data_6G1V
# 
_entry.id   6G1V