   ? 164.261 163.039 185.520 1.00 142.37 ?  79   LYS F O     1 
ATOM   4307  C  CB    . LYS F 2  80   ? 164.003 159.787 185.256 1.00 217.58 ?  79   LYS F CB    1 
ATOM   4308  C  CG    . LYS F 2  80   ? 164.245 158.640 184.282 1.00 302.65 ?  79   LYS F CG    1 
ATOM   4309  C  CD    . LYS F 2  80   ? 163.767 158.936 182.876 1.00 366.14 ?  79   LYS F CD    1 
ATOM   4310  C  CE    . LYS F 2  80   ? 163.189 157.723 182.178 1.00 322.57 ?  79   LYS F CE    1 
ATOM   4311  N  NZ    . LYS F 2  80   ? 162.057 158.087 181.294 1.00 217.44 1  79   LYS F NZ    1 
ATOM   4312  N  N     . THR F 2  81   ? 164.791 161.980 187.478 1.00 112.26 ?  80   THR F N     1 
ATOM   4313  C  CA    . THR F 2  81   ? 164.397 163.110 188.363 1.00 123.09 ?  80   THR F CA    1 
ATOM   4314  C  C     . THR F 2  81   ? 165.547 164.121 188.440 1.00 110.84 ?  80   THR F C     1 
ATOM   4315  O  O     . THR F 2  81   ? 166.653 163.725 188.861 1.00 179.60 ?  80   THR F O     1 
ATOM   4316  C  CB    . THR F 2  81   ? 163.998 162.608 189.756 1.00 149.90 ?  80   THR F CB    1 
ATOM   4317  O  OG1   . THR F 2  81   ? 165.163 162.074 190.385 1.00 142.54 ?  80   THR F OG1   1 
ATOM   4318  C  CG2   . THR F 2  81   ? 162.911 161.556 189.715 1.00 170.67 ?  80   THR F CG2   1 
ATOM   4319  N  N     . VAL F 2  82   ? 165.286 165.372 188.048 1.00 94.48  ?  81   VAL F N     1 
ATOM   4320  C  CA    . VAL F 2  82   ? 166.325 166.444 188.076 1.00 133.73 ?  81   VAL F CA    1 
ATOM   4321  C  C     . VAL F 2  82   ? 166.451 166.977 189.508 1.00 222.35 ?  81   VAL F C     1 
ATOM   4322  O  O     . VAL F 2  82   ? 165.437 167.461 190.050 1.00 380.29 ?  81   VAL F O     1 
ATOM   4323  C  CB    . VAL F 2  82   ? 165.992 167.577 187.084 1.00 115.80 ?  81   VAL F CB    1 
ATOM   4324  C  CG1   . VAL F 2  82   ? 166.606 168.901 187.513 1.00 117.36 ?  81   VAL F CG1   1 
ATOM   4325  C  CG2   . VAL F 2  82   ? 166.410 167.226 185.665 1.00 128.57 ?  81   VAL F CG2   1 
ATOM   4326  N  N     . THR F 2  83   ? 167.652 166.884 190.089 1.00 208.44 ?  82   THR F N     1 
ATOM   4327  C  CA    . THR F 2  83   ? 167.903 167.375 191.503 1.00 149.82 ?  82   THR F CA    1 
ATOM   4328  C  C     . THR F 2  83   ? 168.016 168.920 191.521 1.00 126.90 ?  82   THR F C     1 
ATOM   4329  O  O     . THR F 2  83   ? 168.280 169.601 190.574 1.00 88.23  ?  82   THR F O     1 
ATOM   4330  C  CB    . THR F 2  83   ? 169.113 166.747 192.204 1.00 121.77 ?  82   THR F CB    1 
ATOM   4331  O  OG1   . THR F 2  83   ? 168.857 165.380 192.363 1.00 98.90  ?  82   THR F OG1   1 
ATOM   4332  C  CG2   . THR F 2  83   ? 169.332 167.222 193.613 1.00 110.64 ?  82   THR F CG2   1 
ATOM   4333  N  N     . ALA F 2  84   ? 167.662 169.531 192.635 1.00 115.29 ?  83   ALA F N     1 
ATOM   4334  C  CA    . ALA F 2  84   ? 167.904 170.941 192.807 1.00 116.26 ?  83   ALA F CA    1 
ATOM   4335  C  C     . ALA F 2  84   ? 169.405 171.181 192.960 1.00 88.52  ?  83   ALA F C     1 
ATOM   4336  O  O     . ALA F 2  84   ? 169.946 172.213 192.606 1.00 58.17  ?  83   ALA F O     1 
ATOM   4337  C  CB    . ALA F 2  84   ? 167.126 171.393 194.018 1.00 182.32 ?  83   ALA F CB    1 
ATOM   4338  N  N     . MET F 2  85   ? 170.084 170.257 193.618 1.00 101.31 ?  84   MET F N     1 
ATOM   4339  C  CA    . MET F 2  85   ? 171.566 170.407 193.677 1.00 92.82  ?  84   MET F CA    1 
ATOM   4340  C  C     . MET F 2  85   ? 172.131 170.613 192.282 1.00 70.49  ?  84   MET F C     1 
ATOM   4341  O  O     . MET F 2  85   ? 173.064 171.381 192.043 1.00 50.05  ?  84   MET F O     1 
ATOM   4342  C  CB    . MET F 2  85   ? 172.171 169.128 194.274 1.00 138.29 ?  84   MET F CB    1 
ATOM   4343  C  CG    . MET F 2  85   ? 171.940 168.977 195.781 1.00 178.00 ?  84   MET F CG    1 
ATOM   4344  S  SD    . MET F 2  85   ? 172.602 170.537 196.421 1.00 277.84 ?  84   MET F SD    1 
ATOM   4345  C  CE    . MET F 2  85   ? 174.384 170.329 196.249 1.00 352.90 ?  84   MET F CE    1 
ATOM   4346  N  N     . ASP F 2  86   ? 171.543 169.851 191.358 1.00 77.06  ?  85   ASP F N     1 
ATOM   4347  C  CA    . ASP F 2  86   ? 171.961 169.922 190.079 1.00 102.59 ?  85   ASP F CA    1 
ATOM   4348  C  C     . ASP F 2  86   ? 171.947 171.357 189.630 1.00 105.24 ?  85   ASP F C     1 
ATOM   4349  O  O     . ASP F 2  86   ? 172.867 171.798 188.864 1.00 192.66 ?  85   ASP F O     1 
ATOM   4350  C  CB    . ASP F 2  86   ? 171.202 168.911 189.201 1.00 106.00 ?  85   ASP F CB    1 
ATOM   4351  C  CG    . ASP F 2  86   ? 171.494 167.439 189.454 1.00 102.01 ?  85   ASP F CG    1 
ATOM   4352  O  OD1   . ASP F 2  86   ? 172.399 167.096 190.186 1.00 103.16 ?  85   ASP F OD1   1 
ATOM   4353  O  OD2   . ASP F 2  86   ? 170.731 166.688 188.943 1.00 182.33 -1 85   ASP F OD2   1 
ATOM   4354  N  N     . VAL F 2  87   ? 170.943 172.126 190.040 1.00 79.00  ?  86   VAL F N     1 
ATOM   4355  C  CA    . VAL F 2  87   ? 170.911 173.552 189.643 1.00 72.10  ?  86   VAL F CA    1 
ATOM   4356  C  C     . VAL F 2  87   ? 172.027 174.370 190.298 1.00 50.68  ?  86   VAL F C     1 
ATOM   4357  O  O     . VAL F 2  87   ? 172.720 175.139 189.663 1.00 39.54  ?  86   VAL F O     1 
ATOM   4358  C  CB    . VAL F 2  87   ? 169.577 174.221 189.963 1.00 82.22  ?  86   VAL F CB    1 
ATOM   4359  C  CG1   . VAL F 2  87   ? 169.653 175.602 189.341 1.00 93.15  ?  86   VAL F CG1   1 
ATOM   4360  C  CG2   . VAL F 2  87   ? 168.400 173.516 189.340 1.00 89.85  ?  86   VAL F CG2   1 
ATOM   4361  N  N     . VAL F 2  88   ? 172.237 174.124 191.579 1.00 49.16  ?  87   VAL F N     1 
ATOM   4362  C  CA    . VAL F 2  88   ? 173.234 174.792 192.335 1.00 60.84  ?  87   VAL F CA    1 
ATOM   4363  C  C     . VAL F 2  88   ? 174.578 174.750 191.581 1.00 58.11  ?  87   VAL F C     1 
ATOM   4364  O  O     . VAL F 2  88   ? 175.345 175.728 191.482 1.00 61.52  ?  87   VAL F O     1 
ATOM   4365  C  CB    . VAL F 2  88   ? 173.406 174.201 193.746 1.00 88.22  ?  87   VAL F CB    1 
ATOM   4366  C  CG1   . VAL F 2  88   ? 174.669 174.724 194.477 1.00 195.26 ?  87   VAL F CG1   1 
ATOM   4367  C  CG2   . VAL F 2  88   ? 172.164 174.428 194.599 1.00 80.69  ?  87   VAL F CG2   1 
ATOM   4368  N  N     . TYR F 2  89   ? 175.061 173.531 191.288 1.00 55.61  ?  88   TYR F N     1 
ATOM   4369  C  CA    . TYR F 2  89   ? 176.396 173.439 190.714 1.00 68.99  ?  88   TYR F CA    1 
ATOM   4370  C  C     . TYR F 2  89   ? 176.458 174.311 189.463 1.00 68.33  ?  88   TYR F C     1 
ATOM   4371  O  O     . TYR F 2  89   ? 177.453 174.926 189.141 1.00 60.61  ?  88   TYR F O     1 
ATOM   4372  C  CB    . TYR F 2  89   ? 176.683 172.017 190.320 1.00 87.98  ?  88   TYR F CB    1 
ATOM   4373  C  CG    . TYR F 2  89   ? 176.630 171.138 191.539 1.00 118.19 ?  88   TYR F CG    1 
ATOM   4374  C  CD1   . TYR F 2  89   ? 177.500 171.338 192.572 1.00 156.23 ?  88   TYR F CD1   1 
ATOM   4375  C  CD2   . TYR F 2  89   ? 175.798 170.052 191.600 1.00 169.49 ?  88   TYR F CD2   1 
ATOM   4376  C  CE1   . TYR F 2  89   ? 177.496 170.501 193.683 1.00 227.24 ?  88   TYR F CE1   1 
ATOM   4377  C  CE2   . TYR F 2  89   ? 175.784 169.191 192.674 1.00 224.81 ?  88   TYR F CE2   1 
ATOM   4378  C  CZ    . TYR F 2  89   ? 176.654 169.408 193.721 1.00 250.74 ?  88   TYR F CZ    1 
ATOM   4379  O  OH    . TYR F 2  89   ? 176.641 168.602 194.838 1.00 373.61 ?  88   TYR F OH    1 
ATOM   4380  N  N     . ALA F 2  90   ? 175.331 174.281 188.769 1.00 91.81  ?  89   ALA F N     1 
ATOM   4381  C  CA    . ALA F 2  90   ? 175.203 175.027 187.548 1.00 132.50 ?  89   ALA F CA    1 
ATOM   4382  C  C     . ALA F 2  90   ? 175.499 176.493 187.851 1.00 118.33 ?  89   ALA F C     1 
ATOM   4383  O  O     . ALA F 2  90   ? 176.154 177.244 187.129 1.00 81.88  ?  89   ALA F O     1 
ATOM   4384  C  CB    . ALA F 2  90   ? 173.798 174.833 187.007 1.00 202.15 ?  89   ALA F CB    1 
ATOM   4385  N  N     . LEU F 2  91   ? 174.836 176.971 188.912 1.00 114.95 ?  90   LEU F N     1 
ATOM   4386  C  CA    . LEU F 2  91   ? 174.969 178.384 189.258 1.00 117.75 ?  90   LEU F CA    1 
ATOM   4387  C  C     . LEU F 2  91   ? 176.414 178.646 189.659 1.00 120.00 ?  90   LEU F C     1 
ATOM   4388  O  O     . LEU F 2  91   ? 176.949 179.695 189.428 1.00 138.41 ?  90   LEU F O     1 
ATOM   4389  C  CB    . LEU F 2  91   ? 173.987 178.683 190.400 1.00 109.56 ?  90   LEU F CB    1 
ATOM   4390  C  CG    . LEU F 2  91   ? 172.546 178.282 190.129 1.00 106.11 ?  90   LEU F CG    1 
ATOM   4391  C  CD1   . LEU F 2  91   ? 171.792 178.367 191.426 1.00 112.75 ?  90   LEU F CD1   1 
ATOM   4392  C  CD2   . LEU F 2  91   ? 171.873 179.064 188.925 1.00 127.82 ?  90   LEU F CD2   1 
ATOM   4393  N  N     . LYS F 2  92   ? 177.016 177.670 190.337 1.00 111.48 ?  91   LYS F N     1 
ATOM   4394  C  CA    . LYS F 2  92   ? 178.350 177.710 190.875 1.00 108.45 ?  91   LYS F CA    1 
ATOM   4395  C  C     . LYS F 2  92   ? 179.328 177.900 189.745 1.00 97.57  ?  91   LYS F C     1 
ATOM   4396  O  O     . LYS F 2  92   ? 180.224 178.694 189.903 1.00 75.25  ?  91   LYS F O     1 
ATOM   4397  C  CB    . LYS F 2  92   ? 178.702 176.414 191.585 1.00 110.16 ?  91   LYS F CB    1 
ATOM   4398  C  CG    . LYS F 2  92   ? 178.039 176.321 192.951 1.00 170.67 ?  91   LYS F CG    1 
ATOM   4399  C  CD    . LYS F 2  92   ? 178.434 175.091 193.698 1.00 197.77 ?  91   LYS F CD    1 
ATOM   4400  C  CE    . LYS F 2  92   ? 178.109 175.170 195.174 1.00 279.71 ?  91   LYS F CE    1 
ATOM   4401  N  NZ    . LYS F 2  92   ? 178.327 173.882 195.831 1.00 290.12 1  91   LYS F NZ    1 
ATOM   4402  N  N     . ARG F 2  93   ? 179.086 177.239 188.629 1.00 154.67 ?  92   ARG F N     1 
ATOM   4403  C  CA    . ARG F 2  93   ? 179.944 177.285 187.447 1.00 242.76 ?  92   ARG F CA    1 
ATOM   4404  C  C     . ARG F 2  93   ? 179.993 178.698 186.852 1.00 207.97 ?  92   ARG F C     1 
ATOM   4405  O  O     . ARG F 2  93   ? 180.965 179.124 186.308 1.00 188.32 ?  92   ARG F O     1 
ATOM   4406  C  CB    . ARG F 2  93   ? 179.434 176.235 186.457 1.00 267.15 ?  92   ARG F CB    1 
ATOM   4407  C  CG    . ARG F 2  93   ? 179.471 174.757 186.863 1.00 215.03 ?  92   ARG F CG    1 
ATOM   4408  C  CD    . ARG F 2  93   ? 180.908 174.216 186.975 1.00 227.46 ?  92   ARG F CD    1 
ATOM   4409  N  NE    . ARG F 2  93   ? 180.902 172.810 187.347 1.00 224.48 ?  92   ARG F NE    1 
ATOM   4410  C  CZ    . ARG F 2  93   ? 181.112 172.260 188.560 1.00 271.23 ?  92   ARG F CZ    1 
ATOM   4411  N  NH1   . ARG F 2  93   ? 181.033 172.989 189.655 1.00 296.77 1  92   ARG F NH1   1 
ATOM   4412  N  NH2   . ARG F 2  93   ? 181.462 170.999 188.673 1.00 293.07 ?  92   ARG F NH2   1 
ATOM   4413  N  N     . GLN F 2  94   ? 178.885 179.437 186.971 1.00 163.69 ?  93   GLN F N     1 
ATOM   4414  C  CA    . GLN F 2  94   ? 178.856 180.814 186.434 1.00 178.12 ?  93   GLN F CA    1 
ATOM   4415  C  C     . GLN F 2  94   ? 179.184 181.835 187.534 1.00 173.19 ?  93   GLN F C     1 
ATOM   4416  O  O     . GLN F 2  94   ? 179.162 183.063 187.398 1.00 178.18 ?  93   GLN F O     1 
ATOM   4417  C  CB    . GLN F 2  94   ? 177.485 181.026 185.768 1.00 197.65 ?  93   GLN F CB    1 
ATOM   4418  C  CG    . GLN F 2  94   ? 177.220 182.412 185.183 1.00 243.40 ?  93   GLN F CG    1 
ATOM   4419  C  CD    . GLN F 2  94   ? 178.098 182.750 184.003 1.00 270.96 ?  93   GLN F CD    1 
ATOM   4420  O  OE1   . GLN F 2  94   ? 178.150 182.009 183.034 1.00 352.45 ?  93   GLN F OE1   1 
ATOM   4421  N  NE2   . GLN F 2  94   ? 178.854 183.828 184.120 1.00 204.26 ?  93   GLN F NE2   1 
ATOM   4422  N  N     . GLY F 2  95   ? 179.394 181.331 188.730 1.00 174.57 ?  94   GLY F N     1 
ATOM   4423  C  CA    . GLY F 2  95   ? 179.626 182.222 189.902 1.00 192.76 ?  94   GLY F CA    1 
ATOM   4424  C  C     . GLY F 2  95   ? 178.386 182.967 190.414 1.00 183.73 ?  94   GLY F C     1 
ATOM   4425  O  O     . GLY F 2  95   ? 178.442 184.167 190.654 1.00 171.12 ?  94   GLY F O     1 
ATOM   4426  N  N     . ARG F 2  96   ? 177.287 182.267 190.623 1.00 151.29 ?  95   ARG F N     1 
ATOM   4427  C  CA    . ARG F 2  96   ? 176.110 182.807 191.207 1.00 114.00 ?  95   ARG F CA    1 
ATOM   4428  C  C     . ARG F 2  96   ? 175.531 181.828 192.227 1.00 126.19 ?  95   ARG F C     1 
ATOM   4429  O  O     . ARG F 2  96   ? 174.306 181.723 192.339 1.00 155.61 ?  95   ARG F O     1 
ATOM   4430  C  CB    . ARG F 2  96   ? 175.114 183.165 190.091 1.00 96.40  ?  95   ARG F CB    1 
ATOM   4431  C  CG    . ARG F 2  96   ? 175.664 184.169 189.085 1.00 113.56 ?  95   ARG F CG    1 
ATOM   4432  C  CD    . ARG F 2  96   ? 175.761 185.489 189.824 1.00 147.80 ?  95   ARG F CD    1 
ATOM   4433  N  NE    . ARG F 2  96   ? 176.487 186.613 189.211 1.00 173.87 ?  95   ARG F NE    1 
ATOM   4434  C  CZ    . ARG F 2  96   ? 175.976 187.489 188.347 1.00 182.31 ?  95   ARG F CZ    1 
ATOM   4435  N  NH1   . ARG F 2  96   ? 174.961 187.103 187.605 1.00 199.65 1  95   ARG F NH1   1 
ATOM   4436  N  NH2   . ARG F 2  96   ? 176.444 188.733 188.213 1.00 197.80 ?  95   ARG F NH2   1 
ATOM   4437  N  N     . THR F 2  97   ? 176.400 181.184 192.996 1.00 148.97 ?  96   THR F N     1 
ATOM   4438  C  CA    . THR F 2  97   ? 176.046 180.121 193.942 1.00 202.61 ?  96   THR F CA    1 
ATOM   4439  C  C     . THR F 2  97   ? 175.145 180.632 195.087 1.00 198.04 ?  96   THR F C     1 
ATOM   4440  O  O     . THR F 2  97   ? 175.259 181.747 195.584 1.00 165.72 ?  96   THR F O     1 
ATOM   4441  C  CB    . THR F 2  97   ? 177.297 179.439 194.502 1.00 255.96 ?  96   THR F CB    1 
ATOM   4442  O  OG1   . THR F 2  97   ? 176.889 178.300 195.281 1.00 245.06 ?  96   THR F OG1   1 
ATOM   4443  C  CG2   . THR F 2  97   ? 178.085 180.395 195.370 1.00 291.27 ?  96   THR F CG2   1 
ATOM   4444  N  N     . LEU F 2  98   ? 174.264 179.736 195.511 1.00 178.36 ?  97   LEU F N     1 
ATOM   4445  C  CA    . LEU F 2  98   ? 173.148 180.037 196.368 1.00 153.34 ?  97   LEU F CA    1 
ATOM   4446  C  C     . LEU F 2  98   ? 173.353 179.316 197.681 1.00 132.66 ?  97   LEU F C     1 
ATOM   4447  O  O     . LEU F 2  98   ? 173.403 178.117 197.754 1.00 92.91  ?  97   LEU F O     1 
ATOM   4448  C  CB    . LEU F 2  98   ? 171.897 179.539 195.689 1.00 160.94 ?  97   LEU F CB    1 
ATOM   4449  C  CG    . LEU F 2  98   ? 170.596 180.052 196.275 1.00 143.13 ?  97   LEU F CG    1 
ATOM   4450  C  CD1   . LEU F 2  98   ? 169.607 180.431 195.186 1.00 134.48 ?  97   LEU F CD1   1 
ATOM   4451  C  CD2   . LEU F 2  98   ? 169.986 179.045 197.240 1.00 125.34 ?  97   LEU F CD2   1 
ATOM   4452  N  N     . TYR F 2  99   ? 173.507 180.146 198.688 1.00 141.73 ?  98   TYR F N     1 
ATOM   4453  C  CA    . TYR F 2  99   ? 173.453 179.743 200.015 1.00 158.27 ?  98   TYR F CA    1 
ATOM   4454  C  C     . TYR F 2  99   ? 171.998 179.438 200.400 1.00 135.45 ?  98   TYR F C     1 
ATOM   4455  O  O     . TYR F 2  99   ? 171.033 179.973 199.957 1.00 85.14  ?  98   TYR F O     1 
ATOM   4456  C  CB    . TYR F 2  99   ? 174.092 180.863 200.806 1.00 164.69 ?  98   TYR F CB    1 
ATOM   4457  C  CG    . TYR F 2  99   ? 175.573 180.732 201.046 1.00 119.14 ?  98   TYR F CG    1 
ATOM   4458  C  CD1   . TYR F 2  99   ? 176.179 179.620 201.642 1.00 84.14  ?  98   TYR F CD1   1 
ATOM   4459  C  CD2   . TYR F 2  99   ? 176.354 181.855 200.836 1.00 87.05  ?  98   TYR F CD2   1 
ATOM   4460  C  CE1   . TYR F 2  99   ? 177.516 179.623 201.938 1.00 71.64  ?  98   TYR F CE1   1 
ATOM   4461  C  CE2   . TYR F 2  99   ? 177.698 181.889 201.205 1.00 72.41  ?  98   TYR F CE2   1 
ATOM   4462  C  CZ    . TYR F 2  99   ? 178.273 180.758 201.735 1.00 72.55  ?  98   TYR F CZ    1 
ATOM   4463  O  OH    . TYR F 2  99   ? 179.595 180.768 202.026 1.00 71.71  ?  98   TYR F OH    1 
ATOM   4464  N  N     . GLY F 2  100  ? 171.814 178.555 201.354 1.00 153.93 ?  99   GLY F N     1 
ATOM   4465  C  CA    . GLY F 2  100  ? 170.495 178.121 201.730 1.00 142.43 ?  99   GLY F CA    1 
ATOM   4466  C  C     . GLY F 2  100  ? 170.218 176.695 201.283 1.00 146.17 ?  99   GLY F C     1 
ATOM   4467  O  O     . GLY F 2  100  ? 169.370 175.957 201.874 1.00 127.10 ?  99   GLY F O     1 
ATOM   4468  N  N     . PHE F 2  101  ? 170.896 176.257 200.222 1.00 171.68 ?  100  PHE F N     1 
ATOM   4469  C  CA    . PHE F 2  101  ? 170.535 175.016 199.571 1.00 196.64 ?  100  PHE F CA    1 
ATOM   4470  C  C     . PHE F 2  101  ? 171.682 174.022 199.571 1.00 231.62 ?  100  PHE F C     1 
ATOM   4471  O  O     . PHE F 2  101  ? 172.676 174.437 199.014 1.00 238.25 ?  100  PHE F O     1 
ATOM   4472  C  CB    . PHE F 2  101  ? 170.114 175.378 198.140 1.00 216.30 ?  100  PHE F CB    1 
ATOM   4473  C  CG    . PHE F 2  101  ? 168.648 175.809 198.151 1.00 226.52 ?  100  PHE F CG    1 
ATOM   4474  C  CD1   . PHE F 2  101  ? 167.848 175.336 199.201 1.00 228.19 ?  100  PHE F CD1   1 
ATOM   4475  C  CD2   . PHE F 2  101  ? 168.085 176.673 197.213 1.00 208.17 ?  100  PHE F CD2   1 
ATOM   4476  C  CE1   . PHE F 2  101  ? 166.498 175.673 199.274 1.00 249.89 ?  100  PHE F CE1   1 
ATOM   4477  C  CE2   . PHE F 2  101  ? 166.758 177.049 197.305 1.00 201.19 ?  100  PHE F CE2   1 
ATOM   4478  C  CZ    . PHE F 2  101  ? 165.959 176.511 198.303 1.00 237.93 ?  100  PHE F CZ    1 
ATOM   4479  N  N     . GLY F 2  102  ? 171.351 172.791 199.974 1.00 288.73 ?  101  GLY F N     1 
ATOM   4480  C  CA    . GLY F 2  102  ? 171.865 171.605 199.265 1.00 420.54 ?  101  GLY F CA    1 
ATOM   4481  C  C     . GLY F 2  102  ? 173.379 171.498 199.390 1.00 440.00 ?  101  GLY F C     1 
ATOM   4482  O  O     . GLY F 2  102  ? 174.163 171.403 198.369 1.00 440.00 ?  101  GLY F O     1 
ATOM   4483  N  N     . GLY F 2  103  ? 173.793 171.522 200.654 1.00 440.00 ?  102  GLY F N     1 
ATOM   4484  C  CA    . GLY F 2  103  ? 175.234 171.406 201.040 1.00 440.00 ?  102  GLY F CA    1 
ATOM   4485  C  C     . GLY F 2  103  ? 175.906 170.091 200.633 1.00 440.00 ?  102  GLY F C     1 
ATOM   4486  O  O     . GLY F 2  103  ? 177.020 170.056 200.068 1.00 436.57 ?  102  GLY F O     1 
ATOM   4487  O  OXT   . GLY F 2  103  ? 175.443 168.977 200.808 1.00 356.51 -1 102  GLY F OXT   1 
ATOM   4488  N  N     . ALA G 5  15   ? 202.380 146.840 167.508 1.00 438.80 ?  14   ALA G N     1 
ATOM   4489  C  CA    . ALA G 5  15   ? 203.129 148.082 167.940 1.00 435.70 ?  14   ALA G CA    1 
ATOM   4490  C  C     . ALA G 5  15   ? 203.437 148.027 169.444 1.00 440.00 ?  14   ALA G C     1 
ATOM   4491  O  O     . ALA G 5  15   ? 202.595 147.574 170.243 1.00 440.00 ?  14   ALA G O     1 
ATOM   4492  C  CB    . ALA G 5  15   ? 202.293 149.286 167.525 1.00 405.54 ?  14   ALA G CB    1 
ATOM   4493  N  N     . LYS G 5  16   ? 204.593 148.560 169.872 1.00 436.54 ?  15   LYS G N     1 
ATOM   4494  C  CA    . LYS G 5  16   ? 204.897 148.653 171.316 1.00 382.78 ?  15   LYS G CA    1 
ATOM   4495  C  C     . LYS G 5  16   ? 204.333 149.956 171.915 1.00 286.76 ?  15   LYS G C     1 
ATOM   4496  O  O     . LYS G 5  16   ? 203.576 149.912 172.888 1.00 231.76 ?  15   LYS G O     1 
ATOM   4497  C  CB    . LYS G 5  16   ? 206.418 148.515 171.552 1.00 440.00 ?  15   LYS G CB    1 
ATOM   4498  C  CG    . LYS G 5  16   ? 207.040 148.981 172.872 1.00 440.00 ?  15   LYS G CG    1 
ATOM   4499  C  CD    . LYS G 5  16   ? 208.369 149.745 172.630 1.00 440.00 ?  15   LYS G CD    1 
ATOM   4500  C  CE    . LYS G 5  16   ? 209.140 150.092 173.893 1.00 440.00 ?  15   LYS G CE    1 
ATOM   4501  N  NZ    . LYS G 5  16   ? 210.578 150.353 173.624 1.00 440.00 1  15   LYS G NZ    1 
ATOM   4502  N  N     . THR G 5  17   ? 204.732 151.112 171.362 1.00 285.59 ?  16   THR G N     1 
ATOM   4503  C  CA    . THR G 5  17   ? 204.300 152.413 171.891 1.00 283.91 ?  16   THR G CA    1 
ATOM   4504  C  C     . THR G 5  17   ? 202.752 152.455 171.915 1.00 259.78 ?  16   THR G C     1 
ATOM   4505  O  O     . THR G 5  17   ? 202.049 152.258 170.867 1.00 300.49 ?  16   THR G O     1 
ATOM   4506  C  CB    . THR G 5  17   ? 204.892 153.611 171.127 1.00 287.88 ?  16   THR G CB    1 
ATOM   4507  O  OG1   . THR G 5  17   ? 204.639 154.838 171.819 1.00 239.23 ?  16   THR G OG1   1 
ATOM   4508  C  CG2   . THR G 5  17   ? 204.333 153.829 169.738 1.00 329.52 ?  16   THR G CG2   1 
ATOM   4509  N  N     . ARG G 5  18   ? 202.183 152.745 173.096 1.00 176.95 ?  17   ARG G N     1 
ATOM   4510  C  CA    . ARG G 5  18   ? 200.746 152.825 173.250 1.00 125.49 ?  17   ARG G CA    1 
ATOM   4511  C  C     . ARG G 5  18   ? 200.189 153.832 172.284 1.00 126.16 ?  17   ARG G C     1 
ATOM   4512  O  O     . ARG G 5  18   ? 199.303 153.324 171.543 1.00 127.61 ?  17   ARG G O     1 
ATOM   4513  C  CB    . ARG G 5  18   ? 200.339 153.177 174.677 1.00 124.04 ?  17   ARG G CB    1 
ATOM   4514  C  CG    . ARG G 5  18   ? 200.523 152.048 175.668 1.00 138.91 ?  17   ARG G CG    1 
ATOM   4515  C  CD    . ARG G 5  18   ? 200.070 152.575 177.017 1.00 149.29 ?  17   ARG G CD    1 
ATOM   4516  N  NE    . ARG G 5  18   ? 200.153 151.645 178.134 1.00 176.60 ?  17   ARG G NE    1 
ATOM   4517  C  CZ    . ARG G 5  18   ? 200.178 152.050 179.393 1.00 198.30 ?  17   ARG G CZ    1 
ATOM   4518  N  NH1   . ARG G 5  18   ? 200.372 153.333 179.618 1.00 144.12 1  17   ARG G NH1   1 
ATOM   4519  N  NH2   . ARG G 5  18   ? 200.000 151.204 180.404 1.00 271.27 ?  17   ARG G NH2   1 
ATOM   4520  N  N     . SER G 5  19   ? 200.733 155.082 172.254 1.00 136.74 ?  18   SER G N     1 
ATOM   4521  C  CA    . SER G 5  19   ? 200.234 156.134 171.453 1.00 134.12 ?  18   SER G CA    1 
ATOM   4522  C  C     . SER G 5  19   ? 199.875 155.633 170.064 1.00 147.93 ?  18   SER G C     1 
ATOM   4523  O  O     . SER G 5  19   ? 198.820 155.946 169.503 1.00 153.45 ?  18   SER G O     1 
ATOM   4524  C  CB    . SER G 5  19   ? 201.174 157.332 171.389 1.00 105.89 ?  18   SER G CB    1 
ATOM   4525  O  OG    . SER G 5  19   ? 202.415 156.953 170.849 1.00 90.70  ?  18   SER G OG    1 
ATOM   4526  N  N     . SER G 5  20   ? 200.777 154.823 169.530 1.00 186.69 ?  19   SER G N     1 
ATOM   4527  C  CA    . SER G 5  20   ? 200.622 154.241 168.203 1.00 220.97 ?  19   SER G CA    1 
ATOM   4528  C  C     . SER G 5  20   ? 199.455 153.238 168.216 1.00 180.68 ?  19   SER G C     1 
ATOM   4529  O  O     . SER G 5  20   ? 198.634 153.259 167.329 1.00 282.64 ?  19   SER G O     1 
ATOM   4530  C  CB    . SER G 5  20   ? 201.911 153.655 167.691 1.00 331.17 ?  19   SER G CB    1 
ATOM   4531  O  OG    . SER G 5  20   ? 202.885 154.691 167.404 1.00 330.77 ?  19   SER G OG    1 
ATOM   4532  N  N     . ARG G 5  21   ? 199.321 152.375 169.227 1.00 111.10 ?  20   ARG G N     1 
ATOM   4533  C  CA    . ARG G 5  21   ? 198.144 151.541 169.240 1.00 99.80  ?  20   ARG G CA    1 
ATOM   4534  C  C     . ARG G 5  21   ? 196.824 152.336 169.180 1.00 117.79 ?  20   ARG G C     1 
ATOM   4535  O  O     . ARG G 5  21   ? 195.843 151.860 168.643 1.00 119.14 ?  20   ARG G O     1 
ATOM   4536  C  CB    . ARG G 5  21   ? 198.150 150.686 170.493 1.00 95.36  ?  20   ARG G CB    1 
ATOM   4537  C  CG    . ARG G 5  21   ? 199.190 149.579 170.444 1.00 102.36 ?  20   ARG G CG    1 
ATOM   4538  C  CD    . ARG G 5  21   ? 198.778 148.495 171.456 1.00 135.42 ?  20   ARG G CD    1 
ATOM   4539  N  NE    . ARG G 5  21   ? 199.862 147.710 172.018 1.00 187.47 ?  20   ARG G NE    1 
ATOM   4540  C  CZ    . ARG G 5  21   ? 200.922 148.150 172.728 1.00 256.31 ?  20   ARG G CZ    1 
ATOM   4541  N  NH1   . ARG G 5  21   ? 201.077 149.416 173.082 1.00 235.04 1  20   ARG G NH1   1 
ATOM   4542  N  NH2   . ARG G 5  21   ? 201.839 147.273 173.090 1.00 326.58 ?  20   ARG G NH2   1 
ATOM   4543  N  N     . ALA G 5  22   ? 196.863 153.584 169.636 1.00 120.14 ?  21   ALA G N     1 
ATOM   4544  C  CA    . ALA G 5  22   ? 195.672 154.429 169.525 1.00 92.15  ?  21   ALA G CA    1 
ATOM   4545  C  C     . ALA G 5  22   ? 195.834 155.465 168.401 1.00 99.47  ?  21   ALA G C     1 
ATOM   4546  O  O     . ALA G 5  22   ? 195.081 156.378 168.250 1.00 88.64  ?  21   ALA G O     1 
ATOM   4547  C  CB    . ALA G 5  22   ? 195.479 155.179 170.806 1.00 79.74  ?  21   ALA G CB    1 
ATOM   4548  N  N     . GLY G 5  23   ? 196.904 155.372 167.668 1.00 146.16 ?  22   GLY G N     1 
ATOM   4549  C  CA    . GLY G 5  23   ? 197.160 156.178 166.520 1.00 188.22 ?  22   GLY G CA    1 
ATOM   4550  C  C     . GLY G 5  23   ? 197.459 157.629 166.842 1.00 186.26 ?  22   GLY G C     1 
ATOM   4551  O  O     . GLY G 5  23   ? 196.734 158.409 166.269 1.00 216.83 ?  22   GLY G O     1 
ATOM   4552  N  N     . LEU G 5  24   ? 198.351 157.954 167.754 1.00 163.57 ?  23   LEU G N     1 
ATOM   4553  C  CA    . LEU G 5  24   ? 198.486 159.350 168.071 1.00 164.97 ?  23   LEU G CA    1 
ATOM   4554  C  C     . LEU G 5  24   ? 199.902 159.792 168.399 1.00 132.11 ?  23   LEU G C     1 
ATOM   4555  O  O     . LEU G 5  24   ? 200.795 159.114 168.683 1.00 77.65  ?  23   LEU G O     1 
ATOM   4556  C  CB    . LEU G 5  24   ? 197.642 159.547 169.320 1.00 215.78 ?  23   LEU G CB    1 
ATOM   4557  C  CG    . LEU G 5  24   ? 196.127 159.355 169.204 1.00 228.30 ?  23   LEU G CG    1 
ATOM   4558  C  CD1   . LEU G 5  24   ? 195.500 158.960 170.541 1.00 199.09 ?  23   LEU G CD1   1 
ATOM   4559  C  CD2   . LEU G 5  24   ? 195.470 160.607 168.657 1.00 251.19 ?  23   LEU G CD2   1 
ATOM   4560  N  N     . GLN G 5  25   ? 199.968 161.101 168.300 1.00 156.86 ?  24   GLN G N     1 
ATOM   4561  C  CA    . GLN G 5  25   ? 201.165 161.889 168.627 1.00 187.38 ?  24   GLN G CA    1 
ATOM   4562  C  C     . GLN G 5  25   ? 201.311 162.165 170.141 1.00 232.46 ?  24   GLN G C     1 
ATOM   4563  O  O     . GLN G 5  25   ? 202.419 162.407 170.533 1.00 278.43 ?  24   GLN G O     1 
ATOM   4564  C  CB    . GLN G 5  25   ? 201.111 163.184 167.786 1.00 151.27 ?  24   GLN G CB    1 
ATOM   4565  C  CG    . GLN G 5  25   ? 200.320 163.051 166.469 1.00 118.34 ?  24   GLN G CG    1 
ATOM   4566  C  CD    . GLN G 5  25   ? 200.807 164.000 165.410 1.00 121.53 ?  24   GLN G CD    1 
ATOM   4567  O  OE1   . GLN G 5  25   ? 201.923 164.508 165.475 1.00 100.00 ?  24   GLN G OE1   1 
ATOM   4568  N  NE2   . GLN G 5  25   ? 199.935 164.276 164.457 1.00 159.05 ?  24   GLN G NE2   1 
ATOM   4569  N  N     . PHE G 5  26   ? 200.244 162.226 170.903 1.00 241.99 ?  25   PHE G N     1 
ATOM   4570  C  CA    . PHE G 5  26   ? 200.178 162.626 172.334 1.00 164.23 ?  25   PHE G CA    1 
ATOM   4571  C  C     . PHE G 5  26   ? 200.633 161.479 173.250 1.00 90.37  ?  25   PHE G C     1 
ATOM   4572  O  O     . PHE G 5  26   ? 200.486 160.291 172.883 1.00 69.48  ?  25   PHE G O     1 
ATOM   4573  C  CB    . PHE G 5  26   ? 198.743 163.028 172.724 1.00 287.97 ?  25   PHE G CB    1 
ATOM   4574  C  CG    . PHE G 5  26   ? 198.432 164.495 172.623 1.00 361.66 ?  25   PHE G CG    1 
ATOM   4575  C  CD1   . PHE G 5  26   ? 198.716 165.215 171.466 1.00 244.97 ?  25   PHE G CD1   1 
ATOM   4576  C  CD2   . PHE G 5  26   ? 197.863 165.136 173.721 1.00 440.00 ?  25   PHE G CD2   1 
ATOM   4577  C  CE1   . PHE G 5  26   ? 198.380 166.570 171.449 1.00 308.80 ?  25   PHE G CE1   1 
ATOM   4578  C  CE2   . PHE G 5  26   ? 197.582 166.486 173.717 1.00 440.00 ?  25   PHE G CE2   1 
ATOM   4579  C  CZ    . PHE G 5  26   ? 197.788 167.198 172.559 1.00 405.20 ?  25   PHE G CZ    1 
ATOM   4580  N  N     . PRO G 5  27   ? 201.230 161.839 174.313 1.00 70.88  ?  26   PRO G N     1 
ATOM   4581  C  CA    . PRO G 5  27   ? 201.877 160.814 175.113 1.00 63.74  ?  26   PRO G CA    1 
ATOM   4582  C  C     . PRO G 5  27   ? 200.920 160.120 176.048 1.00 45.90  ?  26   PRO G C     1 
ATOM   4583  O  O     . PRO G 5  27   ? 200.622 160.617 177.098 1.00 49.33  ?  26   PRO G O     1 
ATOM   4584  C  CB    . PRO G 5  27   ? 202.899 161.544 175.990 1.00 76.50  ?  26   PRO G CB    1 
ATOM   4585  C  CG    . PRO G 5  27   ? 202.468 162.991 176.001 1.00 89.47  ?  26   PRO G CG    1 
ATOM   4586  C  CD    . PRO G 5  27   ? 201.437 163.178 174.894 1.00 79.01  ?  26   PRO G CD    1 
ATOM   4587  N  N     . VAL G 5  28   ? 200.628 158.896 175.694 1.00 44.68  ?  27   VAL G N     1 
ATOM   4588  C  CA    . VAL G 5  28   ? 199.830 158.032 176.440 1.00 57.93  ?  27   VAL G CA    1 
ATOM   4589  C  C     . VAL G 5  28   ? 200.300 157.857 177.885 1.00 63.97  ?  27   VAL G C     1 
ATOM   4590  O  O     . VAL G 5  28   ? 199.543 157.823 178.789 1.00 56.73  ?  27   VAL G O     1 
ATOM   4591  C  CB    . VAL G 5  28   ? 199.772 156.620 175.799 1.00 74.20  ?  27   VAL G CB    1 
ATOM   4592  C  CG1   . VAL G 5  28   ? 199.105 155.549 176.710 1.00 75.28  ?  27   VAL G CG1   1 
ATOM   4593  C  CG2   . VAL G 5  28   ? 198.949 156.814 174.558 1.00 97.14  ?  27   VAL G CG2   1 
ATOM   4594  N  N     . GLY G 5  29   ? 201.518 157.466 178.033 1.00 75.38  ?  28   GLY G N     1 
ATOM   4595  C  CA    . GLY G 5  29   ? 201.860 157.074 179.366 1.00 84.94  ?  28   GLY G CA    1 
ATOM   4596  C  C     . GLY G 5  29   ? 202.345 158.232 180.177 1.00 119.19 ?  28   GLY G C     1 
ATOM   4597  O  O     . GLY G 5  29   ? 202.330 158.065 181.370 1.00 119.88 ?  28   GLY G O     1 
ATOM   4598  N  N     . ARG G 5  30   ? 202.869 159.331 179.565 1.00 162.01 ?  29   ARG G N     1 
ATOM   4599  C  CA    . ARG G 5  30   ? 203.368 160.433 180.336 1.00 158.86 ?  29   ARG G CA    1 
ATOM   4600  C  C     . ARG G 5  30   ? 202.187 161.144 181.023 1.00 134.44 ?  29   ARG G C     1 
ATOM   4601  O  O     . ARG G 5  30   ? 202.176 161.701 182.133 1.00 118.75 ?  29   ARG G O     1 
ATOM   4602  C  CB    . ARG G 5  30   ? 204.008 161.479 179.417 1.00 134.75 ?  29   ARG G CB    1 
ATOM   4603  C  CG    . ARG G 5  30   ? 204.420 162.747 180.135 1.00 105.40 ?  29   ARG G CG    1 
ATOM   4604  C  CD    . ARG G 5  30   ? 204.970 163.746 179.097 1.00 77.35  ?  29   ARG G CD    1 
ATOM   4605  N  NE    . ARG G 5  30   ? 206.170 164.410 179.661 1.00 65.33  ?  29   ARG G NE    1 
ATOM   4606  C  CZ    . ARG G 5  30   ? 206.678 165.568 179.248 1.00 59.09  ?  29   ARG G CZ    1 
ATOM   4607  N  NH1   . ARG G 5  30   ? 206.226 166.163 178.135 1.00 44.40  1  29   ARG G NH1   1 
ATOM   4608  N  NH2   . ARG G 5  30   ? 207.644 166.104 179.984 1.00 58.91  ?  29   ARG G NH2   1 
ATOM   4609  N  N     . VAL G 5  31   ? 201.081 161.226 180.272 1.00 117.64 ?  30   VAL G N     1 
ATOM   4610  C  CA    . VAL G 5  31   ? 199.843 161.751 180.804 1.00 92.02  ?  30   VAL G CA    1 
ATOM   4611  C  C     . VAL G 5  31   ? 199.243 160.802 181.832 1.00 72.49  ?  30   VAL G C     1 
ATOM   4612  O  O     . VAL G 5  31   ? 198.690 161.332 182.760 1.00 104.66 ?  30   VAL G O     1 
ATOM   4613  C  CB    . VAL G 5  31   ? 198.930 162.105 179.629 1.00 112.41 ?  30   VAL G CB    1 
ATOM   4614  C  CG1   . VAL G 5  31   ? 199.562 163.370 178.962 1.00 84.70  ?  30   VAL G CG1   1 
ATOM   4615  C  CG2   . VAL G 5  31   ? 198.680 160.824 178.752 1.00 174.10 ?  30   VAL G CG2   1 
ATOM   4616  N  N     . HIS G 5  32   ? 199.368 159.486 181.783 1.00 55.12  ?  31   HIS G N     1 
ATOM   4617  C  CA    . HIS G 5  32   ? 198.894 158.632 182.812 1.00 56.06  ?  31   HIS G CA    1 
ATOM   4618  C  C     . HIS G 5  32   ? 199.480 158.893 184.211 1.00 78.68  ?  31   HIS G C     1 
ATOM   4619  O  O     . HIS G 5  32   ? 198.806 158.964 185.259 1.00 103.17 ?  31   HIS G O     1 
ATOM   4620  C  CB    . HIS G 5  32   ? 198.972 157.179 182.424 1.00 50.79  ?  31   HIS G CB    1 
ATOM   4621  C  CG    . HIS G 5  32   ? 198.687 156.286 183.583 1.00 75.63  ?  31   HIS G CG    1 
ATOM   4622  N  ND1   . HIS G 5  32   ? 199.141 155.019 183.707 1.00 100.00 ?  31   HIS G ND1   1 
ATOM   4623  C  CD2   . HIS G 5  32   ? 197.994 156.532 184.722 1.00 119.31 ?  31   HIS G CD2   1 
ATOM   4624  C  CE1   . HIS G 5  32   ? 198.715 154.511 184.868 1.00 107.90 ?  31   HIS G CE1   1 
ATOM   4625  N  NE2   . HIS G 5  32   ? 197.940 155.404 185.464 1.00 121.87 ?  31   HIS G NE2   1 
ATOM   4626  N  N     . ARG G 5  33   ? 200.811 159.039 184.222 1.00 115.72 ?  32   ARG G N     1 
ATOM   4627  C  CA    . ARG G 5  33   ? 201.572 159.299 185.473 1.00 157.55 ?  32   ARG G CA    1 
ATOM   4628  C  C     . ARG G 5  33   ? 201.177 160.672 186.028 1.00 165.07 ?  32   ARG G C     1 
ATOM   4629  O  O     . ARG G 5  33   ? 201.021 160.789 187.260 1.00 172.58 ?  32   ARG G O     1 
ATOM   4630  C  CB    . ARG G 5  33   ? 203.078 159.229 185.202 1.00 222.25 ?  32   ARG G CB    1 
ATOM   4631  C  CG    . ARG G 5  33   ? 203.944 159.591 186.401 1.00 252.62 ?  32   ARG G CG    1 
ATOM   4632  C  CD    . ARG G 5  33   ? 205.425 159.568 186.070 1.00 227.19 ?  32   ARG G CD    1 
ATOM   4633  N  NE    . ARG G 5  33   ? 205.836 160.726 185.289 1.00 200.85 ?  32   ARG G NE    1 
ATOM   4634  C  CZ    . ARG G 5  33   ? 205.880 161.969 185.755 1.00 161.61 ?  32   ARG G CZ    1 
ATOM   4635  N  NH1   . ARG G 5  33   ? 205.660 162.205 187.037 1.00 167.07 1  32   ARG G NH1   1 
ATOM   4636  N  NH2   . ARG G 5  33   ? 206.145 162.972 184.936 1.00 117.01 ?  32   ARG G NH2   1 
ATOM   4637  N  N     . LEU G 5  34   ? 201.024 161.664 185.145 1.00 132.47 ?  33   LEU G N     1 
ATOM   4638  C  CA    . LEU G 5  34   ? 200.645 163.042 185.559 1.00 103.43 ?  33   LEU G CA    1 
ATOM   4639  C  C     . LEU G 5  34   ? 199.264 163.012 186.225 1.00 92.48  ?  33   LEU G C     1 
ATOM   4640  O  O     . LEU G 5  34   ? 198.951 163.954 186.980 1.00 67.72  ?  33   LEU G O     1 
ATOM   4641  C  CB    . LEU G 5  34   ? 200.642 163.950 184.326 1.00 101.11 ?  33   LEU G CB    1 
ATOM   4642  C  CG    . LEU G 5  34   ? 200.085 165.355 184.545 1.00 108.99 ?  33   LEU G CG    1 
ATOM   4643  C  CD1   . LEU G 5  34   ? 201.027 166.183 185.407 1.00 130.97 ?  33   LEU G CD1   1 
ATOM   4644  C  CD2   . LEU G 5  34   ? 199.830 166.051 183.217 1.00 91.86  ?  33   LEU G CD2   1 
ATOM   4645  N  N     . LEU G 5  35   ? 198.478 161.966 185.951 1.00 129.58 ?  34   LEU G N     1 
ATOM   4646  C  CA    . LEU G 5  35   ? 197.116 161.826 186.535 1.00 159.33 ?  34   LEU G CA    1 
ATOM   4647  C  C     . LEU G 5  35   ? 197.219 161.139 187.901 1.00 195.68 ?  34   LEU G C     1 
ATOM   4648  O  O     . LEU G 5  35   ? 196.192 161.064 188.604 1.00 401.60 ?  34   LEU G O     1 
ATOM   4649  C  CB    . LEU G 5  35   ? 196.243 161.012 185.574 1.00 154.29 ?  34   LEU G CB    1 
ATOM   4650  C  CG    . LEU G 5  35   ? 195.935 161.686 184.238 1.00 140.66 ?  34   LEU G CG    1 
ATOM   4651  C  CD1   . LEU G 5  35   ? 195.339 160.692 183.254 1.00 227.06 ?  34   LEU G CD1   1 
ATOM   4652  C  CD2   . LEU G 5  35   ? 195.000 162.870 184.431 1.00 104.50 ?  34   LEU G CD2   1 
ATOM   4653  N  N     . ARG G 5  36   ? 198.417 160.659 188.253 1.00 132.67 ?  35   ARG G N     1 
ATOM   4654  C  CA    . ARG G 5  36   ? 198.641 159.971 189.553 1.00 128.65 ?  35   ARG G CA    1 
ATOM   4655  C  C     . ARG G 5  36   ? 199.467 160.880 190.471 1.00 178.13 ?  35   ARG G C     1 
ATOM   4656  O  O     . ARG G 5  36   ? 199.405 160.689 191.703 1.00 225.36 ?  35   ARG G O     1 
ATOM   4657  C  CB    . ARG G 5  36   ? 199.347 158.629 189.331 1.00 108.83 ?  35   ARG G CB    1 
ATOM   4658  C  CG    . ARG G 5  36   ? 198.494 157.590 188.616 1.00 113.01 ?  35   ARG G CG    1 
ATOM   4659  C  CD    . ARG G 5  36   ? 199.280 156.341 188.266 1.00 100.42 ?  35   ARG G CD    1 
ATOM   4660  N  NE    . ARG G 5  36   ? 200.349 156.607 187.314 1.00 99.35  ?  35   ARG G NE    1 
ATOM   4661  C  CZ    . ARG G 5  36   ? 201.184 155.688 186.843 1.00 98.22  ?  35   ARG G CZ    1 
ATOM   4662  N  NH1   . ARG G 5  36   ? 201.176 154.467 187.347 1.00 81.99  1  35   ARG G NH1   1 
ATOM   4663  N  NH2   . ARG G 5  36   ? 202.024 155.994 185.871 1.00 123.78 ?  35   ARG G NH2   1 
ATOM   4664  N  N     . LYS G 5  37   ? 200.205 161.828 189.886 1.00 244.46 ?  36   LYS G N     1 
ATOM   4665  C  CA    . LYS G 5  37   ? 201.051 162.767 190.672 1.00 326.47 ?  36   LYS G CA    1 
ATOM   4666  C  C     . LYS G 5  37   ? 200.262 164.054 190.943 1.00 317.89 ?  36   LYS G C     1 
ATOM   4667  O  O     . LYS G 5  37   ? 200.858 165.011 191.477 1.00 315.05 ?  36   LYS G O     1 
ATOM   4668  C  CB    . LYS G 5  37   ? 202.353 163.068 189.925 1.00 434.47 ?  36   LYS G CB    1 
ATOM   4669  C  CG    . LYS G 5  37   ? 203.336 163.966 190.664 1.00 440.00 ?  36   LYS G CG    1 
ATOM   4670  C  CD    . LYS G 5  37   ? 204.627 164.195 189.905 1.00 440.00 ?  36   LYS G CD    1 
ATOM   4671  C  CE    . LYS G 5  37   ? 205.590 165.108 190.634 1.00 440.00 ?  36   LYS G CE    1 
ATOM   4672  N  NZ    . LYS G 5  37   ? 206.840 165.310 189.866 1.00 440.00 1  36   LYS G NZ    1 
ATOM   4673  N  N     . GLY G 5  38   ? 198.972 164.067 190.588 1.00 326.98 ?  37   GLY G N     1 
ATOM   4674  C  CA    . GLY G 5  38   ? 198.157 165.193 190.792 1.00 267.24 ?  37   GLY G CA    1 
ATOM   4675  C  C     . GLY G 5  38   ? 197.010 165.054 191.802 1.00 204.62 ?  37   GLY G C     1 
ATOM   4676  O  O     . GLY G 5  38   ? 196.130 165.844 191.976 1.00 111.10 ?  37   GLY G O     1 
ATOM   4677  N  N     . ASN G 5  39   ? 197.088 163.899 192.458 1.00 250.96 ?  38   ASN G N     1 
ATOM   4678  C  CA    . ASN G 5  39   ? 196.236 163.489 193.563 1.00 245.61 ?  38   ASN G CA    1 
ATOM   4679  C  C     . ASN G 5  39   ? 194.759 163.355 193.147 1.00 155.08 ?  38   ASN G C     1 
ATOM   4680  O  O     . ASN G 5  39   ? 193.966 162.807 193.829 1.00 146.83 ?  38   ASN G O     1 
ATOM   4681  C  CB    . ASN G 5  39   ? 196.518 164.416 194.766 1.00 402.43 ?  38   ASN G CB    1 
ATOM   4682  C  CG    . ASN G 5  39   ? 197.950 164.372 195.288 1.00 440.00 ?  38   ASN G CG    1 
ATOM   4683  O  OD1   . ASN G 5  39   ? 198.619 163.336 195.233 1.00 440.00 ?  38   ASN G OD1   1 
ATOM   4684  N  ND2   . ASN G 5  39   ? 198.428 165.475 195.872 1.00 440.00 ?  38   ASN G ND2   1 
ATOM   4685  N  N     . TYR G 5  40   ? 194.408 163.767 191.950 1.00 83.13  ?  39   TYR G N     1 
ATOM   4686  C  CA    . TYR G 5  40   ? 193.054 163.766 191.495 1.00 54.60  ?  39   TYR G CA    1 
ATOM   4687  C  C     . TYR G 5  40   ? 192.246 162.513 191.880 1.00 54.30  ?  39   TYR G C     1 
ATOM   4688  O  O     . TYR G 5  40   ? 191.076 162.708 192.262 1.00 59.88  ?  39   TYR G O     1 
ATOM   4689  C  CB    . TYR G 5  40   ? 193.031 163.843 190.006 1.00 44.55  ?  39   TYR G CB    1 
ATOM   4690  C  CG    . TYR G 5  40   ? 193.473 165.189 189.536 1.00 50.18  ?  39   TYR G CG    1 
ATOM   4691  C  CD1   . TYR G 5  40   ? 192.775 166.329 189.802 1.00 53.43  ?  39   TYR G CD1   1 
ATOM   4692  C  CD2   . TYR G 5  40   ? 194.629 165.365 188.846 1.00 69.79  ?  39   TYR G CD2   1 
ATOM   4693  C  CE1   . TYR G 5  40   ? 193.278 167.587 189.460 1.00 64.64  ?  39   TYR G CE1   1 
ATOM   4694  C  CE2   . TYR G 5  40   ? 195.105 166.617 188.431 1.00 66.42  ?  39   TYR G CE2   1 
ATOM   4695  C  CZ    . TYR G 5  40   ? 194.431 167.754 188.731 1.00 56.13  ?  39   TYR G CZ    1 
ATOM   4696  O  OH    . TYR G 5  40   ? 194.900 168.930 188.327 1.00 44.23  ?  39   TYR G OH    1 
ATOM   4697  N  N     . ALA G 5  41   ? 192.795 161.291 191.934 1.00 56.22  ?  40   ALA G N     1 
ATOM   4698  C  CA    . ALA G 5  41   ? 191.991 160.323 192.655 1.00 62.87  ?  40   ALA G CA    1 
ATOM   4699  C  C     . ALA G 5  41   ? 192.686 159.007 192.995 1.00 69.51  ?  40   ALA G C     1 
ATOM   4700  O  O     . ALA G 5  41   ? 193.703 158.706 192.564 1.00 66.28  ?  40   ALA G O     1 
ATOM   4701  C  CB    . ALA G 5  41   ? 190.712 160.067 191.901 1.00 61.41  ?  40   ALA G CB    1 
ATOM   4702  N  N     . GLU G 5  42   ? 191.983 158.183 193.744 1.00 99.78  ?  41   GLU G N     1 
ATOM   4703  C  CA    . GLU G 5  42   ? 192.455 156.887 194.137 1.00 132.96 ?  41   GLU G CA    1 
ATOM   4704  C  C     . GLU G 5  42   ? 192.714 155.903 192.991 1.00 149.07 ?  41   GLU G C     1 
ATOM   4705  O  O     . GLU G 5  42   ? 193.687 155.287 193.094 1.00 252.44 ?  41   GLU G O     1 
ATOM   4706  C  CB    . GLU G 5  42   ? 191.439 156.218 195.051 1.00 167.46 ?  41   GLU G CB    1 
ATOM   4707  C  CG    . GLU G 5  42   ? 191.432 156.704 196.493 1.00 216.80 ?  41   GLU G CG    1 
ATOM   4708  C  CD    . GLU G 5  42   ? 190.883 155.680 197.502 1.00 213.64 ?  41   GLU G CD    1 
ATOM   4709  O  OE1   . GLU G 5  42   ? 191.176 154.431 197.421 1.00 187.28 ?  41   GLU G OE1   1 
ATOM   4710  O  OE2   . GLU G 5  42   ? 190.147 156.151 198.341 1.00 175.08 -1 41   GLU G OE2   1 
ATOM   4711  N  N     . ARG G 5  43   ? 191.910 155.832 191.920 1.00 158.03 ?  42   ARG G N     1 
ATOM   4712  C  CA    . ARG G 5  43   ? 192.260 154.874 190.747 1.00 149.08 ?  42   ARG G CA    1 
ATOM   4713  C  C     . ARG G 5  43   ? 192.288 155.600 189.381 1.00 169.01 ?  42   ARG G C     1 
ATOM   4714  O  O     . ARG G 5  43   ? 191.379 156.375 189.040 1.00 205.44 ?  42   ARG G O     1 
ATOM   4715  C  CB    . ARG G 5  43   ? 191.340 153.639 190.770 1.00 114.36 ?  42   ARG G CB    1 
ATOM   4716  C  CG    . ARG G 5  43   ? 191.594 152.679 191.916 1.00 106.01 ?  42   ARG G CG    1 
ATOM   4717  C  CD    . ARG G 5  43   ? 190.370 151.987 192.509 1.00 122.75 ?  42   ARG G CD    1 
ATOM   4718  N  NE    . ARG G 5  43   ? 190.731 150.873 193.367 1.00 143.95 ?  42   ARG G NE    1 
ATOM   4719  C  CZ    . ARG G 5  43   ? 190.847 149.599 192.964 1.00 154.64 ?  42   ARG G CZ    1 
ATOM   4720  N  NH1   . ARG G 5  43   ? 190.795 149.307 191.672 1.00 131.05 1  42   ARG G NH1   1 
ATOM   4721  N  NH2   . ARG G 5  43   ? 191.018 148.629 193.855 1.00 135.58 ?  42   ARG G NH2   1 
ATOM   4722  N  N     . VAL G 5  44   ? 193.279 155.297 188.505 1.00 159.72 ?  43   VAL G N     1 
ATOM   4723  C  CA    . VAL G 5  44   ? 193.426 155.962 187.193 1.00 152.04 ?  43   VAL G CA    1 
ATOM   4724  C  C     . VAL G 5  44   ? 192.941 154.977 186.124 1.00 185.32 ?  43   VAL G C     1 
ATOM   4725  O  O     . VAL G 5  44   ? 193.318 153.765 186.122 1.00 188.09 ?  43   VAL G O     1 
ATOM   4726  C  CB    . VAL G 5  44   ? 194.883 156.386 186.913 1.00 156.41 ?  43   VAL G CB    1 
ATOM   4727  C  CG1   . VAL G 5  44   ? 195.079 156.912 185.517 1.00 174.86 ?  43   VAL G CG1   1 
ATOM   4728  C  CG2   . VAL G 5  44   ? 195.396 157.414 187.854 1.00 122.09 ?  43   VAL G CG2   1 
ATOM   4729  N  N     . GLY G 5  45   ? 192.122 155.512 185.198 1.00 190.06 ?  44   GLY G N     1 
ATOM   4730  C  CA    . GLY G 5  45   ? 191.393 154.738 184.195 1.00 158.85 ?  44   GLY G CA    1 
ATOM   4731  C  C     . GLY G 5  45   ? 192.264 154.371 183.022 1.00 101.23 ?  44   GLY G C     1 
ATOM   4732  O  O     . GLY G 5  45   ? 193.431 154.857 183.025 1.00 96.87  ?  44   GLY G O     1 
ATOM   4733  N  N     . ALA G 5  46   ? 191.772 153.482 182.158 1.00 76.88  ?  45   ALA G N     1 
ATOM   4734  C  CA    . ALA G 5  46   ? 192.726 152.872 181.318 1.00 87.15  ?  45   ALA G CA    1 
ATOM   4735  C  C     . ALA G 5  46   ? 192.736 153.553 179.950 1.00 78.97  ?  45   ALA G C     1 
ATOM   4736  O  O     . ALA G 5  46   ? 193.734 153.657 179.165 1.00 91.83  ?  45   ALA G O     1 
ATOM   4737  C  CB    . ALA G 5  46   ? 192.417 151.399 181.165 1.00 95.63  ?  45   ALA G CB    1 
ATOM   4738  N  N     . GLY G 5  47   ? 191.563 153.910 179.528 1.00 66.33  ?  46   GLY G N     1 
ATOM   4739  C  CA    . GLY G 5  47   ? 191.634 154.606 178.200 1.00 61.44  ?  46   GLY G CA    1 
ATOM   4740  C  C     . GLY G 5  47   ? 191.309 156.034 178.405 1.00 52.81  ?  46   GLY G C     1 
ATOM   4741  O  O     . GLY G 5  47   ? 190.982 156.785 177.501 1.00 49.69  ?  46   GLY G O     1 
ATOM   4742  N  N     . ALA G 5  48   ? 191.141 156.480 179.626 1.00 60.51  ?  47   ALA G N     1 
ATOM   4743  C  CA    . ALA G 5  48   ? 190.971 157.864 179.982 1.00 82.47  ?  47   ALA G CA    1 
ATOM   4744  C  C     . ALA G 5  48   ? 192.137 158.626 179.460 1.00 57.70  ?  47   ALA G C     1 
ATOM   4745  O  O     . ALA G 5  48   ? 192.104 159.756 178.942 1.00 42.16  ?  47   ALA G O     1 
ATOM   4746  C  CB    . ALA G 5  48   ? 190.895 157.941 181.497 1.00 114.99 ?  47   ALA G CB    1 
ATOM   4747  N  N     . PRO G 5  49   ? 193.264 158.091 179.919 1.00 67.21  ?  48   PRO G N     1 
ATOM   4748  C  CA    . PRO G 5  49   ? 194.466 158.809 179.654 1.00 92.06  ?  48   PRO G CA    1 
ATOM   4749  C  C     . PRO G 5  49   ? 194.474 159.187 178.175 1.00 71.76  ?  48   PRO G C     1 
ATOM   4750  O  O     . PRO G 5  49   ? 194.955 160.198 177.797 1.00 59.81  ?  48   PRO G O     1 
ATOM   4751  C  CB    . PRO G 5  49   ? 195.596 157.798 180.105 1.00 137.57 ?  48   PRO G CB    1 
ATOM   4752  C  CG    . PRO G 5  49   ? 194.899 156.852 181.067 1.00 102.96 ?  48   PRO G CG    1 
ATOM   4753  C  CD    . PRO G 5  49   ? 193.468 156.801 180.607 1.00 68.58  ?  48   PRO G CD    1 
ATOM   4754  N  N     . VAL G 5  50   ? 194.174 158.241 177.302 1.00 70.09  ?  49   VAL G N     1 
ATOM   4755  C  CA    . VAL G 5  50   ? 194.334 158.364 175.866 1.00 83.07  ?  49   VAL G CA    1 
ATOM   4756  C  C     . VAL G 5  50   ? 193.364 159.374 175.357 1.00 54.78  ?  49   VAL G C     1 
ATOM   4757  O  O     . VAL G 5  50   ? 193.607 160.076 174.458 1.00 44.18  ?  49   VAL G O     1 
ATOM   4758  C  CB    . VAL G 5  50   ? 194.141 156.996 175.142 1.00 141.86 ?  49   VAL G CB    1 
ATOM   4759  C  CG1   . VAL G 5  50   ? 193.860 157.146 173.661 1.00 188.55 ?  49   VAL G CG1   1 
ATOM   4760  C  CG2   . VAL G 5  50   ? 195.296 156.038 175.438 1.00 215.02 ?  49   VAL G CG2   1 
ATOM   4761  N  N     . TYR G 5  51   ? 192.155 159.185 175.808 1.00 60.17  ?  50   TYR G N     1 
ATOM   4762  C  CA    . TYR G 5  51   ? 191.045 159.930 175.388 1.00 95.33  ?  50   TYR G CA    1 
ATOM   4763  C  C     . TYR G 5  51   ? 191.425 161.377 175.562 1.00 78.89  ?  50   TYR G C     1 
ATOM   4764  O  O     . TYR G 5  51   ? 191.095 162.273 174.860 1.00 65.93  ?  50   TYR G O     1 
ATOM   4765  C  CB    . TYR G 5  51   ? 189.811 159.559 176.229 1.00 151.85 ?  50   TYR G CB    1 
ATOM   4766  C  CG    . TYR G 5  51   ? 188.634 160.489 176.109 1.00 203.79 ?  50   TYR G CG    1 
ATOM   4767  C  CD1   . TYR G 5  51   ? 188.517 161.672 176.821 1.00 300.23 ?  50   TYR G CD1   1 
ATOM   4768  C  CD2   . TYR G 5  51   ? 187.597 160.181 175.259 1.00 233.94 ?  50   TYR G CD2   1 
ATOM   4769  C  CE1   . TYR G 5  51   ? 187.428 162.526 176.659 1.00 329.10 ?  50   TYR G CE1   1 
ATOM   4770  C  CE2   . TYR G 5  51   ? 186.451 160.983 175.135 1.00 258.16 ?  50   TYR G CE2   1 
ATOM   4771  C  CZ    . TYR G 5  51   ? 186.391 162.201 175.799 1.00 293.53 ?  50   TYR G CZ    1 
ATOM   4772  O  OH    . TYR G 5  51   ? 185.304 163.045 175.681 1.00 263.81 ?  50   TYR G OH    1 
ATOM   4773  N  N     . LEU G 5  52   ? 191.922 161.629 176.760 1.00 77.27  ?  51   LEU G N     1 
ATOM   4774  C  CA    . LEU G 5  52   ? 192.264 162.970 177.201 1.00 86.04  ?  51   LEU G CA    1 
ATOM   4775  C  C     . LEU G 5  52   ? 193.401 163.513 176.359 1.00 54.41  ?  51   LEU G C     1 
ATOM   4776  O  O     . LEU G 5  52   ? 193.466 164.556 175.955 1.00 33.59  ?  51   LEU G O     1 
ATOM   4777  C  CB    . LEU G 5  52   ? 192.609 162.823 178.672 1.00 113.11 ?  51   LEU G CB    1 
ATOM   4778  C  CG    . LEU G 5  52   ? 191.586 162.407 179.695 1.00 166.67 ?  51   LEU G CG    1 
ATOM   4779  C  CD1   . LEU G 5  52   ? 192.389 162.241 180.981 1.00 190.37 ?  51   LEU G CD1   1 
ATOM   4780  C  CD2   . LEU G 5  52   ? 190.486 163.441 179.852 1.00 163.23 ?  51   LEU G CD2   1 
ATOM   4781  N  N     . ALA G 5  53   ? 194.362 162.674 176.102 1.00 60.03  ?  52   ALA G N     1 
ATOM   4782  C  CA    . ALA G 5  53   ? 195.545 163.098 175.348 1.00 80.32  ?  52   ALA G CA    1 
ATOM   4783  C  C     . ALA G 5  53   ? 195.099 163.519 173.976 1.00 63.25  ?  52   ALA G C     1 
ATOM   4784  O  O     . ALA G 5  53   ? 195.701 164.349 173.304 1.00 73.14  ?  52   ALA G O     1 
ATOM   4785  C  CB    . ALA G 5  53   ? 196.594 161.962 175.295 1.00 98.77  ?  52   ALA G CB    1 
ATOM   4786  N  N     . ALA G 5  54   ? 194.215 162.726 173.428 1.00 59.65  ?  53   ALA G N     1 
ATOM   4787  C  CA    . ALA G 5  54   ? 193.820 162.886 172.088 1.00 70.68  ?  53   ALA G CA    1 
ATOM   4788  C  C     . ALA G 5  54   ? 193.024 164.192 171.994 1.00 56.44  ?  53   ALA G C     1 
ATOM   4789  O  O     . ALA G 5  54   ? 192.990 164.893 170.964 1.00 48.00  ?  53   ALA G O     1 
ATOM   4790  C  CB    . ALA G 5  54   ? 193.032 161.663 171.745 1.00 96.66  ?  53   ALA G CB    1 
ATOM   4791  N  N     . VAL G 5  55   ? 192.278 164.475 173.033 1.00 56.29  ?  54   VAL G N     1 
ATOM   4792  C  CA    . VAL G 5  55   ? 191.388 165.615 173.046 1.00 71.74  ?  54   VAL G CA    1 
ATOM   4793  C  C     . VAL G 5  55   ? 192.132 166.898 172.892 1.00 53.19  ?  54   VAL G C     1 
ATOM   4794  O  O     . VAL G 5  55   ? 191.653 167.831 172.275 1.00 42.20  ?  54   VAL G O     1 
ATOM   4795  C  CB    . VAL G 5  55   ? 190.582 165.696 174.346 1.00 99.49  ?  54   VAL G CB    1 
ATOM   4796  C  CG1   . VAL G 5  55   ? 189.950 167.090 174.457 1.00 116.41 ?  54   VAL G CG1   1 
ATOM   4797  C  CG2   . VAL G 5  55   ? 189.575 164.539 174.406 1.00 101.28 ?  54   VAL G CG2   1 
ATOM   4798  N  N     . LEU G 5  56   ? 193.187 167.019 173.663 1.00 50.22  ?  55   LEU G N     1 
ATOM   4799  C  CA    . LEU G 5  56   ? 193.908 168.224 173.745 1.00 60.92  ?  55   LEU G CA    1 
ATOM   4800  C  C     . LEU G 5  56   ? 194.582 168.393 172.427 1.00 56.72  ?  55   LEU G C     1 
ATOM   4801  O  O     . LEU G 5  56   ? 195.053 169.444 171.994 1.00 44.34  ?  55   LEU G O     1 
ATOM   4802  C  CB    . LEU G 5  56   ? 194.883 168.192 174.918 1.00 79.73  ?  55   LEU G CB    1 
ATOM   4803  C  CG    . LEU G 5  56   ? 194.296 167.799 176.265 1.00 112.29 ?  55   LEU G CG    1 
ATOM   4804  C  CD1   . LEU G 5  56   ? 195.334 167.824 177.378 1.00 118.72 ?  55   LEU G CD1   1 
ATOM   4805  C  CD2   . LEU G 5  56   ? 193.108 168.668 176.688 1.00 224.51 ?  55   LEU G CD2   1 
ATOM   4806  N  N     . GLU G 5  57   ? 194.883 167.234 171.909 1.00 79.66  ?  56   GLU G N     1 
ATOM   4807  C  CA    . GLU G 5  57   ? 195.573 167.114 170.708 1.00 128.82 ?  56   GLU G CA    1 
ATOM   4808  C  C     . GLU G 5  57   ? 194.782 167.903 169.683 1.00 72.85  ?  56   GLU G C     1 
ATOM   4809  O  O     . GLU G 5  57   ? 195.340 168.563 168.850 1.00 58.61  ?  56   GLU G O     1 
ATOM   4810  C  CB    . GLU G 5  57   ? 195.763 165.632 170.352 1.00 286.66 ?  56   GLU G CB    1 
ATOM   4811  C  CG    . GLU G 5  57   ? 196.564 165.359 169.047 1.00 435.53 ?  56   GLU G CG    1 
ATOM   4812  C  CD    . GLU G 5  57   ? 195.731 165.575 167.795 1.00 429.58 ?  56   GLU G CD    1 
ATOM   4813  O  OE1   . GLU G 5  57   ? 194.456 165.536 167.908 1.00 420.22 ?  56   GLU G OE1   1 
ATOM   4814  O  OE2   . GLU G 5  57   ? 196.366 165.884 166.750 1.00 194.28 -1 56   GLU G OE2   1 
ATOM   4815  N  N     . TYR G 5  58   ? 193.486 167.682 169.672 1.00 64.53  ?  57   TYR G N     1 
ATOM   4816  C  CA    . TYR G 5  58   ? 192.611 168.340 168.773 1.00 82.88  ?  57   TYR G CA    1 
ATOM   4817  C  C     . TYR G 5  58   ? 192.611 169.829 169.022 1.00 67.23  ?  57   TYR G C     1 
ATOM   4818  O  O     . TYR G 5  58   ? 192.539 170.670 168.084 1.00 54.15  ?  57   TYR G O     1 
ATOM   4819  C  CB    . TYR G 5  58   ? 191.171 167.829 168.958 1.00 110.46 ?  57   TYR G CB    1 
ATOM   4820  C  CG    . TYR G 5  58   ? 190.106 168.657 168.264 1.00 151.40 ?  57   TYR G CG    1 
ATOM   4821  C  CD1   . TYR G 5  58   ? 189.971 168.653 166.877 1.00 182.06 ?  57   TYR G CD1   1 
ATOM   4822  C  CD2   . TYR G 5  58   ? 189.133 169.340 168.960 1.00 159.64 ?  57   TYR G CD2   1 
ATOM   4823  C  CE1   . TYR G 5  58   ? 188.994 169.408 166.214 1.00 167.23 ?  57   TYR G CE1   1 
ATOM   4824  C  CE2   . TYR G 5  58   ? 188.118 170.045 168.314 1.00 142.51 ?  57   TYR G CE2   1 
ATOM   4825  C  CZ    . TYR G 5  58   ? 188.056 170.129 166.933 1.00 138.95 ?  57   TYR G CZ    1 
ATOM   4826  O  OH    . TYR G 5  58   ? 187.068 170.904 166.346 1.00 132.74 ?  57   TYR G OH    1 
ATOM   4827  N  N     . LEU G 5  59   ? 192.515 170.146 170.306 1.00 67.65  ?  58   LEU G N     1 
ATOM   4828  C  CA    . LEU G 5  59   ? 192.340 171.524 170.662 1.00 82.83  ?  58   LEU G CA    1 
ATOM   4829  C  C     . LEU G 5  59   ? 193.569 172.299 170.184 1.00 64.51  ?  58   LEU G C     1 
ATOM   4830  O  O     . LEU G 5  59   ? 193.573 173.475 169.719 1.00 48.27  ?  58   LEU G O     1 
ATOM   4831  C  CB    . LEU G 5  59   ? 192.289 171.547 172.176 1.00 96.13  ?  58   LEU G CB    1 
ATOM   4832  C  CG    . LEU G 5  59   ? 191.141 170.762 172.809 1.00 108.05 ?  58   LEU G CG    1 
ATOM   4833  C  CD1   . LEU G 5  59   ? 191.327 170.741 174.275 1.00 121.04 ?  58   LEU G CD1   1 
ATOM   4834  C  CD2   . LEU G 5  59   ? 189.807 171.428 172.517 1.00 179.30 ?  58   LEU G CD2   1 
ATOM   4835  N  N     . THR G 5  60   ? 194.700 171.684 170.463 1.00 60.93  ?  59   THR G N     1 
ATOM   4836  C  CA    . THR G 5  60   ? 195.947 172.320 170.062 1.00 64.43  ?  59   THR G CA    1 
ATOM   4837  C  C     . THR G 5  60   ? 195.926 172.633 168.607 1.00 52.31  ?  59   THR G C     1 
ATOM   4838  O  O     . THR G 5  60   ? 196.329 173.630 168.095 1.00 39.95  ?  59   THR G O     1 
ATOM   4839  C  CB    . THR G 5  60   ? 197.124 171.419 170.336 1.00 75.20  ?  59   THR G CB    1 
ATOM   4840  O  OG1   . THR G 5  60   ? 196.848 170.116 169.878 1.00 70.02  ?  59   THR G OG1   1 
ATOM   4841  C  CG2   . THR G 5  60   ? 197.263 171.284 171.820 1.00 99.84  ?  59   THR G CG2   1 
ATOM   4842  N  N     . ALA G 5  61   ? 195.487 171.618 167.922 1.00 66.82  ?  60   ALA G N     1 
ATOM   4843  C  CA    . ALA G 5  61   ? 195.429 171.671 166.509 1.00 92.95  ?  60   ALA G CA    1 
ATOM   4844  C  C     . ALA G 5  61   ? 194.521 172.755 166.107 1.00 84.84  ?  60   ALA G C     1 
ATOM   4845  O  O     . ALA G 5  61   ? 194.764 173.467 165.151 1.00 73.92  ?  60   ALA G O     1 
ATOM   4846  C  CB    . ALA G 5  61   ? 194.884 170.353 165.964 1.00 139.17 ?  60   ALA G CB    1 
ATOM   4847  N  N     . GLU G 5  62   ? 193.368 172.711 166.777 1.00 90.15  ?  61   GLU G N     1 
ATOM   4848  C  CA    . GLU G 5  62   ? 192.298 173.605 166.432 1.00 120.41 ?  61   GLU G CA    1 
ATOM   4849  C  C     . GLU G 5  62   ? 192.829 175.042 166.458 1.00 115.66 ?  61   GLU G C     1 
ATOM   4850  O  O     . GLU G 5  62   ? 192.445 175.886 165.618 1.00 80.24  ?  61   GLU G O     1 
ATOM   4851  C  CB    . GLU G 5  62   ? 191.192 173.518 167.471 1.00 171.55 ?  61   GLU G CB    1 
ATOM   4852  C  CG    . GLU G 5  62   ? 189.987 174.402 167.217 1.00 249.48 ?  61   GLU G CG    1 
ATOM   4853  C  CD    . GLU G 5  62   ? 189.254 174.098 165.952 1.00 227.92 ?  61   GLU G CD    1 
ATOM   4854  O  OE1   . GLU G 5  62   ? 189.498 173.051 165.319 1.00 204.00 ?  61   GLU G OE1   1 
ATOM   4855  O  OE2   . GLU G 5  62   ? 188.435 174.927 165.670 1.00 131.28 -1 61   GLU G OE2   1 
ATOM   4856  N  N     . ILE G 5  63   ? 193.633 175.311 167.509 1.00 122.17 ?  62   ILE G N     1 
ATOM   4857  C  CA    . ILE G 5  63   ? 194.138 176.641 167.754 1.00 148.84 ?  62   ILE G CA    1 
ATOM   4858  C  C     . ILE G 5  63   ? 195.333 176.875 166.855 1.00 98.16  ?  62   ILE G C     1 
ATOM   4859  O  O     . ILE G 5  63   ? 195.769 178.012 166.699 1.00 65.94  ?  62   ILE G O     1 
ATOM   4860  C  CB    . ILE G 5  63   ? 194.605 176.847 169.221 1.00 251.75 ?  62   ILE G CB    1 
ATOM   4861  C  CG1   . ILE G 5  63   ? 193.492 176.568 170.227 1.00 353.18 ?  62   ILE G CG1   1 
ATOM   4862  C  CG2   . ILE G 5  63   ? 195.226 178.256 169.417 1.00 275.27 ?  62   ILE G CG2   1 
ATOM   4863  C  CD1   . ILE G 5  63   ? 194.006 176.424 171.639 1.00 418.34 ?  62   ILE G CD1   1 
ATOM   4864  N  N     . LEU G 5  64   ? 196.049 175.781 166.596 1.00 99.22  ?  63   LEU G N     1 
ATOM   4865  C  CA    . LEU G 5  64   ? 197.325 175.860 165.956 1.00 107.88 ?  63   LEU G CA    1 
ATOM   4866  C  C     . LEU G 5  64   ? 197.116 175.810 164.472 1.00 88.55  ?  63   LEU G C     1 
ATOM   4867  O  O     . LEU G 5  64   ? 198.084 175.896 163.740 1.00 95.54  ?  63   LEU G O     1 
ATOM   4868  C  CB    . LEU G 5  64   ? 198.205 174.718 166.448 1.00 131.73 ?  63   LEU G CB    1 
ATOM   4869  C  CG    . LEU G 5  64   ? 199.066 175.138 167.642 1.00 202.15 ?  63   LEU G CG    1 
ATOM   4870  C  CD1   . LEU G 5  64   ? 200.191 174.156 167.880 1.00 256.74 ?  63   LEU G CD1   1 
ATOM   4871  C  CD2   . LEU G 5  64   ? 199.650 176.523 167.422 1.00 279.31 ?  63   LEU G CD2   1 
ATOM   4872  N  N     . GLU G 5  65   ? 195.870 175.708 164.058 1.00 96.78  ?  64   GLU G N     1 
ATOM   4873  C  CA    . GLU G 5  65   ? 195.566 175.518 162.691 1.00 128.07 ?  64   GLU G CA    1 
ATOM   4874  C  C     . GLU G 5  65   ? 195.393 176.900 162.053 1.00 106.78 ?  64   GLU G C     1 
ATOM   4875  O  O     . GLU G 5  65   ? 195.517 177.040 160.821 1.00 88.96  ?  64   GLU G O     1 
ATOM   4876  C  CB    . GLU G 5  65   ? 194.291 174.697 162.581 1.00 204.96 ?  64   GLU G CB    1 
ATOM   4877  C  CG    . GLU G 5  65   ? 193.758 174.604 161.176 1.00 327.76 ?  64   GLU G CG    1 
ATOM   4878  C  CD    . GLU G 5  65   ? 192.818 175.731 160.838 1.00 427.11 ?  64   GLU G CD    1 
ATOM   4879  O  OE1   . GLU G 5  65   ? 192.373 176.433 161.790 1.00 440.00 ?  64   GLU G OE1   1 
ATOM   4880  O  OE2   . GLU G 5  65   ? 192.496 175.851 159.638 1.00 431.59 -1 64   GLU G OE2   1 
ATOM   4881  N  N     . LEU G 5  66   ? 194.953 177.870 162.845 1.00 104.44 ?  65   LEU G N     1 
ATOM   4882  C  CA    . LEU G 5  66   ? 194.722 179.172 162.362 1.00 131.40 ?  65   LEU G CA    1 
ATOM   4883  C  C     . LEU G 5  66   ? 195.848 180.080 162.755 1.00 91.92  ?  65   LEU G C     1 
ATOM   4884  O  O     . LEU G 5  66   ? 195.975 181.146 162.189 1.00 80.13  ?  65   LEU G O     1 
ATOM   4885  C  CB    . LEU G 5  66   ? 193.395 179.654 162.923 1.00 190.82 ?  65   LEU G CB    1 
ATOM   4886  C  CG    . LEU G 5  66   ? 193.164 181.167 162.738 1.00 265.85 ?  65   LEU G CG    1 
ATOM   4887  C  CD1   . LEU G 5  66   ? 193.042 181.620 161.260 1.00 306.95 ?  65   LEU G CD1   1 
ATOM   4888  C  CD2   . LEU G 5  66   ? 191.967 181.621 163.528 1.00 312.95 ?  65   LEU G CD2   1 
ATOM   4889  N  N     . ALA G 5  67   ? 196.572 179.734 163.801 1.00 80.96  ?  66   ALA G N     1 
ATOM   4890  C  CA    . ALA G 5  67   ? 197.676 180.415 164.253 1.00 95.86  ?  66   ALA G CA    1 
ATOM   4891  C  C     . ALA G 5  67   ? 198.606 180.530 163.046 1.00 80.19  ?  66   ALA G C     1 
ATOM   4892  O  O     . ALA G 5  67   ? 199.241 181.563 162.742 1.00 62.94  ?  66   ALA G O     1 
ATOM   4893  C  CB    . ALA G 5  67   ? 198.320 179.748 165.468 1.00 96.92  ?  66   ALA G CB    1 
ATOM   4894  N  N     . GLY G 5  68   ? 198.715 179.419 162.379 1.00 82.72  ?  67   GLY G N     1 
ATOM   4895  C  CA    . GLY G 5  68   ? 199.564 179.402 161.207 1.00 116.80 ?  67   GLY G CA    1 
ATOM   4896  C  C     . GLY G 5  68   ? 199.023 180.234 160.071 1.00 99.24  ?  67   GLY G C     1 
ATOM   4897  O  O     . GLY G 5  68   ? 199.706 180.806 159.247 1.00 78.87  ?  67   GLY G O     1 
ATOM   4898  N  N     . ASN G 5  69   ? 197.716 180.173 159.976 1.00 102.92 ?  68   ASN G N     1 
ATOM   4899  C  CA    . ASN G 5  69   ? 197.014 180.917 158.937 1.00 131.32 ?  68   ASN G CA    1 
ATOM   4900  C  C     . ASN G 5  69   ? 197.189 182.408 159.197 1.00 103.77 ?  68   ASN G C     1 
ATOM   4901  O  O     . ASN G 5  69   ? 197.317 183.173 158.311 1.00 99.22  ?  68   ASN G O     1 
ATOM   4902  C  CB    . ASN G 5  69   ? 195.536 180.528 158.940 1.00 158.07 ?  68   ASN G CB    1 
ATOM   4903  C  CG    . ASN G 5  69   ? 195.265 179.053 158.867 1.00 159.50 ?  68   ASN G CG    1 
ATOM   4904  O  OD1   . ASN G 5  69   ? 194.245 178.651 159.368 1.00 204.38 ?  68   ASN G OD1   1 
ATOM   4905  N  ND2   . ASN G 5  69   ? 196.109 178.238 158.253 1.00 155.84 ?  68   ASN G ND2   1 
ATOM   4906  N  N     . ALA G 5  70   ? 197.231 182.786 160.464 1.00 98.80  ?  69   ALA G N     1 
ATOM   4907  C  CA    . ALA G 5  70   ? 197.437 184.156 160.804 1.00 135.02 ?  69   ALA G CA    1 
ATOM   4908  C  C     . ALA G 5  70   ? 198.859 184.558 160.397 1.00 143.62 ?  69   ALA G C     1 
ATOM   4909  O  O     . ALA G 5  70   ? 199.116 185.640 159.957 1.00 127.44 ?  69   ALA G O     1 
ATOM   4910  C  CB    . ALA G 5  70   ? 197.235 184.367 162.283 1.00 185.83 ?  69   ALA G CB    1 
ATOM   4911  N  N     . ALA G 5  71   ? 199.798 183.656 160.643 1.00 162.45 ?  70   ALA G N     1 
ATOM   4912  C  CA    . ALA G 5  71   ? 201.167 183.903 160.289 1.00 208.05 ?  70   ALA G CA    1 
ATOM   4913  C  C     . ALA G 5  71   ? 201.297 184.055 158.778 1.00 188.82 ?  70   ALA G C     1 
ATOM   4914  O  O     . ALA G 5  71   ? 202.030 184.936 158.308 1.00 177.61 ?  70   ALA G O     1 
ATOM   4915  C  CB    . ALA G 5  71   ? 202.044 182.788 160.798 1.00 218.69 ?  70   ALA G CB    1 
ATOM   4916  N  N     . ARG G 5  72   ? 200.551 183.239 158.031 1.00 180.37 ?  71   ARG G N     1 
ATOM   4917  C  CA    . ARG G 5  72   ? 200.500 183.369 156.558 1.00 225.65 ?  71   ARG G CA    1 
ATOM   4918  C  C     . ARG G 5  72   ? 199.987 184.778 156.244 1.00 200.32 ?  71   ARG G C     1 
ATOM   4919  O  O     . ARG G 5  72   ? 200.524 185.440 155.357 1.00 203.68 ?  71   ARG G O     1 
ATOM   4920  C  CB    . ARG G 5  72   ? 199.553 182.354 155.902 1.00 300.68 ?  71   ARG G CB    1 
ATOM   4921  C  CG    . ARG G 5  72   ? 199.169 182.669 154.459 1.00 402.98 ?  71   ARG G CG    1 
ATOM   4922  C  CD    . ARG G 5  72   ? 200.296 182.784 153.435 1.00 440.00 ?  71   ARG G CD    1 
ATOM   4923  N  NE    . ARG G 5  72   ? 199.806 182.973 152.056 1.00 440.00 ?  71   ARG G NE    1 
ATOM   4924  C  CZ    . ARG G 5  72   ? 199.850 184.109 151.300 1.00 381.29 ?  71   ARG G CZ    1 
ATOM   4925  N  NH1   . ARG G 5  72   ? 199.924 185.299 151.874 1.00 315.23 1  71   ARG G NH1   1 
ATOM   4926  N  NH2   . ARG G 5  72   ? 199.759 184.041 149.980 1.00 352.05 ?  71   ARG G NH2   1 
ATOM   4927  N  N     . ASP G 5  73   ? 198.970 185.220 157.001 1.00 194.19 ?  72   ASP G N     1 
ATOM   4928  C  CA    . ASP G 5  73   ? 198.280 186.455 156.712 1.00 233.30 ?  72   ASP G CA    1 
ATOM   4929  C  C     . ASP G 5  73   ? 199.258 187.625 156.608 1.00 225.24 ?  72   ASP G C     1 
ATOM   4930  O  O     . ASP G 5  73   ? 199.119 188.479 155.733 1.00 232.47 ?  72   ASP G O     1 
ATOM   4931  C  CB    . ASP G 5  73   ? 197.139 186.695 157.692 1.00 230.50 ?  72   ASP G CB    1 
ATOM   4932  C  CG    . ASP G 5  73   ? 195.961 185.781 157.389 1.00 232.72 ?  72   ASP G CG    1 
ATOM   4933  O  OD1   . ASP G 5  73   ? 195.965 185.172 156.302 1.00 242.98 ?  72   ASP G OD1   1 
ATOM   4934  O  OD2   . ASP G 5  73   ? 194.977 185.796 158.147 1.00 430.26 -1 72   ASP G OD2   1 
ATOM   4935  N  N     . ASN G 5  74   ? 200.223 187.717 157.551 1.00 229.56 ?  73   ASN G N     1 
ATOM   4936  C  CA    . ASN G 5  74   ? 200.998 188.899 157.754 1.00 374.54 ?  73   ASN G CA    1 
ATOM   4937  C  C     . ASN G 5  74   ? 202.404 188.850 157.116 1.00 403.11 ?  73   ASN G C     1 
ATOM   4938  O  O     . ASN G 5  74   ? 203.224 189.710 157.431 1.00 440.00 ?  73   ASN G O     1 
ATOM   4939  C  CB    . ASN G 5  74   ? 201.098 189.261 159.261 1.00 440.00 ?  73   ASN G CB    1 
ATOM   4940  C  CG    . ASN G 5  74   ? 201.589 190.675 159.451 1.00 440.00 ?  73   ASN G CG    1 
ATOM   4941  O  OD1   . ASN G 5  74   ? 201.372 191.544 158.594 1.00 440.00 ?  73   ASN G OD1   1 
ATOM   4942  N  ND2   . ASN G 5  74   ? 202.332 190.885 160.523 1.00 440.00 ?  73   ASN G ND2   1 
ATOM   4943  N  N     . LYS G 5  75   ? 202.694 187.869 156.225 1.00 325.57 ?  74   LYS G N     1 
ATOM   4944  C  CA    . LYS G 5  75   ? 203.928 187.679 155.426 1.00 290.82 ?  74   LYS G CA    1 
ATOM   4945  C  C     . LYS G 5  75   ? 205.109 186.977 156.125 1.00 254.62 ?  74   LYS G C     1 
ATOM   4946  O  O     . LYS G 5  75   ? 206.253 187.276 155.830 1.00 222.31 ?  74   LYS G O     1 
ATOM   4947  C  CB    . LYS G 5  75   ? 204.444 189.012 154.872 1.00 303.70 ?  74   LYS G CB    1 
ATOM   4948  C  CG    . LYS G 5  75   ? 203.472 189.776 153.975 1.00 326.49 ?  74   LYS G CG    1 
ATOM   4949  C  CD    . LYS G 5  75   ? 203.913 191.183 153.593 1.00 312.46 ?  74   LYS G CD    1 
ATOM   4950  C  CE    . LYS G 5  75   ? 203.644 192.227 154.656 1.00 291.20 ?  74   LYS G CE    1 
ATOM   4951  N  NZ    . LYS G 5  75   ? 202.199 192.391 154.952 1.00 273.80 1  74   LYS G NZ    1 
ATOM   4952  N  N     . LYS G 5  76   ? 204.801 186.061 157.048 1.00 216.19 ?  75   LYS G N     1 
ATOM   4953  C  CA    . LYS G 5  76   ? 205.859 185.333 157.799 1.00 167.10 ?  75   LYS G CA    1 
ATOM   4954  C  C     . LYS G 5  76   ? 205.655 183.821 157.651 1.00 139.53 ?  75   LYS G C     1 
ATOM   4955  O  O     . LYS G 5  76   ? 204.505 183.397 157.419 1.00 168.70 ?  75   LYS G O     1 
ATOM   4956  C  CB    . LYS G 5  76   ? 205.849 185.749 159.274 1.00 178.56 ?  75   LYS G CB    1 
ATOM   4957  C  CG    . LYS G 5  76   ? 206.256 187.190 159.546 1.00 232.92 ?  75   LYS G CG    1 
ATOM   4958  C  CD    . LYS G 5  76   ? 206.207 187.562 161.013 1.00 305.77 ?  75   LYS G CD    1 
ATOM   4959  C  CE    . LYS G 5  76   ? 206.636 188.989 161.278 1.00 318.44 ?  75   LYS G CE    1 
ATOM   4960  N  NZ    . LYS G 5  76   ? 206.555 189.329 162.719 1.00 307.19 1  75   LYS G NZ    1 
ATOM   4961  N  N     . THR G 5  77   ? 206.738 183.050 157.783 1.00 121.78 ?  76   THR G N     1 
ATOM   4962  C  CA    . THR G 5  77   ? 206.680 181.568 157.671 1.00 154.21 ?  76   THR G CA    1 
ATOM   4963  C  C     . THR G 5  77   ? 206.701 180.958 159.076 1.00 113.90 ?  76   THR G C     1 
ATOM   4964  O  O     . THR G 5  77   ? 206.389 179.757 159.206 1.00 89.20  ?  76   THR G O     1 
ATOM   4965  C  CB    . THR G 5  77   ? 207.829 181.031 156.806 1.00 241.25 ?  76   THR G CB    1 
ATOM   4966  O  OG1   . THR G 5  77   ? 207.658 181.536 155.481 1.00 308.66 ?  76   THR G OG1   1 
ATOM   4967  C  CG2   . THR G 5  77   ? 207.888 179.520 156.775 1.00 267.96 ?  76   THR G CG2   1 
ATOM   4968  N  N     . ARG G 5  78   ? 207.057 181.765 160.083 1.00 109.19 ?  77   ARG G N     1 
ATOM   4969  C  CA    . ARG G 5  78   ? 207.109 181.300 161.495 1.00 129.56 ?  77   ARG G CA    1 
ATOM   4970  C  C     . ARG G 5  78   ? 205.795 181.671 162.191 1.00 152.63 ?  77   ARG G C     1 
ATOM   4971  O  O     . ARG G 5  78   ? 204.818 181.979 161.480 1.00 125.82 ?  77   ARG G O     1 
ATOM   4972  C  CB    . ARG G 5  78   ? 208.312 181.915 162.216 1.00 134.50 ?  77   ARG G CB    1 
ATOM   4973  C  CG    . ARG G 5  78   ? 209.661 181.471 161.670 1.00 167.55 ?  77   ARG G CG    1 
ATOM   4974  C  CD    . ARG G 5  78   ? 210.822 182.175 162.346 1.00 200.43 ?  77   ARG G CD    1 
ATOM   4975  N  NE    . ARG G 5  78   ? 210.917 181.856 163.763 1.00 209.93 ?  77   ARG G NE    1 
ATOM   4976  C  CZ    . ARG G 5  78   ? 211.769 182.425 164.608 1.00 161.19 ?  77   ARG G CZ    1 
ATOM   4977  N  NH1   . ARG G 5  78   ? 211.443 183.551 165.220 1.00 144.67 1  77   ARG G NH1   1 
ATOM   4978  N  NH2   . ARG G 5  78   ? 212.944 181.866 164.838 1.00 88.09  ?  77   ARG G NH2   1 
ATOM   4979  N  N     . ILE G 5  79   ? 205.779 181.646 163.528 1.00 178.95 ?  78   ILE G N     1 
ATOM   4980  C  CA    . ILE G 5  79   ? 204.544 181.985 164.298 1.00 158.07 ?  78   ILE G CA    1 
ATOM   4981  C  C     . ILE G 5  79   ? 204.936 182.587 165.652 1.00 200.16 ?  78   ILE G C     1 
ATOM   4982  O  O     . ILE G 5  79   ? 205.402 181.827 166.525 1.00 276.81 ?  78   ILE G O     1 
ATOM   4983  C  CB    . ILE G 5  79   ? 203.644 180.744 164.463 1.00 132.60 ?  78   ILE G CB    1 
ATOM   4984  C  CG1   . ILE G 5  79   ? 202.570 180.670 163.376 1.00 176.64 ?  78   ILE G CG1   1 
ATOM   4985  C  CG2   . ILE G 5  79   ? 203.037 180.699 165.858 1.00 120.11 ?  78   ILE G CG2   1 
ATOM   4986  C  CD1   . ILE G 5  79   ? 202.178 179.261 162.994 1.00 215.26 ?  78   ILE G CD1   1 
ATOM   4987  N  N     . ILE G 5  80   ? 204.755 183.903 165.807 1.00 204.86 ?  79   ILE G N     1 
ATOM   4988  C  CA    . ILE G 5  80   ? 205.065 184.602 167.090 1.00 215.67 ?  79   ILE G CA    1 
ATOM   4989  C  C     . ILE G 5  80   ? 203.789 184.596 167.942 1.00 225.74 ?  79   ILE G C     1 
ATOM   4990  O  O     . ILE G 5  80   ? 202.696 184.508 167.350 1.00 351.95 ?  79   ILE G O     1 
ATOM   4991  C  CB    . ILE G 5  80   ? 205.570 186.035 166.828 1.00 225.29 ?  79   ILE G CB    1 
ATOM   4992  C  CG1   . ILE G 5  80   ? 204.548 186.862 166.044 1.00 207.77 ?  79   ILE G CG1   1 
ATOM   4993  C  CG2   . ILE G 5  80   ? 206.925 186.010 166.137 1.00 281.28 ?  79   ILE G CG2   1 
ATOM   4994  C  CD1   . ILE G 5  80   ? 205.111 188.132 165.451 1.00 160.34 ?  79   ILE G CD1   1 
ATOM   4995  N  N     . PRO G 5  81   ? 203.866 184.683 169.288 1.00 139.99 ?  80   PRO G N     1 
ATOM   4996  C  CA    . PRO G 5  81   ? 202.638 184.656 170.121 1.00 112.45 ?  80   PRO G CA    1 
ATOM   4997  C  C     . PRO G 5  81   ? 201.417 185.490 169.739 1.00 108.27 ?  80   PRO G C     1 
ATOM   4998  O  O     . PRO G 5  81   ? 200.338 185.005 169.932 1.00 83.73  ?  80   PRO G O     1 
ATOM   4999  C  CB    . PRO G 5  81   ? 203.196 184.940 171.522 1.00 121.50 ?  80   PRO G CB    1 
ATOM   5000  C  CG    . PRO G 5  81   ? 204.527 184.243 171.371 1.00 136.60 ?  80   PRO G CG    1 
ATOM   5001  C  CD    . PRO G 5  81   ? 205.092 184.803 170.066 1.00 123.12 ?  80   PRO G CD    1 
ATOM   5002  N  N     . ARG G 5  82   ? 201.544 186.747 169.306 1.00 114.32 ?  81   ARG G N     1 
ATOM   5003  C  CA    . ARG G 5  82   ? 200.296 187.465 168.882 1.00 103.09 ?  81   ARG G CA    1 
ATOM   5004  C  C     . ARG G 5  82   ? 199.430 186.595 167.916 1.00 85.60  ?  81   ARG G C     1 
ATOM   5005  O  O     . ARG G 5  82   ? 198.234 186.500 167.978 1.00 72.03  ?  81   ARG G O     1 
ATOM   5006  C  CB    . ARG G 5  82   ? 200.668 188.819 168.265 1.00 90.91  ?  81   ARG G CB    1 
ATOM   5007  C  CG    . ARG G 5  82   ? 199.458 189.626 167.828 1.00 89.49  ?  81   ARG G CG    1 
ATOM   5008  C  CD    . ARG G 5  82   ? 199.779 190.974 167.291 1.00 95.29  ?  81   ARG G CD    1 
ATOM   5009  N  NE    . ARG G 5  82   ? 200.549 190.822 166.048 1.00 107.91 ?  81   ARG G NE    1 
ATOM   5010  C  CZ    . ARG G 5  82   ? 199.997 190.603 164.851 1.00 97.05  ?  81   ARG G CZ    1 
ATOM   5011  N  NH1   . ARG G 5  82   ? 198.681 190.464 164.750 1.00 88.38  1  81   ARG G NH1   1 
ATOM   5012  N  NH2   . ARG G 5  82   ? 200.775 190.469 163.784 1.00 84.51  ?  81   ARG G NH2   1 
ATOM   5013  N  N     . HIS G 5  83   ? 200.120 185.883 167.063 1.00 106.92 ?  82   HIS G N     1 
ATOM   5014  C  CA    . HIS G 5  83   ? 199.549 184.973 166.121 1.00 108.43 ?  82   HIS G CA    1 
ATOM   5015  C  C     . HIS G 5  83   ? 198.689 184.015 166.909 1.00 83.72  ?  82   HIS G C     1 
ATOM   5016  O  O     . HIS G 5  83   ? 197.625 183.671 166.404 1.00 160.45 ?  82   HIS G O     1 
ATOM   5017  C  CB    . HIS G 5  83   ? 200.630 184.303 165.242 1.00 167.16 ?  82   HIS G CB    1 
ATOM   5018  C  CG    . HIS G 5  83   ? 201.360 185.285 164.364 1.00 255.44 ?  82   HIS G CG    1 
ATOM   5019  N  ND1   . HIS G 5  83   ? 202.517 184.899 163.680 1.00 270.75 ?  82   HIS G ND1   1 
ATOM   5020  C  CD2   . HIS G 5  83   ? 201.209 186.601 164.027 1.00 276.73 ?  82   HIS G CD2   1 
ATOM   5021  C  CE1   . HIS G 5  83   ? 202.975 185.880 162.952 1.00 262.15 ?  82   HIS G CE1   1 
ATOM   5022  N  NE2   . HIS G 5  83   ? 202.215 186.945 163.181 1.00 252.08 ?  82   HIS G NE2   1 
ATOM   5023  N  N     . LEU G 5  84   ? 199.029 183.632 168.134 1.00 63.32  ?  83   LEU G N     1 
ATOM   5024  C  CA    . LEU G 5  84   ? 198.124 182.798 168.894 1.00 65.15  ?  83   LEU G CA    1 
ATOM   5025  C  C     . LEU G 5  84   ? 196.964 183.651 169.386 1.00 93.66  ?  83   LEU G C     1 
ATOM   5026  O  O     . LEU G 5  84   ? 195.811 183.170 169.466 1.00 80.94  ?  83   LEU G O     1 
ATOM   5027  C  CB    . LEU G 5  84   ? 198.859 182.208 170.104 1.00 59.50  ?  83   LEU G CB    1 
ATOM   5028  C  CG    . LEU G 5  84   ? 200.000 181.309 169.770 1.00 63.57  ?  83   LEU G CG    1 
ATOM   5029  C  CD1   . LEU G 5  84   ? 200.875 181.038 171.032 1.00 57.24  ?  83   LEU G CD1   1 
ATOM   5030  C  CD2   . LEU G 5  84   ? 199.331 180.127 169.035 1.00 75.51  ?  83   LEU G CD2   1 
ATOM   5031  N  N     . GLN G 5  85   ? 197.259 184.911 169.760 1.00 135.13 ?  84   GLN G N     1 
ATOM   5032  C  CA    . GLN G 5  85   ? 196.269 185.776 170.371 1.00 156.96 ?  84   GLN G CA    1 
ATOM   5033  C  C     . GLN G 5  85   ? 195.074 186.132 169.449 1.00 135.86 ?  84   GLN G C     1 
ATOM   5034  O  O     . GLN G 5  85   ? 193.847 186.037 169.952 1.00 208.62 ?  84   GLN G O     1 
ATOM   5035  C  CB    . GLN G 5  85   ? 196.961 187.013 170.980 1.00 215.85 ?  84   GLN G CB    1 
ATOM   5036  C  CG    . GLN G 5  85   ? 196.046 188.008 171.739 1.00 273.02 ?  84   GLN G CG    1 
ATOM   5037  C  CD    . GLN G 5  85   ? 194.995 187.458 172.720 1.00 330.87 ?  84   GLN G CD    1 
ATOM   5038  O  OE1   . GLN G 5  85   ? 193.858 187.076 172.405 1.00 364.11 ?  84   GLN G OE1   1 
ATOM   5039  N  NE2   . GLN G 5  85   ? 195.311 187.492 173.994 1.00 375.87 ?  84   GLN G NE2   1 
ATOM   5040  N  N     . LEU G 5  86   ? 195.422 186.633 168.251 1.00 99.03  ?  85   LEU G N     1 
ATOM   5041  C  CA    . LEU G 5  86   ? 194.348 187.011 167.290 1.00 87.25  ?  85   LEU G CA    1 
ATOM   5042  C  C     . LEU G 5  86   ? 193.524 185.751 166.982 1.00 89.62  ?  85   LEU G C     1 
ATOM   5043  O  O     . LEU G 5  86   ? 192.258 185.829 166.881 1.00 98.85  ?  85   LEU G O     1 
ATOM   5044  C  CB    . LEU G 5  86   ? 194.925 187.717 166.056 1.00 81.28  ?  85   LEU G CB    1 
ATOM   5045  C  CG    . LEU G 5  86   ? 195.238 189.211 166.297 1.00 87.86  ?  85   LEU G CG    1 
ATOM   5046  C  CD1   . LEU G 5  86   ? 196.292 189.325 167.422 1.00 78.41  ?  85   LEU G CD1   1 
ATOM   5047  C  CD2   . LEU G 5  86   ? 195.631 189.996 165.026 1.00 87.42  ?  85   LEU G CD2   1 
ATOM   5048  N  N     . ALA G 5  87   ? 194.250 184.637 166.886 1.00 133.40 ?  86   ALA G N     1 
ATOM   5049  C  CA    . ALA G 5  87   ? 193.686 183.358 166.439 1.00 213.80 ?  86   ALA G CA    1 
ATOM   5050  C  C     . ALA G 5  87   ? 192.590 182.968 167.431 1.00 178.52 ?  86   ALA G C     1 
ATOM   5051  O  O     . ALA G 5  87   ? 191.596 182.490 167.061 1.00 264.71 ?  86   ALA G O     1 
ATOM   5052  C  CB    . ALA G 5  87   ? 194.719 182.229 166.332 1.00 303.81 ?  86   ALA G CB    1 
ATOM   5053  N  N     . VAL G 5  88   ? 192.859 183.184 168.708 1.00 120.90 ?  87   VAL G N     1 
ATOM   5054  C  CA    . VAL G 5  88   ? 191.897 182.861 169.783 1.00 118.07 ?  87   VAL G CA    1 
ATOM   5055  C  C     . VAL G 5  88   ? 190.749 183.890 169.871 1.00 139.74 ?  87   VAL G C     1 
ATOM   5056  O  O     . VAL G 5  88   ? 189.609 183.472 170.072 1.00 104.56 ?  87   VAL G O     1 
ATOM   5057  C  CB    . VAL G 5  88   ? 192.639 182.747 171.127 1.00 135.52 ?  87   VAL G CB    1 
ATOM   5058  C  CG1   . VAL G 5  88   ? 191.593 182.401 172.206 1.00 164.33 ?  87   VAL G CG1   1 
ATOM   5059  C  CG2   . VAL G 5  88   ? 193.737 181.712 171.089 1.00 119.46 ?  87   VAL G CG2   1 
ATOM   5060  N  N     . ARG G 5  89   ? 191.010 185.203 169.818 1.00 178.75 ?  88   ARG G N     1 
ATOM   5061  C  CA    . ARG G 5  89   ? 189.930 186.289 169.974 1.00 160.60 ?  88   ARG G CA    1 
ATOM   5062  C  C     . ARG G 5  89   ? 188.856 186.278 168.892 1.00 160.63 ?  88   ARG G C     1 
ATOM   5063  O  O     . ARG G 5  89   ? 187.717 186.495 169.212 1.00 215.27 ?  88   ARG G O     1 
ATOM   5064  C  CB    . ARG G 5  89   ? 190.585 187.670 170.091 1.00 143.02 ?  88   ARG G CB    1 
ATOM   5065  C  CG    . ARG G 5  89   ? 191.410 187.819 171.366 1.00 198.16 ?  88   ARG G CG    1 
ATOM   5066  C  CD    . ARG G 5  89   ? 190.537 187.964 172.622 1.00 211.86 ?  88   ARG G CD    1 
ATOM   5067  N  NE    . ARG G 5  89   ? 191.225 188.214 173.905 1.00 204.47 ?  88   ARG G NE    1 
ATOM   5068  C  CZ    . ARG G 5  89   ? 190.995 187.538 175.065 1.00 156.73 ?  88   ARG G CZ    1 
ATOM   5069  N  NH1   . ARG G 5  89   ? 190.651 186.255 175.070 1.00 86.35  1  88   ARG G NH1   1 
ATOM   5070  N  NH2   . ARG G 5  89   ? 191.160 188.149 176.250 1.00 143.84 ?  88   ARG G NH2   1 
ATOM   5071  N  N     . ASN G 5  90   ? 189.201 186.085 167.628 1.00 151.41 ?  89   ASN G N     1 
ATOM   5072  C  CA    . ASN G 5  90   ? 188.201 186.228 166.602 1.00 144.84 ?  89   ASN G CA    1 
ATOM   5073  C  C     . ASN G 5  90   ? 187.132 185.128 166.716 1.00 142.55 ?  89   ASN G C     1 
ATOM   5074  O  O     . ASN G 5  90   ? 185.979 185.490 166.935 1.00 153.62 ?  89   ASN G O     1 
ATOM   5075  C  CB    . ASN G 5  90   ? 188.884 186.319 165.255 1.00 140.55 ?  89   ASN G CB    1 
ATOM   5076  C  CG    . ASN G 5  90   ? 189.299 187.734 164.927 1.00 133.01 ?  89   ASN G CG    1 
ATOM   5077  O  OD1   . ASN G 5  90   ? 190.448 188.095 164.576 1.00 139.46 ?  89   ASN G OD1   1 
ATOM   5078  N  ND2   . ASN G 5  90   ? 188.266 188.542 164.908 1.00 99.51  ?  89   ASN G ND2   1 
ATOM   5079  N  N     . ASP G 5  91   ? 187.512 183.853 166.628 1.00 128.65 ?  90   ASP G N     1 
ATOM   5080  C  CA    . ASP G 5  91   ? 186.603 182.793 166.816 1.00 153.87 ?  90   ASP G CA    1 
ATOM   5081  C  C     . ASP G 5  91   ? 185.886 182.904 168.170 1.00 146.70 ?  90   ASP G C     1 
ATOM   5082  O  O     . ASP G 5  91   ? 186.450 183.069 169.219 1.00 138.90 ?  90   ASP G O     1 
ATOM   5083  C  CB    . ASP G 5  91   ? 187.303 181.462 166.783 1.00 190.60 ?  90   ASP G CB    1 
ATOM   5084  C  CG    . ASP G 5  91   ? 187.710 181.008 165.394 1.00 223.93 ?  90   ASP G CG    1 
ATOM   5085  O  OD1   . ASP G 5  91   ? 187.144 181.549 164.430 1.00 209.61 ?  90   ASP G OD1   1 
ATOM   5086  O  OD2   . ASP G 5  91   ? 188.663 180.191 165.299 1.00 177.84 -1 90   ASP G OD2   1 
ATOM   5087  N  N     . GLU G 5  92   ? 184.557 182.842 168.079 1.00 174.13 ?  91   GLU G N     1 
ATOM   5088  C  CA    . GLU G 5  92   ? 183.660 182.928 169.225 1.00 257.95 ?  91   GLU G CA    1 
ATOM   5089  C  C     . GLU G 5  92   ? 183.754 181.655 170.054 1.00 268.68 ?  91   GLU G C     1 
ATOM   5090  O  O     . GLU G 5  92   ? 183.622 181.758 171.269 1.00 413.32 ?  91   GLU G O     1 
ATOM   5091  C  CB    . GLU G 5  92   ? 182.271 183.219 168.654 1.00 326.08 ?  91   GLU G CB    1 
ATOM   5092  C  CG    . GLU G 5  92   ? 181.999 184.693 168.319 1.00 351.69 ?  91   GLU G CG    1 
ATOM   5093  C  CD    . GLU G 5  92   ? 180.536 185.120 168.561 1.00 437.41 ?  91   GLU G CD    1 
ATOM   5094  O  OE1   . GLU G 5  92   ? 179.643 184.323 168.200 1.00 440.00 ?  91   GLU G OE1   1 
ATOM   5095  O  OE2   . GLU G 5  92   ? 180.292 186.069 169.315 1.00 330.33 -1 91   GLU G OE2   1 
ATOM   5096  N  N     . GLU G 5  93   ? 183.910 180.497 169.426 1.00 181.27 ?  92   GLU G N     1 
ATOM   5097  C  CA    . GLU G 5  93   ? 183.962 179.238 170.142 1.00 170.89 ?  92   GLU G CA    1 
ATOM   5098  C  C     . GLU G 5  93   ? 185.374 178.972 170.656 1.00 183.64 ?  92   GLU G C     1 
ATOM   5099  O  O     . GLU G 5  93   ? 185.578 178.094 171.498 1.00 170.33 ?  92   GLU G O     1 
ATOM   5100  C  CB    . GLU G 5  93   ? 183.274 178.150 169.302 1.00 179.55 ?  92   GLU G CB    1 
ATOM   5101  C  CG    . GLU G 5  93   ? 181.817 178.097 169.722 1.00 229.01 ?  92   GLU G CG    1 
ATOM   5102  C  CD    . GLU G 5  93   ? 180.624 177.975 168.768 1.00 289.86 ?  92   GLU G CD    1 
ATOM   5103  O  OE1   . GLU G 5  93   ? 180.728 178.382 167.597 1.00 329.68 ?  92   GLU G OE1   1 
ATOM   5104  O  OE2   . GLU G 5  93   ? 179.555 177.624 169.292 1.00 440.00 -1 92   GLU G OE2   1 
ATOM   5105  N  N     . LEU G 5  94   ? 186.317 179.842 170.251 1.00 195.42 ?  93   LEU G N     1 
ATOM   5106  C  CA    . LEU G 5  94   ? 187.718 179.786 170.753 1.00 195.32 ?  93   LEU G CA    1 
ATOM   5107  C  C     . LEU G 5  94   ? 187.999 180.657 171.959 1.00 197.60 ?  93   LEU G C     1 
ATOM   5108  O  O     . LEU G 5  94   ? 188.482 180.112 172.921 1.00 252.89 ?  93   LEU G O     1 
ATOM   5109  C  CB    . LEU G 5  94   ? 188.701 180.149 169.630 1.00 199.77 ?  93   LEU G CB    1 
ATOM   5110  C  CG    . LEU G 5  94   ? 189.208 178.992 168.756 1.00 360.00 ?  93   LEU G CG    1 
ATOM   5111  C  CD1   . LEU G 5  94   ? 190.381 179.438 167.884 1.00 428.18 ?  93   LEU G CD1   1 
ATOM   5112  C  CD2   . LEU G 5  94   ? 189.596 177.810 169.627 1.00 414.43 ?  93   LEU G CD2   1 
ATOM   5113  N  N     . ASN G 5  95   ? 187.724 181.944 171.807 1.00 179.89 ?  94   ASN G N     1 
ATOM   5114  C  CA    . ASN G 5  95   ? 188.087 182.882 172.905 1.00 170.54 ?  94   ASN G CA    1 
ATOM   5115  C  C     . ASN G 5  95   ? 187.075 182.770 174.057 1.00 157.41 ?  94   ASN G C     1 
ATOM   5116  O  O     . ASN G 5  95   ? 187.322 183.170 175.156 1.00 125.18 ?  94   ASN G O     1 
ATOM   5117  C  CB    . ASN G 5  95   ? 188.160 184.327 172.438 1.00 151.14 ?  94   ASN G CB    1 
ATOM   5118  C  CG    . ASN G 5  95   ? 186.827 184.832 171.988 1.00 145.77 ?  94   ASN G CG    1 
ATOM   5119  O  OD1   . ASN G 5  95   ? 185.883 184.805 172.757 1.00 130.90 ?  94   ASN G OD1   1 
ATOM   5120  N  ND2   . ASN G 5  95   ? 186.726 185.247 170.738 1.00 192.81 ?  94   ASN G ND2   1 
ATOM   5121  N  N     . LYS G 5  96   ? 185.934 182.177 173.745 1.00 200.51 ?  95   LYS G N     1 
ATOM   5122  C  CA    . LYS G 5  96   ? 184.807 182.069 174.664 1.00 229.18 ?  95   LYS G CA    1 
ATOM   5123  C  C     . LYS G 5  96   ? 185.226 181.322 175.920 1.00 164.05 ?  95   LYS G C     1 
ATOM   5124  O  O     . LYS G 5  96   ? 184.948 181.715 177.013 1.00 145.30 ?  95   LYS G O     1 
ATOM   5125  C  CB    . LYS G 5  96   ? 183.724 181.280 173.954 1.00 377.04 ?  95   LYS G CB    1 
ATOM   5126  C  CG    . LYS G 5  96   ? 182.906 182.104 172.991 1.00 440.00 ?  95   LYS G CG    1 
ATOM   5127  C  CD    . LYS G 5  96   ? 181.784 181.324 172.272 1.00 440.00 ?  95   LYS G CD    1 
ATOM   5128  C  CE    . LYS G 5  96   ? 180.976 182.243 171.386 1.00 440.00 ?  95   LYS G CE    1 
ATOM   5129  N  NZ    . LYS G 5  96   ? 179.946 181.562 170.548 1.00 440.00 1  95   LYS G NZ    1 
ATOM   5130  N  N     . LEU G 5  97   ? 185.839 180.177 175.680 1.00 169.19 ?  96   LEU G N     1 
ATOM   5131  C  CA    . LEU G 5  97   ? 186.406 179.354 176.747 1.00 186.60 ?  96   LEU G CA    1 
ATOM   5132  C  C     . LEU G 5  97   ? 187.600 180.051 177.454 1.00 199.65 ?  96   LEU G C     1 
ATOM   5133  O  O     . LEU G 5  97   ? 187.738 179.980 178.667 1.00 177.91 ?  96   LEU G O     1 
ATOM   5134  C  CB    . LEU G 5  97   ? 186.852 178.006 176.185 1.00 165.13 ?  96   LEU G CB    1 
ATOM   5135  C  CG    . LEU G 5  97   ? 187.075 176.952 177.265 1.00 152.10 ?  96   LEU G CG    1 
ATOM   5136  C  CD1   . LEU G 5  97   ? 186.413 175.680 176.819 1.00 144.83 ?  96   LEU G CD1   1 
ATOM   5137  C  CD2   . LEU G 5  97   ? 188.535 176.716 177.570 1.00 155.09 ?  96   LEU G CD2   1 
ATOM   5138  N  N     . LEU G 5  98   ? 188.490 180.669 176.705 1.00 175.51 ?  97   LEU G N     1 
ATOM   5139  C  CA    . LEU G 5  98   ? 189.706 181.237 177.203 1.00 190.41 ?  97   LEU G CA    1 
ATOM   5140  C  C     . LEU G 5  98   ? 189.498 182.650 177.714 1.00 251.71 ?  97   LEU G C     1 
ATOM   5141  O  O     . LEU G 5  98   ? 190.427 183.295 178.169 1.00 319.44 ?  97   LEU G O     1 
ATOM   5142  C  CB    . LEU G 5  98   ? 190.711 181.196 176.063 1.00 199.13 ?  97   LEU G CB    1 
ATOM   5143  C  CG    . LEU G 5  98   ? 191.340 179.832 175.785 1.00 280.76 ?  97   LEU G CG    1 
ATOM   5144  C  CD1   . LEU G 5  98   ? 192.627 180.017 174.975 1.00 359.99 ?  97   LEU G CD1   1 
ATOM   5145  C  CD2   . LEU G 5  98   ? 191.548 178.985 177.056 1.00 295.19 ?  97   LEU G CD2   1 
ATOM   5146  N  N     . GLY G 5  99   ? 188.248 183.119 177.625 1.00 308.38 ?  98   GLY G N     1 
ATOM   5147  C  CA    . GLY G 5  99   ? 187.879 184.476 178.076 1.00 302.52 ?  98   GLY G CA    1 
ATOM   5148  C  C     . GLY G 5  99   ? 188.547 184.837 179.391 1.00 261.96 ?  98   GLY G C     1 
ATOM   5149  O  O     . GLY G 5  99   ? 188.694 186.044 179.664 1.00 167.14 ?  98   GLY G O     1 
ATOM   5150  N  N     . ARG G 5  100  ? 188.940 183.826 180.173 1.00 255.65 ?  99   ARG G N     1 
ATOM   5151  C  CA    . ARG G 5  100  ? 189.608 184.056 181.483 1.00 244.88 ?  99   ARG G CA    1 
ATOM   5152  C  C     . ARG G 5  100  ? 191.121 183.883 181.314 1.00 250.34 ?  99   ARG G C     1 
ATOM   5153  O  O     . ARG G 5  100  ? 191.806 183.640 182.328 1.00 225.34 ?  99   ARG G O     1 
ATOM   5154  C  CB    . ARG G 5  100  ? 189.053 183.098 182.540 1.00 247.30 ?  99   ARG G CB    1 
ATOM   5155  C  CG    . ARG G 5  100  ? 187.734 183.546 183.154 1.00 336.89 ?  99   ARG G CG    1 
ATOM   5156  C  CD    . ARG G 5  100  ? 187.781 184.979 183.651 1.00 390.87 ?  99   ARG G CD    1 
ATOM   5157  N  NE    . ARG G 5  100  ? 186.471 185.616 183.633 1.00 440.00 ?  99   ARG G NE    1 
ATOM   5158  C  CZ    . ARG G 5  100  ? 186.078 186.552 184.489 1.00 440.00 ?  99   ARG G CZ    1 
ATOM   5159  N  NH1   . ARG G 5  100  ? 186.344 186.426 185.777 1.00 440.00 1  99   ARG G NH1   1 
ATOM   5160  N  NH2   . ARG G 5  100  ? 185.420 187.612 184.052 1.00 440.00 ?  99   ARG G NH2   1 
ATOM   5161  N  N     . VAL G 5  101  ? 191.614 184.005 180.076 1.00 332.60 ?  100  VAL G N     1 
ATOM   5162  C  CA    . VAL G 5  101  ? 193.070 183.862 179.779 1.00 408.95 ?  100  VAL G CA    1 
ATOM   5163  C  C     . VAL G 5  101  ? 193.592 185.197 179.236 1.00 219.37 ?  100  VAL G C     1 
ATOM   5164  O  O     . VAL G 5  101  ? 193.005 185.712 178.265 1.00 219.28 ?  100  VAL G O     1 
ATOM   5165  C  CB    . VAL G 5  101  ? 193.333 182.712 178.788 1.00 440.00 ?  100  VAL G CB    1 
ATOM   5166  C  CG1   . VAL G 5  101  ? 192.708 181.407 179.260 1.00 440.00 ?  100  VAL G CG1   1 
ATOM   5167  C  CG2   . VAL G 5  101  ? 192.857 183.056 177.385 1.00 440.00 ?  100  VAL G CG2   1 
ATOM   5168  N  N     . THR G 5  102  ? 194.657 185.728 179.849 1.00 139.06 ?  101  THR G N     1 
ATOM   5169  C  CA    . THR G 5  102  ? 195.238 186.985 179.430 1.00 176.78 ?  101  THR G CA    1 
ATOM   5170  C  C     . THR G 5  102  ? 196.641 186.727 178.868 1.00 251.38 ?  101  THR G C     1 
ATOM   5171  O  O     . THR G 5  102  ? 197.233 185.764 179.211 1.00 288.17 ?  101  THR G O     1 
ATOM   5172  C  CB    . THR G 5  102  ? 195.260 187.997 180.593 1.00 152.62 ?  101  THR G CB    1 
ATOM   5173  O  OG1   . THR G 5  102  ? 195.559 189.335 180.180 1.00 133.91 ?  101  THR G OG1   1 
ATOM   5174  C  CG2   . THR G 5  102  ? 196.205 187.569 181.678 1.00 159.03 ?  101  THR G CG2   1 
ATOM   5175  N  N     . ILE G 5  103  ? 197.169 187.563 177.959 1.00 223.16 ?  102  ILE G N     1 
ATOM   5176  C  CA    . ILE G 5  103  ? 198.244 187.022 177.083 1.00 171.41 ?  102  ILE G CA    1 
ATOM   5177  C  C     . ILE G 5  103  ? 199.606 187.692 177.232 1.00 144.01 ?  102  ILE G C     1 
ATOM   5178  O  O     . ILE G 5  103  ? 199.710 188.884 177.036 1.00 152.86 ?  102  ILE G O     1 
ATOM   5179  C  CB    . ILE G 5  103  ? 197.852 186.994 175.599 1.00 185.84 ?  102  ILE G CB    1 
ATOM   5180  C  CG1   . ILE G 5  103  ? 196.552 186.208 175.438 1.00 243.03 ?  102  ILE G CG1   1 
ATOM   5181  C  CG2   . ILE G 5  103  ? 198.955 186.290 174.857 1.00 198.36 ?  102  ILE G CG2   1 
ATOM   5182  C  CD1   . ILE G 5  103  ? 196.665 184.845 176.232 1.00 214.84 ?  102  ILE G CD1   1 
ATOM   5183  N  N     . ALA G 5  104  ? 200.631 186.840 177.448 1.00 110.74 ?  103  ALA G N     1 
ATOM   5184  C  CA    . ALA G 5  104  ? 201.989 187.316 177.359 1.00 111.98 ?  103  ALA G CA    1 
ATOM   5185  C  C     . ALA G 5  104  ? 201.968 188.286 176.149 1.00 142.56 ?  103  ALA G C     1 
ATOM   5186  O  O     . ALA G 5  104  ? 201.745 187.954 175.052 1.00 156.96 ?  103  ALA G O     1 
ATOM   5187  C  CB    . ALA G 5  104  ? 202.960 186.202 177.241 1.00 89.41  ?  103  ALA G CB    1 
ATOM   5188  N  N     . GLN G 5  105  ? 202.145 189.564 176.430 1.00 164.03 ?  104  GLN G N     1 
ATOM   5189  C  CA    . GLN G 5  105  ? 202.183 190.633 175.422 1.00 131.90 ?  104  GLN G CA    1 
ATOM   5190  C  C     . GLN G 5  105  ? 201.072 190.423 174.411 1.00 141.52 ?  104  GLN G C     1 
ATOM   5191  O  O     . GLN G 5  105  ? 201.491 190.383 173.289 1.00 139.12 ?  104  GLN G O     1 
ATOM   5192  C  CB    . GLN G 5  105  ? 203.530 190.608 174.676 1.00 114.41 ?  104  GLN G CB    1 
ATOM   5193  C  CG    . GLN G 5  105  ? 204.779 190.551 175.552 1.00 145.15 ?  104  GLN G CG    1 
ATOM   5194  C  CD    . GLN G 5  105  ? 204.893 189.232 176.273 1.00 175.19 ?  104  GLN G CD    1 
ATOM   5195  O  OE1   . GLN G 5  105  ? 204.145 188.299 175.991 1.00 154.00 ?  104  GLN G OE1   1 
ATOM   5196  N  NE2   . GLN G 5  105  ? 205.836 189.158 177.202 1.00 224.39 ?  104  GLN G NE2   1 
ATOM   5197  N  N     . GLY G 5  106  ? 199.811 190.191 174.815 1.00 156.89 ?  105  GLY G N     1 
ATOM   5198  C  CA    . GLY G 5  106  ? 198.751 189.797 173.897 1.00 186.30 ?  105  GLY G CA    1 
ATOM   5199  C  C     . GLY G 5  106  ? 198.527 190.740 172.681 1.00 218.47 ?  105  GLY G C     1 
ATOM   5200  O  O     . GLY G 5  106  ? 198.573 190.401 171.418 1.00 251.78 ?  105  GLY G O     1 
ATOM   5201  N  N     . GLY G 5  107  ? 198.439 192.018 173.025 1.00 216.49 ?  106  GLY G N     1 
ATOM   5202  C  CA    . GLY G 5  107  ? 198.199 193.039 172.021 1.00 194.04 ?  106  GLY G CA    1 
ATOM   5203  C  C     . GLY G 5  107  ? 196.685 193.096 171.768 1.00 182.88 ?  106  GLY G C     1 
ATOM   5204  O  O     . GLY G 5  107  ? 195.870 192.489 172.541 1.00 202.19 ?  106  GLY G O     1 
ATOM   5205  N  N     . VAL G 5  108  ? 196.294 193.866 170.760 1.00 150.49 ?  107  VAL G N     1 
ATOM   5206  C  CA    . VAL G 5  108  ? 194.869 194.353 170.751 1.00 153.51 ?  107  VAL G CA    1 
ATOM   5207  C  C     . VAL G 5  108  ? 194.227 194.203 169.381 1.00 190.15 ?  107  VAL G C     1 
ATOM   5208  O  O     . VAL G 5  108  ? 194.868 194.518 168.365 1.00 230.93 ?  107  VAL G O     1 
ATOM   5209  C  CB    . VAL G 5  108  ? 194.807 195.819 171.167 1.00 130.77 ?  107  VAL G CB    1 
ATOM   5210  C  CG1   . VAL G 5  108  ? 193.426 196.408 170.848 1.00 151.52 ?  107  VAL G CG1   1 
ATOM   5211  C  CG2   . VAL G 5  108  ? 195.223 195.926 172.623 1.00 138.07 ?  107  VAL G CG2   1 
ATOM   5212  N  N     . LEU G 5  109  ? 192.909 193.911 169.338 1.00 180.48 ?  108  LEU G N     1 
ATOM   5213  C  CA    . LEU G 5  109  ? 192.234 193.899 167.982 1.00 147.18 ?  108  LEU G CA    1 
ATOM   5214  C  C     . LEU G 5  109  ? 191.951 195.331 167.599 1.00 138.27 ?  108  LEU G C     1 
ATOM   5215  O  O     . LEU G 5  109  ? 191.571 196.118 168.467 1.00 133.13 ?  108  LEU G O     1 
ATOM   5216  C  CB    . LEU G 5  109  ? 190.965 193.088 167.873 1.00 101.12 ?  108  LEU G CB    1 
ATOM   5217  C  CG    . LEU G 5  109  ? 191.155 191.598 168.239 1.00 82.06  ?  108  LEU G CG    1 
ATOM   5218  C  CD1   . LEU G 5  109  ? 191.381 191.298 169.758 1.00 64.61  ?  108  LEU G CD1   1 
ATOM   5219  C  CD2   . LEU G 5  109  ? 190.046 190.779 167.698 1.00 74.70  ?  108  LEU G CD2   1 
ATOM   5220  N  N     . PRO G 5  110  ? 192.201 195.785 166.341 1.00 155.39 ?  109  PRO G N     1 
ATOM   5221  C  CA    . PRO G 5  110  ? 191.925 197.185 166.053 1.00 155.60 ?  109  PRO G CA    1 
ATOM   5222  C  C     . PRO G 5  110  ? 190.399 197.123 166.115 1.00 209.65 ?  109  PRO G C     1 
ATOM   5223  O  O     . PRO G 5  110  ? 189.821 196.186 165.604 1.00 276.18 ?  109  PRO G O     1 
ATOM   5224  C  CB    . PRO G 5  110  ? 192.597 197.499 164.717 1.00 132.53 ?  109  PRO G CB    1 
ATOM   5225  C  CG    . PRO G 5  110  ? 193.553 196.305 164.525 1.00 163.03 ?  109  PRO G CG    1 
ATOM   5226  C  CD    . PRO G 5  110  ? 192.817 195.109 165.190 1.00 179.20 ?  109  PRO G CD    1 
ATOM   5227  N  N     . ASN G 5  111  ? 189.805 198.000 166.908 1.00 219.66 ?  110  ASN G N     1 
ATOM   5228  C  CA    . ASN G 5  111  ? 188.372 198.111 166.994 1.00 182.81 ?  110  ASN G CA    1 
ATOM   5229  C  C     . ASN G 5  111  ? 188.054 199.444 167.631 1.00 118.53 ?  110  ASN G C     1 
ATOM   5230  O  O     . ASN G 5  111  ? 188.546 199.755 168.665 1.00 123.49 ?  110  ASN G O     1 
ATOM   5231  C  CB    . ASN G 5  111  ? 187.693 197.037 167.851 1.00 202.69 ?  110  ASN G CB    1 
ATOM   5232  C  CG    . ASN G 5  111  ? 186.186 196.987 167.709 1.00 239.26 ?  110  ASN G CG    1 
ATOM   5233  O  OD1   . ASN G 5  111  ? 185.660 197.301 166.615 1.00 393.62 ?  110  ASN G OD1   1 
ATOM   5234  N  ND2   . ASN G 5  111  ? 185.489 196.611 168.789 1.00 173.63 ?  110  ASN G ND2   1 
ATOM   5235  N  N     . ILE G 5  112  ? 187.348 200.276 166.907 1.00 109.16 ?  111  ILE G N     1 
ATOM   5236  C  CA    . ILE G 5  112  ? 187.162 201.621 167.309 1.00 138.31 ?  111  ILE G CA    1 
ATOM   5237  C  C     . ILE G 5  112  ? 185.655 201.855 167.446 1.00 210.51 ?  111  ILE G C     1 
ATOM   5238  O  O     . ILE G 5  112  ? 184.925 201.651 166.462 1.00 307.83 ?  111  ILE G O     1 
ATOM   5239  C  CB    . ILE G 5  112  ? 187.716 202.564 166.253 1.00 122.19 ?  111  ILE G CB    1 
ATOM   5240  C  CG1   . ILE G 5  112  ? 189.221 202.347 166.127 1.00 101.32 ?  111  ILE G CG1   1 
ATOM   5241  C  CG2   . ILE G 5  112  ? 187.258 204.056 166.454 1.00 126.24 ?  111  ILE G CG2   1 
ATOM   5242  C  CD1   . ILE G 5  112  ? 189.889 203.333 165.187 1.00 92.72  ?  111  ILE G CD1   1 
ATOM   5243  N  N     . GLN G 5  113  ? 185.173 202.338 168.605 1.00 180.15 ?  112  GLN G N     1 
ATOM   5244  C  CA    . GLN G 5  113  ? 183.755 202.348 168.755 1.00 150.81 ?  112  GLN G CA    1 
ATOM   5245  C  C     . GLN G 5  113  ? 183.017 203.280 167.789 1.00 124.94 ?  112  GLN G C     1 
ATOM   5246  O  O     . GLN G 5  113  ? 183.484 204.122 167.238 1.00 82.07  ?  112  GLN G O     1 
ATOM   5247  C  CB    . GLN G 5  113  ? 183.215 202.445 170.180 1.00 136.90 ?  112  GLN G CB    1 
ATOM   5248  C  CG    . GLN G 5  113  ? 183.138 201.046 170.873 1.00 146.15 ?  112  GLN G CG    1 
ATOM   5249  C  CD    . GLN G 5  113  ? 181.786 200.324 170.951 1.00 144.71 ?  112  GLN G CD    1 
ATOM   5250  O  OE1   . GLN G 5  113  ? 180.751 200.914 171.254 1.00 159.07 ?  112  GLN G OE1   1 
ATOM   5251  N  NE2   . GLN G 5  113  ? 181.781 199.036 170.636 1.00 126.35 ?  112  GLN G NE2   1 
ATOM   5252  N  N     . SER G 5  114  ? 181.775 202.902 167.537 1.00 154.52 ?  113  SER G N     1 
ATOM   5253  C  CA    . SER G 5  114  ? 180.960 203.324 166.399 1.00 203.62 ?  113  SER G CA    1 
ATOM   5254  C  C     . SER G 5  114  ? 181.039 204.844 166.225 1.00 185.99 ?  113  SER G C     1 
ATOM   5255  O  O     . SER G 5  114  ? 181.273 205.306 165.161 1.00 133.69 ?  113  SER G O     1 
ATOM   5256  C  CB    . SER G 5  114  ? 179.536 202.736 166.544 1.00 256.19 ?  113  SER G CB    1 
ATOM   5257  O  OG    . SER G 5  114  ? 178.908 203.073 167.778 1.00 243.96 ?  113  SER G OG    1 
ATOM   5258  N  N     . VAL G 5  115  ? 180.793 205.615 167.293 1.00 219.51 ?  114  VAL G N     1 
ATOM   5259  C  CA    . VAL G 5  115  ? 180.291 206.992 167.179 1.00 320.44 ?  114  VAL G CA    1 
ATOM   5260  C  C     . VAL G 5  115  ? 181.367 208.063 167.232 1.00 214.07 ?  114  VAL G C     1 
ATOM   5261  O  O     . VAL G 5  115  ? 181.005 209.248 167.116 1.00 184.26 ?  114  VAL G O     1 
ATOM   5262  C  CB    . VAL G 5  115  ? 179.291 207.338 168.308 1.00 440.00 ?  114  VAL G CB    1 
ATOM   5263  C  CG1   . VAL G 5  115  ? 177.926 206.744 168.042 1.00 440.00 ?  114  VAL G CG1   1 
ATOM   5264  C  CG2   . VAL G 5  115  ? 179.833 206.907 169.662 1.00 440.00 ?  114  VAL G CG2   1 
ATOM   5265  N  N     . LEU G 5  116  ? 182.589 207.715 167.613 1.00 177.31 ?  115  LEU G N     1 
ATOM   5266  C  CA    . LEU G 5  116  ? 183.635 208.738 167.866 1.00 189.65 ?  115  LEU G CA    1 
ATOM   5267  C  C     . LEU G 5  116  ? 184.480 208.877 166.616 1.00 158.27 ?  115  LEU G C     1 
ATOM   5268  O  O     . LEU G 5  116  ? 185.416 209.660 166.531 1.00 137.94 ?  115  LEU G O     1 
ATOM   5269  C  CB    . LEU G 5  116  ? 184.512 208.308 169.046 1.00 192.93 ?  115  LEU G CB    1 
ATOM   5270  C  CG    . LEU G 5  116  ? 185.128 206.933 168.821 1.00 166.87 ?  115  LEU G CG    1 
ATOM   5271  C  CD1   . LEU G 5  116  ? 186.355 207.002 167.930 1.00 209.51 ?  115  LEU G CD1   1 
ATOM   5272  C  CD2   . LEU G 5  116  ? 185.363 206.152 170.106 1.00 144.73 ?  115  LEU G CD2   1 
ATOM   5273  N  N     . LEU G 5  117  ? 184.133 208.045 165.642 1.00 141.59 ?  116  LEU G N     1 
ATOM   5274  C  CA    . LEU G 5  117  ? 184.641 208.079 164.379 1.00 154.49 ?  116  LEU G CA    1 
ATOM   5275  C  C     . LEU G 5  117  ? 184.087 209.293 163.629 1.00 179.06 ?  116  LEU G C     1 
ATOM   5276  O  O     . LEU G 5  117  ? 183.002 209.780 163.941 1.00 191.49 ?  116  LEU G O     1 
ATOM   5277  C  CB    . LEU G 5  117  ? 184.138 206.812 163.781 1.00 150.54 ?  116  LEU G CB    1 
ATOM   5278  C  CG    . LEU G 5  117  ? 184.658 206.474 162.429 1.00 245.79 ?  116  LEU G CG    1 
ATOM   5279  C  CD1   . LEU G 5  117  ? 186.185 206.518 162.397 1.00 262.08 ?  116  LEU G CD1   1 
ATOM   5280  C  CD2   . LEU G 5  117  ? 184.118 205.079 162.107 1.00 316.60 ?  116  LEU G CD2   1 
ATOM   5281  N  N     . PRO G 5  118  ? 184.773 209.941 162.659 1.00 199.23 ?  117  PRO G N     1 
ATOM   5282  C  CA    . PRO G 5  118  ? 184.308 211.317 162.379 1.00 238.34 ?  117  PRO G CA    1 
ATOM   5283  C  C     . PRO G 5  118  ? 183.479 211.611 161.119 1.00 366.23 ?  117  PRO G C     1 
ATOM   5284  O  O     . PRO G 5  118  ? 183.667 211.100 160.058 1.00 440.00 ?  117  PRO G O     1 
ATOM   5285  C  CB    . PRO G 5  118  ? 185.616 212.079 162.379 1.00 198.42 ?  117  PRO G CB    1 
ATOM   5286  C  CG    . PRO G 5  118  ? 186.620 211.099 161.769 1.00 196.32 ?  117  PRO G CG    1 
ATOM   5287  C  CD    . PRO G 5  118  ? 186.100 209.687 162.053 1.00 190.99 ?  117  PRO G CD    1 
ATOM   5288  N  N     . LYS G 5  119  ? 182.534 212.505 161.285 1.00 440.00 ?  118  LYS G N     1 
ATOM   5289  C  CA    . LYS G 5  119  ? 181.750 213.116 160.167 1.00 440.00 ?  118  LYS G CA    1 
ATOM   5290  C  C     . LYS G 5  119  ? 182.620 214.122 159.391 1.00 440.00 ?  118  LYS G C     1 
ATOM   5291  O  O     . LYS G 5  119  ? 183.481 214.811 159.952 1.00 433.79 ?  118  LYS G O     1 
ATOM   5292  C  CB    . LYS G 5  119  ? 180.465 213.723 160.726 1.00 440.00 ?  118  LYS G CB    1 
ATOM   5293  C  CG    . LYS G 5  119  ? 179.423 212.746 161.293 1.00 440.00 ?  118  LYS G CG    1 
ATOM   5294  C  CD    . LYS G 5  119  ? 178.107 213.396 161.890 1.00 440.00 ?  118  LYS G CD    1 
ATOM   5295  C  CE    . LYS G 5  119  ? 177.092 212.380 162.419 1.00 440.00 ?  118  LYS G CE    1 
ATOM   5296  N  NZ    . LYS G 5  119  ? 175.862 212.994 163.003 1.00 440.00 1  118  LYS G NZ    1 
ATOM   5297  N  N     . THR H 4  33   ? 216.545 169.680 187.603 1.00 302.52 ?  29   THR H N     1 
ATOM   5298  C  CA    . THR H 4  33   ? 217.334 168.507 187.139 1.00 342.66 ?  29   THR H CA    1 
ATOM   5299  C  C     . THR H 4  33   ? 216.714 167.953 185.852 1.00 324.35 ?  29   THR H C     1 
ATOM   5300  O  O     . THR H 4  33   ? 217.468 167.735 184.881 1.00 311.43 ?  29   THR H O     1 
ATOM   5301  C  CB    . THR H 4  33   ? 217.421 167.432 188.229 1.00 386.99 ?  29   THR H CB    1 
ATOM   5302  O  OG1   . THR H 4  33   ? 216.192 167.441 188.958 1.00 412.45 ?  29   THR H OG1   1 
ATOM   5303  C  CG2   . THR H 4  33   ? 218.581 167.646 189.176 1.00 402.81 ?  29   THR H CG2   1 
ATOM   5304  N  N     . ARG H 4  34   ? 215.396 167.738 185.854 1.00 271.37 ?  30   ARG H N     1 
ATOM   5305  C  CA    . ARG H 4  34   ? 214.679 167.202 184.666 1.00 220.91 ?  30   ARG H CA    1 
ATOM   5306  C  C     . ARG H 4  34   ? 213.512 168.133 184.317 1.00 212.43 ?  30   ARG H C     1 
ATOM   5307  O  O     . ARG H 4  34   ? 212.365 167.803 184.675 1.00 233.44 ?  30   ARG H O     1 
ATOM   5308  C  CB    . ARG H 4  34   ? 214.182 165.779 184.939 1.00 210.13 ?  30   ARG H CB    1 
ATOM   5309  C  CG    . ARG H 4  34   ? 213.333 165.191 183.824 1.00 193.45 ?  30   ARG H CG    1 
ATOM   5310  C  CD    . ARG H 4  34   ? 213.533 163.695 183.672 1.00 179.89 ?  30   ARG H CD    1 
ATOM   5311  N  NE    . ARG H 4  34   ? 214.895 163.356 183.278 1.00 192.35 ?  30   ARG H NE    1 
ATOM   5312  C  CZ    . ARG H 4  34   ? 215.297 163.197 182.022 1.00 211.16 ?  30   ARG H CZ    1 
ATOM   5313  N  NH1   . ARG H 4  34   ? 214.408 163.123 181.047 1.00 211.97 1  30   ARG H NH1   1 
ATOM   5314  N  NH2   . ARG H 4  34   ? 216.586 163.114 181.746 1.00 210.40 ?  30   ARG H NH2   1 
ATOM   5315  N  N     . LYS H 4  35   ? 213.805 169.251 183.644 1.00 211.70 ?  31   LYS H N     1 
ATOM   5316  C  CA    . LYS H 4  35   ? 212.775 170.218 183.256 1.00 276.83 ?  31   LYS H CA    1 
ATOM   5317  C  C     . LYS H 4  35   ? 211.951 169.468 182.219 1.00 327.73 ?  31   LYS H C     1 
ATOM   5318  O  O     . LYS H 4  35   ? 212.493 168.980 181.230 1.00 429.37 ?  31   LYS H O     1 
ATOM   5319  C  CB    . LYS H 4  35   ? 213.374 171.497 182.665 1.00 290.33 ?  31   LYS H CB    1 
ATOM   5320  C  CG    . LYS H 4  35   ? 212.449 172.697 182.459 1.00 320.09 ?  31   LYS H CG    1 
ATOM   5321  C  CD    . LYS H 4  35   ? 211.594 173.032 183.660 1.00 370.81 ?  31   LYS H CD    1 
ATOM   5322  C  CE    . LYS H 4  35   ? 210.535 174.071 183.377 1.00 362.48 ?  31   LYS H CE    1 
ATOM   5323  N  NZ    . LYS H 4  35   ? 209.787 174.422 184.610 1.00 330.17 1  31   LYS H NZ    1 
ATOM   5324  N  N     . GLU H 4  36   ? 210.652 169.403 182.466 1.00 299.12 ?  32   GLU H N     1 
ATOM   5325  C  CA    . GLU H 4  36   ? 209.679 168.717 181.578 1.00 249.20 ?  32   GLU H CA    1 
ATOM   5326  C  C     . GLU H 4  36   ? 209.197 169.791 180.586 1.00 197.52 ?  32   GLU H C     1 
ATOM   5327  O  O     . GLU H 4  36   ? 209.030 171.034 180.903 1.00 198.08 ?  32   GLU H O     1 
ATOM   5328  C  CB    . GLU H 4  36   ? 208.504 168.129 182.357 1.00 246.70 ?  32   GLU H CB    1 
ATOM   5329  C  CG    . GLU H 4  36   ? 208.882 167.446 183.650 1.00 209.17 ?  32   GLU H CG    1 
ATOM   5330  C  CD    . GLU H 4  36   ? 209.394 166.040 183.486 1.00 180.00 ?  32   GLU H CD    1 
ATOM   5331  O  OE1   . GLU H 4  36   ? 208.723 165.302 182.722 1.00 127.92 ?  32   GLU H OE1   1 
ATOM   5332  O  OE2   . GLU H 4  36   ? 210.510 165.729 184.076 1.00 391.62 -1 32   GLU H OE2   1 
ATOM   5333  N  N     . SER H 4  37   ? 208.846 169.370 179.363 1.00 178.95 ?  33   SER H N     1 
ATOM   5334  C  CA    . SER H 4  37   ? 208.010 170.207 178.486 1.00 209.20 ?  33   SER H CA    1 
ATOM   5335  C  C     . SER H 4  37   ? 207.054 169.337 177.622 1.00 192.26 ?  33   SER H C     1 
ATOM   5336  O  O     . SER H 4  37   ? 207.524 168.332 177.131 1.00 208.46 ?  33   SER H O     1 
ATOM   5337  C  CB    . SER H 4  37   ? 208.914 171.130 177.655 1.00 203.49 ?  33   SER H CB    1 
ATOM   5338  O  OG    . SER H 4  37   ? 208.148 172.067 176.948 1.00 227.53 ?  33   SER H OG    1 
ATOM   5339  N  N     . TYR H 4  38   ? 205.855 169.804 177.284 1.00 168.19 ?  34   TYR H N     1 
ATOM   5340  C  CA    . TYR H 4  38   ? 205.131 169.232 176.183 1.00 172.76 ?  34   TYR H CA    1 
ATOM   5341  C  C     . TYR H 4  38   ? 205.491 169.826 174.798 1.00 225.48 ?  34   TYR H C     1 
ATOM   5342  O  O     . TYR H 4  38   ? 204.625 170.080 173.876 1.00 322.95 ?  34   TYR H O     1 
ATOM   5343  C  CB    . TYR H 4  38   ? 203.668 169.361 176.594 1.00 156.14 ?  34   TYR H CB    1 
ATOM   5344  C  CG    . TYR H 4  38   ? 203.225 168.372 177.631 1.00 142.50 ?  34   TYR H CG    1 
ATOM   5345  C  CD1   . TYR H 4  38   ? 203.197 168.640 178.970 1.00 139.91 ?  34   TYR H CD1   1 
ATOM   5346  C  CD2   . TYR H 4  38   ? 202.566 167.230 177.216 1.00 180.03 ?  34   TYR H CD2   1 
ATOM   5347  C  CE1   . TYR H 4  38   ? 202.460 167.823 179.853 1.00 150.01 ?  34   TYR H CE1   1 
ATOM   5348  C  CE2   . TYR H 4  38   ? 201.884 166.361 178.082 1.00 132.05 ?  34   TYR H CE2   1 
ATOM   5349  C  CZ    . TYR H 4  38   ? 201.832 166.657 179.420 1.00 110.41 ?  34   TYR H CZ    1 
ATOM   5350  O  OH    . TYR H 4  38   ? 201.206 165.805 180.251 1.00 75.33  ?  34   TYR H OH    1 
ATOM   5351  N  N     . ALA H 4  39   ? 206.786 170.106 174.558 1.00 192.20 ?  35   ALA H N     1 
ATOM   5352  C  CA    . ALA H 4  39   ? 207.218 170.732 173.299 1.00 151.81 ?  35   ALA H CA    1 
ATOM   5353  C  C     . ALA H 4  39   ? 207.285 169.676 172.190 1.00 170.18 ?  35   ALA H C     1 
ATOM   5354  O  O     . ALA H 4  39   ? 206.989 169.842 171.064 1.00 147.42 ?  35   ALA H O     1 
ATOM   5355  C  CB    . ALA H 4  39   ? 208.579 171.425 173.486 1.00 157.24 ?  35   ALA H CB    1 
ATOM   5356  N  N     . ILE H 4  40   ? 207.708 168.472 172.598 1.00 186.38 ?  36   ILE H N     1 
ATOM   5357  C  CA    . ILE H 4  40   ? 207.886 167.273 171.770 1.00 150.92 ?  36   ILE H CA    1 
ATOM   5358  C  C     . ILE H 4  40   ? 206.556 166.946 171.101 1.00 107.54 ?  36   ILE H C     1 
ATOM   5359  O  O     . ILE H 4  40   ? 206.503 166.699 169.916 1.00 97.49  ?  36   ILE H O     1 
ATOM   5360  C  CB    . ILE H 4  40   ? 208.385 166.086 172.627 1.00 166.58 ?  36   ILE H CB    1 
ATOM   5361  C  CG1   . ILE H 4  40   ? 209.782 166.303 173.185 1.00 211.92 ?  36   ILE H CG1   1 
ATOM   5362  C  CG2   . ILE H 4  40   ? 208.304 164.823 171.833 1.00 113.21 ?  36   ILE H CG2   1 
ATOM   5363  C  CD1   . ILE H 4  40   ? 210.149 165.271 174.224 1.00 213.51 ?  36   ILE H CD1   1 
ATOM   5364  N  N     . TYR H 4  41   ? 205.464 167.061 171.853 1.00 98.31  ?  37   TYR H N     1 
ATOM   5365  C  CA    . TYR H 4  41   ? 204.155 166.578 171.282 1.00 102.78 ?  37   TYR H CA    1 
ATOM   5366  C  C     . TYR H 4  41   ? 203.576 167.607 170.322 1.00 105.14 ?  37   TYR H C     1 
ATOM   5367  O  O     . TYR H 4  41   ? 203.060 167.213 169.274 1.00 90.95  ?  37   TYR H O     1 
ATOM   5368  C  CB    . TYR H 4  41   ? 203.133 166.171 172.347 1.00 98.44  ?  37   TYR H CB    1 
ATOM   5369  C  CG    . TYR H 4  41   ? 203.598 164.865 172.969 1.00 98.18  ?  37   TYR H CG    1 
ATOM   5370  C  CD1   . TYR H 4  41   ? 204.677 164.851 173.861 1.00 73.28  ?  37   TYR H CD1   1 
ATOM   5371  C  CD2   . TYR H 4  41   ? 203.158 163.660 172.478 1.00 107.25 ?  37   TYR H CD2   1 
ATOM   5372  C  CE1   . TYR H 4  41   ? 205.315 163.703 174.243 1.00 71.81  ?  37   TYR H CE1   1 
ATOM   5373  C  CE2   . TYR H 4  41   ? 203.762 162.480 172.879 1.00 131.29 ?  37   TYR H CE2   1 
ATOM   5374  C  CZ    . TYR H 4  41   ? 204.805 162.495 173.791 1.00 114.00 ?  37   TYR H CZ    1 
ATOM   5375  O  OH    . TYR H 4  41   ? 205.364 161.312 174.199 1.00 177.73 ?  37   TYR H OH    1 
ATOM   5376  N  N     . VAL H 4  42   ? 203.731 168.891 170.665 1.00 138.53 ?  38   VAL H N     1 
ATOM   5377  C  CA    . VAL H 4  42   ? 203.389 169.943 169.742 1.00 194.10 ?  38   VAL H CA    1 
ATOM   5378  C  C     . VAL H 4  42   ? 204.220 169.842 168.419 1.00 238.05 ?  38   VAL H C     1 
ATOM   5379  O  O     . VAL H 4  42   ? 203.836 170.139 167.289 1.00 383.45 ?  38   VAL H O     1 
ATOM   5380  C  CB    . VAL H 4  42   ? 203.585 171.342 170.364 1.00 176.47 ?  38   VAL H CB    1 
ATOM   5381  C  CG1   . VAL H 4  42   ? 203.511 172.416 169.248 1.00 217.61 ?  38   VAL H CG1   1 
ATOM   5382  C  CG2   . VAL H 4  42   ? 202.590 171.600 171.471 1.00 183.97 ?  38   VAL H CG2   1 
ATOM   5383  N  N     . TYR H 4  43   ? 205.476 169.441 168.577 1.00 178.32 ?  39   TYR H N     1 
ATOM   5384  C  CA    . TYR H 4  43   ? 206.467 169.523 167.548 1.00 154.68 ?  39   TYR H CA    1 
ATOM   5385  C  C     . TYR H 4  43   ? 206.186 168.754 166.251 1.00 163.35 ?  39   TYR H C     1 
ATOM   5386  O  O     . TYR H 4  43   ? 206.243 169.317 165.085 1.00 192.88 ?  39   TYR H O     1 
ATOM   5387  C  CB    . TYR H 4  43   ? 207.838 169.148 168.087 1.00 155.59 ?  39   TYR H CB    1 
ATOM   5388  C  CG    . TYR H 4  43   ? 208.736 169.884 167.150 1.00 211.84 ?  39   TYR H CG    1 
ATOM   5389  C  CD1   . TYR H 4  43   ? 208.813 171.269 167.199 1.00 222.32 ?  39   TYR H CD1   1 
ATOM   5390  C  CD2   . TYR H 4  43   ? 209.482 169.233 166.193 1.00 316.94 ?  39   TYR H CD2   1 
ATOM   5391  C  CE1   . TYR H 4  43   ? 209.616 172.010 166.340 1.00 253.04 ?  39   TYR H CE1   1 
ATOM   5392  C  CE2   . TYR H 4  43   ? 210.357 169.944 165.376 1.00 382.49 ?  39   TYR H CE2   1 
ATOM   5393  C  CZ    . TYR H 4  43   ? 210.393 171.333 165.420 1.00 329.23 ?  39   TYR H CZ    1 
ATOM   5394  O  OH    . TYR H 4  43   ? 211.222 172.000 164.561 1.00 338.68 ?  39   TYR H OH    1 
ATOM   5395  N  N     . LYS H 4  44   ? 205.865 167.476 166.413 1.00 163.12 ?  40   LYS H N     1 
ATOM   5396  C  CA    . LYS H 4  44   ? 205.220 166.633 165.361 1.00 175.96 ?  40   LYS H CA    1 
ATOM   5397  C  C     . LYS H 4  44   ? 203.919 167.157 164.676 1.00 172.57 ?  40   LYS H C     1 
ATOM   5398  O  O     . LYS H 4  44   ? 203.762 167.255 163.386 1.00 217.75 ?  40   LYS H O     1 
ATOM   5399  C  CB    . LYS H 4  44   ? 204.763 165.315 165.971 1.00 168.92 ?  40   LYS H CB    1 
ATOM   5400  C  CG    . LYS H 4  44   ? 205.701 164.528 166.878 1.00 181.97 ?  40   LYS H CG    1 
ATOM   5401  C  CD    . LYS H 4  44   ? 205.572 163.012 166.753 1.00 210.95 ?  40   LYS H CD    1 
ATOM   5402  C  CE    . LYS H 4  44   ? 204.414 162.315 167.474 1.00 232.53 ?  40   LYS H CE    1 
ATOM   5403  N  NZ    . LYS H 4  44   ? 204.539 160.835 167.540 1.00 206.19 1  40   LYS H NZ    1 
ATOM   5404  N  N     . VAL H 4  45   ? 202.909 167.389 165.525 1.00 127.35 ?  41   VAL H N     1 
ATOM   5405  C  CA    . VAL H 4  45   ? 201.577 167.790 165.043 1.00 105.53 ?  41   VAL H CA    1 
ATOM   5406  C  C     . VAL H 4  45   ? 201.631 169.100 164.245 1.00 98.58  ?  41   VAL H C     1 
ATOM   5407  O  O     . VAL H 4  45   ? 201.036 169.193 163.163 1.00 107.78 ?  41   VAL H O     1 
ATOM   5408  C  CB    . VAL H 4  45   ? 200.588 167.842 166.201 1.00 83.35  ?  41   VAL H CB    1 
ATOM   5409  C  CG1   . VAL H 4  45   ? 200.321 166.463 166.794 1.00 69.03  ?  41   VAL H CG1   1 
ATOM   5410  C  CG2   . VAL H 4  45   ? 201.153 168.683 167.290 1.00 97.77  ?  41   VAL H CG2   1 
ATOM   5411  N  N     . LEU H 4  46   ? 202.494 170.030 164.661 1.00 101.93 ?  42   LEU H N     1 
ATOM   5412  C  CA    . LEU H 4  46   ? 202.746 171.266 163.937 1.00 117.21 ?  42   LEU H CA    1 
ATOM   5413  C  C     . LEU H 4  46   ? 203.007 170.962 162.463 1.00 148.97 ?  42   LEU H C     1 
ATOM   5414  O  O     . LEU H 4  46   ? 202.407 171.483 161.503 1.00 133.04 ?  42   LEU H O     1 
ATOM   5415  C  CB    . LEU H 4  46   ? 204.048 171.959 164.380 1.00 140.38 ?  42   LEU H CB    1 
ATOM   5416  C  CG    . LEU H 4  46   ? 203.976 172.564 165.771 1.00 214.44 ?  42   LEU H CG    1 
ATOM   5417  C  CD1   . LEU H 4  46   ? 205.274 173.113 166.290 1.00 180.06 ?  42   LEU H CD1   1 
ATOM   5418  C  CD2   . LEU H 4  46   ? 202.916 173.608 165.690 1.00 310.30 ?  42   LEU H CD2   1 
ATOM   5419  N  N     . LYS H 4  47   ? 204.029 170.109 162.322 1.00 214.88 ?  43   LYS H N     1 
ATOM   5420  C  CA    . LYS H 4  47   ? 204.528 169.707 160.986 1.00 222.66 ?  43   LYS H CA    1 
ATOM   5421  C  C     . LYS H 4  47   ? 203.449 168.912 160.250 1.00 187.36 ?  43   LYS H C     1 
ATOM   5422  O  O     . LYS H 4  47   ? 203.284 169.103 159.061 1.00 146.95 ?  43   LYS H O     1 
ATOM   5423  C  CB    . LYS H 4  47   ? 205.857 168.977 161.176 1.00 245.29 ?  43   LYS H CB    1 
ATOM   5424  C  CG    . LYS H 4  47   ? 206.957 169.976 161.527 1.00 274.64 ?  43   LYS H CG    1 
ATOM   5425  C  CD    . LYS H 4  47   ? 206.942 171.170 160.561 1.00 303.65 ?  43   LYS H CD    1 
ATOM   5426  C  CE    . LYS H 4  47   ? 208.135 172.069 160.785 1.00 367.93 ?  43   LYS H CE    1 
ATOM   5427  N  NZ    . LYS H 4  47   ? 208.013 173.338 160.039 1.00 424.23 1  43   LYS H NZ    1 
ATOM   5428  N  N     . GLN H 4  48   ? 202.744 168.041 160.985 1.00 160.67 ?  44   GLN H N     1 
ATOM   5429  C  CA    . GLN H 4  48   ? 201.711 167.229 160.376 1.00 129.32 ?  44   GLN H CA    1 
ATOM   5430  C  C     . GLN H 4  48   ? 200.737 168.156 159.652 1.00 109.39 ?  44   GLN H C     1 
ATOM   5431  O  O     . GLN H 4  48   ? 200.265 167.786 158.594 1.00 104.57 ?  44   GLN H O     1 
ATOM   5432  C  CB    . GLN H 4  48   ? 200.971 166.419 161.421 1.00 138.28 ?  44   GLN H CB    1 
ATOM   5433  C  CG    . GLN H 4  48   ? 199.846 165.529 160.884 1.00 159.52 ?  44   GLN H CG    1 
ATOM   5434  C  CD    . GLN H 4  48   ? 199.536 164.320 161.745 1.00 210.98 ?  44   GLN H CD    1 
ATOM   5435  O  OE1   . GLN H 4  48   ? 200.455 163.715 162.302 1.00 215.71 ?  44   GLN H OE1   1 
ATOM   5436  N  NE2   . GLN H 4  48   ? 198.259 163.900 161.837 1.00 265.46 ?  44   GLN H NE2   1 
ATOM   5437  N  N     . VAL H 4  49   ? 200.491 169.373 160.195 1.00 104.65 ?  45   VAL H N     1 
ATOM   5438  C  CA    . VAL H 4  49   ? 199.459 170.231 159.604 1.00 100.01 ?  45   VAL H CA    1 
ATOM   5439  C  C     . VAL H 4  49   ? 199.930 171.446 158.836 1.00 93.08  ?  45   VAL H C     1 
ATOM   5440  O  O     . VAL H 4  49   ? 199.279 171.799 157.864 1.00 97.56  ?  45   VAL H O     1 
ATOM   5441  C  CB    . VAL H 4  49   ? 198.471 170.700 160.659 1.00 98.92  ?  45   VAL H CB    1 
ATOM   5442  C  CG1   . VAL H 4  49   ? 197.541 171.840 160.246 1.00 88.90  ?  45   VAL H CG1   1 
ATOM   5443  C  CG2   . VAL H 4  49   ? 197.780 169.454 161.226 1.00 113.38 ?  45   VAL H CG2   1 
ATOM   5444  N  N     . HIS H 4  50   ? 201.023 172.077 159.275 1.00 109.39 ?  46   HIS H N     1 
ATOM   5445  C  CA    . HIS H 4  50   ? 201.618 173.195 158.575 1.00 144.66 ?  46   HIS H CA    1 
ATOM   5446  C  C     . HIS H 4  50   ? 203.130 173.048 158.482 1.00 192.58 ?  46   HIS H C     1 
ATOM   5447  O  O     . HIS H 4  50   ? 203.844 173.763 159.149 1.00 254.88 ?  46   HIS H O     1 
ATOM   5448  C  CB    . HIS H 4  50   ? 201.248 174.490 159.262 1.00 134.12 ?  46   HIS H CB    1 
ATOM   5449  C  CG    . HIS H 4  50   ? 199.998 175.077 158.697 1.00 131.80 ?  46   HIS H CG    1 
ATOM   5450  N  ND1   . HIS H 4  50   ? 198.759 174.593 159.111 1.00 146.58 ?  46   HIS H ND1   1 
ATOM   5451  C  CD2   . HIS H 4  50   ? 199.775 175.931 157.663 1.00 133.36 ?  46   HIS H CD2   1 
ATOM   5452  C  CE1   . HIS H 4  50   ? 197.810 175.224 158.423 1.00 176.40 ?  46   HIS H CE1   1 
ATOM   5453  N  NE2   . HIS H 4  50   ? 198.424 176.072 157.539 1.00 173.03 ?  46   HIS H NE2   1 
ATOM   5454  N  N     . PRO H 4  51   ? 203.626 172.078 157.671 1.00 177.94 ?  47   PRO H N     1 
ATOM   5455  C  CA    . PRO H 4  51   ? 205.052 171.750 157.698 1.00 200.59 ?  47   PRO H CA    1 
ATOM   5456  C  C     . PRO H 4  51   ? 206.029 172.877 157.286 1.00 242.69 ?  47   PRO H C     1 
ATOM   5457  O  O     . PRO H 4  51   ? 207.172 172.785 157.671 1.00 262.97 ?  47   PRO H O     1 
ATOM   5458  C  CB    . PRO H 4  51   ? 205.154 170.638 156.654 1.00 213.81 ?  47   PRO H CB    1 
ATOM   5459  C  CG    . PRO H 4  51   ? 203.914 170.753 155.788 1.00 179.51 ?  47   PRO H CG    1 
ATOM   5460  C  CD    . PRO H 4  51   ? 202.846 171.189 156.758 1.00 151.31 ?  47   PRO H CD    1 
ATOM   5461  N  N     . ASP H 4  52   ? 205.601 173.854 156.479 1.00 232.40 ?  48   ASP H N     1 
ATOM   5462  C  CA    . ASP H 4  52   ? 206.382 175.011 156.205 1.00 226.16 ?  48   ASP H CA    1 
ATOM   5463  C  C     . ASP H 4  52   ? 205.895 176.070 157.207 1.00 257.57 ?  48   ASP H C     1 
ATOM   5464  O  O     . ASP H 4  52   ? 205.045 176.830 156.813 1.00 234.98 ?  48   ASP H O     1 
ATOM   5465  C  CB    . ASP H 4  52   ? 206.207 175.438 154.753 1.00 191.17 ?  48   ASP H CB    1 
ATOM   5466  C  CG    . ASP H 4  52   ? 204.760 175.549 154.365 1.00 163.29 ?  48   ASP H CG    1 
ATOM   5467  O  OD1   . ASP H 4  52   ? 203.898 174.954 155.059 1.00 123.78 ?  48   ASP H OD1   1 
ATOM   5468  O  OD2   . ASP H 4  52   ? 204.554 176.156 153.337 1.00 319.94 -1 48   ASP H OD2   1 
ATOM   5469  N  N     . THR H 4  53   ? 206.326 175.947 158.463 1.00 294.80 ?  49   THR H N     1 
ATOM   5470  C  CA    . THR H 4  53   ? 205.872 176.774 159.567 1.00 260.98 ?  49   THR H CA    1 
ATOM   5471  C  C     . THR H 4  53   ? 206.657 176.437 160.834 1.00 233.20 ?  49   THR H C     1 
ATOM   5472  O  O     . THR H 4  53   ? 207.147 175.323 161.052 1.00 287.07 ?  49   THR H O     1 
ATOM   5473  C  CB    . THR H 4  53   ? 204.399 176.522 159.850 1.00 272.68 ?  49   THR H CB    1 
ATOM   5474  O  OG1   . THR H 4  53   ? 203.640 176.871 158.695 1.00 275.31 ?  49   THR H OG1   1 
ATOM   5475  C  CG2   . THR H 4  53   ? 203.924 177.164 161.123 1.00 290.05 ?  49   THR H CG2   1 
ATOM   5476  N  N     . GLY H 4  54   ? 206.763 177.388 161.769 1.00 182.38 ?  50   GLY H N     1 
ATOM   5477  C  CA    . GLY H 4  54   ? 207.466 177.089 163.043 1.00 170.73 ?  50   GLY H CA    1 
ATOM   5478  C  C     . GLY H 4  54   ? 206.902 177.779 164.264 1.00 148.29 ?  50   GLY H C     1 
ATOM   5479  O  O     . GLY H 4  54   ? 206.105 178.688 164.222 1.00 163.19 ?  50   GLY H O     1 
ATOM   5480  N  N     . ILE H 4  55   ? 207.455 177.429 165.427 1.00 130.26 ?  51   ILE H N     1 
ATOM   5481  C  CA    . ILE H 4  55   ? 206.964 177.944 166.734 1.00 145.93 ?  51   ILE H CA    1 
ATOM   5482  C  C     . ILE H 4  55   ? 207.960 178.937 167.342 1.00 192.00 ?  51   ILE H C     1 
ATOM   5483  O  O     . ILE H 4  55   ? 209.119 178.676 167.339 1.00 317.34 ?  51   ILE H O     1 
ATOM   5484  C  CB    . ILE H 4  55   ? 206.750 176.758 167.689 1.00 149.29 ?  51   ILE H CB    1 
ATOM   5485  C  CG1   . ILE H 4  55   ? 207.935 175.790 167.754 1.00 169.86 ?  51   ILE H CG1   1 
ATOM   5486  C  CG2   . ILE H 4  55   ? 205.478 176.089 167.352 1.00 151.07 ?  51   ILE H CG2   1 
ATOM   5487  C  CD1   . ILE H 4  55   ? 208.647 175.842 169.089 1.00 234.92 ?  51   ILE H CD1   1 
ATOM   5488  N  N     . SER H 4  56   ? 207.521 180.036 167.987 1.00 260.93 ?  52   SER H N     1 
ATOM   5489  C  CA    . SER H 4  56   ? 208.428 180.894 168.821 1.00 247.33 ?  52   SER H CA    1 
ATOM   5490  C  C     . SER H 4  56   ? 208.785 180.120 170.094 1.00 259.56 ?  52   SER H C     1 
ATOM   5491  O  O     . SER H 4  56   ? 208.025 179.271 170.529 1.00 251.68 ?  52   SER H O     1 
ATOM   5492  C  CB    . SER H 4  56   ? 207.827 182.270 169.112 1.00 211.31 ?  52   SER H CB    1 
ATOM   5493  O  OG    . SER H 4  56   ? 208.808 183.179 169.630 1.00 128.95 ?  52   SER H OG    1 
ATOM   5494  N  N     . SER H 4  57   ? 209.952 180.353 170.682 1.00 237.49 ?  53   SER H N     1 
ATOM   5495  C  CA    . SER H 4  57   ? 210.313 179.576 171.876 1.00 210.62 ?  53   SER H CA    1 
ATOM   5496  C  C     . SER H 4  57   ? 209.371 179.880 173.048 1.00 161.24 ?  53   SER H C     1 
ATOM   5497  O  O     . SER H 4  57   ? 209.016 179.058 173.766 1.00 122.81 ?  53   SER H O     1 
ATOM   5498  C  CB    . SER H 4  57   ? 211.822 179.749 172.203 1.00 251.88 ?  53   SER H CB    1 
ATOM   5499  O  OG    . SER H 4  57   ? 212.129 181.106 172.544 1.00 193.28 ?  53   SER H OG    1 
ATOM   5500  N  N     . LYS H 4  58   ? 209.033 181.145 173.199 1.00 156.51 ?  54   LYS H N     1 
ATOM   5501  C  CA    . LYS H 4  58   ? 208.002 181.577 174.163 1.00 135.83 ?  54   LYS H CA    1 
ATOM   5502  C  C     . LYS H 4  58   ? 206.569 181.211 173.731 1.00 103.68 ?  54   LYS H C     1 
ATOM   5503  O  O     . LYS H 4  58   ? 205.785 180.738 174.498 1.00 94.54  ?  54   LYS H O     1 
ATOM   5504  C  CB    . LYS H 4  58   ? 208.083 183.081 174.437 1.00 152.13 ?  54   LYS H CB    1 
ATOM   5505  C  CG    . LYS H 4  58   ? 208.098 183.956 173.203 1.00 178.33 ?  54   LYS H CG    1 
ATOM   5506  C  CD    . LYS H 4  58   ? 208.497 185.383 173.566 1.00 181.49 ?  54   LYS H CD    1 
ATOM   5507  C  CE    . LYS H 4  58   ? 209.649 185.884 172.722 1.00 188.91 ?  54   LYS H CE    1 
ATOM   5508  N  NZ    . LYS H 4  58   ? 209.830 187.358 172.814 1.00 183.87 1  54   LYS H NZ    1 
ATOM   5509  N  N     . ALA H 4  59   ? 206.330 181.277 172.432 1.00 90.14  ?  55   ALA H N     1 
ATOM   5510  C  CA    . ALA H 4  59   ? 204.995 180.847 171.910 1.00 76.93  ?  55   ALA H CA    1 
ATOM   5511  C  C     . ALA H 4  59   ? 204.774 179.369 172.273 1.00 92.31  ?  55   ALA H C     1 
ATOM   5512  O  O     . ALA H 4  59   ? 203.656 178.994 172.677 1.00 79.29  ?  55   ALA H O     1 
ATOM   5513  C  CB    . ALA H 4  59   ? 204.889 181.156 170.451 1.00 79.79  ?  55   ALA H CB    1 
ATOM   5514  N  N     . MET H 4  60   ? 205.824 178.552 172.201 1.00 117.75 ?  56   MET H N     1 
ATOM   5515  C  CA    . MET H 4  60   ? 205.711 177.171 172.584 1.00 142.80 ?  56   MET H CA    1 
ATOM   5516  C  C     . MET H 4  60   ? 205.503 177.020 174.108 1.00 124.42 ?  56   MET H C     1 
ATOM   5517  O  O     . MET H 4  60   ? 204.747 176.216 174.611 1.00 103.12 ?  56   MET H O     1 
ATOM   5518  C  CB    . MET H 4  60   ? 206.968 176.365 172.205 1.00 113.86 ?  56   MET H CB    1 
ATOM   5519  C  CG    . MET H 4  60   ? 206.819 174.879 172.476 1.00 108.29 ?  56   MET H CG    1 
ATOM   5520  S  SD    . MET H 4  60   ? 207.796 173.866 171.600 1.00 147.78 ?  56   MET H SD    1 
ATOM   5521  C  CE    . MET H 4  60   ? 206.937 173.794 170.023 1.00 127.92 ?  56   MET H CE    1 
ATOM   5522  N  N     . SER H 4  61   ? 206.224 177.844 174.853 1.00 108.86 ?  57   SER H N     1 
ATOM   5523  C  CA    . SER H 4  61   ? 206.080 177.815 176.261 1.00 104.69 ?  57   SER H CA    1 
ATOM   5524  C  C     . SER H 4  61   ? 204.626 178.161 176.578 1.00 85.72  ?  57   SER H C     1 
ATOM   5525  O  O     . SER H 4  61   ? 204.065 177.498 177.462 1.00 71.98  ?  57   SER H O     1 
ATOM   5526  C  CB    . SER H 4  61   ? 207.055 178.747 176.965 1.00 138.09 ?  57   SER H CB    1 
ATOM   5527  O  OG    . SER H 4  61   ? 208.374 178.436 176.535 1.00 160.91 ?  57   SER H OG    1 
ATOM   5528  N  N     . ILE H 4  62   ? 204.078 179.172 175.899 1.00 82.89  ?  58   ILE H N     1 
ATOM   5529  C  CA    . ILE H 4  62   ? 202.717 179.621 176.153 1.00 80.85  ?  58   ILE H CA    1 
ATOM   5530  C  C     . ILE H 4  62   ? 201.811 178.428 175.963 1.00 69.06  ?  58   ILE H C     1 
ATOM   5531  O  O     . ILE H 4  62   ? 200.839 178.228 176.678 1.00 65.44  ?  58   ILE H O     1 
ATOM   5532  C  CB    . ILE H 4  62   ? 202.289 180.751 175.222 1.00 81.27  ?  58   ILE H CB    1 
ATOM   5533  C  CG1   . ILE H 4  62   ? 203.281 181.888 175.193 1.00 76.78  ?  58   ILE H CG1   1 
ATOM   5534  C  CG2   . ILE H 4  62   ? 200.934 181.305 175.580 1.00 116.77 ?  58   ILE H CG2   1 
ATOM   5535  C  CD1   . ILE H 4  62   ? 203.137 182.701 173.917 1.00 65.29  ?  58   ILE H CD1   1 
ATOM   5536  N  N     . MET H 4  63   ? 202.127 177.665 174.915 1.00 78.28  ?  59   MET H N     1 
ATOM   5537  C  CA    . MET H 4  63   ? 201.308 176.489 174.621 1.00 96.33  ?  59   MET H CA    1 
ATOM   5538  C  C     . MET H 4  63   ? 201.482 175.427 175.683 1.00 77.80  ?  59   MET H C     1 
ATOM   5539  O  O     . MET H 4  63   ? 200.506 174.813 176.093 1.00 61.21  ?  59   MET H O     1 
ATOM   5540  C  CB    . MET H 4  63   ? 201.622 175.952 173.236 1.00 139.71 ?  59   MET H CB    1 
ATOM   5541  C  CG    . MET H 4  63   ? 201.720 177.076 172.210 1.00 197.85 ?  59   MET H CG    1 
ATOM   5542  S  SD    . MET H 4  63   ? 200.732 178.657 172.419 1.00 183.07 ?  59   MET H SD    1 
ATOM   5543  C  CE    . MET H 4  63   ? 199.023 178.304 171.995 1.00 178.60 ?  59   MET H CE    1 
ATOM   5544  N  N     . ASN H 4  64   ? 202.682 175.248 176.199 1.00 81.07  ?  60   ASN H N     1 
ATOM   5545  C  CA    . ASN H 4  64   ? 202.934 174.320 177.267 1.00 90.11  ?  60   ASN H CA    1 
ATOM   5546  C  C     . ASN H 4  64   ? 202.075 174.624 178.496 1.00 96.64  ?  60   ASN H C     1 
ATOM   5547  O  O     . ASN H 4  64   ? 201.478 173.691 179.146 1.00 66.61  ?  60   ASN H O     1 
ATOM   5548  C  CB    . ASN H 4  64   ? 204.405 174.298 177.675 1.00 70.77  ?  60   ASN H CB    1 
ATOM   5549  C  CG    . ASN H 4  64   ? 205.370 173.834 176.582 1.00 66.93  ?  60   ASN H CG    1 
ATOM   5550  O  OD1   . ASN H 4  64   ? 206.540 174.211 176.513 1.00 45.42  ?  60   ASN H OD1   1 
ATOM   5551  N  ND2   . ASN H 4  64   ? 204.848 173.065 175.648 1.00 92.30  ?  60   ASN H ND2   1 
ATOM   5552  N  N     . SER H 4  65   ? 202.020 175.923 178.820 1.00 128.50 ?  61   SER H N     1 
ATOM   5553  C  CA    . SER H 4  65   ? 201.244 176.437 179.933 1.00 156.87 ?  61   SER H CA    1 
ATOM   5554  C  C     . SER H 4  65   ? 199.769 176.113 179.701 1.00 128.69 ?  61   SER H C     1 
ATOM   5555  O  O     . SER H 4  65   ? 199.073 175.566 180.604 1.00 139.39 ?  61   SER H O     1 
ATOM   5556  C  CB    . SER H 4  65   ? 201.449 177.925 180.116 1.00 170.75 ?  61   SER H CB    1 
ATOM   5557  O  OG    . SER H 4  65   ? 200.310 178.466 180.763 1.00 147.51 ?  61   SER H OG    1 
ATOM   5558  N  N     . PHE H 4  66   ? 199.372 176.369 178.461 1.00 112.47 ?  62   PHE H N     1 
ATOM   5559  C  CA    . PHE H 4  66   ? 197.954 176.334 178.084 1.00 115.99 ?  62   PHE H CA    1 
ATOM   5560  C  C     . PHE H 4  66   ? 197.407 174.948 178.280 1.00 108.83 ?  62   PHE H C     1 
ATOM   5561  O  O     . PHE H 4  66   ? 196.320 174.808 178.751 1.00 95.28  ?  62   PHE H O     1 
ATOM   5562  C  CB    . PHE H 4  66   ? 197.795 176.826 176.645 1.00 139.99 ?  62   PHE H CB    1 
ATOM   5563  C  CG    . PHE H 4  66   ? 196.498 176.462 175.996 1.00 160.69 ?  62   PHE H CG    1 
ATOM   5564  C  CD1   . PHE H 4  66   ? 196.289 175.241 175.358 1.00 169.68 ?  62   PHE H CD1   1 
ATOM   5565  C  CD2   . PHE H 4  66   ? 195.467 177.347 176.071 1.00 179.64 ?  62   PHE H CD2   1 
ATOM   5566  C  CE1   . PHE H 4  66   ? 195.059 174.892 174.845 1.00 166.05 ?  62   PHE H CE1   1 
ATOM   5567  C  CE2   . PHE H 4  66   ? 194.261 177.053 175.446 1.00 221.98 ?  62   PHE H CE2   1 
ATOM   5568  C  CZ    . PHE H 4  66   ? 194.059 175.816 174.869 1.00 204.09 ?  62   PHE H CZ    1 
ATOM   5569  N  N     . VAL H 4  67   ? 198.172 173.924 177.857 1.00 104.35 ?  63   VAL H N     1 
ATOM   5570  C  CA    . VAL H 4  67   ? 197.726 172.544 177.880 1.00 109.99 ?  63   VAL H CA    1 
ATOM   5571  C  C     . VAL H 4  67   ? 197.525 172.105 179.336 1.00 94.66  ?  63   VAL H C     1 
ATOM   5572  O  O     . VAL H 4  67   ? 196.586 171.433 179.705 1.00 84.93  ?  63   VAL H O     1 
ATOM   5573  C  CB    . VAL H 4  67   ? 198.834 171.678 177.230 1.00 138.00 ?  63   VAL H CB    1 
ATOM   5574  C  CG1   . VAL H 4  67   ? 198.646 170.174 177.475 1.00 218.94 ?  63   VAL H CG1   1 
ATOM   5575  C  CG2   . VAL H 4  67   ? 198.902 172.022 175.750 1.00 135.28 ?  63   VAL H CG2   1 
ATOM   5576  N  N     . ASN H 4  68   ? 198.501 172.487 180.171 1.00 93.80  ?  64   ASN H N     1 
ATOM   5577  C  CA    . ASN H 4  68   ? 198.501 172.015 181.519 1.00 109.21 ?  64   ASN H CA    1 
ATOM   5578  C  C     . ASN H 4  68   ? 197.305 172.560 182.297 1.00 118.68 ?  64   ASN H C     1 
ATOM   5579  O  O     . ASN H 4  68   ? 196.716 171.804 183.119 1.00 116.66 ?  64   ASN H O     1 
ATOM   5580  C  CB    . ASN H 4  68   ? 199.835 172.271 182.194 1.00 153.26 ?  64   ASN H CB    1 
ATOM   5581  C  CG    . ASN H 4  68   ? 200.099 171.126 183.152 1.00 175.80 ?  64   ASN H CG    1 
ATOM   5582  O  OD1   . ASN H 4  68   ? 199.749 169.991 182.961 1.00 126.22 ?  64   ASN H OD1   1 
ATOM   5583  N  ND2   . ASN H 4  68   ? 200.838 171.402 184.194 1.00 239.64 ?  64   ASN H ND2   1 
ATOM   5584  N  N     . ASP H 4  69   ? 197.065 173.882 182.093 1.00 123.21 ?  65   ASP H N     1 
ATOM   5585  C  CA    . ASP H 4  69   ? 195.867 174.599 182.635 1.00 99.90  ?  65   ASP H CA    1 
ATOM   5586  C  C     . ASP H 4  69   ? 194.647 173.855 182.168 1.00 76.68  ?  65   ASP H C     1 
ATOM   5587  O  O     . ASP H 4  69   ? 193.694 173.575 182.803 1.00 61.41  ?  65   ASP H O     1 
ATOM   5588  C  CB    . ASP H 4  69   ? 195.697 176.049 182.145 1.00 123.24 ?  65   ASP H CB    1 
ATOM   5589  C  CG    . ASP H 4  69   ? 194.272 176.663 182.170 1.00 160.24 ?  65   ASP H CG    1 
ATOM   5590  O  OD1   . ASP H 4  69   ? 193.805 177.082 183.217 1.00 238.98 ?  65   ASP H OD1   1 
ATOM   5591  O  OD2   . ASP H 4  69   ? 193.551 176.756 181.163 1.00 440.00 -1 65   ASP H OD2   1 
ATOM   5592  N  N     . VAL H 4  70   ? 194.780 173.537 180.890 1.00 86.65  ?  66   VAL H N     1 
ATOM   5593  C  CA    . VAL H 4  70   ? 193.696 172.918 180.210 1.00 89.79  ?  66   VAL H CA    1 
ATOM   5594  C  C     . VAL H 4  70   ? 193.550 171.479 180.726 1.00 91.69  ?  66   VAL H C     1 
ATOM   5595  O  O     . VAL H 4  70   ? 192.479 170.966 180.974 1.00 75.27  ?  66   VAL H O     1 
ATOM   5596  C  CB    . VAL H 4  70   ? 193.942 172.924 178.704 1.00 94.79  ?  66   VAL H CB    1 
ATOM   5597  C  CG1   . VAL H 4  70   ? 192.806 172.225 178.072 1.00 120.45 ?  66   VAL H CG1   1 
ATOM   5598  C  CG2   . VAL H 4  70   ? 193.994 174.291 178.115 1.00 72.95  ?  66   VAL H CG2   1 
ATOM   5599  N  N     . PHE H 4  71   ? 194.700 170.855 180.962 1.00 79.38  ?  67   PHE H N     1 
ATOM   5600  C  CA    . PHE H 4  71   ? 194.742 169.509 181.573 1.00 68.71  ?  67   PHE H CA    1 
ATOM   5601  C  C     . PHE H 4  71   ? 194.090 169.552 182.965 1.00 70.37  ?  67   PHE H C     1 
ATOM   5602  O  O     . PHE H 4  71   ? 193.395 168.714 183.386 1.00 65.93  ?  67   PHE H O     1 
ATOM   5603  C  CB    . PHE H 4  71   ? 196.167 168.963 181.606 1.00 67.79  ?  67   PHE H CB    1 
ATOM   5604  C  CG    . PHE H 4  71   ? 196.273 167.764 182.515 1.00 97.62  ?  67   PHE H CG    1 
ATOM   5605  C  CD1   . PHE H 4  71   ? 195.885 166.490 182.144 1.00 106.95 ?  67   PHE H CD1   1 
ATOM   5606  C  CD2   . PHE H 4  71   ? 196.633 167.880 183.853 1.00 126.18 ?  67   PHE H CD2   1 
ATOM   5607  C  CE1   . PHE H 4  71   ? 195.892 165.405 183.044 1.00 81.20  ?  67   PHE H CE1   1 
ATOM   5608  C  CE2   . PHE H 4  71   ? 196.712 166.785 184.719 1.00 102.96 ?  67   PHE H CE2   1 
ATOM   5609  C  CZ    . PHE H 4  71   ? 196.281 165.524 184.354 1.00 67.15  ?  67   PHE H CZ    1 
ATOM   5610  N  N     . GLU H 4  72   ? 194.441 170.561 183.765 1.00 78.72  ?  68   GLU H N     1 
ATOM   5611  C  CA    . GLU H 4  72   ? 193.912 170.724 185.136 1.00 83.88  ?  68   GLU H CA    1 
ATOM   5612  C  C     . GLU H 4  72   ? 192.433 171.107 185.248 1.00 77.51  ?  68   GLU H C     1 
ATOM   5613  O  O     . GLU H 4  72   ? 191.810 170.612 186.166 1.00 62.46  ?  68   GLU H O     1 
ATOM   5614  C  CB    . GLU H 4  72   ? 194.715 171.817 185.855 1.00 121.15 ?  68   GLU H CB    1 
ATOM   5615  C  CG    . GLU H 4  72   ? 195.981 171.311 186.630 1.00 151.05 ?  68   GLU H CG    1 
ATOM   5616  C  CD    . GLU H 4  72   ? 196.211 171.840 188.049 1.00 169.13 ?  68   GLU H CD    1 
ATOM   5617  O  OE1   . GLU H 4  72   ? 195.940 171.040 188.987 1.00 155.07 ?  68   GLU H OE1   1 
ATOM   5618  O  OE2   . GLU H 4  72   ? 196.787 173.038 188.235 1.00 102.47 -1 68   GLU H OE2   1 
ATOM   5619  N  N     . ARG H 4  73   ? 191.900 172.054 184.491 1.00 83.71  ?  69   ARG H N     1 
ATOM   5620  C  CA    . ARG H 4  73   ? 190.472 172.441 184.664 1.00 73.57  ?  69   ARG H CA    1 
ATOM   5621  C  C     . ARG H 4  73   ? 189.563 171.222 184.511 1.00 66.13  ?  69   ARG H C     1 
ATOM   5622  O  O     . ARG H 4  73   ? 188.603 171.043 185.256 1.00 47.07  ?  69   ARG H O     1 
ATOM   5623  C  CB    . ARG H 4  73   ? 190.091 173.433 183.567 1.00 73.72  ?  69   ARG H CB    1 
ATOM   5624  C  CG    . ARG H 4  73   ? 190.751 174.780 183.550 1.00 75.62  ?  69   ARG H CG    1 
ATOM   5625  C  CD    . ARG H 4  73   ? 190.324 175.442 182.249 1.00 85.39  ?  69   ARG H CD    1 
ATOM   5626  N  NE    . ARG H 4  73   ? 190.807 176.807 182.218 1.00 112.36 ?  69   ARG H NE    1 
ATOM   5627  C  CZ    . ARG H 4  73   ? 190.606 177.717 181.265 1.00 111.16 ?  69   ARG H CZ    1 
ATOM   5628  N  NH1   . ARG H 4  73   ? 189.823 177.440 180.241 1.00 91.10  1  69   ARG H NH1   1 
ATOM   5629  N  NH2   . ARG H 4  73   ? 191.045 178.949 181.420 1.00 103.42 ?  69   ARG H NH2   1 
ATOM   5630  N  N     . ILE H 4  74   ? 189.942 170.389 183.548 1.00 84.74  ?  70   ILE H N     1 
ATOM   5631  C  CA    . ILE H 4  74   ? 189.250 169.175 183.136 1.00 106.13 ?  70   ILE H CA    1 
ATOM   5632  C  C     . ILE H 4  74   ? 189.450 168.139 184.238 1.00 75.88  ?  70   ILE H C     1 
ATOM   5633  O  O     . ILE H 4  74   ? 188.604 167.436 184.640 1.00 75.75  ?  70   ILE H O     1 
ATOM   5634  C  CB    . ILE H 4  74   ? 189.781 168.698 181.737 1.00 121.13 ?  70   ILE H CB    1 
ATOM   5635  C  CG1   . ILE H 4  74   ? 189.652 169.787 180.683 1.00 114.99 ?  70   ILE H CG1   1 
ATOM   5636  C  CG2   . ILE H 4  74   ? 189.052 167.414 181.243 1.00 130.75 ?  70   ILE H CG2   1 
ATOM   5637  C  CD1   . ILE H 4  74   ? 190.581 170.883 180.725 1.00 85.26  ?  70   ILE H CD1   1 
ATOM   5638  N  N     . ALA H 4  75   ? 190.700 167.923 184.600 1.00 64.35  ?  71   ALA H N     1 
ATOM   5639  C  CA    . ALA H 4  75   ? 191.071 166.945 185.596 1.00 70.45  ?  71   ALA H CA    1 
ATOM   5640  C  C     . ALA H 4  75   ? 190.333 167.316 186.854 1.00 79.43  ?  71   ALA H C     1 
ATOM   5641  O  O     . ALA H 4  75   ? 189.844 166.371 187.533 1.00 67.90  ?  71   ALA H O     1 
ATOM   5642  C  CB    . ALA H 4  75   ? 192.546 167.031 185.875 1.00 77.66  ?  71   ALA H CB    1 
ATOM   5643  N  N     . GLY H 4  76   ? 190.326 168.608 187.187 1.00 98.32  ?  72   GLY H N     1 
ATOM   5644  C  CA    . GLY H 4  76   ? 189.622 169.137 188.298 1.00 114.90 ?  72   GLY H CA    1 
ATOM   5645  C  C     . GLY H 4  76   ? 188.168 168.846 188.167 1.00 100.30 ?  72   GLY H C     1 
ATOM   5646  O  O     . GLY H 4  76   ? 187.474 168.404 189.116 1.00 87.92  ?  72   GLY H O     1 
ATOM   5647  N  N     . GLU H 4  77   ? 187.703 169.097 186.950 1.00 91.88  ?  73   GLU H N     1 
ATOM   5648  C  CA    . GLU H 4  77   ? 186.291 168.821 186.713 1.00 90.47  ?  73   GLU H CA    1 
ATOM   5649  C  C     . GLU H 4  77   ? 186.006 167.357 186.999 1.00 83.91  ?  73   GLU H C     1 
ATOM   5650  O  O     . GLU H 4  77   ? 185.003 167.044 187.572 1.00 52.78  ?  73   GLU H O     1 
ATOM   5651  C  CB    . GLU H 4  77   ? 185.973 169.198 185.271 1.00 118.28 ?  73   GLU H CB    1 
ATOM   5652  C  CG    . GLU H 4  77   ? 184.498 169.303 184.930 1.00 151.54 ?  73   GLU H CG    1 
ATOM   5653  C  CD    . GLU H 4  77   ? 183.726 170.215 185.817 1.00 171.89 ?  73   GLU H CD    1 
ATOM   5654  O  OE1   . GLU H 4  77   ? 184.373 170.942 186.563 1.00 168.02 ?  73   GLU H OE1   1 
ATOM   5655  O  OE2   . GLU H 4  77   ? 182.485 170.228 185.692 1.00 145.37 -1 73   GLU H OE2   1 
ATOM   5656  N  N     . ALA H 4  78   ? 186.888 166.489 186.478 1.00 117.83 ?  74   ALA H N     1 
ATOM   5657  C  CA    . ALA H 4  78   ? 186.760 165.078 186.492 1.00 118.31 ?  74   ALA H CA    1 
ATOM   5658  C  C     . ALA H 4  78   ? 186.647 164.608 187.941 1.00 112.19 ?  74   ALA H C     1 
ATOM   5659  O  O     . ALA H 4  78   ? 185.858 163.780 188.376 1.00 110.59 ?  74   ALA H O     1 
ATOM   5660  C  CB    . ALA H 4  78   ? 187.974 164.375 185.837 1.00 72.79  ?  74   ALA H CB    1 
ATOM   5661  N  N     . SER H 4  79   ? 187.593 165.096 188.715 1.00 120.37 ?  75   SER H N     1 
ATOM   5662  C  CA    . SER H 4  79   ? 187.724 164.676 190.096 1.00 137.14 ?  75   SER H CA    1 
ATOM   5663  C  C     . SER H 4  79   ? 186.423 164.996 190.860 1.00 95.43  ?  75   SER H C     1 
ATOM   5664  O  O     . SER H 4  79   ? 186.026 164.178 191.728 1.00 80.63  ?  75   SER H O     1 
ATOM   5665  C  CB    . SER H 4  79   ? 188.935 165.352 190.736 1.00 205.56 ?  75   SER H CB    1 
ATOM   5666  O  OG    . SER H 4  79   ? 188.740 166.763 190.733 1.00 293.16 ?  75   SER H OG    1 
ATOM   5667  N  N     . ARG H 4  80   ? 185.890 166.210 190.700 1.00 92.03  ?  76   ARG H N     1 
ATOM   5668  C  CA    . ARG H 4  80   ? 184.776 166.657 191.511 1.00 119.84 ?  76   ARG H CA    1 
ATOM   5669  C  C     . ARG H 4  80   ? 183.620 165.670 191.323 1.00 107.06 ?  76   ARG H C     1 
ATOM   5670  O  O     . ARG H 4  80   ? 182.894 165.325 192.219 1.00 105.85 ?  76   ARG H O     1 
ATOM   5671  C  CB    . ARG H 4  80   ? 184.311 168.056 191.118 1.00 145.65 ?  76   ARG H CB    1 
ATOM   5672  C  CG    . ARG H 4  80   ? 185.308 169.155 191.351 1.00 177.98 ?  76   ARG H CG    1 
ATOM   5673  C  CD    . ARG H 4  80   ? 184.755 170.478 190.851 1.00 203.51 ?  76   ARG H CD    1 
ATOM   5674  N  NE    . ARG H 4  80   ? 185.722 171.625 190.822 1.00 223.71 ?  76   ARG H NE    1 
ATOM   5675  C  CZ    . ARG H 4  80   ? 185.574 172.757 190.115 1.00 219.83 ?  76   ARG H CZ    1 
ATOM   5676  N  NH1   . ARG H 4  80   ? 184.347 173.217 190.024 1.00 280.75 1  76   ARG H NH1   1 
ATOM   5677  N  NH2   . ARG H 4  80   ? 186.562 173.347 189.427 1.00 175.48 ?  76   ARG H NH2   1 
ATOM   5678  N  N     . LEU H 4  81   ? 183.384 165.355 190.058 1.00 109.63 ?  77   LEU H N     1 
ATOM   5679  C  CA    . LEU H 4  81   ? 182.277 164.506 189.608 1.00 141.18 ?  77   LEU H CA    1 
ATOM   5680  C  C     . LEU H 4  81   ? 182.486 163.116 190.206 1.00 99.66  ?  77   LEU H C     1 
ATOM   5681  O  O     . LEU H 4  81   ? 181.490 162.523 190.661 1.00 87.72  ?  77   LEU H O     1 
ATOM   5682  C  CB    . LEU H 4  81   ? 182.240 164.460 188.078 1.00 169.71 ?  77   LEU H CB    1 
ATOM   5683  C  CG    . LEU H 4  81   ? 181.473 165.615 187.383 1.00 172.00 ?  77   LEU H CG    1 
ATOM   5684  C  CD1   . LEU H 4  81   ? 182.084 166.991 187.658 1.00 146.64 ?  77   LEU H CD1   1 
ATOM   5685  C  CD2   . LEU H 4  81   ? 181.421 165.509 185.869 1.00 122.24 ?  77   LEU H CD2   1 
ATOM   5686  N  N     . ALA H 4  82   ? 183.722 162.631 190.227 1.00 84.11  ?  78   ALA H N     1 
ATOM   5687  C  CA    . ALA H 4  82   ? 183.967 161.288 190.708 1.00 110.70 ?  78   ALA H CA    1 
ATOM   5688  C  C     . ALA H 4  82   ? 183.419 161.215 192.125 1.00 132.20 ?  78   ALA H C     1 
ATOM   5689  O  O     . ALA H 4  82   ? 182.820 160.275 192.556 1.00 122.46 ?  78   ALA H O     1 
ATOM   5690  C  CB    . ALA H 4  82   ? 185.446 160.999 190.752 1.00 106.94 ?  78   ALA H CB    1 
ATOM   5691  N  N     . HIS H 4  83   ? 183.789 162.256 192.850 1.00 184.80 ?  79   HIS H N     1 
ATOM   5692  C  CA    . HIS H 4  83   ? 183.549 162.364 194.285 1.00 244.82 ?  79   HIS H CA    1 
ATOM   5693  C  C     . HIS H 4  83   ? 182.043 162.527 194.580 1.00 222.52 ?  79   HIS H C     1 
ATOM   5694  O  O     . HIS H 4  83   ? 181.521 162.001 195.556 1.00 232.13 ?  79   HIS H O     1 
ATOM   5695  C  CB    . HIS H 4  83   ? 184.307 163.587 194.872 1.00 307.92 ?  79   HIS H CB    1 
ATOM   5696  C  CG    . HIS H 4  83   ? 183.916 163.926 196.280 1.00 355.54 ?  79   HIS H CG    1 
ATOM   5697  N  ND1   . HIS H 4  83   ? 184.377 163.178 197.357 1.00 345.88 ?  79   HIS H ND1   1 
ATOM   5698  C  CD2   . HIS H 4  83   ? 183.133 164.910 196.799 1.00 395.44 ?  79   HIS H CD2   1 
ATOM   5699  C  CE1   . HIS H 4  83   ? 183.893 163.677 198.470 1.00 349.62 ?  79   HIS H CE1   1 
ATOM   5700  N  NE2   . HIS H 4  83   ? 183.134 164.741 198.155 1.00 387.51 ?  79   HIS H NE2   1 
ATOM   5701  N  N     . TYR H 4  84   ? 181.382 163.340 193.754 1.00 186.45 ?  80   TYR H N     1 
ATOM   5702  C  CA    . TYR H 4  84   ? 180.030 163.711 193.925 1.00 172.63 ?  80   TYR H CA    1 
ATOM   5703  C  C     . TYR H 4  84   ? 179.218 162.442 194.211 1.00 144.72 ?  80   TYR H C     1 
ATOM   5704  O  O     . TYR H 4  84   ? 178.579 162.342 195.298 1.00 134.94 ?  80   TYR H O     1 
ATOM   5705  C  CB    . TYR H 4  84   ? 179.537 164.526 192.750 1.00 174.71 ?  80   TYR H CB    1 
ATOM   5706  C  CG    . TYR H 4  84   ? 178.164 165.017 193.091 1.00 245.83 ?  80   TYR H CG    1 
ATOM   5707  C  CD1   . TYR H 4  84   ? 177.961 165.925 194.120 1.00 305.66 ?  80   TYR H CD1   1 
ATOM   5708  C  CD2   . TYR H 4  84   ? 177.044 164.437 192.526 1.00 386.52 ?  80   TYR H CD2   1 
ATOM   5709  C  CE1   . TYR H 4  84   ? 176.677 166.309 194.518 1.00 440.00 ?  80   TYR H CE1   1 
ATOM   5710  C  CE2   . TYR H 4  84   ? 175.750 164.854 192.854 1.00 440.00 ?  80   TYR H CE2   1 
ATOM   5711  C  CZ    . TYR H 4  84   ? 175.575 165.779 193.867 1.00 440.00 ?  80   TYR H CZ    1 
ATOM   5712  O  OH    . TYR H 4  84   ? 174.323 166.165 194.229 1.00 440.00 ?  80   TYR H OH    1 
ATOM   5713  N  N     . ASN H 4  85   ? 179.193 161.507 193.271 1.00 129.80 ?  81   ASN H N     1 
ATOM   5714  C  CA    . ASN H 4  85   ? 178.491 160.280 193.581 1.00 163.80 ?  81   ASN H CA    1 
ATOM   5715  C  C     . ASN H 4  85   ? 179.441 159.201 194.063 1.00 147.52 ?  81   ASN H C     1 
ATOM   5716  O  O     . ASN H 4  85   ? 179.268 157.977 193.715 1.00 150.49 ?  81   ASN H O     1 
ATOM   5717  C  CB    . ASN H 4  85   ? 177.602 159.627 192.499 1.00 229.00 ?  81   ASN H CB    1 
ATOM   5718  C  CG    . ASN H 4  85   ? 176.590 158.634 193.092 1.00 278.02 ?  81   ASN H CG    1 
ATOM   5719  O  OD1   . ASN H 4  85   ? 176.239 158.715 194.278 1.00 287.35 ?  81   ASN H OD1   1 
ATOM   5720  N  ND2   . ASN H 4  85   ? 176.039 157.740 192.269 1.00 375.04 ?  81   ASN H ND2   1 
ATOM   5721  N  N     . LYS H 4  86   ? 180.439 159.610 194.853 1.00 155.84 ?  82   LYS H N     1 
ATOM   5722  C  CA    . LYS H 4  86   ? 181.450 158.666 195.400 1.00 209.76 ?  82   LYS H CA    1 
ATOM   5723  C  C     . LYS H 4  86   ? 181.848 157.669 194.305 1.00 255.10 ?  82   LYS H C     1 
ATOM   5724  O  O     . LYS H 4  86   ? 181.322 156.539 194.313 1.00 265.37 ?  82   LYS H O     1 
ATOM   5725  C  CB    . LYS H 4  86   ? 180.892 157.939 196.628 1.00 233.53 ?  82   LYS H CB    1 
ATOM   5726  C  CG    . LYS H 4  86   ? 179.854 158.716 197.427 1.00 323.07 ?  82   LYS H CG    1 
ATOM   5727  C  CD    . LYS H 4  86   ? 178.937 157.828 198.242 1.00 377.68 ?  82   LYS H CD    1 
ATOM   5728  C  CE    . LYS H 4  86   ? 178.043 158.604 199.185 1.00 400.00 ?  82   LYS H CE    1 
ATOM   5729  N  NZ    . LYS H 4  86   ? 176.989 157.744 199.776 1.00 381.55 1  82   LYS H NZ    1 
ATOM   5730  N  N     . ARG H 4  87   ? 182.746 158.082 193.404 1.00 278.27 ?  83   ARG H N     1 
ATOM   5731  C  CA    . ARG H 4  87   ? 183.207 157.209 192.291 1.00 281.56 ?  83   ARG H CA    1 
ATOM   5732  C  C     . ARG H 4  87   ? 184.727 157.034 192.380 1.00 268.11 ?  83   ARG H C     1 
ATOM   5733  O  O     . ARG H 4  87   ? 185.454 157.940 191.926 1.00 263.64 ?  83   ARG H O     1 
ATOM   5734  C  CB    . ARG H 4  87   ? 182.804 157.808 190.941 1.00 306.28 ?  83   ARG H CB    1 
ATOM   5735  C  CG    . ARG H 4  87   ? 181.300 157.851 190.703 1.00 330.58 ?  83   ARG H CG    1 
ATOM   5736  C  CD    . ARG H 4  87   ? 180.950 158.384 189.327 1.00 324.61 ?  83   ARG H CD    1 
ATOM   5737  N  NE    . ARG H 4  87   ? 179.513 158.446 189.107 1.00 314.05 ?  83   ARG H NE    1 
ATOM   5738  C  CZ    . ARG H 4  87   ? 178.764 157.419 188.719 1.00 264.13 ?  83   ARG H CZ    1 
ATOM   5739  N  NH1   . ARG H 4  87   ? 179.312 156.226 188.555 1.00 208.68 1  83   ARG H NH1   1 
ATOM   5740  N  NH2   . ARG H 4  87   ? 177.474 157.585 188.498 1.00 257.12 ?  83   ARG H NH2   1 
ATOM   5741  N  N     . SER H 4  88   ? 185.180 155.909 192.943 1.00 204.32 ?  84   SER H N     1 
ATOM   5742  C  CA    . SER H 4  88   ? 186.633 155.624 193.082 1.00 159.62 ?  84   SER H CA    1 
ATOM   5743  C  C     . SER H 4  88   ? 187.224 155.288 191.708 1.00 121.41 ?  84   SER H C     1 
ATOM   5744  O  O     . SER H 4  88   ? 187.954 154.284 191.607 1.00 113.44 ?  84   SER H O     1 
ATOM   5745  C  CB    . SER H 4  88   ? 186.873 154.511 194.068 1.00 160.57 ?  84   SER H CB    1 
ATOM   5746  O  OG    . SER H 4  88   ? 186.259 154.801 195.315 1.00 195.01 ?  84   SER H OG    1 
ATOM   5747  N  N     . THR H 4  89   ? 186.914 156.108 190.698 1.00 107.49 ?  85   THR H N     1 
ATOM   5748  C  CA    . THR H 4  89   ? 187.406 155.897 189.356 1.00 110.51 ?  85   THR H CA    1 
ATOM   5749  C  C     . THR H 4  89   ? 187.071 157.130 188.520 1.00 93.95  ?  85   THR H C     1 
ATOM   5750  O  O     . THR H 4  89   ? 185.908 157.597 188.452 1.00 143.34 ?  85   THR H O     1 
ATOM   5751  C  CB    . THR H 4  89   ? 186.751 154.701 188.643 1.00 132.11 ?  85   THR H CB    1 
ATOM   5752  O  OG1   . THR H 4  89   ? 185.326 154.762 188.727 1.00 188.29 ?  85   THR H OG1   1 
ATOM   5753  C  CG2   . THR H 4  89   ? 187.168 153.366 189.199 1.00 162.22 ?  85   THR H CG2   1 
ATOM   5754  N  N     . ILE H 4  90   ? 188.027 157.588 187.732 1.00 90.71  ?  86   ILE H N     1 
ATOM   5755  C  CA    . ILE H 4  90   ? 187.757 158.462 186.610 1.00 121.15 ?  86   ILE H CA    1 
ATOM   5756  C  C     . ILE H 4  90   ? 187.723 157.566 185.395 1.00 195.88 ?  86   ILE H C     1 
ATOM   5757  O  O     . ILE H 4  90   ? 188.820 157.239 184.906 1.00 369.67 ?  86   ILE H O     1 
ATOM   5758  C  CB    . ILE H 4  90   ? 188.915 159.463 186.493 1.00 128.22 ?  86   ILE H CB    1 
ATOM   5759  C  CG1   . ILE H 4  90   ? 189.075 160.250 187.788 1.00 167.07 ?  86   ILE H CG1   1 
ATOM   5760  C  CG2   . ILE H 4  90   ? 188.835 160.356 185.302 1.00 108.50 ?  86   ILE H CG2   1 
ATOM   5761  C  CD1   . ILE H 4  90   ? 187.865 161.001 188.210 1.00 189.90 ?  86   ILE H CD1   1 
ATOM   5762  N  N     . THR H 4  91   ? 186.527 157.183 184.937 1.00 191.41 ?  87   THR H N     1 
ATOM   5763  C  CA    . THR H 4  91   ? 186.379 156.297 183.751 1.00 165.14 ?  87   THR H CA    1 
ATOM   5764  C  C     . THR H 4  91   ? 186.620 157.106 182.472 1.00 112.28 ?  87   THR H C     1 
ATOM   5765  O  O     . THR H 4  91   ? 187.198 158.206 182.570 1.00 75.66  ?  87   THR H O     1 
ATOM   5766  C  CB    . THR H 4  91   ? 185.003 155.617 183.737 1.00 150.69 ?  87   THR H CB    1 
ATOM   5767  O  OG1   . THR H 4  91   ? 184.963 154.721 182.627 1.00 142.67 ?  87   THR H OG1   1 
ATOM   5768  C  CG2   . THR H 4  91   ? 183.860 156.603 183.640 1.00 144.57 ?  87   THR H CG2   1 
ATOM   5769  N  N     . SER H 4  92   ? 186.192 156.570 181.323 1.00 96.72  ?  88   SER H N     1 
ATOM   5770  C  CA    . SER H 4  92   ? 186.370 157.257 180.015 1.00 97.89  ?  88   SER H CA    1 
ATOM   5771  C  C     . SER H 4  92   ? 185.131 158.102 179.698 1.00 121.50 ?  88   SER H C     1 
ATOM   5772  O  O     . SER H 4  92   ? 185.181 158.884 178.727 1.00 125.87 ?  88   SER H O     1 
ATOM   5773  C  CB    . SER H 4  92   ? 186.653 156.263 178.918 1.00 107.45 ?  88   SER H CB    1 
ATOM   5774  O  OG    . SER H 4  92   ? 185.448 155.846 178.292 1.00 159.95 ?  88   SER H OG    1 
ATOM   5775  N  N     . ARG H 4  93   ? 184.066 157.946 180.492 1.00 145.15 ?  89   ARG H N     1 
ATOM   5776  C  CA    . ARG H 4  93   ? 182.808 158.712 180.284 1.00 116.47 ?  89   ARG H CA    1 
ATOM   5777  C  C     . ARG H 4  93   ? 182.801 159.931 181.216 1.00 95.07  ?  89   ARG H C     1 
ATOM   5778  O  O     . ARG H 4  93   ? 182.274 160.984 180.808 1.00 75.18  ?  89   ARG H O     1 
ATOM   5779  C  CB    . ARG H 4  93   ? 181.590 157.820 180.539 1.00 105.09 ?  89   ARG H CB    1 
ATOM   5780  C  CG    . ARG H 4  93   ? 181.404 156.713 179.511 1.00 140.97 ?  89   ARG H CG    1 
ATOM   5781  C  CD    . ARG H 4  93   ? 180.291 155.753 179.892 1.00 180.45 ?  89   ARG H CD    1 
ATOM   5782  N  NE    . ARG H 4  93   ? 180.584 155.027 181.120 1.00 201.76 ?  89   ARG H NE    1 
ATOM   5783  C  CZ    . ARG H 4  93   ? 179.777 154.128 181.672 1.00 200.56 ?  89   ARG H CZ    1 
ATOM   5784  N  NH1   . ARG H 4  93   ? 178.549 154.469 182.023 1.00 167.01 1  89   ARG H NH1   1 
ATOM   5785  N  NH2   . ARG H 4  93   ? 180.200 152.893 181.870 1.00 184.33 ?  89   ARG H NH2   1 
ATOM   5786  N  N     . GLU H 4  94   ? 183.369 159.781 182.418 1.00 104.39 ?  90   GLU H N     1 
ATOM   5787  C  CA    . GLU H 4  94   ? 183.425 160.890 183.407 1.00 114.38 ?  90   GLU H CA    1 
ATOM   5788  C  C     . GLU H 4  94   ? 184.132 162.095 182.775 1.00 80.80  ?  90   GLU H C     1 
ATOM   5789  O  O     . GLU H 4  94   ? 183.734 163.237 183.075 1.00 65.64  ?  90   GLU H O     1 
ATOM   5790  C  CB    . GLU H 4  94   ? 184.149 160.435 184.677 1.00 156.72 ?  90   GLU H CB    1 
ATOM   5791  C  CG    . GLU H 4  94   ? 183.414 159.342 185.431 1.00 188.71 ?  90   GLU H CG    1 
ATOM   5792  C  CD    . GLU H 4  94   ? 182.003 159.704 185.861 1.00 223.33 ?  90   GLU H CD    1 
ATOM   5793  O  OE1   . GLU H 4  94   ? 181.794 160.856 186.287 1.00 217.31 ?  90   GLU H OE1   1 
ATOM   5794  O  OE2   . GLU H 4  94   ? 181.117 158.831 185.769 1.00 367.01 -1 90   GLU H OE2   1 
ATOM   5795  N  N     . ILE H 4  95   ? 185.138 161.838 181.934 1.00 81.85  ?  91   ILE H N     1 
ATOM   5796  C  CA    . ILE H 4  95   ? 185.885 162.902 181.271 1.00 98.83  ?  91   ILE H CA    1 
ATOM   5797  C  C     . ILE H 4  95   ? 185.036 163.501 180.178 1.00 68.75  ?  91   ILE H C     1 
ATOM   5798  O  O     . ILE H 4  95   ? 185.055 164.646 179.866 1.00 50.95  ?  91   ILE H O     1 
ATOM   5799  C  CB    . ILE H 4  95   ? 187.246 162.455 180.746 1.00 146.52 ?  91   ILE H CB    1 
ATOM   5800  C  CG1   . ILE H 4  95   ? 188.162 162.072 181.893 1.00 150.44 ?  91   ILE H CG1   1 
ATOM   5801  C  CG2   . ILE H 4  95   ? 187.846 163.587 179.953 1.00 157.80 ?  91   ILE H CG2   1 
ATOM   5802  C  CD1   . ILE H 4  95   ? 188.323 160.597 182.013 1.00 139.01 ?  91   ILE H CD1   1 
ATOM   5803  N  N     . GLN H 4  96   ? 184.315 162.643 179.511 1.00 105.34 ?  92   GLN H N     1 
ATOM   5804  C  CA    . GLN H 4  96   ? 183.549 162.995 178.328 1.00 173.40 ?  92   GLN H CA    1 
ATOM   5805  C  C     . GLN H 4  96   ? 182.528 164.048 178.646 1.00 123.83 ?  92   GLN H C     1 
ATOM   5806  O  O     . GLN H 4  96   ? 182.334 164.954 177.847 1.00 110.69 ?  92   GLN H O     1 
ATOM   5807  C  CB    . GLN H 4  96   ? 182.935 161.735 177.709 1.00 293.70 ?  92   GLN H CB    1 
ATOM   5808  C  CG    . GLN H 4  96   ? 182.260 161.939 176.377 1.00 346.12 ?  92   GLN H CG    1 
ATOM   5809  C  CD    . GLN H 4  96   ? 181.280 160.875 175.914 1.00 326.88 ?  92   GLN H CD    1 
ATOM   5810  O  OE1   . GLN H 4  96   ? 180.884 160.875 174.747 1.00 351.02 ?  92   GLN H OE1   1 
ATOM   5811  N  NE2   . GLN H 4  96   ? 180.799 159.998 176.789 1.00 239.71 ?  92   GLN H NE2   1 
ATOM   5812  N  N     . THR H 4  97   ? 181.668 163.826 179.647 1.00 108.12 ?  93   THR H N     1 
ATOM   5813  C  CA    . THR H 4  97   ? 180.699 164.873 180.008 1.00 94.38  ?  93   THR H CA    1 
ATOM   5814  C  C     . THR H 4  97   ? 181.378 166.167 180.440 1.00 67.33  ?  93   THR H C     1 
ATOM   5815  O  O     . THR H 4  97   ? 181.040 167.250 180.099 1.00 50.43  ?  93   THR H O     1 
ATOM   5816  C  CB    . THR H 4  97   ? 179.844 164.429 181.215 1.00 87.69  ?  93   THR H CB    1 
ATOM   5817  O  OG1   . THR H 4  97   ? 178.610 165.118 181.199 1.00 102.66 ?  93   THR H OG1   1 
ATOM   5818  C  CG2   . THR H 4  97   ? 180.457 164.641 182.569 1.00 66.86  ?  93   THR H CG2   1 
ATOM   5819  N  N     . ALA H 4  98   ? 182.424 165.935 181.225 1.00 72.93  ?  94   ALA H N     1 
ATOM   5820  C  CA    . ALA H 4  98   ? 183.176 167.007 181.782 1.00 105.04 ?  94   ALA H CA    1 
ATOM   5821  C  C     . ALA H 4  98   ? 183.556 167.998 180.697 1.00 75.80  ?  94   ALA H C     1 
ATOM   5822  O  O     . ALA H 4  98   ? 183.599 169.166 180.891 1.00 59.60  ?  94   ALA H O     1 
ATOM   5823  C  CB    . ALA H 4  98   ? 184.368 166.478 182.510 1.00 192.33 ?  94   ALA H CB    1 
ATOM   5824  N  N     . VAL H 4  99   ? 184.019 167.469 179.588 1.00 62.83  ?  95   VAL H N     1 
ATOM   5825  C  CA    . VAL H 4  99   ? 184.421 168.279 178.502 1.00 67.66  ?  95   VAL H CA    1 
ATOM   5826  C  C     . VAL H 4  99   ? 183.196 168.930 177.894 1.00 70.09  ?  95   VAL H C     1 
ATOM   5827  O  O     . VAL H 4  99   ? 183.162 170.088 177.434 1.00 57.74  ?  95   VAL H O     1 
ATOM   5828  C  CB    . VAL H 4  99   ? 185.099 167.475 177.399 1.00 67.01  ?  95   VAL H CB    1 
ATOM   5829  C  CG1   . VAL H 4  99   ? 185.324 168.454 176.216 1.00 68.92  ?  95   VAL H CG1   1 
ATOM   5830  C  CG2   . VAL H 4  99   ? 186.351 166.852 178.036 1.00 73.99  ?  95   VAL H CG2   1 
ATOM   5831  N  N     . ARG H 4  100  ? 182.164 168.119 177.801 1.00 103.55 ?  96   ARG H N     1 
ATOM   5832  C  CA    . ARG H 4  100  ? 180.941 168.563 177.112 1.00 180.25 ?  96   ARG H CA    1 
ATOM   5833  C  C     . ARG H 4  100  ? 180.471 169.892 177.709 1.00 199.47 ?  96   ARG H C     1 
ATOM   5834  O  O     . ARG H 4  100  ? 179.948 170.772 176.941 1.00 187.98 ?  96   ARG H O     1 
ATOM   5835  C  CB    . ARG H 4  100  ? 179.888 167.460 177.177 1.00 299.73 ?  96   ARG H CB    1 
ATOM   5836  C  CG    . ARG H 4  100  ? 178.648 167.775 176.353 1.00 408.89 ?  96   ARG H CG    1 
ATOM   5837  C  CD    . ARG H 4  100  ? 177.510 166.778 176.576 1.00 440.00 ?  96   ARG H CD    1 
ATOM   5838  N  NE    . ARG H 4  100  ? 177.620 165.566 175.742 1.00 432.94 ?  96   ARG H NE    1 
ATOM   5839  C  CZ    . ARG H 4  100  ? 178.100 164.368 176.112 1.00 346.30 ?  96   ARG H CZ    1 
ATOM   5840  N  NH1   . ARG H 4  100  ? 178.022 163.999 177.384 1.00 240.09 1  96   ARG H NH1   1 
ATOM   5841  N  NH2   . ARG H 4  100  ? 178.701 163.578 175.210 1.00 412.03 ?  96   ARG H NH2   1 
ATOM   5842  N  N     . LEU H 4  101  ? 180.503 169.963 179.040 1.00 191.65 ?  97   LEU H N     1 
ATOM   5843  C  CA    . LEU H 4  101  ? 180.078 171.114 179.787 1.00 188.46 ?  97   LEU H CA    1 
ATOM   5844  C  C     . LEU H 4  101  ? 181.106 172.245 179.674 1.00 168.02 ?  97   LEU H C     1 
ATOM   5845  O  O     . LEU H 4  101  ? 180.737 173.426 179.578 1.00 168.17 ?  97   LEU H O     1 
ATOM   5846  C  CB    . LEU H 4  101  ? 179.830 170.727 181.245 1.00 155.90 ?  97   LEU H CB    1 
ATOM   5847  C  CG    . LEU H 4  101  ? 181.030 170.497 182.166 1.00 141.87 ?  97   LEU H CG    1 
ATOM   5848  C  CD1   . LEU H 4  101  ? 181.742 171.798 182.553 1.00 207.40 ?  97   LEU H CD1   1 
ATOM   5849  C  CD2   . LEU H 4  101  ? 180.679 169.706 183.433 1.00 114.71 ?  97   LEU H CD2   1 
ATOM   5850  N  N     . LEU H 4  102  ? 182.358 171.873 179.816 1.00 147.93 ?  98   LEU H N     1 
ATOM   5851  C  CA    . LEU H 4  102  ? 183.421 172.825 179.893 1.00 160.73 ?  98   LEU H CA    1 
ATOM   5852  C  C     . LEU H 4  102  ? 183.519 173.504 178.540 1.00 136.07 ?  98   LEU H C     1 
ATOM   5853  O  O     . LEU H 4  102  ? 183.922 174.724 178.512 1.00 158.84 ?  98   LEU H O     1 
ATOM   5854  C  CB    . LEU H 4  102  ? 184.732 172.152 180.257 1.00 140.27 ?  98   LEU H CB    1 
ATOM   5855  C  CG    . LEU H 4  102  ? 185.976 173.025 180.090 1.00 205.89 ?  98   LEU H CG    1 
ATOM   5856  C  CD1   . LEU H 4  102  ? 185.960 174.241 181.004 1.00 266.27 ?  98   LEU H CD1   1 
ATOM   5857  C  CD2   . LEU H 4  102  ? 187.272 172.240 180.336 1.00 237.97 ?  98   LEU H CD2   1 
ATOM   5858  N  N     . LEU H 4  103  ? 183.164 172.795 177.469 1.00 105.77 ?  99   LEU H N     1 
ATOM   5859  C  CA    . LEU H 4  103  ? 183.447 173.450 176.285 1.00 117.97 ?  99   LEU H CA    1 
ATOM   5860  C  C     . LEU H 4  103  ? 182.203 174.006 175.568 1.00 119.73 ?  99   LEU H C     1 
ATOM   5861  O  O     . LEU H 4  103  ? 181.245 173.259 175.284 1.00 97.31  ?  99   LEU H O     1 
ATOM   5862  C  CB    . LEU H 4  103  ? 184.262 172.475 175.443 1.00 115.27 ?  99   LEU H CB    1 
ATOM   5863  C  CG    . LEU H 4  103  ? 185.729 172.401 175.758 1.00 116.23 ?  99   LEU H CG    1 
ATOM   5864  C  CD1   . LEU H 4  103  ? 185.962 171.738 177.070 1.00 99.07  ?  99   LEU H CD1   1 
ATOM   5865  C  CD2   . LEU H 4  103  ? 186.414 171.646 174.674 1.00 133.20 ?  99   LEU H CD2   1 
ATOM   5866  N  N     . PRO H 4  104  ? 182.368 175.243 175.011 1.00 151.99 ?  100  PRO H N     1 
ATOM   5867  C  CA    . PRO H 4  104  ? 181.501 175.848 173.992 1.00 190.87 ?  100  PRO H CA    1 
ATOM   5868  C  C     . PRO H 4  104  ? 181.297 174.859 172.836 1.00 314.41 ?  100  PRO H C     1 
ATOM   5869  O  O     . PRO H 4  104  ? 182.179 174.091 172.429 1.00 440.00 ?  100  PRO H O     1 
ATOM   5870  C  CB    . PRO H 4  104  ? 182.308 177.074 173.517 1.00 154.54 ?  100  PRO H CB    1 
ATOM   5871  C  CG    . PRO H 4  104  ? 183.319 177.298 174.610 1.00 133.99 ?  100  PRO H CG    1 
ATOM   5872  C  CD    . PRO H 4  104  ? 183.626 175.989 175.184 1.00 140.59 ?  100  PRO H CD    1 
ATOM   5873  N  N     . GLY H 4  105  ? 180.092 174.870 172.286 1.00 307.24 ?  101  GLY H N     1 
ATOM   5874  C  CA    . GLY H 4  105  ? 179.510 173.786 171.393 1.00 248.89 ?  101  GLY H CA    1 
ATOM   5875  C  C     . GLY H 4  105  ? 180.378 173.224 170.263 1.00 170.55 ?  101  GLY H C     1 
ATOM   5876  O  O     . GLY H 4  105  ? 180.812 172.114 170.295 1.00 127.62 ?  101  GLY H O     1 
ATOM   5877  N  N     . GLU H 4  106  ? 180.670 174.001 169.222 1.00 149.06 ?  102  GLU H N     1 
ATOM   5878  C  CA    . GLU H 4  106  ? 181.240 173.516 167.987 1.00 167.37 ?  102  GLU H CA    1 
ATOM   5879  C  C     . GLU H 4  106  ? 182.543 172.721 168.238 1.00 149.20 ?  102  GLU H C     1 
ATOM   5880  O  O     . GLU H 4  106  ? 182.756 171.591 167.696 1.00 191.98 ?  102  GLU H O     1 
ATOM   5881  C  CB    . GLU H 4  106  ? 181.414 174.723 167.056 1.00 215.43 ?  102  GLU H CB    1 
ATOM   5882  C  CG    . GLU H 4  106  ? 180.024 175.328 166.696 1.00 240.55 ?  102  GLU H CG    1 
ATOM   5883  C  CD    . GLU H 4  106  ? 179.713 175.793 165.266 1.00 249.74 ?  102  GLU H CD    1 
ATOM   5884  O  OE1   . GLU H 4  106  ? 180.300 176.807 164.866 1.00 231.07 ?  102  GLU H OE1   1 
ATOM   5885  O  OE2   . GLU H 4  106  ? 178.875 175.112 164.537 1.00 188.24 -1 102  GLU H OE2   1 
ATOM   5886  N  N     . LEU H 4  107  ? 183.330 173.241 169.180 1.00 124.70 ?  103  LEU H N     1 
ATOM   5887  C  CA    . LEU H 4  107  ? 184.582 172.636 169.517 1.00 116.63 ?  103  LEU H CA    1 
ATOM   5888  C  C     . LEU H 4  107  ? 184.351 171.344 170.309 1.00 100.27 ?  103  LEU H C     1 
ATOM   5889  O  O     . LEU H 4  107  ? 185.145 170.379 170.115 1.00 78.27  ?  103  LEU H O     1 
ATOM   5890  C  CB    . LEU H 4  107  ? 185.407 173.648 170.334 1.00 139.72 ?  103  LEU H CB    1 
ATOM   5891  C  CG    . LEU H 4  107  ? 186.780 173.271 170.905 1.00 154.87 ?  103  LEU H CG    1 
ATOM   5892  C  CD1   . LEU H 4  107  ? 187.644 172.987 169.698 1.00 128.68 ?  103  LEU H CD1   1 
ATOM   5893  C  CD2   . LEU H 4  107  ? 187.404 174.313 171.849 1.00 168.38 ?  103  LEU H CD2   1 
ATOM   5894  N  N     . ALA H 4  108  ? 183.378 171.348 171.207 1.00 130.71 ?  104  ALA H N     1 
ATOM   5895  C  CA    . ALA H 4  108  ? 183.163 170.313 172.189 1.00 146.20 ?  104  ALA H CA    1 
ATOM   5896  C  C     . ALA H 4  108  ? 182.769 168.985 171.510 1.00 124.12 ?  104  ALA H C     1 
ATOM   5897  O  O     . ALA H 4  108  ? 183.086 167.908 171.922 1.00 96.47  ?  104  ALA H O     1 
ATOM   5898  C  CB    . ALA H 4  108  ? 182.126 170.804 173.242 1.00 181.32 ?  104  ALA H CB    1 
ATOM   5899  N  N     . LYS H 4  109  ? 181.872 169.090 170.534 1.00 134.34 ?  105  LYS H N     1 
ATOM   5900  C  CA    . LYS H 4  109  ? 181.253 167.968 169.902 1.00 154.83 ?  105  LYS H CA    1 
ATOM   5901  C  C     . LYS H 4  109  ? 182.280 167.221 169.041 1.00 154.02 ?  105  LYS H C     1 
ATOM   5902  O  O     . LYS H 4  109  ? 182.262 166.046 169.031 1.00 132.30 ?  105  LYS H O     1 
ATOM   5903  C  CB    . LYS H 4  109  ? 179.947 168.505 169.276 1.00 181.55 ?  105  LYS H CB    1 
ATOM   5904  C  CG    . LYS H 4  109  ? 178.918 168.951 170.326 1.00 175.90 ?  105  LYS H CG    1 
ATOM   5905  C  CD    . LYS H 4  109  ? 177.600 169.522 169.710 1.00 191.60 ?  105  LYS H CD    1 
ATOM   5906  C  CE    . LYS H 4  109  ? 176.618 169.919 170.819 1.00 270.43 ?  105  LYS H CE    1 
ATOM   5907  N  NZ    . LYS H 4  109  ? 175.288 170.515 170.453 1.00 261.50 1  105  LYS H NZ    1 
ATOM   5908  N  N     . HIS H 4  110  ? 183.112 167.917 168.276 1.00 153.47 ?  106  HIS H N     1 
ATOM   5909  C  CA    . HIS H 4  110  ? 184.152 167.248 167.512 1.00 127.05 ?  106  HIS H CA    1 
ATOM   5910  C  C     . HIS H 4  110  ? 185.059 166.418 168.442 1.00 110.38 ?  106  HIS H C     1 
ATOM   5911  O  O     . HIS H 4  110  ? 185.464 165.321 168.222 1.00 122.92 ?  106  HIS H O     1 
ATOM   5912  C  CB    . HIS H 4  110  ? 185.050 168.253 166.798 1.00 138.86 ?  106  HIS H CB    1 
ATOM   5913  C  CG    . HIS H 4  110  ? 184.332 169.250 165.960 1.00 167.90 ?  106  HIS H CG    1 
ATOM   5914  N  ND1   . HIS H 4  110  ? 184.790 170.547 165.792 1.00 177.02 ?  106  HIS H ND1   1 
ATOM   5915  C  CD2   . HIS H 4  110  ? 183.178 169.159 165.273 1.00 182.21 ?  106  HIS H CD2   1 
ATOM   5916  C  CE1   . HIS H 4  110  ? 183.984 171.205 164.981 1.00 177.82 ?  106  HIS H CE1   1 
ATOM   5917  N  NE2   . HIS H 4  110  ? 182.979 170.370 164.639 1.00 183.54 ?  106  HIS H NE2   1 
ATOM   5918  N  N     . ALA H 4  111  ? 185.442 167.062 169.515 1.00 105.53 ?  107  ALA H N     1 
ATOM   5919  C  CA    . ALA H 4  111  ? 186.318 166.440 170.467 1.00 125.39 ?  107  ALA H CA    1 
ATOM   5920  C  C     . ALA H 4  111  ? 185.666 165.182 171.088 1.00 133.41 ?  107  ALA H C     1 
ATOM   5921  O  O     . ALA H 4  111  ? 186.344 164.164 171.246 1.00 153.93 ?  107  ALA H O     1 
ATOM   5922  C  CB    . ALA H 4  111  ? 186.647 167.467 171.493 1.00 159.84 ?  107  ALA H CB    1 
ATOM   5923  N  N     . VAL H 4  112  ? 184.344 165.223 171.335 1.00 114.33 ?  108  VAL H N     1 
ATOM   5924  C  CA    . VAL H 4  112  ? 183.648 164.075 171.828 1.00 116.51 ?  108  VAL H CA    1 
ATOM   5925  C  C     . VAL H 4  112  ? 183.844 162.871 170.880 1.00 126.08 ?  108  VAL H C     1 
ATOM   5926  O  O     . VAL H 4  112  ? 184.082 161.737 171.240 1.00 87.76  ?  108  VAL H O     1 
ATOM   5927  C  CB    . VAL H 4  112  ? 182.137 164.286 172.012 1.00 130.01 ?  108  VAL H CB    1 
ATOM   5928  C  CG1   . VAL H 4  112  ? 181.478 162.941 172.375 1.00 126.87 ?  108  VAL H CG1   1 
ATOM   5929  C  CG2   . VAL H 4  112  ? 181.831 165.303 173.090 1.00 151.73 ?  108  VAL H CG2   1 
ATOM   5930  N  N     . SER H 4  113  ? 183.713 163.191 169.585 1.00 163.73 ?  109  SER H N     1 
ATOM   5931  C  CA    . SER H 4  113  ? 183.840 162.196 168.505 1.00 171.84 ?  109  SER H CA    1 
ATOM   5932  C  C     . SER H 4  113  ? 185.256 161.581 168.429 1.00 133.90 ?  109  SER H C     1 
ATOM   5933  O  O     . SER H 4  113  ? 185.293 160.378 168.185 1.00 119.57 ?  109  SER H O     1 
ATOM   5934  C  CB    . SER H 4  113  ? 183.391 162.735 167.162 1.00 200.05 ?  109  SER H CB    1 
ATOM   5935  O  OG    . SER H 4  113  ? 183.916 162.018 166.050 1.00 218.50 ?  109  SER H OG    1 
ATOM   5936  N  N     . GLU H 4  114  ? 186.295 162.409 168.375 1.00 113.80 ?  110  GLU H N     1 
ATOM   5937  C  CA    . GLU H 4  114  ? 187.627 161.920 168.293 1.00 99.01  ?  110  GLU H CA    1 
ATOM   5938  C  C     . GLU H 4  114  ? 187.898 160.903 169.417 1.00 74.57  ?  110  GLU H C     1 
ATOM   5939  O  O     . GLU H 4  114  ? 188.648 159.930 169.285 1.00 59.48  ?  110  GLU H O     1 
ATOM   5940  C  CB    . GLU H 4  114  ? 188.662 163.056 168.431 1.00 93.71  ?  110  GLU H CB    1 
ATOM   5941  C  CG    . GLU H 4  114  ? 188.440 164.292 167.582 1.00 85.92  ?  110  GLU H CG    1 
ATOM   5942  C  CD    . GLU H 4  114  ? 189.708 164.543 166.763 1.00 88.65  ?  110  GLU H CD    1 
ATOM   5943  O  OE1   . GLU H 4  114  ? 190.159 163.569 166.222 1.00 129.85 ?  110  GLU H OE1   1 
ATOM   5944  O  OE2   . GLU H 4  114  ? 190.333 165.642 166.633 1.00 116.01 -1 110  GLU H OE2   1 
ATOM   5945  N  N     . GLY H 4  115  ? 187.329 161.237 170.569 1.00 84.26  ?  111  GLY H N     1 
ATOM   5946  C  CA    . GLY H 4  115  ? 187.465 160.506 171.775 1.00 133.25 ?  111  GLY H CA    1 
ATOM   5947  C  C     . GLY H 4  115  ? 187.008 159.065 171.712 1.00 146.22 ?  111  GLY H C     1 
ATOM   5948  O  O     . GLY H 4  115  ? 187.657 158.142 172.142 1.00 175.74 ?  111  GLY H O     1 
ATOM   5949  N  N     . THR H 4  116  ? 185.736 158.855 171.361 1.00 133.83 ?  112  THR H N     1 
ATOM   5950  C  CA    . THR H 4  116  ? 185.207 157.493 171.254 1.00 142.46 ?  112  THR H CA    1 
ATOM   5951  C  C     . THR H 4  116  ? 185.991 156.686 170.189 1.00 137.43 ?  112  THR H C     1 
ATOM   5952  O  O     . THR H 4  116  ? 186.221 155.490 170.329 1.00 125.27 ?  112  THR H O     1 
ATOM   5953  C  CB    . THR H 4  116  ? 183.701 157.511 170.959 1.00 159.74 ?  112  THR H CB    1 
ATOM   5954  O  OG1   . THR H 4  116  ? 183.278 156.145 170.987 1.00 153.09 ?  112  THR H OG1   1 
ATOM   5955  C  CG2   . THR H 4  116  ? 183.491 158.199 169.624 1.00 183.84 ?  112  THR H CG2   1 
ATOM   5956  N  N     . LYS H 4  117  ? 186.347 157.296 169.069 1.00 144.13 ?  113  LYS H N     1 
ATOM   5957  C  CA    . LYS H 4  117  ? 186.989 156.605 167.958 1.00 125.76 ?  113  LYS H CA    1 
ATOM   5958  C  C     . LYS H 4  117  ? 188.299 156.073 168.481 1.00 94.18  ?  113  LYS H C     1 
ATOM   5959  O  O     . LYS H 4  117  ? 188.677 154.989 168.100 1.00 91.14  ?  113  LYS H O     1 
ATOM   5960  C  CB    . LYS H 4  117  ? 187.318 157.527 166.765 1.00 126.74 ?  113  LYS H CB    1 
ATOM   5961  C  CG    . LYS H 4  117  ? 186.131 158.207 166.102 1.00 130.97 ?  113  LYS H CG    1 
ATOM   5962  C  CD    . LYS H 4  117  ? 185.122 157.342 165.434 1.00 127.55 ?  113  LYS H CD    1 
ATOM   5963  C  CE    . LYS H 4  117  ? 184.005 158.099 164.735 1.00 152.50 ?  113  LYS H CE    1 
ATOM   5964  N  NZ    . LYS H 4  117  ? 183.008 157.195 164.103 1.00 112.19 1  113  LYS H NZ    1 
ATOM   5965  N  N     . ALA H 4  118  ? 188.957 156.897 169.296 1.00 68.25  ?  114  ALA H N     1 
ATOM   5966  C  CA    . ALA H 4  118  ? 190.179 156.468 169.782 1.00 68.22  ?  114  ALA H CA    1 
ATOM   5967  C  C     . ALA H 4  118  ? 190.003 155.210 170.618 1.00 85.74  ?  114  ALA H C     1 
ATOM   5968  O  O     . ALA H 4  118  ? 190.871 154.309 170.544 1.00 119.38 ?  114  ALA H O     1 
ATOM   5969  C  CB    . ALA H 4  118  ? 190.789 157.574 170.552 1.00 58.06  ?  114  ALA H CB    1 
ATOM   5970  N  N     . VAL H 4  119  ? 188.997 155.182 171.502 1.00 104.81 ?  115  VAL H N     1 
ATOM   5971  C  CA    . VAL H 4  119  ? 188.778 153.981 172.310 1.00 144.91 ?  115  VAL H CA    1 
ATOM   5972  C  C     . VAL H 4  119  ? 188.511 152.872 171.308 1.00 141.67 ?  115  VAL H C     1 
ATOM   5973  O  O     . VAL H 4  119  ? 188.881 151.749 171.410 1.00 96.07  ?  115  VAL H O     1 
ATOM   5974  C  CB    . VAL H 4  119  ? 187.548 154.004 173.235 1.00 196.74 ?  115  VAL H CB    1 
ATOM   5975  C  CG1   . VAL H 4  119  ? 187.409 152.684 173.985 1.00 182.58 ?  115  VAL H CG1   1 
ATOM   5976  C  CG2   . VAL H 4  119  ? 187.468 155.148 174.240 1.00 223.13 ?  115  VAL H CG2   1 
ATOM   5977  N  N     . THR H 4  120  ? 187.739 153.242 170.285 1.00 169.47 ?  116  THR H N     1 
ATOM   5978  C  CA    . THR H 4  120  ? 187.395 152.255 169.296 1.00 188.32 ?  116  THR H CA    1 
ATOM   5979  C  C     . THR H 4  120  ? 188.692 151.663 168.755 1.00 159.88 ?  116  THR H C     1 
ATOM   5980  O  O     . THR H 4  120  ? 188.839 150.375 168.680 1.00 116.16 ?  116  THR H O     1 
ATOM   5981  C  CB    . THR H 4  120  ? 186.516 152.797 168.168 1.00 254.79 ?  116  THR H CB    1 
ATOM   5982  O  OG1   . THR H 4  120  ? 185.587 153.765 168.666 1.00 283.17 ?  116  THR H OG1   1 
ATOM   5983  C  CG2   . THR H 4  120  ? 185.743 151.614 167.661 1.00 301.17 ?  116  THR H CG2   1 
ATOM   5984  N  N     . LYS H 4  121  ? 189.621 152.584 168.476 1.00 156.43 ?  117  LYS H N     1 
ATOM   5985  C  CA    . LYS H 4  121  ? 190.898 152.285 167.814 1.00 142.30 ?  117  LYS H CA    1 
ATOM   5986  C  C     . LYS H 4  121  ? 191.719 151.321 168.659 1.00 114.13 ?  117  LYS H C     1 
ATOM   5987  O  O     . LYS H 4  121  ? 192.433 150.454 168.175 1.00 129.71 ?  117  LYS H O     1 
ATOM   5988  C  CB    . LYS H 4  121  ? 191.722 153.549 167.596 1.00 126.53 ?  117  LYS H CB    1 
ATOM   5989  C  CG    . LYS H 4  121  ? 190.963 154.549 166.732 1.00 158.29 ?  117  LYS H CG    1 
ATOM   5990  C  CD    . LYS H 4  121  ? 191.458 155.948 166.638 1.00 166.34 ?  117  LYS H CD    1 
ATOM   5991  C  CE    . LYS H 4  121  ? 191.088 156.553 165.293 1.00 185.91 ?  117  LYS H CE    1 
ATOM   5992  N  NZ    . LYS H 4  121  ? 191.744 157.849 165.015 1.00 202.17 1  117  LYS H NZ    1 
ATOM   5993  N  N     . TYR H 4  122  ? 191.798 151.677 169.936 1.00 114.58 ?  118  TYR H N     1 
ATOM   5994  C  CA    . TYR H 4  122  ? 192.792 151.093 170.854 1.00 158.08 ?  118  TYR H CA    1 
ATOM   5995  C  C     . TYR H 4  122  ? 192.399 149.737 171.475 1.00 207.02 ?  118  TYR H C     1 
ATOM   5996  O  O     . TYR H 4  122  ? 193.315 148.854 171.530 1.00 334.89 ?  118  TYR H O     1 
ATOM   5997  C  CB    . TYR H 4  122  ? 193.172 152.130 171.929 1.00 165.44 ?  118  TYR H CB    1 
ATOM   5998  C  CG    . TYR H 4  122  ? 193.982 151.539 173.048 1.00 180.93 ?  118  TYR H CG    1 
ATOM   5999  C  CD1   . TYR H 4  122  ? 195.344 151.499 172.916 1.00 170.13 ?  118  TYR H CD1   1 
ATOM   6000  C  CD2   . TYR H 4  122  ? 193.410 150.914 174.156 1.00 256.95 ?  118  TYR H CD2   1 
ATOM   6001  C  CE1   . TYR H 4  122  ? 196.167 151.041 173.949 1.00 226.78 ?  118  TYR H CE1   1 
ATOM   6002  C  CE2   . TYR H 4  122  ? 194.210 150.371 175.154 1.00 229.75 ?  118  TYR H CE2   1 
ATOM   6003  C  CZ    . TYR H 4  122  ? 195.589 150.445 175.055 1.00 238.13 ?  118  TYR H CZ    1 
ATOM   6004  O  OH    . TYR H 4  122  ? 196.371 149.892 176.031 1.00 304.96 ?  118  TYR H OH    1 
ATOM   6005  N  N     . THR H 4  123  ? 191.190 149.556 172.002 1.00 189.34 ?  119  THR H N     1 
ATOM   6006  C  CA    . THR H 4  123  ? 190.828 148.319 172.706 1.00 223.57 ?  119  THR H CA    1 
ATOM   6007  C  C     . THR H 4  123  ? 190.999 147.026 171.891 1.00 244.75 ?  119  THR H C     1 
ATOM   6008  O  O     . THR H 4  123  ? 191.496 145.998 172.463 1.00 319.32 ?  119  THR H O     1 
ATOM   6009  C  CB    . THR H 4  123  ? 189.362 148.331 173.176 1.00 203.78 ?  119  THR H CB    1 
ATOM   6010  O  OG1   . THR H 4  123  ? 189.434 149.176 174.313 1.00 214.34 ?  119  THR H OG1   1 
ATOM   6011  C  CG2   . THR H 4  123  ? 188.760 147.006 173.579 1.00 233.46 ?  119  THR H CG2   1 
ATOM   6012  N  N     . SER H 4  124  ? 190.504 146.965 170.631 1.00 224.52 ?  120  SER H N     1 
ATOM   6013  C  CA    . SER H 4  124  ? 190.648 145.692 169.926 1.00 308.19 ?  120  SER H CA    1 
ATOM   6014  C  C     . SER H 4  124  ? 192.130 145.386 169.709 1.00 401.82 ?  120  SER H C     1 
ATOM   6015  O  O     . SER H 4  124  ? 192.596 144.209 169.877 1.00 407.79 ?  120  SER H O     1 
ATOM   6016  C  CB    . SER H 4  124  ? 189.895 145.629 168.633 1.00 345.36 ?  120  SER H CB    1 
ATOM   6017  O  OG    . SER H 4  124  ? 190.212 144.417 167.990 1.00 390.49 ?  120  SER H OG    1 
ATOM   6018  N  N     . ALA H 4  125  ? 192.853 146.447 169.338 1.00 440.00 ?  121  ALA H N     1 
ATOM   6019  C  CA    . ALA H 4  125  ? 194.310 146.390 169.086 1.00 440.00 ?  121  ALA H CA    1 
ATOM   6020  C  C     . ALA H 4  125  ? 195.111 146.032 170.357 1.00 440.00 ?  121  ALA H C     1 
ATOM   6021  O  O     . ALA H 4  125  ? 194.548 145.598 171.388 1.00 440.00 ?  121  ALA H O     1 
ATOM   6022  C  CB    . ALA H 4  125  ? 194.798 147.692 168.470 1.00 440.00 ?  121  ALA H CB    1 
ATOM   6023  P  P     . DA  I 6  1    ? 65.712  235.420 227.450 1.00 440.00 ?  -86  DA  I P     1 
ATOM   6024  O  OP1   . DA  I 6  1    ? 64.942  236.034 226.339 1.00 440.00 ?  -86  DA  I OP1   1 
ATOM   6025  O  OP2   . DA  I 6  1    ? 66.802  234.458 227.146 1.00 440.00 -1 -86  DA  I OP2   1 
ATOM   6026  O  "O5'" . DA  I 6  1    ? 66.315  236.594 228.342 1.00 440.00 ?  -86  DA  I "O5'" 1 
ATOM   6027  C  "C5'" . DA  I 6  1    ? 65.455  237.562 228.970 1.00 440.00 ?  -86  DA  I "C5'" 1 
ATOM   6028  C  "C4'" . DA  I 6  1    ? 66.133  238.155 230.183 1.00 440.00 ?  -86  DA  I "C4'" 1 
ATOM   6029  O  "O4'" . DA  I 6  1    ? 65.896  237.306 231.331 1.00 440.00 ?  -86  DA  I "O4'" 1 
ATOM   6030  C  "C3'" . DA  I 6  1    ? 67.652  238.283 230.066 1.00 440.00 ?  -86  DA  I "C3'" 1 
ATOM   6031  O  "O3'" . DA  I 6  1    ? 68.104  239.451 230.758 1.00 440.00 ?  -86  DA  I "O3'" 1 
ATOM   6032  C  "C2'" . DA  I 6  1    ? 68.158  237.030 230.756 1.00 440.00 ?  -86  DA  I "C2'" 1 
ATOM   6033  C  "C1'" . DA  I 6  1    ? 67.128  236.830 231.854 1.00 440.00 ?  -86  DA  I "C1'" 1 
ATOM   6034  N  N9    . DA  I 6  1    ? 66.938  235.436 232.252 1.00 20.00  ?  -86  DA  I N9    1 
ATOM   6035  C  C8    . DA  I 6  1    ? 66.551  234.382 231.462 1.00 20.00  ?  -86  DA  I C8    1 
ATOM   6036  N  N7    . DA  I 6  1    ? 66.466  233.242 232.106 1.00 20.00  ?  -86  DA  I N7    1 
ATOM   6037  C  C5    . DA  I 6  1    ? 66.820  233.569 233.407 1.00 20.00  ?  -86  DA  I C5    1 
ATOM   6038  C  C6    . DA  I 6  1    ? 66.927  232.800 234.579 1.00 20.00  ?  -86  DA  I C6    1 
ATOM   6039  N  N6    . DA  I 6  1    ? 66.676  231.490 234.632 1.00 20.00  ?  -86  DA  I N6    1 
ATOM   6040  N  N1    . DA  I 6  1    ? 67.304  233.432 235.712 1.00 20.00  ?  -86  DA  I N1    1 
ATOM   6041  C  C2    . DA  I 6  1    ? 67.555  234.746 235.659 1.00 20.00  ?  -86  DA  I C2    1 
ATOM   6042  N  N3    . DA  I 6  1    ? 67.491  235.575 234.620 1.00 20.00  ?  -86  DA  I N3    1 
ATOM   6043  C  C4    . DA  I 6  1    ? 67.113  234.917 233.511 1.00 20.00  ?  -86  DA  I C4    1 
ATOM   6044  P  P     . DT  I 6  2    ? 69.554  240.053 230.450 1.00 440.00 ?  -85  DT  I P     1 
ATOM   6045  O  OP1   . DT  I 6  2    ? 69.430  241.530 230.371 1.00 440.00 ?  -85  DT  I OP1   1 
ATOM   6046  O  OP2   . DT  I 6  2    ? 70.131  239.301 229.307 1.00 440.00 -1 -85  DT  I OP2   1 
ATOM   6047  O  "O5'" . DT  I 6  2    ? 70.380  239.689 231.763 1.00 440.00 ?  -85  DT  I "O5'" 1 
ATOM   6048  C  "C5'" . DT  I 6  2    ? 70.707  240.701 232.735 1.00 440.00 ?  -85  DT  I "C5'" 1 
ATOM   6049  C  "C4'" . DT  I 6  2    ? 71.580  240.118 233.821 1.00 440.00 ?  -85  DT  I "C4'" 1 
ATOM   6050  O  "O4'" . DT  I 6  2    ? 71.139  238.773 234.123 1.00 440.00 ?  -85  DT  I "O4'" 1 
ATOM   6051  C  "C3'" . DT  I 6  2    ? 73.060  240.000 233.456 1.00 440.00 ?  -85  DT  I "C3'" 1 
ATOM   6052  O  "O3'" . DT  I 6  2    ? 73.873  240.216 234.613 1.00 440.00 ?  -85  DT  I "O3'" 1 
ATOM   6053  C  "C2'" . DT  I 6  2    ? 73.183  238.565 232.980 1.00 440.00 ?  -85  DT  I "C2'" 1 
ATOM   6054  C  "C1'" . DT  I 6  2    ? 72.182  237.843 233.867 1.00 440.00 ?  -85  DT  I "C1'" 1 
ATOM   6055  N  N1    . DT  I 6  2    ? 71.579  236.649 233.252 1.00 20.00  ?  -85  DT  I N1    1 
ATOM   6056  C  C2    . DT  I 6  2    ? 70.971  235.729 234.075 1.00 20.00  ?  -85  DT  I C2    1 
ATOM   6057  O  O2    . DT  I 6  2    ? 70.908  235.857 235.286 1.00 20.00  ?  -85  DT  I O2    1 
ATOM   6058  N  N3    . DT  I 6  2    ? 70.434  234.646 233.423 1.00 20.00  ?  -85  DT  I N3    1 
ATOM   6059  C  C4    . DT  I 6  2    ? 70.446  234.399 232.063 1.00 20.00  ?  -85  DT  I C4    1 
ATOM   6060  O  O4    . DT  I 6  2    ? 69.922  233.379 231.621 1.00 20.00  ?  -85  DT  I O4    1 
ATOM   6061  C  C5    . DT  I 6  2    ? 71.101  235.406 231.260 1.00 20.00  ?  -85  DT  I C5    1 
ATOM   6062  C  C7    . DT  I 6  2    ? 71.164  235.225 229.776 1.00 20.00  ?  -85  DT  I C7    1 
ATOM   6063  C  C6    . DT  I 6  2    ? 71.628  236.466 231.886 1.00 20.00  ?  -85  DT  I C6    1 
ATOM   6064  P  P     . DA  I 6  3    ? 75.358  240.791 234.452 1.00 440.00 ?  -84  DA  I P     1 
ATOM   6065  O  OP1   . DA  I 6  3    ? 75.298  242.267 234.602 1.00 440.00 ?  -84  DA  I OP1   1 
ATOM   6066  O  OP2   . DA  I 6  3    ? 75.948  240.200 233.225 1.00 440.00 -1 -84  DA  I OP2   1 
ATOM   6067  O  "O5'" . DA  I 6  3    ? 76.115  240.190 235.718 1.00 440.00 ?  -84  DA  I "O5'" 1 
ATOM   6068  C  "C5'" . DA  I 6  3    ? 75.554  240.302 237.038 1.00 440.00 ?  -84  DA  I "C5'" 1 
ATOM   6069  C  "C4'" . DA  I 6  3    ? 75.925  239.095 237.868 1.00 440.00 ?  -84  DA  I "C4'" 1 
ATOM   6070  O  "O4'" . DA  I 6  3    ? 75.282  237.920 237.319 1.00 440.00 ?  -84  DA  I "O4'" 1 
ATOM   6071  C  "C3'" . DA  I 6  3    ? 77.418  238.776 237.897 1.00 440.00 ?  -84  DA  I "C3'" 1 
ATOM   6072  O  "O3'" . DA  I 6  3    ? 77.782  238.220 239.164 1.00 440.00 ?  -84  DA  I "O3'" 1 
ATOM   6073  C  "C2'" . DA  I 6  3    ? 77.570  237.739 236.801 1.00 440.00 ?  -84  DA  I "C2'" 1 
ATOM   6074  C  "C1'" . DA  I 6  3    ? 76.258  236.977 236.895 1.00 440.00 ?  -84  DA  I "C1'" 1 
ATOM   6075  N  N9    . DA  I 6  3    ? 75.806  236.403 235.629 1.00 20.00  ?  -84  DA  I N9    1 
ATOM   6076  C  C8    . DA  I 6  3    ? 76.166  236.776 234.359 1.00 20.00  ?  -84  DA  I C8    1 
ATOM   6077  N  N7    . DA  I 6  3    ? 75.590  236.069 233.417 1.00 20.00  ?  -84  DA  I N7    1 
ATOM   6078  C  C5    . DA  I 6  3    ? 74.798  235.168 234.114 1.00 20.00  ?  -84  DA  I C5    1 
ATOM   6079  C  C6    . DA  I 6  3    ? 73.935  234.142 233.690 1.00 20.00  ?  -84  DA  I C6    1 
ATOM   6080  N  N6    . DA  I 6  3    ? 73.717  233.840 232.408 1.00 20.00  ?  -84  DA  I N6    1 
ATOM   6081  N  N1    . DA  I 6  3    ? 73.295  233.428 234.641 1.00 20.00  ?  -84  DA  I N1    1 
ATOM   6082  C  C2    . DA  I 6  3    ? 73.514  233.731 235.926 1.00 20.00  ?  -84  DA  I C2    1 
ATOM   6083  N  N3    . DA  I 6  3    ? 74.301  234.671 236.449 1.00 20.00  ?  -84  DA  I N3    1 
ATOM   6084  C  C4    . DA  I 6  3    ? 74.921  235.361 235.478 1.00 20.00  ?  -84  DA  I C4    1 
ATOM   6085  P  P     . DC  I 6  4    ? 79.279  238.377 239.706 1.00 440.00 ?  -83  DC  I P     1 
ATOM   6086  O  OP1   . DC  I 6  4    ? 79.275  239.410 240.775 1.00 440.00 ?  -83  DC  I OP1   1 
ATOM   6087  O  OP2   . DC  I 6  4    ? 80.179  238.536 238.535 1.00 440.00 -1 -83  DC  I OP2   1 
ATOM   6088  O  "O5'" . DC  I 6  4    ? 79.569  236.962 240.378 1.00 440.00 ?  -83  DC  I "O5'" 1 
ATOM   6089  C  "C5'" . DC  I 6  4    ? 78.744  236.471 241.452 1.00 440.00 ?  -83  DC  I "C5'" 1 
ATOM   6090  C  "C4'" . DC  I 6  4    ? 78.771  234.960 241.479 1.00 440.00 ?  -83  DC  I "C4'" 1 
ATOM   6091  O  "O4'" . DC  I 6  4    ? 78.278  234.448 240.218 1.00 440.00 ?  -83  DC  I "O4'" 1 
ATOM   6092  C  "C3'" . DC  I 6  4    ? 80.160  234.349 241.663 1.00 440.00 ?  -83  DC  I "C3'" 1 
ATOM   6093  O  "O3'" . DC  I 6  4    ? 80.073  233.139 242.422 1.00 440.00 ?  -83  DC  I "O3'" 1 
ATOM   6094  C  "C2'" . DC  I 6  4    ? 80.599  234.060 240.240 1.00 440.00 ?  -83  DC  I "C2'" 1 
ATOM   6095  C  "C1'" . DC  I 6  4    ? 79.290  233.698 239.559 1.00 440.00 ?  -83  DC  I "C1'" 1 
ATOM   6096  N  N1    . DC  I 6  4    ? 79.241  234.037 238.130 1.00 20.00  ?  -83  DC  I N1    1 
ATOM   6097  C  C2    . DC  I 6  4    ? 78.589  233.166 237.253 1.00 20.00  ?  -83  DC  I C2    1 
ATOM   6098  O  O2    . DC  I 6  4    ? 78.071  232.136 237.708 1.00 20.00  ?  -83  DC  I O2    1 
ATOM   6099  N  N3    . DC  I 6  4    ? 78.538  233.470 235.935 1.00 20.00  ?  -83  DC  I N3    1 
ATOM   6100  C  C4    . DC  I 6  4    ? 79.110  234.590 235.487 1.00 20.00  ?  -83  DC  I C4    1 
ATOM   6101  N  N4    . DC  I 6  4    ? 79.036  234.850 234.180 1.00 20.00  ?  -83  DC  I N4    1 
ATOM   6102  C  C5    . DC  I 6  4    ? 79.781  235.495 236.360 1.00 20.00  ?  -83  DC  I C5    1 
ATOM   6103  C  C6    . DC  I 6  4    ? 79.822  235.181 237.661 1.00 20.00  ?  -83  DC  I C6    1 
ATOM   6104  P  P     . DG  I 6  5    ? 81.342  232.623 243.249 1.00 440.00 ?  -82  DG  I P     1 
ATOM   6105  O  OP1   . DG  I 6  5    ? 80.931  232.456 244.666 1.00 440.00 ?  -82  DG  I OP1   1 
ATOM   6106  O  OP2   . DG  I 6  5    ? 82.495  233.497 242.916 1.00 440.00 -1 -82  DG  I OP2   1 
ATOM   6107  O  "O5'" . DG  I 6  5    ? 81.610  231.178 242.633 1.00 440.00 ?  -82  DG  I "O5'" 1 
ATOM   6108  C  "C5'" . DG  I 6  5    ? 80.618  230.138 242.729 1.00 440.00 ?  -82  DG  I "C5'" 1 
ATOM   6109  C  "C4'" . DG  I 6  5    ? 81.003  228.969 241.854 1.00 440.00 ?  -82  DG  I "C4'" 1 
ATOM   6110  O  "O4'" . DG  I 6  5    ? 80.874  229.348 240.462 1.00 440.00 ?  -82  DG  I "O4'" 1 
ATOM   6111  C  "C3'" . DG  I 6  5    ? 82.443  228.489 242.023 1.00 440.00 ?  -82  DG  I "C3'" 1 
ATOM   6112  O  "O3'" . DG  I 6  5    ? 82.521  227.072 241.845 1.00 440.00 ?  -82  DG  I "O3'" 1 
ATOM   6113  C  "C2'" . DG  I 6  5    ? 83.179  229.207 240.908 1.00 440.00 ?  -82  DG  I "C2'" 1 
ATOM   6114  C  "C1'" . DG  I 6  5    ? 82.132  229.258 239.808 1.00 440.00 ?  -82  DG  I "C1'" 1 
ATOM   6115  N  N9    . DG  I 6  5    ? 82.255  230.408 238.918 1.00 440.00 ?  -82  DG  I N9    1 
ATOM   6116  C  C8    . DG  I 6  5    ? 82.769  231.644 239.227 1.00 440.00 ?  -82  DG  I C8    1 
ATOM   6117  N  N7    . DG  I 6  5    ? 82.749  232.474 238.222 1.00 440.00 ?  -82  DG  I N7    1 
ATOM   6118  C  C5    . DG  I 6  5    ? 82.187  231.743 237.183 1.00 440.00 ?  -82  DG  I C5    1 
ATOM   6119  C  C6    . DG  I 6  5    ? 81.908  232.118 235.839 1.00 440.00 ?  -82  DG  I C6    1 
ATOM   6120  O  O6    . DG  I 6  5    ? 82.110  233.203 235.283 1.00 440.00 ?  -82  DG  I O6    1 
ATOM   6121  N  N1    . DG  I 6  5    ? 81.335  231.069 235.124 1.00 440.00 ?  -82  DG  I N1    1 
ATOM   6122  C  C2    . DG  I 6  5    ? 81.065  229.822 235.635 1.00 440.00 ?  -82  DG  I C2    1 
ATOM   6123  N  N2    . DG  I 6  5    ? 80.509  228.944 234.787 1.00 376.89 ?  -82  DG  I N2    1 
ATOM   6124  N  N3    . DG  I 6  5    ? 81.319  229.461 236.885 1.00 440.00 ?  -82  DG  I N3    1 
ATOM   6125  C  C4    . DG  I 6  5    ? 81.877  230.465 237.598 1.00 440.00 ?  -82  DG  I C4    1 
ATOM   6126  P  P     . DC  I 6  6    ? 83.675  226.235 242.570 1.00 440.00 ?  -81  DC  I P     1 
ATOM   6127  O  OP1   . DC  I 6  6    ? 83.154  225.771 243.881 1.00 440.00 ?  -81  DC  I OP1   1 
ATOM   6128  O  OP2   . DC  I 6  6    ? 84.925  227.035 242.517 1.00 440.00 -1 -81  DC  I OP2   1 
ATOM   6129  O  "O5'" . DC  I 6  6    ? 83.848  224.966 241.624 1.00 440.00 ?  -81  DC  I "O5'" 1 
ATOM   6130  C  "C5'" . DC  I 6  6    ? 83.108  224.855 240.393 1.00 440.00 ?  -81  DC  I "C5'" 1 
ATOM   6131  C  "C4'" . DC  I 6  6    ? 83.993  224.302 239.301 1.00 440.00 ?  -81  DC  I "C4'" 1 
ATOM   6132  O  "O4'" . DC  I 6  6    ? 84.115  225.278 238.239 1.00 440.00 ?  -81  DC  I "O4'" 1 
ATOM   6133  C  "C3'" . DC  I 6  6    ? 85.422  223.981 239.739 1.00 440.00 ?  -81  DC  I "C3'" 1 
ATOM   6134  O  "O3'" . DC  I 6  6    ? 85.913  222.835 239.037 1.00 440.00 ?  -81  DC  I "O3'" 1 
ATOM   6135  C  "C2'" . DC  I 6  6    ? 86.193  225.226 239.341 1.00 440.00 ?  -81  DC  I "C2'" 1 
ATOM   6136  C  "C1'" . DC  I 6  6    ? 85.472  225.668 238.079 1.00 440.00 ?  -81  DC  I "C1'" 1 
ATOM   6137  N  N1    . DC  I 6  6    ? 85.498  227.119 237.848 1.00 20.00  ?  -81  DC  I N1    1 
ATOM   6138  C  C2    . DC  I 6  6    ? 85.096  227.612 236.603 1.00 20.00  ?  -81  DC  I C2    1 
ATOM   6139  O  O2    . DC  I 6  6    ? 84.730  226.809 235.732 1.00 20.00  ?  -81  DC  I O2    1 
ATOM   6140  N  N3    . DC  I 6  6    ? 85.116  228.946 236.381 1.00 20.00  ?  -81  DC  I N3    1 
ATOM   6141  C  C4    . DC  I 6  6    ? 85.516  229.776 237.347 1.00 20.00  ?  -81  DC  I C4    1 
ATOM   6142  N  N4    . DC  I 6  6    ? 85.520  231.085 237.084 1.00 20.00  ?  -81  DC  I N4    1 
ATOM   6143  C  C5    . DC  I 6  6    ? 85.931  229.302 238.625 1.00 20.00  ?  -81  DC  I C5    1 
ATOM   6144  C  C6    . DC  I 6  6    ? 85.906  227.978 238.830 1.00 20.00  ?  -81  DC  I C6    1 
ATOM   6145  P  P     . DG  I 6  7    ? 85.674  221.369 239.634 1.00 440.00 ?  -80  DG  I P     1 
ATOM   6146  O  OP1   . DG  I 6  7    ? 84.701  221.480 240.749 1.00 440.00 ?  -80  DG  I OP1   1 
ATOM   6147  O  OP2   . DG  I 6  7    ? 87.002  220.750 239.875 1.00 440.00 -1 -80  DG  I OP2   1 
ATOM   6148  O  "O5'" . DG  I 6  7    ? 84.969  220.602 238.429 1.00 440.00 ?  -80  DG  I "O5'" 1 
ATOM   6149  C  "C5'" . DG  I 6  7    ? 84.817  221.227 237.141 1.00 440.00 ?  -80  DG  I "C5'" 1 
ATOM   6150  C  "C4'" . DG  I 6  7    ? 85.906  220.761 236.202 1.00 440.00 ?  -80  DG  I "C4'" 1 
ATOM   6151  O  "O4'" . DG  I 6  7    ? 86.370  221.880 235.410 1.00 435.70 ?  -80  DG  I "O4'" 1 
ATOM   6152  C  "C3'" . DG  I 6  7    ? 87.146  220.196 236.894 1.00 440.00 ?  -80  DG  I "C3'" 1 
ATOM   6153  O  "O3'" . DG  I 6  7    ? 87.711  219.139 236.111 1.00 440.00 ?  -80  DG  I "O3'" 1 
ATOM   6154  C  "C2'" . DG  I 6  7    ? 88.086  221.385 236.941 1.00 429.86 ?  -80  DG  I "C2'" 1 
ATOM   6155  C  "C1'" . DG  I 6  7    ? 87.751  222.115 235.652 1.00 377.14 ?  -80  DG  I "C1'" 1 
ATOM   6156  N  N9    . DG  I 6  7    ? 87.952  223.559 235.712 1.00 20.00  ?  -80  DG  I N9    1 
ATOM   6157  C  C8    . DG  I 6  7    ? 88.537  224.271 236.731 1.00 20.00  ?  -80  DG  I C8    1 
ATOM   6158  N  N7    . DG  I 6  7    ? 88.578  225.556 236.502 1.00 20.00  ?  -80  DG  I N7    1 
ATOM   6159  C  C5    . DG  I 6  7    ? 87.983  225.701 235.256 1.00 20.00  ?  -80  DG  I C5    1 
ATOM   6160  C  C6    . DG  I 6  7    ? 87.742  226.871 234.481 1.00 20.00  ?  -80  DG  I C6    1 
ATOM   6161  O  O6    . DG  I 6  7    ? 88.015  228.046 234.753 1.00 20.00  ?  -80  DG  I O6    1 
ATOM   6162  N  N1    . DG  I 6  7    ? 87.115  226.567 233.276 1.00 20.00  ?  -80  DG  I N1    1 
ATOM   6163  C  C2    . DG  I 6  7    ? 86.764  225.302 232.868 1.00 20.00  ?  -80  DG  I C2    1 
ATOM   6164  N  N2    . DG  I 6  7    ? 86.166  225.212 231.671 1.00 20.00  ?  -80  DG  I N2    1 
ATOM   6165  N  N3    . DG  I 6  7    ? 86.983  224.205 233.580 1.00 20.00  ?  -80  DG  I N3    1 
ATOM   6166  C  C4    . DG  I 6  7    ? 87.592  224.477 234.755 1.00 20.00  ?  -80  DG  I C4    1 
ATOM   6167  P  P     . DG  I 6  8    ? 88.471  217.930 236.833 1.00 440.00 ?  -79  DG  I P     1 
ATOM   6168  O  OP1   . DG  I 6  8    ? 87.524  216.791 236.942 1.00 440.00 ?  -79  DG  I OP1   1 
ATOM   6169  O  OP2   . DG  I 6  8    ? 89.123  218.462 238.057 1.00 440.00 -1 -79  DG  I OP2   1 
ATOM   6170  O  "O5'" . DG  I 6  8    ? 89.606  217.541 235.785 1.00 440.00 ?  -79  DG  I "O5'" 1 
ATOM   6171  C  "C5'" . DG  I 6  8    ? 89.265  217.022 234.486 1.00 440.00 ?  -79  DG  I "C5'" 1 
ATOM   6172  C  "C4'" . DG  I 6  8    ? 89.919  217.851 233.406 1.00 440.00 ?  -79  DG  I "C4'" 1 
ATOM   6173  O  "O4'" . DG  I 6  8    ? 89.890  219.247 233.786 1.00 440.00 ?  -79  DG  I "O4'" 1 
ATOM   6174  C  "C3'" . DG  I 6  8    ? 91.387  217.518 233.145 1.00 440.00 ?  -79  DG  I "C3'" 1 
ATOM   6175  O  "O3'" . DG  I 6  8    ? 91.689  217.674 231.755 1.00 440.00 ?  -79  DG  I "O3'" 1 
ATOM   6176  C  "C2'" . DG  I 6  8    ? 92.128  218.552 233.970 1.00 440.00 ?  -79  DG  I "C2'" 1 
ATOM   6177  C  "C1'" . DG  I 6  8    ? 91.213  219.760 233.872 1.00 440.00 ?  -79  DG  I "C1'" 1 
ATOM   6178  N  N9    . DG  I 6  8    ? 91.272  220.651 235.026 1.00 20.00  ?  -79  DG  I N9    1 
ATOM   6179  C  C8    . DG  I 6  8    ? 91.334  220.288 236.351 1.00 20.00  ?  -79  DG  I C8    1 
ATOM   6180  N  N7    . DG  I 6  8    ? 91.376  221.310 237.161 1.00 20.00  ?  -79  DG  I N7    1 
ATOM   6181  C  C5    . DG  I 6  8    ? 91.339  222.415 236.323 1.00 20.00  ?  -79  DG  I C5    1 
ATOM   6182  C  C6    . DG  I 6  8    ? 91.357  223.805 236.630 1.00 20.00  ?  -79  DG  I C6    1 
ATOM   6183  O  O6    . DG  I 6  8    ? 91.412  224.349 237.739 1.00 20.00  ?  -79  DG  I O6    1 
ATOM   6184  N  N1    . DG  I 6  8    ? 91.303  224.585 235.477 1.00 20.00  ?  -79  DG  I N1    1 
ATOM   6185  C  C2    . DG  I 6  8    ? 91.240  224.092 234.195 1.00 20.00  ?  -79  DG  I C2    1 
ATOM   6186  N  N2    . DG  I 6  8    ? 91.195  225.005 233.214 1.00 20.00  ?  -79  DG  I N2    1 
ATOM   6187  N  N3    . DG  I 6  8    ? 91.222  222.800 233.897 1.00 20.00  ?  -79  DG  I N3    1 
ATOM   6188  C  C4    . DG  I 6  8    ? 91.273  222.025 235.001 1.00 20.00  ?  -79  DG  I C4    1 
ATOM   6189  P  P     . DC  I 6  9    ? 93.027  217.040 231.150 1.00 400.95 ?  -78  DC  I P     1 
ATOM   6190  O  OP1   . DC  I 6  9    ? 92.668  216.302 229.912 1.00 297.77 ?  -78  DC  I OP1   1 
ATOM   6191  O  OP2   . DC  I 6  9    ? 93.737  216.333 232.247 1.00 391.40 -1 -78  DC  I OP2   1 
ATOM   6192  O  "O5'" . DC  I 6  9    ? 93.879  218.322 230.740 1.00 440.00 ?  -78  DC  I "O5'" 1 
ATOM   6193  C  "C5'" . DC  I 6  9    ? 93.231  219.560 230.392 1.00 440.00 ?  -78  DC  I "C5'" 1 
ATOM   6194  C  "C4'" . DC  I 6  9    ? 94.257  220.581 229.960 1.00 440.00 ?  -78  DC  I "C4'" 1 
ATOM   6195  O  "O4'" . DC  I 6  9    ? 94.253  221.690 230.889 1.00 440.00 ?  -78  DC  I "O4'" 1 
ATOM   6196  C  "C3'" . DC  I 6  9    ? 95.695  220.067 229.931 1.00 440.00 ?  -78  DC  I "C3'" 1 
ATOM   6197  O  "O3'" . DC  I 6  9    ? 96.427  220.694 228.873 1.00 440.00 ?  -78  DC  I "O3'" 1 
ATOM   6198  C  "C2'" . DC  I 6  9    ? 96.238  220.487 231.284 1.00 440.00 ?  -78  DC  I "C2'" 1 
ATOM   6199  C  "C1'" . DC  I 6  9    ? 95.514  221.800 231.535 1.00 440.00 ?  -78  DC  I "C1'" 1 
ATOM   6200  N  N1    . DC  I 6  9    ? 95.268  222.090 232.955 1.00 20.00  ?  -78  DC  I N1    1 
ATOM   6201  C  C2    . DC  I 6  9    ? 95.591  223.356 233.450 1.00 20.00  ?  -78  DC  I C2    1 
ATOM   6202  O  O2    . DC  I 6  9    ? 96.076  224.195 232.677 1.00 20.00  ?  -78  DC  I O2    1 
ATOM   6203  N  N3    . DC  I 6  9    ? 95.366  223.632 234.756 1.00 20.00  ?  -78  DC  I N3    1 
ATOM   6204  C  C4    . DC  I 6  9    ? 94.841  222.699 235.554 1.00 20.00  ?  -78  DC  I C4    1 
ATOM   6205  N  N4    . DC  I 6  9    ? 94.637  223.016 236.835 1.00 20.00  ?  -78  DC  I N4    1 
ATOM   6206  C  C5    . DC  I 6  9    ? 94.503  221.402 235.075 1.00 20.00  ?  -78  DC  I C5    1 
ATOM   6207  C  C6    . DC  I 6  9    ? 94.730  221.142 233.781 1.00 20.00  ?  -78  DC  I C6    1 
ATOM   6208  P  P     . DC  I 6  10   ? 97.919  220.222 228.543 1.00 440.00 ?  -77  DC  I P     1 
ATOM   6209  O  OP1   . DC  I 6  10   ? 98.147  220.402 227.087 1.00 440.00 ?  -77  DC  I OP1   1 
ATOM   6210  O  OP2   . DC  I 6  10   ? 98.126  218.887 229.160 1.00 440.00 -1 -77  DC  I OP2   1 
ATOM   6211  O  "O5'" . DC  I 6  10   ? 98.812  221.284 229.326 1.00 440.00 ?  -77  DC  I "O5'" 1 
ATOM   6212  C  "C5'" . DC  I 6  10   ? 98.340  222.625 229.550 1.00 440.00 ?  -77  DC  I "C5'" 1 
ATOM   6213  C  "C4'" . DC  I 6  10   ? 99.429  223.462 230.181 1.00 440.00 ?  -77  DC  I "C4'" 1 
ATOM   6214  O  "O4'" . DC  I 6  10   ? 99.083  223.738 231.559 1.00 440.00 ?  -77  DC  I "O4'" 1 
ATOM   6215  C  "C3'" . DC  I 6  10   ? 100.803 222.794 230.221 1.00 440.00 ?  -77  DC  I "C3'" 1 
ATOM   6216  O  "O3'" . DC  I 6  10   ? 101.836 223.771 230.064 1.00 440.00 ?  -77  DC  I "O3'" 1 
ATOM   6217  C  "C2'" . DC  I 6  10   ? 100.848 222.183 231.609 1.00 440.00 ?  -77  DC  I "C2'" 1 
ATOM   6218  C  "C1'" . DC  I 6  10   ? 100.057 223.185 232.434 1.00 440.00 ?  -77  DC  I "C1'" 1 
ATOM   6219  N  N1    . DC  I 6  10   ? 99.348  222.595 233.579 1.00 20.00  ?  -77  DC  I N1    1 
ATOM   6220  C  C2    . DC  I 6  10   ? 98.975  223.424 234.640 1.00 20.00  ?  -77  DC  I C2    1 
ATOM   6221  O  O2    . DC  I 6  10   ? 99.252  224.632 234.582 1.00 20.00  ?  -77  DC  I O2    1 
ATOM   6222  N  N3    . DC  I 6  10   ? 98.324  222.892 235.699 1.00 20.00  ?  -77  DC  I N3    1 
ATOM   6223  C  C4    . DC  I 6  10   ? 98.045  221.586 235.721 1.00 20.00  ?  -77  DC  I C4    1 
ATOM   6224  N  N4    . DC  I 6  10   ? 97.401  221.102 236.785 1.00 20.00  ?  -77  DC  I N4    1 
ATOM   6225  C  C5    . DC  I 6  10   ? 98.414  220.719 234.652 1.00 20.00  ?  -77  DC  I C5    1 
ATOM   6226  C  C6    . DC  I 6  10   ? 99.058  221.260 233.611 1.00 20.00  ?  -77  DC  I C6    1 
ATOM   6227  P  P     . DG  I 6  11   ? 103.259 223.342 229.472 1.00 440.00 ?  -76  DG  I P     1 
ATOM   6228  O  OP1   . DG  I 6  11   ? 103.344 223.840 228.075 1.00 440.00 ?  -76  DG  I OP1   1 
ATOM   6229  O  OP2   . DG  I 6  11   ? 103.457 221.897 229.751 1.00 440.00 -1 -76  DG  I OP2   1 
ATOM   6230  O  "O5'" . DG  I 6  11   ? 104.285 224.174 230.362 1.00 440.00 ?  -76  DG  I "O5'" 1 
ATOM   6231  C  "C5'" . DG  I 6  11   ? 104.465 225.588 230.156 1.00 440.00 ?  -76  DG  I "C5'" 1 
ATOM   6232  C  "C4'" . DG  I 6  11   ? 105.089 226.218 231.379 1.00 440.00 ?  -76  DG  I "C4'" 1 
ATOM   6233  O  "O4'" . DG  I 6  11   ? 104.246 225.973 232.530 1.00 440.00 ?  -76  DG  I "O4'" 1 
ATOM   6234  C  "C3'" . DG  I 6  11   ? 106.466 225.668 231.747 1.00 440.00 ?  -76  DG  I "C3'" 1 
ATOM   6235  O  "O3'" . DG  I 6  11   ? 107.282 226.704 232.304 1.00 440.00 ?  -76  DG  I "O3'" 1 
ATOM   6236  C  "C2'" . DG  I 6  11   ? 106.149 224.619 232.797 1.00 440.00 ?  -76  DG  I "C2'" 1 
ATOM   6237  C  "C1'" . DG  I 6  11   ? 104.953 225.227 233.510 1.00 440.00 ?  -76  DG  I "C1'" 1 
ATOM   6238  N  N9    . DG  I 6  11   ? 104.032 224.248 234.076 1.00 20.00  ?  -76  DG  I N9    1 
ATOM   6239  C  C8    . DG  I 6  11   ? 103.630 223.064 233.507 1.00 20.00  ?  -76  DG  I C8    1 
ATOM   6240  N  N7    . DG  I 6  11   ? 102.796 222.392 234.254 1.00 20.00  ?  -76  DG  I N7    1 
ATOM   6241  C  C5    . DG  I 6  11   ? 102.636 223.182 235.385 1.00 20.00  ?  -76  DG  I C5    1 
ATOM   6242  C  C6    . DG  I 6  11   ? 101.846 222.972 236.551 1.00 20.00  ?  -76  DG  I C6    1 
ATOM   6243  O  O6    . DG  I 6  11   ? 101.108 222.017 236.821 1.00 20.00  ?  -76  DG  I O6    1 
ATOM   6244  N  N1    . DG  I 6  11   ? 101.977 224.025 237.453 1.00 20.00  ?  -76  DG  I N1    1 
ATOM   6245  C  C2    . DG  I 6  11   ? 102.766 225.134 237.261 1.00 20.00  ?  -76  DG  I C2    1 
ATOM   6246  N  N2    . DG  I 6  11   ? 102.759 226.041 238.249 1.00 20.00  ?  -76  DG  I N2    1 
ATOM   6247  N  N3    . DG  I 6  11   ? 103.506 225.340 236.181 1.00 20.00  ?  -76  DG  I N3    1 
ATOM   6248  C  C4    . DG  I 6  11   ? 103.394 224.331 235.291 1.00 20.00  ?  -76  DG  I C4    1 
ATOM   6249  P  P     . DC  I 6  12   ? 108.816 226.413 232.653 1.00 440.00 ?  -75  DC  I P     1 
ATOM   6250  O  OP1   . DC  I 6  12   ? 109.587 227.660 232.413 1.00 440.00 ?  -75  DC  I OP1   1 
ATOM   6251  O  OP2   . DC  I 6  12   ? 109.216 225.159 231.965 1.00 440.00 -1 -75  DC  I OP2   1 
ATOM   6252  O  "O5'" . DC  I 6  12   ? 108.782 226.140 234.222 1.00 440.00 ?  -75  DC  I "O5'" 1 
ATOM   6253  C  "C5'" . DC  I 6  12   ? 107.901 226.885 235.083 1.00 440.00 ?  -75  DC  I "C5'" 1 
ATOM   6254  C  "C4'" . DC  I 6  12   ? 108.178 226.548 236.530 1.00 440.00 ?  -75  DC  I "C4'" 1 
ATOM   6255  O  "O4'" . DC  I 6  12   ? 107.009 225.919 237.108 1.00 440.00 ?  -75  DC  I "O4'" 1 
ATOM   6256  C  "C3'" . DC  I 6  12   ? 109.330 225.569 236.748 1.00 440.00 ?  -75  DC  I "C3'" 1 
ATOM   6257  O  "O3'" . DC  I 6  12   ? 110.539 226.276 237.039 1.00 440.00 ?  -75  DC  I "O3'" 1 
ATOM   6258  C  "C2'" . DC  I 6  12   ? 108.878 224.767 237.954 1.00 440.00 ?  -75  DC  I "C2'" 1 
ATOM   6259  C  "C1'" . DC  I 6  12   ? 107.372 224.706 237.754 1.00 440.00 ?  -75  DC  I "C1'" 1 
ATOM   6260  N  N1    . DC  I 6  12   ? 106.924 223.593 236.904 1.00 20.00  ?  -75  DC  I N1    1 
ATOM   6261  C  C2    . DC  I 6  12   ? 105.779 222.883 237.272 1.00 20.00  ?  -75  DC  I C2    1 
ATOM   6262  O  O2    . DC  I 6  12   ? 105.176 223.213 238.304 1.00 20.00  ?  -75  DC  I O2    1 
ATOM   6263  N  N3    . DC  I 6  12   ? 105.359 221.858 236.497 1.00 20.00  ?  -75  DC  I N3    1 
ATOM   6264  C  C4    . DC  I 6  12   ? 106.037 221.535 235.393 1.00 20.00  ?  -75  DC  I C4    1 
ATOM   6265  N  N4    . DC  I 6  12   ? 105.587 220.515 234.657 1.00 20.00  ?  -75  DC  I N4    1 
ATOM   6266  C  C5    . DC  I 6  12   ? 107.207 222.242 234.995 1.00 20.00  ?  -75  DC  I C5    1 
ATOM   6267  C  C6    . DC  I 6  12   ? 107.611 223.255 235.772 1.00 20.00  ?  -75  DC  I C6    1 
ATOM   6268  P  P     . DC  I 6  13   ? 111.936 225.495 237.066 1.00 440.00 ?  -74  DC  I P     1 
ATOM   6269  O  OP1   . DC  I 6  13   ? 113.020 226.485 236.842 1.00 440.00 ?  -74  DC  I OP1   1 
ATOM   6270  O  OP2   . DC  I 6  13   ? 111.821 224.316 236.172 1.00 440.00 -1 -74  DC  I OP2   1 
ATOM   6271  O  "O5'" . DC  I 6  13   ? 112.030 224.981 238.571 1.00 440.00 ?  -74  DC  I "O5'" 1 
ATOM   6272  C  "C5'" . DC  I 6  13   ? 111.868 225.890 239.675 1.00 440.00 ?  -74  DC  I "C5'" 1 
ATOM   6273  C  "C4'" . DC  I 6  13   ? 111.559 225.125 240.940 1.00 440.00 ?  -74  DC  I "C4'" 1 
ATOM   6274  O  "O4'" . DC  I 6  13   ? 110.463 224.212 240.694 1.00 440.00 ?  -74  DC  I "O4'" 1 
ATOM   6275  C  "C3'" . DC  I 6  13   ? 112.710 224.263 241.461 1.00 440.00 ?  -74  DC  I "C3'" 1 
ATOM   6276  O  "O3'" . DC  I 6  13   ? 112.693 224.223 242.891 1.00 440.00 ?  -74  DC  I "O3'" 1 
ATOM   6277  C  "C2'" . DC  I 6  13   ? 112.405 222.895 240.880 1.00 440.00 ?  -74  DC  I "C2'" 1 
ATOM   6278  C  "C1'" . DC  I 6  13   ? 110.886 222.868 240.882 1.00 440.00 ?  -74  DC  I "C1'" 1 
ATOM   6279  N  N1    . DC  I 6  13   ? 110.296 222.058 239.806 1.00 20.00  ?  -74  DC  I N1    1 
ATOM   6280  C  C2    . DC  I 6  13   ? 109.159 221.296 240.082 1.00 20.00  ?  -74  DC  I C2    1 
ATOM   6281  O  O2    . DC  I 6  13   ? 108.681 221.326 241.226 1.00 20.00  ?  -74  DC  I O2    1 
ATOM   6282  N  N3    . DC  I 6  13   ? 108.609 220.547 239.098 1.00 20.00  ?  -74  DC  I N3    1 
ATOM   6283  C  C4    . DC  I 6  13   ? 109.155 220.543 237.880 1.00 20.00  ?  -74  DC  I C4    1 
ATOM   6284  N  N4    . DC  I 6  13   ? 108.580 219.789 236.940 1.00 20.00  ?  -74  DC  I N4    1 
ATOM   6285  C  C5    . DC  I 6  13   ? 110.315 221.310 237.572 1.00 20.00  ?  -74  DC  I C5    1 
ATOM   6286  C  C6    . DC  I 6  13   ? 110.848 222.047 238.554 1.00 20.00  ?  -74  DC  I C6    1 
ATOM   6287  P  P     . DC  I 6  14   ? 113.834 223.426 243.681 1.00 440.00 ?  -73  DC  I P     1 
ATOM   6288  O  OP1   . DC  I 6  14   ? 113.977 224.041 245.026 1.00 440.00 ?  -73  DC  I OP1   1 
ATOM   6289  O  OP2   . DC  I 6  14   ? 115.018 223.316 242.793 1.00 440.00 -1 -73  DC  I OP2   1 
ATOM   6290  O  "O5'" . DC  I 6  14   ? 113.200 221.975 243.859 1.00 440.00 ?  -73  DC  I "O5'" 1 
ATOM   6291  C  "C5'" . DC  I 6  14   ? 111.784 221.805 244.056 1.00 440.00 ?  -73  DC  I "C5'" 1 
ATOM   6292  C  "C4'" . DC  I 6  14   ? 111.489 220.404 244.540 1.00 440.00 ?  -73  DC  I "C4'" 1 
ATOM   6293  O  "O4'" . DC  I 6  14   ? 110.805 219.669 243.497 1.00 440.00 ?  -73  DC  I "O4'" 1 
ATOM   6294  C  "C3'" . DC  I 6  14   ? 112.726 219.578 244.889 1.00 440.00 ?  -73  DC  I "C3'" 1 
ATOM   6295  O  "O3'" . DC  I 6  14   ? 112.447 218.700 245.984 1.00 440.00 ?  -73  DC  I "O3'" 1 
ATOM   6296  C  "C2'" . DC  I 6  14   ? 112.983 218.787 243.620 1.00 440.00 ?  -73  DC  I "C2'" 1 
ATOM   6297  C  "C1'" . DC  I 6  14   ? 111.577 218.546 243.095 1.00 440.00 ?  -73  DC  I "C1'" 1 
ATOM   6298  N  N1    . DC  I 6  14   ? 111.491 218.443 241.631 1.00 20.00  ?  -73  DC  I N1    1 
ATOM   6299  C  C2    . DC  I 6  14   ? 110.479 217.663 241.068 1.00 20.00  ?  -73  DC  I C2    1 
ATOM   6300  O  O2    . DC  I 6  14   ? 109.683 217.080 241.821 1.00 20.00  ?  -73  DC  I O2    1 
ATOM   6301  N  N3    . DC  I 6  14   ? 110.392 217.561 239.722 1.00 20.00  ?  -73  DC  I N3    1 
ATOM   6302  C  C4    . DC  I 6  14   ? 111.268 218.205 238.947 1.00 20.00  ?  -73  DC  I C4    1 
ATOM   6303  N  N4    . DC  I 6  14   ? 111.145 218.077 237.625 1.00 20.00  ?  -73  DC  I N4    1 
ATOM   6304  C  C5    . DC  I 6  14   ? 112.310 219.008 239.495 1.00 20.00  ?  -73  DC  I C5    1 
ATOM   6305  C  C6    . DC  I 6  14   ? 112.384 219.098 240.830 1.00 20.00  ?  -73  DC  I C6    1 
ATOM   6306  P  P     . DA  I 6  15   ? 113.500 217.562 246.387 1.00 440.00 ?  -72  DA  I P     1 
ATOM   6307  O  OP1   . DA  I 6  15   ? 113.677 217.601 247.861 1.00 440.00 ?  -72  DA  I OP1   1 
ATOM   6308  O  OP2   . DA  I 6  15   ? 114.684 217.697 245.501 1.00 440.00 -1 -72  DA  I OP2   1 
ATOM   6309  O  "O5'" . DA  I 6  15   ? 112.741 216.212 246.011 1.00 440.00 ?  -72  DA  I "O5'" 1 
ATOM   6310  C  "C5'" . DA  I 6  15   ? 112.336 215.281 247.036 1.00 440.00 ?  -72  DA  I "C5'" 1 
ATOM   6311  C  "C4'" . DA  I 6  15   ? 111.845 213.983 246.432 1.00 393.81 ?  -72  DA  I "C4'" 1 
ATOM   6312  O  "O4'" . DA  I 6  15   ? 111.264 214.220 245.126 1.00 440.00 ?  -72  DA  I "O4'" 1 
ATOM   6313  C  "C3'" . DA  I 6  15   ? 112.921 212.917 246.225 1.00 393.17 ?  -72  DA  I "C3'" 1 
ATOM   6314  O  "O3'" . DA  I 6  15   ? 112.365 211.618 246.454 1.00 440.00 ?  -72  DA  I "O3'" 1 
ATOM   6315  C  "C2'" . DA  I 6  15   ? 113.286 213.080 244.761 1.00 389.30 ?  -72  DA  I "C2'" 1 
ATOM   6316  C  "C1'" . DA  I 6  15   ? 111.954 213.464 244.141 1.00 440.00 ?  -72  DA  I "C1'" 1 
ATOM   6317  N  N9    . DA  I 6  15   ? 112.066 214.291 242.940 1.00 440.00 ?  -72  DA  I N9    1 
ATOM   6318  C  C8    . DA  I 6  15   ? 112.629 215.538 242.826 1.00 440.00 ?  -72  DA  I C8    1 
ATOM   6319  N  N7    . DA  I 6  15   ? 112.581 216.031 241.612 1.00 440.00 ?  -72  DA  I N7    1 
ATOM   6320  C  C5    . DA  I 6  15   ? 111.942 215.043 240.877 1.00 440.00 ?  -72  DA  I C5    1 
ATOM   6321  C  C6    . DA  I 6  15   ? 111.584 214.955 239.520 1.00 440.00 ?  -72  DA  I C6    1 
ATOM   6322  N  N6    . DA  I 6  15   ? 111.830 215.914 238.625 1.00 440.00 ?  -72  DA  I N6    1 
ATOM   6323  N  N1    . DA  I 6  15   ? 110.956 213.832 239.108 1.00 440.00 ?  -72  DA  I N1    1 
ATOM   6324  C  C2    . DA  I 6  15   ? 110.710 212.869 240.005 1.00 440.00 ?  -72  DA  I C2    1 
ATOM   6325  N  N3    . DA  I 6  15   ? 110.996 212.836 241.305 1.00 440.00 ?  -72  DA  I N3    1 
ATOM   6326  C  C4    . DA  I 6  15   ? 111.619 213.965 241.682 1.00 440.00 ?  -72  DA  I C4    1 
ATOM   6327  P  P     . DT  I 6  16   ? 113.307 210.420 246.937 1.00 440.00 ?  -71  DT  I P     1 
ATOM   6328  O  OP1   . DT  I 6  16   ? 112.761 209.890 248.212 1.00 440.00 ?  -71  DT  I OP1   1 
ATOM   6329  O  OP2   . DT  I 6  16   ? 114.714 210.889 246.878 1.00 440.00 -1 -71  DT  I OP2   1 
ATOM   6330  O  "O5'" . DT  I 6  16   ? 113.095 209.318 245.806 1.00 440.00 ?  -71  DT  I "O5'" 1 
ATOM   6331  C  "C5'" . DT  I 6  16   ? 111.803 208.719 245.592 1.00 440.00 ?  -71  DT  I "C5'" 1 
ATOM   6332  C  "C4'" . DT  I 6  16   ? 111.872 207.715 244.465 1.00 440.00 ?  -71  DT  I "C4'" 1 
ATOM   6333  O  "O4'" . DT  I 6  16   ? 112.144 208.404 243.221 1.00 440.00 ?  -71  DT  I "O4'" 1 
ATOM   6334  C  "C3'" . DT  I 6  16   ? 112.973 206.664 244.611 1.00 440.00 ?  -71  DT  I "C3'" 1 
ATOM   6335  O  "O3'" . DT  I 6  16   ? 112.525 205.413 244.080 1.00 410.66 ?  -71  DT  I "O3'" 1 
ATOM   6336  C  "C2'" . DT  I 6  16   ? 114.102 207.226 243.767 1.00 440.00 ?  -71  DT  I "C2'" 1 
ATOM   6337  C  "C1'" . DT  I 6  16   ? 113.350 207.923 242.646 1.00 440.00 ?  -71  DT  I "C1'" 1 
ATOM   6338  N  N1    . DT  I 6  16   ? 114.061 209.073 242.063 1.00 20.00  ?  -71  DT  I N1    1 
ATOM   6339  C  C2    . DT  I 6  16   ? 114.141 209.164 240.693 1.00 20.00  ?  -71  DT  I C2    1 
ATOM   6340  O  O2    . DT  I 6  16   ? 113.651 208.336 239.941 1.00 20.00  ?  -71  DT  I O2    1 
ATOM   6341  N  N3    . DT  I 6  16   ? 114.819 210.264 240.231 1.00 20.00  ?  -71  DT  I N3    1 
ATOM   6342  C  C4    . DT  I 6  16   ? 115.412 211.258 240.986 1.00 20.00  ?  -71  DT  I C4    1 
ATOM   6343  O  O4    . DT  I 6  16   ? 115.989 212.188 240.430 1.00 20.00  ?  -71  DT  I O4    1 
ATOM   6344  C  C5    . DT  I 6  16   ? 115.289 211.099 242.417 1.00 20.00  ?  -71  DT  I C5    1 
ATOM   6345  C  C7    . DT  I 6  16   ? 115.899 212.127 243.317 1.00 20.00  ?  -71  DT  I C7    1 
ATOM   6346  C  C6    . DT  I 6  16   ? 114.629 210.028 242.877 1.00 20.00  ?  -71  DT  I C6    1 
ATOM   6347  P  P     . DC  I 6  17   ? 113.255 204.055 244.510 1.00 387.69 ?  -70  DC  I P     1 
ATOM   6348  O  OP1   . DC  I 6  17   ? 112.250 203.179 245.163 1.00 338.32 ?  -70  DC  I OP1   1 
ATOM   6349  O  OP2   . DC  I 6  17   ? 114.500 204.412 245.235 1.00 399.26 -1 -70  DC  I OP2   1 
ATOM   6350  O  "O5'" . DC  I 6  17   ? 113.653 203.404 243.112 1.00 417.83 ?  -70  DC  I "O5'" 1 
ATOM   6351  C  "C5'" . DC  I 6  17   ? 112.694 203.308 242.041 1.00 440.00 ?  -70  DC  I "C5'" 1 
ATOM   6352  C  "C4'" . DC  I 6  17   ? 113.384 202.919 240.755 1.00 428.64 ?  -70  DC  I "C4'" 1 
ATOM   6353  O  "O4'" . DC  I 6  17   ? 113.993 204.090 240.162 1.00 333.03 ?  -70  DC  I "O4'" 1 
ATOM   6354  C  "C3'" . DC  I 6  17   ? 114.513 201.901 240.919 1.00 385.36 ?  -70  DC  I "C3'" 1 
ATOM   6355  O  "O3'" . DC  I 6  17   ? 114.580 201.049 239.772 1.00 403.52 ?  -70  DC  I "O3'" 1 
ATOM   6356  C  "C2'" . DC  I 6  17   ? 115.751 202.773 241.006 1.00 294.57 ?  -70  DC  I "C2'" 1 
ATOM   6357  C  "C1'" . DC  I 6  17   ? 115.402 203.927 240.080 1.00 293.75 ?  -70  DC  I "C1'" 1 
ATOM   6358  N  N1    . DC  I 6  17   ? 116.026 205.205 240.450 1.00 20.00  ?  -70  DC  I N1    1 
ATOM   6359  C  C2    . DC  I 6  17   ? 116.054 206.237 239.508 1.00 20.00  ?  -70  DC  I C2    1 
ATOM   6360  O  O2    . DC  I 6  17   ? 115.553 206.043 238.391 1.00 20.00  ?  -70  DC  I O2    1 
ATOM   6361  N  N3    . DC  I 6  17   ? 116.626 207.419 239.840 1.00 20.00  ?  -70  DC  I N3    1 
ATOM   6362  C  C4    . DC  I 6  17   ? 117.154 207.586 241.054 1.00 20.00  ?  -70  DC  I C4    1 
ATOM   6363  N  N4    . DC  I 6  17   ? 117.707 208.768 241.337 1.00 20.00  ?  -70  DC  I N4    1 
ATOM   6364  C  C5    . DC  I 6  17   ? 117.138 206.550 242.032 1.00 20.00  ?  -70  DC  I C5    1 
ATOM   6365  C  C6    . DC  I 6  17   ? 116.570 205.386 241.690 1.00 20.00  ?  -70  DC  I C6    1 
ATOM   6366  P  P     . DA  I 6  18   ? 115.473 199.721 239.818 1.00 415.96 ?  -69  DA  I P     1 
ATOM   6367  O  OP1   . DA  I 6  18   ? 114.571 198.568 240.066 1.00 401.89 ?  -69  DA  I OP1   1 
ATOM   6368  O  OP2   . DA  I 6  18   ? 116.617 199.969 240.730 1.00 440.00 -1 -69  DA  I OP2   1 
ATOM   6369  O  "O5'" . DA  I 6  18   ? 116.028 199.612 238.329 1.00 401.73 ?  -69  DA  I "O5'" 1 
ATOM   6370  C  "C5'" . DA  I 6  18   ? 115.158 199.820 237.200 1.00 440.00 ?  -69  DA  I "C5'" 1 
ATOM   6371  C  "C4'" . DA  I 6  18   ? 115.934 200.406 236.044 1.00 440.00 ?  -69  DA  I "C4'" 1 
ATOM   6372  O  "O4'" . DA  I 6  18   ? 116.385 201.737 236.390 1.00 440.00 ?  -69  DA  I "O4'" 1 
ATOM   6373  C  "C3'" . DA  I 6  18   ? 117.190 199.626 235.655 1.00 440.00 ?  -69  DA  I "C3'" 1 
ATOM   6374  O  "O3'" . DA  I 6  18   ? 117.373 199.677 234.237 1.00 440.00 ?  -69  DA  I "O3'" 1 
ATOM   6375  C  "C2'" . DA  I 6  18   ? 118.301 200.385 236.355 1.00 440.00 ?  -69  DA  I "C2'" 1 
ATOM   6376  C  "C1'" . DA  I 6  18   ? 117.799 201.816 236.282 1.00 405.01 ?  -69  DA  I "C1'" 1 
ATOM   6377  N  N9    . DA  I 6  18   ? 118.282 202.680 237.357 1.00 20.00  ?  -69  DA  I N9    1 
ATOM   6378  C  C8    . DA  I 6  18   ? 118.643 202.318 238.632 1.00 20.00  ?  -69  DA  I C8    1 
ATOM   6379  N  N7    . DA  I 6  18   ? 119.040 203.323 239.374 1.00 20.00  ?  -69  DA  I N7    1 
ATOM   6380  C  C5    . DA  I 6  18   ? 118.936 204.421 238.532 1.00 20.00  ?  -69  DA  I C5    1 
ATOM   6381  C  C6    . DA  I 6  18   ? 119.209 205.787 238.721 1.00 20.00  ?  -69  DA  I C6    1 
ATOM   6382  N  N6    . DA  I 6  18   ? 119.662 206.301 239.866 1.00 20.00  ?  -69  DA  I N6    1 
ATOM   6383  N  N1    . DA  I 6  18   ? 118.997 206.619 237.678 1.00 20.00  ?  -69  DA  I N1    1 
ATOM   6384  C  C2    . DA  I 6  18   ? 118.542 206.103 236.529 1.00 20.00  ?  -69  DA  I C2    1 
ATOM   6385  N  N3    . DA  I 6  18   ? 118.249 204.840 236.229 1.00 20.00  ?  -69  DA  I N3    1 
ATOM   6386  C  C4    . DA  I 6  18   ? 118.470 204.039 237.286 1.00 20.00  ?  -69  DA  I C4    1 
ATOM   6387  P  P     . DG  I 6  19   ? 118.165 198.505 233.490 1.00 440.00 ?  -68  DG  I P     1 
ATOM   6388  O  OP1   . DG  I 6  19   ? 117.183 197.715 232.705 1.00 440.00 ?  -68  DG  I OP1   1 
ATOM   6389  O  OP2   . DG  I 6  19   ? 119.025 197.823 234.489 1.00 440.00 -1 -68  DG  I OP2   1 
ATOM   6390  O  "O5'" . DG  I 6  19   ? 119.101 199.295 232.472 1.00 440.00 ?  -68  DG  I "O5'" 1 
ATOM   6391  C  "C5'" . DG  I 6  19   ? 118.592 200.409 231.712 1.00 440.00 ?  -68  DG  I "C5'" 1 
ATOM   6392  C  "C4'" . DG  I 6  19   ? 119.722 201.338 231.331 1.00 440.00 ?  -68  DG  I "C4'" 1 
ATOM   6393  O  "O4'" . DG  I 6  19   ? 120.138 202.091 232.495 1.00 440.00 ?  -68  DG  I "O4'" 1 
ATOM   6394  C  "C3'" . DG  I 6  19   ? 120.979 200.638 230.818 1.00 440.00 ?  -68  DG  I "C3'" 1 
ATOM   6395  O  "O3'" . DG  I 6  19   ? 121.630 201.438 229.827 1.00 440.00 ?  -68  DG  I "O3'" 1 
ATOM   6396  C  "C2'" . DG  I 6  19   ? 121.837 200.517 232.064 1.00 440.00 ?  -68  DG  I "C2'" 1 
ATOM   6397  C  "C1'" . DG  I 6  19   ? 121.484 201.783 232.830 1.00 440.00 ?  -68  DG  I "C1'" 1 
ATOM   6398  N  N9    . DG  I 6  19   ? 121.563 201.644 234.280 1.00 20.00  ?  -68  DG  I N9    1 
ATOM   6399  C  C8    . DG  I 6  19   ? 121.412 200.489 235.010 1.00 20.00  ?  -68  DG  I C8    1 
ATOM   6400  N  N7    . DG  I 6  19   ? 121.536 200.677 236.296 1.00 20.00  ?  -68  DG  I N7    1 
ATOM   6401  C  C5    . DG  I 6  19   ? 121.783 202.037 236.423 1.00 20.00  ?  -68  DG  I C5    1 
ATOM   6402  C  C6    . DG  I 6  19   ? 122.005 202.829 237.585 1.00 20.00  ?  -68  DG  I C6    1 
ATOM   6403  O  O6    . DG  I 6  19   ? 122.025 202.471 238.770 1.00 20.00  ?  -68  DG  I O6    1 
ATOM   6404  N  N1    . DG  I 6  19   ? 122.216 204.166 237.262 1.00 20.00  ?  -68  DG  I N1    1 
ATOM   6405  C  C2    . DG  I 6  19   ? 122.215 204.677 235.986 1.00 20.00  ?  -68  DG  I C2    1 
ATOM   6406  N  N2    . DG  I 6  19   ? 122.439 205.994 235.878 1.00 20.00  ?  -68  DG  I N2    1 
ATOM   6407  N  N3    . DG  I 6  19   ? 122.011 203.951 234.895 1.00 20.00  ?  -68  DG  I N3    1 
ATOM   6408  C  C4    . DG  I 6  19   ? 121.803 202.648 235.187 1.00 20.00  ?  -68  DG  I C4    1 
ATOM   6409  P  P     . DA  I 6  20   ? 122.409 200.735 228.620 1.00 440.00 ?  -67  DA  I P     1 
ATOM   6410  O  OP1   . DA  I 6  20   ? 121.598 200.909 227.387 1.00 440.00 ?  -67  DA  I OP1   1 
ATOM   6411  O  OP2   . DA  I 6  20   ? 122.798 199.370 229.056 1.00 440.00 -1 -67  DA  I OP2   1 
ATOM   6412  O  "O5'" . DA  I 6  20   ? 123.728 201.618 228.480 1.00 440.00 ?  -67  DA  I "O5'" 1 
ATOM   6413  C  "C5'" . DA  I 6  20   ? 123.645 203.032 228.227 1.00 440.00 ?  -67  DA  I "C5'" 1 
ATOM   6414  C  "C4'" . DA  I 6  20   ? 124.834 203.741 228.831 1.00 440.00 ?  -67  DA  I "C4'" 1 
ATOM   6415  O  "O4'" . DA  I 6  20   ? 124.771 203.647 230.275 1.00 440.00 ?  -67  DA  I "O4'" 1 
ATOM   6416  C  "C3'" . DA  I 6  20   ? 126.194 203.165 228.433 1.00 440.00 ?  -67  DA  I "C3'" 1 
ATOM   6417  O  "O3'" . DA  I 6  20   ? 127.149 204.222 228.315 1.00 440.00 ?  -67  DA  I "O3'" 1 
ATOM   6418  C  "C2'" . DA  I 6  20   ? 126.547 202.269 229.605 1.00 440.00 ?  -67  DA  I "C2'" 1 
ATOM   6419  C  "C1'" . DA  I 6  20   ? 125.946 203.028 230.775 1.00 440.00 ?  -67  DA  I "C1'" 1 
ATOM   6420  N  N9    . DA  I 6  20   ? 125.562 202.185 231.906 1.00 20.00  ?  -67  DA  I N9    1 
ATOM   6421  C  C8    . DA  I 6  20   ? 124.933 200.964 231.873 1.00 20.00  ?  -67  DA  I C8    1 
ATOM   6422  N  N7    . DA  I 6  20   ? 124.719 200.447 233.058 1.00 20.00  ?  -67  DA  I N7    1 
ATOM   6423  C  C5    . DA  I 6  20   ? 125.240 201.390 233.932 1.00 20.00  ?  -67  DA  I C5    1 
ATOM   6424  C  C6    . DA  I 6  20   ? 125.322 201.436 235.334 1.00 20.00  ?  -67  DA  I C6    1 
ATOM   6425  N  N6    . DA  I 6  20   ? 124.862 200.473 236.136 1.00 20.00  ?  -67  DA  I N6    1 
ATOM   6426  N  N1    . DA  I 6  20   ? 125.902 202.521 235.894 1.00 20.00  ?  -67  DA  I N1    1 
ATOM   6427  C  C2    . DA  I 6  20   ? 126.363 203.486 235.090 1.00 20.00  ?  -67  DA  I C2    1 
ATOM   6428  N  N3    . DA  I 6  20   ? 126.344 203.558 233.761 1.00 20.00  ?  -67  DA  I N3    1 
ATOM   6429  C  C4    . DA  I 6  20   ? 125.762 202.466 233.236 1.00 20.00  ?  -67  DA  I C4    1 
ATOM   6430  P  P     . DA  I 6  21   ? 128.337 204.109 227.250 1.00 440.00 ?  -66  DA  I P     1 
ATOM   6431  O  OP1   . DA  I 6  21   ? 128.187 205.218 226.273 1.00 440.00 ?  -66  DA  I OP1   1 
ATOM   6432  O  OP2   . DA  I 6  21   ? 128.390 202.706 226.767 1.00 440.00 -1 -66  DA  I OP2   1 
ATOM   6433  O  "O5'" . DA  I 6  21   ? 129.636 204.389 228.129 1.00 440.00 ?  -66  DA  I "O5'" 1 
ATOM   6434  C  "C5'" . DA  I 6  21   ? 129.626 205.393 229.162 1.00 440.00 ?  -66  DA  I "C5'" 1 
ATOM   6435  C  "C4'" . DA  I 6  21   ? 130.787 205.183 230.105 1.00 401.62 ?  -66  DA  I "C4'" 1 
ATOM   6436  O  "O4'" . DA  I 6  21   ? 130.365 204.350 231.211 1.00 333.27 ?  -66  DA  I "O4'" 1 
ATOM   6437  C  "C3'" . DA  I 6  21   ? 131.991 204.474 229.486 1.00 324.53 ?  -66  DA  I "C3'" 1 
ATOM   6438  O  "O3'" . DA  I 6  21   ? 133.203 204.963 230.071 1.00 431.32 ?  -66  DA  I "O3'" 1 
ATOM   6439  C  "C2'" . DA  I 6  21   ? 131.768 203.022 229.866 1.00 360.00 ?  -66  DA  I "C2'" 1 
ATOM   6440  C  "C1'" . DA  I 6  21   ? 131.113 203.142 231.233 1.00 440.00 ?  -66  DA  I "C1'" 1 
ATOM   6441  N  N9    . DA  I 6  21   ? 130.193 202.052 231.555 1.00 20.00  ?  -66  DA  I N9    1 
ATOM   6442  C  C8    . DA  I 6  21   ? 129.751 201.052 230.725 1.00 20.00  ?  -66  DA  I C8    1 
ATOM   6443  N  N7    . DA  I 6  21   ? 128.924 200.213 231.302 1.00 20.00  ?  -66  DA  I N7    1 
ATOM   6444  C  C5    . DA  I 6  21   ? 128.814 200.695 232.600 1.00 20.00  ?  -66  DA  I C5    1 
ATOM   6445  C  C6    . DA  I 6  21   ? 128.084 200.248 233.715 1.00 20.00  ?  -66  DA  I C6    1 
ATOM   6446  N  N6    . DA  I 6  21   ? 127.294 199.172 233.701 1.00 20.00  ?  -66  DA  I N6    1 
ATOM   6447  N  N1    . DA  I 6  21   ? 128.194 200.954 234.861 1.00 20.00  ?  -66  DA  I N1    1 
ATOM   6448  C  C2    . DA  I 6  21   ? 128.988 202.033 234.875 1.00 20.00  ?  -66  DA  I C2    1 
ATOM   6449  N  N3    . DA  I 6  21   ? 129.723 202.551 233.893 1.00 20.00  ?  -66  DA  I N3    1 
ATOM   6450  C  C4    . DA  I 6  21   ? 129.590 201.826 232.770 1.00 20.00  ?  -66  DA  I C4    1 
ATOM   6451  P  P     . DT  I 6  22   ? 134.587 204.827 229.281 1.00 440.00 ?  -65  DT  I P     1 
ATOM   6452  O  OP1   . DT  I 6  22   ? 134.635 205.893 228.250 1.00 440.00 ?  -65  DT  I OP1   1 
ATOM   6453  O  OP2   . DT  I 6  22   ? 134.749 203.407 228.879 1.00 440.00 -1 -65  DT  I OP2   1 
ATOM   6454  O  "O5'" . DT  I 6  22   ? 135.672 205.161 230.399 1.00 440.00 ?  -65  DT  I "O5'" 1 
ATOM   6455  C  "C5'" . DT  I 6  22   ? 135.358 206.038 231.498 1.00 440.00 ?  -65  DT  I "C5'" 1 
ATOM   6456  C  "C4'" . DT  I 6  22   ? 136.097 205.603 232.742 1.00 440.00 ?  -65  DT  I "C4'" 1 
ATOM   6457  O  "O4'" . DT  I 6  22   ? 135.288 204.649 233.470 1.00 440.00 ?  -65  DT  I "O4'" 1 
ATOM   6458  C  "C3'" . DT  I 6  22   ? 137.428 204.902 232.480 1.00 440.00 ?  -65  DT  I "C3'" 1 
ATOM   6459  O  "O3'" . DT  I 6  22   ? 138.361 205.174 233.531 1.00 440.00 ?  -65  DT  I "O3'" 1 
ATOM   6460  C  "C2'" . DT  I 6  22   ? 137.045 203.434 232.470 1.00 440.00 ?  -65  DT  I "C2'" 1 
ATOM   6461  C  "C1'" . DT  I 6  22   ? 135.925 203.377 233.496 1.00 354.56 ?  -65  DT  I "C1'" 1 
ATOM   6462  N  N1    . DT  I 6  22   ? 134.902 202.356 233.215 1.00 20.00  ?  -65  DT  I N1    1 
ATOM   6463  C  C2    . DT  I 6  22   ? 134.223 201.802 234.276 1.00 20.00  ?  -65  DT  I C2    1 
ATOM   6464  O  O2    . DT  I 6  22   ? 134.430 202.116 235.436 1.00 20.00  ?  -65  DT  I O2    1 
ATOM   6465  N  N3    . DT  I 6  22   ? 133.287 200.860 233.927 1.00 20.00  ?  -65  DT  I N3    1 
ATOM   6466  C  C4    . DT  I 6  22   ? 132.970 200.428 232.651 1.00 20.00  ?  -65  DT  I C4    1 
ATOM   6467  O  O4    . DT  I 6  22   ? 132.104 199.573 232.493 1.00 20.00  ?  -65  DT  I O4    1 
ATOM   6468  C  C5    . DT  I 6  22   ? 133.722 201.053 231.587 1.00 20.00  ?  -65  DT  I C5    1 
ATOM   6469  C  C7    . DT  I 6  22   ? 133.448 200.650 230.172 1.00 20.00  ?  -65  DT  I C7    1 
ATOM   6470  C  C6    . DT  I 6  22   ? 134.636 201.973 231.917 1.00 20.00  ?  -65  DT  I C6    1 
ATOM   6471  P  P     . DC  I 6  23   ? 139.892 204.733 233.375 1.00 440.00 ?  -64  DC  I P     1 
ATOM   6472  O  OP1   . DC  I 6  23   ? 140.723 205.962 233.344 1.00 440.00 ?  -64  DC  I OP1   1 
ATOM   6473  O  OP2   . DC  I 6  23   ? 139.978 203.758 232.258 1.00 440.00 -1 -64  DC  I OP2   1 
ATOM   6474  O  "O5'" . DC  I 6  23   ? 140.183 203.963 234.739 1.00 440.00 ?  -64  DC  I "O5'" 1 
ATOM   6475  C  "C5'" . DC  I 6  23   ? 139.767 204.516 236.002 1.00 440.00 ?  -64  DC  I "C5'" 1 
ATOM   6476  C  "C4'" . DC  I 6  23   ? 139.640 203.420 237.034 1.00 440.00 ?  -64  DC  I "C4'" 1 
ATOM   6477  O  "O4'" . DC  I 6  23   ? 138.493 202.594 236.721 1.00 440.00 ?  -64  DC  I "O4'" 1 
ATOM   6478  C  "C3'" . DC  I 6  23   ? 140.834 202.468 237.106 1.00 440.00 ?  -64  DC  I "C3'" 1 
ATOM   6479  O  "O3'" . DC  I 6  23   ? 141.053 202.049 238.456 1.00 440.00 ?  -64  DC  I "O3'" 1 
ATOM   6480  C  "C2'" . DC  I 6  23   ? 140.395 201.297 236.246 1.00 440.00 ?  -64  DC  I "C2'" 1 
ATOM   6481  C  "C1'" . DC  I 6  23   ? 138.898 201.250 236.502 1.00 440.00 ?  -64  DC  I "C1'" 1 
ATOM   6482  N  N1    . DC  I 6  23   ? 138.110 200.720 235.379 1.00 20.00  ?  -64  DC  I N1    1 
ATOM   6483  C  C2    . DC  I 6  23   ? 136.847 200.184 235.637 1.00 20.00  ?  -64  DC  I C2    1 
ATOM   6484  O  O2    . DC  I 6  23   ? 136.429 200.171 236.805 1.00 20.00  ?  -64  DC  I O2    1 
ATOM   6485  N  N3    . DC  I 6  23   ? 136.114 199.694 234.610 1.00 20.00  ?  -64  DC  I N3    1 
ATOM   6486  C  C4    . DC  I 6  23   ? 136.603 199.728 233.368 1.00 20.00  ?  -64  DC  I C4    1 
ATOM   6487  N  N4    . DC  I 6  23   ? 135.846 199.233 232.385 1.00 20.00  ?  -64  DC  I N4    1 
ATOM   6488  C  C5    . DC  I 6  23   ? 137.888 200.269 233.078 1.00 20.00  ?  -64  DC  I C5    1 
ATOM   6489  C  C6    . DC  I 6  23   ? 138.602 200.750 234.104 1.00 20.00  ?  -64  DC  I C6    1 
ATOM   6490  P  P     . DC  I 6  24   ? 142.484 201.487 238.897 1.00 440.00 ?  -63  DC  I P     1 
ATOM   6491  O  OP1   . DC  I 6  24   ? 143.056 202.422 239.899 1.00 440.00 ?  -63  DC  I OP1   1 
ATOM   6492  O  OP2   . DC  I 6  24   ? 143.251 201.168 237.667 1.00 410.90 -1 -63  DC  I OP2   1 
ATOM   6493  O  "O5'" . DC  I 6  24   ? 142.122 200.123 239.636 1.00 440.00 ?  -63  DC  I "O5'" 1 
ATOM   6494  C  "C5'" . DC  I 6  24   ? 141.143 200.091 240.692 1.00 440.00 ?  -63  DC  I "C5'" 1 
ATOM   6495  C  "C4'" . DC  I 6  24   ? 140.617 198.687 240.873 1.00 440.00 ?  -63  DC  I "C4'" 1 
ATOM   6496  O  "O4'" . DC  I 6  24   ? 139.821 198.319 239.721 1.00 440.00 ?  -63  DC  I "O4'" 1 
ATOM   6497  C  "C3'" . DC  I 6  24   ? 141.696 197.612 240.998 1.00 440.00 ?  -63  DC  I "C3'" 1 
ATOM   6498  O  "O3'" . DC  I 6  24   ? 141.271 196.588 241.904 1.00 440.00 ?  -63  DC  I "O3'" 1 
ATOM   6499  C  "C2'" . DC  I 6  24   ? 141.806 197.066 239.588 1.00 440.00 ?  -63  DC  I "C2'" 1 
ATOM   6500  C  "C1'" . DC  I 6  24   ? 140.376 197.174 239.086 1.00 440.00 ?  -63  DC  I "C1'" 1 
ATOM   6501  N  N1    . DC  I 6  24   ? 140.258 197.365 237.633 1.00 20.00  ?  -63  DC  I N1    1 
ATOM   6502  C  C2    . DC  I 6  24   ? 139.171 196.797 236.965 1.00 20.00  ?  -63  DC  I C2    1 
ATOM   6503  O  O2    . DC  I 6  24   ? 138.339 196.150 237.618 1.00 20.00  ?  -63  DC  I O2    1 
ATOM   6504  N  N3    . DC  I 6  24   ? 139.055 196.967 235.628 1.00 20.00  ?  -63  DC  I N3    1 
ATOM   6505  C  C4    . DC  I 6  24   ? 139.973 197.671 234.963 1.00 20.00  ?  -63  DC  I C4    1 
ATOM   6506  N  N4    . DC  I 6  24   ? 139.819 197.813 233.645 1.00 20.00  ?  -63  DC  I N4    1 
ATOM   6507  C  C5    . DC  I 6  24   ? 141.091 198.261 235.620 1.00 20.00  ?  -63  DC  I C5    1 
ATOM   6508  C  C6    . DC  I 6  24   ? 141.194 198.085 236.943 1.00 20.00  ?  -63  DC  I C6    1 
ATOM   6509  P  P     . DC  I 6  25   ? 142.353 195.770 242.752 1.00 440.00 ?  -62  DC  I P     1 
ATOM   6510  O  OP1   . DC  I 6  25   ? 141.637 194.717 243.516 1.00 440.00 ?  -62  DC  I OP1   1 
ATOM   6511  O  OP2   . DC  I 6  25   ? 143.208 196.748 243.470 1.00 440.00 -1 -62  DC  I OP2   1 
ATOM   6512  O  "O5'" . DC  I 6  25   ? 143.230 195.062 241.626 1.00 440.00 ?  -62  DC  I "O5'" 1 
ATOM   6513  C  "C5'" . DC  I 6  25   ? 143.383 193.630 241.598 1.00 440.00 ?  -62  DC  I "C5'" 1 
ATOM   6514  C  "C4'" . DC  I 6  25   ? 142.256 192.999 240.816 1.00 422.87 ?  -62  DC  I "C4'" 1 
ATOM   6515  O  "O4'" . DC  I 6  25   ? 141.924 193.839 239.686 1.00 377.42 ?  -62  DC  I "O4'" 1 
ATOM   6516  C  "C3'" . DC  I 6  25   ? 142.579 191.625 240.231 1.00 440.00 ?  -62  DC  I "C3'" 1 
ATOM   6517  O  "O3'" . DC  I 6  25   ? 141.405 190.806 240.205 1.00 440.00 ?  -62  DC  I "O3'" 1 
ATOM   6518  C  "C2'" . DC  I 6  25   ? 143.035 191.951 238.821 1.00 403.27 ?  -62  DC  I "C2'" 1 
ATOM   6519  C  "C1'" . DC  I 6  25   ? 142.170 193.151 238.466 1.00 425.74 ?  -62  DC  I "C1'" 1 
ATOM   6520  N  N1    . DC  I 6  25   ? 142.807 194.097 237.539 1.00 20.00  ?  -62  DC  I N1    1 
ATOM   6521  C  C2    . DC  I 6  25   ? 142.375 194.131 236.210 1.00 20.00  ?  -62  DC  I C2    1 
ATOM   6522  O  O2    . DC  I 6  25   ? 141.468 193.362 235.855 1.00 20.00  ?  -62  DC  I O2    1 
ATOM   6523  N  N3    . DC  I 6  25   ? 142.954 194.997 235.349 1.00 20.00  ?  -62  DC  I N3    1 
ATOM   6524  C  C4    . DC  I 6  25   ? 143.926 195.807 235.771 1.00 20.00  ?  -62  DC  I C4    1 
ATOM   6525  N  N4    . DC  I 6  25   ? 144.470 196.647 234.887 1.00 20.00  ?  -62  DC  I N4    1 
ATOM   6526  C  C5    . DC  I 6  25   ? 144.386 195.793 237.120 1.00 20.00  ?  -62  DC  I C5    1 
ATOM   6527  C  C6    . DC  I 6  25   ? 143.803 194.930 237.961 1.00 20.00  ?  -62  DC  I C6    1 
ATOM   6528  P  P     . DG  I 6  26   ? 141.525 189.249 239.855 1.00 440.00 ?  -61  DG  I P     1 
ATOM   6529  O  OP1   . DG  I 6  26   ? 140.340 188.558 240.425 1.00 440.00 ?  -61  DG  I OP1   1 
ATOM   6530  O  OP2   . DG  I 6  26   ? 142.889 188.798 240.227 1.00 440.00 -1 -61  DG  I OP2   1 
ATOM   6531  O  "O5'" . DG  I 6  26   ? 141.400 189.227 238.267 1.00 339.15 ?  -61  DG  I "O5'" 1 
ATOM   6532  C  "C5'" . DG  I 6  26   ? 142.505 188.803 237.445 1.00 202.59 ?  -61  DG  I "C5'" 1 
ATOM   6533  C  "C4'" . DG  I 6  26   ? 141.998 188.013 236.260 1.00 231.58 ?  -61  DG  I "C4'" 1 
ATOM   6534  O  "O4'" . DG  I 6  26   ? 141.859 188.895 235.120 1.00 385.64 ?  -61  DG  I "O4'" 1 
ATOM   6535  C  "C3'" . DG  I 6  26   ? 142.920 186.884 235.805 1.00 260.26 ?  -61  DG  I "C3'" 1 
ATOM   6536  O  "O3'" . DG  I 6  26   ? 142.149 185.783 235.313 1.00 264.64 ?  -61  DG  I "O3'" 1 
ATOM   6537  C  "C2'" . DG  I 6  26   ? 143.715 187.520 234.680 1.00 380.33 ?  -61  DG  I "C2'" 1 
ATOM   6538  C  "C1'" . DG  I 6  26   ? 142.696 188.459 234.057 1.00 440.00 ?  -61  DG  I "C1'" 1 
ATOM   6539  N  N9    . DG  I 6  26   ? 143.276 189.644 233.433 1.00 20.00  ?  -61  DG  I N9    1 
ATOM   6540  C  C8    . DG  I 6  26   ? 143.920 190.681 234.065 1.00 20.00  ?  -61  DG  I C8    1 
ATOM   6541  N  N7    . DG  I 6  26   ? 144.334 191.605 233.240 1.00 20.00  ?  -61  DG  I N7    1 
ATOM   6542  C  C5    . DG  I 6  26   ? 143.940 191.151 231.989 1.00 20.00  ?  -61  DG  I C5    1 
ATOM   6543  C  C6    . DG  I 6  26   ? 144.112 191.732 230.701 1.00 20.00  ?  -61  DG  I C6    1 
ATOM   6544  O  O6    . DG  I 6  26   ? 144.665 192.799 230.405 1.00 20.00  ?  -61  DG  I O6    1 
ATOM   6545  N  N1    . DG  I 6  26   ? 143.559 190.937 229.702 1.00 20.00  ?  -61  DG  I N1    1 
ATOM   6546  C  C2    . DG  I 6  26   ? 142.923 189.737 229.912 1.00 20.00  ?  -61  DG  I C2    1 
ATOM   6547  N  N2    . DG  I 6  26   ? 142.457 189.117 228.818 1.00 20.00  ?  -61  DG  I N2    1 
ATOM   6548  N  N3    . DG  I 6  26   ? 142.756 189.184 231.106 1.00 20.00  ?  -61  DG  I N3    1 
ATOM   6549  C  C4    . DG  I 6  26   ? 143.286 189.941 232.092 1.00 20.00  ?  -61  DG  I C4    1 
ATOM   6550  P  P     . DG  I 6  27   ? 142.572 184.285 235.679 1.00 322.47 ?  -60  DG  I P     1 
ATOM   6551  O  OP1   . DG  I 6  27   ? 141.619 183.774 236.698 1.00 284.50 ?  -60  DG  I OP1   1 
ATOM   6552  O  OP2   . DG  I 6  27   ? 144.029 184.274 235.966 1.00 295.58 -1 -60  DG  I OP2   1 
ATOM   6553  O  "O5'" . DG  I 6  27   ? 142.319 183.497 234.317 1.00 306.78 ?  -60  DG  I "O5'" 1 
ATOM   6554  C  "C5'" . DG  I 6  27   ? 140.989 183.345 233.790 1.00 298.09 ?  -60  DG  I "C5'" 1 
ATOM   6555  C  "C4'" . DG  I 6  27   ? 141.019 183.379 232.279 1.00 291.50 ?  -60  DG  I "C4'" 1 
ATOM   6556  O  "O4'" . DG  I 6  27   ? 141.748 184.550 231.837 1.00 223.85 ?  -60  DG  I "O4'" 1 
ATOM   6557  C  "C3'" . DG  I 6  27   ? 141.708 182.183 231.625 1.00 391.10 ?  -60  DG  I "C3'" 1 
ATOM   6558  O  "O3'" . DG  I 6  27   ? 141.039 181.831 230.410 1.00 440.00 ?  -60  DG  I "O3'" 1 
ATOM   6559  C  "C2'" . DG  I 6  27   ? 143.102 182.702 231.331 1.00 327.71 ?  -60  DG  I "C2'" 1 
ATOM   6560  C  "C1'" . DG  I 6  27   ? 142.840 184.164 231.017 1.00 301.27 ?  -60  DG  I "C1'" 1 
ATOM   6561  N  N9    . DG  I 6  27   ? 143.959 185.051 231.315 1.00 321.71 ?  -60  DG  I N9    1 
ATOM   6562  C  C8    . DG  I 6  27   ? 144.675 185.115 232.486 1.00 440.00 ?  -60  DG  I C8    1 
ATOM   6563  N  N7    . DG  I 6  27   ? 145.623 186.012 232.459 1.00 440.00 ?  -60  DG  I N7    1 
ATOM   6564  C  C5    . DG  I 6  27   ? 145.527 186.576 231.194 1.00 440.00 ?  -60  DG  I C5    1 
ATOM   6565  C  C6    . DG  I 6  27   ? 146.296 187.606 230.583 1.00 379.67 ?  -60  DG  I C6    1 
ATOM   6566  O  O6    . DG  I 6  27   ? 147.245 188.244 231.057 1.00 289.60 ?  -60  DG  I O6    1 
ATOM   6567  N  N1    . DG  I 6  27   ? 145.862 187.870 229.287 1.00 280.19 ?  -60  DG  I N1    1 
ATOM   6568  C  C2    . DG  I 6  27   ? 144.823 187.226 228.659 1.00 245.46 ?  -60  DG  I C2    1 
ATOM   6569  N  N2    . DG  I 6  27   ? 144.555 187.622 227.405 1.00 270.74 ?  -60  DG  I N2    1 
ATOM   6570  N  N3    . DG  I 6  27   ? 144.100 186.265 229.216 1.00 190.06 ?  -60  DG  I N3    1 
ATOM   6571  C  C4    . DG  I 6  27   ? 144.505 185.993 230.476 1.00 303.27 ?  -60  DG  I C4    1 
ATOM   6572  P  P     . DT  I 6  28   ? 141.388 180.455 229.674 1.00 440.00 ?  -59  DT  I P     1 
ATOM   6573  O  OP1   . DT  I 6  28   ? 140.114 179.823 229.249 1.00 440.00 ?  -59  DT  I OP1   1 
ATOM   6574  O  OP2   . DT  I 6  28   ? 142.332 179.700 230.536 1.00 440.00 -1 -59  DT  I OP2   1 
ATOM   6575  O  "O5'" . DT  I 6  28   ? 142.170 180.933 228.370 1.00 440.00 ?  -59  DT  I "O5'" 1 
ATOM   6576  C  "C5'" . DT  I 6  28   ? 141.637 181.972 227.529 1.00 440.00 ?  -59  DT  I "C5'" 1 
ATOM   6577  C  "C4'" . DT  I 6  28   ? 142.531 182.184 226.329 1.00 440.00 ?  -59  DT  I "C4'" 1 
ATOM   6578  O  "O4'" . DT  I 6  28   ? 143.543 183.169 226.649 1.00 440.00 ?  -59  DT  I "O4'" 1 
ATOM   6579  C  "C3'" . DT  I 6  28   ? 143.289 180.940 225.867 1.00 440.00 ?  -59  DT  I "C3'" 1 
ATOM   6580  O  "O3'" . DT  I 6  28   ? 143.412 180.938 224.442 1.00 440.00 ?  -59  DT  I "O3'" 1 
ATOM   6581  C  "C2'" . DT  I 6  28   ? 144.650 181.101 226.518 1.00 440.00 ?  -59  DT  I "C2'" 1 
ATOM   6582  C  "C1'" . DT  I 6  28   ? 144.839 182.609 226.495 1.00 440.00 ?  -59  DT  I "C1'" 1 
ATOM   6583  N  N1    . DT  I 6  28   ? 145.687 183.129 227.582 1.00 440.00 ?  -59  DT  I N1    1 
ATOM   6584  C  C2    . DT  I 6  28   ? 146.321 184.335 227.393 1.00 345.83 ?  -59  DT  I C2    1 
ATOM   6585  O  O2    . DT  I 6  28   ? 146.213 184.991 226.370 1.00 271.78 ?  -59  DT  I O2    1 
ATOM   6586  N  N3    . DT  I 6  28   ? 147.091 184.749 228.452 1.00 229.54 ?  -59  DT  I N3    1 
ATOM   6587  C  C4    . DT  I 6  28   ? 147.285 184.089 229.652 1.00 292.72 ?  -59  DT  I C4    1 
ATOM   6588  O  O4    . DT  I 6  28   ? 148.006 184.585 230.513 1.00 343.32 ?  -59  DT  I O4    1 
ATOM   6589  C  C5    . DT  I 6  28   ? 146.589 182.829 229.781 1.00 351.61 ?  -59  DT  I C5    1 
ATOM   6590  C  C7    . DT  I 6  28   ? 146.737 182.044 231.045 1.00 353.24 ?  -59  DT  I C7    1 
ATOM   6591  C  C6    . DT  I 6  28   ? 145.835 182.418 228.753 1.00 415.72 ?  -59  DT  I C6    1 
ATOM   6592  P  P     . DG  I 6  29   ? 143.547 179.553 223.652 1.00 440.00 ?  -58  DG  I P     1 
ATOM   6593  O  OP1   . DG  I 6  29   ? 142.203 179.184 223.140 1.00 440.00 ?  -58  DG  I OP1   1 
ATOM   6594  O  OP2   . DG  I 6  29   ? 144.291 178.602 224.515 1.00 440.00 -1 -58  DG  I OP2   1 
ATOM   6595  O  "O5'" . DG  I 6  29   ? 144.467 179.935 222.409 1.00 440.00 ?  -58  DG  I "O5'" 1 
ATOM   6596  C  "C5'" . DG  I 6  29   ? 144.341 181.216 221.762 1.00 440.00 ?  -58  DG  I "C5'" 1 
ATOM   6597  C  "C4'" . DG  I 6  29   ? 145.707 181.759 221.412 1.00 440.00 ?  -58  DG  I "C4'" 1 
ATOM   6598  O  "O4'" . DG  I 6  29   ? 146.393 182.156 222.623 1.00 440.00 ?  -58  DG  I "O4'" 1 
ATOM   6599  C  "C3'" . DG  I 6  29   ? 146.632 180.762 220.715 1.00 440.00 ?  -58  DG  I "C3'" 1 
ATOM   6600  O  "O3'" . DG  I 6  29   ? 147.464 181.438 219.768 1.00 440.00 ?  -58  DG  I "O3'" 1 
ATOM   6601  C  "C2'" . DG  I 6  29   ? 147.463 180.207 221.855 1.00 440.00 ?  -58  DG  I "C2'" 1 
ATOM   6602  C  "C1'" . DG  I 6  29   ? 147.591 181.407 222.778 1.00 440.00 ?  -58  DG  I "C1'" 1 
ATOM   6603  N  N9    . DG  I 6  29   ? 147.725 181.065 224.190 1.00 20.00  ?  -58  DG  I N9    1 
ATOM   6604  C  C8    . DG  I 6  29   ? 147.461 179.851 224.777 1.00 20.00  ?  -58  DG  I C8    1 
ATOM   6605  N  N7    . DG  I 6  29   ? 147.674 179.847 226.064 1.00 20.00  ?  -58  DG  I N7    1 
ATOM   6606  C  C5    . DG  I 6  29   ? 148.105 181.136 226.346 1.00 20.00  ?  -58  DG  I C5    1 
ATOM   6607  C  C6    . DG  I 6  29   ? 148.487 181.730 227.582 1.00 20.00  ?  -58  DG  I C6    1 
ATOM   6608  O  O6    . DG  I 6  29   ? 148.522 181.216 228.707 1.00 20.00  ?  -58  DG  I O6    1 
ATOM   6609  N  N1    . DG  I 6  29   ? 148.857 183.062 227.418 1.00 20.00  ?  -58  DG  I N1    1 
ATOM   6610  C  C2    . DG  I 6  29   ? 148.859 183.737 226.219 1.00 20.00  ?  -58  DG  I C2    1 
ATOM   6611  N  N2    . DG  I 6  29   ? 149.248 185.019 226.265 1.00 20.00  ?  -58  DG  I N2    1 
ATOM   6612  N  N3    . DG  I 6  29   ? 148.504 183.195 225.062 1.00 20.00  ?  -58  DG  I N3    1 
ATOM   6613  C  C4    . DG  I 6  29   ? 148.141 181.901 225.199 1.00 20.00  ?  -58  DG  I C4    1 
ATOM   6614  P  P     . DC  I 6  30   ? 147.999 180.663 218.475 1.00 440.00 ?  -57  DC  I P     1 
ATOM   6615  O  OP1   . DC  I 6  30   ? 147.287 181.203 217.288 1.00 440.00 ?  -57  DC  I OP1   1 
ATOM   6616  O  OP2   . DC  I 6  30   ? 147.951 179.206 218.759 1.00 440.00 -1 -57  DC  I OP2   1 
ATOM   6617  O  "O5'" . DC  I 6  30   ? 149.525 181.112 218.391 1.00 440.00 ?  -57  DC  I "O5'" 1 
ATOM   6618  C  "C5'" . DC  I 6  30   ? 149.883 182.504 218.325 1.00 440.00 ?  -57  DC  I "C5'" 1 
ATOM   6619  C  "C4'" . DC  I 6  30   ? 151.318 182.696 218.760 1.00 440.00 ?  -57  DC  I "C4'" 1 
ATOM   6620  O  "O4'" . DC  I 6  30   ? 151.418 182.489 220.189 1.00 440.00 ?  -57  DC  I "O4'" 1 
ATOM   6621  C  "C3'" . DC  I 6  30   ? 152.313 181.726 218.126 1.00 440.00 ?  -57  DC  I "C3'" 1 
ATOM   6622  O  "O3'" . DC  I 6  30   ? 153.570 182.374 217.912 1.00 440.00 ?  -57  DC  I "O3'" 1 
ATOM   6623  C  "C2'" . DC  I 6  30   ? 152.447 180.635 219.173 1.00 440.00 ?  -57  DC  I "C2'" 1 
ATOM   6624  C  "C1'" . DC  I 6  30   ? 152.299 181.411 220.471 1.00 440.00 ?  -57  DC  I "C1'" 1 
ATOM   6625  N  N1    . DC  I 6  30   ? 151.719 180.632 221.575 1.00 20.00  ?  -57  DC  I N1    1 
ATOM   6626  C  C2    . DC  I 6  30   ? 152.141 180.896 222.880 1.00 20.00  ?  -57  DC  I C2    1 
ATOM   6627  O  O2    . DC  I 6  30   ? 152.994 181.776 223.067 1.00 20.00  ?  -57  DC  I O2    1 
ATOM   6628  N  N3    . DC  I 6  30   ? 151.614 180.185 223.903 1.00 20.00  ?  -57  DC  I N3    1 
ATOM   6629  C  C4    . DC  I 6  30   ? 150.698 179.244 223.658 1.00 20.00  ?  -57  DC  I C4    1 
ATOM   6630  N  N4    . DC  I 6  30   ? 150.203 178.567 224.697 1.00 20.00  ?  -57  DC  I N4    1 
ATOM   6631  C  C5    . DC  I 6  30   ? 150.248 178.956 222.337 1.00 20.00  ?  -57  DC  I C5    1 
ATOM   6632  C  C6    . DC  I 6  30   ? 150.781 179.668 221.335 1.00 20.00  ?  -57  DC  I C6    1 
ATOM   6633  P  P     . DC  I 6  31   ? 154.542 181.867 216.746 1.00 440.00 ?  -56  DC  I P     1 
ATOM   6634  O  OP1   . DC  I 6  31   ? 154.280 182.689 215.538 1.00 440.00 ?  -56  DC  I OP1   1 
ATOM   6635  O  OP2   . DC  I 6  31   ? 154.432 180.388 216.667 1.00 440.00 -1 -56  DC  I OP2   1 
ATOM   6636  O  "O5'" . DC  I 6  31   ? 155.989 182.237 217.299 1.00 440.00 ?  -56  DC  I "O5'" 1 
ATOM   6637  C  "C5'" . DC  I 6  31   ? 156.168 183.308 218.245 1.00 440.00 ?  -56  DC  I "C5'" 1 
ATOM   6638  C  "C4'" . DC  I 6  31   ? 157.282 182.970 219.210 1.00 440.00 ?  -56  DC  I "C4'" 1 
ATOM   6639  O  "O4'" . DC  I 6  31   ? 156.731 182.284 220.358 1.00 440.00 ?  -56  DC  I "O4'" 1 
ATOM   6640  C  "C3'" . DC  I 6  31   ? 158.354 182.040 218.645 1.00 440.00 ?  -56  DC  I "C3'" 1 
ATOM   6641  O  "O3'" . DC  I 6  31   ? 159.631 182.360 219.208 1.00 386.03 ?  -56  DC  I "O3'" 1 
ATOM   6642  C  "C2'" . DC  I 6  31   ? 157.897 180.669 219.104 1.00 391.11 ?  -56  DC  I "C2'" 1 
ATOM   6643  C  "C1'" . DC  I 6  31   ? 157.266 180.971 220.454 1.00 440.00 ?  -56  DC  I "C1'" 1 
ATOM   6644  N  N1    . DC  I 6  31   ? 156.169 180.065 220.822 1.00 20.00  ?  -56  DC  I N1    1 
ATOM   6645  C  C2    . DC  I 6  31   ? 155.947 179.790 222.174 1.00 20.00  ?  -56  DC  I C2    1 
ATOM   6646  O  O2    . DC  I 6  31   ? 156.682 180.320 223.021 1.00 20.00  ?  -56  DC  I O2    1 
ATOM   6647  N  N3    . DC  I 6  31   ? 154.940 178.958 222.524 1.00 20.00  ?  -56  DC  I N3    1 
ATOM   6648  C  C4    . DC  I 6  31   ? 154.171 178.409 221.580 1.00 20.00  ?  -56  DC  I C4    1 
ATOM   6649  N  N4    . DC  I 6  31   ? 153.188 177.593 221.970 1.00 20.00  ?  -56  DC  I N4    1 
ATOM   6650  C  C5    . DC  I 6  31   ? 154.376 178.671 220.195 1.00 20.00  ?  -56  DC  I C5    1 
ATOM   6651  C  C6    . DC  I 6  31   ? 155.376 179.497 219.864 1.00 20.00  ?  -56  DC  I C6    1 
ATOM   6652  P  P     . DG  I 6  32   ? 160.963 182.124 218.353 1.00 303.14 ?  -55  DG  I P     1 
ATOM   6653  O  OP1   . DG  I 6  32   ? 161.166 183.309 217.482 1.00 363.75 ?  -55  DG  I OP1   1 
ATOM   6654  O  OP2   . DG  I 6  32   ? 160.888 180.771 217.749 1.00 220.85 -1 -55  DG  I OP2   1 
ATOM   6655  O  "O5'" . DG  I 6  32   ? 162.104 182.120 219.465 1.00 303.78 ?  -55  DG  I "O5'" 1 
ATOM   6656  C  "C5'" . DG  I 6  32   ? 161.793 182.412 220.841 1.00 328.11 ?  -55  DG  I "C5'" 1 
ATOM   6657  C  "C4'" . DG  I 6  32   ? 162.321 181.316 221.738 1.00 296.24 ?  -55  DG  I "C4'" 1 
ATOM   6658  O  "O4'" . DG  I 6  32   ? 161.260 180.374 222.025 1.00 321.46 ?  -55  DG  I "O4'" 1 
ATOM   6659  C  "C3'" . DG  I 6  32   ? 163.463 180.495 221.138 1.00 267.81 ?  -55  DG  I "C3'" 1 
ATOM   6660  O  "O3'" . DG  I 6  32   ? 164.403 180.141 222.157 1.00 272.71 ?  -55  DG  I "O3'" 1 
ATOM   6661  C  "C2'" . DG  I 6  32   ? 162.762 179.258 220.608 1.00 229.10 ?  -55  DG  I "C2'" 1 
ATOM   6662  C  "C1'" . DG  I 6  32   ? 161.640 179.069 221.614 1.00 304.54 ?  -55  DG  I "C1'" 1 
ATOM   6663  N  N9    . DG  I 6  32   ? 160.457 178.408 221.075 1.00 20.00  ?  -55  DG  I N9    1 
ATOM   6664  C  C8    . DG  I 6  32   ? 160.171 178.170 219.752 1.00 20.00  ?  -55  DG  I C8    1 
ATOM   6665  N  N7    . DG  I 6  32   ? 159.032 177.556 219.576 1.00 20.00  ?  -55  DG  I N7    1 
ATOM   6666  C  C5    . DG  I 6  32   ? 158.536 177.377 220.860 1.00 20.00  ?  -55  DG  I C5    1 
ATOM   6667  C  C6    . DG  I 6  32   ? 157.328 176.768 221.305 1.00 20.00  ?  -55  DG  I C6    1 
ATOM   6668  O  O6    . DG  I 6  32   ? 156.432 176.249 220.628 1.00 20.00  ?  -55  DG  I O6    1 
ATOM   6669  N  N1    . DG  I 6  32   ? 157.219 176.801 222.692 1.00 20.00  ?  -55  DG  I N1    1 
ATOM   6670  C  C2    . DG  I 6  32   ? 158.149 177.349 223.542 1.00 20.00  ?  -55  DG  I C2    1 
ATOM   6671  N  N2    . DG  I 6  32   ? 157.863 177.283 224.851 1.00 20.00  ?  -55  DG  I N2    1 
ATOM   6672  N  N3    . DG  I 6  32   ? 159.276 177.919 223.141 1.00 20.00  ?  -55  DG  I N3    1 
ATOM   6673  C  C4    . DG  I 6  32   ? 159.404 177.898 221.797 1.00 20.00  ?  -55  DG  I C4    1 
ATOM   6674  P  P     . DA  I 6  33   ? 165.935 179.883 221.776 1.00 270.26 ?  -54  DA  I P     1 
ATOM   6675  O  OP1   . DA  I 6  33   ? 166.645 181.187 221.817 1.00 168.04 ?  -54  DA  I OP1   1 
ATOM   6676  O  OP2   . DA  I 6  33   ? 165.969 179.068 220.536 1.00 218.28 -1 -54  DA  I OP2   1 
ATOM   6677  O  "O5'" . DA  I 6  33   ? 166.459 178.989 222.984 1.00 307.58 ?  -54  DA  I "O5'" 1 
ATOM   6678  C  "C5'" . DA  I 6  33   ? 166.776 179.580 224.259 1.00 248.72 ?  -54  DA  I "C5'" 1 
ATOM   6679  C  "C4'" . DA  I 6  33   ? 166.280 178.698 225.381 1.00 316.75 ?  -54  DA  I "C4'" 1 
ATOM   6680  O  "O4'" . DA  I 6  33   ? 164.948 178.224 225.069 1.00 356.04 ?  -54  DA  I "O4'" 1 
ATOM   6681  C  "C3'" . DA  I 6  33   ? 167.123 177.448 225.633 1.00 339.74 ?  -54  DA  I "C3'" 1 
ATOM   6682  O  "O3'" . DA  I 6  33   ? 167.180 177.162 227.034 1.00 400.00 ?  -54  DA  I "O3'" 1 
ATOM   6683  C  "C2'" . DA  I 6  33   ? 166.365 176.361 224.895 1.00 241.39 ?  -54  DA  I "C2'" 1 
ATOM   6684  C  "C1'" . DA  I 6  33   ? 164.922 176.804 225.061 1.00 275.96 ?  -54  DA  I "C1'" 1 
ATOM   6685  N  N9    . DA  I 6  33   ? 164.035 176.380 223.978 1.00 20.00  ?  -54  DA  I N9    1 
ATOM   6686  C  C8    . DA  I 6  33   ? 164.281 176.412 222.628 1.00 20.00  ?  -54  DA  I C8    1 
ATOM   6687  N  N7    . DA  I 6  33   ? 163.289 175.963 221.899 1.00 20.00  ?  -54  DA  I N7    1 
ATOM   6688  C  C5    . DA  I 6  33   ? 162.323 175.612 222.832 1.00 20.00  ?  -54  DA  I C5    1 
ATOM   6689  C  C6    . DA  I 6  33   ? 161.033 175.069 222.699 1.00 20.00  ?  -54  DA  I C6    1 
ATOM   6690  N  N6    . DA  I 6  33   ? 160.470 174.775 221.525 1.00 20.00  ?  -54  DA  I N6    1 
ATOM   6691  N  N1    . DA  I 6  33   ? 160.331 174.836 223.830 1.00 20.00  ?  -54  DA  I N1    1 
ATOM   6692  C  C2    . DA  I 6  33   ? 160.896 175.132 225.007 1.00 20.00  ?  -54  DA  I C2    1 
ATOM   6693  N  N3    . DA  I 6  33   ? 162.099 175.644 225.260 1.00 20.00  ?  -54  DA  I N3    1 
ATOM   6694  C  C4    . DA  I 6  33   ? 162.770 175.863 224.117 1.00 20.00  ?  -54  DA  I C4    1 
ATOM   6695  P  P     . DG  I 6  34   ? 168.149 176.011 227.576 1.00 385.96 ?  -53  DG  I P     1 
ATOM   6696  O  OP1   . DG  I 6  34   ? 168.713 176.459 228.875 1.00 435.91 ?  -53  DG  I OP1   1 
ATOM   6697  O  OP2   . DG  I 6  34   ? 169.062 175.621 226.473 1.00 220.79 -1 -53  DG  I OP2   1 
ATOM   6698  O  "O5'" . DG  I 6  34   ? 167.149 174.802 227.855 1.00 373.40 ?  -53  DG  I "O5'" 1 
ATOM   6699  C  "C5'" . DG  I 6  34   ? 165.880 175.025 228.499 1.00 352.85 ?  -53  DG  I "C5'" 1 
ATOM   6700  C  "C4'" . DG  I 6  34   ? 165.177 173.709 228.735 1.00 315.57 ?  -53  DG  I "C4'" 1 
ATOM   6701  O  "O4'" . DG  I 6  34   ? 164.324 173.409 227.604 1.00 247.51 ?  -53  DG  I "O4'" 1 
ATOM   6702  C  "C3'" . DG  I 6  34   ? 166.107 172.505 228.888 1.00 334.46 ?  -53  DG  I "C3'" 1 
ATOM   6703  O  "O3'" . DG  I 6  34   ? 165.555 171.569 229.818 1.00 354.85 ?  -53  DG  I "O3'" 1 
ATOM   6704  C  "C2'" . DG  I 6  34   ? 166.135 171.913 227.492 1.00 387.54 ?  -53  DG  I "C2'" 1 
ATOM   6705  C  "C1'" . DG  I 6  34   ? 164.725 172.189 226.995 1.00 309.98 ?  -53  DG  I "C1'" 1 
ATOM   6706  N  N9    . DG  I 6  34   ? 164.622 172.358 225.550 1.00 20.00  ?  -53  DG  I N9    1 
ATOM   6707  C  C8    . DG  I 6  34   ? 165.615 172.762 224.690 1.00 20.00  ?  -53  DG  I C8    1 
ATOM   6708  N  N7    . DG  I 6  34   ? 165.223 172.820 223.445 1.00 20.00  ?  -53  DG  I N7    1 
ATOM   6709  C  C5    . DG  I 6  34   ? 163.891 172.431 223.486 1.00 20.00  ?  -53  DG  I C5    1 
ATOM   6710  C  C6    . DG  I 6  34   ? 162.938 172.299 222.438 1.00 20.00  ?  -53  DG  I C6    1 
ATOM   6711  O  O6    . DG  I 6  34   ? 163.088 172.509 221.227 1.00 20.00  ?  -53  DG  I O6    1 
ATOM   6712  N  N1    . DG  I 6  34   ? 161.702 171.877 222.919 1.00 20.00  ?  -53  DG  I N1    1 
ATOM   6713  C  C2    . DG  I 6  34   ? 161.418 171.614 224.238 1.00 20.00  ?  -53  DG  I C2    1 
ATOM   6714  N  N2    . DG  I 6  34   ? 160.166 171.216 224.505 1.00 20.00  ?  -53  DG  I N2    1 
ATOM   6715  N  N3    . DG  I 6  34   ? 162.298 171.732 225.224 1.00 20.00  ?  -53  DG  I N3    1 
ATOM   6716  C  C4    . DG  I 6  34   ? 163.505 172.141 224.778 1.00 20.00  ?  -53  DG  I C4    1 
ATOM   6717  P  P     . DG  I 6  35   ? 166.398 171.131 231.105 1.00 396.02 ?  -52  DG  I P     1 
ATOM   6718  O  OP1   . DG  I 6  35   ? 165.776 171.759 232.298 1.00 420.44 ?  -52  DG  I OP1   1 
ATOM   6719  O  OP2   . DG  I 6  35   ? 167.835 171.366 230.814 1.00 344.83 -1 -52  DG  I OP2   1 
ATOM   6720  O  "O5'" . DG  I 6  35   ? 166.149 169.559 231.179 1.00 392.83 ?  -52  DG  I "O5'" 1 
ATOM   6721  C  "C5'" . DG  I 6  35   ? 164.818 169.017 231.075 1.00 376.35 ?  -52  DG  I "C5'" 1 
ATOM   6722  C  "C4'" . DG  I 6  35   ? 164.837 167.744 230.262 1.00 323.31 ?  -52  DG  I "C4'" 1 
ATOM   6723  O  "O4'" . DG  I 6  35   ? 164.087 167.938 229.048 1.00 235.09 ?  -52  DG  I "O4'" 1 
ATOM   6724  C  "C3'" . DG  I 6  35   ? 166.222 167.300 229.803 1.00 326.25 ?  -52  DG  I "C3'" 1 
ATOM   6725  O  "O3'" . DG  I 6  35   ? 166.786 166.393 230.756 1.00 348.15 ?  -52  DG  I "O3'" 1 
ATOM   6726  C  "C2'" . DG  I 6  35   ? 165.950 166.580 228.491 1.00 218.70 ?  -52  DG  I "C2'" 1 
ATOM   6727  C  "C1'" . DG  I 6  35   ? 164.553 167.029 228.063 1.00 215.94 ?  -52  DG  I "C1'" 1 
ATOM   6728  N  N9    . DG  I 6  35   ? 164.507 167.707 226.773 1.00 249.72 ?  -52  DG  I N9    1 
ATOM   6729  C  C8    . DG  I 6  35   ? 165.438 168.579 226.262 1.00 292.93 ?  -52  DG  I C8    1 
ATOM   6730  N  N7    . DG  I 6  35   ? 165.124 169.029 225.077 1.00 381.74 ?  -52  DG  I N7    1 
ATOM   6731  C  C5    . DG  I 6  35   ? 163.913 168.416 224.787 1.00 412.04 ?  -52  DG  I C5    1 
ATOM   6732  C  C6    . DG  I 6  35   ? 163.081 168.517 223.637 1.00 440.00 ?  -52  DG  I C6    1 
ATOM   6733  O  O6    . DG  I 6  35   ? 163.258 169.189 222.614 1.00 440.00 ?  -52  DG  I O6    1 
ATOM   6734  N  N1    . DG  I 6  35   ? 161.942 167.726 223.756 1.00 440.00 ?  -52  DG  I N1    1 
ATOM   6735  C  C2    . DG  I 6  35   ? 161.640 166.939 224.843 1.00 440.00 ?  -52  DG  I C2    1 
ATOM   6736  N  N2    . DG  I 6  35   ? 160.492 166.249 224.771 1.00 440.00 ?  -52  DG  I N2    1 
ATOM   6737  N  N3    . DG  I 6  35   ? 162.406 166.837 225.921 1.00 440.00 ?  -52  DG  I N3    1 
ATOM   6738  C  C4    . DG  I 6  35   ? 163.518 167.597 225.825 1.00 342.64 ?  -52  DG  I C4    1 
ATOM   6739  P  P     . DC  I 6  36   ? 165.970 165.089 231.199 1.00 344.32 ?  -51  DC  I P     1 
ATOM   6740  O  OP1   . DC  I 6  36   ? 165.035 165.478 232.285 1.00 360.00 ?  -51  DC  I OP1   1 
ATOM   6741  O  OP2   . DC  I 6  36   ? 166.945 163.992 231.426 1.00 227.39 -1 -51  DC  I OP2   1 
ATOM   6742  O  "O5'" . DC  I 6  36   ? 165.112 164.741 229.902 1.00 308.19 ?  -51  DC  I "O5'" 1 
ATOM   6743  C  "C5'" . DC  I 6  36   ? 163.735 164.336 230.015 1.00 284.84 ?  -51  DC  I "C5'" 1 
ATOM   6744  C  "C4'" . DC  I 6  36   ? 163.433 163.222 229.039 1.00 275.73 ?  -51  DC  I "C4'" 1 
ATOM   6745  O  "O4'" . DC  I 6  36   ? 163.441 163.747 227.690 1.00 208.76 ?  -51  DC  I "O4'" 1 
ATOM   6746  C  "C3'" . DC  I 6  36   ? 164.439 162.072 229.047 1.00 321.59 ?  -51  DC  I "C3'" 1 
ATOM   6747  O  "O3'" . DC  I 6  36   ? 163.773 160.828 228.807 1.00 339.62 ?  -51  DC  I "O3'" 1 
ATOM   6748  C  "C2'" . DC  I 6  36   ? 165.364 162.413 227.894 1.00 319.35 ?  -51  DC  I "C2'" 1 
ATOM   6749  C  "C1'" . DC  I 6  36   ? 164.418 163.076 226.908 1.00 209.57 ?  -51  DC  I "C1'" 1 
ATOM   6750  N  N1    . DC  I 6  36   ? 165.056 164.070 226.034 1.00 225.78 ?  -51  DC  I N1    1 
ATOM   6751  C  C2    . DC  I 6  36   ? 164.423 164.421 224.839 1.00 294.25 ?  -51  DC  I C2    1 
ATOM   6752  O  O2    . DC  I 6  36   ? 163.344 163.882 224.552 1.00 313.18 ?  -51  DC  I O2    1 
ATOM   6753  N  N3    . DC  I 6  36   ? 165.002 165.336 224.028 1.00 399.27 ?  -51  DC  I N3    1 
ATOM   6754  C  C4    . DC  I 6  36   ? 166.165 165.892 224.374 1.00 422.74 ?  -51  DC  I C4    1 
ATOM   6755  N  N4    . DC  I 6  36   ? 166.701 166.791 223.544 1.00 342.52 ?  -51  DC  I N4    1 
ATOM   6756  C  C5    . DC  I 6  36   ? 166.832 165.552 225.587 1.00 431.04 ?  -51  DC  I C5    1 
ATOM   6757  C  C6    . DC  I 6  36   ? 166.246 164.645 226.380 1.00 344.18 ?  -51  DC  I C6    1 
ATOM   6758  P  P     . DC  I 6  37   ? 164.475 159.451 229.222 1.00 305.56 ?  -50  DC  I P     1 
ATOM   6759  O  OP1   . DC  I 6  37   ? 163.569 158.737 230.159 1.00 218.29 ?  -50  DC  I OP1   1 
ATOM   6760  O  OP2   . DC  I 6  37   ? 165.869 159.752 229.635 1.00 320.00 -1 -50  DC  I OP2   1 
ATOM   6761  O  "O5'" . DC  I 6  37   ? 164.517 158.641 227.851 1.00 272.59 ?  -50  DC  I "O5'" 1 
ATOM   6762  C  "C5'" . DC  I 6  37   ? 164.189 159.280 226.604 1.00 310.52 ?  -50  DC  I "C5'" 1 
ATOM   6763  C  "C4'" . DC  I 6  37   ? 164.812 158.526 225.452 1.00 351.21 ?  -50  DC  I "C4'" 1 
ATOM   6764  O  "O4'" . DC  I 6  37   ? 165.316 159.469 224.476 1.00 269.88 ?  -50  DC  I "O4'" 1 
ATOM   6765  C  "C3'" . DC  I 6  37   ? 166.000 157.645 225.833 1.00 381.30 ?  -50  DC  I "C3'" 1 
ATOM   6766  O  "O3'" . DC  I 6  37   ? 166.038 156.481 225.003 1.00 374.90 ?  -50  DC  I "O3'" 1 
ATOM   6767  C  "C2'" . DC  I 6  37   ? 167.193 158.534 225.538 1.00 384.54 ?  -50  DC  I "C2'" 1 
ATOM   6768  C  "C1'" . DC  I 6  37   ? 166.719 159.307 224.318 1.00 330.89 ?  -50  DC  I "C1'" 1 
ATOM   6769  N  N1    . DC  I 6  37   ? 167.313 160.644 224.182 1.00 427.76 ?  -50  DC  I N1    1 
ATOM   6770  C  C2    . DC  I 6  37   ? 167.000 161.409 223.055 1.00 440.00 ?  -50  DC  I C2    1 
ATOM   6771  O  O2    . DC  I 6  37   ? 166.231 160.935 222.206 1.00 336.59 ?  -50  DC  I O2    1 
ATOM   6772  N  N3    . DC  I 6  37   ? 167.542 162.641 222.921 1.00 440.00 ?  -50  DC  I N3    1 
ATOM   6773  C  C4    . DC  I 6  37   ? 168.366 163.113 223.858 1.00 440.00 ?  -50  DC  I C4    1 
ATOM   6774  N  N4    . DC  I 6  37   ? 168.879 164.333 223.685 1.00 440.00 ?  -50  DC  I N4    1 
ATOM   6775  C  C5    . DC  I 6  37   ? 168.703 162.355 225.017 1.00 440.00 ?  -50  DC  I C5    1 
ATOM   6776  C  C6    . DC  I 6  37   ? 168.159 161.136 225.137 1.00 440.00 ?  -50  DC  I C6    1 
ATOM   6777  P  P     . DG  I 6  38   ? 165.352 155.123 225.494 1.00 152.69 ?  -49  DG  I P     1 
ATOM   6778  O  OP1   . DG  I 6  38   ? 163.941 155.423 225.847 1.00 152.50 -1 -49  DG  I OP1   1 
ATOM   6779  O  OP2   . DG  I 6  38   ? 166.244 154.494 226.500 1.00 152.87 ?  -49  DG  I OP2   1 
ATOM   6780  O  "O5'" . DG  I 6  38   ? 165.363 154.221 224.181 1.00 151.71 ?  -49  DG  I "O5'" 1 
ATOM   6781  C  "C5'" . DG  I 6  38   ? 165.173 154.808 222.879 1.00 151.19 ?  -49  DG  I "C5'" 1 
ATOM   6782  C  "C4'" . DG  I 6  38   ? 166.265 154.357 221.938 1.00 151.07 ?  -49  DG  I "C4'" 1 
ATOM   6783  O  "O4'" . DG  I 6  38   ? 166.955 155.516 221.411 1.00 151.15 ?  -49  DG  I "O4'" 1 
ATOM   6784  C  "C3'" . DG  I 6  38   ? 167.344 153.487 222.583 1.00 150.62 ?  -49  DG  I "C3'" 1 
ATOM   6785  O  "O3'" . DG  I 6  38   ? 167.824 152.521 221.642 1.00 149.80 ?  -49  DG  I "O3'" 1 
ATOM   6786  C  "C2'" . DG  I 6  38   ? 168.441 154.483 222.907 1.00 150.76 ?  -49  DG  I "C2'" 1 
ATOM   6787  C  "C1'" . DG  I 6  38   ? 168.335 155.457 221.746 1.00 150.93 ?  -49  DG  I "C1'" 1 
ATOM   6788  N  N9    . DG  I 6  38   ? 168.778 156.811 222.054 1.00 150.91 ?  -49  DG  I N9    1 
ATOM   6789  C  C8    . DG  I 6  38   ? 169.188 157.292 223.275 1.00 151.02 ?  -49  DG  I C8    1 
ATOM   6790  N  N7    . DG  I 6  38   ? 169.529 158.551 223.242 1.00 151.24 ?  -49  DG  I N7    1 
ATOM   6791  C  C5    . DG  I 6  38   ? 169.335 158.925 221.919 1.00 151.14 ?  -49  DG  I C5    1 
ATOM   6792  C  C6    . DG  I 6  38   ? 169.539 160.180 221.277 1.00 150.99 ?  -49  DG  I C6    1 
ATOM   6793  O  O6    . DG  I 6  38   ? 169.943 161.241 221.768 1.00 150.87 ?  -49  DG  I O6    1 
ATOM   6794  N  N1    . DG  I 6  38   ? 169.217 160.121 219.924 1.00 151.04 ?  -49  DG  I N1    1 
ATOM   6795  C  C2    . DG  I 6  38   ? 168.759 159.000 219.272 1.00 151.06 ?  -49  DG  I C2    1 
ATOM   6796  N  N2    . DG  I 6  38   ? 168.504 159.142 217.963 1.00 150.94 ?  -49  DG  I N2    1 
ATOM   6797  N  N3    . DG  I 6  38   ? 168.566 157.827 219.858 1.00 151.21 ?  -49  DG  I N3    1 
ATOM   6798  C  C4    . DG  I 6  38   ? 168.873 157.862 221.172 1.00 151.16 ?  -49  DG  I C4    1 
ATOM   6799  P  P     . DC  I 6  39   ? 167.184 151.056 221.600 1.00 149.28 ?  -48  DC  I P     1 
ATOM   6800  O  OP1   . DC  I 6  39   ? 165.706 151.198 221.625 1.00 149.08 ?  -48  DC  I OP1   1 
ATOM   6801  O  OP2   . DC  I 6  39   ? 167.861 150.229 222.630 1.00 149.21 -1 -48  DC  I OP2   1 
ATOM   6802  O  "O5'" . DC  I 6  39   ? 167.614 150.521 220.162 1.00 148.28 ?  -48  DC  I "O5'" 1 
ATOM   6803  C  "C5'" . DC  I 6  39   ? 166.900 150.927 218.978 1.00 146.77 ?  -48  DC  I "C5'" 1 
ATOM   6804  C  "C4'" . DC  I 6  39   ? 167.856 151.502 217.959 1.00 145.42 ?  -48  DC  I "C4'" 1 
ATOM   6805  O  "O4'" . DC  I 6  39   ? 168.481 152.692 218.499 1.00 145.32 ?  -48  DC  I "O4'" 1 
ATOM   6806  C  "C3'" . DC  I 6  39   ? 168.999 150.570 217.553 1.00 144.47 ?  -48  DC  I "C3'" 1 
ATOM   6807  O  "O3'" . DC  I 6  39   ? 169.260 150.686 216.151 1.00 142.62 ?  -48  DC  I "O3'" 1 
ATOM   6808  C  "C2'" . DC  I 6  39   ? 170.178 151.084 218.359 1.00 144.91 ?  -48  DC  I "C2'" 1 
ATOM   6809  C  "C1'" . DC  I 6  39   ? 169.893 152.574 218.426 1.00 145.40 ?  -48  DC  I "C1'" 1 
ATOM   6810  N  N1    . DC  I 6  39   ? 170.463 153.247 219.602 1.00 145.60 ?  -48  DC  I N1    1 
ATOM   6811  C  C2    . DC  I 6  39   ? 170.718 154.619 219.534 1.00 145.98 ?  -48  DC  I C2    1 
ATOM   6812  O  O2    . DC  I 6  39   ? 170.454 155.225 218.485 1.00 145.92 ?  -48  DC  I O2    1 
ATOM   6813  N  N3    . DC  I 6  39   ? 171.243 155.248 220.610 1.00 146.07 ?  -48  DC  I N3    1 
ATOM   6814  C  C4    . DC  I 6  39   ? 171.512 154.557 221.720 1.00 145.69 ?  -48  DC  I C4    1 
ATOM   6815  N  N4    . DC  I 6  39   ? 172.031 155.218 222.759 1.00 145.63 ?  -48  DC  I N4    1 
ATOM   6816  C  C5    . DC  I 6  39   ? 171.264 153.156 221.816 1.00 145.64 ?  -48  DC  I C5    1 
ATOM   6817  C  C6    . DC  I 6  39   ? 170.743 152.548 220.743 1.00 145.56 ?  -48  DC  I C6    1 
ATOM   6818  P  P     . DT  I 6  40   ? 170.389 149.779 215.470 1.00 140.51 ?  -47  DT  I P     1 
ATOM   6819  O  OP1   . DT  I 6  40   ? 170.011 149.562 214.051 1.00 140.63 ?  -47  DT  I OP1   1 
ATOM   6820  O  OP2   . DT  I 6  40   ? 170.635 148.610 216.352 1.00 140.32 -1 -47  DT  I OP2   1 
ATOM   6821  O  "O5'" . DT  I 6  40   ? 171.676 150.717 215.506 1.00 138.88 ?  -47  DT  I "O5'" 1 
ATOM   6822  C  "C5'" . DT  I 6  40   ? 171.567 152.132 215.256 1.00 135.88 ?  -47  DT  I "C5'" 1 
ATOM   6823  C  "C4'" . DT  I 6  40   ? 172.903 152.689 214.823 1.00 134.09 ?  -47  DT  I "C4'" 1 
ATOM   6824  O  "O4'" . DT  I 6  40   ? 173.418 153.561 215.858 1.00 134.06 ?  -47  DT  I "O4'" 1 
ATOM   6825  C  "C3'" . DT  I 6  40   ? 173.987 151.640 214.585 1.00 132.87 ?  -47  DT  I "C3'" 1 
ATOM   6826  O  "O3'" . DT  I 6  40   ? 174.852 152.055 213.523 1.00 131.02 ?  -47  DT  I "O3'" 1 
ATOM   6827  C  "C2'" . DT  I 6  40   ? 174.743 151.621 215.901 1.00 133.46 ?  -47  DT  I "C2'" 1 
ATOM   6828  C  "C1'" . DT  I 6  40   ? 174.665 153.075 216.333 1.00 134.07 ?  -47  DT  I "C1'" 1 
ATOM   6829  N  N1    . DT  I 6  40   ? 174.700 153.276 217.793 1.00 134.24 ?  -47  DT  I N1    1 
ATOM   6830  C  C2    . DT  I 6  40   ? 175.040 154.520 218.271 1.00 134.24 ?  -47  DT  I C2    1 
ATOM   6831  O  O2    . DT  I 6  40   ? 175.310 155.463 217.544 1.00 134.12 ?  -47  DT  I O2    1 
ATOM   6832  N  N3    . DT  I 6  40   ? 175.048 154.624 219.639 1.00 134.35 ?  -47  DT  I N3    1 
ATOM   6833  C  C4    . DT  I 6  40   ? 174.760 153.629 220.554 1.00 134.25 ?  -47  DT  I C4    1 
ATOM   6834  O  O4    . DT  I 6  40   ? 174.810 153.871 221.758 1.00 134.02 ?  -47  DT  I O4    1 
ATOM   6835  C  C5    . DT  I 6  40   ? 174.413 152.349 219.983 1.00 134.10 ?  -47  DT  I C5    1 
ATOM   6836  C  C7    . DT  I 6  40   ? 174.084 151.210 220.896 1.00 134.01 ?  -47  DT  I C7    1 
ATOM   6837  C  C6    . DT  I 6  40   ? 174.401 152.238 218.648 1.00 133.92 ?  -47  DT  I C6    1 
ATOM   6838  P  P     . DC  I 6  41   ? 174.656 151.462 212.051 1.00 129.34 ?  -46  DC  I P     1 
ATOM   6839  O  OP1   . DC  I 6  41   ? 173.214 151.554 211.707 1.00 128.91 ?  -46  DC  I OP1   1 
ATOM   6840  O  OP2   . DC  I 6  41   ? 175.344 150.148 211.989 1.00 128.78 -1 -46  DC  I OP2   1 
ATOM   6841  O  "O5'" . DC  I 6  41   ? 175.456 152.495 211.140 1.00 127.45 ?  -46  DC  I "O5'" 1 
ATOM   6842  C  "C5'" . DC  I 6  41   ? 175.189 153.908 211.216 1.00 125.07 ?  -46  DC  I "C5'" 1 
ATOM   6843  C  "C4'" . DC  I 6  41   ? 176.435 154.656 211.630 1.00 123.49 ?  -46  DC  I "C4'" 1 
ATOM   6844  O  "O4'" . DC  I 6  41   ? 176.749 154.347 213.009 1.00 123.81 ?  -46  DC  I "O4'" 1 
ATOM   6845  C  "C3'" . DC  I 6  41   ? 177.688 154.309 210.824 1.00 121.97 ?  -46  DC  I "C3'" 1 
ATOM   6846  O  "O3'" . DC  I 6  41   ? 178.487 155.479 210.627 1.00 119.73 ?  -46  DC  I "O3'" 1 
ATOM   6847  C  "C2'" . DC  I 6  41   ? 178.412 153.317 211.716 1.00 122.24 ?  -46  DC  I "C2'" 1 
ATOM   6848  C  "C1'" . DC  I 6  41   ? 178.065 153.824 213.104 1.00 123.16 ?  -46  DC  I "C1'" 1 
ATOM   6849  N  N1    . DC  I 6  41   ? 178.063 152.785 214.144 1.00 123.48 ?  -46  DC  I N1    1 
ATOM   6850  C  C2    . DC  I 6  41   ? 178.027 153.174 215.484 1.00 123.40 ?  -46  DC  I C2    1 
ATOM   6851  O  O2    . DC  I 6  41   ? 177.997 154.384 215.757 1.00 123.10 ?  -46  DC  I O2    1 
ATOM   6852  N  N3    . DC  I 6  41   ? 178.026 152.226 216.449 1.00 123.53 ?  -46  DC  I N3    1 
ATOM   6853  C  C4    . DC  I 6  41   ? 178.059 150.934 216.113 1.00 123.47 ?  -46  DC  I C4    1 
ATOM   6854  N  N4    . DC  I 6  41   ? 178.055 150.032 217.097 1.00 123.26 ?  -46  DC  I N4    1 
ATOM   6855  C  C5    . DC  I 6  41   ? 178.096 150.509 214.754 1.00 123.43 ?  -46  DC  I C5    1 
ATOM   6856  C  C6    . DC  I 6  41   ? 178.098 151.460 213.810 1.00 123.54 ?  -46  DC  I C6    1 
ATOM   6857  P  P     . DA  I 6  42   ? 179.470 155.571 209.369 1.00 117.73 ?  -45  DA  I P     1 
ATOM   6858  O  OP1   . DA  I 6  42   ? 178.667 155.973 208.186 1.00 117.23 ?  -45  DA  I OP1   1 
ATOM   6859  O  OP2   . DA  I 6  42   ? 180.275 154.324 209.322 1.00 117.17 -1 -45  DA  I OP2   1 
ATOM   6860  O  "O5'" . DA  I 6  42   ? 180.434 156.780 209.754 1.00 115.96 ?  -45  DA  I "O5'" 1 
ATOM   6861  C  "C5'" . DA  I 6  42   ? 179.897 158.074 210.084 1.00 112.72 ?  -45  DA  I "C5'" 1 
ATOM   6862  C  "C4'" . DA  I 6  42   ? 180.605 158.639 211.294 1.00 109.86 ?  -45  DA  I "C4'" 1 
ATOM   6863  O  "O4'" . DA  I 6  42   ? 180.421 157.749 212.419 1.00 109.20 ?  -45  DA  I "O4'" 1 
ATOM   6864  C  "C3'" . DA  I 6  42   ? 182.115 158.806 211.130 1.00 108.30 ?  -45  DA  I "C3'" 1 
ATOM   6865  O  "O3'" . DA  I 6  42   ? 182.557 159.978 211.819 1.00 106.18 ?  -45  DA  I "O3'" 1 
ATOM   6866  C  "C2'" . DA  I 6  42   ? 182.675 157.558 211.788 1.00 108.34 ?  -45  DA  I "C2'" 1 
ATOM   6867  C  "C1'" . DA  I 6  42   ? 181.681 157.314 212.910 1.00 108.74 ?  -45  DA  I "C1'" 1 
ATOM   6868  N  N9    . DA  I 6  42   ? 181.548 155.912 213.301 1.00 108.68 ?  -45  DA  I N9    1 
ATOM   6869  C  C8    . DA  I 6  42   ? 181.249 154.838 212.498 1.00 108.54 ?  -45  DA  I C8    1 
ATOM   6870  N  N7    . DA  I 6  42   ? 181.199 153.696 213.139 1.00 108.55 ?  -45  DA  I N7    1 
ATOM   6871  C  C5    . DA  I 6  42   ? 181.484 154.039 214.453 1.00 108.56 ?  -45  DA  I C5    1 
ATOM   6872  C  C6    . DA  I 6  42   ? 181.585 153.275 215.629 1.00 108.47 ?  -45  DA  I C6    1 
ATOM   6873  N  N6    . DA  I 6  42   ? 181.401 151.954 215.673 1.00 108.68 ?  -45  DA  I N6    1 
ATOM   6874  N  N1    . DA  I 6  42   ? 181.885 153.925 216.775 1.00 108.57 ?  -45  DA  I N1    1 
ATOM   6875  C  C2    . DA  I 6  42   ? 182.068 155.250 216.731 1.00 108.53 ?  -45  DA  I C2    1 
ATOM   6876  N  N3    . DA  I 6  42   ? 182.001 156.077 215.689 1.00 108.87 ?  -45  DA  I N3    1 
ATOM   6877  C  C4    . DA  I 6  42   ? 181.702 155.401 214.567 1.00 108.80 ?  -45  DA  I C4    1 
ATOM   6878  P  P     . DA  I 6  43   ? 183.976 160.626 211.463 1.00 104.41 ?  -44  DA  I P     1 
ATOM   6879  O  OP1   . DA  I 6  43   ? 183.752 162.043 211.078 1.00 104.96 ?  -44  DA  I OP1   1 
ATOM   6880  O  OP2   . DA  I 6  43   ? 184.677 159.712 210.526 1.00 104.76 -1 -44  DA  I OP2   1 
ATOM   6881  O  "O5'" . DA  I 6  43   ? 184.742 160.603 212.860 1.00 104.27 ?  -44  DA  I "O5'" 1 
ATOM   6882  C  "C5'" . DA  I 6  43   ? 184.644 161.712 213.773 1.00 103.18 ?  -44  DA  I "C5'" 1 
ATOM   6883  C  "C4'" . DA  I 6  43   ? 184.965 161.266 215.180 1.00 101.88 ?  -44  DA  I "C4'" 1 
ATOM   6884  O  "O4'" . DA  I 6  43   ? 184.463 159.925 215.394 1.00 101.56 ?  -44  DA  I "O4'" 1 
ATOM   6885  C  "C3'" . DA  I 6  43   ? 186.457 161.217 215.514 1.00 102.38 ?  -44  DA  I "C3'" 1 
ATOM   6886  O  "O3'" . DA  I 6  43   ? 186.669 161.651 216.860 1.00 103.65 ?  -44  DA  I "O3'" 1 
ATOM   6887  C  "C2'" . DA  I 6  43   ? 186.800 159.746 215.368 1.00 101.52 ?  -44  DA  I "C2'" 1 
ATOM   6888  C  "C1'" . DA  I 6  43   ? 185.516 159.073 215.818 1.00 101.33 ?  -44  DA  I "C1'" 1 
ATOM   6889  N  N9    . DA  I 6  43   ? 185.289 157.754 215.228 1.00 101.43 ?  -44  DA  I N9    1 
ATOM   6890  C  C8    . DA  I 6  43   ? 185.148 157.439 213.900 1.00 101.17 ?  -44  DA  I C8    1 
ATOM   6891  N  N7    . DA  I 6  43   ? 184.953 156.162 213.677 1.00 100.85 ?  -44  DA  I N7    1 
ATOM   6892  C  C5    . DA  I 6  43   ? 184.967 155.597 214.945 1.00 101.34 ?  -44  DA  I C5    1 
ATOM   6893  C  C6    . DA  I 6  43   ? 184.815 154.274 215.393 1.00 100.99 ?  -44  DA  I C6    1 
ATOM   6894  N  N6    . DA  I 6  43   ? 184.611 153.235 214.580 1.00 101.34 ?  -44  DA  I N6    1 
ATOM   6895  N  N1    . DA  I 6  43   ? 184.880 154.049 216.724 1.00 101.09 ?  -44  DA  I N1    1 
ATOM   6896  C  C2    . DA  I 6  43   ? 185.086 155.092 217.539 1.00 100.95 ?  -44  DA  I C2    1 
ATOM   6897  N  N3    . DA  I 6  43   ? 185.244 156.379 217.239 1.00 101.34 ?  -44  DA  I N3    1 
ATOM   6898  C  C4    . DA  I 6  43   ? 185.174 156.567 215.910 1.00 101.63 ?  -44  DA  I C4    1 
ATOM   6899  P  P     . DT  I 6  44   ? 188.129 162.105 217.331 1.00 104.44 ?  -43  DT  I P     1 
ATOM   6900  O  OP1   . DT  I 6  44   ? 188.015 163.448 217.953 1.00 103.86 ?  -43  DT  I OP1   1 
ATOM   6901  O  OP2   . DT  I 6  44   ? 189.064 161.897 216.197 1.00 103.88 -1 -43  DT  I OP2   1 
ATOM   6902  O  "O5'" . DT  I 6  44   ? 188.480 161.052 218.473 1.00 106.34 ?  -43  DT  I "O5'" 1 
ATOM   6903  C  "C5'" . DT  I 6  44   ? 187.452 160.520 219.329 1.00 108.34 ?  -43  DT  I "C5'" 1 
ATOM   6904  C  "C4'" . DT  I 6  44   ? 188.019 159.443 220.223 1.00 110.22 ?  -43  DT  I "C4'" 1 
ATOM   6905  O  "O4'" . DT  I 6  44   ? 187.830 158.151 219.600 1.00 110.05 ?  -43  DT  I "O4'" 1 
ATOM   6906  C  "C3'" . DT  I 6  44   ? 189.518 159.561 220.497 1.00 111.69 ?  -43  DT  I "C3'" 1 
ATOM   6907  O  "O3'" . DT  I 6  44   ? 189.809 159.115 221.824 1.00 114.84 ?  -43  DT  I "O3'" 1 
ATOM   6908  C  "C2'" . DT  I 6  44   ? 190.130 158.625 219.473 1.00 110.55 ?  -43  DT  I "C2'" 1 
ATOM   6909  C  "C1'" . DT  I 6  44   ? 189.086 157.525 219.376 1.00 110.66 ?  -43  DT  I "C1'" 1 
ATOM   6910  N  N1    . DT  I 6  44   ? 189.029 156.859 218.063 1.00 111.06 ?  -43  DT  I N1    1 
ATOM   6911  C  C2    . DT  I 6  44   ? 188.747 155.514 218.025 1.00 111.29 ?  -43  DT  I C2    1 
ATOM   6912  O  O2    . DT  I 6  44   ? 188.542 154.848 219.027 1.00 111.45 ?  -43  DT  I O2    1 
ATOM   6913  N  N3    . DT  I 6  44   ? 188.712 154.972 216.764 1.00 111.10 ?  -43  DT  I N3    1 
ATOM   6914  C  C4    . DT  I 6  44   ? 188.925 155.627 215.567 1.00 111.25 ?  -43  DT  I C4    1 
ATOM   6915  O  O4    . DT  I 6  44   ? 188.861 155.007 214.510 1.00 111.24 ?  -43  DT  I O4    1 
ATOM   6916  C  C5    . DT  I 6  44   ? 189.216 157.038 215.681 1.00 111.23 ?  -43  DT  I C5    1 
ATOM   6917  C  C7    . DT  I 6  44   ? 189.462 157.831 214.437 1.00 110.92 ?  -43  DT  I C7    1 
ATOM   6918  C  C6    . DT  I 6  44   ? 189.252 157.576 216.908 1.00 111.37 ?  -43  DT  I C6    1 
ATOM   6919  P  P     . DT  I 6  45   ? 191.253 159.382 222.459 1.00 117.09 ?  -42  DT  I P     1 
ATOM   6920  O  OP1   . DT  I 6  45   ? 191.091 160.343 223.580 1.00 117.19 ?  -42  DT  I OP1   1 
ATOM   6921  O  OP2   . DT  I 6  45   ? 192.192 159.695 221.353 1.00 116.55 -1 -42  DT  I OP2   1 
ATOM   6922  O  "O5'" . DT  I 6  45   ? 191.643 157.963 223.069 1.00 118.59 ?  -42  DT  I "O5'" 1 
ATOM   6923  C  "C5'" . DT  I 6  45   ? 190.651 156.931 223.226 1.00 121.45 ?  -42  DT  I "C5'" 1 
ATOM   6924  C  "C4'" . DT  I 6  45   ? 191.313 155.574 223.271 1.00 124.13 ?  -42  DT  I "C4'" 1 
ATOM   6925  O  "O4'" . DT  I 6  45   ? 191.009 154.849 222.055 1.00 124.89 ?  -42  DT  I "O4'" 1 
ATOM   6926  C  "C3'" . DT  I 6  45   ? 192.838 155.608 223.367 1.00 125.68 ?  -42  DT  I "C3'" 1 
ATOM   6927  O  "O3'" . DT  I 6  45   ? 193.299 154.513 224.164 1.00 128.04 ?  -42  DT  I "O3'" 1 
ATOM   6928  C  "C2'" . DT  I 6  45   ? 193.279 155.435 221.926 1.00 125.76 ?  -42  DT  I "C2'" 1 
ATOM   6929  C  "C1'" . DT  I 6  45   ? 192.208 154.512 221.372 1.00 126.19 ?  -42  DT  I "C1'" 1 
ATOM   6930  N  N1    . DT  I 6  45   ? 191.961 154.668 219.928 1.00 126.66 ?  -42  DT  I N1    1 
ATOM   6931  C  C2    . DT  I 6  45   ? 191.484 153.584 219.228 1.00 126.77 ?  -42  DT  I C2    1 
ATOM   6932  O  O2    . DT  I 6  45   ? 191.255 152.504 219.747 1.00 126.95 ?  -42  DT  I O2    1 
ATOM   6933  N  N3    . DT  I 6  45   ? 191.281 153.812 217.889 1.00 126.67 ?  -42  DT  I N3    1 
ATOM   6934  C  C4    . DT  I 6  45   ? 191.504 154.988 217.199 1.00 126.73 ?  -42  DT  I C4    1 
ATOM   6935  O  O4    . DT  I 6  45   ? 191.275 155.045 215.994 1.00 126.80 ?  -42  DT  I O4    1 
ATOM   6936  C  C5    . DT  I 6  45   ? 192.005 156.085 217.996 1.00 126.90 ?  -42  DT  I C5    1 
ATOM   6937  C  C7    . DT  I 6  45   ? 192.277 157.400 217.336 1.00 126.78 ?  -42  DT  I C7    1 
ATOM   6938  C  C6    . DT  I 6  45   ? 192.205 155.872 219.303 1.00 126.86 ?  -42  DT  I C6    1 
ATOM   6939  P  P     . DG  I 6  46   ? 194.598 154.687 225.080 1.00 129.59 ?  -41  DG  I P     1 
ATOM   6940  O  OP1   . DG  I 6  46   ? 194.194 154.483 226.494 1.00 129.52 ?  -41  DG  I OP1   1 
ATOM   6941  O  OP2   . DG  I 6  46   ? 195.275 155.948 224.683 1.00 129.54 -1 -41  DG  I OP2   1 
ATOM   6942  O  "O5'" . DG  I 6  46   ? 195.512 153.459 224.638 1.00 131.37 ?  -41  DG  I "O5'" 1 
ATOM   6943  C  "C5'" . DG  I 6  46   ? 194.966 152.131 224.567 1.00 134.55 ?  -41  DG  I "C5'" 1 
ATOM   6944  C  "C4'" . DG  I 6  46   ? 195.732 151.299 223.565 1.00 137.25 ?  -41  DG  I "C4'" 1 
ATOM   6945  O  "O4'" . DG  I 6  46   ? 195.338 151.665 222.221 1.00 138.39 ?  -41  DG  I "O4'" 1 
ATOM   6946  C  "C3'" . DG  I 6  46   ? 197.255 151.452 223.624 1.00 138.81 ?  -41  DG  I "C3'" 1 
ATOM   6947  O  "O3'" . DG  I 6  46   ? 197.855 150.156 223.549 1.00 140.36 ?  -41  DG  I "O3'" 1 
ATOM   6948  C  "C2'" . DG  I 6  46   ? 197.585 152.270 222.386 1.00 139.20 ?  -41  DG  I "C2'" 1 
ATOM   6949  C  "C1'" . DG  I 6  46   ? 196.493 151.849 221.423 1.00 139.70 ?  -41  DG  I "C1'" 1 
ATOM   6950  N  N9    . DG  I 6  46   ? 196.176 152.840 220.399 1.00 140.07 ?  -41  DG  I N9    1 
ATOM   6951  C  C8    . DG  I 6  46   ? 196.345 154.201 220.482 1.00 140.18 ?  -41  DG  I C8    1 
ATOM   6952  N  N7    . DG  I 6  46   ? 195.970 154.831 219.403 1.00 140.31 ?  -41  DG  I N7    1 
ATOM   6953  C  C5    . DG  I 6  46   ? 195.528 153.825 218.553 1.00 140.21 ?  -41  DG  I C5    1 
ATOM   6954  C  C6    . DG  I 6  46   ? 195.003 153.899 217.233 1.00 139.88 ?  -41  DG  I C6    1 
ATOM   6955  O  O6    . DG  I 6  46   ? 194.817 154.901 216.531 1.00 139.92 ?  -41  DG  I O6    1 
ATOM   6956  N  N1    . DG  I 6  46   ? 194.679 152.639 216.739 1.00 139.99 ?  -41  DG  I N1    1 
ATOM   6957  C  C2    . DG  I 6  46   ? 194.840 151.458 217.425 1.00 140.17 ?  -41  DG  I C2    1 
ATOM   6958  N  N2    . DG  I 6  46   ? 194.470 150.344 216.779 1.00 140.22 ?  -41  DG  I N2    1 
ATOM   6959  N  N3    . DG  I 6  46   ? 195.329 151.377 218.656 1.00 140.24 ?  -41  DG  I N3    1 
ATOM   6960  C  C4    . DG  I 6  46   ? 195.650 152.590 219.155 1.00 140.22 ?  -41  DG  I C4    1 
ATOM   6961  P  P     . DG  I 6  47   ? 199.447 150.017 223.433 1.00 141.49 ?  -40  DG  I P     1 
ATOM   6962  O  OP1   . DG  I 6  47   ? 199.843 148.734 224.067 1.00 141.43 ?  -40  DG  I OP1   1 
ATOM   6963  O  OP2   . DG  I 6  47   ? 200.055 151.287 223.905 1.00 141.29 -1 -40  DG  I OP2   1 
ATOM   6964  O  "O5'" . DG  I 6  47   ? 199.687 149.898 221.863 1.00 142.11 ?  -40  DG  I "O5'" 1 
ATOM   6965  C  "C5'" . DG  I 6  47   ? 198.924 148.971 221.068 1.00 143.17 ?  -40  DG  I "C5'" 1 
ATOM   6966  C  "C4'" . DG  I 6  47   ? 199.608 148.719 219.744 1.00 144.00 ?  -40  DG  I "C4'" 1 
ATOM   6967  O  "O4'" . DG  I 6  47   ? 198.968 149.504 218.710 1.00 144.73 ?  -40  DG  I "O4'" 1 
ATOM   6968  C  "C3'" . DG  I 6  47   ? 201.091 149.089 219.693 1.00 144.39 ?  -40  DG  I "C3'" 1 
ATOM   6969  O  "O3'" . DG  I 6  47   ? 201.777 148.156 218.852 1.00 144.77 ?  -40  DG  I "O3'" 1 
ATOM   6970  C  "C2'" . DG  I 6  47   ? 201.082 150.458 219.040 1.00 144.84 ?  -40  DG  I "C2'" 1 
ATOM   6971  C  "C1'" . DG  I 6  47   ? 199.928 150.325 218.062 1.00 145.27 ?  -40  DG  I "C1'" 1 
ATOM   6972  N  N9    . DG  I 6  47   ? 199.278 151.584 217.714 1.00 145.39 ?  -40  DG  I N9    1 
ATOM   6973  C  C8    . DG  I 6  47   ? 199.213 152.724 218.480 1.00 145.48 ?  -40  DG  I C8    1 
ATOM   6974  N  N7    . DG  I 6  47   ? 198.560 153.695 217.901 1.00 145.46 ?  -40  DG  I N7    1 
ATOM   6975  C  C5    . DG  I 6  47   ? 198.170 153.165 216.678 1.00 145.51 ?  -40  DG  I C5    1 
ATOM   6976  C  C6    . DG  I 6  47   ? 197.430 153.751 215.614 1.00 145.46 ?  -40  DG  I C6    1 
ATOM   6977  O  O6    . DG  I 6  47   ? 196.957 154.893 215.540 1.00 145.43 ?  -40  DG  I O6    1 
ATOM   6978  N  N1    . DG  I 6  47   ? 197.258 152.862 214.557 1.00 145.51 ?  -40  DG  I N1    1 
ATOM   6979  C  C2    . DG  I 6  47   ? 197.738 151.574 214.527 1.00 145.59 ?  -40  DG  I C2    1 
ATOM   6980  N  N2    . DG  I 6  47   ? 197.469 150.870 213.417 1.00 145.39 ?  -40  DG  I N2    1 
ATOM   6981  N  N3    . DG  I 6  47   ? 198.428 151.015 215.511 1.00 145.75 ?  -40  DG  I N3    1 
ATOM   6982  C  C4    . DG  I 6  47   ? 198.606 151.862 216.549 1.00 145.57 ?  -40  DG  I C4    1 
ATOM   6983  P  P     . DT  I 6  48   ? 203.367 148.013 218.954 1.00 145.08 ?  -39  DT  I P     1 
ATOM   6984  O  OP1   . DT  I 6  48   ? 203.668 146.805 219.764 1.00 145.44 ?  -39  DT  I OP1   1 
ATOM   6985  O  OP2   . DT  I 6  48   ? 203.922 149.329 219.360 1.00 144.78 -1 -39  DT  I OP2   1 
ATOM   6986  O  "O5'" . DT  I 6  48   ? 203.799 147.724 217.448 1.00 144.54 ?  -39  DT  I "O5'" 1 
ATOM   6987  C  "C5'" . DT  I 6  48   ? 203.030 146.831 216.623 1.00 143.87 ?  -39  DT  I "C5'" 1 
ATOM   6988  C  "C4'" . DT  I 6  48   ? 203.186 147.203 215.167 1.00 143.49 ?  -39  DT  I "C4'" 1 
ATOM   6989  O  "O4'" . DT  I 6  48   ? 202.498 148.447 214.908 1.00 143.71 ?  -39  DT  I "O4'" 1 
ATOM   6990  C  "C3'" . DT  I 6  48   ? 204.634 147.404 214.707 1.00 143.21 ?  -39  DT  I "C3'" 1 
ATOM   6991  O  "O3'" . DT  I 6  48   ? 204.929 146.490 213.645 1.00 142.06 ?  -39  DT  I "O3'" 1 
ATOM   6992  C  "C2'" . DT  I 6  48   ? 204.692 148.850 214.239 1.00 143.56 ?  -39  DT  I "C2'" 1 
ATOM   6993  C  "C1'" . DT  I 6  48   ? 203.240 149.198 213.970 1.00 144.10 ?  -39  DT  I "C1'" 1 
ATOM   6994  N  N1    . DT  I 6  48   ? 202.910 150.619 214.171 1.00 144.40 ?  -39  DT  I N1    1 
ATOM   6995  C  C2    . DT  I 6  48   ? 202.372 151.318 213.114 1.00 144.34 ?  -39  DT  I C2    1 
ATOM   6996  O  O2    . DT  I 6  48   ? 202.157 150.816 212.024 1.00 144.31 ?  -39  DT  I O2    1 
ATOM   6997  N  N3    . DT  I 6  48   ? 202.093 152.636 213.384 1.00 144.22 ?  -39  DT  I N3    1 
ATOM   6998  C  C4    . DT  I 6  48   ? 202.294 153.305 214.576 1.00 144.20 ?  -39  DT  I C4    1 
ATOM   6999  O  O4    . DT  I 6  48   ? 201.994 154.492 214.669 1.00 144.20 ?  -39  DT  I O4    1 
ATOM   7000  C  C5    . DT  I 6  48   ? 202.861 152.510 215.641 1.00 144.29 ?  -39  DT  I C5    1 
ATOM   7001  C  C7    . DT  I 6  48   ? 203.115 153.150 216.970 1.00 144.27 ?  -39  DT  I C7    1 
ATOM   7002  C  C6    . DT  I 6  48   ? 203.137 151.224 215.388 1.00 144.40 ?  -39  DT  I C6    1 
ATOM   7003  P  P     . DC  I 6  49   ? 206.400 146.443 213.019 1.00 140.87 ?  -38  DC  I P     1 
ATOM   7004  O  OP1   . DC  I 6  49   ? 206.609 145.093 212.437 1.00 140.47 ?  -38  DC  I OP1   1 
ATOM   7005  O  OP2   . DC  I 6  49   ? 207.351 146.961 214.036 1.00 140.48 -1 -38  DC  I OP2   1 
ATOM   7006  O  "O5'" . DC  I 6  49   ? 206.315 147.493 211.824 1.00 140.43 ?  -38  DC  I "O5'" 1 
ATOM   7007  C  "C5'" . DC  I 6  49   ? 205.393 147.299 210.737 1.00 139.00 ?  -38  DC  I "C5'" 1 
ATOM   7008  C  "C4'" . DC  I 6  49   ? 205.635 148.330 209.660 1.00 137.61 ?  -38  DC  I "C4'" 1 
ATOM   7009  O  "O4'" . DC  I 6  49   ? 205.159 149.617 210.113 1.00 137.57 ?  -38  DC  I "O4'" 1 
ATOM   7010  C  "C3'" . DC  I 6  49   ? 207.104 148.516 209.268 1.00 136.52 ?  -38  DC  I "C3'" 1 
ATOM   7011  O  "O3'" . DC  I 6  49   ? 207.264 148.276 207.865 1.00 134.40 ?  -38  DC  I "O3'" 1 
ATOM   7012  C  "C2'" . DC  I 6  49   ? 207.437 149.941 209.680 1.00 137.04 ?  -38  DC  I "C2'" 1 
ATOM   7013  C  "C1'" . DC  I 6  49   ? 206.087 150.628 209.772 1.00 138.04 ?  -38  DC  I "C1'" 1 
ATOM   7014  N  N1    . DC  I 6  49   ? 206.016 151.666 210.810 1.00 138.41 ?  -38  DC  I N1    1 
ATOM   7015  C  C2    . DC  I 6  49   ? 205.264 152.817 210.563 1.00 138.75 ?  -38  DC  I C2    1 
ATOM   7016  O  O2    . DC  I 6  49   ? 204.685 152.932 209.473 1.00 138.72 ?  -38  DC  I O2    1 
ATOM   7017  N  N3    . DC  I 6  49   ? 205.190 153.775 211.516 1.00 138.63 ?  -38  DC  I N3    1 
ATOM   7018  C  C4    . DC  I 6  49   ? 205.828 153.612 212.676 1.00 138.34 ?  -38  DC  I C4    1 
ATOM   7019  N  N4    . DC  I 6  49   ? 205.728 154.583 213.588 1.00 138.40 ?  -38  DC  I N4    1 
ATOM   7020  C  C5    . DC  I 6  49   ? 206.600 152.446 212.954 1.00 138.36 ?  -38  DC  I C5    1 
ATOM   7021  C  C6    . DC  I 6  49   ? 206.664 151.507 212.003 1.00 138.27 ?  -38  DC  I C6    1 
ATOM   7022  P  P     . DG  I 6  50   ? 208.070 149.322 206.960 1.00 133.11 ?  -37  DG  I P     1 
ATOM   7023  O  OP1   . DG  I 6  50   ? 208.339 148.682 205.648 1.00 133.04 ?  -37  DG  I OP1   1 
ATOM   7024  O  OP2   . DG  I 6  50   ? 209.200 149.849 207.766 1.00 132.66 -1 -37  DG  I OP2   1 
ATOM   7025  O  "O5'" . DG  I 6  50   ? 207.015 150.496 206.747 1.00 133.11 ?  -37  DG  I "O5'" 1 
ATOM   7026  C  "C5'" . DG  I 6  50   ? 206.534 150.832 205.431 1.00 131.21 ?  -37  DG  I "C5'" 1 
ATOM   7027  C  "C4'" . DG  I 6  50   ? 206.927 152.247 205.077 1.00 129.43 ?  -37  DG  I "C4'" 1 
ATOM   7028  O  "O4'" . DG  I 6  50   ? 206.779 153.093 206.243 1.00 129.32 ?  -37  DG  I "O4'" 1 
ATOM   7029  C  "C3'" . DG  I 6  50   ? 208.380 152.411 204.634 1.00 127.93 ?  -37  DG  I "C3'" 1 
ATOM   7030  O  "O3'" . DG  I 6  50   ? 208.491 153.493 203.705 1.00 125.53 ?  -37  DG  I "O3'" 1 
ATOM   7031  C  "C2'" . DG  I 6  50   ? 209.088 152.775 205.925 1.00 128.36 ?  -37  DG  I "C2'" 1 
ATOM   7032  C  "C1'" . DG  I 6  50   ? 208.042 153.623 206.629 1.00 129.26 ?  -37  DG  I "C1'" 1 
ATOM   7033  N  N9    . DG  I 6  50   ? 208.115 153.586 208.086 1.00 129.40 ?  -37  DG  I N9    1 
ATOM   7034  C  C8    . DG  I 6  50   ? 208.784 152.669 208.859 1.00 129.69 ?  -37  DG  I C8    1 
ATOM   7035  N  N7    . DG  I 6  50   ? 208.667 152.894 210.140 1.00 129.75 ?  -37  DG  I N7    1 
ATOM   7036  C  C5    . DG  I 6  50   ? 207.873 154.030 210.217 1.00 129.55 ?  -37  DG  I C5    1 
ATOM   7037  C  C6    . DG  I 6  50   ? 207.405 154.750 211.352 1.00 129.57 ?  -37  DG  I C6    1 
ATOM   7038  O  O6    . DG  I 6  50   ? 207.607 154.518 212.550 1.00 129.49 ?  -37  DG  I O6    1 
ATOM   7039  N  N1    . DG  I 6  50   ? 206.626 155.843 210.979 1.00 129.67 ?  -37  DG  I N1    1 
ATOM   7040  C  C2    . DG  I 6  50   ? 206.335 156.197 209.683 1.00 129.57 ?  -37  DG  I C2    1 
ATOM   7041  N  N2    . DG  I 6  50   ? 205.567 157.285 209.526 1.00 129.43 ?  -37  DG  I N2    1 
ATOM   7042  N  N3    . DG  I 6  50   ? 206.767 155.535 208.618 1.00 129.69 ?  -37  DG  I N3    1 
ATOM   7043  C  C4    . DG  I 6  50   ? 207.523 154.469 208.958 1.00 129.55 ?  -37  DG  I C4    1 
ATOM   7044  P  P     . DT  I 6  51   ? 207.791 153.394 202.272 1.00 124.00 ?  -36  DT  I P     1 
ATOM   7045  O  OP1   . DT  I 6  51   ? 206.515 152.652 202.435 1.00 123.74 ?  -36  DT  I OP1   1 
ATOM   7046  O  OP2   . DT  I 6  51   ? 208.802 152.909 201.298 1.00 124.16 -1 -36  DT  I OP2   1 
ATOM   7047  O  "O5'" . DT  I 6  51   ? 207.449 154.913 201.936 1.00 123.32 ?  -36  DT  I "O5'" 1 
ATOM   7048  C  "C5'" . DT  I 6  51   ? 206.365 155.588 202.600 1.00 121.36 ?  -36  DT  I "C5'" 1 
ATOM   7049  C  "C4'" . DT  I 6  51   ? 206.794 156.971 203.036 1.00 120.00 ?  -36  DT  I "C4'" 1 
ATOM   7050  O  "O4'" . DT  I 6  51   ? 207.321 156.912 204.384 1.00 120.81 ?  -36  DT  I "O4'" 1 
ATOM   7051  C  "C3'" . DT  I 6  51   ? 207.895 157.604 202.184 1.00 118.77 ?  -36  DT  I "C3'" 1 
ATOM   7052  O  "O3'" . DT  I 6  51   ? 207.686 159.017 202.109 1.00 116.49 ?  -36  DT  I "O3'" 1 
ATOM   7053  C  "C2'" . DT  I 6  51   ? 209.151 157.331 202.989 1.00 119.67 ?  -36  DT  I "C2'" 1 
ATOM   7054  C  "C1'" . DT  I 6  51   ? 208.632 157.453 204.409 1.00 121.33 ?  -36  DT  I "C1'" 1 
ATOM   7055  N  N1    . DT  I 6  51   ? 209.411 156.707 205.414 1.00 121.85 ?  -36  DT  I N1    1 
ATOM   7056  C  C2    . DT  I 6  51   ? 209.316 157.100 206.730 1.00 121.94 ?  -36  DT  I C2    1 
ATOM   7057  O  O2    . DT  I 6  51   ? 208.619 158.031 207.098 1.00 122.03 ?  -36  DT  I O2    1 
ATOM   7058  N  N3    . DT  I 6  51   ? 210.072 156.358 207.603 1.00 121.72 ?  -36  DT  I N3    1 
ATOM   7059  C  C4    . DT  I 6  51   ? 210.892 155.288 207.298 1.00 121.89 ?  -36  DT  I C4    1 
ATOM   7060  O  O4    . DT  I 6  51   ? 211.511 154.717 208.192 1.00 122.05 ?  -36  DT  I O4    1 
ATOM   7061  C  C5    . DT  I 6  51   ? 210.944 154.932 205.899 1.00 122.03 ?  -36  DT  I C5    1 
ATOM   7062  C  C7    . DT  I 6  51   ? 211.807 153.787 205.472 1.00 121.65 ?  -36  DT  I C7    1 
ATOM   7063  C  C6    . DT  I 6  51   ? 210.210 155.650 205.038 1.00 121.98 ?  -36  DT  I C6    1 
ATOM   7064  P  P     . DA  I 6  52   ? 207.939 159.791 200.732 1.00 114.68 ?  -35  DA  I P     1 
ATOM   7065  O  OP1   . DA  I 6  52   ? 207.329 158.994 199.638 1.00 114.09 ?  -35  DA  I OP1   1 
ATOM   7066  O  OP2   . DA  I 6  52   ? 209.379 160.149 200.665 1.00 113.86 -1 -35  DA  I OP2   1 
ATOM   7067  O  "O5'" . DA  I 6  52   ? 207.091 161.126 200.913 1.00 114.53 ?  -35  DA  I "O5'" 1 
ATOM   7068  C  "C5'" . DA  I 6  52   ? 205.969 161.171 201.814 1.00 114.24 ?  -35  DA  I "C5'" 1 
ATOM   7069  C  "C4'" . DA  I 6  52   ? 206.184 162.236 202.864 1.00 114.07 ?  -35  DA  I "C4'" 1 
ATOM   7070  O  "O4'" . DA  I 6  52   ? 207.292 161.859 203.716 1.00 114.46 ?  -35  DA  I "O4'" 1 
ATOM   7071  C  "C3'" . DA  I 6  52   ? 206.527 163.619 202.310 1.00 113.94 ?  -35  DA  I "C3'" 1 
ATOM   7072  O  "O3'" . DA  I 6  52   ? 205.898 164.637 203.095 1.00 113.18 ?  -35  DA  I "O3'" 1 
ATOM   7073  C  "C2'" . DA  I 6  52   ? 208.036 163.688 202.450 1.00 114.28 ?  -35  DA  I "C2'" 1 
ATOM   7074  C  "C1'" . DA  I 6  52   ? 208.281 162.878 203.710 1.00 114.83 ?  -35  DA  I "C1'" 1 
ATOM   7075  N  N9    . DA  I 6  52   ? 209.591 162.230 203.762 1.00 114.96 ?  -35  DA  I N9    1 
ATOM   7076  C  C8    . DA  I 6  52   ? 210.490 162.066 202.737 1.00 115.06 ?  -35  DA  I C8    1 
ATOM   7077  N  N7    . DA  I 6  52   ? 211.587 161.443 203.089 1.00 115.21 ?  -35  DA  I N7    1 
ATOM   7078  C  C5    . DA  I 6  52   ? 211.400 161.177 204.439 1.00 115.02 ?  -35  DA  I C5    1 
ATOM   7079  C  C6    . DA  I 6  52   ? 212.204 160.536 205.397 1.00 114.95 ?  -35  DA  I C6    1 
ATOM   7080  N  N6    . DA  I 6  52   ? 213.408 160.024 205.132 1.00 115.14 ?  -35  DA  I N6    1 
ATOM   7081  N  N1    . DA  I 6  52   ? 211.722 160.437 206.655 1.00 114.91 ?  -35  DA  I N1    1 
ATOM   7082  C  C2    . DA  I 6  52   ? 210.515 160.951 206.921 1.00 115.04 ?  -35  DA  I C2    1 
ATOM   7083  N  N3    . DA  I 6  52   ? 209.666 161.575 206.108 1.00 115.34 ?  -35  DA  I N3    1 
ATOM   7084  C  C4    . DA  I 6  52   ? 210.175 161.657 204.866 1.00 115.01 ?  -35  DA  I C4    1 
ATOM   7085  P  P     . DG  I 6  53   ? 205.982 166.169 202.635 1.00 112.42 ?  -34  DG  I P     1 
ATOM   7086  O  OP1   . DG  I 6  53   ? 204.599 166.707 202.574 1.00 111.79 ?  -34  DG  I OP1   1 
ATOM   7087  O  OP2   . DG  I 6  53   ? 206.853 166.241 201.434 1.00 111.08 -1 -34  DG  I OP2   1 
ATOM   7088  O  "O5'" . DG  I 6  53   ? 206.741 166.875 203.845 1.00 114.52 ?  -34  DG  I "O5'" 1 
ATOM   7089  C  "C5'" . DG  I 6  53   ? 207.098 166.144 205.032 1.00 118.15 ?  -34  DG  I "C5'" 1 
ATOM   7090  C  "C4'" . DG  I 6  53   ? 208.323 166.757 205.674 1.00 120.64 ?  -34  DG  I "C4'" 1 
ATOM   7091  O  "O4'" . DG  I 6  53   ? 209.411 165.802 205.631 1.00 121.35 ?  -34  DG  I "O4'" 1 
ATOM   7092  C  "C3'" . DG  I 6  53   ? 208.853 168.007 204.975 1.00 122.05 ?  -34  DG  I "C3'" 1 
ATOM   7093  O  "O3'" . DG  I 6  53   ? 209.589 168.798 205.910 1.00 123.65 ?  -34  DG  I "O3'" 1 
ATOM   7094  C  "C2'" . DG  I 6  53   ? 209.872 167.433 204.012 1.00 122.23 ?  -34  DG  I "C2'" 1 
ATOM   7095  C  "C1'" . DG  I 6  53   ? 210.486 166.344 204.875 1.00 123.20 ?  -34  DG  I "C1'" 1 
ATOM   7096  N  N9    . DG  I 6  53   ? 211.115 165.251 204.141 1.00 123.79 ?  -34  DG  I N9    1 
ATOM   7097  C  C8    . DG  I 6  53   ? 210.882 164.885 202.837 1.00 124.10 ?  -34  DG  I C8    1 
ATOM   7098  N  N7    . DG  I 6  53   ? 211.602 163.864 202.455 1.00 124.22 ?  -34  DG  I N7    1 
ATOM   7099  C  C5    . DG  I 6  53   ? 212.358 163.540 203.574 1.00 124.18 ?  -34  DG  I C5    1 
ATOM   7100  C  C6    . DG  I 6  53   ? 213.326 162.513 203.765 1.00 123.77 ?  -34  DG  I C6    1 
ATOM   7101  O  O6    . DG  I 6  53   ? 213.718 161.663 202.957 1.00 123.79 ?  -34  DG  I O6    1 
ATOM   7102  N  N1    . DG  I 6  53   ? 213.850 162.538 205.054 1.00 123.81 ?  -34  DG  I N1    1 
ATOM   7103  C  C2    . DG  I 6  53   ? 213.491 163.434 206.034 1.00 124.02 ?  -34  DG  I C2    1 
ATOM   7104  N  N2    . DG  I 6  53   ? 214.110 163.296 207.214 1.00 124.21 ?  -34  DG  I N2    1 
ATOM   7105  N  N3    . DG  I 6  53   ? 212.591 164.393 205.867 1.00 124.16 ?  -34  DG  I N3    1 
ATOM   7106  C  C4    . DG  I 6  53   ? 212.069 164.387 204.623 1.00 124.07 ?  -34  DG  I C4    1 
ATOM   7107  P  P     . DA  I 6  54   ? 209.142 170.300 206.223 1.00 124.41 ?  -33  DA  I P     1 
ATOM   7108  O  OP1   . DA  I 6  54   ? 207.729 170.273 206.681 1.00 124.20 ?  -33  DA  I OP1   1 
ATOM   7109  O  OP2   . DA  I 6  54   ? 209.523 171.146 205.064 1.00 123.96 -1 -33  DA  I OP2   1 
ATOM   7110  O  "O5'" . DA  I 6  54   ? 210.060 170.691 207.465 1.00 125.71 ?  -33  DA  I "O5'" 1 
ATOM   7111  C  "C5'" . DA  I 6  54   ? 209.903 170.026 208.732 1.00 127.34 ?  -33  DA  I "C5'" 1 
ATOM   7112  C  "C4'" . DA  I 6  54   ? 211.245 169.583 209.268 1.00 128.63 ?  -33  DA  I "C4'" 1 
ATOM   7113  O  "O4'" . DA  I 6  54   ? 211.805 168.563 208.407 1.00 128.70 ?  -33  DA  I "O4'" 1 
ATOM   7114  C  "C3'" . DA  I 6  54   ? 212.300 170.691 209.361 1.00 129.54 ?  -33  DA  I "C3'" 1 
ATOM   7115  O  "O3'" . DA  I 6  54   ? 212.986 170.602 210.613 1.00 130.83 ?  -33  DA  I "O3'" 1 
ATOM   7116  C  "C2'" . DA  I 6  54   ? 213.251 170.381 208.218 1.00 129.32 ?  -33  DA  I "C2'" 1 
ATOM   7117  C  "C1'" . DA  I 6  54   ? 213.160 168.870 208.133 1.00 129.32 ?  -33  DA  I "C1'" 1 
ATOM   7118  N  N9    . DA  I 6  54   ? 213.491 168.315 206.823 1.00 129.61 ?  -33  DA  I N9    1 
ATOM   7119  C  C8    . DA  I 6  54   ? 212.911 168.601 205.612 1.00 129.50 ?  -33  DA  I C8    1 
ATOM   7120  N  N7    . DA  I 6  54   ? 213.430 167.940 204.606 1.00 129.45 ?  -33  DA  I N7    1 
ATOM   7121  C  C5    . DA  I 6  54   ? 214.421 167.165 205.193 1.00 129.36 ?  -33  DA  I C5    1 
ATOM   7122  C  C6    . DA  I 6  54   ? 215.336 166.239 204.664 1.00 129.34 ?  -33  DA  I C6    1 
ATOM   7123  N  N6    . DA  I 6  54   ? 215.407 165.925 203.368 1.00 129.44 ?  -33  DA  I N6    1 
ATOM   7124  N  N1    . DA  I 6  54   ? 216.190 165.639 205.521 1.00 129.43 ?  -33  DA  I N1    1 
ATOM   7125  C  C2    . DA  I 6  54   ? 216.119 165.955 206.821 1.00 129.43 ?  -33  DA  I C2    1 
ATOM   7126  N  N3    . DA  I 6  54   ? 215.304 166.807 207.438 1.00 129.42 ?  -33  DA  I N3    1 
ATOM   7127  C  C4    . DA  I 6  54   ? 214.469 167.386 206.558 1.00 129.46 ?  -33  DA  I C4    1 
ATOM   7128  P  P     . DC  I 6  55   ? 213.830 171.849 211.149 1.00 131.27 ?  -32  DC  I P     1 
ATOM   7129  O  OP1   . DC  I 6  55   ? 213.396 172.135 212.539 1.00 130.91 ?  -32  DC  I OP1   1 
ATOM   7130  O  OP2   . DC  I 6  55   ? 213.769 172.922 210.123 1.00 131.14 -1 -32  DC  I OP2   1 
ATOM   7131  O  "O5'" . DC  I 6  55   ? 215.314 171.274 211.192 1.00 131.99 ?  -32  DC  I "O5'" 1 
ATOM   7132  C  "C5'" . DC  I 6  55   ? 215.600 169.957 210.688 1.00 133.11 ?  -32  DC  I "C5'" 1 
ATOM   7133  C  "C4'" . DC  I 6  55   ? 217.067 169.840 210.345 1.00 133.92 ?  -32  DC  I "C4'" 1 
ATOM   7134  O  "O4'" . DC  I 6  55   ? 217.214 169.205 209.052 1.00 133.88 ?  -32  DC  I "O4'" 1 
ATOM   7135  C  "C3'" . DC  I 6  55   ? 217.809 171.173 210.247 1.00 134.62 ?  -32  DC  I "C3'" 1 
ATOM   7136  O  "O3'" . DC  I 6  55   ? 219.134 171.000 210.754 1.00 136.08 ?  -32  DC  I "O3'" 1 
ATOM   7137  C  "C2'" . DC  I 6  55   ? 217.848 171.442 208.756 1.00 134.50 ?  -32  DC  I "C2'" 1 
ATOM   7138  C  "C1'" . DC  I 6  55   ? 217.968 170.040 208.186 1.00 134.33 ?  -32  DC  I "C1'" 1 
ATOM   7139  N  N1    . DC  I 6  55   ? 217.426 169.885 206.829 1.00 134.65 ?  -32  DC  I N1    1 
ATOM   7140  C  C2    . DC  I 6  55   ? 218.081 169.035 205.934 1.00 134.63 ?  -32  DC  I C2    1 
ATOM   7141  O  O2    . DC  I 6  55   ? 219.100 168.438 206.314 1.00 134.48 ?  -32  DC  I O2    1 
ATOM   7142  N  N3    . DC  I 6  55   ? 217.591 168.886 204.683 1.00 134.62 ?  -32  DC  I N3    1 
ATOM   7143  C  C4    . DC  I 6  55   ? 216.492 169.548 204.315 1.00 134.44 ?  -32  DC  I C4    1 
ATOM   7144  N  N4    . DC  I 6  55   ? 216.043 169.371 203.070 1.00 134.34 ?  -32  DC  I N4    1 
ATOM   7145  C  C5    . DC  I 6  55   ? 215.804 170.421 205.206 1.00 134.62 ?  -32  DC  I C5    1 
ATOM   7146  C  C6    . DC  I 6  55   ? 216.302 170.559 206.442 1.00 134.82 ?  -32  DC  I C6    1 
ATOM   7147  P  P     . DA  I 6  56   ? 219.971 172.271 211.246 1.00 136.92 ?  -31  DA  I P     1 
ATOM   7148  O  OP1   . DA  I 6  56   ? 219.887 172.331 212.727 1.00 136.91 ?  -31  DA  I OP1   1 
ATOM   7149  O  OP2   . DA  I 6  56   ? 219.548 173.442 210.437 1.00 136.47 -1 -31  DA  I OP2   1 
ATOM   7150  O  "O5'" . DA  I 6  56   ? 221.465 171.892 210.846 1.00 137.02 ?  -31  DA  I "O5'" 1 
ATOM   7151  C  "C5'" . DA  I 6  56   ? 221.937 170.536 210.959 1.00 137.67 ?  -31  DA  I "C5'" 1 
ATOM   7152  C  "C4'" . DA  I 6  56   ? 222.847 170.199 209.802 1.00 138.60 ?  -31  DA  I "C4'" 1 
ATOM   7153  O  "O4'" . DA  I 6  56   ? 222.054 169.969 208.612 1.00 138.90 ?  -31  DA  I "O4'" 1 
ATOM   7154  C  "C3'" . DA  I 6  56   ? 223.854 171.291 209.437 1.00 139.42 ?  -31  DA  I "C3'" 1 
ATOM   7155  O  "O3'" . DA  I 6  56   ? 225.109 170.695 209.099 1.00 140.55 ?  -31  DA  I "O3'" 1 
ATOM   7156  C  "C2'" . DA  I 6  56   ? 223.234 171.952 208.219 1.00 139.59 ?  -31  DA  I "C2'" 1 
ATOM   7157  C  "C1'" . DA  I 6  56   ? 222.524 170.788 207.554 1.00 139.63 ?  -31  DA  I "C1'" 1 
ATOM   7158  N  N9    . DA  I 6  56   ? 221.373 171.171 206.739 1.00 139.77 ?  -31  DA  I N9    1 
ATOM   7159  C  C8    . DA  I 6  56   ? 220.325 171.985 207.091 1.00 139.68 ?  -31  DA  I C8    1 
ATOM   7160  N  N7    . DA  I 6  56   ? 219.436 172.144 206.140 1.00 139.81 ?  -31  DA  I N7    1 
ATOM   7161  C  C5    . DA  I 6  56   ? 219.932 171.383 205.090 1.00 139.88 ?  -31  DA  I C5    1 
ATOM   7162  C  C6    . DA  I 6  56   ? 219.453 171.136 203.792 1.00 139.85 ?  -31  DA  I C6    1 
ATOM   7163  N  N6    . DA  I 6  56   ? 218.319 171.650 203.309 1.00 139.69 ?  -31  DA  I N6    1 
ATOM   7164  N  N1    . DA  I 6  56   ? 220.189 170.331 202.994 1.00 139.77 ?  -31  DA  I N1    1 
ATOM   7165  C  C2    . DA  I 6  56   ? 221.327 169.816 203.477 1.00 139.57 ?  -31  DA  I C2    1 
ATOM   7166  N  N3    . DA  I 6  56   ? 221.880 169.974 204.677 1.00 139.72 ?  -31  DA  I N3    1 
ATOM   7167  C  C4    . DA  I 6  56   ? 221.125 170.780 205.445 1.00 139.84 ?  -31  DA  I C4    1 
ATOM   7168  P  P     . DG  I 6  57   ? 226.316 171.608 208.583 1.00 141.33 ?  -30  DG  I P     1 
ATOM   7169  O  OP1   . DG  I 6  57   ? 227.211 171.882 209.737 1.00 141.60 ?  -30  DG  I OP1   1 
ATOM   7170  O  OP2   . DG  I 6  57   ? 225.737 172.741 207.816 1.00 141.33 -1 -30  DG  I OP2   1 
ATOM   7171  O  "O5'" . DG  I 6  57   ? 227.075 170.651 207.562 1.00 141.99 ?  -30  DG  I "O5'" 1 
ATOM   7172  C  "C5'" . DG  I 6  57   ? 226.336 169.875 206.600 1.00 142.93 ?  -30  DG  I "C5'" 1 
ATOM   7173  C  "C4'" . DG  I 6  57   ? 226.996 169.960 205.244 1.00 143.53 ?  -30  DG  I "C4'" 1 
ATOM   7174  O  "O4'" . DG  I 6  57   ? 225.997 170.239 204.236 1.00 144.04 ?  -30  DG  I "O4'" 1 
ATOM   7175  C  "C3'" . DG  I 6  57   ? 228.066 171.050 205.117 1.00 143.57 ?  -30  DG  I "C3'" 1 
ATOM   7176  O  "O3'" . DG  I 6  57   ? 229.286 170.499 204.610 1.00 143.14 ?  -30  DG  I "O3'" 1 
ATOM   7177  C  "C2'" . DG  I 6  57   ? 227.445 172.084 204.192 1.00 143.99 ?  -30  DG  I "C2'" 1 
ATOM   7178  C  "C1'" . DG  I 6  57   ? 226.426 171.292 203.391 1.00 144.42 ?  -30  DG  I "C1'" 1 
ATOM   7179  N  N9    . DG  I 6  57   ? 225.248 172.064 203.013 1.00 144.45 ?  -30  DG  I N9    1 
ATOM   7180  C  C8    . DG  I 6  57   ? 224.718 173.142 203.681 1.00 144.57 ?  -30  DG  I C8    1 
ATOM   7181  N  N7    . DG  I 6  57   ? 223.653 173.629 203.104 1.00 144.81 ?  -30  DG  I N7    1 
ATOM   7182  C  C5    . DG  I 6  57   ? 223.464 172.823 201.991 1.00 144.76 ?  -30  DG  I C5    1 
ATOM   7183  C  C6    . DG  I 6  57   ? 222.463 172.866 200.980 1.00 144.64 ?  -30  DG  I C6    1 
ATOM   7184  O  O6    . DG  I 6  57   ? 221.516 173.654 200.867 1.00 144.55 ?  -30  DG  I O6    1 
ATOM   7185  N  N1    . DG  I 6  57   ? 222.646 171.861 200.035 1.00 144.66 ?  -30  DG  I N1    1 
ATOM   7186  C  C2    . DG  I 6  57   ? 223.659 170.933 200.058 1.00 144.74 ?  -30  DG  I C2    1 
ATOM   7187  N  N2    . DG  I 6  57   ? 223.665 170.041 199.056 1.00 144.65 ?  -30  DG  I N2    1 
ATOM   7188  N  N3    . DG  I 6  57   ? 224.597 170.881 200.993 1.00 144.83 ?  -30  DG  I N3    1 
ATOM   7189  C  C4    . DG  I 6  57   ? 224.440 171.849 201.922 1.00 144.70 ?  -30  DG  I C4    1 
ATOM   7190  P  P     . DC  I 6  58   ? 229.974 171.138 203.314 1.00 143.23 ?  -29  DC  I P     1 
ATOM   7191  O  OP1   . DC  I 6  58   ? 231.229 170.391 203.044 1.00 142.94 ?  -29  DC  I OP1   1 
ATOM   7192  O  OP2   . DC  I 6  58   ? 230.020 172.612 203.496 1.00 143.12 -1 -29  DC  I OP2   1 
ATOM   7193  O  "O5'" . DC  I 6  58   ? 228.934 170.805 202.154 1.00 142.54 ?  -29  DC  I "O5'" 1 
ATOM   7194  C  "C5'" . DC  I 6  58   ? 229.380 170.299 200.881 1.00 141.06 ?  -29  DC  I "C5'" 1 
ATOM   7195  C  "C4'" . DC  I 6  58   ? 228.874 171.178 199.760 1.00 139.88 ?  -29  DC  I "C4'" 1 
ATOM   7196  O  "O4'" . DC  I 6  58   ? 227.543 171.634 200.070 1.00 139.41 ?  -29  DC  I "O4'" 1 
ATOM   7197  C  "C3'" . DC  I 6  58   ? 229.688 172.448 199.526 1.00 139.40 ?  -29  DC  I "C3'" 1 
ATOM   7198  O  "O3'" . DC  I 6  58   ? 230.647 172.238 198.484 1.00 138.51 ?  -29  DC  I "O3'" 1 
ATOM   7199  C  "C2'" . DC  I 6  58   ? 228.653 173.476 199.089 1.00 139.50 ?  -29  DC  I "C2'" 1 
ATOM   7200  C  "C1'" . DC  I 6  58   ? 227.294 172.826 199.347 1.00 139.27 ?  -29  DC  I "C1'" 1 
ATOM   7201  N  N1    . DC  I 6  58   ? 226.373 173.650 200.143 1.00 139.14 ?  -29  DC  I N1    1 
ATOM   7202  C  C2    . DC  I 6  58   ? 225.218 174.146 199.535 1.00 139.25 ?  -29  DC  I C2    1 
ATOM   7203  O  O2    . DC  I 6  58   ? 225.006 173.878 198.343 1.00 139.24 ?  -29  DC  I O2    1 
ATOM   7204  N  N3    . DC  I 6  58   ? 224.363 174.904 200.259 1.00 139.17 ?  -29  DC  I N3    1 
ATOM   7205  C  C4    . DC  I 6  58   ? 224.629 175.170 201.539 1.00 139.10 ?  -29  DC  I C4    1 
ATOM   7206  N  N4    . DC  I 6  58   ? 223.758 175.924 202.216 1.00 139.09 ?  -29  DC  I N4    1 
ATOM   7207  C  C5    . DC  I 6  58   ? 225.800 174.677 202.184 1.00 139.09 ?  -29  DC  I C5    1 
ATOM   7208  C  C6    . DC  I 6  58   ? 226.636 173.928 201.455 1.00 139.03 ?  -29  DC  I C6    1 
ATOM   7209  P  P     . DT  I 6  59   ? 230.658 173.186 197.191 1.00 138.05 ?  -28  DT  I P     1 
ATOM   7210  O  OP1   . DT  I 6  59   ? 231.714 172.694 196.270 1.00 138.14 ?  -28  DT  I OP1   1 
ATOM   7211  O  OP2   . DT  I 6  59   ? 230.689 174.595 197.657 1.00 137.41 -1 -28  DT  I OP2   1 
ATOM   7212  O  "O5'" . DT  I 6  59   ? 229.243 172.902 196.517 1.00 139.15 ?  -28  DT  I "O5'" 1 
ATOM   7213  C  "C5'" . DT  I 6  59   ? 229.146 172.291 195.211 1.00 139.72 ?  -28  DT  I "C5'" 1 
ATOM   7214  C  "C4'" . DT  I 6  59   ? 228.419 173.197 194.241 1.00 140.07 ?  -28  DT  I "C4'" 1 
ATOM   7215  O  "O4'" . DT  I 6  59   ? 227.423 173.977 194.946 1.00 139.99 ?  -28  DT  I "O4'" 1 
ATOM   7216  C  "C3'" . DT  I 6  59   ? 229.305 174.224 193.541 1.00 140.33 ?  -28  DT  I "C3'" 1 
ATOM   7217  O  "O3'" . DT  I 6  59   ? 228.677 174.666 192.334 1.00 140.73 ?  -28  DT  I "O3'" 1 
ATOM   7218  C  "C2'" . DT  I 6  59   ? 229.252 175.394 194.502 1.00 140.25 ?  -28  DT  I "C2'" 1 
ATOM   7219  C  "C1'" . DT  I 6  59   ? 227.793 175.352 194.936 1.00 140.11 ?  -28  DT  I "C1'" 1 
ATOM   7220  N  N1    . DT  I 6  59   ? 227.530 175.901 196.277 1.00 140.20 ?  -28  DT  I N1    1 
ATOM   7221  C  C2    . DT  I 6  59   ? 226.221 176.116 196.647 1.00 140.22 ?  -28  DT  I C2    1 
ATOM   7222  O  O2    . DT  I 6  59   ? 225.275 175.871 195.917 1.00 140.01 ?  -28  DT  I O2    1 
ATOM   7223  N  N3    . DT  I 6  59   ? 226.061 176.630 197.910 1.00 140.05 ?  -28  DT  I N3    1 
ATOM   7224  C  C4    . DT  I 6  59   ? 227.056 176.943 198.817 1.00 139.99 ?  -28  DT  I C4    1 
ATOM   7225  O  O4    . DT  I 6  59   ? 226.758 177.398 199.918 1.00 139.95 ?  -28  DT  I O4    1 
ATOM   7226  C  C5    . DT  I 6  59   ? 228.404 176.693 198.363 1.00 140.07 ?  -28  DT  I C5    1 
ATOM   7227  C  C7    . DT  I 6  59   ? 229.547 177.001 199.277 1.00 140.21 ?  -28  DT  I C7    1 
ATOM   7228  C  C6    . DT  I 6  59   ? 228.571 176.192 197.132 1.00 140.13 ?  -28  DT  I C6    1 
ATOM   7229  P  P     . DC  I 6  60   ? 228.643 173.717 191.049 1.00 141.08 ?  -27  DC  I P     1 
ATOM   7230  O  OP1   . DC  I 6  60   ? 228.242 172.359 191.491 1.00 140.55 ?  -27  DC  I OP1   1 
ATOM   7231  O  OP2   . DC  I 6  60   ? 229.917 173.898 190.311 1.00 141.03 -1 -27  DC  I OP2   1 
ATOM   7232  O  "O5'" . DC  I 6  60   ? 227.460 174.339 190.182 1.00 140.45 ?  -27  DC  I "O5'" 1 
ATOM   7233  C  "C5'" . DC  I 6  60   ? 226.146 174.505 190.747 1.00 139.51 ?  -27  DC  I "C5'" 1 
ATOM   7234  C  "C4'" . DC  I 6  60   ? 225.698 175.944 190.627 1.00 138.74 ?  -27  DC  I "C4'" 1 
ATOM   7235  O  "O4'" . DC  I 6  60   ? 225.786 176.590 191.919 1.00 139.15 ?  -27  DC  I "O4'" 1 
ATOM   7236  C  "C3'" . DC  I 6  60   ? 226.518 176.806 189.665 1.00 137.87 ?  -27  DC  I "C3'" 1 
ATOM   7237  O  "O3'" . DC  I 6  60   ? 225.651 177.709 188.975 1.00 136.30 ?  -27  DC  I "O3'" 1 
ATOM   7238  C  "C2'" . DC  I 6  60   ? 227.429 177.591 190.591 1.00 138.32 ?  -27  DC  I "C2'" 1 
ATOM   7239  C  "C1'" . DC  I 6  60   ? 226.536 177.788 191.802 1.00 139.10 ?  -27  DC  I "C1'" 1 
ATOM   7240  N  N1    . DC  I 6  60   ? 227.257 177.996 193.068 1.00 139.34 ?  -27  DC  I N1    1 
ATOM   7241  C  C2    . DC  I 6  60   ? 226.549 178.475 194.173 1.00 139.31 ?  -27  DC  I C2    1 
ATOM   7242  O  O2    . DC  I 6  60   ? 225.336 178.705 194.054 1.00 139.46 ?  -27  DC  I O2    1 
ATOM   7243  N  N3    . DC  I 6  60   ? 227.203 178.674 195.341 1.00 139.31 ?  -27  DC  I N3    1 
ATOM   7244  C  C4    . DC  I 6  60   ? 228.509 178.414 195.426 1.00 139.34 ?  -27  DC  I C4    1 
ATOM   7245  N  N4    . DC  I 6  60   ? 229.113 178.624 196.598 1.00 139.46 ?  -27  DC  I N4    1 
ATOM   7246  C  C5    . DC  I 6  60   ? 229.255 177.926 194.314 1.00 139.37 ?  -27  DC  I C5    1 
ATOM   7247  C  C6    . DC  I 6  60   ? 228.595 177.735 193.164 1.00 139.30 ?  -27  DC  I C6    1 
ATOM   7248  P  P     . DT  I 6  61   ? 226.052 178.278 187.537 1.00 135.12 ?  -26  DT  I P     1 
ATOM   7249  O  OP1   . DT  I 6  61   ? 226.245 177.124 186.622 1.00 134.98 ?  -26  DT  I OP1   1 
ATOM   7250  O  OP2   . DT  I 6  61   ? 227.149 179.262 187.721 1.00 134.79 -1 -26  DT  I OP2   1 
ATOM   7251  O  "O5'" . DT  I 6  61   ? 224.739 179.063 187.089 1.00 133.80 ?  -26  DT  I "O5'" 1 
ATOM   7252  C  "C5'" . DT  I 6  61   ? 223.460 178.400 187.051 1.00 131.61 ?  -26  DT  I "C5'" 1 
ATOM   7253  C  "C4'" . DT  I 6  61   ? 222.442 179.166 187.863 1.00 129.97 ?  -26  DT  I "C4'" 1 
ATOM   7254  O  "O4'" . DT  I 6  61   ? 223.031 179.581 189.118 1.00 130.05 ?  -26  DT  I "O4'" 1 
ATOM   7255  C  "C3'" . DT  I 6  61   ? 221.913 180.439 187.196 1.00 128.25 ?  -26  DT  I "C3'" 1 
ATOM   7256  O  "O3'" . DT  I 6  61   ? 220.494 180.553 187.353 1.00 125.08 ?  -26  DT  I "O3'" 1 
ATOM   7257  C  "C2'" . DT  I 6  61   ? 222.626 181.556 187.938 1.00 129.00 ?  -26  DT  I "C2'" 1 
ATOM   7258  C  "C1'" . DT  I 6  61   ? 222.799 180.965 189.323 1.00 130.12 ?  -26  DT  I "C1'" 1 
ATOM   7259  N  N1    . DT  I 6  61   ? 223.943 181.508 190.076 1.00 130.60 ?  -26  DT  I N1    1 
ATOM   7260  C  C2    . DT  I 6  61   ? 223.689 182.416 191.078 1.00 130.68 ?  -26  DT  I C2    1 
ATOM   7261  O  O2    . DT  I 6  61   ? 222.564 182.789 191.370 1.00 130.76 ?  -26  DT  I O2    1 
ATOM   7262  N  N3    . DT  I 6  61   ? 224.806 182.873 191.731 1.00 130.48 ?  -26  DT  I N3    1 
ATOM   7263  C  C4    . DT  I 6  61   ? 226.120 182.522 191.485 1.00 130.51 ?  -26  DT  I C4    1 
ATOM   7264  O  O4    . DT  I 6  61   ? 227.022 183.018 192.156 1.00 130.42 ?  -26  DT  I O4    1 
ATOM   7265  C  C5    . DT  I 6  61   ? 226.313 181.566 190.419 1.00 130.75 ?  -26  DT  I C5    1 
ATOM   7266  C  C7    . DT  I 6  61   ? 227.701 181.125 190.081 1.00 130.60 ?  -26  DT  I C7    1 
ATOM   7267  C  C6    . DT  I 6  61   ? 225.229 181.113 189.777 1.00 130.74 ?  -26  DT  I C6    1 
ATOM   7268  P  P     . DA  I 6  62   ? 219.713 181.790 186.707 1.00 122.73 ?  -25  DA  I P     1 
ATOM   7269  O  OP1   . DA  I 6  62   ? 218.266 181.460 186.689 1.00 122.30 ?  -25  DA  I OP1   1 
ATOM   7270  O  OP2   . DA  I 6  62   ? 220.399 182.157 185.443 1.00 122.34 -1 -25  DA  I OP2   1 
ATOM   7271  O  "O5'" . DA  I 6  62   ? 219.952 182.957 187.765 1.00 122.34 ?  -25  DA  I "O5'" 1 
ATOM   7272  C  "C5'" . DA  I 6  62   ? 219.057 183.145 188.878 1.00 120.22 ?  -25  DA  I "C5'" 1 
ATOM   7273  C  "C4'" . DA  I 6  62   ? 219.048 184.597 189.296 1.00 118.45 ?  -25  DA  I "C4'" 1 
ATOM   7274  O  "O4'" . DA  I 6  62   ? 220.333 184.936 189.868 1.00 118.82 ?  -25  DA  I "O4'" 1 
ATOM   7275  C  "C3'" . DA  I 6  62   ? 218.833 185.584 188.151 1.00 116.90 ?  -25  DA  I "C3'" 1 
ATOM   7276  O  "O3'" . DA  I 6  62   ? 218.174 186.760 188.629 1.00 114.53 ?  -25  DA  I "O3'" 1 
ATOM   7277  C  "C2'" . DA  I 6  62   ? 220.250 185.937 187.741 1.00 117.75 ?  -25  DA  I "C2'" 1 
ATOM   7278  C  "C1'" . DA  I 6  62   ? 220.970 185.935 189.080 1.00 119.25 ?  -25  DA  I "C1'" 1 
ATOM   7279  N  N9    . DA  I 6  62   ? 222.392 185.604 189.001 1.00 119.58 ?  -25  DA  I N9    1 
ATOM   7280  C  C8    . DA  I 6  62   ? 223.053 184.964 187.982 1.00 119.79 ?  -25  DA  I C8    1 
ATOM   7281  N  N7    . DA  I 6  62   ? 224.336 184.810 188.199 1.00 119.97 ?  -25  DA  I N7    1 
ATOM   7282  C  C5    . DA  I 6  62   ? 224.535 185.389 189.445 1.00 120.08 ?  -25  DA  I C5    1 
ATOM   7283  C  C6    . DA  I 6  62   ? 225.682 185.550 190.240 1.00 119.90 ?  -25  DA  I C6    1 
ATOM   7284  N  N6    . DA  I 6  62   ? 226.897 185.125 189.883 1.00 119.63 ?  -25  DA  I N6    1 
ATOM   7285  N  N1    . DA  I 6  62   ? 225.538 186.171 191.431 1.00 120.09 ?  -25  DA  I N1    1 
ATOM   7286  C  C2    . DA  I 6  62   ? 224.320 186.596 191.788 1.00 119.83 ?  -25  DA  I C2    1 
ATOM   7287  N  N3    . DA  I 6  62   ? 223.168 186.504 191.128 1.00 119.86 ?  -25  DA  I N3    1 
ATOM   7288  C  C4    . DA  I 6  62   ? 223.346 185.882 189.950 1.00 119.89 ?  -25  DA  I C4    1 
ATOM   7289  P  P     . DG  I 6  63   ? 216.620 186.713 189.005 1.00 113.07 ?  -24  DG  I P     1 
ATOM   7290  O  OP1   . DG  I 6  63   ? 216.292 185.330 189.433 1.00 112.45 ?  -24  DG  I OP1   1 
ATOM   7291  O  OP2   . DG  I 6  63   ? 215.860 187.339 187.893 1.00 113.35 -1 -24  DG  I OP2   1 
ATOM   7292  O  "O5'" . DG  I 6  63   ? 216.533 187.665 190.280 1.00 112.82 ?  -24  DG  I "O5'" 1 
ATOM   7293  C  "C5'" . DG  I 6  63   ? 217.063 187.243 191.549 1.00 111.79 ?  -24  DG  I "C5'" 1 
ATOM   7294  C  "C4'" . DG  I 6  63   ? 217.743 188.397 192.249 1.00 110.28 ?  -24  DG  I "C4'" 1 
ATOM   7295  O  "O4'" . DG  I 6  63   ? 219.166 188.359 191.984 1.00 109.67 ?  -24  DG  I "O4'" 1 
ATOM   7296  C  "C3'" . DG  I 6  63   ? 217.267 189.789 191.827 1.00 109.56 ?  -24  DG  I "C3'" 1 
ATOM   7297  O  "O3'" . DG  I 6  63   ? 217.158 190.615 192.990 1.00 107.53 ?  -24  DG  I "O3'" 1 
ATOM   7298  C  "C2'" . DG  I 6  63   ? 218.385 190.290 190.930 1.00 110.03 ?  -24  DG  I "C2'" 1 
ATOM   7299  C  "C1'" . DG  I 6  63   ? 219.604 189.634 191.550 1.00 110.98 ?  -24  DG  I "C1'" 1 
ATOM   7300  N  N9    . DG  I 6  63   ? 220.718 189.437 190.630 1.00 111.13 ?  -24  DG  I N9    1 
ATOM   7301  C  C8    . DG  I 6  63   ? 220.647 189.065 189.309 1.00 111.45 ?  -24  DG  I C8    1 
ATOM   7302  N  N7    . DG  I 6  63   ? 221.818 188.968 188.740 1.00 111.30 ?  -24  DG  I N7    1 
ATOM   7303  C  C5    . DG  I 6  63   ? 222.717 189.295 189.745 1.00 111.18 ?  -24  DG  I C5    1 
ATOM   7304  C  C6    . DG  I 6  63   ? 224.139 189.364 189.723 1.00 111.45 ?  -24  DG  I C6    1 
ATOM   7305  O  O6    . DG  I 6  63   ? 224.908 189.142 188.780 1.00 111.50 ?  -24  DG  I O6    1 
ATOM   7306  N  N1    . DG  I 6  63   ? 224.653 189.737 190.963 1.00 111.56 ?  -24  DG  I N1    1 
ATOM   7307  C  C2    . DG  I 6  63   ? 223.898 190.007 192.079 1.00 111.47 ?  -24  DG  I C2    1 
ATOM   7308  N  N2    . DG  I 6  63   ? 224.579 190.350 193.183 1.00 111.52 ?  -24  DG  I N2    1 
ATOM   7309  N  N3    . DG  I 6  63   ? 222.574 189.947 192.112 1.00 111.48 ?  -24  DG  I N3    1 
ATOM   7310  C  C4    . DG  I 6  63   ? 222.054 189.588 190.919 1.00 111.21 ?  -24  DG  I C4    1 
ATOM   7311  P  P     . DC  I 6  64   ? 216.738 192.152 192.843 1.00 106.35 ?  -23  DC  I P     1 
ATOM   7312  O  OP1   . DC  I 6  64   ? 215.734 192.455 193.894 1.00 106.27 ?  -23  DC  I OP1   1 
ATOM   7313  O  OP2   . DC  I 6  64   ? 216.412 192.407 191.417 1.00 107.12 -1 -23  DC  I OP2   1 
ATOM   7314  O  "O5'" . DC  I 6  64   ? 218.083 192.927 193.199 1.00 108.95 ?  -23  DC  I "O5'" 1 
ATOM   7315  C  "C5'" . DC  I 6  64   ? 218.861 192.560 194.352 1.00 112.09 ?  -23  DC  I "C5'" 1 
ATOM   7316  C  "C4'" . DC  I 6  64   ? 220.152 193.343 194.384 1.00 114.21 ?  -23  DC  I "C4'" 1 
ATOM   7317  O  "O4'" . DC  I 6  64   ? 221.002 192.917 193.301 1.00 114.49 ?  -23  DC  I "O4'" 1 
ATOM   7318  C  "C3'" . DC  I 6  64   ? 219.996 194.851 194.199 1.00 115.98 ?  -23  DC  I "C3'" 1 
ATOM   7319  O  "O3'" . DC  I 6  64   ? 219.962 195.481 195.482 1.00 118.06 ?  -23  DC  I "O3'" 1 
ATOM   7320  C  "C2'" . DC  I 6  64   ? 221.238 195.259 193.418 1.00 115.44 ?  -23  DC  I "C2'" 1 
ATOM   7321  C  "C1'" . DC  I 6  64   ? 221.933 193.950 193.047 1.00 115.23 ?  -23  DC  I "C1'" 1 
ATOM   7322  N  N1    . DC  I 6  64   ? 222.341 193.853 191.638 1.00 115.42 ?  -23  DC  I N1    1 
ATOM   7323  C  C2    . DC  I 6  64   ? 223.619 193.373 191.339 1.00 115.59 ?  -23  DC  I C2    1 
ATOM   7324  O  O2    . DC  I 6  64   ? 224.369 193.045 192.270 1.00 116.04 ?  -23  DC  I O2    1 
ATOM   7325  N  N3    . DC  I 6  64   ? 224.003 193.280 190.046 1.00 116.05 ?  -23  DC  I N3    1 
ATOM   7326  C  C4    . DC  I 6  64   ? 223.165 193.645 189.073 1.00 115.86 ?  -23  DC  I C4    1 
ATOM   7327  N  N4    . DC  I 6  64   ? 223.587 193.536 187.810 1.00 115.72 ?  -23  DC  I N4    1 
ATOM   7328  C  C5    . DC  I 6  64   ? 221.857 194.136 189.350 1.00 115.94 ?  -23  DC  I C5    1 
ATOM   7329  C  C6    . DC  I 6  64   ? 221.489 194.223 190.634 1.00 115.91 ?  -23  DC  I C6    1 
ATOM   7330  P  P     . DA  I 6  65   ? 219.977 197.081 195.591 1.00 118.94 ?  -22  DA  I P     1 
ATOM   7331  O  OP1   . DA  I 6  65   ? 220.022 197.443 197.030 1.00 119.15 ?  -22  DA  I OP1   1 
ATOM   7332  O  OP2   . DA  I 6  65   ? 218.885 197.610 194.735 1.00 118.67 -1 -22  DA  I OP2   1 
ATOM   7333  O  "O5'" . DA  I 6  65   ? 221.372 197.481 194.931 1.00 120.48 ?  -22  DA  I "O5'" 1 
ATOM   7334  C  "C5'" . DA  I 6  65   ? 222.551 196.691 195.168 1.00 123.90 ?  -22  DA  I "C5'" 1 
ATOM   7335  C  "C4'" . DA  I 6  65   ? 223.800 197.462 194.807 1.00 126.86 ?  -22  DA  I "C4'" 1 
ATOM   7336  O  "O4'" . DA  I 6  65   ? 224.431 196.848 193.657 1.00 128.00 ?  -22  DA  I "O4'" 1 
ATOM   7337  C  "C3'" . DA  I 6  65   ? 223.593 198.930 194.430 1.00 128.67 ?  -22  DA  I "C3'" 1 
ATOM   7338  O  "O3'" . DA  I 6  65   ? 224.761 199.655 194.825 1.00 130.91 ?  -22  DA  I "O3'" 1 
ATOM   7339  C  "C2'" . DA  I 6  65   ? 223.533 198.883 192.915 1.00 129.22 ?  -22  DA  I "C2'" 1 
ATOM   7340  C  "C1'" . DA  I 6  65   ? 224.548 197.797 192.607 1.00 129.82 ?  -22  DA  I "C1'" 1 
ATOM   7341  N  N9    . DA  I 6  65   ? 224.330 197.096 191.343 1.00 130.15 ?  -22  DA  I N9    1 
ATOM   7342  C  C8    . DA  I 6  65   ? 223.141 196.660 190.813 1.00 130.14 ?  -22  DA  I C8    1 
ATOM   7343  N  N7    . DA  I 6  65   ? 223.267 196.056 189.656 1.00 130.58 ?  -22  DA  I N7    1 
ATOM   7344  C  C5    . DA  I 6  65   ? 224.632 196.095 189.408 1.00 130.61 ?  -22  DA  I C5    1 
ATOM   7345  C  C6    . DA  I 6  65   ? 225.414 195.621 188.340 1.00 130.33 ?  -22  DA  I C6    1 
ATOM   7346  N  N6    . DA  I 6  65   ? 224.910 194.988 187.277 1.00 130.38 ?  -22  DA  I N6    1 
ATOM   7347  N  N1    . DA  I 6  65   ? 226.749 195.821 188.401 1.00 130.21 ?  -22  DA  I N1    1 
ATOM   7348  C  C2    . DA  I 6  65   ? 227.252 196.455 189.466 1.00 130.43 ?  -22  DA  I C2    1 
ATOM   7349  N  N3    . DA  I 6  65   ? 226.623 196.947 190.531 1.00 130.86 ?  -22  DA  I N3    1 
ATOM   7350  C  C4    . DA  I 6  65   ? 225.299 196.731 190.439 1.00 130.61 ?  -22  DA  I C4    1 
ATOM   7351  P  P     . DC  I 6  66   ? 224.712 201.249 194.941 1.00 132.74 ?  -21  DC  I P     1 
ATOM   7352  O  OP1   . DC  I 6  66   ? 224.723 201.607 196.381 1.00 132.78 ?  -21  DC  I OP1   1 
ATOM   7353  O  OP2   . DC  I 6  66   ? 223.614 201.740 194.070 1.00 132.06 -1 -21  DC  I OP2   1 
ATOM   7354  O  "O5'" . DC  I 6  66   ? 226.103 201.689 194.302 1.00 134.52 ?  -21  DC  I "O5'" 1 
ATOM   7355  C  "C5'" . DC  I 6  66   ? 226.993 200.702 193.751 1.00 137.54 ?  -21  DC  I "C5'" 1 
ATOM   7356  C  "C4'" . DC  I 6  66   ? 227.636 201.228 192.489 1.00 140.03 ?  -21  DC  I "C4'" 1 
ATOM   7357  O  "O4'" . DC  I 6  66   ? 227.422 200.295 191.405 1.00 140.92 ?  -21  DC  I "O4'" 1 
ATOM   7358  C  "C3'" . DC  I 6  66   ? 227.099 202.578 192.008 1.00 141.52 ?  -21  DC  I "C3'" 1 
ATOM   7359  O  "O3'" . DC  I 6  66   ? 228.204 203.392 191.613 1.00 143.45 ?  -21  DC  I "O3'" 1 
ATOM   7360  C  "C2'" . DC  I 6  66   ? 226.232 202.217 190.814 1.00 141.44 ?  -21  DC  I "C2'" 1 
ATOM   7361  C  "C1'" . DC  I 6  66   ? 226.927 200.984 190.271 1.00 141.47 ?  -21  DC  I "C1'" 1 
ATOM   7362  N  N1    . DC  I 6  66   ? 226.044 200.065 189.536 1.00 141.47 ?  -21  DC  I N1    1 
ATOM   7363  C  C2    . DC  I 6  66   ? 226.554 199.385 188.427 1.00 141.46 ?  -21  DC  I C2    1 
ATOM   7364  O  O2    . DC  I 6  66   ? 227.734 199.578 188.097 1.00 141.41 ?  -21  DC  I O2    1 
ATOM   7365  N  N3    . DC  I 6  66   ? 225.751 198.536 187.746 1.00 141.48 ?  -21  DC  I N3    1 
ATOM   7366  C  C4    . DC  I 6  66   ? 224.487 198.357 188.136 1.00 141.52 ?  -21  DC  I C4    1 
ATOM   7367  N  N4    . DC  I 6  66   ? 223.729 197.511 187.434 1.00 141.48 ?  -21  DC  I N4    1 
ATOM   7368  C  C5    . DC  I 6  66   ? 223.942 199.038 189.263 1.00 141.55 ?  -21  DC  I C5    1 
ATOM   7369  C  C6    . DC  I 6  66   ? 224.749 199.874 189.928 1.00 141.38 ?  -21  DC  I C6    1 
ATOM   7370  P  P     . DC  I 6  67   ? 227.981 204.944 191.290 1.00 144.90 ?  -20  DC  I P     1 
ATOM   7371  O  OP1   . DC  I 6  67   ? 228.360 205.723 192.496 1.00 144.52 ?  -20  DC  I OP1   1 
ATOM   7372  O  OP2   . DC  I 6  67   ? 226.624 205.101 190.709 1.00 144.95 -1 -20  DC  I OP2   1 
ATOM   7373  O  "O5'" . DC  I 6  67   ? 229.056 205.234 190.150 1.00 145.70 ?  -20  DC  I "O5'" 1 
ATOM   7374  C  "C5'" . DC  I 6  67   ? 229.855 204.171 189.597 1.00 147.01 ?  -20  DC  I "C5'" 1 
ATOM   7375  C  "C4'" . DC  I 6  67   ? 230.180 204.460 188.150 1.00 148.23 ?  -20  DC  I "C4'" 1 
ATOM   7376  O  "O4'" . DC  I 6  67   ? 229.615 203.422 187.313 1.00 148.27 ?  -20  DC  I "O4'" 1 
ATOM   7377  C  "C3'" . DC  I 6  67   ? 229.617 205.776 187.616 1.00 149.02 ?  -20  DC  I "C3'" 1 
ATOM   7378  O  "O3'" . DC  I 6  67   ? 230.505 206.321 186.635 1.00 150.19 ?  -20  DC  I "O3'" 1 
ATOM   7379  C  "C2'" . DC  I 6  67   ? 228.315 205.351 186.964 1.00 148.66 ?  -20  DC  I "C2'" 1 
ATOM   7380  C  "C1'" . DC  I 6  67   ? 228.665 203.978 186.415 1.00 148.42 ?  -20  DC  I "C1'" 1 
ATOM   7381  N  N1    . DC  I 6  67   ? 227.528 203.050 186.334 1.00 148.39 ?  -20  DC  I N1    1 
ATOM   7382  C  C2    . DC  I 6  67   ? 227.411 202.223 185.214 1.00 148.25 ?  -20  DC  I C2    1 
ATOM   7383  O  O2    . DC  I 6  67   ? 228.270 202.297 184.323 1.00 148.11 ?  -20  DC  I O2    1 
ATOM   7384  N  N3    . DC  I 6  67   ? 226.368 201.365 185.132 1.00 148.27 ?  -20  DC  I N3    1 
ATOM   7385  C  C4    . DC  I 6  67   ? 225.465 201.317 186.114 1.00 148.33 ?  -20  DC  I C4    1 
ATOM   7386  N  N4    . DC  I 6  67   ? 224.452 200.456 185.990 1.00 148.36 ?  -20  DC  I N4    1 
ATOM   7387  C  C5    . DC  I 6  67   ? 225.560 202.150 187.266 1.00 148.24 ?  -20  DC  I C5    1 
ATOM   7388  C  C6    . DC  I 6  67   ? 226.598 202.994 187.335 1.00 148.38 ?  -20  DC  I C6    1 
ATOM   7389  P  P     . DG  I 6  68   ? 230.655 207.906 186.484 1.00 151.04 ?  -19  DG  I P     1 
ATOM   7390  O  OP1   . DG  I 6  68   ? 231.946 208.305 187.099 1.00 151.15 ?  -19  DG  I OP1   1 
ATOM   7391  O  OP2   . DG  I 6  68   ? 229.393 208.533 186.953 1.00 150.77 -1 -19  DG  I OP2   1 
ATOM   7392  O  "O5'" . DG  I 6  68   ? 230.766 208.108 184.906 1.00 151.21 ?  -19  DG  I "O5'" 1 
ATOM   7393  C  "C5'" . DG  I 6  68   ? 231.519 207.188 184.091 1.00 151.26 ?  -19  DG  I "C5'" 1 
ATOM   7394  C  "C4'" . DG  I 6  68   ? 230.966 207.166 182.684 1.00 151.25 ?  -19  DG  I "C4'" 1 
ATOM   7395  O  "O4'" . DG  I 6  68   ? 229.949 206.139 182.587 1.00 151.49 ?  -19  DG  I "O4'" 1 
ATOM   7396  C  "C3'" . DG  I 6  68   ? 230.272 208.459 182.260 1.00 151.12 ?  -19  DG  I "C3'" 1 
ATOM   7397  O  "O3'" . DG  I 6  68   ? 230.244 208.550 180.834 1.00 151.06 ?  -19  DG  I "O3'" 1 
ATOM   7398  C  "C2'" . DG  I 6  68   ? 228.838 208.201 182.672 1.00 151.03 ?  -19  DG  I "C2'" 1 
ATOM   7399  C  "C1'" . DG  I 6  68   ? 228.700 206.742 182.272 1.00 151.37 ?  -19  DG  I "C1'" 1 
ATOM   7400  N  N9    . DG  I 6  68   ? 227.653 206.003 182.969 1.00 151.48 ?  -19  DG  I N9    1 
ATOM   7401  C  C8    . DG  I 6  68   ? 227.261 206.150 184.277 1.00 151.57 ?  -19  DG  I C8    1 
ATOM   7402  N  N7    . DG  I 6  68   ? 226.290 205.345 184.616 1.00 151.55 ?  -19  DG  I N7    1 
ATOM   7403  C  C5    . DG  I 6  68   ? 226.024 204.623 183.459 1.00 151.39 ?  -19  DG  I C5    1 
ATOM   7404  C  C6    . DG  I 6  68   ? 225.069 203.597 183.212 1.00 151.30 ?  -19  DG  I C6    1 
ATOM   7405  O  O6    . DG  I 6  68   ? 224.242 203.109 183.992 1.00 151.50 ?  -19  DG  I O6    1 
ATOM   7406  N  N1    . DG  I 6  68   ? 225.137 203.138 181.899 1.00 151.46 ?  -19  DG  I N1    1 
ATOM   7407  C  C2    . DG  I 6  68   ? 226.013 203.604 180.948 1.00 151.61 ?  -19  DG  I C2    1 
ATOM   7408  N  N2    . DG  I 6  68   ? 225.926 203.034 179.736 1.00 151.54 ?  -19  DG  I N2    1 
ATOM   7409  N  N3    . DG  I 6  68   ? 226.908 204.557 181.165 1.00 151.50 ?  -19  DG  I N3    1 
ATOM   7410  C  C4    . DG  I 6  68   ? 226.857 205.019 182.433 1.00 151.42 ?  -19  DG  I C4    1 
ATOM   7411  P  P     . DC  I 6  69   ? 231.266 209.507 180.063 1.00 150.83 ?  -18  DC  I P     1 
ATOM   7412  O  OP1   . DC  I 6  69   ? 232.628 208.932 180.201 1.00 150.56 ?  -18  DC  I OP1   1 
ATOM   7413  O  OP2   . DC  I 6  69   ? 231.009 210.903 180.498 1.00 150.40 -1 -18  DC  I OP2   1 
ATOM   7414  O  "O5'" . DC  I 6  69   ? 230.814 209.356 178.542 1.00 150.46 ?  -18  DC  I "O5'" 1 
ATOM   7415  C  "C5'" . DC  I 6  69   ? 231.287 208.260 177.736 1.00 149.68 ?  -18  DC  I "C5'" 1 
ATOM   7416  C  "C4'" . DC  I 6  69   ? 230.162 207.695 176.899 1.00 148.82 ?  -18  DC  I "C4'" 1 
ATOM   7417  O  "O4'" . DC  I 6  69   ? 229.147 207.128 177.764 1.00 148.65 ?  -18  DC  I "O4'" 1 
ATOM   7418  C  "C3'" . DC  I 6  69   ? 229.444 208.712 176.009 1.00 148.53 ?  -18  DC  I "C3'" 1 
ATOM   7419  O  "O3'" . DC  I 6  69   ? 229.203 208.156 174.712 1.00 147.80 ?  -18  DC  I "O3'" 1 
ATOM   7420  C  "C2'" . DC  I 6  69   ? 228.130 208.957 176.729 1.00 148.62 ?  -18  DC  I "C2'" 1 
ATOM   7421  C  "C1'" . DC  I 6  69   ? 227.872 207.610 177.378 1.00 148.66 ?  -18  DC  I "C1'" 1 
ATOM   7422  N  N1    . DC  I 6  69   ? 227.026 207.666 178.579 1.00 148.78 ?  -18  DC  I N1    1 
ATOM   7423  C  C2    . DC  I 6  69   ? 225.792 207.010 178.562 1.00 149.05 ?  -18  DC  I C2    1 
ATOM   7424  O  O2    . DC  I 6  69   ? 225.450 206.404 177.536 1.00 149.16 ?  -18  DC  I O2    1 
ATOM   7425  N  N3    . DC  I 6  69   ? 225.004 207.055 179.662 1.00 148.97 ?  -18  DC  I N3    1 
ATOM   7426  C  C4    . DC  I 6  69   ? 225.410 207.721 180.745 1.00 148.68 ?  -18  DC  I C4    1 
ATOM   7427  N  N4    . DC  I 6  69   ? 224.602 207.739 181.808 1.00 148.54 ?  -18  DC  I N4    1 
ATOM   7428  C  C5    . DC  I 6  69   ? 226.664 208.398 180.788 1.00 149.00 ?  -18  DC  I C5    1 
ATOM   7429  C  C6    . DC  I 6  69   ? 227.432 208.345 179.693 1.00 148.94 ?  -18  DC  I C6    1 
ATOM   7430  P  P     . DT  I 6  70   ? 228.695 209.101 173.525 1.00 147.06 ?  -17  DT  I P     1 
ATOM   7431  O  OP1   . DT  I 6  70   ? 229.292 208.609 172.257 1.00 147.02 ?  -17  DT  I OP1   1 
ATOM   7432  O  OP2   . DT  I 6  70   ? 228.905 210.512 173.939 1.00 146.75 -1 -17  DT  I OP2   1 
ATOM   7433  O  "O5'" . DT  I 6  70   ? 227.128 208.817 173.484 1.00 146.13 ?  -17  DT  I "O5'" 1 
ATOM   7434  C  "C5'" . DT  I 6  70   ? 226.636 207.475 173.315 1.00 144.76 ?  -17  DT  I "C5'" 1 
ATOM   7435  C  "C4'" . DT  I 6  70   ? 225.126 207.469 173.261 1.00 143.73 ?  -17  DT  I "C4'" 1 
ATOM   7436  O  "O4'" . DT  I 6  70   ? 224.586 207.648 174.592 1.00 143.69 ?  -17  DT  I "O4'" 1 
ATOM   7437  C  "C3'" . DT  I 6  70   ? 224.499 208.566 172.395 1.00 143.11 ?  -17  DT  I "C3'" 1 
ATOM   7438  O  "O3'" . DT  I 6  70   ? 223.400 208.003 171.675 1.00 142.03 ?  -17  DT  I "O3'" 1 
ATOM   7439  C  "C2'" . DT  I 6  70   ? 223.990 209.571 173.412 1.00 143.36 ?  -17  DT  I "C2'" 1 
ATOM   7440  C  "C1'" . DT  I 6  70   ? 223.606 208.672 174.570 1.00 143.91 ?  -17  DT  I "C1'" 1 
ATOM   7441  N  N1    . DT  I 6  70   ? 223.612 209.330 175.888 1.00 144.00 ?  -17  DT  I N1    1 
ATOM   7442  C  C2    . DT  I 6  70   ? 222.478 209.241 176.662 1.00 144.00 ?  -17  DT  I C2    1 
ATOM   7443  O  O2    . DT  I 6  70   ? 221.474 208.645 176.308 1.00 144.00 ?  -17  DT  I O2    1 
ATOM   7444  N  N3    . DT  I 6  70   ? 222.563 209.878 177.875 1.00 144.19 ?  -17  DT  I N3    1 
ATOM   7445  C  C4    . DT  I 6  70   ? 223.643 210.579 178.378 1.00 144.15 ?  -17  DT  I C4    1 
ATOM   7446  O  O4    . DT  I 6  70   ? 223.573 211.101 179.487 1.00 144.08 ?  -17  DT  I O4    1 
ATOM   7447  C  C5    . DT  I 6  70   ? 224.799 210.632 177.511 1.00 144.26 ?  -17  DT  I C5    1 
ATOM   7448  C  C7    . DT  I 6  70   ? 226.017 211.368 177.970 1.00 144.21 ?  -17  DT  I C7    1 
ATOM   7449  C  C6    . DT  I 6  70   ? 224.726 210.012 176.326 1.00 144.24 ?  -17  DT  I C6    1 
ATOM   7450  P  P     . DT  I 6  71   ? 222.696 208.842 170.509 1.00 140.75 ?  -16  DT  I P     1 
ATOM   7451  O  OP1   . DT  I 6  71   ? 222.640 207.985 169.297 1.00 140.78 ?  -16  DT  I OP1   1 
ATOM   7452  O  OP2   . DT  I 6  71   ? 223.351 210.172 170.438 1.00 140.83 -1 -16  DT  I OP2   1 
ATOM   7453  O  "O5'" . DT  I 6  71   ? 221.211 209.036 171.051 1.00 139.21 ?  -16  DT  I "O5'" 1 
ATOM   7454  C  "C5'" . DT  I 6  71   ? 220.573 208.016 171.843 1.00 136.93 ?  -16  DT  I "C5'" 1 
ATOM   7455  C  "C4'" . DT  I 6  71   ? 219.177 208.450 172.225 1.00 134.94 ?  -16  DT  I "C4'" 1 
ATOM   7456  O  "O4'" . DT  I 6  71   ? 219.184 208.951 173.583 1.00 135.02 ?  -16  DT  I "O4'" 1 
ATOM   7457  C  "C3'" . DT  I 6  71   ? 218.600 209.576 171.369 1.00 133.39 ?  -16  DT  I "C3'" 1 
ATOM   7458  O  "O3'" . DT  I 6  71   ? 217.187 209.414 171.229 1.00 130.18 ?  -16  DT  I "O3'" 1 
ATOM   7459  C  "C2'" . DT  I 6  71   ? 218.906 210.818 172.185 1.00 134.26 ?  -16  DT  I "C2'" 1 
ATOM   7460  C  "C1'" . DT  I 6  71   ? 218.763 210.307 173.609 1.00 135.41 ?  -16  DT  I "C1'" 1 
ATOM   7461  N  N1    . DT  I 6  71   ? 219.594 211.019 174.595 1.00 135.79 ?  -16  DT  I N1    1 
ATOM   7462  C  C2    . DT  I 6  71   ? 219.160 211.063 175.900 1.00 135.93 ?  -16  DT  I C2    1 
ATOM   7463  O  O2    . DT  I 6  71   ? 218.124 210.540 176.276 1.00 135.91 ?  -16  DT  I O2    1 
ATOM   7464  N  N3    . DT  I 6  71   ? 219.991 211.744 176.756 1.00 136.14 ?  -16  DT  I N3    1 
ATOM   7465  C  C4    . DT  I 6  71   ? 221.181 212.371 176.442 1.00 136.02 ?  -16  DT  I C4    1 
ATOM   7466  O  O4    . DT  I 6  71   ? 221.821 212.946 177.319 1.00 135.83 ?  -16  DT  I O4    1 
ATOM   7467  C  C5    . DT  I 6  71   ? 221.575 212.286 175.054 1.00 136.02 ?  -16  DT  I C5    1 
ATOM   7468  C  C7    . DT  I 6  71   ? 222.851 212.935 174.620 1.00 135.76 ?  -16  DT  I C7    1 
ATOM   7469  C  C6    . DT  I 6  71   ? 220.772 211.623 174.212 1.00 135.93 ?  -16  DT  I C6    1 
ATOM   7470  P  P     . DA  I 6  72   ? 216.528 209.329 169.775 1.00 127.08 ?  -15  DA  I P     1 
ATOM   7471  O  OP1   . DA  I 6  72   ? 217.552 208.803 168.836 1.00 126.96 ?  -15  DA  I OP1   1 
ATOM   7472  O  OP2   . DA  I 6  72   ? 215.869 210.630 169.491 1.00 125.91 -1 -15  DA  I OP2   1 
ATOM   7473  O  "O5'" . DA  I 6  72   ? 215.403 208.218 169.962 1.00 125.14 ?  -15  DA  I "O5'" 1 
ATOM   7474  C  "C5'" . DA  I 6  72   ? 215.607 207.114 170.864 1.00 121.31 ?  -15  DA  I "C5'" 1 
ATOM   7475  C  "C4'" . DA  I 6  72   ? 214.755 207.280 172.101 1.00 118.12 ?  -15  DA  I "C4'" 1 
ATOM   7476  O  "O4'" . DA  I 6  72   ? 215.374 208.230 173.001 1.00 117.75 ?  -15  DA  I "O4'" 1 
ATOM   7477  C  "C3'" . DA  I 6  72   ? 213.335 207.795 171.843 1.00 115.86 ?  -15  DA  I "C3'" 1 
ATOM   7478  O  "O3'" . DA  I 6  72   ? 212.399 207.014 172.590 1.00 112.21 ?  -15  DA  I "O3'" 1 
ATOM   7479  C  "C2'" . DA  I 6  72   ? 213.365 209.220 172.366 1.00 116.50 ?  -15  DA  I "C2'" 1 
ATOM   7480  C  "C1'" . DA  I 6  72   ? 214.390 209.129 173.478 1.00 117.53 ?  -15  DA  I "C1'" 1 
ATOM   7481  N  N9    . DA  I 6  72   ? 215.051 210.393 173.798 1.00 117.66 ?  -15  DA  I N9    1 
ATOM   7482  C  C8    . DA  I 6  72   ? 215.733 211.229 172.949 1.00 117.77 ?  -15  DA  I C8    1 
ATOM   7483  N  N7    . DA  I 6  72   ? 216.216 212.297 173.534 1.00 117.97 ?  -15  DA  I N7    1 
ATOM   7484  C  C5    . DA  I 6  72   ? 215.822 212.159 174.858 1.00 117.81 ?  -15  DA  I C5    1 
ATOM   7485  C  C6    . DA  I 6  72   ? 216.021 212.965 175.993 1.00 117.46 ?  -15  DA  I C6    1 
ATOM   7486  N  N6    . DA  I 6  72   ? 216.694 214.118 175.976 1.00 117.48 ?  -15  DA  I N6    1 
ATOM   7487  N  N1    . DA  I 6  72   ? 215.497 212.539 177.163 1.00 117.50 ?  -15  DA  I N1    1 
ATOM   7488  C  C2    . DA  I 6  72   ? 214.822 211.383 177.180 1.00 117.55 ?  -15  DA  I C2    1 
ATOM   7489  N  N3    . DA  I 6  72   ? 214.569 210.540 176.182 1.00 117.69 ?  -15  DA  I N3    1 
ATOM   7490  C  C4    . DA  I 6  72   ? 215.102 210.992 175.034 1.00 117.85 ?  -15  DA  I C4    1 
ATOM   7491  P  P     . DA  I 6  73   ? 210.832 207.163 172.305 1.00 109.75 ?  -14  DA  I P     1 
ATOM   7492  O  OP1   . DA  I 6  73   ? 210.269 205.806 172.102 1.00 109.05 ?  -14  DA  I OP1   1 
ATOM   7493  O  OP2   . DA  I 6  73   ? 210.651 208.200 171.257 1.00 108.49 -1 -14  DA  I OP2   1 
ATOM   7494  O  "O5'" . DA  I 6  73   ? 210.271 207.736 173.680 1.00 106.43 ?  -14  DA  I "O5'" 1 
ATOM   7495  C  "C5'" . DA  I 6  73   ? 210.597 207.096 174.926 1.00 101.21 ?  -14  DA  I "C5'" 1 
ATOM   7496  C  "C4'" . DA  I 6  73   ? 210.539 208.089 176.062 1.00 97.58  ?  -14  DA  I "C4'" 1 
ATOM   7497  O  "O4'" . DA  I 6  73   ? 211.483 209.164 175.839 1.00 97.40  ?  -14  DA  I "O4'" 1 
ATOM   7498  C  "C3'" . DA  I 6  73   ? 209.174 208.751 176.282 1.00 94.47  ?  -14  DA  I "C3'" 1 
ATOM   7499  O  "O3'" . DA  I 6  73   ? 208.840 208.626 177.664 1.00 89.42  ?  -14  DA  I "O3'" 1 
ATOM   7500  C  "C2'" . DA  I 6  73   ? 209.409 210.210 175.932 1.00 95.33  ?  -14  DA  I "C2'" 1 
ATOM   7501  C  "C1'" . DA  I 6  73   ? 210.882 210.379 176.245 1.00 99.03  ?  -14  DA  I "C1'" 1 
ATOM   7502  N  N9    . DA  I 6  73   ? 211.538 211.470 175.528 1.00 100.14 ?  -14  DA  I N9    1 
ATOM   7503  C  C8    . DA  I 6  73   ? 211.837 211.544 174.190 1.00 100.80 ?  -14  DA  I C8    1 
ATOM   7504  N  N7    . DA  I 6  73   ? 212.437 212.657 173.843 1.00 101.21 ?  -14  DA  I N7    1 
ATOM   7505  C  C5    . DA  I 6  73   ? 212.543 213.363 175.033 1.00 101.16 ?  -14  DA  I C5    1 
ATOM   7506  C  C6    . DA  I 6  73   ? 213.086 214.623 175.341 1.00 100.50 ?  -14  DA  I C6    1 
ATOM   7507  N  N6    . DA  I 6  73   ? 213.648 215.429 174.437 1.00 100.58 ?  -14  DA  I N6    1 
ATOM   7508  N  N1    . DA  I 6  73   ? 213.032 215.033 176.627 1.00 100.69 ?  -14  DA  I N1    1 
ATOM   7509  C  C2    . DA  I 6  73   ? 212.469 214.225 177.534 1.00 100.81 ?  -14  DA  I C2    1 
ATOM   7510  N  N3    . DA  I 6  73   ? 211.924 213.020 177.368 1.00 101.03 ?  -14  DA  I N3    1 
ATOM   7511  C  C4    . DA  I 6  73   ? 211.995 212.643 176.080 1.00 101.40 ?  -14  DA  I C4    1 
ATOM   7512  P  P     . DA  I 6  74   ? 207.304 208.572 178.098 1.00 86.45  ?  -13  DA  I P     1 
ATOM   7513  O  OP1   . DA  I 6  74   ? 207.111 207.377 178.960 1.00 86.74  ?  -13  DA  I OP1   1 
ATOM   7514  O  OP2   . DA  I 6  74   ? 206.476 208.738 176.877 1.00 84.67  -1 -13  DA  I OP2   1 
ATOM   7515  O  "O5'" . DA  I 6  74   ? 207.146 209.872 179.002 1.00 89.16  ?  -13  DA  I "O5'" 1 
ATOM   7516  C  "C5'" . DA  I 6  74   ? 207.787 209.934 180.286 1.00 89.50  ?  -13  DA  I "C5'" 1 
ATOM   7517  C  "C4'" . DA  I 6  74   ? 208.291 211.331 180.564 1.00 88.97  ?  -13  DA  I "C4'" 1 
ATOM   7518  O  "O4'" . DA  I 6  74   ? 208.887 211.914 179.389 1.00 87.58  ?  -13  DA  I "O4'" 1 
ATOM   7519  C  "C3'" . DA  I 6  74   ? 207.224 212.327 181.020 1.00 89.75  ?  -13  DA  I "C3'" 1 
ATOM   7520  O  "O3'" . DA  I 6  74   ? 207.369 212.471 182.432 1.00 91.78  ?  -13  DA  I "O3'" 1 
ATOM   7521  C  "C2'" . DA  I 6  74   ? 207.584 213.622 180.301 1.00 88.47  ?  -13  DA  I "C2'" 1 
ATOM   7522  C  "C1'" . DA  I 6  74   ? 208.897 213.310 179.598 1.00 89.27  ?  -13  DA  I "C1'" 1 
ATOM   7523  N  N9    . DA  I 6  74   ? 209.069 213.960 178.299 1.00 89.71  ?  -13  DA  I N9    1 
ATOM   7524  C  C8    . DA  I 6  74   ? 208.591 213.555 177.078 1.00 90.35  ?  -13  DA  I C8    1 
ATOM   7525  N  N7    . DA  I 6  74   ? 208.916 214.356 176.092 1.00 90.67  ?  -13  DA  I N7    1 
ATOM   7526  C  C5    . DA  I 6  74   ? 209.658 215.356 176.705 1.00 90.87  ?  -13  DA  I C5    1 
ATOM   7527  C  C6    . DA  I 6  74   ? 210.291 216.507 176.204 1.00 89.87  ?  -13  DA  I C6    1 
ATOM   7528  N  N6    . DA  I 6  74   ? 210.278 216.859 174.916 1.00 89.82  ?  -13  DA  I N6    1 
ATOM   7529  N  N1    . DA  I 6  74   ? 210.948 217.295 177.082 1.00 89.88  ?  -13  DA  I N1    1 
ATOM   7530  C  C2    . DA  I 6  74   ? 210.961 216.941 178.374 1.00 90.23  ?  -13  DA  I C2    1 
ATOM   7531  N  N3    . DA  I 6  74   ? 210.404 215.886 178.964 1.00 90.81  ?  -13  DA  I N3    1 
ATOM   7532  C  C4    . DA  I 6  74   ? 209.760 215.124 178.064 1.00 90.82  ?  -13  DA  I C4    1 
ATOM   7533  P  P     . DC  I 6  75   ? 206.328 213.375 183.248 1.00 91.83  ?  -12  DC  I P     1 
ATOM   7534  O  OP1   . DC  I 6  75   ? 206.586 213.178 184.697 1.00 91.20  ?  -12  DC  I OP1   1 
ATOM   7535  O  OP2   . DC  I 6  75   ? 204.971 213.118 182.702 1.00 91.76  -1 -12  DC  I OP2   1 
ATOM   7536  O  "O5'" . DC  I 6  75   ? 206.760 214.859 182.860 1.00 93.16  ?  -12  DC  I "O5'" 1 
ATOM   7537  C  "C5'" . DC  I 6  75   ? 207.998 215.409 183.345 1.00 96.17  ?  -12  DC  I "C5'" 1 
ATOM   7538  C  "C4'" . DC  I 6  75   ? 208.195 216.820 182.840 1.00 99.52  ?  -12  DC  I "C4'" 1 
ATOM   7539  O  "O4'" . DC  I 6  75   ? 208.317 216.828 181.407 1.00 100.08 ?  -12  DC  I "O4'" 1 
ATOM   7540  C  "C3'" . DC  I 6  75   ? 207.061 217.797 183.148 1.00 101.74 ?  -12  DC  I "C3'" 1 
ATOM   7541  O  "O3'" . DC  I 6  75   ? 207.379 218.456 184.377 1.00 105.75 ?  -12  DC  I "O3'" 1 
ATOM   7542  C  "C2'" . DC  I 6  75   ? 207.071 218.753 181.962 1.00 100.94 ?  -12  DC  I "C2'" 1 
ATOM   7543  C  "C1'" . DC  I 6  75   ? 208.063 218.149 180.966 1.00 101.21 ?  -12  DC  I "C1'" 1 
ATOM   7544  N  N1    . DC  I 6  75   ? 207.581 218.075 179.580 1.00 101.45 ?  -12  DC  I N1    1 
ATOM   7545  C  C2    . DC  I 6  75   ? 208.059 219.003 178.651 1.00 101.68 ?  -12  DC  I C2    1 
ATOM   7546  O  O2    . DC  I 6  75   ? 208.869 219.864 179.027 1.00 101.94 ?  -12  DC  I O2    1 
ATOM   7547  N  N3    . DC  I 6  75   ? 207.626 218.941 177.371 1.00 101.77 ?  -12  DC  I N3    1 
ATOM   7548  C  C4    . DC  I 6  75   ? 206.754 217.997 177.008 1.00 101.59 ?  -12  DC  I C4    1 
ATOM   7549  N  N4    . DC  I 6  75   ? 206.353 217.973 175.735 1.00 101.41 ?  -12  DC  I N4    1 
ATOM   7550  C  C5    . DC  I 6  75   ? 206.253 217.038 177.934 1.00 101.41 ?  -12  DC  I C5    1 
ATOM   7551  C  C6    . DC  I 6  75   ? 206.691 217.111 179.198 1.00 101.51 ?  -12  DC  I C6    1 
ATOM   7552  P  P     . DG  I 6  76   ? 206.283 219.370 185.099 1.00 107.71 ?  -11  DG  I P     1 
ATOM   7553  O  OP1   . DG  I 6  76   ? 206.813 219.760 186.430 1.00 108.05 ?  -11  DG  I OP1   1 
ATOM   7554  O  OP2   . DG  I 6  76   ? 204.972 218.679 185.005 1.00 106.97 -1 -11  DG  I OP2   1 
ATOM   7555  O  "O5'" . DG  I 6  76   ? 206.235 220.668 184.177 1.00 109.22 ?  -11  DG  I "O5'" 1 
ATOM   7556  C  "C5'" . DG  I 6  76   ? 207.297 221.640 184.220 1.00 112.73 ?  -11  DG  I "C5'" 1 
ATOM   7557  C  "C4'" . DG  I 6  76   ? 207.047 222.738 183.212 1.00 115.98 ?  -11  DG  I "C4'" 1 
ATOM   7558  O  "O4'" . DG  I 6  76   ? 207.089 222.192 181.872 1.00 116.80 ?  -11  DG  I "O4'" 1 
ATOM   7559  C  "C3'" . DG  I 6  76   ? 205.695 223.445 183.345 1.00 117.79 ?  -11  DG  I "C3'" 1 
ATOM   7560  O  "O3'" . DG  I 6  76   ? 205.881 224.855 183.200 1.00 119.78 ?  -11  DG  I "O3'" 1 
ATOM   7561  C  "C2'" . DG  I 6  76   ? 204.883 222.890 182.187 1.00 117.90 ?  -11  DG  I "C2'" 1 
ATOM   7562  C  "C1'" . DG  I 6  76   ? 205.953 222.624 181.145 1.00 118.68 ?  -11  DG  I "C1'" 1 
ATOM   7563  N  N9    . DG  I 6  76   ? 205.614 221.579 180.185 1.00 119.17 ?  -11  DG  I N9    1 
ATOM   7564  C  C8    . DG  I 6  76   ? 205.103 220.334 180.462 1.00 119.43 ?  -11  DG  I C8    1 
ATOM   7565  N  N7    . DG  I 6  76   ? 204.901 219.614 179.392 1.00 119.29 ?  -11  DG  I N7    1 
ATOM   7566  C  C5    . DG  I 6  76   ? 205.302 220.433 178.345 1.00 119.40 ?  -11  DG  I C5    1 
ATOM   7567  C  C6    . DG  I 6  76   ? 205.313 220.195 176.941 1.00 119.49 ?  -11  DG  I C6    1 
ATOM   7568  O  O6    . DG  I 6  76   ? 204.961 219.181 176.329 1.00 119.06 ?  -11  DG  I O6    1 
ATOM   7569  N  N1    . DG  I 6  76   ? 205.799 221.295 176.240 1.00 119.67 ?  -11  DG  I N1    1 
ATOM   7570  C  C2    . DG  I 6  76   ? 206.219 222.472 176.813 1.00 119.47 ?  -11  DG  I C2    1 
ATOM   7571  N  N2    . DG  I 6  76   ? 206.655 223.418 175.968 1.00 119.40 ?  -11  DG  I N2    1 
ATOM   7572  N  N3    . DG  I 6  76   ? 206.213 222.706 178.118 1.00 119.19 ?  -11  DG  I N3    1 
ATOM   7573  C  C4    . DG  I 6  76   ? 205.745 221.650 178.819 1.00 119.31 ?  -11  DG  I C4    1 
ATOM   7574  P  P     . DC  I 6  77   ? 204.720 225.864 183.643 1.00 121.32 ?  -10  DC  I P     1 
ATOM   7575  O  OP1   . DC  I 6  77   ? 205.202 226.632 184.819 1.00 121.52 ?  -10  DC  I OP1   1 
ATOM   7576  O  OP2   . DC  I 6  77   ? 203.453 225.097 183.735 1.00 121.44 -1 -10  DC  I OP2   1 
ATOM   7577  O  "O5'" . DC  I 6  77   ? 204.616 226.856 182.402 1.00 121.92 ?  -10  DC  I "O5'" 1 
ATOM   7578  C  "C5'" . DC  I 6  77   ? 205.768 227.130 181.586 1.00 123.18 ?  -10  DC  I "C5'" 1 
ATOM   7579  C  "C4'" . DC  I 6  77   ? 205.346 227.432 180.167 1.00 124.83 ?  -10  DC  I "C4'" 1 
ATOM   7580  O  "O4'" . DC  I 6  77   ? 205.138 226.195 179.442 1.00 125.47 ?  -10  DC  I "O4'" 1 
ATOM   7581  C  "C3'" . DC  I 6  77   ? 204.044 228.226 180.033 1.00 125.56 ?  -10  DC  I "C3'" 1 
ATOM   7582  O  "O3'" . DC  I 6  77   ? 204.212 229.198 179.000 1.00 126.40 ?  -10  DC  I "O3'" 1 
ATOM   7583  C  "C2'" . DC  I 6  77   ? 203.030 227.182 179.603 1.00 125.58 ?  -10  DC  I "C2'" 1 
ATOM   7584  C  "C1'" . DC  I 6  77   ? 203.886 226.239 178.781 1.00 125.76 ?  -10  DC  I "C1'" 1 
ATOM   7585  N  N1    . DC  I 6  77   ? 203.372 224.864 178.696 1.00 125.98 ?  -10  DC  I N1    1 
ATOM   7586  C  C2    . DC  I 6  77   ? 203.107 224.322 177.437 1.00 126.02 ?  -10  DC  I C2    1 
ATOM   7587  O  O2    . DC  I 6  77   ? 203.310 225.018 176.431 1.00 126.14 ?  -10  DC  I O2    1 
ATOM   7588  N  N3    . DC  I 6  77   ? 202.635 223.057 177.347 1.00 125.97 ?  -10  DC  I N3    1 
ATOM   7589  C  C4    . DC  I 6  77   ? 202.430 222.342 178.455 1.00 125.94 ?  -10  DC  I C4    1 
ATOM   7590  N  N4    . DC  I 6  77   ? 201.964 221.098 178.320 1.00 126.02 ?  -10  DC  I N4    1 
ATOM   7591  C  C5    . DC  I 6  77   ? 202.693 222.870 179.753 1.00 126.18 ?  -10  DC  I C5    1 
ATOM   7592  C  C6    . DC  I 6  77   ? 203.159 224.123 179.826 1.00 126.18 ?  -10  DC  I C6    1 
ATOM   7593  P  P     . DA  I 6  78   ? 203.360 230.552 179.029 1.00 126.88 ?  -9   DA  I P     1 
ATOM   7594  O  OP1   . DA  I 6  78   ? 204.229 231.632 179.562 1.00 127.25 ?  -9   DA  I OP1   1 
ATOM   7595  O  OP2   . DA  I 6  78   ? 202.060 230.263 179.686 1.00 126.89 -1 -9   DA  I OP2   1 
ATOM   7596  O  "O5'" . DA  I 6  78   ? 203.092 230.842 177.485 1.00 127.46 ?  -9   DA  I "O5'" 1 
ATOM   7597  C  "C5'" . DA  I 6  78   ? 204.012 230.382 176.479 1.00 128.70 ?  -9   DA  I "C5'" 1 
ATOM   7598  C  "C4'" . DA  I 6  78   ? 203.285 230.150 175.174 1.00 129.73 ?  -9   DA  I "C4'" 1 
ATOM   7599  O  "O4'" . DA  I 6  78   ? 202.768 228.797 175.144 1.00 130.42 ?  -9   DA  I "O4'" 1 
ATOM   7600  C  "C3'" . DA  I 6  78   ? 202.084 231.065 174.938 1.00 130.21 ?  -9   DA  I "C3'" 1 
ATOM   7601  O  "O3'" . DA  I 6  78   ? 201.994 231.389 173.548 1.00 130.33 ?  -9   DA  I "O3'" 1 
ATOM   7602  C  "C2'" . DA  I 6  78   ? 200.906 230.207 175.358 1.00 130.63 ?  -9   DA  I "C2'" 1 
ATOM   7603  C  "C1'" . DA  I 6  78   ? 201.362 228.818 174.949 1.00 131.47 ?  -9   DA  I "C1'" 1 
ATOM   7604  N  N9    . DA  I 6  78   ? 200.784 227.736 175.744 1.00 131.81 ?  -9   DA  I N9    1 
ATOM   7605  C  C8    . DA  I 6  78   ? 200.263 227.807 177.012 1.00 131.86 ?  -9   DA  I C8    1 
ATOM   7606  N  N7    . DA  I 6  78   ? 199.817 226.661 177.466 1.00 131.81 ?  -9   DA  I N7    1 
ATOM   7607  C  C5    . DA  I 6  78   ? 200.061 225.774 176.427 1.00 131.87 ?  -9   DA  I C5    1 
ATOM   7608  C  C6    . DA  I 6  78   ? 199.818 224.396 176.281 1.00 131.98 ?  -9   DA  I C6    1 
ATOM   7609  N  N6    . DA  I 6  78   ? 199.252 223.641 177.225 1.00 131.74 ?  -9   DA  I N6    1 
ATOM   7610  N  N1    . DA  I 6  78   ? 200.183 223.814 175.119 1.00 132.08 ?  -9   DA  I N1    1 
ATOM   7611  C  C2    . DA  I 6  78   ? 200.752 224.573 174.173 1.00 131.87 ?  -9   DA  I C2    1 
ATOM   7612  N  N3    . DA  I 6  78   ? 201.031 225.874 174.192 1.00 131.77 ?  -9   DA  I N3    1 
ATOM   7613  C  C4    . DA  I 6  78   ? 200.657 226.422 175.360 1.00 131.93 ?  -9   DA  I C4    1 
ATOM   7614  P  P     . DC  I 6  79   ? 201.095 232.626 173.081 1.00 130.62 ?  -8   DC  I P     1 
ATOM   7615  O  OP1   . DC  I 6  79   ? 201.839 233.364 172.029 1.00 130.05 ?  -8   DC  I OP1   1 
ATOM   7616  O  OP2   . DC  I 6  79   ? 200.635 233.346 174.296 1.00 130.75 -1 -8   DC  I OP2   1 
ATOM   7617  O  "O5'" . DC  I 6  79   ? 199.837 231.921 172.406 1.00 130.30 ?  -8   DC  I "O5'" 1 
ATOM   7618  C  "C5'" . DC  I 6  79   ? 199.958 231.299 171.116 1.00 128.73 ?  -8   DC  I "C5'" 1 
ATOM   7619  C  "C4'" . DC  I 6  79   ? 198.734 230.467 170.809 1.00 127.43 ?  -8   DC  I "C4'" 1 
ATOM   7620  O  "O4'" . DC  I 6  79   ? 198.616 229.381 171.758 1.00 127.36 ?  -8   DC  I "O4'" 1 
ATOM   7621  C  "C3'" . DC  I 6  79   ? 197.398 231.217 170.845 1.00 126.76 ?  -8   DC  I "C3'" 1 
ATOM   7622  O  "O3'" . DC  I 6  79   ? 196.671 230.862 169.666 1.00 125.80 ?  -8   DC  I "O3'" 1 
ATOM   7623  C  "C2'" . DC  I 6  79   ? 196.694 230.649 172.065 1.00 126.94 ?  -8   DC  I "C2'" 1 
ATOM   7624  C  "C1'" . DC  I 6  79   ? 197.256 229.244 172.122 1.00 127.56 ?  -8   DC  I "C1'" 1 
ATOM   7625  N  N1    . DC  I 6  79   ? 197.205 228.610 173.448 1.00 127.73 ?  -8   DC  I N1    1 
ATOM   7626  C  C2    . DC  I 6  79   ? 196.549 227.383 173.582 1.00 127.68 ?  -8   DC  I C2    1 
ATOM   7627  O  O2    . DC  I 6  79   ? 196.030 226.870 172.579 1.00 127.73 ?  -8   DC  I O2    1 
ATOM   7628  N  N3    . DC  I 6  79   ? 196.496 226.791 174.797 1.00 127.71 ?  -8   DC  I N3    1 
ATOM   7629  C  C4    . DC  I 6  79   ? 197.068 227.378 175.851 1.00 127.83 ?  -8   DC  I C4    1 
ATOM   7630  N  N4    . DC  I 6  79   ? 196.992 226.757 177.030 1.00 127.62 ?  -8   DC  I N4    1 
ATOM   7631  C  C5    . DC  I 6  79   ? 197.744 228.627 175.741 1.00 128.02 ?  -8   DC  I C5    1 
ATOM   7632  C  C6    . DC  I 6  79   ? 197.789 229.202 174.532 1.00 128.09 ?  -8   DC  I C6    1 
ATOM   7633  P  P     . DG  I 6  80   ? 195.459 231.781 169.169 1.00 124.81 ?  -7   DG  I P     1 
ATOM   7634  O  OP1   . DG  I 6  80   ? 195.933 232.581 168.012 1.00 124.84 ?  -7   DG  I OP1   1 
ATOM   7635  O  OP2   . DG  I 6  80   ? 194.886 232.468 170.354 1.00 124.28 -1 -7   DG  I OP2   1 
ATOM   7636  O  "O5'" . DG  I 6  80   ? 194.396 230.719 168.640 1.00 125.42 ?  -7   DG  I "O5'" 1 
ATOM   7637  C  "C5'" . DG  I 6  80   ? 194.822 229.489 168.024 1.00 126.17 ?  -7   DG  I "C5'" 1 
ATOM   7638  C  "C4'" . DG  I 6  80   ? 193.782 228.413 168.235 1.00 126.78 ?  -7   DG  I "C4'" 1 
ATOM   7639  O  "O4'" . DG  I 6  80   ? 193.942 227.844 169.557 1.00 127.69 ?  -7   DG  I "O4'" 1 
ATOM   7640  C  "C3'" . DG  I 6  80   ? 192.336 228.901 168.166 1.00 126.54 ?  -7   DG  I "C3'" 1 
ATOM   7641  O  "O3'" . DG  I 6  80   ? 191.498 227.862 167.651 1.00 124.93 ?  -7   DG  I "O3'" 1 
ATOM   7642  C  "C2'" . DG  I 6  80   ? 191.990 229.148 169.622 1.00 127.48 ?  -7   DG  I "C2'" 1 
ATOM   7643  C  "C1'" . DG  I 6  80   ? 192.753 228.030 170.313 1.00 129.09 ?  -7   DG  I "C1'" 1 
ATOM   7644  N  N9    . DG  I 6  80   ? 193.140 228.321 171.690 1.00 129.64 ?  -7   DG  I N9    1 
ATOM   7645  C  C8    . DG  I 6  80   ? 193.410 229.555 172.232 1.00 130.05 ?  -7   DG  I C8    1 
ATOM   7646  N  N7    . DG  I 6  80   ? 193.730 229.499 173.496 1.00 130.47 ?  -7   DG  I N7    1 
ATOM   7647  C  C5    . DG  I 6  80   ? 193.666 228.149 173.809 1.00 130.23 ?  -7   DG  I C5    1 
ATOM   7648  C  C6    . DG  I 6  80   ? 193.910 227.475 175.039 1.00 129.86 ?  -7   DG  I C6    1 
ATOM   7649  O  O6    . DG  I 6  80   ? 194.241 227.957 176.128 1.00 129.90 ?  -7   DG  I O6    1 
ATOM   7650  N  N1    . DG  I 6  80   ? 193.730 226.101 174.914 1.00 129.85 ?  -7   DG  I N1    1 
ATOM   7651  C  C2    . DG  I 6  80   ? 193.363 225.456 173.757 1.00 130.05 ?  -7   DG  I C2    1 
ATOM   7652  N  N2    . DG  I 6  80   ? 193.240 224.123 173.837 1.00 129.92 ?  -7   DG  I N2    1 
ATOM   7653  N  N3    . DG  I 6  80   ? 193.133 226.072 172.606 1.00 130.17 ?  -7   DG  I N3    1 
ATOM   7654  C  C4    . DG  I 6  80   ? 193.302 227.408 172.704 1.00 130.15 ?  -7   DG  I C4    1 
ATOM   7655  P  P     . DT  I 6  81   ? 190.725 228.070 166.266 1.00 123.18 ?  -6   DT  I P     1 
ATOM   7656  O  OP1   . DT  I 6  81   ? 191.660 228.719 165.312 1.00 122.47 ?  -6   DT  I OP1   1 
ATOM   7657  O  OP2   . DT  I 6  81   ? 189.417 228.708 166.561 1.00 122.32 -1 -6   DT  I OP2   1 
ATOM   7658  O  "O5'" . DT  I 6  81   ? 190.461 226.578 165.777 1.00 122.99 ?  -6   DT  I "O5'" 1 
ATOM   7659  C  "C5'" . DT  I 6  81   ? 191.368 225.516 166.126 1.00 122.32 ?  -6   DT  I "C5'" 1 
ATOM   7660  C  "C4'" . DT  I 6  81   ? 190.660 224.474 166.960 1.00 121.85 ?  -6   DT  I "C4'" 1 
ATOM   7661  O  "O4'" . DT  I 6  81   ? 190.740 224.836 168.359 1.00 122.19 ?  -6   DT  I "O4'" 1 
ATOM   7662  C  "C3'" . DT  I 6  81   ? 189.171 224.308 166.651 1.00 121.22 ?  -6   DT  I "C3'" 1 
ATOM   7663  O  "O3'" . DT  I 6  81   ? 188.803 222.928 166.724 1.00 119.95 ?  -6   DT  I "O3'" 1 
ATOM   7664  C  "C2'" . DT  I 6  81   ? 188.493 225.102 167.752 1.00 121.94 ?  -6   DT  I "C2'" 1 
ATOM   7665  C  "C1'" . DT  I 6  81   ? 189.439 224.904 168.921 1.00 123.35 ?  -6   DT  I "C1'" 1 
ATOM   7666  N  N1    . DT  I 6  81   ? 189.429 226.003 169.902 1.00 124.04 ?  -6   DT  I N1    1 
ATOM   7667  C  C2    . DT  I 6  81   ? 189.897 225.749 171.170 1.00 124.29 ?  -6   DT  I C2    1 
ATOM   7668  O  O2    . DT  I 6  81   ? 190.320 224.657 171.517 1.00 124.61 ?  -6   DT  I O2    1 
ATOM   7669  N  N3    . DT  I 6  81   ? 189.852 226.823 172.023 1.00 124.27 ?  -6   DT  I N3    1 
ATOM   7670  C  C4    . DT  I 6  81   ? 189.396 228.097 171.739 1.00 124.62 ?  -6   DT  I C4    1 
ATOM   7671  O  O4    . DT  I 6  81   ? 189.418 228.963 172.609 1.00 124.66 ?  -6   DT  I O4    1 
ATOM   7672  C  C5    . DT  I 6  81   ? 188.919 228.292 170.389 1.00 125.05 ?  -6   DT  I C5    1 
ATOM   7673  C  C7    . DT  I 6  81   ? 188.405 229.640 169.989 1.00 124.59 ?  -6   DT  I C7    1 
ATOM   7674  C  C6    . DT  I 6  81   ? 188.959 227.250 169.550 1.00 124.71 ?  -6   DT  I C6    1 
ATOM   7675  P  P     . DA  I 6  82   ? 187.691 222.346 165.732 1.00 118.15 ?  -5   DA  I P     1 
ATOM   7676  O  OP1   . DA  I 6  82   ? 188.305 222.216 164.385 1.00 117.53 ?  -5   DA  I OP1   1 
ATOM   7677  O  OP2   . DA  I 6  82   ? 186.456 223.147 165.905 1.00 117.66 -1 -5   DA  I OP2   1 
ATOM   7678  O  "O5'" . DA  I 6  82   ? 187.423 220.885 166.308 1.00 116.93 ?  -5   DA  I "O5'" 1 
ATOM   7679  C  "C5'" . DA  I 6  82   ? 188.110 220.411 167.480 1.00 114.16 ?  -5   DA  I "C5'" 1 
ATOM   7680  C  "C4'" . DA  I 6  82   ? 187.128 220.196 168.607 1.00 112.05 ?  -5   DA  I "C4'" 1 
ATOM   7681  O  "O4'" . DA  I 6  82   ? 187.151 221.350 169.483 1.00 112.56 ?  -5   DA  I "O4'" 1 
ATOM   7682  C  "C3'" . DA  I 6  82   ? 185.675 220.049 168.166 1.00 110.92 ?  -5   DA  I "C3'" 1 
ATOM   7683  O  "O3'" . DA  I 6  82   ? 184.953 219.290 169.138 1.00 108.92 ?  -5   DA  I "O3'" 1 
ATOM   7684  C  "C2'" . DA  I 6  82   ? 185.167 221.474 168.241 1.00 111.54 ?  -5   DA  I "C2'" 1 
ATOM   7685  C  "C1'" . DA  I 6  82   ? 185.870 221.965 169.495 1.00 112.73 ?  -5   DA  I "C1'" 1 
ATOM   7686  N  N9    . DA  I 6  82   ? 186.066 223.412 169.563 1.00 113.22 ?  -5   DA  I N9    1 
ATOM   7687  C  C8    . DA  I 6  82   ? 186.076 224.316 168.529 1.00 112.96 ?  -5   DA  I C8    1 
ATOM   7688  N  N7    . DA  I 6  82   ? 186.278 225.553 168.910 1.00 112.84 ?  -5   DA  I N7    1 
ATOM   7689  C  C5    . DA  I 6  82   ? 186.407 225.461 170.288 1.00 113.46 ?  -5   DA  I C5    1 
ATOM   7690  C  C6    . DA  I 6  82   ? 186.637 226.426 171.284 1.00 113.08 ?  -5   DA  I C6    1 
ATOM   7691  N  N6    . DA  I 6  82   ? 186.781 227.730 171.032 1.00 112.94 ?  -5   DA  I N6    1 
ATOM   7692  N  N1    . DA  I 6  82   ? 186.712 226.002 172.565 1.00 113.00 ?  -5   DA  I N1    1 
ATOM   7693  C  C2    . DA  I 6  82   ? 186.567 224.694 172.816 1.00 112.86 ?  -5   DA  I C2    1 
ATOM   7694  N  N3    . DA  I 6  82   ? 186.349 223.693 171.968 1.00 113.32 ?  -5   DA  I N3    1 
ATOM   7695  C  C4    . DA  I 6  82   ? 186.279 224.148 170.705 1.00 113.52 ?  -5   DA  I C4    1 
ATOM   7696  P  P     . DC  I 6  83   ? 183.934 218.153 168.664 1.00 106.87 ?  -4   DC  I P     1 
ATOM   7697  O  OP1   . DC  I 6  83   ? 184.716 217.090 167.983 1.00 106.10 ?  -4   DC  I OP1   1 
ATOM   7698  O  OP2   . DC  I 6  83   ? 182.812 218.811 167.948 1.00 106.12 -1 -4   DC  I OP2   1 
ATOM   7699  O  "O5'" . DC  I 6  83   ? 183.390 217.563 170.039 1.00 104.94 ?  -4   DC  I "O5'" 1 
ATOM   7700  C  "C5'" . DC  I 6  83   ? 184.267 216.851 170.931 1.00 103.44 ?  -4   DC  I "C5'" 1 
ATOM   7701  C  "C4'" . DC  I 6  83   ? 184.282 217.516 172.288 1.00 102.40 ?  -4   DC  I "C4'" 1 
ATOM   7702  O  "O4'" . DC  I 6  83   ? 184.302 218.948 172.122 1.00 102.52 ?  -4   DC  I "O4'" 1 
ATOM   7703  C  "C3'" . DC  I 6  83   ? 183.065 217.205 173.165 1.00 101.00 ?  -4   DC  I "C3'" 1 
ATOM   7704  O  "O3'" . DC  I 6  83   ? 183.458 216.382 174.267 1.00 98.65  ?  -4   DC  I "O3'" 1 
ATOM   7705  C  "C2'" . DC  I 6  83   ? 182.577 218.565 173.645 1.00 102.03 ?  -4   DC  I "C2'" 1 
ATOM   7706  C  "C1'" . DC  I 6  83   ? 183.678 219.532 173.245 1.00 102.85 ?  -4   DC  I "C1'" 1 
ATOM   7707  N  N1    . DC  I 6  83   ? 183.196 220.864 172.850 1.00 103.54 ?  -4   DC  I N1    1 
ATOM   7708  C  C2    . DC  I 6  83   ? 182.977 221.822 173.844 1.00 103.75 ?  -4   DC  I C2    1 
ATOM   7709  O  O2    . DC  I 6  83   ? 183.198 221.520 175.026 1.00 103.65 ?  -4   DC  I O2    1 
ATOM   7710  N  N3    . DC  I 6  83   ? 182.533 223.051 173.491 1.00 103.68 ?  -4   DC  I N3    1 
ATOM   7711  C  C4    . DC  I 6  83   ? 182.309 223.335 172.206 1.00 103.43 ?  -4   DC  I C4    1 
ATOM   7712  N  N4    . DC  I 6  83   ? 181.870 224.560 171.904 1.00 103.26 ?  -4   DC  I N4    1 
ATOM   7713  C  C5    . DC  I 6  83   ? 182.523 222.377 171.174 1.00 103.55 ?  -4   DC  I C5    1 
ATOM   7714  C  C6    . DC  I 6  83   ? 182.963 221.165 171.538 1.00 103.66 ?  -4   DC  I C6    1 
ATOM   7715  P  P     . DG  I 6  84   ? 182.343 215.664 175.164 1.00 96.66  ?  -3   DG  I P     1 
ATOM   7716  O  OP1   . DG  I 6  84   ? 182.870 214.340 175.580 1.00 97.23  ?  -3   DG  I OP1   1 
ATOM   7717  O  OP2   . DG  I 6  84   ? 181.048 215.745 174.440 1.00 96.26  -1 -3   DG  I OP2   1 
ATOM   7718  O  "O5'" . DG  I 6  84   ? 182.260 216.599 176.451 1.00 97.49  ?  -3   DG  I "O5'" 1 
ATOM   7719  C  "C5'" . DG  I 6  84   ? 183.283 216.554 177.463 1.00 97.84  ?  -3   DG  I "C5'" 1 
ATOM   7720  C  "C4'" . DG  I 6  84   ? 182.963 217.529 178.572 1.00 97.82  ?  -3   DG  I "C4'" 1 
ATOM   7721  O  "O4'" . DG  I 6  84   ? 182.776 218.851 178.015 1.00 98.01  ?  -3   DG  I "O4'" 1 
ATOM   7722  C  "C3'" . DG  I 6  84   ? 181.684 217.216 179.349 1.00 98.62  ?  -3   DG  I "C3'" 1 
ATOM   7723  O  "O3'" . DG  I 6  84   ? 181.852 217.554 180.729 1.00 99.62  ?  -3   DG  I "O3'" 1 
ATOM   7724  C  "C2'" . DG  I 6  84   ? 180.650 218.113 178.693 1.00 98.21  ?  -3   DG  I "C2'" 1 
ATOM   7725  C  "C1'" . DG  I 6  84   ? 181.471 219.331 178.305 1.00 98.41  ?  -3   DG  I "C1'" 1 
ATOM   7726  N  N9    . DG  I 6  84   ? 180.980 220.032 177.124 1.00 98.49  ?  -3   DG  I N9    1 
ATOM   7727  C  C8    . DG  I 6  84   ? 180.669 219.481 175.904 1.00 98.47  ?  -3   DG  I C8    1 
ATOM   7728  N  N7    . DG  I 6  84   ? 180.254 220.362 175.035 1.00 97.95  ?  -3   DG  I N7    1 
ATOM   7729  C  C5    . DG  I 6  84   ? 180.293 221.568 175.721 1.00 98.25  ?  -3   DG  I C5    1 
ATOM   7730  C  C6    . DG  I 6  84   ? 179.956 222.882 175.293 1.00 98.39  ?  -3   DG  I C6    1 
ATOM   7731  O  O6    . DG  I 6  84   ? 179.542 223.251 174.188 1.00 98.73  ?  -3   DG  I O6    1 
ATOM   7732  N  N1    . DG  I 6  84   ? 180.145 223.816 176.309 1.00 98.85  ?  -3   DG  I N1    1 
ATOM   7733  C  C2    . DG  I 6  84   ? 180.599 223.523 177.573 1.00 98.85  ?  -3   DG  I C2    1 
ATOM   7734  N  N2    . DG  I 6  84   ? 180.715 224.562 178.413 1.00 98.74  ?  -3   DG  I N2    1 
ATOM   7735  N  N3    . DG  I 6  84   ? 180.917 222.303 177.983 1.00 99.00  ?  -3   DG  I N3    1 
ATOM   7736  C  C4    . DG  I 6  84   ? 180.741 221.380 177.012 1.00 98.81  ?  -3   DG  I C4    1 
ATOM   7737  P  P     . DC  I 6  85   ? 180.570 217.668 181.685 1.00 100.21 ?  -2   DC  I P     1 
ATOM   7738  O  OP1   . DC  I 6  85   ? 181.018 217.444 183.083 1.00 99.87  ?  -2   DC  I OP1   1 
ATOM   7739  O  OP2   . DC  I 6  85   ? 179.496 216.817 181.113 1.00 98.68  -1 -2   DC  I OP2   1 
ATOM   7740  O  "O5'" . DC  I 6  85   ? 180.138 219.193 181.534 1.00 102.70 ?  -2   DC  I "O5'" 1 
ATOM   7741  C  "C5'" . DC  I 6  85   ? 179.746 219.971 182.683 1.00 105.64 ?  -2   DC  I "C5'" 1 
ATOM   7742  C  "C4'" . DC  I 6  85   ? 178.556 220.843 182.351 1.00 107.76 ?  -2   DC  I "C4'" 1 
ATOM   7743  O  "O4'" . DC  I 6  85   ? 178.673 221.320 180.988 1.00 106.97 ?  -2   DC  I "O4'" 1 
ATOM   7744  C  "C3'" . DC  I 6  85   ? 177.204 220.133 182.423 1.00 109.69 ?  -2   DC  I "C3'" 1 
ATOM   7745  O  "O3'" . DC  I 6  85   ? 176.166 221.056 182.767 1.00 112.81 ?  -2   DC  I "O3'" 1 
ATOM   7746  C  "C2'" . DC  I 6  85   ? 176.989 219.680 180.991 1.00 108.74 ?  -2   DC  I "C2'" 1 
ATOM   7747  C  "C1'" . DC  I 6  85   ? 177.579 220.846 180.214 1.00 107.33 ?  -2   DC  I "C1'" 1 
ATOM   7748  N  N1    . DC  I 6  85   ? 178.087 220.497 178.880 1.00 107.28 ?  -2   DC  I N1    1 
ATOM   7749  C  C2    . DC  I 6  85   ? 178.221 221.508 177.926 1.00 107.36 ?  -2   DC  I C2    1 
ATOM   7750  O  O2    . DC  I 6  85   ? 177.907 222.668 178.235 1.00 106.84 ?  -2   DC  I O2    1 
ATOM   7751  N  N3    . DC  I 6  85   ? 178.687 221.198 176.693 1.00 107.19 ?  -2   DC  I N3    1 
ATOM   7752  C  C4    . DC  I 6  85   ? 179.013 219.937 176.402 1.00 107.11 ?  -2   DC  I C4    1 
ATOM   7753  N  N4    . DC  I 6  85   ? 179.469 219.677 175.175 1.00 107.66 ?  -2   DC  I N4    1 
ATOM   7754  C  C5    . DC  I 6  85   ? 178.886 218.887 177.356 1.00 106.69 ?  -2   DC  I C5    1 
ATOM   7755  C  C6    . DC  I 6  85   ? 178.424 219.208 178.571 1.00 106.87 ?  -2   DC  I C6    1 
ATOM   7756  P  P     . DG  I 6  86   ? 175.843 221.365 184.302 1.00 115.34 ?  -1   DG  I P     1 
ATOM   7757  O  OP1   . DG  I 6  86   ? 177.031 220.983 185.108 1.00 114.64 ?  -1   DG  I OP1   1 
ATOM   7758  O  OP2   . DG  I 6  86   ? 174.517 220.780 184.621 1.00 115.30 -1 -1   DG  I OP2   1 
ATOM   7759  O  "O5'" . DG  I 6  86   ? 175.714 222.951 184.325 1.00 118.56 ?  -1   DG  I "O5'" 1 
ATOM   7760  C  "C5'" . DG  I 6  86   ? 176.155 223.736 183.203 1.00 123.25 ?  -1   DG  I "C5'" 1 
ATOM   7761  C  "C4'" . DG  I 6  86   ? 175.052 224.661 182.746 1.00 127.02 ?  -1   DG  I "C4'" 1 
ATOM   7762  O  "O4'" . DG  I 6  86   ? 174.889 224.554 181.312 1.00 127.98 ?  -1   DG  I "O4'" 1 
ATOM   7763  C  "C3'" . DG  I 6  86   ? 173.677 224.381 183.355 1.00 129.08 ?  -1   DG  I "C3'" 1 
ATOM   7764  O  "O3'" . DG  I 6  86   ? 173.058 225.631 183.677 1.00 132.20 ?  -1   DG  I "O3'" 1 
ATOM   7765  C  "C2'" . DG  I 6  86   ? 172.943 223.633 182.259 1.00 129.14 ?  -1   DG  I "C2'" 1 
ATOM   7766  C  "C1'" . DG  I 6  86   ? 173.557 224.191 180.986 1.00 129.42 ?  -1   DG  I "C1'" 1 
ATOM   7767  N  N9    . DG  I 6  86   ? 173.615 223.235 179.885 1.00 129.69 ?  -1   DG  I N9    1 
ATOM   7768  C  C8    . DG  I 6  86   ? 173.694 221.867 179.983 1.00 129.89 ?  -1   DG  I C8    1 
ATOM   7769  N  N7    . DG  I 6  86   ? 173.737 221.272 178.821 1.00 130.19 ?  -1   DG  I N7    1 
ATOM   7770  C  C5    . DG  I 6  86   ? 173.688 222.310 177.901 1.00 129.99 ?  -1   DG  I C5    1 
ATOM   7771  C  C6    . DG  I 6  86   ? 173.701 222.282 176.479 1.00 129.64 ?  -1   DG  I C6    1 
ATOM   7772  O  O6    . DG  I 6  86   ? 173.762 221.301 175.728 1.00 129.43 ?  -1   DG  I O6    1 
ATOM   7773  N  N1    . DG  I 6  86   ? 173.634 223.564 175.939 1.00 129.94 ?  -1   DG  I N1    1 
ATOM   7774  C  C2    . DG  I 6  86   ? 173.564 224.725 176.674 1.00 129.98 ?  -1   DG  I C2    1 
ATOM   7775  N  N2    . DG  I 6  86   ? 173.506 225.865 175.971 1.00 129.88 ?  -1   DG  I N2    1 
ATOM   7776  N  N3    . DG  I 6  86   ? 173.550 224.764 177.999 1.00 129.76 ?  -1   DG  I N3    1 
ATOM   7777  C  C4    . DG  I 6  86   ? 173.615 223.529 178.543 1.00 129.85 ?  -1   DG  I C4    1 
ATOM   7778  P  P     . DC  I 6  87   ? 171.517 225.671 184.107 1.00 134.15 ?  0    DC  I P     1 
ATOM   7779  O  OP1   . DC  I 6  87   ? 171.347 226.753 185.110 1.00 133.95 ?  0    DC  I OP1   1 
ATOM   7780  O  OP2   . DC  I 6  87   ? 171.097 224.286 184.442 1.00 133.70 -1 0    DC  I OP2   1 
ATOM   7781  O  "O5'" . DC  I 6  87   ? 170.781 226.113 182.766 1.00 135.81 ?  0    DC  I "O5'" 1 
ATOM   7782  C  "C5'" . DC  I 6  87   ? 171.167 227.316 182.075 1.00 138.92 ?  0    DC  I "C5'" 1 
ATOM   7783  C  "C4'" . DC  I 6  87   ? 170.253 227.566 180.899 1.00 141.28 ?  0    DC  I "C4'" 1 
ATOM   7784  O  "O4'" . DC  I 6  87   ? 170.553 226.625 179.839 1.00 142.13 ?  0    DC  I "O4'" 1 
ATOM   7785  C  "C3'" . DC  I 6  87   ? 168.759 227.414 181.193 1.00 142.72 ?  0    DC  I "C3'" 1 
ATOM   7786  O  "O3'" . DC  I 6  87   ? 168.037 228.449 180.520 1.00 144.70 ?  0    DC  I "O3'" 1 
ATOM   7787  C  "C2'" . DC  I 6  87   ? 168.417 226.061 180.598 1.00 142.58 ?  0    DC  I "C2'" 1 
ATOM   7788  C  "C1'" . DC  I 6  87   ? 169.359 225.992 179.411 1.00 142.80 ?  0    DC  I "C1'" 1 
ATOM   7789  N  N1    . DC  I 6  87   ? 169.701 224.627 178.983 1.00 143.22 ?  0    DC  I N1    1 
ATOM   7790  C  C2    . DC  I 6  87   ? 169.494 224.270 177.649 1.00 143.23 ?  0    DC  I C2    1 
ATOM   7791  O  O2    . DC  I 6  87   ? 169.028 225.113 176.868 1.00 143.16 ?  0    DC  I O2    1 
ATOM   7792  N  N3    . DC  I 6  87   ? 169.806 223.017 177.244 1.00 143.12 ?  0    DC  I N3    1 
ATOM   7793  C  C4    . DC  I 6  87   ? 170.306 222.140 178.117 1.00 143.08 ?  0    DC  I C4    1 
ATOM   7794  N  N4    . DC  I 6  87   ? 170.600 220.915 177.673 1.00 142.93 ?  0    DC  I N4    1 
ATOM   7795  C  C5    . DC  I 6  87   ? 170.527 222.478 179.483 1.00 143.37 ?  0    DC  I C5    1 
ATOM   7796  C  C6    . DC  I 6  87   ? 170.214 223.722 179.869 1.00 143.50 ?  0    DC  I C6    1 
ATOM   7797  P  P     . DT  I 6  88   ? 166.509 228.729 180.896 1.00 146.13 ?  1    DT  I P     1 
ATOM   7798  O  OP1   . DT  I 6  88   ? 166.349 230.188 181.119 1.00 146.23 ?  1    DT  I OP1   1 
ATOM   7799  O  OP2   . DT  I 6  88   ? 166.115 227.773 181.962 1.00 146.03 -1 1    DT  I OP2   1 
ATOM   7800  O  "O5'" . DT  I 6  88   ? 165.736 228.342 179.559 1.00 146.86 ?  1    DT  I "O5'" 1 
ATOM   7801  C  "C5'" . DT  I 6  88   ? 166.214 228.797 178.281 1.00 148.56 ?  1    DT  I "C5'" 1 
ATOM   7802  C  "C4'" . DT  I 6  88   ? 165.631 227.955 177.171 1.00 150.05 ?  1    DT  I "C4'" 1 
ATOM   7803  O  "O4'" . DT  I 6  88   ? 166.249 226.644 177.171 1.00 150.58 ?  1    DT  I "O4'" 1 
ATOM   7804  C  "C3'" . DT  I 6  88   ? 164.121 227.713 177.263 1.00 150.65 ?  1    DT  I "C3'" 1 
ATOM   7805  O  "O3'" . DT  I 6  88   ? 163.571 227.804 175.948 1.00 151.59 ?  1    DT  I "O3'" 1 
ATOM   7806  C  "C2'" . DT  I 6  88   ? 164.023 226.279 177.751 1.00 150.65 ?  1    DT  I "C2'" 1 
ATOM   7807  C  "C1'" . DT  I 6  88   ? 165.238 225.653 177.099 1.00 150.84 ?  1    DT  I "C1'" 1 
ATOM   7808  N  N1    . DT  I 6  88   ? 165.744 224.441 177.769 1.00 150.90 ?  1    DT  I N1    1 
ATOM   7809  C  C2    . DT  I 6  88   ? 165.787 223.272 177.045 1.00 150.94 ?  1    DT  I C2    1 
ATOM   7810  O  O2    . DT  I 6  88   ? 165.427 223.195 175.882 1.00 151.15 ?  1    DT  I O2    1 
ATOM   7811  N  N3    . DT  I 6  88   ? 166.268 222.189 177.738 1.00 151.01 ?  1    DT  I N3    1 
ATOM   7812  C  C4    . DT  I 6  88   ? 166.702 222.161 179.049 1.00 150.99 ?  1    DT  I C4    1 
ATOM   7813  O  O4    . DT  I 6  88   ? 167.109 221.110 179.537 1.00 151.05 ?  1    DT  I O4    1 
ATOM   7814  C  C5    . DT  I 6  88   ? 166.628 223.423 179.749 1.00 151.06 ?  1    DT  I C5    1 
ATOM   7815  C  C7    . DT  I 6  88   ? 167.075 223.491 181.174 1.00 150.96 ?  1    DT  I C7    1 
ATOM   7816  C  C6    . DT  I 6  88   ? 166.160 224.485 179.081 1.00 151.08 ?  1    DT  I C6    1 
ATOM   7817  P  P     . DG  I 6  89   ? 162.150 228.506 175.727 1.00 152.05 ?  2    DG  I P     1 
ATOM   7818  O  OP1   . DG  I 6  89   ? 162.368 229.973 175.643 1.00 151.86 ?  2    DG  I OP1   1 
ATOM   7819  O  OP2   . DG  I 6  89   ? 161.205 227.959 176.733 1.00 151.89 -1 2    DG  I OP2   1 
ATOM   7820  O  "O5'" . DG  I 6  89   ? 161.722 227.978 174.289 1.00 151.82 ?  2    DG  I "O5'" 1 
ATOM   7821  C  "C5'" . DG  I 6  89   ? 162.594 227.099 173.559 1.00 151.68 ?  2    DG  I "C5'" 1 
ATOM   7822  C  "C4'" . DG  I 6  89   ? 161.893 225.792 173.270 1.00 151.84 ?  2    DG  I "C4'" 1 
ATOM   7823  O  "O4'" . DG  I 6  89   ? 162.510 224.713 174.015 1.00 151.84 ?  2    DG  I "O4'" 1 
ATOM   7824  C  "C3'" . DG  I 6  89   ? 160.402 225.755 173.621 1.00 151.83 ?  2    DG  I "C3'" 1 
ATOM   7825  O  "O3'" . DG  I 6  89   ? 159.762 225.086 172.537 1.00 151.94 ?  2    DG  I "O3'" 1 
ATOM   7826  C  "C2'" . DG  I 6  89   ? 160.345 224.853 174.840 1.00 151.62 ?  2    DG  I "C2'" 1 
ATOM   7827  C  "C1'" . DG  I 6  89   ? 161.485 223.898 174.551 1.00 151.33 ?  2    DG  I "C1'" 1 
ATOM   7828  N  N9    . DG  I 6  89   ? 162.025 223.200 175.713 1.00 151.10 ?  2    DG  I N9    1 
ATOM   7829  C  C8    . DG  I 6  89   ? 162.100 223.666 177.004 1.00 150.91 ?  2    DG  I C8    1 
ATOM   7830  N  N7    . DG  I 6  89   ? 162.632 222.805 177.830 1.00 150.88 ?  2    DG  I N7    1 
ATOM   7831  C  C5    . DG  I 6  89   ? 162.923 221.704 177.037 1.00 150.92 ?  2    DG  I C5    1 
ATOM   7832  C  C6    . DG  I 6  89   ? 163.514 220.454 177.377 1.00 151.02 ?  2    DG  I C6    1 
ATOM   7833  O  O6    . DG  I 6  89   ? 163.910 220.063 178.483 1.00 150.93 ?  2    DG  I O6    1 
ATOM   7834  N  N1    . DG  I 6  89   ? 163.627 219.621 176.268 1.00 151.16 ?  2    DG  I N1    1 
ATOM   7835  C  C2    . DG  I 6  89   ? 163.224 219.948 174.994 1.00 150.98 ?  2    DG  I C2    1 
ATOM   7836  N  N2    . DG  I 6  89   ? 163.417 219.009 174.055 1.00 150.93 ?  2    DG  I N2    1 
ATOM   7837  N  N3    . DG  I 6  89   ? 162.672 221.107 174.665 1.00 150.97 ?  2    DG  I N3    1 
ATOM   7838  C  C4    . DG  I 6  89   ? 162.553 221.931 175.727 1.00 150.96 ?  2    DG  I C4    1 
ATOM   7839  P  P     . DT  I 6  90   ? 158.177 225.214 172.352 1.00 151.90 ?  3    DT  I P     1 
ATOM   7840  O  OP1   . DT  I 6  90   ? 157.920 226.215 171.286 1.00 151.92 ?  3    DT  I OP1   1 
ATOM   7841  O  OP2   . DT  I 6  90   ? 157.570 225.396 173.694 1.00 151.92 -1 3    DT  I OP2   1 
ATOM   7842  O  "O5'" . DT  I 6  90   ? 157.762 223.780 171.799 1.00 151.41 ?  3    DT  I "O5'" 1 
ATOM   7843  C  "C5'" . DT  I 6  90   ? 158.511 223.160 170.738 1.00 150.53 ?  3    DT  I "C5'" 1 
ATOM   7844  C  "C4'" . DT  I 6  90   ? 158.497 221.658 170.899 1.00 149.88 ?  3    DT  I "C4'" 1 
ATOM   7845  O  "O4'" . DT  I 6  90   ? 159.139 221.294 172.146 1.00 149.98 ?  3    DT  I "O4'" 1 
ATOM   7846  C  "C3'" . DT  I 6  90   ? 157.103 221.030 170.939 1.00 149.40 ?  3    DT  I "C3'" 1 
ATOM   7847  O  "O3'" . DT  I 6  90   ? 157.118 219.810 170.193 1.00 148.36 ?  3    DT  I "O3'" 1 
ATOM   7848  C  "C2'" . DT  I 6  90   ? 156.890 220.732 172.413 1.00 149.73 ?  3    DT  I "C2'" 1 
ATOM   7849  C  "C1'" . DT  I 6  90   ? 158.299 220.410 172.869 1.00 150.08 ?  3    DT  I "C1'" 1 
ATOM   7850  N  N1    . DT  I 6  90   ? 158.544 220.626 174.305 1.00 150.28 ?  3    DT  I N1    1 
ATOM   7851  C  C2    . DT  I 6  90   ? 159.147 219.615 175.019 1.00 150.11 ?  3    DT  I C2    1 
ATOM   7852  O  O2    . DT  I 6  90   ? 159.488 218.556 174.517 1.00 149.78 ?  3    DT  I O2    1 
ATOM   7853  N  N3    . DT  I 6  90   ? 159.340 219.892 176.349 1.00 150.19 ?  3    DT  I N3    1 
ATOM   7854  C  C4    . DT  I 6  90   ? 158.997 221.050 177.021 1.00 150.16 ?  3    DT  I C4    1 
ATOM   7855  O  O4    . DT  I 6  90   ? 159.232 221.155 178.221 1.00 150.01 ?  3    DT  I O4    1 
ATOM   7856  C  C5    . DT  I 6  90   ? 158.367 222.068 176.210 1.00 150.11 ?  3    DT  I C5    1 
ATOM   7857  C  C7    . DT  I 6  90   ? 157.959 223.357 176.849 1.00 149.98 ?  3    DT  I C7    1 
ATOM   7858  C  C6    . DT  I 6  90   ? 158.175 221.807 174.910 1.00 150.31 ?  3    DT  I C6    1 
ATOM   7859  P  P     . DC  I 6  91   ? 155.763 219.246 169.556 1.00 147.37 ?  4    DC  I P     1 
ATOM   7860  O  OP1   . DC  I 6  91   ? 155.441 220.065 168.359 1.00 147.33 ?  4    DC  I OP1   1 
ATOM   7861  O  OP2   . DC  I 6  91   ? 154.764 219.112 170.645 1.00 147.28 -1 4    DC  I OP2   1 
ATOM   7862  O  "O5'" . DC  I 6  91   ? 156.175 217.785 169.071 1.00 146.41 ?  4    DC  I "O5'" 1 
ATOM   7863  C  "C5'" . DC  I 6  91   ? 157.267 217.081 169.693 1.00 144.47 ?  4    DC  I "C5'" 1 
ATOM   7864  C  "C4'" . DC  I 6  91   ? 156.738 215.974 170.576 1.00 142.61 ?  4    DC  I "C4'" 1 
ATOM   7865  O  "O4'" . DC  I 6  91   ? 156.829 216.375 171.956 1.00 141.92 ?  4    DC  I "O4'" 1 
ATOM   7866  C  "C3'" . DC  I 6  91   ? 155.267 215.625 170.351 1.00 141.74 ?  4    DC  I "C3'" 1 
ATOM   7867  O  "O3'" . DC  I 6  91   ? 155.162 214.451 169.538 1.00 141.04 ?  4    DC  I "O3'" 1 
ATOM   7868  C  "C2'" . DC  I 6  91   ? 154.721 215.357 171.747 1.00 141.28 ?  4    DC  I "C2'" 1 
ATOM   7869  C  "C1'" . DC  I 6  91   ? 155.883 215.631 172.696 1.00 141.00 ?  4    DC  I "C1'" 1 
ATOM   7870  N  N1    . DC  I 6  91   ? 155.522 216.418 173.884 1.00 140.76 ?  4    DC  I N1    1 
ATOM   7871  C  C2    . DC  I 6  91   ? 155.679 215.840 175.147 1.00 140.74 ?  4    DC  I C2    1 
ATOM   7872  O  O2    . DC  I 6  91   ? 156.116 214.683 175.225 1.00 140.68 ?  4    DC  I O2    1 
ATOM   7873  N  N3    . DC  I 6  91   ? 155.351 216.557 176.247 1.00 140.72 ?  4    DC  I N3    1 
ATOM   7874  C  C4    . DC  I 6  91   ? 154.885 217.800 176.118 1.00 140.64 ?  4    DC  I C4    1 
ATOM   7875  N  N4    . DC  I 6  91   ? 154.575 218.470 177.230 1.00 140.58 ?  4    DC  I N4    1 
ATOM   7876  C  C5    . DC  I 6  91   ? 154.715 218.413 174.843 1.00 140.61 ?  4    DC  I C5    1 
ATOM   7877  C  C6    . DC  I 6  91   ? 155.044 217.692 173.762 1.00 140.71 ?  4    DC  I C6    1 
ATOM   7878  P  P     . DC  I 6  92   ? 154.521 213.115 170.140 1.00 140.78 ?  5    DC  I P     1 
ATOM   7879  O  OP1   . DC  I 6  92   ? 154.880 211.987 169.242 1.00 140.59 ?  5    DC  I OP1   1 
ATOM   7880  O  OP2   . DC  I 6  92   ? 153.094 213.387 170.444 1.00 140.30 -1 5    DC  I OP2   1 
ATOM   7881  O  "O5'" . DC  I 6  92   ? 155.304 212.931 171.514 1.00 140.25 ?  5    DC  I "O5'" 1 
ATOM   7882  C  "C5'" . DC  I 6  92   ? 156.476 212.100 171.591 1.00 139.26 ?  5    DC  I "C5'" 1 
ATOM   7883  C  "C4'" . DC  I 6  92   ? 156.293 211.042 172.653 1.00 138.68 ?  5    DC  I "C4'" 1 
ATOM   7884  O  "O4'" . DC  I 6  92   ? 155.831 211.666 173.874 1.00 138.47 ?  5    DC  I "O4'" 1 
ATOM   7885  C  "C3'" . DC  I 6  92   ? 155.249 209.980 172.316 1.00 138.30 ?  5    DC  I "C3'" 1 
ATOM   7886  O  "O3'" . DC  I 6  92   ? 155.591 208.741 172.942 1.00 137.31 ?  5    DC  I "O3'" 1 
ATOM   7887  C  "C2'" . DC  I 6  92   ? 153.984 210.543 172.930 1.00 138.57 ?  5    DC  I "C2'" 1 
ATOM   7888  C  "C1'" . DC  I 6  92   ? 154.508 211.239 174.178 1.00 138.74 ?  5    DC  I "C1'" 1 
ATOM   7889  N  N1    . DC  I 6  92   ? 153.736 212.423 174.581 1.00 138.92 ?  5    DC  I N1    1 
ATOM   7890  C  C2    . DC  I 6  92   ? 153.609 212.712 175.942 1.00 138.89 ?  5    DC  I C2    1 
ATOM   7891  O  O2    . DC  I 6  92   ? 154.149 211.960 176.766 1.00 138.86 ?  5    DC  I O2    1 
ATOM   7892  N  N3    . DC  I 6  92   ? 152.902 213.800 176.324 1.00 138.71 ?  5    DC  I N3    1 
ATOM   7893  C  C4    . DC  I 6  92   ? 152.336 214.584 175.403 1.00 138.73 ?  5    DC  I C4    1 
ATOM   7894  N  N4    . DC  I 6  92   ? 151.648 215.647 175.824 1.00 138.74 ?  5    DC  I N4    1 
ATOM   7895  C  C5    . DC  I 6  92   ? 152.451 214.312 174.009 1.00 138.99 ?  5    DC  I C5    1 
ATOM   7896  C  C6    . DC  I 6  92   ? 153.153 213.231 173.646 1.00 139.12 ?  5    DC  I C6    1 
ATOM   7897  P  P     . DC  I 6  93   ? 155.610 207.387 172.094 1.00 136.36 ?  6    DC  I P     1 
ATOM   7898  O  OP1   . DC  I 6  93   ? 156.292 207.662 170.804 1.00 136.29 ?  6    DC  I OP1   1 
ATOM   7899  O  OP2   . DC  I 6  93   ? 154.236 206.825 172.095 1.00 136.16 -1 6    DC  I OP2   1 
ATOM   7900  O  "O5'" . DC  I 6  93   ? 156.550 206.438 172.963 1.00 135.18 ?  6    DC  I "O5'" 1 
ATOM   7901  C  "C5'" . DC  I 6  93   ? 157.796 206.926 173.494 1.00 133.56 ?  6    DC  I "C5'" 1 
ATOM   7902  C  "C4'" . DC  I 6  93   ? 157.696 207.105 174.991 1.00 132.33 ?  6    DC  I "C4'" 1 
ATOM   7903  O  "O4'" . DC  I 6  93   ? 156.776 208.182 175.294 1.00 132.06 ?  6    DC  I "O4'" 1 
ATOM   7904  C  "C3'" . DC  I 6  93   ? 157.189 205.879 175.754 1.00 131.52 ?  6    DC  I "C3'" 1 
ATOM   7905  O  "O3'" . DC  I 6  93   ? 157.987 205.654 176.919 1.00 130.37 ?  6    DC  I "O3'" 1 
ATOM   7906  C  "C2'" . DC  I 6  93   ? 155.770 206.256 176.143 1.00 131.41 ?  6    DC  I "C2'" 1 
ATOM   7907  C  "C1'" . DC  I 6  93   ? 155.870 207.760 176.297 1.00 131.86 ?  6    DC  I "C1'" 1 
ATOM   7908  N  N1    . DC  I 6  93   ? 154.602 208.476 176.092 1.00 132.04 ?  6    DC  I N1    1 
ATOM   7909  C  C2    . DC  I 6  93   ? 154.062 209.205 177.155 1.00 132.31 ?  6    DC  I C2    1 
ATOM   7910  O  O2    . DC  I 6  93   ? 154.667 209.224 178.236 1.00 132.43 ?  6    DC  I O2    1 
ATOM   7911  N  N3    . DC  I 6  93   ? 152.895 209.867 176.977 1.00 132.41 ?  6    DC  I N3    1 
ATOM   7912  C  C4    . DC  I 6  93   ? 152.276 209.821 175.796 1.00 132.28 ?  6    DC  I C4    1 
ATOM   7913  N  N4    . DC  I 6  93   ? 151.128 210.489 175.665 1.00 132.06 ?  6    DC  I N4    1 
ATOM   7914  C  C5    . DC  I 6  93   ? 152.805 209.085 174.696 1.00 132.41 ?  6    DC  I C5    1 
ATOM   7915  C  C6    . DC  I 6  93   ? 153.960 208.435 174.886 1.00 132.19 ?  6    DC  I C6    1 
ATOM   7916  P  P     . DC  I 6  94   ? 158.410 204.166 177.325 1.00 128.92 ?  7    DC  I P     1 
ATOM   7917  O  OP1   . DC  I 6  94   ? 159.812 203.950 176.888 1.00 128.95 ?  7    DC  I OP1   1 
ATOM   7918  O  OP2   . DC  I 6  94   ? 157.345 203.242 176.857 1.00 128.86 -1 7    DC  I OP2   1 
ATOM   7919  O  "O5'" . DC  I 6  94   ? 158.381 204.205 178.917 1.00 127.96 ?  7    DC  I "O5'" 1 
ATOM   7920  C  "C5'" . DC  I 6  94   ? 157.147 204.024 179.638 1.00 126.31 ?  7    DC  I "C5'" 1 
ATOM   7921  C  "C4'" . DC  I 6  94   ? 157.173 204.807 180.929 1.00 125.38 ?  7    DC  I "C4'" 1 
ATOM   7922  O  "O4'" . DC  I 6  94   ? 156.420 206.031 180.759 1.00 125.26 ?  7    DC  I "O4'" 1 
ATOM   7923  C  "C3'" . DC  I 6  94   ? 156.528 204.090 182.113 1.00 124.99 ?  7    DC  I "C3'" 1 
ATOM   7924  O  "O3'" . DC  I 6  94   ? 157.139 204.476 183.350 1.00 124.02 ?  7    DC  I "O3'" 1 
ATOM   7925  C  "C2'" . DC  I 6  94   ? 155.089 204.567 182.055 1.00 125.42 ?  7    DC  I "C2'" 1 
ATOM   7926  C  "C1'" . DC  I 6  94   ? 155.223 205.990 181.529 1.00 125.57 ?  7    DC  I "C1'" 1 
ATOM   7927  N  N1    . DC  I 6  94   ? 154.116 206.416 180.660 1.00 125.60 ?  7    DC  I N1    1 
ATOM   7928  C  C2    . DC  I 6  94   ? 153.385 207.554 181.009 1.00 125.41 ?  7    DC  I C2    1 
ATOM   7929  O  O2    . DC  I 6  94   ? 153.693 208.171 182.040 1.00 125.37 ?  7    DC  I O2    1 
ATOM   7930  N  N3    . DC  I 6  94   ? 152.364 207.953 180.216 1.00 125.53 ?  7    DC  I N3    1 
ATOM   7931  C  C4    . DC  I 6  94   ? 152.065 207.260 179.115 1.00 125.57 ?  7    DC  I C4    1 
ATOM   7932  N  N4    . DC  I 6  94   ? 151.049 207.689 178.362 1.00 125.74 ?  7    DC  I N4    1 
ATOM   7933  C  C5    . DC  I 6  94   ? 152.794 206.096 178.736 1.00 125.40 ?  7    DC  I C5    1 
ATOM   7934  C  C6    . DC  I 6  94   ? 153.801 205.712 179.531 1.00 125.64 ?  7    DC  I C6    1 
ATOM   7935  P  P     . DC  I 6  95   ? 156.880 203.609 184.670 1.00 122.86 ?  8    DC  I P     1 
ATOM   7936  O  OP1   . DC  I 6  95   ? 158.153 203.543 185.432 1.00 123.05 ?  8    DC  I OP1   1 
ATOM   7937  O  OP2   . DC  I 6  95   ? 156.199 202.352 184.269 1.00 122.53 -1 8    DC  I OP2   1 
ATOM   7938  O  "O5'" . DC  I 6  95   ? 155.850 204.503 185.490 1.00 123.47 ?  8    DC  I "O5'" 1 
ATOM   7939  C  "C5'" . DC  I 6  95   ? 156.315 205.485 186.435 1.00 124.48 ?  8    DC  I "C5'" 1 
ATOM   7940  C  "C4'" . DC  I 6  95   ? 155.158 206.309 186.948 1.00 125.32 ?  8    DC  I "C4'" 1 
ATOM   7941  O  "O4'" . DC  I 6  95   ? 154.286 206.664 185.848 1.00 125.77 ?  8    DC  I "O4'" 1 
ATOM   7942  C  "C3'" . DC  I 6  95   ? 154.274 205.606 187.981 1.00 125.82 ?  8    DC  I "C3'" 1 
ATOM   7943  O  "O3'" . DC  I 6  95   ? 153.915 206.525 189.017 1.00 127.35 ?  8    DC  I "O3'" 1 
ATOM   7944  C  "C2'" . DC  I 6  95   ? 153.050 205.198 187.183 1.00 125.46 ?  8    DC  I "C2'" 1 
ATOM   7945  C  "C1'" . DC  I 6  95   ? 152.949 206.316 186.163 1.00 125.81 ?  8    DC  I "C1'" 1 
ATOM   7946  N  N1    . DC  I 6  95   ? 152.276 205.936 184.913 1.00 125.86 ?  8    DC  I N1    1 
ATOM   7947  C  C2    . DC  I 6  95   ? 151.062 206.550 184.589 1.00 126.00 ?  8    DC  I C2    1 
ATOM   7948  O  O2    . DC  I 6  95   ? 150.592 207.394 185.366 1.00 125.95 ?  8    DC  I O2    1 
ATOM   7949  N  N3    . DC  I 6  95   ? 150.435 206.208 183.440 1.00 126.03 ?  8    DC  I N3    1 
ATOM   7950  C  C4    . DC  I 6  95   ? 150.976 205.294 182.631 1.00 125.95 ?  8    DC  I C4    1 
ATOM   7951  N  N4    . DC  I 6  95   ? 150.322 204.987 181.508 1.00 125.98 ?  8    DC  I N4    1 
ATOM   7952  C  C5    . DC  I 6  95   ? 152.212 204.654 182.938 1.00 125.73 ?  8    DC  I C5    1 
ATOM   7953  C  C6    . DC  I 6  95   ? 152.821 205.002 184.077 1.00 125.57 ?  8    DC  I C6    1 
ATOM   7954  P  P     . DG  I 6  96   ? 153.496 205.978 190.461 1.00 128.68 ?  9    DG  I P     1 
ATOM   7955  O  OP1   . DG  I 6  96   ? 154.239 206.758 191.484 1.00 128.24 ?  9    DG  I OP1   1 
ATOM   7956  O  OP2   . DG  I 6  96   ? 153.608 204.497 190.443 1.00 128.76 -1 9    DG  I OP2   1 
ATOM   7957  O  "O5'" . DG  I 6  96   ? 151.953 206.363 190.557 1.00 129.78 ?  9    DG  I "O5'" 1 
ATOM   7958  C  "C5'" . DG  I 6  96   ? 151.534 207.737 190.486 1.00 131.84 ?  9    DG  I "C5'" 1 
ATOM   7959  C  "C4'" . DG  I 6  96   ? 150.041 207.821 190.265 1.00 133.15 ?  9    DG  I "C4'" 1 
ATOM   7960  O  "O4'" . DG  I 6  96   ? 149.717 207.369 188.928 1.00 133.38 ?  9    DG  I "O4'" 1 
ATOM   7961  C  "C3'" . DG  I 6  96   ? 149.197 206.975 191.223 1.00 134.38 ?  9    DG  I "C3'" 1 
ATOM   7962  O  "O3'" . DG  I 6  96   ? 148.112 207.766 191.717 1.00 136.08 ?  9    DG  I "O3'" 1 
ATOM   7963  C  "C2'" . DG  I 6  96   ? 148.685 205.839 190.353 1.00 134.09 ?  9    DG  I "C2'" 1 
ATOM   7964  C  "C1'" . DG  I 6  96   ? 148.614 206.483 188.984 1.00 134.26 ?  9    DG  I "C1'" 1 
ATOM   7965  N  N9    . DG  I 6  96   ? 148.735 205.549 187.870 1.00 134.41 ?  9    DG  I N9    1 
ATOM   7966  C  C8    . DG  I 6  96   ? 149.509 204.415 187.820 1.00 134.72 ?  9    DG  I C8    1 
ATOM   7967  N  N7    . DG  I 6  96   ? 149.413 203.777 186.685 1.00 134.90 ?  9    DG  I N7    1 
ATOM   7968  C  C5    . DG  I 6  96   ? 148.522 204.536 185.939 1.00 134.75 ?  9    DG  I C5    1 
ATOM   7969  C  C6    . DG  I 6  96   ? 148.026 204.342 184.619 1.00 134.58 ?  9    DG  I C6    1 
ATOM   7970  O  O6    . DG  I 6  96   ? 148.286 203.430 183.825 1.00 134.54 ?  9    DG  I O6    1 
ATOM   7971  N  N1    . DG  I 6  96   ? 147.141 205.351 184.250 1.00 134.74 ?  9    DG  I N1    1 
ATOM   7972  C  C2    . DG  I 6  96   ? 146.779 206.411 185.047 1.00 134.91 ?  9    DG  I C2    1 
ATOM   7973  N  N2    . DG  I 6  96   ? 145.911 207.282 184.512 1.00 134.74 ?  9    DG  I N2    1 
ATOM   7974  N  N3    . DG  I 6  96   ? 147.233 206.603 186.277 1.00 134.98 ?  9    DG  I N3    1 
ATOM   7975  C  C4    . DG  I 6  96   ? 148.094 205.635 186.656 1.00 134.72 ?  9    DG  I C4    1 
ATOM   7976  P  P     . DC  I 6  97   ? 147.140 207.174 192.841 1.00 137.46 ?  10   DC  I P     1 
ATOM   7977  O  OP1   . DC  I 6  97   ? 146.694 208.298 193.703 1.00 137.71 ?  10   DC  I OP1   1 
ATOM   7978  O  OP2   . DC  I 6  97   ? 147.808 205.998 193.453 1.00 136.94 -1 10   DC  I OP2   1 
ATOM   7979  O  "O5'" . DC  I 6  97   ? 145.889 206.662 191.999 1.00 139.11 ?  10   DC  I "O5'" 1 
ATOM   7980  C  "C5'" . DC  I 6  97   ? 145.267 207.511 191.017 1.00 142.03 ?  10   DC  I "C5'" 1 
ATOM   7981  C  "C4'" . DC  I 6  97   ? 144.010 206.862 190.485 1.00 143.97 ?  10   DC  I "C4'" 1 
ATOM   7982  O  "O4'" . DC  I 6  97   ? 144.310 206.177 189.244 1.00 144.14 ?  10   DC  I "O4'" 1 
ATOM   7983  C  "C3'" . DC  I 6  97   ? 143.389 205.810 191.403 1.00 145.27 ?  10   DC  I "C3'" 1 
ATOM   7984  O  "O3'" . DC  I 6  97   ? 141.966 205.835 191.259 1.00 147.48 ?  10   DC  I "O3'" 1 
ATOM   7985  C  "C2'" . DC  I 6  97   ? 143.937 204.508 190.851 1.00 144.82 ?  10   DC  I "C2'" 1 
ATOM   7986  C  "C1'" . DC  I 6  97   ? 143.990 204.799 189.361 1.00 144.56 ?  10   DC  I "C1'" 1 
ATOM   7987  N  N1    . DC  I 6  97   ? 145.010 204.036 188.628 1.00 144.73 ?  10   DC  I N1    1 
ATOM   7988  C  C2    . DC  I 6  97   ? 145.015 204.087 187.232 1.00 144.82 ?  10   DC  I C2    1 
ATOM   7989  O  O2    . DC  I 6  97   ? 144.161 204.774 186.655 1.00 144.88 ?  10   DC  I O2    1 
ATOM   7990  N  N3    . DC  I 6  97   ? 145.950 203.388 186.548 1.00 144.71 ?  10   DC  I N3    1 
ATOM   7991  C  C4    . DC  I 6  97   ? 146.854 202.659 187.208 1.00 144.60 ?  10   DC  I C4    1 
ATOM   7992  N  N4    . DC  I 6  97   ? 147.758 201.985 186.493 1.00 144.79 ?  10   DC  I N4    1 
ATOM   7993  C  C5    . DC  I 6  97   ? 146.871 202.590 188.631 1.00 144.67 ?  10   DC  I C5    1 
ATOM   7994  C  C6    . DC  I 6  97   ? 145.940 203.287 189.295 1.00 144.73 ?  10   DC  I C6    1 
ATOM   7995  P  P     . DG  I 6  98   ? 141.037 205.652 192.548 1.00 149.46 ?  11   DG  I P     1 
ATOM   7996  O  OP1   . DG  I 6  98   ? 140.591 206.998 192.987 1.00 149.43 ?  11   DG  I OP1   1 
ATOM   7997  O  OP2   . DG  I 6  98   ? 141.746 204.764 193.504 1.00 149.78 -1 11   DG  I OP2   1 
ATOM   7998  O  "O5'" . DG  I 6  98   ? 139.775 204.869 191.972 1.00 150.88 ?  11   DG  I "O5'" 1 
ATOM   7999  C  "C5'" . DG  I 6  98   ? 138.873 205.512 191.055 1.00 153.40 ?  11   DG  I "C5'" 1 
ATOM   8000  C  "C4'" . DG  I 6  98   ? 138.491 204.561 189.944 1.00 155.37 ?  11   DG  I "C4'" 1 
ATOM   8001  O  "O4'" . DG  I 6  98   ? 139.672 204.137 189.233 1.00 155.80 ?  11   DG  I "O4'" 1 
ATOM   8002  C  "C3'" . DG  I 6  98   ? 137.788 203.280 190.404 1.00 156.43 ?  11   DG  I "C3'" 1 
ATOM   8003  O  "O3'" . DG  I 6  98   ? 136.429 203.328 189.964 1.00 157.84 ?  11   DG  I "O3'" 1 
ATOM   8004  C  "C2'" . DG  I 6  98   ? 138.547 202.153 189.715 1.00 156.49 ?  11   DG  I "C2'" 1 
ATOM   8005  C  "C1'" . DG  I 6  98   ? 139.415 202.860 188.688 1.00 156.53 ?  11   DG  I "C1'" 1 
ATOM   8006  N  N9    . DG  I 6  98   ? 140.700 202.216 188.436 1.00 156.68 ?  11   DG  I N9    1 
ATOM   8007  C  C8    . DG  I 6  98   ? 141.819 202.259 189.231 1.00 156.77 ?  11   DG  I C8    1 
ATOM   8008  N  N7    . DG  I 6  98   ? 142.823 201.583 188.742 1.00 156.83 ?  11   DG  I N7    1 
ATOM   8009  C  C5    . DG  I 6  98   ? 142.337 201.062 187.550 1.00 156.74 ?  11   DG  I C5    1 
ATOM   8010  C  C6    . DG  I 6  98   ? 142.973 200.240 186.577 1.00 156.70 ?  11   DG  I C6    1 
ATOM   8011  O  O6    . DG  I 6  98   ? 144.128 199.797 186.578 1.00 156.53 ?  11   DG  I O6    1 
ATOM   8012  N  N1    . DG  I 6  98   ? 142.117 199.942 185.521 1.00 156.91 ?  11   DG  I N1    1 
ATOM   8013  C  C2    . DG  I 6  98   ? 140.817 200.376 185.413 1.00 156.86 ?  11   DG  I C2    1 
ATOM   8014  N  N2    . DG  I 6  98   ? 140.151 199.981 184.318 1.00 156.78 ?  11   DG  I N2    1 
ATOM   8015  N  N3    . DG  I 6  98   ? 140.214 201.142 186.312 1.00 156.70 ?  11   DG  I N3    1 
ATOM   8016  C  C4    . DG  I 6  98   ? 141.027 201.444 187.347 1.00 156.73 ?  11   DG  I C4    1 
ATOM   8017  P  P     . DT  I 6  99   ? 135.429 202.133 190.333 1.00 158.95 ?  12   DT  I P     1 
ATOM   8018  O  OP1   . DT  I 6  99   ? 134.040 202.653 190.248 1.00 158.78 ?  12   DT  I OP1   1 
ATOM   8019  O  OP2   . DT  I 6  99   ? 135.904 201.509 191.594 1.00 158.88 -1 12   DT  I OP2   1 
ATOM   8020  O  "O5'" . DT  I 6  99   ? 135.651 201.098 189.143 1.00 159.51 ?  12   DT  I "O5'" 1 
ATOM   8021  C  "C5'" . DT  I 6  99   ? 135.477 201.508 187.774 1.00 160.37 ?  12   DT  I "C5'" 1 
ATOM   8022  C  "C4'" . DT  I 6  99   ? 135.793 200.366 186.836 1.00 161.22 ?  12   DT  I "C4'" 1 
ATOM   8023  O  "O4'" . DT  I 6  99   ? 137.144 199.904 187.059 1.00 161.63 ?  12   DT  I "O4'" 1 
ATOM   8024  C  "C3'" . DT  I 6  99   ? 134.887 199.138 186.976 1.00 161.69 ?  12   DT  I "C3'" 1 
ATOM   8025  O  "O3'" . DT  I 6  99   ? 134.212 198.911 185.735 1.00 162.23 ?  12   DT  I "O3'" 1 
ATOM   8026  C  "C2'" . DT  I 6  99   ? 135.838 197.994 187.299 1.00 161.75 ?  12   DT  I "C2'" 1 
ATOM   8027  C  "C1'" . DT  I 6  99   ? 137.183 198.512 186.828 1.00 161.59 ?  12   DT  I "C1'" 1 
ATOM   8028  N  N1    . DT  I 6  99   ? 138.335 197.966 187.565 1.00 161.50 ?  12   DT  I N1    1 
ATOM   8029  C  C2    . DT  I 6  99   ? 139.223 197.165 186.883 1.00 161.47 ?  12   DT  I C2    1 
ATOM   8030  O  O2    . DT  I 6  99   ? 139.099 196.889 185.701 1.00 161.31 ?  12   DT  I O2    1 
ATOM   8031  N  N3    . DT  I 6  99   ? 140.269 196.697 187.639 1.00 161.32 ?  12   DT  I N3    1 
ATOM   8032  C  C4    . DT  I 6  99   ? 140.508 196.944 188.977 1.00 161.36 ?  12   DT  I C4    1 
ATOM   8033  O  O4    . DT  I 6  99   ? 141.492 196.454 189.525 1.00 161.18 ?  12   DT  I O4    1 
ATOM   8034  C  C5    . DT  I 6  99   ? 139.536 197.792 189.631 1.00 161.45 ?  12   DT  I C5    1 
ATOM   8035  C  C7    . DT  I 6  99   ? 139.712 198.116 191.080 1.00 161.49 ?  12   DT  I C7    1 
ATOM   8036  C  C6    . DT  I 6  99   ? 138.513 198.253 188.901 1.00 161.43 ?  12   DT  I C6    1 
ATOM   8037  P  P     . DT  I 6  100  ? 133.341 197.585 185.533 1.00 162.68 ?  13   DT  I P     1 
ATOM   8038  O  OP1   . DT  I 6  100  ? 132.229 197.902 184.601 1.00 163.00 ?  13   DT  I OP1   1 
ATOM   8039  O  OP2   . DT  I 6  100  ? 133.039 197.023 186.874 1.00 162.11 -1 13   DT  I OP2   1 
ATOM   8040  O  "O5'" . DT  I 6  100  ? 134.350 196.603 184.789 1.00 162.20 ?  13   DT  I "O5'" 1 
ATOM   8041  C  "C5'" . DT  I 6  100  ? 134.714 196.827 183.415 1.00 161.22 ?  13   DT  I "C5'" 1 
ATOM   8042  C  "C4'" . DT  I 6  100  ? 135.668 195.755 182.941 1.00 160.75 ?  13   DT  I "C4'" 1 
ATOM   8043  O  "O4'" . DT  I 6  100  ? 136.781 195.647 183.859 1.00 160.65 ?  13   DT  I "O4'" 1 
ATOM   8044  C  "C3'" . DT  I 6  100  ? 135.062 194.352 182.828 1.00 160.44 ?  13   DT  I "C3'" 1 
ATOM   8045  O  "O3'" . DT  I 6  100  ? 135.356 193.812 181.537 1.00 160.01 ?  13   DT  I "O3'" 1 
ATOM   8046  C  "C2'" . DT  I 6  100  ? 135.751 193.559 183.925 1.00 160.27 ?  13   DT  I "C2'" 1 
ATOM   8047  C  "C1'" . DT  I 6  100  ? 137.074 194.281 184.079 1.00 160.43 ?  13   DT  I "C1'" 1 
ATOM   8048  N  N1    . DT  I 6  100  ? 137.682 194.160 185.416 1.00 160.27 ?  13   DT  I N1    1 
ATOM   8049  C  C2    . DT  I 6  100  ? 138.939 193.609 185.511 1.00 160.20 ?  13   DT  I C2    1 
ATOM   8050  O  O2    . DT  I 6  100  ? 139.571 193.218 184.543 1.00 160.12 ?  13   DT  I O2    1 
ATOM   8051  N  N3    . DT  I 6  100  ? 139.433 193.532 186.789 1.00 160.16 ?  13   DT  I N3    1 
ATOM   8052  C  C4    . DT  I 6  100  ? 138.809 193.942 187.952 1.00 160.27 ?  13   DT  I C4    1 
ATOM   8053  O  O4    . DT  I 6  100  ? 139.380 193.809 189.033 1.00 160.37 ?  13   DT  I O4    1 
ATOM   8054  C  C5    . DT  I 6  100  ? 137.492 194.511 187.778 1.00 160.16 ?  13   DT  I C5    1 
ATOM   8055  C  C7    . DT  I 6  100  ? 136.740 194.982 188.980 1.00 160.14 ?  13   DT  I C7    1 
ATOM   8056  C  C6    . DT  I 6  100  ? 137.002 194.590 186.534 1.00 160.14 ?  13   DT  I C6    1 
ATOM   8057  P  P     . DT  I 6  101  ? 135.030 192.277 181.222 1.00 160.00 ?  14   DT  I P     1 
ATOM   8058  O  OP1   . DT  I 6  101  ? 134.789 192.148 179.763 1.00 159.95 ?  14   DT  I OP1   1 
ATOM   8059  O  OP2   . DT  I 6  101  ? 133.993 191.821 182.183 1.00 159.70 -1 14   DT  I OP2   1 
ATOM   8060  O  "O5'" . DT  I 6  101  ? 136.399 191.539 181.569 1.00 159.67 ?  14   DT  I "O5'" 1 
ATOM   8061  C  "C5'" . DT  I 6  101  ? 137.409 191.356 180.561 1.00 158.50 ?  14   DT  I "C5'" 1 
ATOM   8062  C  "C4'" . DT  I 6  101  ? 138.502 190.445 181.069 1.00 157.62 ?  14   DT  I "C4'" 1 
ATOM   8063  O  "O4'" . DT  I 6  101  ? 138.850 190.804 182.427 1.00 157.42 ?  14   DT  I "O4'" 1 
ATOM   8064  C  "C3'" . DT  I 6  101  ? 138.144 188.955 181.094 1.00 157.20 ?  14   DT  I "C3'" 1 
ATOM   8065  O  "O3'" . DT  I 6  101  ? 139.205 188.201 180.502 1.00 156.61 ?  14   DT  I "O3'" 1 
ATOM   8066  C  "C2'" . DT  I 6  101  ? 138.021 188.633 182.573 1.00 157.24 ?  14   DT  I "C2'" 1 
ATOM   8067  C  "C1'" . DT  I 6  101  ? 138.979 189.626 183.201 1.00 157.44 ?  14   DT  I "C1'" 1 
ATOM   8068  N  N1    . DT  I 6  101  ? 138.673 189.969 184.601 1.00 157.56 ?  14   DT  I N1    1 
ATOM   8069  C  C2    . DT  I 6  101  ? 139.649 189.761 185.548 1.00 157.53 ?  14   DT  I C2    1 
ATOM   8070  O  O2    . DT  I 6  101  ? 140.751 189.308 185.283 1.00 157.38 ?  14   DT  I O2    1 
ATOM   8071  N  N3    . DT  I 6  101  ? 139.287 190.106 186.827 1.00 157.58 ?  14   DT  I N3    1 
ATOM   8072  C  C4    . DT  I 6  101  ? 138.075 190.626 187.240 1.00 157.53 ?  14   DT  I C4    1 
ATOM   8073  O  O4    . DT  I 6  101  ? 137.894 190.888 188.426 1.00 157.48 ?  14   DT  I O4    1 
ATOM   8074  C  C5    . DT  I 6  101  ? 137.098 190.818 186.193 1.00 157.54 ?  14   DT  I C5    1 
ATOM   8075  C  C7    . DT  I 6  101  ? 135.755 191.376 186.546 1.00 157.52 ?  14   DT  I C7    1 
ATOM   8076  C  C6    . DT  I 6  101  ? 137.442 190.484 184.943 1.00 157.65 ?  14   DT  I C6    1 
ATOM   8077  P  P     . DT  I 6  102  ? 139.053 186.618 180.322 1.00 156.08 ?  15   DT  I P     1 
ATOM   8078  O  OP1   . DT  I 6  102  ? 139.209 186.303 178.879 1.00 156.19 ?  15   DT  I OP1   1 
ATOM   8079  O  OP2   . DT  I 6  102  ? 137.826 186.190 181.040 1.00 155.89 -1 15   DT  I OP2   1 
ATOM   8080  O  "O5'" . DT  I 6  102  ? 140.319 186.045 181.100 1.00 156.16 ?  15   DT  I "O5'" 1 
ATOM   8081  C  "C5'" . DT  I 6  102  ? 141.645 186.517 180.799 1.00 156.32 ?  15   DT  I "C5'" 1 
ATOM   8082  C  "C4'" . DT  I 6  102  ? 142.635 185.986 181.809 1.00 156.53 ?  15   DT  I "C4'" 1 
ATOM   8083  O  "O4'" . DT  I 6  102  ? 142.247 186.406 183.140 1.00 156.92 ?  15   DT  I "O4'" 1 
ATOM   8084  C  "C3'" . DT  I 6  102  ? 142.748 184.462 181.863 1.00 156.50 ?  15   DT  I "C3'" 1 
ATOM   8085  O  "O3'" . DT  I 6  102  ? 144.114 184.093 182.064 1.00 156.17 ?  15   DT  I "O3'" 1 
ATOM   8086  C  "C2'" . DT  I 6  102  ? 141.925 184.090 183.081 1.00 156.75 ?  15   DT  I "C2'" 1 
ATOM   8087  C  "C1'" . DT  I 6  102  ? 142.165 185.277 183.995 1.00 157.37 ?  15   DT  I "C1'" 1 
ATOM   8088  N  N1    . DT  I 6  102  ? 141.089 185.526 184.971 1.00 157.67 ?  15   DT  I N1    1 
ATOM   8089  C  C2    . DT  I 6  102  ? 141.444 185.859 186.258 1.00 157.88 ?  15   DT  I C2    1 
ATOM   8090  O  O2    . DT  I 6  102  ? 142.603 185.957 186.625 1.00 158.05 ?  15   DT  I O2    1 
ATOM   8091  N  N3    . DT  I 6  102  ? 140.386 186.074 187.106 1.00 157.78 ?  15   DT  I N3    1 
ATOM   8092  C  C4    . DT  I 6  102  ? 139.041 185.991 186.800 1.00 157.72 ?  15   DT  I C4    1 
ATOM   8093  O  O4    . DT  I 6  102  ? 138.201 186.212 187.668 1.00 157.78 ?  15   DT  I O4    1 
ATOM   8094  C  C5    . DT  I 6  102  ? 138.740 185.637 185.431 1.00 157.80 ?  15   DT  I C5    1 
ATOM   8095  C  C7    . DT  I 6  102  ? 137.311 185.524 185.006 1.00 157.79 ?  15   DT  I C7    1 
ATOM   8096  C  C6    . DT  I 6  102  ? 139.767 185.426 184.597 1.00 157.80 ?  15   DT  I C6    1 
ATOM   8097  P  P     . DA  I 6  103  ? 144.577 182.582 181.828 1.00 156.07 ?  16   DA  I P     1 
ATOM   8098  O  OP1   . DA  I 6  103  ? 145.009 182.449 180.413 1.00 155.79 ?  16   DA  I OP1   1 
ATOM   8099  O  OP2   . DA  I 6  103  ? 143.516 181.688 182.358 1.00 156.04 -1 16   DA  I OP2   1 
ATOM   8100  O  "O5'" . DA  I 6  103  ? 145.860 182.452 182.762 1.00 155.43 ?  16   DA  I "O5'" 1 
ATOM   8101  C  "C5'" . DA  I 6  103  ? 146.234 183.522 183.650 1.00 154.24 ?  16   DA  I "C5'" 1 
ATOM   8102  C  "C4'" . DA  I 6  103  ? 146.364 183.005 185.063 1.00 153.35 ?  16   DA  I "C4'" 1 
ATOM   8103  O  "O4'" . DA  I 6  103  ? 145.179 183.358 185.817 1.00 153.14 ?  16   DA  I "O4'" 1 
ATOM   8104  C  "C3'" . DA  I 6  103  ? 146.489 181.486 185.178 1.00 152.79 ?  16   DA  I "C3'" 1 
ATOM   8105  O  "O3'" . DA  I 6  103  ? 147.270 181.160 186.330 1.00 151.60 ?  16   DA  I "O3'" 1 
ATOM   8106  C  "C2'" . DA  I 6  103  ? 145.062 181.052 185.450 1.00 152.94 ?  16   DA  I "C2'" 1 
ATOM   8107  C  "C1'" . DA  I 6  103  ? 144.582 182.181 186.341 1.00 153.18 ?  16   DA  I "C1'" 1 
ATOM   8108  N  N9    . DA  I 6  103  ? 143.133 182.378 186.359 1.00 153.25 ?  16   DA  I N9    1 
ATOM   8109  C  C8    . DA  I 6  103  ? 142.270 182.409 185.292 1.00 153.18 ?  16   DA  I C8    1 
ATOM   8110  N  N7    . DA  I 6  103  ? 141.019 182.603 185.630 1.00 153.19 ?  16   DA  I N7    1 
ATOM   8111  C  C5    . DA  I 6  103  ? 141.059 182.706 187.014 1.00 153.19 ?  16   DA  I C5    1 
ATOM   8112  C  C6    . DA  I 6  103  ? 140.057 182.917 187.977 1.00 153.23 ?  16   DA  I C6    1 
ATOM   8113  N  N6    . DA  I 6  103  ? 138.765 183.066 187.680 1.00 153.12 ?  16   DA  I N6    1 
ATOM   8114  N  N1    . DA  I 6  103  ? 140.434 182.968 189.273 1.00 153.28 ?  16   DA  I N1    1 
ATOM   8115  C  C2    . DA  I 6  103  ? 141.731 182.817 189.569 1.00 153.15 ?  16   DA  I C2    1 
ATOM   8116  N  N3    . DA  I 6  103  ? 142.764 182.615 188.756 1.00 153.12 ?  16   DA  I N3    1 
ATOM   8117  C  C4    . DA  I 6  103  ? 142.356 182.569 187.475 1.00 153.21 ?  16   DA  I C4    1 
ATOM   8118  P  P     . DA  I 6  104  ? 148.786 180.677 186.164 1.00 150.59 ?  17   DA  I P     1 
ATOM   8119  O  OP1   . DA  I 6  104  ? 149.401 181.461 185.064 1.00 150.34 ?  17   DA  I OP1   1 
ATOM   8120  O  OP2   . DA  I 6  104  ? 148.791 179.193 186.102 1.00 150.20 -1 17   DA  I OP2   1 
ATOM   8121  O  "O5'" . DA  I 6  104  ? 149.456 181.128 187.538 1.00 150.48 ?  17   DA  I "O5'" 1 
ATOM   8122  C  "C5'" . DA  I 6  104  ? 149.461 182.512 187.934 1.00 150.61 ?  17   DA  I "C5'" 1 
ATOM   8123  C  "C4'" . DA  I 6  104  ? 149.319 182.629 189.434 1.00 150.61 ?  17   DA  I "C4'" 1 
ATOM   8124  O  "O4'" . DA  I 6  104  ? 147.915 182.638 189.790 1.00 150.89 ?  17   DA  I "O4'" 1 
ATOM   8125  C  "C3'" . DA  I 6  104  ? 149.951 181.485 190.231 1.00 150.27 ?  17   DA  I "C3'" 1 
ATOM   8126  O  "O3'" . DA  I 6  104  ? 150.567 182.001 191.414 1.00 149.64 ?  17   DA  I "O3'" 1 
ATOM   8127  C  "C2'" . DA  I 6  104  ? 148.766 180.605 190.584 1.00 150.77 ?  17   DA  I "C2'" 1 
ATOM   8128  C  "C1'" . DA  I 6  104  ? 147.648 181.620 190.740 1.00 151.17 ?  17   DA  I "C1'" 1 
ATOM   8129  N  N9    . DA  I 6  104  ? 146.311 181.091 190.467 1.00 151.35 ?  17   DA  I N9    1 
ATOM   8130  C  C8    . DA  I 6  104  ? 145.847 180.541 189.297 1.00 151.40 ?  17   DA  I C8    1 
ATOM   8131  N  N7    . DA  I 6  104  ? 144.596 180.154 189.356 1.00 151.30 ?  17   DA  I N7    1 
ATOM   8132  C  C5    . DA  I 6  104  ? 144.210 180.469 190.651 1.00 151.27 ?  17   DA  I C5    1 
ATOM   8133  C  C6    . DA  I 6  104  ? 142.997 180.309 191.342 1.00 151.29 ?  17   DA  I C6    1 
ATOM   8134  N  N6    . DA  I 6  104  ? 141.902 179.769 190.802 1.00 151.33 ?  17   DA  I N6    1 
ATOM   8135  N  N1    . DA  I 6  104  ? 142.945 180.730 192.626 1.00 151.45 ?  17   DA  I N1    1 
ATOM   8136  C  C2    . DA  I 6  104  ? 144.043 181.272 193.166 1.00 151.42 ?  17   DA  I C2    1 
ATOM   8137  N  N3    . DA  I 6  104  ? 145.239 181.476 192.621 1.00 151.45 ?  17   DA  I N3    1 
ATOM   8138  C  C4    . DA  I 6  104  ? 145.257 181.047 191.346 1.00 151.37 ?  17   DA  I C4    1 
ATOM   8139  P  P     . DC  I 6  105  ? 151.388 181.022 192.381 1.00 149.30 ?  18   DC  I P     1 
ATOM   8140  O  OP1   . DC  I 6  105  ? 152.465 181.814 193.029 1.00 149.38 ?  18   DC  I OP1   1 
ATOM   8141  O  OP2   . DC  I 6  105  ? 151.737 179.801 191.612 1.00 149.00 -1 18   DC  I OP2   1 
ATOM   8142  O  "O5'" . DC  I 6  105  ? 150.317 180.629 193.493 1.00 150.48 ?  18   DC  I "O5'" 1 
ATOM   8143  C  "C5'" . DC  I 6  105  ? 149.337 181.585 193.935 1.00 152.05 ?  18   DC  I "C5'" 1 
ATOM   8144  C  "C4'" . DC  I 6  105  ? 148.502 181.013 195.058 1.00 153.20 ?  18   DC  I "C4'" 1 
ATOM   8145  O  "O4'" . DC  I 6  105  ? 147.262 180.489 194.526 1.00 153.53 ?  18   DC  I "O4'" 1 
ATOM   8146  C  "C3'" . DC  I 6  105  ? 149.150 179.872 195.850 1.00 153.86 ?  18   DC  I "C3'" 1 
ATOM   8147  O  "O3'" . DC  I 6  105  ? 148.952 180.122 197.246 1.00 154.47 ?  18   DC  I "O3'" 1 
ATOM   8148  C  "C2'" . DC  I 6  105  ? 148.387 178.638 195.399 1.00 153.97 ?  18   DC  I "C2'" 1 
ATOM   8149  C  "C1'" . DC  I 6  105  ? 147.019 179.203 195.066 1.00 154.09 ?  18   DC  I "C1'" 1 
ATOM   8150  N  N1    . DC  I 6  105  ? 146.265 178.431 194.066 1.00 154.23 ?  18   DC  I N1    1 
ATOM   8151  C  C2    . DC  I 6  105  ? 144.945 178.073 194.348 1.00 154.33 ?  18   DC  I C2    1 
ATOM   8152  O  O2    . DC  I 6  105  ? 144.451 178.415 195.432 1.00 154.36 ?  18   DC  I O2    1 
ATOM   8153  N  N3    . DC  I 6  105  ? 144.242 177.365 193.435 1.00 154.32 ?  18   DC  I N3    1 
ATOM   8154  C  C4    . DC  I 6  105  ? 144.812 177.016 192.279 1.00 154.35 ?  18   DC  I C4    1 
ATOM   8155  N  N4    . DC  I 6  105  ? 144.082 176.318 191.407 1.00 154.40 ?  18   DC  I N4    1 
ATOM   8156  C  C5    . DC  I 6  105  ? 146.156 177.370 191.966 1.00 154.18 ?  18   DC  I C5    1 
ATOM   8157  C  C6    . DC  I 6  105  ? 146.839 178.071 192.879 1.00 154.15 ?  18   DC  I C6    1 
ATOM   8158  P  P     . DC  I 6  106  ? 149.509 179.083 198.327 1.00 154.81 ?  19   DC  I P     1 
ATOM   8159  O  OP1   . DC  I 6  106  ? 149.942 179.851 199.522 1.00 154.31 ?  19   DC  I OP1   1 
ATOM   8160  O  OP2   . DC  I 6  106  ? 150.473 178.181 197.645 1.00 154.26 -1 19   DC  I OP2   1 
ATOM   8161  O  "O5'" . DC  I 6  106  ? 148.215 178.239 198.716 1.00 156.15 ?  19   DC  I "O5'" 1 
ATOM   8162  C  "C5'" . DC  I 6  106  ? 147.087 178.878 199.340 1.00 157.96 ?  19   DC  I "C5'" 1 
ATOM   8163  C  "C4'" . DC  I 6  106  ? 146.045 177.854 199.727 1.00 159.29 ?  19   DC  I "C4'" 1 
ATOM   8164  O  "O4'" . DC  I 6  106  ? 145.335 177.403 198.547 1.00 159.21 ?  19   DC  I "O4'" 1 
ATOM   8165  C  "C3'" . DC  I 6  106  ? 146.584 176.594 200.411 1.00 160.54 ?  19   DC  I "C3'" 1 
ATOM   8166  O  "O3'" . DC  I 6  106  ? 145.719 176.274 201.503 1.00 162.86 ?  19   DC  I "O3'" 1 
ATOM   8167  C  "C2'" . DC  I 6  106  ? 146.479 175.529 199.334 1.00 160.08 ?  19   DC  I "C2'" 1 
ATOM   8168  C  "C1'" . DC  I 6  106  ? 145.261 175.989 198.557 1.00 159.49 ?  19   DC  I "C1'" 1 
ATOM   8169  N  N1    . DC  I 6  106  ? 145.213 175.530 197.160 1.00 159.42 ?  19   DC  I N1    1 
ATOM   8170  C  C2    . DC  I 6  106  ? 144.026 174.976 196.675 1.00 159.37 ?  19   DC  I C2    1 
ATOM   8171  O  O2    . DC  I 6  106  ? 143.053 174.886 197.437 1.00 159.24 ?  19   DC  I O2    1 
ATOM   8172  N  N3    . DC  I 6  106  ? 143.970 174.552 195.392 1.00 159.29 ?  19   DC  I N3    1 
ATOM   8173  C  C4    . DC  I 6  106  ? 145.042 174.667 194.605 1.00 159.27 ?  19   DC  I C4    1 
ATOM   8174  N  N4    . DC  I 6  106  ? 144.944 174.236 193.345 1.00 159.31 ?  19   DC  I N4    1 
ATOM   8175  C  C5    . DC  I 6  106  ? 146.264 175.231 195.074 1.00 159.22 ?  19   DC  I C5    1 
ATOM   8176  C  C6    . DC  I 6  106  ? 146.305 175.646 196.346 1.00 159.27 ?  19   DC  I C6    1 
ATOM   8177  P  P     . DG  I 6  107  ? 146.186 175.209 202.602 1.00 164.67 ?  20   DG  I P     1 
ATOM   8178  O  OP1   . DG  I 6  107  ? 146.414 175.933 203.878 1.00 164.51 ?  20   DG  I OP1   1 
ATOM   8179  O  OP2   . DG  I 6  107  ? 147.278 174.392 202.014 1.00 164.28 -1 20   DG  I OP2   1 
ATOM   8180  O  "O5'" . DG  I 6  107  ? 144.898 174.287 202.768 1.00 166.23 ?  20   DG  I "O5'" 1 
ATOM   8181  C  "C5'" . DG  I 6  107  ? 143.634 174.701 202.222 1.00 168.54 ?  20   DG  I "C5'" 1 
ATOM   8182  C  "C4'" . DG  I 6  107  ? 142.930 173.528 201.579 1.00 170.47 ?  20   DG  I "C4'" 1 
ATOM   8183  O  "O4'" . DG  I 6  107  ? 143.207 173.505 200.164 1.00 170.97 ?  20   DG  I "O4'" 1 
ATOM   8184  C  "C3'" . DG  I 6  107  ? 143.335 172.152 202.120 1.00 171.58 ?  20   DG  I "C3'" 1 
ATOM   8185  O  "O3'" . DG  I 6  107  ? 142.198 171.580 202.770 1.00 172.92 ?  20   DG  I "O3'" 1 
ATOM   8186  C  "C2'" . DG  I 6  107  ? 143.729 171.354 200.885 1.00 171.63 ?  20   DG  I "C2'" 1 
ATOM   8187  C  "C1'" . DG  I 6  107  ? 143.167 172.163 199.729 1.00 171.77 ?  20   DG  I "C1'" 1 
ATOM   8188  N  N9    . DG  I 6  107  ? 143.939 172.071 198.494 1.00 171.90 ?  20   DG  I N9    1 
ATOM   8189  C  C8    . DG  I 6  107  ? 145.193 172.580 198.261 1.00 171.99 ?  20   DG  I C8    1 
ATOM   8190  N  N7    . DG  I 6  107  ? 145.627 172.341 197.052 1.00 172.08 ?  20   DG  I N7    1 
ATOM   8191  C  C5    . DG  I 6  107  ? 144.596 171.633 196.451 1.00 172.03 ?  20   DG  I C5    1 
ATOM   8192  C  C6    . DG  I 6  107  ? 144.488 171.100 195.136 1.00 171.99 ?  20   DG  I C6    1 
ATOM   8193  O  O6    . DG  I 6  107  ? 145.312 171.151 194.214 1.00 171.98 ?  20   DG  I O6    1 
ATOM   8194  N  N1    . DG  I 6  107  ? 143.271 170.454 194.942 1.00 172.01 ?  20   DG  I N1    1 
ATOM   8195  C  C2    . DG  I 6  107  ? 142.283 170.335 195.890 1.00 172.06 ?  20   DG  I C2    1 
ATOM   8196  N  N2    . DG  I 6  107  ? 141.179 169.675 195.512 1.00 172.03 ?  20   DG  I N2    1 
ATOM   8197  N  N3    . DG  I 6  107  ? 142.370 170.828 197.118 1.00 172.05 ?  20   DG  I N3    1 
ATOM   8198  C  C4    . DG  I 6  107  ? 143.545 171.460 197.328 1.00 172.00 ?  20   DG  I C4    1 
ATOM   8199  P  P     . DC  I 6  108  ? 142.328 170.162 203.500 1.00 173.88 ?  21   DC  I P     1 
ATOM   8200  O  OP1   . DC  I 6  108  ? 141.157 169.998 204.398 1.00 173.91 ?  21   DC  I OP1   1 
ATOM   8201  O  OP2   . DC  I 6  108  ? 143.701 170.056 204.056 1.00 173.90 -1 21   DC  I OP2   1 
ATOM   8202  O  "O5'" . DC  I 6  108  ? 142.188 169.125 202.299 1.00 174.32 ?  21   DC  I "O5'" 1 
ATOM   8203  C  "C5'" . DC  I 6  108  ? 140.900 168.599 201.926 1.00 174.81 ?  21   DC  I "C5'" 1 
ATOM   8204  C  "C4'" . DC  I 6  108  ? 141.040 167.644 200.764 1.00 175.15 ?  21   DC  I "C4'" 1 
ATOM   8205  O  "O4'" . DC  I 6  108  ? 141.800 168.267 199.711 1.00 175.19 ?  21   DC  I "O4'" 1 
ATOM   8206  C  "C3'" . DC  I 6  108  ? 141.789 166.353 201.079 1.00 175.39 ?  21   DC  I "C3'" 1 
ATOM   8207  O  "O3'" . DC  I 6  108  ? 140.858 165.353 201.501 1.00 175.77 ?  21   DC  I "O3'" 1 
ATOM   8208  C  "C2'" . DC  I 6  108  ? 142.411 165.972 199.744 1.00 175.28 ?  21   DC  I "C2'" 1 
ATOM   8209  C  "C1'" . DC  I 6  108  ? 142.391 167.256 198.910 1.00 175.18 ?  21   DC  I "C1'" 1 
ATOM   8210  N  N1    . DC  I 6  108  ? 143.719 167.730 198.495 1.00 175.13 ?  21   DC  I N1    1 
ATOM   8211  C  C2    . DC  I 6  108  ? 144.027 167.765 197.133 1.00 175.00 ?  21   DC  I C2    1 
ATOM   8212  O  O2    . DC  I 6  108  ? 143.171 167.393 196.316 1.00 174.87 ?  21   DC  I O2    1 
ATOM   8213  N  N3    . DC  I 6  108  ? 145.247 168.200 196.742 1.00 174.94 ?  21   DC  I N3    1 
ATOM   8214  C  C4    . DC  I 6  108  ? 146.140 168.591 197.654 1.00 174.97 ?  21   DC  I C4    1 
ATOM   8215  N  N4    . DC  I 6  108  ? 147.331 169.013 197.223 1.00 175.00 ?  21   DC  I N4    1 
ATOM   8216  C  C5    . DC  I 6  108  ? 145.851 168.566 199.050 1.00 174.91 ?  21   DC  I C5    1 
ATOM   8217  C  C6    . DC  I 6  108  ? 144.640 168.132 199.422 1.00 175.08 ?  21   DC  I C6    1 
ATOM   8218  P  P     . DC  I 6  109  ? 141.369 163.871 201.820 1.00 175.98 ?  22   DC  I P     1 
ATOM   8219  O  OP1   . DC  I 6  109  ? 140.248 163.121 202.440 1.00 175.90 ?  22   DC  I OP1   1 
ATOM   8220  O  OP2   . DC  I 6  109  ? 142.667 163.977 202.532 1.00 175.79 -1 22   DC  I OP2   1 
ATOM   8221  O  "O5'" . DC  I 6  109  ? 141.631 163.266 200.370 1.00 176.03 ?  22   DC  I "O5'" 1 
ATOM   8222  C  "C5'" . DC  I 6  109  ? 140.561 163.164 199.412 1.00 175.89 ?  22   DC  I "C5'" 1 
ATOM   8223  C  "C4'" . DC  I 6  109  ? 141.078 162.614 198.103 1.00 175.65 ?  22   DC  I "C4'" 1 
ATOM   8224  O  "O4'" . DC  I 6  109  ? 142.024 163.546 197.525 1.00 175.68 ?  22   DC  I "O4'" 1 
ATOM   8225  C  "C3'" . DC  I 6  109  ? 141.813 161.277 198.211 1.00 175.57 ?  22   DC  I "C3'" 1 
ATOM   8226  O  "O3'" . DC  I 6  109  ? 141.494 160.459 197.081 1.00 175.33 ?  22   DC  I "O3'" 1 
ATOM   8227  C  "C2'" . DC  I 6  109  ? 143.276 161.677 198.168 1.00 175.51 ?  22   DC  I "C2'" 1 
ATOM   8228  C  "C1'" . DC  I 6  109  ? 143.245 162.881 197.244 1.00 175.30 ?  22   DC  I "C1'" 1 
ATOM   8229  N  N1    . DC  I 6  109  ? 144.340 163.838 197.456 1.00 175.15 ?  22   DC  I N1    1 
ATOM   8230  C  C2    . DC  I 6  109  ? 144.879 164.498 196.349 1.00 175.08 ?  22   DC  I C2    1 
ATOM   8231  O  O2    . DC  I 6  109  ? 144.417 164.257 195.224 1.00 175.02 ?  22   DC  I O2    1 
ATOM   8232  N  N3    . DC  I 6  109  ? 145.889 165.379 196.532 1.00 174.94 ?  22   DC  I N3    1 
ATOM   8233  C  C4    . DC  I 6  109  ? 146.358 165.609 197.760 1.00 174.91 ?  22   DC  I C4    1 
ATOM   8234  N  N4    . DC  I 6  109  ? 147.355 166.488 197.895 1.00 174.83 ?  22   DC  I N4    1 
ATOM   8235  C  C5    . DC  I 6  109  ? 145.826 164.949 198.907 1.00 174.97 ?  22   DC  I C5    1 
ATOM   8236  C  C6    . DC  I 6  109  ? 144.828 164.080 198.709 1.00 175.02 ?  22   DC  I C6    1 
ATOM   8237  P  P     . DA  I 6  110  ? 141.584 158.876 197.197 1.00 175.24 ?  23   DA  I P     1 
ATOM   8238  O  OP1   . DA  I 6  110  ? 140.203 158.333 197.233 1.00 175.32 ?  23   DA  I OP1   1 
ATOM   8239  O  OP2   . DA  I 6  110  ? 142.533 158.548 198.290 1.00 175.18 -1 23   DA  I OP2   1 
ATOM   8240  O  "O5'" . DA  I 6  110  ? 142.258 158.483 195.813 1.00 174.53 ?  23   DA  I "O5'" 1 
ATOM   8241  C  "C5'" . DA  I 6  110  ? 142.775 159.510 194.949 1.00 173.62 ?  23   DA  I "C5'" 1 
ATOM   8242  C  "C4'" . DA  I 6  110  ? 143.433 158.860 193.756 1.00 172.98 ?  23   DA  I "C4'" 1 
ATOM   8243  O  "O4'" . DA  I 6  110  ? 144.593 159.616 193.349 1.00 173.12 ?  23   DA  I "O4'" 1 
ATOM   8244  C  "C3'" . DA  I 6  110  ? 143.915 157.438 194.025 1.00 172.16 ?  23   DA  I "C3'" 1 
ATOM   8245  O  "O3'" . DA  I 6  110  ? 143.597 156.601 192.914 1.00 170.46 ?  23   DA  I "O3'" 1 
ATOM   8246  C  "C2'" . DA  I 6  110  ? 145.406 157.586 194.282 1.00 172.45 ?  23   DA  I "C2'" 1 
ATOM   8247  C  "C1'" . DA  I 6  110  ? 145.793 158.931 193.674 1.00 172.88 ?  23   DA  I "C1'" 1 
ATOM   8248  N  N9    . DA  I 6  110  ? 146.563 159.784 194.576 1.00 172.92 ?  23   DA  I N9    1 
ATOM   8249  C  C8    . DA  I 6  110  ? 146.538 159.792 195.949 1.00 172.87 ?  23   DA  I C8    1 
ATOM   8250  N  N7    . DA  I 6  110  ? 147.343 160.674 196.488 1.00 172.90 ?  23   DA  I N7    1 
ATOM   8251  C  C5    . DA  I 6  110  ? 147.940 161.290 195.396 1.00 172.89 ?  23   DA  I C5    1 
ATOM   8252  C  C6    . DA  I 6  110  ? 148.894 162.318 195.295 1.00 172.85 ?  23   DA  I C6    1 
ATOM   8253  N  N6    . DA  I 6  110  ? 149.439 162.931 196.348 1.00 172.86 ?  23   DA  I N6    1 
ATOM   8254  N  N1    . DA  I 6  110  ? 149.277 162.699 194.057 1.00 172.81 ?  23   DA  I N1    1 
ATOM   8255  C  C2    . DA  I 6  110  ? 148.731 162.084 193.000 1.00 172.86 ?  23   DA  I C2    1 
ATOM   8256  N  N3    . DA  I 6  110  ? 147.826 161.107 192.967 1.00 172.84 ?  23   DA  I N3    1 
ATOM   8257  C  C4    . DA  I 6  110  ? 147.469 160.752 194.213 1.00 172.90 ?  23   DA  I C4    1 
ATOM   8258  P  P     . DA  I 6  111  ? 144.670 155.544 192.374 1.00 168.85 ?  24   DA  I P     1 
ATOM   8259  O  OP1   . DA  I 6  111  ? 143.957 154.556 191.524 1.00 168.92 ?  24   DA  I OP1   1 
ATOM   8260  O  OP2   . DA  I 6  111  ? 145.475 155.074 193.529 1.00 168.62 -1 24   DA  I OP2   1 
ATOM   8261  O  "O5'" . DA  I 6  111  ? 145.603 156.431 191.434 1.00 167.36 ?  24   DA  I "O5'" 1 
ATOM   8262  C  "C5'" . DA  I 6  111  ? 145.864 156.043 190.073 1.00 165.07 ?  24   DA  I "C5'" 1 
ATOM   8263  C  "C4'" . DA  I 6  111  ? 147.353 155.938 189.835 1.00 163.58 ?  24   DA  I "C4'" 1 
ATOM   8264  O  "O4'" . DA  I 6  111  ? 148.034 156.986 190.568 1.00 163.33 ?  24   DA  I "O4'" 1 
ATOM   8265  C  "C3'" . DA  I 6  111  ? 147.986 154.628 190.303 1.00 162.58 ?  24   DA  I "C3'" 1 
ATOM   8266  O  "O3'" . DA  I 6  111  ? 149.109 154.317 189.476 1.00 161.20 ?  24   DA  I "O3'" 1 
ATOM   8267  C  "C2'" . DA  I 6  111  ? 148.495 154.979 191.688 1.00 162.76 ?  24   DA  I "C2'" 1 
ATOM   8268  C  "C1'" . DA  I 6  111  ? 148.958 156.409 191.480 1.00 163.24 ?  24   DA  I "C1'" 1 
ATOM   8269  N  N9    . DA  I 6  111  ? 148.972 157.231 192.689 1.00 163.31 ?  24   DA  I N9    1 
ATOM   8270  C  C8    . DA  I 6  111  ? 148.110 157.176 193.757 1.00 163.33 ?  24   DA  I C8    1 
ATOM   8271  N  N7    . DA  I 6  111  ? 148.382 158.046 194.700 1.00 163.33 ?  24   DA  I N7    1 
ATOM   8272  C  C5    . DA  I 6  111  ? 149.500 158.716 194.221 1.00 163.40 ?  24   DA  I C5    1 
ATOM   8273  C  C6    . DA  I 6  111  ? 150.276 159.759 194.756 1.00 163.33 ?  24   DA  I C6    1 
ATOM   8274  N  N6    . DA  I 6  111  ? 150.036 160.333 195.936 1.00 163.29 ?  24   DA  I N6    1 
ATOM   8275  N  N1    . DA  I 6  111  ? 151.323 160.199 194.023 1.00 163.36 ?  24   DA  I N1    1 
ATOM   8276  C  C2    . DA  I 6  111  ? 151.564 159.624 192.839 1.00 163.37 ?  24   DA  I C2    1 
ATOM   8277  N  N3    . DA  I 6  111  ? 150.907 158.638 192.232 1.00 163.41 ?  24   DA  I N3    1 
ATOM   8278  C  C4    . DA  I 6  111  ? 149.874 158.224 192.985 1.00 163.41 ?  24   DA  I C4    1 
ATOM   8279  P  P     . DG  I 6  112  ? 149.176 152.920 188.703 1.00 160.00 ?  25   DG  I P     1 
ATOM   8280  O  OP1   . DG  I 6  112  ? 148.006 152.842 187.793 1.00 159.94 ?  25   DG  I OP1   1 
ATOM   8281  O  OP2   . DG  I 6  112  ? 149.400 151.848 189.706 1.00 160.09 -1 25   DG  I OP2   1 
ATOM   8282  O  "O5'" . DG  I 6  112  ? 150.492 153.070 187.817 1.00 158.30 ?  25   DG  I "O5'" 1 
ATOM   8283  C  "C5'" . DG  I 6  112  ? 150.839 154.336 187.226 1.00 155.21 ?  25   DG  I "C5'" 1 
ATOM   8284  C  "C4'" . DG  I 6  112  ? 152.210 154.774 187.686 1.00 152.87 ?  25   DG  I "C4'" 1 
ATOM   8285  O  "O4'" . DG  I 6  112  ? 152.091 155.547 188.905 1.00 152.20 ?  25   DG  I "O4'" 1 
ATOM   8286  C  "C3'" . DG  I 6  112  ? 153.180 153.632 188.000 1.00 151.45 ?  25   DG  I "C3'" 1 
ATOM   8287  O  "O3'" . DG  I 6  112  ? 154.493 153.966 187.541 1.00 149.49 ?  25   DG  I "O3'" 1 
ATOM   8288  C  "C2'" . DG  I 6  112  ? 153.167 153.566 189.516 1.00 151.65 ?  25   DG  I "C2'" 1 
ATOM   8289  C  "C1'" . DG  I 6  112  ? 152.968 155.021 189.889 1.00 151.95 ?  25   DG  I "C1'" 1 
ATOM   8290  N  N9    . DG  I 6  112  ? 152.353 155.232 191.195 1.00 152.01 ?  25   DG  I N9    1 
ATOM   8291  C  C8    . DG  I 6  112  ? 151.283 154.553 191.727 1.00 152.00 ?  25   DG  I C8    1 
ATOM   8292  N  N7    . DG  I 6  112  ? 150.959 154.964 192.923 1.00 151.94 ?  25   DG  I N7    1 
ATOM   8293  C  C5    . DG  I 6  112  ? 151.873 155.972 193.200 1.00 151.97 ?  25   DG  I C5    1 
ATOM   8294  C  C6    . DG  I 6  112  ? 152.019 156.792 194.354 1.00 152.02 ?  25   DG  I C6    1 
ATOM   8295  O  O6    . DG  I 6  112  ? 151.348 156.787 195.394 1.00 152.02 ?  25   DG  I O6    1 
ATOM   8296  N  N1    . DG  I 6  112  ? 153.075 157.688 194.216 1.00 152.09 ?  25   DG  I N1    1 
ATOM   8297  C  C2    . DG  I 6  112  ? 153.887 157.784 193.110 1.00 151.93 ?  25   DG  I C2    1 
ATOM   8298  N  N2    . DG  I 6  112  ? 154.853 158.712 193.167 1.00 151.97 ?  25   DG  I N2    1 
ATOM   8299  N  N3    . DG  I 6  112  ? 153.761 157.027 192.029 1.00 151.99 ?  25   DG  I N3    1 
ATOM   8300  C  C4    . DG  I 6  112  ? 152.741 156.149 192.143 1.00 152.04 ?  25   DG  I C4    1 
ATOM   8301  P  P     . DG  I 6  113  ? 155.081 153.272 186.224 1.00 148.49 ?  26   DG  I P     1 
ATOM   8302  O  OP1   . DG  I 6  113  ? 153.974 153.130 185.246 1.00 148.35 ?  26   DG  I OP1   1 
ATOM   8303  O  OP2   . DG  I 6  113  ? 155.851 152.073 186.641 1.00 148.34 -1 26   DG  I OP2   1 
ATOM   8304  O  "O5'" . DG  I 6  113  ? 156.103 154.361 185.671 1.00 148.04 ?  26   DG  I "O5'" 1 
ATOM   8305  C  "C5'" . DG  I 6  113  ? 155.738 155.752 185.612 1.00 146.54 ?  26   DG  I "C5'" 1 
ATOM   8306  C  "C4'" . DG  I 6  113  ? 156.803 156.603 186.263 1.00 145.27 ?  26   DG  I "C4'" 1 
ATOM   8307  O  "O4'" . DG  I 6  113  ? 156.682 156.516 187.703 1.00 145.28 ?  26   DG  I "O4'" 1 
ATOM   8308  C  "C3'" . DG  I 6  113  ? 158.240 156.194 185.934 1.00 144.05 ?  26   DG  I "C3'" 1 
ATOM   8309  O  "O3'" . DG  I 6  113  ? 159.058 157.358 185.788 1.00 141.81 ?  26   DG  I "O3'" 1 
ATOM   8310  C  "C2'" . DG  I 6  113  ? 158.667 155.398 187.154 1.00 144.64 ?  26   DG  I "C2'" 1 
ATOM   8311  C  "C1'" . DG  I 6  113  ? 157.915 156.101 188.270 1.00 145.75 ?  26   DG  I "C1'" 1 
ATOM   8312  N  N9    . DG  I 6  113  ? 157.617 155.253 189.419 1.00 145.99 ?  26   DG  I N9    1 
ATOM   8313  C  C8    . DG  I 6  113  ? 157.374 153.901 189.409 1.00 146.11 ?  26   DG  I C8    1 
ATOM   8314  N  N7    . DG  I 6  113  ? 157.137 153.414 190.598 1.00 146.17 ?  26   DG  I N7    1 
ATOM   8315  C  C5    . DG  I 6  113  ? 157.227 154.513 191.443 1.00 146.10 ?  26   DG  I C5    1 
ATOM   8316  C  C6    . DG  I 6  113  ? 157.064 154.605 192.854 1.00 145.95 ?  26   DG  I C6    1 
ATOM   8317  O  O6    . DG  I 6  113  ? 156.800 153.704 193.660 1.00 146.04 ?  26   DG  I O6    1 
ATOM   8318  N  N1    . DG  I 6  113  ? 157.241 155.909 193.305 1.00 145.96 ?  26   DG  I N1    1 
ATOM   8319  C  C2    . DG  I 6  113  ? 157.537 156.987 192.505 1.00 146.17 ?  26   DG  I C2    1 
ATOM   8320  N  N2    . DG  I 6  113  ? 157.669 158.167 193.128 1.00 146.15 ?  26   DG  I N2    1 
ATOM   8321  N  N3    . DG  I 6  113  ? 157.691 156.915 191.190 1.00 146.13 ?  26   DG  I N3    1 
ATOM   8322  C  C4    . DG  I 6  113  ? 157.523 155.655 190.729 1.00 146.09 ?  26   DG  I C4    1 
ATOM   8323  P  P     . DG  I 6  114  ? 160.558 157.217 185.253 1.00 139.51 ?  27   DG  I P     1 
ATOM   8324  O  OP1   . DG  I 6  114  ? 160.820 158.337 184.314 1.00 139.22 ?  27   DG  I OP1   1 
ATOM   8325  O  OP2   . DG  I 6  114  ? 160.753 155.816 184.798 1.00 139.25 -1 27   DG  I OP2   1 
ATOM   8326  O  "O5'" . DG  I 6  114  ? 161.429 157.451 186.565 1.00 138.10 ?  27   DG  I "O5'" 1 
ATOM   8327  C  "C5'" . DG  I 6  114  ? 161.194 158.592 187.409 1.00 135.43 ?  27   DG  I "C5'" 1 
ATOM   8328  C  "C4'" . DG  I 6  114  ? 161.909 158.427 188.730 1.00 133.62 ?  27   DG  I "C4'" 1 
ATOM   8329  O  "O4'" . DG  I 6  114  ? 161.197 157.472 189.552 1.00 133.38 ?  27   DG  I "O4'" 1 
ATOM   8330  C  "C3'" . DG  I 6  114  ? 163.344 157.905 188.625 1.00 132.66 ?  27   DG  I "C3'" 1 
ATOM   8331  O  "O3'" . DG  I 6  114  ? 164.141 158.516 189.642 1.00 131.01 ?  27   DG  I "O3'" 1 
ATOM   8332  C  "C2'" . DG  I 6  114  ? 163.194 156.427 188.930 1.00 133.04 ?  27   DG  I "C2'" 1 
ATOM   8333  C  "C1'" . DG  I 6  114  ? 162.084 156.444 189.964 1.00 133.75 ?  27   DG  I "C1'" 1 
ATOM   8334  N  N9    . DG  I 6  114  ? 161.320 155.204 190.060 1.00 134.00 ?  27   DG  I N9    1 
ATOM   8335  C  C8    . DG  I 6  114  ? 160.931 154.386 189.027 1.00 134.06 ?  27   DG  I C8    1 
ATOM   8336  N  N7    . DG  I 6  114  ? 160.257 153.342 189.426 1.00 134.11 ?  27   DG  I N7    1 
ATOM   8337  C  C5    . DG  I 6  114  ? 160.197 153.478 190.806 1.00 134.10 ?  27   DG  I C5    1 
ATOM   8338  C  C6    . DG  I 6  114  ? 159.591 152.645 191.788 1.00 134.15 ?  27   DG  I C6    1 
ATOM   8339  O  O6    . DG  I 6  114  ? 158.967 151.589 191.626 1.00 134.16 ?  27   DG  I O6    1 
ATOM   8340  N  N1    . DG  I 6  114  ? 159.768 153.155 193.072 1.00 133.90 ?  27   DG  I N1    1 
ATOM   8341  C  C2    . DG  I 6  114  ? 160.441 154.315 193.372 1.00 133.88 ?  27   DG  I C2    1 
ATOM   8342  N  N2    . DG  I 6  114  ? 160.505 154.642 194.671 1.00 134.07 ?  27   DG  I N2    1 
ATOM   8343  N  N3    . DG  I 6  114  ? 161.009 155.099 192.466 1.00 134.16 ?  27   DG  I N3    1 
ATOM   8344  C  C4    . DG  I 6  114  ? 160.850 154.623 191.213 1.00 134.09 ?  27   DG  I C4    1 
ATOM   8345  P  P     . DG  I 6  115  ? 165.684 158.825 189.362 1.00 129.56 ?  28   DG  I P     1 
ATOM   8346  O  OP1   . DG  I 6  115  ? 165.761 159.886 188.327 1.00 129.05 ?  28   DG  I OP1   1 
ATOM   8347  O  OP2   . DG  I 6  115  ? 166.380 157.532 189.142 1.00 128.93 -1 28   DG  I OP2   1 
ATOM   8348  O  "O5'" . DG  I 6  115  ? 166.180 159.437 190.747 1.00 130.83 ?  28   DG  I "O5'" 1 
ATOM   8349  C  "C5'" . DG  I 6  115  ? 165.252 160.082 191.638 1.00 132.88 ?  28   DG  I "C5'" 1 
ATOM   8350  C  "C4'" . DG  I 6  115  ? 165.183 159.335 192.949 1.00 134.43 ?  28   DG  I "C4'" 1 
ATOM   8351  O  "O4'" . DG  I 6  115  ? 164.389 158.135 192.787 1.00 135.32 ?  28   DG  I "O4'" 1 
ATOM   8352  C  "C3'" . DG  I 6  115  ? 166.535 158.879 193.502 1.00 135.16 ?  28   DG  I "C3'" 1 
ATOM   8353  O  "O3'" . DG  I 6  115  ? 166.565 159.073 194.918 1.00 135.61 ?  28   DG  I "O3'" 1 
ATOM   8354  C  "C2'" . DG  I 6  115  ? 166.569 157.396 193.178 1.00 135.57 ?  28   DG  I "C2'" 1 
ATOM   8355  C  "C1'" . DG  I 6  115  ? 165.105 157.019 193.290 1.00 136.65 ?  28   DG  I "C1'" 1 
ATOM   8356  N  N9    . DG  I 6  115  ? 164.721 155.850 192.508 1.00 137.04 ?  28   DG  I N9    1 
ATOM   8357  C  C8    . DG  I 6  115  ? 164.944 155.637 191.169 1.00 137.27 ?  28   DG  I C8    1 
ATOM   8358  N  N7    . DG  I 6  115  ? 164.483 154.490 190.748 1.00 137.27 ?  28   DG  I N7    1 
ATOM   8359  C  C5    . DG  I 6  115  ? 163.922 153.909 191.877 1.00 137.44 ?  28   DG  I C5    1 
ATOM   8360  C  C6    . DG  I 6  115  ? 163.266 152.657 192.040 1.00 137.46 ?  28   DG  I C6    1 
ATOM   8361  O  O6    . DG  I 6  115  ? 163.046 151.786 191.190 1.00 137.35 ?  28   DG  I O6    1 
ATOM   8362  N  N1    . DG  I 6  115  ? 162.850 152.463 193.354 1.00 137.36 ?  28   DG  I N1    1 
ATOM   8363  C  C2    . DG  I 6  115  ? 163.040 153.358 194.381 1.00 137.28 ?  28   DG  I C2    1 
ATOM   8364  N  N2    . DG  I 6  115  ? 162.566 152.991 195.580 1.00 137.16 ?  28   DG  I N2    1 
ATOM   8365  N  N3    . DG  I 6  115  ? 163.648 154.528 194.241 1.00 137.42 ?  28   DG  I N3    1 
ATOM   8366  C  C4    . DG  I 6  115  ? 164.061 154.737 192.973 1.00 137.37 ?  28   DG  I C4    1 
ATOM   8367  P  P     . DA  I 6  116  ? 167.954 159.381 195.648 1.00 136.09 ?  29   DA  I P     1 
ATOM   8368  O  OP1   . DA  I 6  116  ? 167.885 160.754 196.208 1.00 135.35 ?  29   DA  I OP1   1 
ATOM   8369  O  OP2   . DA  I 6  116  ? 169.053 159.022 194.715 1.00 135.72 -1 29   DA  I OP2   1 
ATOM   8370  O  "O5'" . DA  I 6  116  ? 167.959 158.346 196.858 1.00 137.52 ?  29   DA  I "O5'" 1 
ATOM   8371  C  "C5'" . DA  I 6  116  ? 166.790 158.176 197.680 1.00 140.02 ?  29   DA  I "C5'" 1 
ATOM   8372  C  "C4'" . DA  I 6  116  ? 166.846 156.854 198.408 1.00 141.88 ?  29   DA  I "C4'" 1 
ATOM   8373  O  "O4'" . DA  I 6  116  ? 166.289 155.811 197.572 1.00 142.73 ?  29   DA  I "O4'" 1 
ATOM   8374  C  "C3'" . DA  I 6  116  ? 168.250 156.386 198.798 1.00 142.92 ?  29   DA  I "C3'" 1 
ATOM   8375  O  "O3'" . DA  I 6  116  ? 168.203 155.855 200.125 1.00 144.39 ?  29   DA  I "O3'" 1 
ATOM   8376  C  "C2'" . DA  I 6  116  ? 168.557 155.292 197.790 1.00 143.04 ?  29   DA  I "C2'" 1 
ATOM   8377  C  "C1'" . DA  I 6  116  ? 167.182 154.712 197.521 1.00 143.30 ?  29   DA  I "C1'" 1 
ATOM   8378  N  N9    . DA  I 6  116  ? 167.037 154.079 196.211 1.00 143.52 ?  29   DA  I N9    1 
ATOM   8379  C  C8    . DA  I 6  116  ? 167.309 154.621 194.979 1.00 143.60 ?  29   DA  I C8    1 
ATOM   8380  N  N7    . DA  I 6  116  ? 167.076 153.804 193.979 1.00 143.70 ?  29   DA  I N7    1 
ATOM   8381  C  C5    . DA  I 6  116  ? 166.619 152.648 194.595 1.00 143.60 ?  29   DA  I C5    1 
ATOM   8382  C  C6    . DA  I 6  116  ? 166.202 151.405 194.085 1.00 143.41 ?  29   DA  I C6    1 
ATOM   8383  N  N6    . DA  I 6  116  ? 166.177 151.110 192.783 1.00 143.49 ?  29   DA  I N6    1 
ATOM   8384  N  N1    . DA  I 6  116  ? 165.805 150.464 194.969 1.00 143.43 ?  29   DA  I N1    1 
ATOM   8385  C  C2    . DA  I 6  116  ? 165.831 150.761 196.274 1.00 143.45 ?  29   DA  I C2    1 
ATOM   8386  N  N3    . DA  I 6  116  ? 166.202 151.890 196.875 1.00 143.57 ?  29   DA  I N3    1 
ATOM   8387  C  C4    . DA  I 6  116  ? 166.589 152.803 195.969 1.00 143.59 ?  29   DA  I C4    1 
ATOM   8388  P  P     . DT  I 6  117  ? 169.557 155.442 200.870 1.00 145.85 ?  30   DT  I P     1 
ATOM   8389  O  OP1   . DT  I 6  117  ? 169.856 156.480 201.890 1.00 145.49 ?  30   DT  I OP1   1 
ATOM   8390  O  OP2   . DT  I 6  117  ? 170.571 155.114 199.836 1.00 145.92 -1 30   DT  I OP2   1 
ATOM   8391  O  "O5'" . DT  I 6  117  ? 169.154 154.096 201.620 1.00 147.18 ?  30   DT  I "O5'" 1 
ATOM   8392  C  "C5'" . DT  I 6  117  ? 168.043 153.305 201.160 1.00 148.67 ?  30   DT  I "C5'" 1 
ATOM   8393  C  "C4'" . DT  I 6  117  ? 168.337 151.834 201.349 1.00 149.53 ?  30   DT  I "C4'" 1 
ATOM   8394  O  "O4'" . DT  I 6  117  ? 168.108 151.132 200.107 1.00 149.87 ?  30   DT  I "O4'" 1 
ATOM   8395  C  "C3'" . DT  I 6  117  ? 169.774 151.519 201.773 1.00 150.03 ?  30   DT  I "C3'" 1 
ATOM   8396  O  "O3'" . DT  I 6  117  ? 169.771 150.750 202.980 1.00 150.56 ?  30   DT  I "O3'" 1 
ATOM   8397  C  "C2'" . DT  I 6  117  ? 170.358 150.746 200.600 1.00 150.28 ?  30   DT  I "C2'" 1 
ATOM   8398  C  "C1'" . DT  I 6  117  ? 169.137 150.186 199.895 1.00 150.49 ?  30   DT  I "C1'" 1 
ATOM   8399  N  N1    . DT  I 6  117  ? 169.307 150.026 198.441 1.00 150.73 ?  30   DT  I N1    1 
ATOM   8400  C  C2    . DT  I 6  117  ? 169.094 148.783 197.890 1.00 150.89 ?  30   DT  I C2    1 
ATOM   8401  O  O2    . DT  I 6  117  ? 168.777 147.807 198.550 1.00 151.00 ?  30   DT  I O2    1 
ATOM   8402  N  N3    . DT  I 6  117  ? 169.270 148.723 196.529 1.00 150.95 ?  30   DT  I N3    1 
ATOM   8403  C  C4    . DT  I 6  117  ? 169.627 149.759 195.687 1.00 150.77 ?  30   DT  I C4    1 
ATOM   8404  O  O4    . DT  I 6  117  ? 169.748 149.553 194.482 1.00 150.80 ?  30   DT  I O4    1 
ATOM   8405  C  C5    . DT  I 6  117  ? 169.832 151.035 196.333 1.00 150.86 ?  30   DT  I C5    1 
ATOM   8406  C  C7    . DT  I 6  117  ? 170.221 152.216 195.500 1.00 150.79 ?  30   DT  I C7    1 
ATOM   8407  C  C6    . DT  I 6  117  ? 169.663 151.103 197.659 1.00 150.82 ?  30   DT  I C6    1 
ATOM   8408  P  P     . DT  I 6  118  ? 170.871 149.609 203.204 1.00 151.16 ?  31   DT  I P     1 
ATOM   8409  O  OP1   . DT  I 6  118  ? 170.701 149.070 204.577 1.00 151.14 ?  31   DT  I OP1   1 
ATOM   8410  O  OP2   . DT  I 6  118  ? 172.188 150.152 202.785 1.00 150.54 -1 31   DT  I OP2   1 
ATOM   8411  O  "O5'" . DT  I 6  118  ? 170.439 148.480 202.167 1.00 151.53 ?  31   DT  I "O5'" 1 
ATOM   8412  C  "C5'" . DT  I 6  118  ? 169.571 147.402 202.567 1.00 151.75 ?  31   DT  I "C5'" 1 
ATOM   8413  C  "C4'" . DT  I 6  118  ? 169.914 146.139 201.812 1.00 152.03 ?  31   DT  I "C4'" 1 
ATOM   8414  O  "O4'" . DT  I 6  118  ? 169.909 146.407 200.388 1.00 152.01 ?  31   DT  I "O4'" 1 
ATOM   8415  C  "C3'" . DT  I 6  118  ? 171.290 145.550 202.130 1.00 152.16 ?  31   DT  I "C3'" 1 
ATOM   8416  O  "O3'" . DT  I 6  118  ? 171.209 144.123 202.205 1.00 152.72 ?  31   DT  I "O3'" 1 
ATOM   8417  C  "C2'" . DT  I 6  118  ? 172.136 145.964 200.940 1.00 151.95 ?  31   DT  I "C2'" 1 
ATOM   8418  C  "C1'" . DT  I 6  118  ? 171.122 145.951 199.813 1.00 152.15 ?  31   DT  I "C1'" 1 
ATOM   8419  N  N1    . DT  I 6  118  ? 171.452 146.842 198.687 1.00 152.30 ?  31   DT  I N1    1 
ATOM   8420  C  C2    . DT  I 6  118  ? 171.684 146.273 197.456 1.00 152.32 ?  31   DT  I C2    1 
ATOM   8421  O  O2    . DT  I 6  118  ? 171.629 145.071 197.256 1.00 152.31 ?  31   DT  I O2    1 
ATOM   8422  N  N3    . DT  I 6  118  ? 171.985 147.170 196.460 1.00 152.30 ?  31   DT  I N3    1 
ATOM   8423  C  C4    . DT  I 6  118  ? 172.074 148.544 196.573 1.00 152.24 ?  31   DT  I C4    1 
ATOM   8424  O  O4    . DT  I 6  118  ? 172.354 149.223 195.588 1.00 152.36 ?  31   DT  I O4    1 
ATOM   8425  C  C5    . DT  I 6  118  ? 171.818 149.072 197.894 1.00 152.27 ?  31   DT  I C5    1 
ATOM   8426  C  C7    . DT  I 6  118  ? 171.892 150.550 198.113 1.00 152.18 ?  31   DT  I C7    1 
ATOM   8427  C  C6    . DT  I 6  118  ? 171.524 148.205 198.871 1.00 152.33 ?  31   DT  I C6    1 
ATOM   8428  P  P     . DA  I 6  119  ? 172.303 143.300 203.032 1.00 153.10 ?  32   DA  I P     1 
ATOM   8429  O  OP1   . DA  I 6  119  ? 171.765 143.063 204.395 1.00 152.98 ?  32   DA  I OP1   1 
ATOM   8430  O  OP2   . DA  I 6  119  ? 173.612 143.979 202.865 1.00 152.78 -1 32   DA  I OP2   1 
ATOM   8431  O  "O5'" . DA  I 6  119  ? 172.349 141.905 202.264 1.00 153.55 ?  32   DA  I "O5'" 1 
ATOM   8432  C  "C5'" . DA  I 6  119  ? 171.489 141.660 201.136 1.00 154.17 ?  32   DA  I "C5'" 1 
ATOM   8433  C  "C4'" . DA  I 6  119  ? 172.259 140.965 200.038 1.00 154.66 ?  32   DA  I "C4'" 1 
ATOM   8434  O  "O4'" . DA  I 6  119  ? 172.442 141.871 198.926 1.00 154.79 ?  32   DA  I "O4'" 1 
ATOM   8435  C  "C3'" . DA  I 6  119  ? 173.656 140.483 200.443 1.00 154.86 ?  32   DA  I "C3'" 1 
ATOM   8436  O  "O3'" . DA  I 6  119  ? 173.771 139.076 200.209 1.00 155.29 ?  32   DA  I "O3'" 1 
ATOM   8437  C  "C2'" . DA  I 6  119  ? 174.606 141.282 199.564 1.00 154.91 ?  32   DA  I "C2'" 1 
ATOM   8438  C  "C1'" . DA  I 6  119  ? 173.739 141.700 198.392 1.00 155.21 ?  32   DA  I "C1'" 1 
ATOM   8439  N  N9    . DA  I 6  119  ? 174.139 142.964 197.776 1.00 155.34 ?  32   DA  I N9    1 
ATOM   8440  C  C8    . DA  I 6  119  ? 174.093 144.221 198.327 1.00 155.33 ?  32   DA  I C8    1 
ATOM   8441  N  N7    . DA  I 6  119  ? 174.520 145.166 197.525 1.00 155.33 ?  32   DA  I N7    1 
ATOM   8442  C  C5    . DA  I 6  119  ? 174.872 144.485 196.367 1.00 155.36 ?  32   DA  I C5    1 
ATOM   8443  C  C6    . DA  I 6  119  ? 175.396 144.921 195.137 1.00 155.36 ?  32   DA  I C6    1 
ATOM   8444  N  N6    . DA  I 6  119  ? 175.669 146.197 194.858 1.00 155.28 ?  32   DA  I N6    1 
ATOM   8445  N  N1    . DA  I 6  119  ? 175.633 143.987 194.191 1.00 155.33 ?  32   DA  I N1    1 
ATOM   8446  C  C2    . DA  I 6  119  ? 175.359 142.707 194.472 1.00 155.33 ?  32   DA  I C2    1 
ATOM   8447  N  N3    . DA  I 6  119  ? 174.866 142.175 195.588 1.00 155.46 ?  32   DA  I N3    1 
ATOM   8448  C  C4    . DA  I 6  119  ? 174.642 143.129 196.507 1.00 155.40 ?  32   DA  I C4    1 
ATOM   8449  P  P     . DC  I 6  120  ? 175.212 138.417 199.981 1.00 155.50 ?  33   DC  I P     1 
ATOM   8450  O  OP1   . DC  I 6  120  ? 175.052 136.941 200.016 1.00 155.43 ?  33   DC  I OP1   1 
ATOM   8451  O  OP2   . DC  I 6  120  ? 176.170 139.075 200.905 1.00 155.39 -1 33   DC  I OP2   1 
ATOM   8452  O  "O5'" . DC  I 6  120  ? 175.574 138.845 198.490 1.00 154.85 ?  33   DC  I "O5'" 1 
ATOM   8453  C  "C5'" . DC  I 6  120  ? 174.636 138.648 197.416 1.00 153.87 ?  33   DC  I "C5'" 1 
ATOM   8454  C  "C4'" . DC  I 6  120  ? 175.365 138.316 196.134 1.00 153.32 ?  33   DC  I "C4'" 1 
ATOM   8455  O  "O4'" . DC  I 6  120  ? 175.879 139.532 195.538 1.00 153.44 ?  33   DC  I "O4'" 1 
ATOM   8456  C  "C3'" . DC  I 6  120  ? 176.565 137.381 196.295 1.00 152.65 ?  33   DC  I "C3'" 1 
ATOM   8457  O  "O3'" . DC  I 6  120  ? 176.602 136.449 195.211 1.00 151.58 ?  33   DC  I "O3'" 1 
ATOM   8458  C  "C2'" . DC  I 6  120  ? 177.756 138.319 196.235 1.00 152.94 ?  33   DC  I "C2'" 1 
ATOM   8459  C  "C1'" . DC  I 6  120  ? 177.268 139.397 195.286 1.00 153.39 ?  33   DC  I "C1'" 1 
ATOM   8460  N  N1    . DC  I 6  120  ? 177.892 140.711 195.491 1.00 153.56 ?  33   DC  I N1    1 
ATOM   8461  C  C2    . DC  I 6  120  ? 178.469 141.361 194.396 1.00 153.53 ?  33   DC  I C2    1 
ATOM   8462  O  O2    . DC  I 6  120  ? 178.437 140.808 193.287 1.00 153.52 ?  33   DC  I O2    1 
ATOM   8463  N  N3    . DC  I 6  120  ? 179.047 142.571 194.575 1.00 153.61 ?  33   DC  I N3    1 
ATOM   8464  C  C4    . DC  I 6  120  ? 179.060 143.131 195.787 1.00 153.60 ?  33   DC  I C4    1 
ATOM   8465  N  N4    . DC  I 6  120  ? 179.641 144.326 195.917 1.00 153.56 ?  33   DC  I N4    1 
ATOM   8466  C  C5    . DC  I 6  120  ? 178.479 142.490 196.919 1.00 153.75 ?  33   DC  I C5    1 
ATOM   8467  C  C6    . DC  I 6  120  ? 177.912 141.293 196.728 1.00 153.88 ?  33   DC  I C6    1 
ATOM   8468  P  P     . DT  I 6  121  ? 177.828 135.429 195.081 1.00 150.98 ?  34   DT  I P     1 
ATOM   8469  O  OP1   . DT  I 6  121  ? 177.308 134.157 194.518 1.00 151.13 ?  34   DT  I OP1   1 
ATOM   8470  O  OP2   . DT  I 6  121  ? 178.555 135.418 196.376 1.00 150.43 -1 34   DT  I OP2   1 
ATOM   8471  O  "O5'" . DT  I 6  121  ? 178.755 136.121 193.988 1.00 149.77 ?  34   DT  I "O5'" 1 
ATOM   8472  C  "C5'" . DT  I 6  121  ? 178.404 136.072 192.594 1.00 147.43 ?  34   DT  I "C5'" 1 
ATOM   8473  C  "C4'" . DT  I 6  121  ? 179.169 137.117 191.815 1.00 145.96 ?  34   DT  I "C4'" 1 
ATOM   8474  O  "O4'" . DT  I 6  121  ? 179.336 138.315 192.609 1.00 146.06 ?  34   DT  I "O4'" 1 
ATOM   8475  C  "C3'" . DT  I 6  121  ? 180.572 136.696 191.368 1.00 144.82 ?  34   DT  I "C3'" 1 
ATOM   8476  O  "O3'" . DT  I 6  121  ? 180.704 136.925 189.963 1.00 143.15 ?  34   DT  I "O3'" 1 
ATOM   8477  C  "C2'" . DT  I 6  121  ? 181.501 137.623 192.137 1.00 145.31 ?  34   DT  I "C2'" 1 
ATOM   8478  C  "C1'" . DT  I 6  121  ? 180.627 138.837 192.369 1.00 145.90 ?  34   DT  I "C1'" 1 
ATOM   8479  N  N1    . DT  I 6  121  ? 181.009 139.653 193.535 1.00 145.98 ?  34   DT  I N1    1 
ATOM   8480  C  C2    . DT  I 6  121  ? 181.368 140.964 193.324 1.00 145.75 ?  34   DT  I C2    1 
ATOM   8481  O  O2    . DT  I 6  121  ? 181.385 141.479 192.218 1.00 145.54 ?  34   DT  I O2    1 
ATOM   8482  N  N3    . DT  I 6  121  ? 181.708 141.653 194.461 1.00 145.70 ?  34   DT  I N3    1 
ATOM   8483  C  C4    . DT  I 6  121  ? 181.724 141.172 195.756 1.00 145.70 ?  34   DT  I C4    1 
ATOM   8484  O  O4    . DT  I 6  121  ? 182.054 141.912 196.679 1.00 145.71 ?  34   DT  I O4    1 
ATOM   8485  C  C5    . DT  I 6  121  ? 181.336 139.788 195.904 1.00 145.72 ?  34   DT  I C5    1 
ATOM   8486  C  C7    . DT  I 6  121  ? 181.322 139.179 197.271 1.00 145.69 ?  34   DT  I C7    1 
ATOM   8487  C  C6    . DT  I 6  121  ? 181.002 139.108 194.800 1.00 145.98 ?  34   DT  I C6    1 
ATOM   8488  P  P     . DC  I 6  122  ? 181.723 136.042 189.103 1.00 142.31 ?  35   DC  I P     1 
ATOM   8489  O  OP1   . DC  I 6  122  ? 181.024 134.798 188.693 1.00 142.57 ?  35   DC  I OP1   1 
ATOM   8490  O  OP2   . DC  I 6  122  ? 183.002 135.954 189.853 1.00 141.96 -1 35   DC  I OP2   1 
ATOM   8491  O  "O5'" . DC  I 6  122  ? 181.959 136.932 187.804 1.00 140.74 ?  35   DC  I "O5'" 1 
ATOM   8492  C  "C5'" . DC  I 6  122  ? 181.329 138.220 187.675 1.00 137.61 ?  35   DC  I "C5'" 1 
ATOM   8493  C  "C4'" . DC  I 6  122  ? 182.371 139.303 187.526 1.00 135.26 ?  35   DC  I "C4'" 1 
ATOM   8494  O  "O4'" . DC  I 6  122  ? 182.609 139.934 188.809 1.00 135.15 ?  35   DC  I "O4'" 1 
ATOM   8495  C  "C3'" . DC  I 6  122  ? 183.738 138.824 187.035 1.00 133.51 ?  35   DC  I "C3'" 1 
ATOM   8496  O  "O3'" . DC  I 6  122  ? 184.305 139.823 186.183 1.00 130.93 ?  35   DC  I "O3'" 1 
ATOM   8497  C  "C2'" . DC  I 6  122  ? 184.555 138.742 188.311 1.00 133.80 ?  35   DC  I "C2'" 1 
ATOM   8498  C  "C1'" . DC  I 6  122  ? 183.996 139.907 189.104 1.00 134.42 ?  35   DC  I "C1'" 1 
ATOM   8499  N  N1    . DC  I 6  122  ? 184.146 139.782 190.561 1.00 134.36 ?  35   DC  I N1    1 
ATOM   8500  C  C2    . DC  I 6  122  ? 184.811 140.794 191.258 1.00 134.36 ?  35   DC  I C2    1 
ATOM   8501  O  O2    . DC  I 6  122  ? 185.254 141.765 190.626 1.00 134.26 ?  35   DC  I O2    1 
ATOM   8502  N  N3    . DC  I 6  122  ? 184.954 140.690 192.598 1.00 134.22 ?  35   DC  I N3    1 
ATOM   8503  C  C4    . DC  I 6  122  ? 184.463 139.627 193.241 1.00 134.25 ?  35   DC  I C4    1 
ATOM   8504  N  N4    . DC  I 6  122  ? 184.627 139.565 194.563 1.00 134.04 ?  35   DC  I N4    1 
ATOM   8505  C  C5    . DC  I 6  122  ? 183.781 138.581 192.554 1.00 134.47 ?  35   DC  I C5    1 
ATOM   8506  C  C6    . DC  I 6  122  ? 183.647 138.698 191.226 1.00 134.45 ?  35   DC  I C6    1 
ATOM   8507  P  P     . DC  I 6  123  ? 185.365 139.394 185.062 1.00 129.23 ?  36   DC  I P     1 
ATOM   8508  O  OP1   . DC  I 6  123  ? 184.772 138.290 184.268 1.00 129.08 ?  36   DC  I OP1   1 
ATOM   8509  O  OP2   . DC  I 6  123  ? 186.680 139.200 185.723 1.00 128.68 -1 36   DC  I OP2   1 
ATOM   8510  O  "O5'" . DC  I 6  123  ? 185.448 140.684 184.132 1.00 127.27 ?  36   DC  I "O5'" 1 
ATOM   8511  C  "C5'" . DC  I 6  123  ? 184.426 141.693 184.188 1.00 123.97 ?  36   DC  I "C5'" 1 
ATOM   8512  C  "C4'" . DC  I 6  123  ? 185.004 142.990 184.703 1.00 121.51 ?  36   DC  I "C4'" 1 
ATOM   8513  O  "O4'" . DC  I 6  123  ? 185.447 142.820 186.071 1.00 121.25 ?  36   DC  I "O4'" 1 
ATOM   8514  C  "C3'" . DC  I 6  123  ? 186.213 143.510 183.920 1.00 119.61 ?  36   DC  I "C3'" 1 
ATOM   8515  O  "O3'" . DC  I 6  123  ? 186.043 144.908 183.682 1.00 116.50 ?  36   DC  I "O3'" 1 
ATOM   8516  C  "C2'" . DC  I 6  123  ? 187.385 143.261 184.854 1.00 119.82 ?  36   DC  I "C2'" 1 
ATOM   8517  C  "C1'" . DC  I 6  123  ? 186.740 143.377 186.219 1.00 120.99 ?  36   DC  I "C1'" 1 
ATOM   8518  N  N1    . DC  I 6  123  ? 187.431 142.636 187.283 1.00 121.37 ?  36   DC  I N1    1 
ATOM   8519  C  C2    . DC  I 6  123  ? 188.045 143.353 188.312 1.00 121.71 ?  36   DC  I C2    1 
ATOM   8520  O  O2    . DC  I 6  123  ? 187.988 144.591 188.296 1.00 121.92 ?  36   DC  I O2    1 
ATOM   8521  N  N3    . DC  I 6  123  ? 188.685 142.681 189.297 1.00 121.56 ?  36   DC  I N3    1 
ATOM   8522  C  C4    . DC  I 6  123  ? 188.723 141.346 189.277 1.00 121.54 ?  36   DC  I C4    1 
ATOM   8523  N  N4    . DC  I 6  123  ? 189.364 140.723 190.269 1.00 121.41 ?  36   DC  I N4    1 
ATOM   8524  C  C5    . DC  I 6  123  ? 188.104 140.591 188.239 1.00 121.87 ?  36   DC  I C5    1 
ATOM   8525  C  C6    . DC  I 6  123  ? 187.475 141.270 187.272 1.00 121.90 ?  36   DC  I C6    1 
ATOM   8526  P  P     . DC  I 6  124  ? 187.054 145.679 182.707 1.00 114.48 ?  37   DC  I P     1 
ATOM   8527  O  OP1   . DC  I 6  124  ? 186.262 146.279 181.604 1.00 114.01 ?  37   DC  I OP1   1 
ATOM   8528  O  OP2   . DC  I 6  124  ? 188.178 144.763 182.391 1.00 113.74 -1 37   DC  I OP2   1 
ATOM   8529  O  "O5'" . DC  I 6  124  ? 187.604 146.857 183.628 1.00 113.15 ?  37   DC  I "O5'" 1 
ATOM   8530  C  "C5'" . DC  I 6  124  ? 186.892 147.250 184.813 1.00 110.06 ?  37   DC  I "C5'" 1 
ATOM   8531  C  "C4'" . DC  I 6  124  ? 187.850 147.810 185.838 1.00 107.58 ?  37   DC  I "C4'" 1 
ATOM   8532  O  "O4'" . DC  I 6  124  ? 188.347 146.742 186.680 1.00 106.65 ?  37   DC  I "O4'" 1 
ATOM   8533  C  "C3'" . DC  I 6  124  ? 189.085 148.505 185.259 1.00 106.60 ?  37   DC  I "C3'" 1 
ATOM   8534  O  "O3'" . DC  I 6  124  ? 189.353 149.674 186.034 1.00 105.70 ?  37   DC  I "O3'" 1 
ATOM   8535  C  "C2'" . DC  I 6  124  ? 190.192 147.487 185.458 1.00 106.22 ?  37   DC  I "C2'" 1 
ATOM   8536  C  "C1'" . DC  I 6  124  ? 189.761 146.809 186.744 1.00 106.76 ?  37   DC  I "C1'" 1 
ATOM   8537  N  N1    . DC  I 6  124  ? 190.270 145.441 186.918 1.00 106.75 ?  37   DC  I N1    1 
ATOM   8538  C  C2    . DC  I 6  124  ? 191.016 145.141 188.061 1.00 106.48 ?  37   DC  I C2    1 
ATOM   8539  O  O2    . DC  I 6  124  ? 191.229 146.040 188.890 1.00 106.50 ?  37   DC  I O2    1 
ATOM   8540  N  N3    . DC  I 6  124  ? 191.487 143.884 188.233 1.00 106.83 ?  37   DC  I N3    1 
ATOM   8541  C  C4    . DC  I 6  124  ? 191.236 142.948 187.316 1.00 106.87 ?  37   DC  I C4    1 
ATOM   8542  N  N4    . DC  I 6  124  ? 191.720 141.722 187.526 1.00 106.84 ?  37   DC  I N4    1 
ATOM   8543  C  C5    . DC  I 6  124  ? 190.476 143.227 186.142 1.00 106.73 ?  37   DC  I C5    1 
ATOM   8544  C  C6    . DC  I 6  124  ? 190.016 144.474 185.986 1.00 107.20 ?  37   DC  I C6    1 
ATOM   8545  P  P     . DT  I 6  125  ? 190.251 150.849 185.423 1.00 104.18 ?  38   DT  I P     1 
ATOM   8546  O  OP1   . DT  I 6  125  ? 189.396 152.055 185.279 1.00 103.41 ?  38   DT  I OP1   1 
ATOM   8547  O  OP2   . DT  I 6  125  ? 190.971 150.312 184.242 1.00 103.72 -1 38   DT  I OP2   1 
ATOM   8548  O  "O5'" . DT  I 6  125  ? 191.312 151.126 186.579 1.00 103.80 ?  38   DT  I "O5'" 1 
ATOM   8549  C  "C5'" . DT  I 6  125  ? 190.892 151.642 187.854 1.00 102.80 ?  38   DT  I "C5'" 1 
ATOM   8550  C  "C4'" . DT  I 6  125  ? 191.836 151.180 188.939 1.00 102.34 ?  38   DT  I "C4'" 1 
ATOM   8551  O  "O4'" . DT  I 6  125  ? 191.911 149.743 188.934 1.00 102.32 ?  38   DT  I "O4'" 1 
ATOM   8552  C  "C3'" . DT  I 6  125  ? 193.278 151.649 188.774 1.00 102.13 ?  38   DT  I "C3'" 1 
ATOM   8553  O  "O3'" . DT  I 6  125  ? 193.451 152.892 189.461 1.00 101.65 ?  38   DT  I "O3'" 1 
ATOM   8554  C  "C2'" . DT  I 6  125  ? 194.091 150.539 189.424 1.00 102.25 ?  38   DT  I "C2'" 1 
ATOM   8555  C  "C1'" . DT  I 6  125  ? 193.133 149.351 189.539 1.00 102.94 ?  38   DT  I "C1'" 1 
ATOM   8556  N  N1    . DT  I 6  125  ? 193.595 148.124 188.867 1.00 103.51 ?  38   DT  I N1    1 
ATOM   8557  C  C2    . DT  I 6  125  ? 193.968 147.056 189.651 1.00 103.69 ?  38   DT  I C2    1 
ATOM   8558  O  O2    . DT  I 6  125  ? 193.937 147.082 190.870 1.00 103.67 ?  38   DT  I O2    1 
ATOM   8559  N  N3    . DT  I 6  125  ? 194.384 145.951 188.951 1.00 103.55 ?  38   DT  I N3    1 
ATOM   8560  C  C4    . DT  I 6  125  ? 194.459 145.811 187.578 1.00 103.45 ?  38   DT  I C4    1 
ATOM   8561  O  O4    . DT  I 6  125  ? 194.853 144.754 187.092 1.00 103.50 ?  38   DT  I O4    1 
ATOM   8562  C  C5    . DT  I 6  125  ? 194.050 146.970 186.818 1.00 103.65 ?  38   DT  I C5    1 
ATOM   8563  C  C7    . DT  I 6  125  ? 194.097 146.912 185.324 1.00 103.35 ?  38   DT  I C7    1 
ATOM   8564  C  C6    . DT  I 6  125  ? 193.643 148.053 187.492 1.00 104.00 ?  38   DT  I C6    1 
ATOM   8565  P  P     . DA  I 6  126  ? 194.866 153.636 189.418 1.00 100.78 ?  39   DA  I P     1 
ATOM   8566  O  OP1   . DA  I 6  126  ? 194.616 155.100 189.396 1.00 101.70 ?  39   DA  I OP1   1 
ATOM   8567  O  OP2   . DA  I 6  126  ? 195.681 153.014 188.344 1.00 100.63 -1 39   DA  I OP2   1 
ATOM   8568  O  "O5'" . DA  I 6  126  ? 195.511 153.258 190.825 1.00 103.42 ?  39   DA  I "O5'" 1 
ATOM   8569  C  "C5'" . DA  I 6  126  ? 194.691 153.138 192.002 1.00 106.88 ?  39   DA  I "C5'" 1 
ATOM   8570  C  "C4'" . DA  I 6  126  ? 195.456 152.441 193.103 1.00 109.26 ?  39   DA  I "C4'" 1 
ATOM   8571  O  "O4'" . DA  I 6  126  ? 195.540 151.026 192.809 1.00 109.92 ?  39   DA  I "O4'" 1 
ATOM   8572  C  "C3'" . DA  I 6  126  ? 196.897 152.917 193.281 1.00 110.78 ?  39   DA  I "C3'" 1 
ATOM   8573  O  "O3'" . DA  I 6  126  ? 197.264 152.865 194.664 1.00 113.11 ?  39   DA  I "O3'" 1 
ATOM   8574  C  "C2'" . DA  I 6  126  ? 197.695 151.915 192.467 1.00 110.68 ?  39   DA  I "C2'" 1 
ATOM   8575  C  "C1'" . DA  I 6  126  ? 196.895 150.633 192.641 1.00 110.56 ?  39   DA  I "C1'" 1 
ATOM   8576  N  N9    . DA  I 6  126  ? 196.958 149.728 191.494 1.00 110.44 ?  39   DA  I N9    1 
ATOM   8577  C  C8    . DA  I 6  126  ? 196.834 150.047 190.165 1.00 110.52 ?  39   DA  I C8    1 
ATOM   8578  N  N7    . DA  I 6  126  ? 196.935 149.015 189.362 1.00 110.39 ?  39   DA  I N7    1 
ATOM   8579  C  C5    . DA  I 6  126  ? 197.138 147.944 190.221 1.00 110.43 ?  39   DA  I C5    1 
ATOM   8580  C  C6    . DA  I 6  126  ? 197.321 146.569 189.992 1.00 110.57 ?  39   DA  I C6    1 
ATOM   8581  N  N6    . DA  I 6  126  ? 197.330 146.015 188.777 1.00 110.54 ?  39   DA  I N6    1 
ATOM   8582  N  N1    . DA  I 6  126  ? 197.497 145.772 191.068 1.00 110.78 ?  39   DA  I N1    1 
ATOM   8583  C  C2    . DA  I 6  126  ? 197.489 146.328 192.285 1.00 110.76 ?  39   DA  I C2    1 
ATOM   8584  N  N3    . DA  I 6  126  ? 197.327 147.603 192.629 1.00 111.13 ?  39   DA  I N3    1 
ATOM   8585  C  C4    . DA  I 6  126  ? 197.154 148.369 191.537 1.00 110.74 ?  39   DA  I C4    1 
ATOM   8586  P  P     . DG  I 6  127  ? 198.702 153.394 195.128 1.00 115.07 ?  40   DG  I P     1 
ATOM   8587  O  OP1   . DG  I 6  127  ? 198.561 153.971 196.489 1.00 116.12 ?  40   DG  I OP1   1 
ATOM   8588  O  OP2   . DG  I 6  127  ? 199.263 154.223 194.032 1.00 115.10 -1 40   DG  I OP2   1 
ATOM   8589  O  "O5'" . DG  I 6  127  ? 199.560 152.056 195.238 1.00 117.27 ?  40   DG  I "O5'" 1 
ATOM   8590  C  "C5'" . DG  I 6  127  ? 199.011 150.878 195.859 1.00 119.58 ?  40   DG  I "C5'" 1 
ATOM   8591  C  "C4'" . DG  I 6  127  ? 200.046 149.780 195.909 1.00 121.45 ?  40   DG  I "C4'" 1 
ATOM   8592  O  "O4'" . DG  I 6  127  ? 199.922 148.941 194.734 1.00 122.22 ?  40   DG  I "O4'" 1 
ATOM   8593  C  "C3'" . DG  I 6  127  ? 201.499 150.256 195.936 1.00 122.52 ?  40   DG  I "C3'" 1 
ATOM   8594  O  "O3'" . DG  I 6  127  ? 202.258 149.390 196.785 1.00 124.52 ?  40   DG  I "O3'" 1 
ATOM   8595  C  "C2'" . DG  I 6  127  ? 201.942 150.108 194.492 1.00 122.49 ?  40   DG  I "C2'" 1 
ATOM   8596  C  "C1'" . DG  I 6  127  ? 201.160 148.886 194.043 1.00 122.76 ?  40   DG  I "C1'" 1 
ATOM   8597  N  N9    . DG  I 6  127  ? 200.870 148.848 192.614 1.00 122.85 ?  40   DG  I N9    1 
ATOM   8598  C  C8    . DG  I 6  127  ? 200.463 149.896 191.822 1.00 123.00 ?  40   DG  I C8    1 
ATOM   8599  N  N7    . DG  I 6  127  ? 200.278 149.555 190.575 1.00 122.96 ?  40   DG  I N7    1 
ATOM   8600  C  C5    . DG  I 6  127  ? 200.582 148.201 190.540 1.00 122.87 ?  40   DG  I C5    1 
ATOM   8601  C  C6    . DG  I 6  127  ? 200.565 147.280 189.456 1.00 122.69 ?  40   DG  I C6    1 
ATOM   8602  O  O6    . DG  I 6  127  ? 200.269 147.489 188.273 1.00 122.76 ?  40   DG  I O6    1 
ATOM   8603  N  N1    . DG  I 6  127  ? 200.943 146.003 189.860 1.00 122.93 ?  40   DG  I N1    1 
ATOM   8604  C  C2    . DG  I 6  127  ? 201.292 145.655 191.143 1.00 123.17 ?  40   DG  I C2    1 
ATOM   8605  N  N2    . DG  I 6  127  ? 201.627 144.371 191.336 1.00 123.13 ?  40   DG  I N2    1 
ATOM   8606  N  N3    . DG  I 6  127  ? 201.313 146.503 192.162 1.00 123.12 ?  40   DG  I N3    1 
ATOM   8607  C  C4    . DG  I 6  127  ? 200.949 147.749 191.791 1.00 122.90 ?  40   DG  I C4    1 
ATOM   8608  P  P     . DT  I 6  128  ? 203.807 149.694 197.054 1.00 125.78 ?  41   DT  I P     1 
ATOM   8609  O  OP1   . DT  I 6  128  ? 204.107 149.342 198.464 1.00 125.17 ?  41   DT  I OP1   1 
ATOM   8610  O  OP2   . DT  I 6  128  ? 204.099 151.064 196.561 1.00 125.30 -1 41   DT  I OP2   1 
ATOM   8611  O  "O5'" . DT  I 6  128  ? 204.549 148.648 196.108 1.00 127.01 ?  41   DT  I "O5'" 1 
ATOM   8612  C  "C5'" . DT  I 6  128  ? 204.169 147.260 196.113 1.00 128.86 ?  41   DT  I "C5'" 1 
ATOM   8613  C  "C4'" . DT  I 6  128  ? 205.097 146.453 195.235 1.00 130.40 ?  41   DT  I "C4'" 1 
ATOM   8614  O  "O4'" . DT  I 6  128  ? 204.559 146.382 193.893 1.00 130.79 ?  41   DT  I "O4'" 1 
ATOM   8615  C  "C3'" . DT  I 6  128  ? 206.519 147.002 195.097 1.00 131.52 ?  41   DT  I "C3'" 1 
ATOM   8616  O  "O3'" . DT  I 6  128  ? 207.432 145.903 195.145 1.00 133.39 ?  41   DT  I "O3'" 1 
ATOM   8617  C  "C2'" . DT  I 6  128  ? 206.521 147.641 193.719 1.00 131.13 ?  41   DT  I "C2'" 1 
ATOM   8618  C  "C1'" . DT  I 6  128  ? 205.557 146.753 192.956 1.00 130.62 ?  41   DT  I "C1'" 1 
ATOM   8619  N  N1    . DT  I 6  128  ? 204.886 147.410 191.821 1.00 130.39 ?  41   DT  I N1    1 
ATOM   8620  C  C2    . DT  I 6  128  ? 204.700 146.683 190.667 1.00 129.89 ?  41   DT  I C2    1 
ATOM   8621  O  O2    . DT  I 6  128  ? 205.065 145.527 190.542 1.00 130.23 ?  41   DT  I O2    1 
ATOM   8622  N  N3    . DT  I 6  128  ? 204.067 147.367 189.658 1.00 129.70 ?  41   DT  I N3    1 
ATOM   8623  C  C4    . DT  I 6  128  ? 203.613 148.672 189.690 1.00 130.18 ?  41   DT  I C4    1 
ATOM   8624  O  O4    . DT  I 6  128  ? 203.062 149.152 188.702 1.00 130.35 ?  41   DT  I O4    1 
ATOM   8625  C  C5    . DT  I 6  128  ? 203.841 149.373 190.932 1.00 130.30 ?  41   DT  I C5    1 
ATOM   8626  C  C7    . DT  I 6  128  ? 203.384 150.791 191.060 1.00 130.35 ?  41   DT  I C7    1 
ATOM   8627  C  C6    . DT  I 6  128  ? 204.457 148.715 191.922 1.00 130.46 ?  41   DT  I C6    1 
ATOM   8628  P  P     . DC  I 6  129  ? 209.009 146.168 195.119 1.00 134.61 ?  42   DC  I P     1 
ATOM   8629  O  OP1   . DC  I 6  129  ? 209.638 145.308 196.153 1.00 134.99 ?  42   DC  I OP1   1 
ATOM   8630  O  OP2   . DC  I 6  129  ? 209.229 147.637 195.152 1.00 134.39 -1 42   DC  I OP2   1 
ATOM   8631  O  "O5'" . DC  I 6  129  ? 209.441 145.625 193.685 1.00 135.35 ?  42   DC  I "O5'" 1 
ATOM   8632  C  "C5'" . DC  I 6  129  ? 210.073 144.339 193.538 1.00 136.26 ?  42   DC  I "C5'" 1 
ATOM   8633  C  "C4'" . DC  I 6  129  ? 210.371 144.072 192.081 1.00 137.11 ?  42   DC  I "C4'" 1 
ATOM   8634  O  "O4'" . DC  I 6  129  ? 209.235 144.463 191.286 1.00 137.24 ?  42   DC  I "O4'" 1 
ATOM   8635  C  "C3'" . DC  I 6  129  ? 211.543 144.869 191.517 1.00 137.52 ?  42   DC  I "C3'" 1 
ATOM   8636  O  "O3'" . DC  I 6  129  ? 212.756 144.113 191.598 1.00 138.49 ?  42   DC  I "O3'" 1 
ATOM   8637  C  "C2'" . DC  I 6  129  ? 211.173 145.066 190.055 1.00 137.32 ?  42   DC  I "C2'" 1 
ATOM   8638  C  "C1'" . DC  I 6  129  ? 209.671 144.791 189.975 1.00 137.38 ?  42   DC  I "C1'" 1 
ATOM   8639  N  N1    . DC  I 6  129  ? 208.873 145.933 189.507 1.00 137.35 ?  42   DC  I N1    1 
ATOM   8640  C  C2    . DC  I 6  129  ? 208.860 146.229 188.141 1.00 137.36 ?  42   DC  I C2    1 
ATOM   8641  O  O2    . DC  I 6  129  ? 209.519 145.518 187.368 1.00 137.19 ?  42   DC  I O2    1 
ATOM   8642  N  N3    . DC  I 6  129  ? 208.129 147.279 187.699 1.00 137.40 ?  42   DC  I N3    1 
ATOM   8643  C  C4    . DC  I 6  129  ? 207.433 148.019 188.566 1.00 137.36 ?  42   DC  I C4    1 
ATOM   8644  N  N4    . DC  I 6  129  ? 206.727 149.044 188.085 1.00 137.24 ?  42   DC  I N4    1 
ATOM   8645  C  C5    . DC  I 6  129  ? 207.430 147.739 189.962 1.00 137.21 ?  42   DC  I C5    1 
ATOM   8646  C  C6    . DC  I 6  129  ? 208.158 146.697 190.385 1.00 137.20 ?  42   DC  I C6    1 
ATOM   8647  P  P     . DT  I 6  130  ? 213.734 144.030 190.334 1.00 138.98 ?  43   DT  I P     1 
ATOM   8648  O  OP1   . DT  I 6  130  ? 214.691 142.919 190.567 1.00 138.59 ?  43   DT  I OP1   1 
ATOM   8649  O  OP2   . DT  I 6  130  ? 214.245 145.397 190.057 1.00 138.68 -1 43   DT  I OP2   1 
ATOM   8650  O  "O5'" . DT  I 6  130  ? 212.757 143.608 189.149 1.00 138.95 ?  43   DT  I "O5'" 1 
ATOM   8651  C  "C5'" . DT  I 6  130  ? 213.133 142.583 188.208 1.00 138.55 ?  43   DT  I "C5'" 1 
ATOM   8652  C  "C4'" . DT  I 6  130  ? 213.268 143.165 186.820 1.00 138.33 ?  43   DT  I "C4'" 1 
ATOM   8653  O  "O4'" . DT  I 6  130  ? 212.264 144.179 186.622 1.00 138.51 ?  43   DT  I "O4'" 1 
ATOM   8654  C  "C3'" . DT  I 6  130  ? 214.607 143.850 186.543 1.00 137.89 ?  43   DT  I "C3'" 1 
ATOM   8655  O  "O3'" . DT  I 6  130  ? 215.451 142.997 185.761 1.00 137.33 ?  43   DT  I "O3'" 1 
ATOM   8656  C  "C2'" . DT  I 6  130  ? 214.244 145.099 185.751 1.00 138.19 ?  43   DT  I "C2'" 1 
ATOM   8657  C  "C1'" . DT  I 6  130  ? 212.726 145.071 185.626 1.00 138.62 ?  43   DT  I "C1'" 1 
ATOM   8658  N  N1    . DT  I 6  130  ? 212.080 146.375 185.854 1.00 138.54 ?  43   DT  I N1    1 
ATOM   8659  C  C2    . DT  I 6  130  ? 211.320 146.912 184.841 1.00 138.35 ?  43   DT  I C2    1 
ATOM   8660  O  O2    . DT  I 6  130  ? 211.155 146.359 183.766 1.00 138.51 ?  43   DT  I O2    1 
ATOM   8661  N  N3    . DT  I 6  130  ? 210.755 148.129 185.134 1.00 138.21 ?  43   DT  I N3    1 
ATOM   8662  C  C4    . DT  I 6  130  ? 210.873 148.843 186.312 1.00 138.48 ?  43   DT  I C4    1 
ATOM   8663  O  O4    . DT  I 6  130  ? 210.306 149.926 186.431 1.00 138.70 ?  43   DT  I O4    1 
ATOM   8664  C  C5    . DT  I 6  130  ? 211.686 148.219 187.331 1.00 138.46 ?  43   DT  I C5    1 
ATOM   8665  C  C7    . DT  I 6  130  ? 211.871 148.919 188.641 1.00 138.40 ?  43   DT  I C7    1 
ATOM   8666  C  C6    . DT  I 6  130  ? 212.241 147.033 187.055 1.00 138.49 ?  43   DT  I C6    1 
ATOM   8667  P  P     . DC  I 6  131  ? 216.170 143.567 184.449 1.00 137.07 ?  44   DC  I P     1 
ATOM   8668  O  OP1   . DC  I 6  131  ? 216.577 142.411 183.610 1.00 136.85 ?  44   DC  I OP1   1 
ATOM   8669  O  OP2   . DC  I 6  131  ? 217.186 144.560 184.876 1.00 136.63 -1 44   DC  I OP2   1 
ATOM   8670  O  "O5'" . DC  I 6  131  ? 214.994 144.337 183.700 1.00 135.97 ?  44   DC  I "O5'" 1 
ATOM   8671  C  "C5'" . DC  I 6  131  ? 214.242 143.696 182.652 1.00 134.45 ?  44   DC  I "C5'" 1 
ATOM   8672  C  "C4'" . DC  I 6  131  ? 213.847 144.702 181.596 1.00 133.08 ?  44   DC  I "C4'" 1 
ATOM   8673  O  "O4'" . DC  I 6  131  ? 213.259 145.865 182.228 1.00 132.53 ?  44   DC  I "O4'" 1 
ATOM   8674  C  "C3'" . DC  I 6  131  ? 215.000 145.219 180.733 1.00 132.41 ?  44   DC  I "C3'" 1 
ATOM   8675  O  "O3'" . DC  I 6  131  ? 214.588 145.289 179.365 1.00 131.38 ?  44   DC  I "O3'" 1 
ATOM   8676  C  "C2'" . DC  I 6  131  ? 215.265 146.609 181.285 1.00 132.34 ?  44   DC  I "C2'" 1 
ATOM   8677  C  "C1'" . DC  I 6  131  ? 213.885 147.041 181.742 1.00 132.54 ?  44   DC  I "C1'" 1 
ATOM   8678  N  N1    . DC  I 6  131  ? 213.889 148.030 182.830 1.00 132.48 ?  44   DC  I N1    1 
ATOM   8679  C  C2    . DC  I 6  131  ? 213.283 149.270 182.614 1.00 132.34 ?  44   DC  I C2    1 
ATOM   8680  O  O2    . DC  I 6  131  ? 212.760 149.498 181.512 1.00 132.32 ?  44   DC  I O2    1 
ATOM   8681  N  N3    . DC  I 6  131  ? 213.280 150.187 183.609 1.00 132.24 ?  44   DC  I N3    1 
ATOM   8682  C  C4    . DC  I 6  131  ? 213.854 149.901 184.781 1.00 132.33 ?  44   DC  I C4    1 
ATOM   8683  N  N4    . DC  I 6  131  ? 213.828 150.835 185.734 1.00 132.47 ?  44   DC  I N4    1 
ATOM   8684  C  C5    . DC  I 6  131  ? 214.479 148.645 185.026 1.00 132.23 ?  44   DC  I C5    1 
ATOM   8685  C  C6    . DC  I 6  131  ? 214.474 147.747 184.033 1.00 132.36 ?  44   DC  I C6    1 
ATOM   8686  P  P     . DC  I 6  132  ? 215.560 145.939 178.270 1.00 130.75 ?  45   DC  I P     1 
ATOM   8687  O  OP1   . DC  I 6  132  ? 215.375 145.199 176.996 1.00 130.18 ?  45   DC  I OP1   1 
ATOM   8688  O  OP2   . DC  I 6  132  ? 216.915 146.049 178.867 1.00 130.23 -1 45   DC  I OP2   1 
ATOM   8689  O  "O5'" . DC  I 6  132  ? 214.968 147.406 178.087 1.00 130.34 ?  45   DC  I "O5'" 1 
ATOM   8690  C  "C5'" . DC  I 6  132  ? 214.247 147.766 176.894 1.00 128.58 ?  45   DC  I "C5'" 1 
ATOM   8691  C  "C4'" . DC  I 6  132  ? 214.260 149.265 176.702 1.00 127.40 ?  45   DC  I "C4'" 1 
ATOM   8692  O  "O4'" . DC  I 6  132  ? 214.144 149.922 177.987 1.00 127.66 ?  45   DC  I "O4'" 1 
ATOM   8693  C  "C3'" . DC  I 6  132  ? 215.529 149.819 176.049 1.00 126.67 ?  45   DC  I "C3'" 1 
ATOM   8694  O  "O3'" . DC  I 6  132  ? 215.190 150.763 175.029 1.00 125.18 ?  45   DC  I "O3'" 1 
ATOM   8695  C  "C2'" . DC  I 6  132  ? 216.266 150.490 177.195 1.00 127.08 ?  45   DC  I "C2'" 1 
ATOM   8696  C  "C1'" . DC  I 6  132  ? 215.132 150.929 178.101 1.00 128.12 ?  45   DC  I "C1'" 1 
ATOM   8697  N  N1    . DC  I 6  132  ? 215.500 151.039 179.519 1.00 128.55 ?  45   DC  I N1    1 
ATOM   8698  C  C2    . DC  I 6  132  ? 214.678 151.777 180.374 1.00 128.69 ?  45   DC  I C2    1 
ATOM   8699  O  O2    . DC  I 6  132  ? 213.662 152.316 179.910 1.00 128.50 ?  45   DC  I O2    1 
ATOM   8700  N  N3    . DC  I 6  132  ? 215.008 151.884 181.681 1.00 128.78 ?  45   DC  I N3    1 
ATOM   8701  C  C4    . DC  I 6  132  ? 216.111 151.287 182.141 1.00 128.67 ?  45   DC  I C4    1 
ATOM   8702  N  N4    . DC  I 6  132  ? 216.399 151.419 183.439 1.00 128.56 ?  45   DC  I N4    1 
ATOM   8703  C  C5    . DC  I 6  132  ? 216.968 150.529 181.292 1.00 128.69 ?  45   DC  I C5    1 
ATOM   8704  C  C6    . DC  I 6  132  ? 216.628 150.432 180.000 1.00 128.72 ?  45   DC  I C6    1 
ATOM   8705  P  P     . DA  I 6  133  ? 214.893 147.749 173.861 1.00 20.00  ?  46   DA  I P     1 
ATOM   8706  O  OP1   . DA  I 6  133  ? 214.344 146.482 173.327 1.00 20.00  ?  46   DA  I OP1   1 
ATOM   8707  O  OP2   . DA  I 6  133  ? 216.353 147.901 174.043 1.00 20.00  -1 46   DA  I OP2   1 
ATOM   8708  O  "O5'" . DA  I 6  133  ? 214.387 148.962 172.947 1.00 20.00  ?  46   DA  I "O5'" 1 
ATOM   8709  C  "C5'" . DA  I 6  133  ? 212.993 149.175 172.751 1.00 20.00  ?  46   DA  I "C5'" 1 
ATOM   8710  C  "C4'" . DA  I 6  133  ? 212.554 150.506 173.340 1.00 20.00  ?  46   DA  I "C4'" 1 
ATOM   8711  O  "O4'" . DA  I 6  133  ? 213.057 150.631 174.699 1.00 20.00  ?  46   DA  I "O4'" 1 
ATOM   8712  C  "C3'" . DA  I 6  133  ? 213.058 151.746 172.602 1.00 20.00  ?  46   DA  I "C3'" 1 
ATOM   8713  O  "O3'" . DA  I 6  133  ? 212.084 152.775 172.690 1.00 20.00  ?  46   DA  I "O3'" 1 
ATOM   8714  C  "C2'" . DA  I 6  133  ? 214.307 152.108 173.397 1.00 20.00  ?  46   DA  I "C2'" 1 
ATOM   8715  C  "C1'" . DA  I 6  133  ? 213.824 151.812 174.805 1.00 20.00  ?  46   DA  I "C1'" 1 
ATOM   8716  N  N9    . DA  I 6  133  ? 214.900 151.583 175.768 1.00 20.00  ?  46   DA  I N9    1 
ATOM   8717  C  C8    . DA  I 6  133  ? 216.026 150.833 175.584 1.00 20.00  ?  46   DA  I C8    1 
ATOM   8718  N  N7    . DA  I 6  133  ? 216.816 150.800 176.633 1.00 20.00  ?  46   DA  I N7    1 
ATOM   8719  C  C5    . DA  I 6  133  ? 216.159 151.583 177.568 1.00 20.00  ?  46   DA  I C5    1 
ATOM   8720  C  C6    . DA  I 6  133  ? 216.475 151.945 178.894 1.00 20.00  ?  46   DA  I C6    1 
ATOM   8721  N  N6    . DA  I 6  133  ? 217.586 151.546 179.521 1.00 20.00  ?  46   DA  I N6    1 
ATOM   8722  N  N1    . DA  I 6  133  ? 215.603 152.739 179.552 1.00 20.00  ?  46   DA  I N1    1 
ATOM   8723  C  C2    . DA  I 6  133  ? 214.490 153.135 178.919 1.00 20.00  ?  46   DA  I C2    1 
ATOM   8724  N  N3    . DA  I 6  133  ? 214.087 152.859 177.679 1.00 20.00  ?  46   DA  I N3    1 
ATOM   8725  C  C4    . DA  I 6  133  ? 214.974 152.070 177.052 1.00 20.00  ?  46   DA  I C4    1 
ATOM   8726  P  P     . DG  I 6  134  ? 211.733 153.680 171.411 1.00 0.00   ?  47   DG  I P     1 
ATOM   8727  O  OP1   . DG  I 6  134  ? 210.730 152.945 170.609 1.00 0.00   ?  47   DG  I OP1   1 
ATOM   8728  O  OP2   . DG  I 6  134  ? 213.007 154.103 170.790 1.00 0.00   -1 47   DG  I OP2   1 
ATOM   8729  O  "O5'" . DG  I 6  134  ? 211.039 154.976 172.044 1.00 0.00   ?  47   DG  I "O5'" 1 
ATOM   8730  C  "C5'" . DG  I 6  134  ? 209.896 154.837 172.884 1.00 0.00   ?  47   DG  I "C5'" 1 
ATOM   8731  C  "C4'" . DG  I 6  134  ? 209.728 156.043 173.800 1.00 0.00   ?  47   DG  I "C4'" 1 
ATOM   8732  O  "O4'" . DG  I 6  134  ? 210.593 155.910 174.957 1.00 0.00   ?  47   DG  I "O4'" 1 
ATOM   8733  C  "C3'" . DG  I 6  134  ? 210.067 157.389 173.179 1.00 0.00   ?  47   DG  I "C3'" 1 
ATOM   8734  O  "O3'" . DG  I 6  134  ? 209.230 158.398 173.728 1.00 0.00   ?  47   DG  I "O3'" 1 
ATOM   8735  C  "C2'" . DG  I 6  134  ? 211.526 157.590 173.581 1.00 0.00   ?  47   DG  I "C2'" 1 
ATOM   8736  C  "C1'" . DG  I 6  134  ? 211.581 156.927 174.955 1.00 0.00   ?  47   DG  I "C1'" 1 
ATOM   8737  N  N9    . DG  I 6  134  ? 212.866 156.297 175.247 1.00 20.00  ?  47   DG  I N9    1 
ATOM   8738  C  C8    . DG  I 6  134  ? 213.518 155.368 174.474 1.00 20.00  ?  47   DG  I C8    1 
ATOM   8739  N  N7    . DG  I 6  134  ? 214.645 154.966 174.984 1.00 20.00  ?  47   DG  I N7    1 
ATOM   8740  C  C5    . DG  I 6  134  ? 214.750 155.665 176.178 1.00 20.00  ?  47   DG  I C5    1 
ATOM   8741  C  C6    . DG  I 6  134  ? 215.767 155.635 177.159 1.00 20.00  ?  47   DG  I C6    1 
ATOM   8742  O  O6    . DG  I 6  134  ? 216.805 154.962 177.164 1.00 20.00  ?  47   DG  I O6    1 
ATOM   8743  N  N1    . DG  I 6  134  ? 215.489 156.496 178.218 1.00 20.00  ?  47   DG  I N1    1 
ATOM   8744  C  C2    . DG  I 6  134  ? 214.369 157.289 178.315 1.00 20.00  ?  47   DG  I C2    1 
ATOM   8745  N  N2    . DG  I 6  134  ? 214.275 158.057 179.414 1.00 20.00  ?  47   DG  I N2    1 
ATOM   8746  N  N3    . DG  I 6  134  ? 213.404 157.326 177.399 1.00 20.00  ?  47   DG  I N3    1 
ATOM   8747  C  C4    . DG  I 6  134  ? 213.662 156.489 176.359 1.00 20.00  ?  47   DG  I C4    1 
ATOM   8748  P  P     . DG  I 6  135  ? 209.312 159.907 173.183 1.00 0.00   ?  48   DG  I P     1 
ATOM   8749  O  OP1   . DG  I 6  135  ? 207.985 160.528 173.388 1.00 0.00   ?  48   DG  I OP1   1 
ATOM   8750  O  OP2   . DG  I 6  135  ? 209.903 159.865 171.826 1.00 0.00   -1 48   DG  I OP2   1 
ATOM   8751  O  "O5'" . DG  I 6  135  ? 210.366 160.611 174.159 1.00 0.00   ?  48   DG  I "O5'" 1 
ATOM   8752  C  "C5'" . DG  I 6  135  ? 210.098 160.682 175.555 1.00 0.00   ?  48   DG  I "C5'" 1 
ATOM   8753  C  "C4'" . DG  I 6  135  ? 211.218 161.397 176.292 1.00 0.00   ?  48   DG  I "C4'" 1 
ATOM   8754  O  "O4'" . DG  I 6  135  ? 212.333 160.487 176.493 1.00 0.00   ?  48   DG  I "O4'" 1 
ATOM   8755  C  "C3'" . DG  I 6  135  ? 211.788 162.623 175.580 1.00 0.00   ?  48   DG  I "C3'" 1 
ATOM   8756  O  "O3'" . DG  I 6  135  ? 212.004 163.663 176.522 1.00 0.00   ?  48   DG  I "O3'" 1 
ATOM   8757  C  "C2'" . DG  I 6  135  ? 213.105 162.108 175.000 1.00 0.00   ?  48   DG  I "C2'" 1 
ATOM   8758  C  "C1'" . DG  I 6  135  ? 213.526 161.100 176.056 1.00 0.00   ?  48   DG  I "C1'" 1 
ATOM   8759  N  N9    . DG  I 6  135  ? 214.416 160.058 175.554 1.00 20.00  ?  48   DG  I N9    1 
ATOM   8760  C  C8    . DG  I 6  135  ? 214.224 159.272 174.446 1.00 20.00  ?  48   DG  I C8    1 
ATOM   8761  N  N7    . DG  I 6  135  ? 215.182 158.413 174.243 1.00 20.00  ?  48   DG  I N7    1 
ATOM   8762  C  C5    . DG  I 6  135  ? 216.070 158.642 175.283 1.00 20.00  ?  48   DG  I C5    1 
ATOM   8763  C  C6    . DG  I 6  135  ? 217.301 158.014 175.586 1.00 20.00  ?  48   DG  I C6    1 
ATOM   8764  O  O6    . DG  I 6  135  ? 217.864 157.098 174.972 1.00 20.00  ?  48   DG  I O6    1 
ATOM   8765  N  N1    . DG  I 6  135  ? 217.884 158.547 176.731 1.00 20.00  ?  48   DG  I N1    1 
ATOM   8766  C  C2    . DG  I 6  135  ? 217.347 159.564 177.488 1.00 20.00  ?  48   DG  I C2    1 
ATOM   8767  N  N2    . DG  I 6  135  ? 218.055 159.947 178.562 1.00 20.00  ?  48   DG  I N2    1 
ATOM   8768  N  N3    . DG  I 6  135  ? 216.193 160.161 177.216 1.00 20.00  ?  48   DG  I N3    1 
ATOM   8769  C  C4    . DG  I 6  135  ? 215.613 159.652 176.103 1.00 20.00  ?  48   DG  I C4    1 
ATOM   8770  P  P     . DC  I 6  136  ? 212.133 165.190 176.038 1.00 0.00   ?  49   DC  I P     1 
ATOM   8771  O  OP1   . DC  I 6  136  ? 211.038 165.952 176.677 1.00 0.00   ?  49   DC  I OP1   1 
ATOM   8772  O  OP2   . DC  I 6  136  ? 212.267 165.195 174.564 1.00 0.00   -1 49   DC  I OP2   1 
ATOM   8773  O  "O5'" . DC  I 6  136  ? 213.524 165.665 176.667 1.00 0.00   ?  49   DC  I "O5'" 1 
ATOM   8774  C  "C5'" . DC  I 6  136  ? 213.762 165.501 178.061 1.00 0.00   ?  49   DC  I "C5'" 1 
ATOM   8775  C  "C4'" . DC  I 6  136  ? 215.245 165.585 178.376 1.00 0.00   ?  49   DC  I "C4'" 1 
ATOM   8776  O  "O4'" . DC  I 6  136  ? 215.916 164.381 177.914 1.00 0.00   ?  49   DC  I "O4'" 1 
ATOM   8777  C  "C3'" . DC  I 6  136  ? 215.981 166.759 177.727 1.00 0.00   ?  49   DC  I "C3'" 1 
ATOM   8778  O  "O3'" . DC  I 6  136  ? 216.869 167.355 178.666 1.00 0.00   ?  49   DC  I "O3'" 1 
ATOM   8779  C  "C2'" . DC  I 6  136  ? 216.738 166.101 176.574 1.00 0.00   ?  49   DC  I "C2'" 1 
ATOM   8780  C  "C1'" . DC  I 6  136  ? 217.056 164.738 177.169 1.00 0.00   ?  49   DC  I "C1'" 1 
ATOM   8781  N  N1    . DC  I 6  136  ? 217.307 163.682 176.145 1.00 20.00  ?  49   DC  I N1    1 
ATOM   8782  C  C2    . DC  I 6  136  ? 218.498 162.944 176.183 1.00 20.00  ?  49   DC  I C2    1 
ATOM   8783  O  O2    . DC  I 6  136  ? 219.330 163.182 177.068 1.00 20.00  ?  49   DC  I O2    1 
ATOM   8784  N  N3    . DC  I 6  136  ? 218.707 161.989 175.244 1.00 20.00  ?  49   DC  I N3    1 
ATOM   8785  C  C4    . DC  I 6  136  ? 217.788 161.761 174.305 1.00 20.00  ?  49   DC  I C4    1 
ATOM   8786  N  N4    . DC  I 6  136  ? 218.040 160.808 173.400 1.00 20.00  ?  49   DC  I N4    1 
ATOM   8787  C  C5    . DC  I 6  136  ? 216.572 162.502 174.249 1.00 20.00  ?  49   DC  I C5    1 
ATOM   8788  C  C6    . DC  I 6  136  ? 216.375 163.442 175.180 1.00 20.00  ?  49   DC  I C6    1 
ATOM   8789  P  P     . DA  I 6  137  ? 217.248 168.912 178.549 1.00 0.00   ?  50   DA  I P     1 
ATOM   8790  O  OP1   . DA  I 6  137  ? 216.812 169.577 179.798 1.00 0.00   ?  50   DA  I OP1   1 
ATOM   8791  O  OP2   . DA  I 6  137  ? 216.749 169.399 177.245 1.00 0.00   -1 50   DA  I OP2   1 
ATOM   8792  O  "O5'" . DA  I 6  137  ? 218.847 168.912 178.490 1.00 0.00   ?  50   DA  I "O5'" 1 
ATOM   8793  C  "C5'" . DA  I 6  137  ? 219.520 167.966 177.673 1.00 0.00   ?  50   DA  I "C5'" 1 
ATOM   8794  C  "C4'" . DA  I 6  137  ? 220.997 168.291 177.552 1.00 0.00   ?  50   DA  I "C4'" 1 
ATOM   8795  O  "O4'" . DA  I 6  137  ? 221.670 167.183 176.915 1.00 0.00   ?  50   DA  I "O4'" 1 
ATOM   8796  C  "C3'" . DA  I 6  137  ? 221.318 169.482 176.673 1.00 0.00   ?  50   DA  I "C3'" 1 
ATOM   8797  O  "O3'" . DA  I 6  137  ? 222.618 169.973 176.984 1.00 0.00   ?  50   DA  I "O3'" 1 
ATOM   8798  C  "C2'" . DA  I 6  137  ? 221.273 168.860 175.282 1.00 0.00   ?  50   DA  I "C2'" 1 
ATOM   8799  C  "C1'" . DA  I 6  137  ? 221.846 167.464 175.535 1.00 0.00   ?  50   DA  I "C1'" 1 
ATOM   8800  N  N9    . DA  I 6  137  ? 221.178 166.419 174.766 1.00 0.00   ?  50   DA  I N9    1 
ATOM   8801  C  C8    . DA  I 6  137  ? 219.851 166.354 174.444 1.00 0.00   ?  50   DA  I C8    1 
ATOM   8802  N  N7    . DA  I 6  137  ? 219.528 165.296 173.738 1.00 0.00   ?  50   DA  I N7    1 
ATOM   8803  C  C5    . DA  I 6  137  ? 220.728 164.620 173.589 1.00 0.00   ?  50   DA  I C5    1 
ATOM   8804  C  C6    . DA  I 6  137  ? 221.064 163.419 172.936 1.00 0.00   ?  50   DA  I C6    1 
ATOM   8805  N  N6    . DA  I 6  137  ? 220.175 162.660 172.288 1.00 0.00   ?  50   DA  I N6    1 
ATOM   8806  N  N1    . DA  I 6  137  ? 222.356 163.026 172.972 1.00 0.00   ?  50   DA  I N1    1 
ATOM   8807  C  C2    . DA  I 6  137  ? 223.241 163.789 173.624 1.00 0.00   ?  50   DA  I C2    1 
ATOM   8808  N  N3    . DA  I 6  137  ? 223.045 164.936 174.271 1.00 0.00   ?  50   DA  I N3    1 
ATOM   8809  C  C4    . DA  I 6  137  ? 221.755 165.299 174.215 1.00 0.00   ?  50   DA  I C4    1 
ATOM   8810  P  P     . DC  I 6  138  ? 223.288 171.130 176.093 1.00 0.00   ?  51   DC  I P     1 
ATOM   8811  O  OP1   . DC  I 6  138  ? 224.237 171.859 176.963 1.00 0.00   ?  51   DC  I OP1   1 
ATOM   8812  O  OP2   . DC  I 6  138  ? 222.205 171.876 175.413 1.00 0.00   -1 51   DC  I OP2   1 
ATOM   8813  O  "O5'" . DC  I 6  138  ? 224.120 170.330 174.984 1.00 0.00   ?  51   DC  I "O5'" 1 
ATOM   8814  C  "C5'" . DC  I 6  138  ? 225.161 169.445 175.383 1.00 0.00   ?  51   DC  I "C5'" 1 
ATOM   8815  C  "C4'" . DC  I 6  138  ? 225.836 168.807 174.179 1.00 0.00   ?  51   DC  I "C4'" 1 
ATOM   8816  O  "O4'" . DC  I 6  138  ? 225.000 167.745 173.645 1.00 0.00   ?  51   DC  I "O4'" 1 
ATOM   8817  C  "C3'" . DC  I 6  138  ? 226.122 169.751 173.005 1.00 0.00   ?  51   DC  I "C3'" 1 
ATOM   8818  O  "O3'" . DC  I 6  138  ? 227.426 169.497 172.499 1.00 0.00   ?  51   DC  I "O3'" 1 
ATOM   8819  C  "C2'" . DC  I 6  138  ? 225.048 169.364 171.987 1.00 0.00   ?  51   DC  I "C2'" 1 
ATOM   8820  C  "C1'" . DC  I 6  138  ? 224.951 167.873 172.244 1.00 0.00   ?  51   DC  I "C1'" 1 
ATOM   8821  N  N1    . DC  I 6  138  ? 223.692 167.245 171.748 1.00 20.00  ?  51   DC  I N1    1 
ATOM   8822  C  C2    . DC  I 6  138  ? 223.753 166.011 171.090 1.00 20.00  ?  51   DC  I C2    1 
ATOM   8823  O  O2    . DC  I 6  138  ? 224.852 165.468 170.928 1.00 20.00  ?  51   DC  I O2    1 
ATOM   8824  N  N3    . DC  I 6  138  ? 222.604 165.445 170.644 1.00 20.00  ?  51   DC  I N3    1 
ATOM   8825  C  C4    . DC  I 6  138  ? 221.438 166.064 170.837 1.00 20.00  ?  51   DC  I C4    1 
ATOM   8826  N  N4    . DC  I 6  138  ? 220.330 165.467 170.382 1.00 20.00  ?  51   DC  I N4    1 
ATOM   8827  C  C5    . DC  I 6  138  ? 221.355 167.321 171.508 1.00 20.00  ?  51   DC  I C5    1 
ATOM   8828  C  C6    . DC  I 6  138  ? 222.496 167.869 171.941 1.00 20.00  ?  51   DC  I C6    1 
ATOM   8829  P  P     . DG  I 6  139  ? 228.233 170.634 171.699 1.00 0.00   ?  52   DG  I P     1 
ATOM   8830  O  OP1   . DG  I 6  139  ? 229.183 171.256 172.646 1.00 0.00   ?  52   DG  I OP1   1 
ATOM   8831  O  OP2   . DG  I 6  139  ? 227.248 171.478 170.986 1.00 0.00   -1 52   DG  I OP2   1 
ATOM   8832  O  "O5'" . DG  I 6  139  ? 229.059 169.810 170.604 1.00 0.00   ?  52   DG  I "O5'" 1 
ATOM   8833  C  "C5'" . DG  I 6  139  ? 229.989 168.810 171.014 1.00 0.00   ?  52   DG  I "C5'" 1 
ATOM   8834  C  "C4'" . DG  I 6  139  ? 230.211 167.783 169.914 1.00 0.00   ?  52   DG  I "C4'" 1 
ATOM   8835  O  "O4'" . DG  I 6  139  ? 228.994 167.019 169.707 1.00 0.00   ?  52   DG  I "O4'" 1 
ATOM   8836  C  "C3'" . DG  I 6  139  ? 230.591 168.359 168.553 1.00 0.00   ?  52   DG  I "C3'" 1 
ATOM   8837  O  "O3'" . DG  I 6  139  ? 231.558 167.530 167.923 1.00 0.00   ?  52   DG  I "O3'" 1 
ATOM   8838  C  "C2'" . DG  I 6  139  ? 229.269 168.356 167.790 1.00 0.00   ?  52   DG  I "C2'" 1 
ATOM   8839  C  "C1'" . DG  I 6  139  ? 228.570 167.129 168.362 1.00 0.00   ?  52   DG  I "C1'" 1 
ATOM   8840  N  N9    . DG  I 6  139  ? 227.114 167.239 168.356 1.00 20.00  ?  52   DG  I N9    1 
ATOM   8841  C  C8    . DG  I 6  139  ? 226.355 168.132 169.072 1.00 20.00  ?  52   DG  I C8    1 
ATOM   8842  N  N7    . DG  I 6  139  ? 225.074 168.005 168.870 1.00 20.00  ?  52   DG  I N7    1 
ATOM   8843  C  C5    . DG  I 6  139  ? 224.973 166.954 167.969 1.00 20.00  ?  52   DG  I C5    1 
ATOM   8844  C  C6    . DG  I 6  139  ? 223.827 166.362 167.388 1.00 20.00  ?  52   DG  I C6    1 
ATOM   8845  O  O6    . DG  I 6  139  ? 222.638 166.662 167.564 1.00 20.00  ?  52   DG  I O6    1 
ATOM   8846  N  N1    . DG  I 6  139  ? 224.163 165.323 166.526 1.00 20.00  ?  52   DG  I N1    1 
ATOM   8847  C  C2    . DG  I 6  139  ? 225.447 164.909 166.253 1.00 20.00  ?  52   DG  I C2    1 
ATOM   8848  N  N2    . DG  I 6  139  ? 225.576 163.884 165.396 1.00 20.00  ?  52   DG  I N2    1 
ATOM   8849  N  N3    . DG  I 6  139  ? 226.533 165.453 166.797 1.00 20.00  ?  52   DG  I N3    1 
ATOM   8850  C  C4    . DG  I 6  139  ? 226.221 166.468 167.641 1.00 20.00  ?  52   DG  I C4    1 
ATOM   8851  P  P     . DT  I 6  140  ? 232.281 168.017 166.573 1.00 0.00   ?  53   DT  I P     1 
ATOM   8852  O  OP1   . DT  I 6  140  ? 233.611 167.373 166.520 1.00 0.00   ?  53   DT  I OP1   1 
ATOM   8853  O  OP2   . DT  I 6  140  ? 232.174 169.492 166.515 1.00 0.00   -1 53   DT  I OP2   1 
ATOM   8854  O  "O5'" . DT  I 6  140  ? 231.366 167.412 165.407 1.00 0.00   ?  53   DT  I "O5'" 1 
ATOM   8855  C  "C5'" . DT  I 6  140  ? 231.209 166.003 165.289 1.00 0.00   ?  53   DT  I "C5'" 1 
ATOM   8856  C  "C4'" . DT  I 6  140  ? 230.426 165.647 164.037 1.00 0.00   ?  53   DT  I "C4'" 1 
ATOM   8857  O  "O4'" . DT  I 6  140  ? 229.002 165.716 164.311 1.00 0.00   ?  53   DT  I "O4'" 1 
ATOM   8858  C  "C3'" . DT  I 6  140  ? 230.678 166.559 162.833 1.00 0.00   ?  53   DT  I "C3'" 1 
ATOM   8859  O  "O3'" . DT  I 6  140  ? 230.931 165.770 161.676 1.00 0.00   ?  53   DT  I "O3'" 1 
ATOM   8860  C  "C2'" . DT  I 6  140  ? 229.378 167.355 162.701 1.00 0.00   ?  53   DT  I "C2'" 1 
ATOM   8861  C  "C1'" . DT  I 6  140  ? 228.355 166.375 163.249 1.00 0.00   ?  53   DT  I "C1'" 1 
ATOM   8862  N  N1    . DT  I 6  140  ? 227.127 167.031 163.786 1.00 20.00  ?  53   DT  I N1    1 
ATOM   8863  C  C2    . DT  I 6  140  ? 225.891 166.612 163.349 1.00 20.00  ?  53   DT  I C2    1 
ATOM   8864  O  O2    . DT  I 6  140  ? 225.736 165.723 162.531 1.00 20.00  ?  53   DT  I O2    1 
ATOM   8865  N  N3    . DT  I 6  140  ? 224.832 167.279 163.909 1.00 20.00  ?  53   DT  I N3    1 
ATOM   8866  C  C4    . DT  I 6  140  ? 224.886 168.299 164.841 1.00 20.00  ?  53   DT  I C4    1 
ATOM   8867  O  O4    . DT  I 6  140  ? 223.878 168.837 165.287 1.00 20.00  ?  53   DT  I O4    1 
ATOM   8868  C  C5    . DT  I 6  140  ? 226.211 168.688 165.255 1.00 20.00  ?  53   DT  I C5    1 
ATOM   8869  C  C7    . DT  I 6  140  ? 226.389 169.787 166.258 1.00 20.00  ?  53   DT  I C7    1 
ATOM   8870  C  C6    . DT  I 6  140  ? 227.255 168.042 164.717 1.00 20.00  ?  53   DT  I C6    1 
ATOM   8871  P  P     . DG  I 6  141  ? 231.360 166.466 160.294 1.00 0.00   ?  54   DG  I P     1 
ATOM   8872  O  OP1   . DG  I 6  141  ? 232.368 165.592 159.650 1.00 0.00   ?  54   DG  I OP1   1 
ATOM   8873  O  OP2   . DG  I 6  141  ? 231.693 167.881 160.574 1.00 0.00   -1 54   DG  I OP2   1 
ATOM   8874  O  "O5'" . DG  I 6  141  ? 230.020 166.434 159.422 1.00 0.00   ?  54   DG  I "O5'" 1 
ATOM   8875  C  "C5'" . DG  I 6  141  ? 229.373 165.192 159.161 1.00 0.00   ?  54   DG  I "C5'" 1 
ATOM   8876  C  "C4'" . DG  I 6  141  ? 228.078 165.403 158.396 1.00 0.00   ?  54   DG  I "C4'" 1 
ATOM   8877  O  "O4'" . DG  I 6  141  ? 227.041 165.864 159.304 1.00 0.00   ?  54   DG  I "O4'" 1 
ATOM   8878  C  "C3'" . DG  I 6  141  ? 228.152 166.443 157.277 1.00 0.00   ?  54   DG  I "C3'" 1 
ATOM   8879  O  "O3'" . DG  I 6  141  ? 227.422 165.991 156.145 1.00 0.00   ?  54   DG  I "O3'" 1 
ATOM   8880  C  "C2'" . DG  I 6  141  ? 227.498 167.668 157.907 1.00 0.00   ?  54   DG  I "C2'" 1 
ATOM   8881  C  "C1'" . DG  I 6  141  ? 226.436 167.021 158.774 1.00 0.00   ?  54   DG  I "C1'" 1 
ATOM   8882  N  N9    . DG  I 6  141  ? 225.987 167.860 159.879 1.00 20.00  ?  54   DG  I N9    1 
ATOM   8883  C  C8    . DG  I 6  141  ? 226.773 168.511 160.799 1.00 20.00  ?  54   DG  I C8    1 
ATOM   8884  N  N7    . DG  I 6  141  ? 226.089 169.185 161.682 1.00 20.00  ?  54   DG  I N7    1 
ATOM   8885  C  C5    . DG  I 6  141  ? 224.764 168.967 161.325 1.00 20.00  ?  54   DG  I C5    1 
ATOM   8886  C  C6    . DG  I 6  141  ? 223.569 169.439 161.917 1.00 20.00  ?  54   DG  I C6    1 
ATOM   8887  O  O6    . DG  I 6  141  ? 223.441 170.173 162.907 1.00 20.00  ?  54   DG  I O6    1 
ATOM   8888  N  N1    . DG  I 6  141  ? 222.443 168.981 161.239 1.00 20.00  ?  54   DG  I N1    1 
ATOM   8889  C  C2    . DG  I 6  141  ? 222.468 168.164 160.130 1.00 20.00  ?  54   DG  I C2    1 
ATOM   8890  N  N2    . DG  I 6  141  ? 221.281 167.820 159.611 1.00 20.00  ?  54   DG  I N2    1 
ATOM   8891  N  N3    . DG  I 6  141  ? 223.581 167.713 159.569 1.00 20.00  ?  54   DG  I N3    1 
ATOM   8892  C  C4    . DG  I 6  141  ? 224.686 168.152 160.218 1.00 20.00  ?  54   DG  I C4    1 
ATOM   8893  P  P     . DT  I 6  142  ? 228.178 165.250 154.935 1.00 0.00   ?  55   DT  I P     1 
ATOM   8894  O  OP1   . DT  I 6  142  ? 228.308 163.821 155.299 1.00 0.00   ?  55   DT  I OP1   1 
ATOM   8895  O  OP2   . DT  I 6  142  ? 229.387 166.040 154.612 1.00 0.00   -1 55   DT  I OP2   1 
ATOM   8896  O  "O5'" . DT  I 6  142  ? 227.162 165.381 153.708 1.00 0.00   ?  55   DT  I "O5'" 1 
ATOM   8897  C  "C5'" . DT  I 6  142  ? 227.073 166.606 152.984 1.00 0.00   ?  55   DT  I "C5'" 1 
ATOM   8898  C  "C4'" . DT  I 6  142  ? 225.625 167.019 152.794 1.00 0.00   ?  55   DT  I "C4'" 1 
ATOM   8899  O  "O4'" . DT  I 6  142  ? 225.136 167.639 154.013 1.00 0.00   ?  55   DT  I "O4'" 1 
ATOM   8900  C  "C3'" . DT  I 6  142  ? 225.393 168.053 151.701 1.00 0.00   ?  55   DT  I "C3'" 1 
ATOM   8901  O  "O3'" . DT  I 6  142  ? 224.068 167.930 151.196 1.00 0.00   ?  55   DT  I "O3'" 1 
ATOM   8902  C  "C2'" . DT  I 6  142  ? 225.575 169.357 152.466 1.00 0.00   ?  55   DT  I "C2'" 1 
ATOM   8903  C  "C1'" . DT  I 6  142  ? 224.886 169.016 153.782 1.00 0.00   ?  55   DT  I "C1'" 1 
ATOM   8904  N  N1    . DT  I 6  142  ? 225.397 169.790 154.953 1.00 20.00  ?  55   DT  I N1    1 
ATOM   8905  C  C2    . DT  I 6  142  ? 224.500 170.409 155.794 1.00 20.00  ?  55   DT  I C2    1 
ATOM   8906  O  O2    . DT  I 6  142  ? 223.294 170.372 155.628 1.00 20.00  ?  55   DT  I O2    1 
ATOM   8907  N  N3    . DT  I 6  142  ? 225.068 171.088 156.839 1.00 20.00  ?  55   DT  I N3    1 
ATOM   8908  C  C4    . DT  I 6  142  ? 226.419 171.201 157.125 1.00 20.00  ?  55   DT  I C4    1 
ATOM   8909  O  O4    . DT  I 6  142  ? 226.834 171.833 158.092 1.00 20.00  ?  55   DT  I O4    1 
ATOM   8910  C  C5    . DT  I 6  142  ? 227.304 170.527 156.204 1.00 20.00  ?  55   DT  I C5    1 
ATOM   8911  C  C7    . DT  I 6  142  ? 228.790 170.579 156.412 1.00 20.00  ?  55   DT  I C7    1 
ATOM   8912  C  C6    . DT  I 6  142  ? 226.756 169.859 155.177 1.00 20.00  ?  55   DT  I C6    1 
ATOM   8913  P  P     . DC  I 6  143  ? 223.709 168.445 149.719 1.00 0.00   ?  56   DC  I P     1 
ATOM   8914  O  OP1   . DC  I 6  143  ? 223.330 167.262 148.914 1.00 0.00   ?  56   DC  I OP1   1 
ATOM   8915  O  OP2   . DC  I 6  143  ? 224.812 169.320 149.263 1.00 0.00   -1 56   DC  I OP2   1 
ATOM   8916  O  "O5'" . DC  I 6  143  ? 222.412 169.357 149.936 1.00 0.00   ?  56   DC  I "O5'" 1 
ATOM   8917  C  "C5'" . DC  I 6  143  ? 221.200 168.772 150.399 1.00 0.00   ?  56   DC  I "C5'" 1 
ATOM   8918  C  "C4'" . DC  I 6  143  ? 220.224 169.838 150.878 1.00 0.00   ?  56   DC  I "C4'" 1 
ATOM   8919  O  "O4'" . DC  I 6  143  ? 220.701 170.417 152.122 1.00 0.00   ?  56   DC  I "O4'" 1 
ATOM   8920  C  "C3'" . DC  I 6  143  ? 220.016 171.011 149.921 1.00 0.00   ?  56   DC  I "C3'" 1 
ATOM   8921  O  "O3'" . DC  I 6  143  ? 218.654 171.416 149.950 1.00 0.00   ?  56   DC  I "O3'" 1 
ATOM   8922  C  "C2'" . DC  I 6  143  ? 220.926 172.087 150.507 1.00 0.00   ?  56   DC  I "C2'" 1 
ATOM   8923  C  "C1'" . DC  I 6  143  ? 220.764 171.821 151.995 1.00 0.00   ?  56   DC  I "C1'" 1 
ATOM   8924  N  N1    . DC  I 6  143  ? 221.898 172.318 152.824 1.00 20.00  ?  56   DC  I N1    1 
ATOM   8925  C  C2    . DC  I 6  143  ? 221.638 173.091 153.962 1.00 20.00  ?  56   DC  I C2    1 
ATOM   8926  O  O2    . DC  I 6  143  ? 220.466 173.356 154.254 1.00 20.00  ?  56   DC  I O2    1 
ATOM   8927  N  N3    . DC  I 6  143  ? 222.680 173.531 154.710 1.00 20.00  ?  56   DC  I N3    1 
ATOM   8928  C  C4    . DC  I 6  143  ? 223.930 173.225 154.356 1.00 20.00  ?  56   DC  I C4    1 
ATOM   8929  N  N4    . DC  I 6  143  ? 224.929 173.676 155.122 1.00 20.00  ?  56   DC  I N4    1 
ATOM   8930  C  C5    . DC  I 6  143  ? 224.213 172.438 153.202 1.00 20.00  ?  56   DC  I C5    1 
ATOM   8931  C  C6    . DC  I 6  143  ? 223.178 172.008 152.474 1.00 20.00  ?  56   DC  I C6    1 
ATOM   8932  P  P     . DA  I 6  144  ? 217.883 171.775 148.588 1.00 0.00   ?  57   DA  I P     1 
ATOM   8933  O  OP1   . DA  I 6  144  ? 217.186 170.553 148.126 1.00 0.00   ?  57   DA  I OP1   1 
ATOM   8934  O  OP2   . DA  I 6  144  ? 218.844 172.454 147.691 1.00 0.00   -1 57   DA  I OP2   1 
ATOM   8935  O  "O5'" . DA  I 6  144  ? 216.791 172.853 149.042 1.00 0.00   ?  57   DA  I "O5'" 1 
ATOM   8936  C  "C5'" . DA  I 6  144  ? 217.180 174.202 149.277 1.00 0.00   ?  57   DA  I "C5'" 1 
ATOM   8937  C  "C4'" . DA  I 6  144  ? 216.315 174.842 150.348 1.00 0.00   ?  57   DA  I "C4'" 1 
ATOM   8938  O  "O4'" . DA  I 6  144  ? 217.037 174.846 151.605 1.00 0.00   ?  57   DA  I "O4'" 1 
ATOM   8939  C  "C3'" . DA  I 6  144  ? 215.979 176.300 150.100 1.00 0.00   ?  57   DA  I "C3'" 1 
ATOM   8940  O  "O3'" . DA  I 6  144  ? 214.822 176.666 150.847 1.00 0.00   ?  57   DA  I "O3'" 1 
ATOM   8941  C  "C2'" . DA  I 6  144  ? 217.227 176.990 150.631 1.00 0.00   ?  57   DA  I "C2'" 1 
ATOM   8942  C  "C1'" . DA  I 6  144  ? 217.557 176.144 151.855 1.00 0.00   ?  57   DA  I "C1'" 1 
ATOM   8943  N  N9    . DA  I 6  144  ? 218.990 176.019 152.114 1.00 20.00  ?  57   DA  I N9    1 
ATOM   8944  C  C8    . DA  I 6  144  ? 219.864 175.179 151.486 1.00 20.00  ?  57   DA  I C8    1 
ATOM   8945  N  N7    . DA  I 6  144  ? 221.095 175.270 151.924 1.00 20.00  ?  57   DA  I N7    1 
ATOM   8946  C  C5    . DA  I 6  144  ? 221.027 176.236 152.914 1.00 20.00  ?  57   DA  I C5    1 
ATOM   8947  C  C6    . DA  I 6  144  ? 222.004 176.790 153.764 1.00 20.00  ?  57   DA  I C6    1 
ATOM   8948  N  N6    . DA  I 6  144  ? 223.289 176.424 153.744 1.00 20.00  ?  57   DA  I N6    1 
ATOM   8949  N  N1    . DA  I 6  144  ? 221.608 177.739 154.641 1.00 20.00  ?  57   DA  I N1    1 
ATOM   8950  C  C2    . DA  I 6  144  ? 220.318 178.105 154.654 1.00 20.00  ?  57   DA  I C2    1 
ATOM   8951  N  N3    . DA  I 6  144  ? 219.309 177.653 153.905 1.00 20.00  ?  57   DA  I N3    1 
ATOM   8952  C  C4    . DA  I 6  144  ? 219.736 176.712 153.045 1.00 20.00  ?  57   DA  I C4    1 
ATOM   8953  P  P     . DG  I 6  145  ? 214.057 178.048 150.538 1.00 0.00   ?  58   DG  I P     1 
ATOM   8954  O  OP1   . DG  I 6  145  ? 213.970 178.797 151.812 1.00 0.00   ?  58   DG  I OP1   1 
ATOM   8955  O  OP2   . DG  I 6  145  ? 212.816 177.716 149.801 1.00 0.00   -1 58   DG  I OP2   1 
ATOM   8956  O  "O5'" . DG  I 6  145  ? 215.034 178.812 149.524 1.00 0.00   ?  58   DG  I "O5'" 1 
ATOM   8957  C  "C5'" . DG  I 6  145  ? 214.941 180.224 149.357 1.00 0.00   ?  58   DG  I "C5'" 1 
ATOM   8958  C  "C4'" . DG  I 6  145  ? 215.792 180.951 150.386 1.00 0.00   ?  58   DG  I "C4'" 1 
ATOM   8959  O  "O4'" . DG  I 6  145  ? 216.936 180.141 150.733 1.00 0.00   ?  58   DG  I "O4'" 1 
ATOM   8960  C  "C3'" . DG  I 6  145  ? 216.353 182.303 149.926 1.00 0.00   ?  58   DG  I "C3'" 1 
ATOM   8961  O  "O3'" . DG  I 6  145  ? 215.821 183.357 150.719 1.00 0.00   ?  58   DG  I "O3'" 1 
ATOM   8962  C  "C2'" . DG  I 6  145  ? 217.872 182.174 150.112 1.00 0.00   ?  58   DG  I "C2'" 1 
ATOM   8963  C  "C1'" . DG  I 6  145  ? 217.994 180.999 151.065 1.00 0.00   ?  58   DG  I "C1'" 1 
ATOM   8964  N  N9    . DG  I 6  145  ? 219.255 180.276 150.929 1.00 20.00  ?  58   DG  I N9    1 
ATOM   8965  C  C8    . DG  I 6  145  ? 219.532 179.232 150.083 1.00 20.00  ?  58   DG  I C8    1 
ATOM   8966  N  N7    . DG  I 6  145  ? 220.757 178.794 150.180 1.00 20.00  ?  58   DG  I N7    1 
ATOM   8967  C  C5    . DG  I 6  145  ? 221.331 179.609 151.146 1.00 20.00  ?  58   DG  I C5    1 
ATOM   8968  C  C6    . DG  I 6  145  ? 222.644 179.614 151.674 1.00 20.00  ?  58   DG  I C6    1 
ATOM   8969  O  O6    . DG  I 6  145  ? 223.596 178.878 151.383 1.00 20.00  ?  58   DG  I O6    1 
ATOM   8970  N  N1    . DG  I 6  145  ? 222.805 180.607 152.637 1.00 20.00  ?  58   DG  I N1    1 
ATOM   8971  C  C2    . DG  I 6  145  ? 221.825 181.483 153.037 1.00 20.00  ?  58   DG  I C2    1 
ATOM   8972  N  N2    . DG  I 6  145  ? 222.165 182.375 153.978 1.00 20.00  ?  58   DG  I N2    1 
ATOM   8973  N  N3    . DG  I 6  145  ? 220.594 181.488 152.551 1.00 20.00  ?  58   DG  I N3    1 
ATOM   8974  C  C4    . DG  I 6  145  ? 220.419 180.527 151.614 1.00 20.00  ?  58   DG  I C4    1 
ATOM   8975  P  P     . DA  I 6  146  ? 215.946 184.879 150.220 1.00 0.00   ?  59   DA  I P     1 
ATOM   8976  O  OP1   . DA  I 6  146  ? 214.976 185.686 150.992 1.00 0.00   ?  59   DA  I OP1   1 
ATOM   8977  O  OP2   . DA  I 6  146  ? 215.885 184.868 148.742 1.00 0.00   -1 59   DA  I OP2   1 
ATOM   8978  O  "O5'" . DA  I 6  146  ? 217.430 185.309 150.645 1.00 0.00   ?  59   DA  I "O5'" 1 
ATOM   8979  C  "C5'" . DA  I 6  146  ? 217.770 185.425 152.022 1.00 0.00   ?  59   DA  I "C5'" 1 
ATOM   8980  C  "C4'" . DA  I 6  146  ? 219.159 186.016 152.197 1.00 0.00   ?  59   DA  I "C4'" 1 
ATOM   8981  O  "O4'" . DA  I 6  146  ? 220.157 184.965 152.132 1.00 0.00   ?  59   DA  I "O4'" 1 
ATOM   8982  C  "C3'" . DA  I 6  146  ? 219.568 187.061 151.154 1.00 0.00   ?  59   DA  I "C3'" 1 
ATOM   8983  O  "O3'" . DA  I 6  146  ? 220.135 188.192 151.810 1.00 0.00   ?  59   DA  I "O3'" 1 
ATOM   8984  C  "C2'" . DA  I 6  146  ? 220.601 186.324 150.295 1.00 0.00   ?  59   DA  I "C2'" 1 
ATOM   8985  C  "C1'" . DA  I 6  146  ? 221.223 185.384 151.313 1.00 0.00   ?  59   DA  I "C1'" 1 
ATOM   8986  N  N9    . DA  I 6  146  ? 221.843 184.197 150.727 1.00 20.00  ?  59   DA  I N9    1 
ATOM   8987  C  C8    . DA  I 6  146  ? 221.271 183.310 149.860 1.00 20.00  ?  59   DA  I C8    1 
ATOM   8988  N  N7    . DA  I 6  146  ? 222.064 182.323 149.511 1.00 20.00  ?  59   DA  I N7    1 
ATOM   8989  C  C5    . DA  I 6  146  ? 223.237 182.578 150.203 1.00 20.00  ?  59   DA  I C5    1 
ATOM   8990  C  C6    . DA  I 6  146  ? 224.472 181.898 150.264 1.00 20.00  ?  59   DA  I C6    1 
ATOM   8991  N  N6    . DA  I 6  146  ? 224.727 180.775 149.585 1.00 20.00  ?  59   DA  I N6    1 
ATOM   8992  N  N1    . DA  I 6  146  ? 225.436 182.420 151.053 1.00 20.00  ?  59   DA  I N1    1 
ATOM   8993  C  C2    . DA  I 6  146  ? 225.171 183.544 151.733 1.00 20.00  ?  59   DA  I C2    1 
ATOM   8994  N  N3    . DA  I 6  146  ? 224.052 184.269 151.754 1.00 20.00  ?  59   DA  I N3    1 
ATOM   8995  C  C4    . DA  I 6  146  ? 223.117 183.726 150.961 1.00 20.00  ?  59   DA  I C4    1 
ATOM   8996  P  P     . DT  I 6  147  ? 220.716 189.429 150.964 1.00 0.00   ?  60   DT  I P     1 
ATOM   8997  O  OP1   . DT  I 6  147  ? 220.510 190.649 151.775 1.00 0.00   ?  60   DT  I OP1   1 
ATOM   8998  O  OP2   . DT  I 6  147  ? 220.158 189.363 149.595 1.00 0.00   -1 60   DT  I OP2   1 
ATOM   8999  O  "O5'" . DT  I 6  147  ? 222.286 189.131 150.884 1.00 0.00   ?  60   DT  I "O5'" 1 
ATOM   9000  C  "C5'" . DT  I 6  147  ? 223.039 188.978 152.084 1.00 0.00   ?  60   DT  I "C5'" 1 
ATOM   9001  C  "C4'" . DT  I 6  147  ? 224.531 188.993 151.796 1.00 0.00   ?  60   DT  I "C4'" 1 
ATOM   9002  O  "O4'" . DT  I 6  147  ? 224.959 187.680 151.344 1.00 0.00   ?  60   DT  I "O4'" 1 
ATOM   9003  C  "C3'" . DT  I 6  147  ? 224.971 189.982 150.710 1.00 0.00   ?  60   DT  I "C3'" 1 
ATOM   9004  O  "O3'" . DT  I 6  147  ? 226.139 190.679 151.127 1.00 0.00   ?  60   DT  I "O3'" 1 
ATOM   9005  C  "C2'" . DT  I 6  147  ? 225.258 189.077 149.515 1.00 0.00   ?  60   DT  I "C2'" 1 
ATOM   9006  C  "C1'" . DT  I 6  147  ? 225.775 187.832 150.209 1.00 0.00   ?  60   DT  I "C1'" 1 
ATOM   9007  N  N1    . DT  I 6  147  ? 225.679 186.601 149.376 1.00 20.00  ?  60   DT  I N1    1 
ATOM   9008  C  C2    . DT  I 6  147  ? 226.787 185.798 149.233 1.00 20.00  ?  60   DT  I C2    1 
ATOM   9009  O  O2    . DT  I 6  147  ? 227.857 186.035 149.766 1.00 20.00  ?  60   DT  I O2    1 
ATOM   9010  N  N3    . DT  I 6  147  ? 226.598 184.695 148.444 1.00 20.00  ?  60   DT  I N3    1 
ATOM   9011  C  C4    . DT  I 6  147  ? 225.435 184.326 147.792 1.00 20.00  ?  60   DT  I C4    1 
ATOM   9012  O  O4    . DT  I 6  147  ? 225.362 183.315 147.102 1.00 20.00  ?  60   DT  I O4    1 
ATOM   9013  C  C5    . DT  I 6  147  ? 224.312 185.216 147.979 1.00 20.00  ?  60   DT  I C5    1 
ATOM   9014  C  C7    . DT  I 6  147  ? 222.996 184.920 147.321 1.00 20.00  ?  60   DT  I C7    1 
ATOM   9015  C  C6    . DT  I 6  147  ? 224.488 186.298 148.751 1.00 20.00  ?  60   DT  I C6    1 
ATOM   9016  P  P     . DA  I 6  148  ? 226.450 192.146 150.553 1.00 0.00   ?  61   DA  I P     1 
ATOM   9017  O  OP1   . DA  I 6  148  ? 227.704 192.622 151.181 1.00 0.00   ?  61   DA  I OP1   1 
ATOM   9018  O  OP2   . DA  I 6  148  ? 225.213 192.947 150.697 1.00 0.00   -1 61   DA  I OP2   1 
ATOM   9019  O  "O5'" . DA  I 6  148  ? 226.692 191.907 148.989 1.00 0.00   ?  61   DA  I "O5'" 1 
ATOM   9020  C  "C5'" . DA  I 6  148  ? 227.985 192.105 148.419 1.00 0.00   ?  61   DA  I "C5'" 1 
ATOM   9021  C  "C4'" . DA  I 6  148  ? 228.910 190.946 148.746 1.00 0.00   ?  61   DA  I "C4'" 1 
ATOM   9022  O  "O4'" . DA  I 6  148  ? 228.230 189.689 148.484 1.00 0.00   ?  61   DA  I "O4'" 1 
ATOM   9023  C  "C3'" . DA  I 6  148  ? 230.207 190.907 147.932 1.00 0.00   ?  61   DA  I "C3'" 1 
ATOM   9024  O  "O3'" . DA  I 6  148  ? 231.303 190.570 148.773 1.00 0.00   ?  61   DA  I "O3'" 1 
ATOM   9025  C  "C2'" . DA  I 6  148  ? 229.936 189.815 146.901 1.00 0.00   ?  61   DA  I "C2'" 1 
ATOM   9026  C  "C1'" . DA  I 6  148  ? 229.062 188.865 147.701 1.00 0.00   ?  61   DA  I "C1'" 1 
ATOM   9027  N  N9    . DA  I 6  148  ? 228.226 188.003 146.871 1.00 20.00  ?  61   DA  I N9    1 
ATOM   9028  C  C8    . DA  I 6  148  ? 226.895 188.158 146.596 1.00 20.00  ?  61   DA  I C8    1 
ATOM   9029  N  N7    . DA  I 6  148  ? 226.405 187.224 145.814 1.00 20.00  ?  61   DA  I N7    1 
ATOM   9030  C  C5    . DA  I 6  148  ? 227.489 186.400 145.559 1.00 20.00  ?  61   DA  I C5    1 
ATOM   9031  C  C6    . DA  I 6  148  ? 227.632 185.225 144.793 1.00 20.00  ?  61   DA  I C6    1 
ATOM   9032  N  N6    . DA  I 6  148  ? 226.626 184.658 144.117 1.00 20.00  ?  61   DA  I N6    1 
ATOM   9033  N  N1    . DA  I 6  148  ? 228.853 184.651 144.750 1.00 20.00  ?  61   DA  I N1    1 
ATOM   9034  C  C2    . DA  I 6  148  ? 229.857 185.221 145.424 1.00 20.00  ?  61   DA  I C2    1 
ATOM   9035  N  N3    . DA  I 6  148  ? 229.844 186.319 146.180 1.00 20.00  ?  61   DA  I N3    1 
ATOM   9036  C  C4    . DA  I 6  148  ? 228.619 186.866 146.203 1.00 20.00  ?  61   DA  I C4    1 
ATOM   9037  P  P     . DT  I 6  149  ? 232.791 191.047 148.393 1.00 0.00   ?  62   DT  I P     1 
ATOM   9038  O  OP1   . DT  I 6  149  ? 233.677 190.695 149.524 1.00 0.00   ?  62   DT  I OP1   1 
ATOM   9039  O  OP2   . DT  I 6  149  ? 232.708 192.451 147.932 1.00 0.00   -1 62   DT  I OP2   1 
ATOM   9040  O  "O5'" . DT  I 6  149  ? 233.178 190.145 147.129 1.00 0.00   ?  62   DT  I "O5'" 1 
ATOM   9041  C  "C5'" . DT  I 6  149  ? 233.395 188.746 147.287 1.00 0.00   ?  62   DT  I "C5'" 1 
ATOM   9042  C  "C4'" . DT  I 6  149  ? 234.005 188.154 146.029 1.00 0.00   ?  62   DT  I "C4'" 1 
ATOM   9043  O  "O4'" . DT  I 6  149  ? 233.005 187.376 145.315 1.00 0.00   ?  62   DT  I "O4'" 1 
ATOM   9044  C  "C3'" . DT  I 6  149  ? 234.534 189.181 145.022 1.00 0.00   ?  62   DT  I "C3'" 1 
ATOM   9045  O  "O3'" . DT  I 6  149  ? 235.754 188.717 144.455 1.00 0.00   ?  62   DT  I "O3'" 1 
ATOM   9046  C  "C2'" . DT  I 6  149  ? 233.419 189.229 143.981 1.00 0.00   ?  62   DT  I "C2'" 1 
ATOM   9047  C  "C1'" . DT  I 6  149  ? 232.995 187.774 143.963 1.00 0.00   ?  62   DT  I "C1'" 1 
ATOM   9048  N  N1    . DT  I 6  149  ? 231.634 187.541 143.400 1.00 20.00  ?  62   DT  I N1    1 
ATOM   9049  C  C2    . DT  I 6  149  ? 231.432 186.468 142.565 1.00 20.00  ?  62   DT  I C2    1 
ATOM   9050  O  O2    . DT  I 6  149  ? 232.314 185.686 142.258 1.00 20.00  ?  62   DT  I O2    1 
ATOM   9051  N  N3    . DT  I 6  149  ? 230.152 186.335 142.099 1.00 20.00  ?  62   DT  I N3    1 
ATOM   9052  C  C4    . DT  I 6  149  ? 229.074 187.156 142.376 1.00 20.00  ?  62   DT  I C4    1 
ATOM   9053  O  O4    . DT  I 6  149  ? 227.958 186.953 141.906 1.00 20.00  ?  62   DT  I O4    1 
ATOM   9054  C  C5    . DT  I 6  149  ? 229.353 188.266 143.258 1.00 20.00  ?  62   DT  I C5    1 
ATOM   9055  C  C7    . DT  I 6  149  ? 228.262 189.227 143.630 1.00 20.00  ?  62   DT  I C7    1 
ATOM   9056  C  C6    . DT  I 6  149  ? 230.606 188.404 143.721 1.00 20.00  ?  62   DT  I C6    1 
ATOM   9057  P  P     . DA  I 6  150  ? 236.806 189.760 143.830 1.00 0.00   ?  63   DA  I P     1 
ATOM   9058  O  OP1   . DA  I 6  150  ? 237.909 189.920 144.804 1.00 0.00   ?  63   DA  I OP1   1 
ATOM   9059  O  OP2   . DA  I 6  150  ? 236.051 190.947 143.374 1.00 0.00   -1 63   DA  I OP2   1 
ATOM   9060  O  "O5'" . DA  I 6  150  ? 237.366 189.010 142.531 1.00 0.00   ?  63   DA  I "O5'" 1 
ATOM   9061  C  "C5'" . DA  I 6  150  ? 238.140 187.822 142.669 1.00 0.00   ?  63   DA  I "C5'" 1 
ATOM   9062  C  "C4'" . DA  I 6  150  ? 238.032 186.956 141.424 1.00 0.00   ?  63   DA  I "C4'" 1 
ATOM   9063  O  "O4'" . DA  I 6  150  ? 236.642 186.597 141.205 1.00 0.00   ?  63   DA  I "O4'" 1 
ATOM   9064  C  "C3'" . DA  I 6  150  ? 238.510 187.618 140.132 1.00 0.00   ?  63   DA  I "C3'" 1 
ATOM   9065  O  "O3'" . DA  I 6  150  ? 239.192 186.675 139.312 1.00 0.00   ?  63   DA  I "O3'" 1 
ATOM   9066  C  "C2'" . DA  I 6  150  ? 237.216 188.090 139.479 1.00 0.00   ?  63   DA  I "C2'" 1 
ATOM   9067  C  "C1'" . DA  I 6  150  ? 236.224 187.027 139.927 1.00 0.00   ?  63   DA  I "C1'" 1 
ATOM   9068  N  N9    . DA  I 6  150  ? 234.864 187.538 140.040 1.00 20.00  ?  63   DA  I N9    1 
ATOM   9069  C  C8    . DA  I 6  150  ? 234.446 188.588 140.808 1.00 20.00  ?  63   DA  I C8    1 
ATOM   9070  N  N7    . DA  I 6  150  ? 233.164 188.841 140.707 1.00 20.00  ?  63   DA  I N7    1 
ATOM   9071  C  C5    . DA  I 6  150  ? 232.708 187.891 139.812 1.00 20.00  ?  63   DA  I C5    1 
ATOM   9072  C  C6    . DA  I 6  150  ? 231.430 187.623 139.286 1.00 20.00  ?  63   DA  I C6    1 
ATOM   9073  N  N6    . DA  I 6  150  ? 230.343 188.329 139.610 1.00 20.00  ?  63   DA  I N6    1 
ATOM   9074  N  N1    . DA  I 6  150  ? 231.314 186.602 138.413 1.00 20.00  ?  63   DA  I N1    1 
ATOM   9075  C  C2    . DA  I 6  150  ? 232.408 185.899 138.094 1.00 20.00  ?  63   DA  I C2    1 
ATOM   9076  N  N3    . DA  I 6  150  ? 233.660 186.056 138.522 1.00 20.00  ?  63   DA  I N3    1 
ATOM   9077  C  C4    . DA  I 6  150  ? 233.742 187.079 139.388 1.00 20.00  ?  63   DA  I C4    1 
ATOM   9078  P  P     . DT  I 6  151  ? 239.919 187.162 137.964 1.00 0.00   ?  64   DT  I P     1 
ATOM   9079  O  OP1   . DT  I 6  151  ? 241.000 186.199 137.658 1.00 0.00   ?  64   DT  I OP1   1 
ATOM   9080  O  OP2   . DT  I 6  151  ? 240.242 188.597 138.128 1.00 0.00   -1 64   DT  I OP2   1 
ATOM   9081  O  "O5'" . DT  I 6  151  ? 238.781 187.040 136.844 1.00 0.00   ?  64   DT  I "O5'" 1 
ATOM   9082  C  "C5'" . DT  I 6  151  ? 238.260 185.762 136.497 1.00 0.00   ?  64   DT  I "C5'" 1 
ATOM   9083  C  "C4'" . DT  I 6  151  ? 237.180 185.881 135.433 1.00 0.00   ?  64   DT  I "C4'" 1 
ATOM   9084  O  "O4'" . DT  I 6  151  ? 235.963 186.382 136.023 1.00 0.00   ?  64   DT  I "O4'" 1 
ATOM   9085  C  "C3'" . DT  I 6  151  ? 237.502 186.832 134.274 1.00 0.00   ?  64   DT  I "C3'" 1 
ATOM   9086  O  "O3'" . DT  I 6  151  ? 237.762 186.088 133.086 1.00 0.00   ?  64   DT  I "O3'" 1 
ATOM   9087  C  "C2'" . DT  I 6  151  ? 236.242 187.708 134.128 1.00 0.00   ?  64   DT  I "C2'" 1 
ATOM   9088  C  "C1'" . DT  I 6  151  ? 235.219 186.997 135.009 1.00 0.00   ?  64   DT  I "C1'" 1 
ATOM   9089  N  N1    . DT  I 6  151  ? 234.225 187.923 135.630 1.00 20.00  ?  64   DT  I N1    1 
ATOM   9090  C  C2    . DT  I 6  151  ? 232.908 187.860 135.234 1.00 20.00  ?  64   DT  I C2    1 
ATOM   9091  O  O2    . DT  I 6  151  ? 232.500 187.079 134.394 1.00 20.00  ?  64   DT  I O2    1 
ATOM   9092  N  N3    . DT  I 6  151  ? 232.079 188.759 135.855 1.00 20.00  ?  64   DT  I N3    1 
ATOM   9093  C  C4    . DT  I 6  151  ? 232.429 189.693 136.814 1.00 20.00  ?  64   DT  I C4    1 
ATOM   9094  O  O4    . DT  I 6  151  ? 231.612 190.457 137.316 1.00 20.00  ?  64   DT  I O4    1 
ATOM   9095  C  C5    . DT  I 6  151  ? 233.827 189.704 137.183 1.00 20.00  ?  64   DT  I C5    1 
ATOM   9096  C  C7    . DT  I 6  151  ? 234.325 190.676 138.210 1.00 20.00  ?  64   DT  I C7    1 
ATOM   9097  C  C6    . DT  I 6  151  ? 234.647 188.832 136.579 1.00 20.00  ?  64   DT  I C6    1 
ATOM   9098  P  P     . DA  I 6  152  ? 238.206 186.843 131.737 1.00 0.00   ?  65   DA  I P     1 
ATOM   9099  O  OP1   . DA  I 6  152  ? 238.995 185.888 130.929 1.00 0.00   ?  65   DA  I OP1   1 
ATOM   9100  O  OP2   . DA  I 6  152  ? 238.797 188.144 132.119 1.00 0.00   -1 65   DA  I OP2   1 
ATOM   9101  O  "O5'" . DA  I 6  152  ? 236.823 187.135 130.986 1.00 0.00   ?  65   DA  I "O5'" 1 
ATOM   9102  C  "C5'" . DA  I 6  152  ? 235.992 186.052 130.577 1.00 0.00   ?  65   DA  I "C5'" 1 
ATOM   9103  C  "C4'" . DA  I 6  152  ? 234.604 186.544 130.205 1.00 0.00   ?  65   DA  I "C4'" 1 
ATOM   9104  O  "O4'" . DA  I 6  152  ? 233.996 187.177 131.346 1.00 0.00   ?  65   DA  I "O4'" 1 
ATOM   9105  C  "C3'" . DA  I 6  152  ? 234.564 187.594 129.093 1.00 0.00   ?  65   DA  I "C3'" 1 
ATOM   9106  O  "O3'" . DA  I 6  152  ? 234.154 186.998 127.865 1.00 0.00   ?  65   DA  I "O3'" 1 
ATOM   9107  C  "C2'" . DA  I 6  152  ? 233.545 188.640 129.577 1.00 0.00   ?  65   DA  I "C2'" 1 
ATOM   9108  C  "C1'" . DA  I 6  152  ? 233.009 188.053 130.880 1.00 0.00   ?  65   DA  I "C1'" 1 
ATOM   9109  N  N9    . DA  I 6  152  ? 232.752 189.064 131.902 1.00 20.00  ?  65   DA  I N9    1 
ATOM   9110  C  C8    . DA  I 6  152  ? 233.655 189.616 132.766 1.00 20.00  ?  65   DA  I C8    1 
ATOM   9111  N  N7    . DA  I 6  152  ? 233.136 190.512 133.574 1.00 20.00  ?  65   DA  I N7    1 
ATOM   9112  C  C5    . DA  I 6  152  ? 231.801 190.556 133.207 1.00 20.00  ?  65   DA  I C5    1 
ATOM   9113  C  C6    . DA  I 6  152  ? 230.707 191.312 133.680 1.00 20.00  ?  65   DA  I C6    1 
ATOM   9114  N  N6    . DA  I 6  152  ? 230.800 192.203 134.671 1.00 20.00  ?  65   DA  I N6    1 
ATOM   9115  N  N1    . DA  I 6  152  ? 229.507 191.111 133.091 1.00 20.00  ?  65   DA  I N1    1 
ATOM   9116  C  C2    . DA  I 6  152  ? 229.419 190.218 132.098 1.00 20.00  ?  65   DA  I C2    1 
ATOM   9117  N  N3    . DA  I 6  152  ? 230.372 189.453 131.571 1.00 20.00  ?  65   DA  I N3    1 
ATOM   9118  C  C4    . DA  I 6  152  ? 231.549 189.671 132.175 1.00 20.00  ?  65   DA  I C4    1 
ATOM   9119  P  P     . DC  I 6  153  ? 234.184 187.856 126.504 1.00 0.00   ?  66   DC  I P     1 
ATOM   9120  O  OP1   . DC  I 6  153  ? 234.219 186.906 125.370 1.00 0.00   ?  66   DC  I OP1   1 
ATOM   9121  O  OP2   . DC  I 6  153  ? 235.250 188.873 126.646 1.00 0.00   -1 66   DC  I OP2   1 
ATOM   9122  O  "O5'" . DC  I 6  153  ? 232.779 188.624 126.492 1.00 0.00   ?  66   DC  I "O5'" 1 
ATOM   9123  C  "C5'" . DC  I 6  153  ? 231.565 187.888 126.374 1.00 0.00   ?  66   DC  I "C5'" 1 
ATOM   9124  C  "C4'" . DC  I 6  153  ? 230.360 188.812 126.425 1.00 0.00   ?  66   DC  I "C4'" 1 
ATOM   9125  O  "O4'" . DC  I 6  153  ? 230.284 189.443 127.727 1.00 0.00   ?  66   DC  I "O4'" 1 
ATOM   9126  C  "C3'" . DC  I 6  153  ? 230.368 189.953 125.396 1.00 0.00   ?  66   DC  I "C3'" 1 
ATOM   9127  O  "O3'" . DC  I 6  153  ? 229.215 189.875 124.564 1.00 0.00   ?  66   DC  I "O3'" 1 
ATOM   9128  C  "C2'" . DC  I 6  153  ? 230.364 191.230 126.243 1.00 0.00   ?  66   DC  I "C2'" 1 
ATOM   9129  C  "C1'" . DC  I 6  153  ? 229.788 190.745 127.563 1.00 0.00   ?  66   DC  I "C1'" 1 
ATOM   9130  N  N1    . DC  I 6  153  ? 230.212 191.570 128.726 1.00 20.00  ?  66   DC  I N1    1 
ATOM   9131  C  C2    . DC  I 6  153  ? 229.286 192.411 129.351 1.00 20.00  ?  66   DC  I C2    1 
ATOM   9132  O  O2    . DC  I 6  153  ? 228.122 192.445 128.935 1.00 20.00  ?  66   DC  I O2    1 
ATOM   9133  N  N3    . DC  I 6  153  ? 229.688 193.165 130.405 1.00 20.00  ?  66   DC  I N3    1 
ATOM   9134  C  C4    . DC  I 6  153  ? 230.952 193.099 130.827 1.00 20.00  ?  66   DC  I C4    1 
ATOM   9135  N  N4    . DC  I 6  153  ? 231.304 193.860 131.868 1.00 20.00  ?  66   DC  I N4    1 
ATOM   9136  C  C5    . DC  I 6  153  ? 231.913 192.253 130.197 1.00 20.00  ?  66   DC  I C5    1 
ATOM   9137  C  C6    . DC  I 6  153  ? 231.503 191.514 129.162 1.00 20.00  ?  66   DC  I C6    1 
ATOM   9138  P  P     . DA  I 6  154  ? 229.118 190.772 123.232 1.00 0.00   ?  67   DA  I P     1 
ATOM   9139  O  OP1   . DA  I 6  154  ? 228.436 189.965 122.197 1.00 0.00   ?  67   DA  I OP1   1 
ATOM   9140  O  OP2   . DA  I 6  154  ? 230.465 191.324 122.964 1.00 0.00   -1 67   DA  I OP2   1 
ATOM   9141  O  "O5'" . DA  I 6  154  ? 228.170 191.990 123.652 1.00 0.00   ?  67   DA  I "O5'" 1 
ATOM   9142  C  "C5'" . DA  I 6  154  ? 226.805 191.751 123.984 1.00 0.00   ?  67   DA  I "C5'" 1 
ATOM   9143  C  "C4'" . DA  I 6  154  ? 226.152 193.006 124.537 1.00 0.00   ?  67   DA  I "C4'" 1 
ATOM   9144  O  "O4'" . DA  I 6  154  ? 226.734 193.333 125.823 1.00 0.00   ?  67   DA  I "O4'" 1 
ATOM   9145  C  "C3'" . DA  I 6  154  ? 226.304 194.259 123.664 1.00 0.00   ?  67   DA  I "C3'" 1 
ATOM   9146  O  "O3'" . DA  I 6  154  ? 225.026 194.837 123.410 1.00 0.00   ?  67   DA  I "O3'" 1 
ATOM   9147  C  "C2'" . DA  I 6  154  ? 227.187 195.190 124.500 1.00 0.00   ?  67   DA  I "C2'" 1 
ATOM   9148  C  "C1'" . DA  I 6  154  ? 226.890 194.725 125.916 1.00 0.00   ?  67   DA  I "C1'" 1 
ATOM   9149  N  N9    . DA  I 6  154  ? 227.969 195.014 126.859 1.00 20.00  ?  67   DA  I N9    1 
ATOM   9150  C  C8    . DA  I 6  154  ? 229.236 194.505 126.841 1.00 20.00  ?  67   DA  I C8    1 
ATOM   9151  N  N7    . DA  I 6  154  ? 230.000 194.948 127.813 1.00 20.00  ?  67   DA  I N7    1 
ATOM   9152  C  C5    . DA  I 6  154  ? 229.176 195.810 128.516 1.00 20.00  ?  67   DA  I C5    1 
ATOM   9153  C  C6    . DA  I 6  154  ? 229.389 196.603 129.663 1.00 20.00  ?  67   DA  I C6    1 
ATOM   9154  N  N6    . DA  I 6  154  ? 230.550 196.648 130.321 1.00 20.00  ?  67   DA  I N6    1 
ATOM   9155  N  N1    . DA  I 6  154  ? 228.356 197.350 130.107 1.00 20.00  ?  67   DA  I N1    1 
ATOM   9156  C  C2    . DA  I 6  154  ? 227.193 197.302 129.443 1.00 20.00  ?  67   DA  I C2    1 
ATOM   9157  N  N3    . DA  I 6  154  ? 226.875 196.597 128.358 1.00 20.00  ?  67   DA  I N3    1 
ATOM   9158  C  C4    . DA  I 6  154  ? 227.921 195.866 127.941 1.00 20.00  ?  67   DA  I C4    1 
ATOM   9159  P  P     . DT  I 6  155  ? 224.896 196.136 122.472 1.00 0.00   ?  68   DT  I P     1 
ATOM   9160  O  OP1   . DT  I 6  155  ? 223.557 196.101 121.847 1.00 0.00   ?  68   DT  I OP1   1 
ATOM   9161  O  OP2   . DT  I 6  155  ? 226.103 196.203 121.616 1.00 0.00   -1 68   DT  I OP2   1 
ATOM   9162  O  "O5'" . DT  I 6  155  ? 224.950 197.361 123.500 1.00 0.00   ?  68   DT  I "O5'" 1 
ATOM   9163  C  "C5'" . DT  I 6  155  ? 223.936 197.500 124.490 1.00 0.00   ?  68   DT  I "C5'" 1 
ATOM   9164  C  "C4'" . DT  I 6  155  ? 224.102 198.797 125.266 1.00 0.00   ?  68   DT  I "C4'" 1 
ATOM   9165  O  "O4'" . DT  I 6  155  ? 225.212 198.676 126.194 1.00 0.00   ?  68   DT  I "O4'" 1 
ATOM   9166  C  "C3'" . DT  I 6  155  ? 224.394 200.036 124.408 1.00 0.00   ?  68   DT  I "C3'" 1 
ATOM   9167  O  "O3'" . DT  I 6  155  ? 223.502 201.093 124.755 1.00 0.00   ?  68   DT  I "O3'" 1 
ATOM   9168  C  "C2'" . DT  I 6  155  ? 225.840 200.387 124.765 1.00 0.00   ?  68   DT  I "C2'" 1 
ATOM   9169  C  "C1'" . DT  I 6  155  ? 225.925 199.886 126.194 1.00 0.00   ?  68   DT  I "C1'" 1 
ATOM   9170  N  N1    . DT  I 6  155  ? 227.319 199.633 126.655 1.00 20.00  ?  68   DT  I N1    1 
ATOM   9171  C  C2    . DT  I 6  155  ? 227.776 200.274 127.782 1.00 20.00  ?  68   DT  I C2    1 
ATOM   9172  O  O2    . DT  I 6  155  ? 227.094 201.038 128.441 1.00 20.00  ?  68   DT  I O2    1 
ATOM   9173  N  N3    . DT  I 6  155  ? 229.071 199.983 128.120 1.00 20.00  ?  68   DT  I N3    1 
ATOM   9174  C  C4    . DT  I 6  155  ? 229.938 199.136 127.454 1.00 20.00  ?  68   DT  I C4    1 
ATOM   9175  O  O4    . DT  I 6  155  ? 231.087 198.939 127.837 1.00 20.00  ?  68   DT  I O4    1 
ATOM   9176  C  C5    . DT  I 6  155  ? 229.396 198.499 126.276 1.00 20.00  ?  68   DT  I C5    1 
ATOM   9177  C  C7    . DT  I 6  155  ? 230.243 197.560 125.469 1.00 20.00  ?  68   DT  I C7    1 
ATOM   9178  C  C6    . DT  I 6  155  ? 228.128 198.778 125.936 1.00 20.00  ?  68   DT  I C6    1 
ATOM   9179  P  P     . DC  I 6  156  ? 223.183 202.264 123.701 1.00 0.00   ?  69   DC  I P     1 
ATOM   9180  O  OP1   . DC  I 6  156  ? 222.211 203.186 124.329 1.00 0.00   ?  69   DC  I OP1   1 
ATOM   9181  O  OP2   . DC  I 6  156  ? 222.851 201.618 122.410 1.00 0.00   -1 69   DC  I OP2   1 
ATOM   9182  O  "O5'" . DC  I 6  156  ? 224.584 203.017 123.521 1.00 0.00   ?  69   DC  I "O5'" 1 
ATOM   9183  C  "C5'" . DC  I 6  156  ? 224.710 204.395 123.865 1.00 0.00   ?  69   DC  I "C5'" 1 
ATOM   9184  C  "C4'" . DC  I 6  156  ? 224.951 204.564 125.356 1.00 0.00   ?  69   DC  I "C4'" 1 
ATOM   9185  O  "O4'" . DC  I 6  156  ? 225.973 203.627 125.795 1.00 0.00   ?  69   DC  I "O4'" 1 
ATOM   9186  C  "C3'" . DC  I 6  156  ? 225.439 205.952 125.777 1.00 0.00   ?  69   DC  I "C3'" 1 
ATOM   9187  O  "O3'" . DC  I 6  156  ? 224.807 206.351 126.992 1.00 0.00   ?  69   DC  I "O3'" 1 
ATOM   9188  C  "C2'" . DC  I 6  156  ? 226.938 205.744 125.968 1.00 0.00   ?  69   DC  I "C2'" 1 
ATOM   9189  C  "C1'" . DC  I 6  156  ? 226.972 204.323 126.505 1.00 0.00   ?  69   DC  I "C1'" 1 
ATOM   9190  N  N1    . DC  I 6  156  ? 228.281 203.632 126.294 1.00 20.00  ?  69   DC  I N1    1 
ATOM   9191  C  C2    . DC  I 6  156  ? 229.319 203.822 127.213 1.00 20.00  ?  69   DC  I C2    1 
ATOM   9192  O  O2    . DC  I 6  156  ? 229.136 204.564 128.186 1.00 20.00  ?  69   DC  I O2    1 
ATOM   9193  N  N3    . DC  I 6  156  ? 230.503 203.189 127.009 1.00 20.00  ?  69   DC  I N3    1 
ATOM   9194  C  C4    . DC  I 6  156  ? 230.659 202.396 125.947 1.00 20.00  ?  69   DC  I C4    1 
ATOM   9195  N  N4    . DC  I 6  156  ? 231.841 201.791 125.784 1.00 20.00  ?  69   DC  I N4    1 
ATOM   9196  C  C5    . DC  I 6  156  ? 229.611 202.190 125.000 1.00 20.00  ?  69   DC  I C5    1 
ATOM   9197  C  C6    . DC  I 6  156  ? 228.451 202.821 125.213 1.00 20.00  ?  69   DC  I C6    1 
ATOM   9198  P  P     . DG  I 6  157  ? 224.383 207.884 127.219 1.00 0.00   ?  70   DG  I P     1 
ATOM   9199  O  OP1   . DG  I 6  157  ? 222.914 207.921 127.389 1.00 0.00   ?  70   DG  I OP1   1 
ATOM   9200  O  OP2   . DG  I 6  157  ? 225.022 208.689 126.153 1.00 0.00   -1 70   DG  I OP2   1 
ATOM   9201  O  "O5'" . DG  I 6  157  ? 225.073 208.278 128.609 1.00 0.00   ?  70   DG  I "O5'" 1 
ATOM   9202  C  "C5'" . DG  I 6  157  ? 226.447 207.986 128.830 1.00 0.00   ?  70   DG  I "C5'" 1 
ATOM   9203  C  "C4'" . DG  I 6  157  ? 227.079 208.999 129.769 1.00 0.00   ?  70   DG  I "C4'" 1 
ATOM   9204  O  "O4'" . DG  I 6  157  ? 228.431 208.591 130.064 1.00 0.00   ?  70   DG  I "O4'" 1 
ATOM   9205  C  "C3'" . DG  I 6  157  ? 227.230 210.394 129.195 1.00 0.00   ?  70   DG  I "C3'" 1 
ATOM   9206  O  "O3'" . DG  I 6  157  ? 227.385 211.342 130.245 1.00 0.00   ?  70   DG  I "O3'" 1 
ATOM   9207  C  "C2'" . DG  I 6  157  ? 228.508 210.261 128.375 1.00 0.00   ?  70   DG  I "C2'" 1 
ATOM   9208  C  "C1'" . DG  I 6  157  ? 229.328 209.255 129.191 1.00 0.00   ?  70   DG  I "C1'" 1 
ATOM   9209  N  N9    . DG  I 6  157  ? 229.986 208.252 128.363 1.00 20.00  ?  70   DG  I N9    1 
ATOM   9210  C  C8    . DG  I 6  157  ? 229.454 207.609 127.273 1.00 20.00  ?  70   DG  I C8    1 
ATOM   9211  N  N7    . DG  I 6  157  ? 230.270 206.759 126.721 1.00 20.00  ?  70   DG  I N7    1 
ATOM   9212  C  C5    . DG  I 6  157  ? 231.419 206.839 127.493 1.00 20.00  ?  70   DG  I C5    1 
ATOM   9213  C  C6    . DG  I 6  157  ? 232.640 206.145 127.372 1.00 20.00  ?  70   DG  I C6    1 
ATOM   9214  O  O6    . DG  I 6  157  ? 232.957 205.296 126.527 1.00 20.00  ?  70   DG  I O6    1 
ATOM   9215  N  N1    . DG  I 6  157  ? 233.548 206.523 128.356 1.00 20.00  ?  70   DG  I N1    1 
ATOM   9216  C  C2    . DG  I 6  157  ? 233.301 207.455 129.340 1.00 20.00  ?  70   DG  I C2    1 
ATOM   9217  N  N2    . DG  I 6  157  ? 234.298 207.691 130.205 1.00 20.00  ?  70   DG  I N2    1 
ATOM   9218  N  N3    . DG  I 6  157  ? 232.155 208.113 129.463 1.00 20.00  ?  70   DG  I N3    1 
ATOM   9219  C  C4    . DG  I 6  157  ? 231.263 207.756 128.510 1.00 20.00  ?  70   DG  I C4    1 
ATOM   9220  P  P     . DA  I 6  158  ? 227.572 212.901 129.905 1.00 0.00   ?  71   DA  I P     1 
ATOM   9221  O  OP1   . DA  I 6  158  ? 227.129 213.672 131.088 1.00 0.00   ?  71   DA  I OP1   1 
ATOM   9222  O  OP2   . DA  I 6  158  ? 226.950 213.154 128.587 1.00 0.00   -1 71   DA  I OP2   1 
ATOM   9223  O  "O5'" . DA  I 6  158  ? 229.156 213.074 129.741 1.00 0.00   ?  71   DA  I "O5'" 1 
ATOM   9224  C  "C5'" . DA  I 6  158  ? 230.014 212.836 130.851 1.00 0.00   ?  71   DA  I "C5'" 1 
ATOM   9225  C  "C4'" . DA  I 6  158  ? 231.468 212.771 130.414 1.00 0.00   ?  71   DA  I "C4'" 1 
ATOM   9226  O  "O4'" . DA  I 6  158  ? 231.681 211.601 129.596 1.00 0.00   ?  71   DA  I "O4'" 1 
ATOM   9227  C  "C3'" . DA  I 6  158  ? 231.958 213.967 129.590 1.00 0.00   ?  71   DA  I "C3'" 1 
ATOM   9228  O  "O3'" . DA  I 6  158  ? 232.976 214.661 130.311 1.00 0.00   ?  71   DA  I "O3'" 1 
ATOM   9229  C  "C2'" . DA  I 6  158  ? 232.495 213.347 128.287 1.00 0.00   ?  71   DA  I "C2'" 1 
ATOM   9230  C  "C1'" . DA  I 6  158  ? 232.683 211.883 128.656 1.00 0.00   ?  71   DA  I "C1'" 1 
ATOM   9231  N  N9    . DA  I 6  158  ? 232.519 210.968 127.528 1.00 20.00  ?  71   DA  I N9    1 
ATOM   9232  C  C8    . DA  I 6  158  ? 231.413 210.822 126.740 1.00 20.00  ?  71   DA  I C8    1 
ATOM   9233  N  N7    . DA  I 6  158  ? 231.543 209.912 125.805 1.00 20.00  ?  71   DA  I N7    1 
ATOM   9234  C  C5    . DA  I 6  158  ? 232.825 209.422 125.994 1.00 20.00  ?  71   DA  I C5    1 
ATOM   9235  C  C6    . DA  I 6  158  ? 233.572 208.435 125.321 1.00 20.00  ?  71   DA  I C6    1 
ATOM   9236  N  N6    . DA  I 6  158  ? 233.102 207.738 124.280 1.00 20.00  ?  71   DA  I N6    1 
ATOM   9237  N  N1    . DA  I 6  158  ? 234.823 208.187 125.763 1.00 20.00  ?  71   DA  I N1    1 
ATOM   9238  C  C2    . DA  I 6  158  ? 235.288 208.886 126.806 1.00 20.00  ?  71   DA  I C2    1 
ATOM   9239  N  N3    . DA  I 6  158  ? 234.681 209.837 127.517 1.00 20.00  ?  71   DA  I N3    1 
ATOM   9240  C  C4    . DA  I 6  158  ? 233.441 210.060 127.054 1.00 20.00  ?  71   DA  I C4    1 
ATOM   9241  P  P     . DT  I 6  159  ? 233.797 215.864 129.631 1.00 0.00   ?  72   DT  I P     1 
ATOM   9242  O  OP1   . DT  I 6  159  ? 234.189 216.789 130.718 1.00 0.00   ?  72   DT  I OP1   1 
ATOM   9243  O  OP2   . DT  I 6  159  ? 233.025 216.384 128.482 1.00 0.00   -1 72   DT  I OP2   1 
ATOM   9244  O  "O5'" . DT  I 6  159  ? 235.117 215.153 129.079 1.00 0.00   ?  72   DT  I "O5'" 1 
ATOM   9245  C  "C5'" . DT  I 6  159  ? 235.900 214.345 129.952 1.00 0.00   ?  72   DT  I "C5'" 1 
ATOM   9246  C  "C4'" . DT  I 6  159  ? 237.171 213.876 129.268 1.00 0.00   ?  72   DT  I "C4'" 1 
ATOM   9247  O  "O4'" . DT  I 6  159  ? 236.861 212.811 128.333 1.00 0.00   ?  72   DT  I "O4'" 1 
ATOM   9248  C  "C3'" . DT  I 6  159  ? 237.909 214.952 128.471 1.00 0.00   ?  72   DT  I "C3'" 1 
ATOM   9249  O  "O3'" . DT  I 6  159  ? 239.298 214.906 128.765 1.00 0.00   ?  72   DT  I "O3'" 1 
ATOM   9250  C  "C2'" . DT  I 6  159  ? 237.624 214.581 127.014 1.00 0.00   ?  72   DT  I "C2'" 1 
ATOM   9251  C  "C1'" . DT  I 6  159  ? 237.481 213.069 127.095 1.00 0.00   ?  72   DT  I "C1'" 1 
ATOM   9252  N  N1    . DT  I 6  159  ? 236.625 212.490 126.016 1.00 0.00   ?  72   DT  I N1    1 
ATOM   9253  C  C2    . DT  I 6  159  ? 237.127 211.480 125.223 1.00 0.00   ?  72   DT  I C2    1 
ATOM   9254  O  O2    . DT  I 6  159  ? 238.250 211.026 125.350 1.00 0.00   ?  72   DT  I O2    1 
ATOM   9255  N  N3    . DT  I 6  159  ? 236.256 211.016 124.270 1.00 0.00   ?  72   DT  I N3    1 
ATOM   9256  C  C4    . DT  I 6  159  ? 234.963 211.453 124.035 1.00 0.00   ?  72   DT  I C4    1 
ATOM   9257  O  O4    . DT  I 6  159  ? 234.257 210.975 123.153 1.00 0.00   ?  72   DT  I O4    1 
ATOM   9258  C  C5    . DT  I 6  159  ? 234.502 212.512 124.901 1.00 0.00   ?  72   DT  I C5    1 
ATOM   9259  C  C7    . DT  I 6  159  ? 233.118 213.067 124.740 1.00 0.00   ?  72   DT  I C7    1 
ATOM   9260  C  C6    . DT  I 6  159  ? 235.344 212.972 125.838 1.00 0.00   ?  72   DT  I C6    1 
ATOM   9261  P  P     . DT  I 6  160  ? 240.262 216.106 128.307 1.00 0.00   ?  73   DT  I P     1 
ATOM   9262  O  OP1   . DT  I 6  160  ? 241.212 216.363 129.414 1.00 0.00   ?  73   DT  I OP1   1 
ATOM   9263  O  OP2   . DT  I 6  160  ? 239.411 217.205 127.801 1.00 0.00   -1 73   DT  I OP2   1 
ATOM   9264  O  "O5'" . DT  I 6  160  ? 241.066 215.494 127.070 1.00 0.00   ?  73   DT  I "O5'" 1 
ATOM   9265  C  "C5'" . DT  I 6  160  ? 241.768 214.267 127.222 1.00 0.00   ?  73   DT  I "C5'" 1 
ATOM   9266  C  "C4'" . DT  I 6  160  ? 242.208 213.725 125.876 1.00 0.00   ?  73   DT  I "C4'" 1 
ATOM   9267  O  "O4'" . DT  I 6  160  ? 241.054 213.232 125.142 1.00 0.00   ?  73   DT  I "O4'" 1 
ATOM   9268  C  "C3'" . DT  I 6  160  ? 242.893 214.745 124.958 1.00 0.00   ?  73   DT  I "C3'" 1 
ATOM   9269  O  "O3'" . DT  I 6  160  ? 244.068 214.177 124.392 1.00 0.00   ?  73   DT  I "O3'" 1 
ATOM   9270  C  "C2'" . DT  I 6  160  ? 241.834 215.024 123.89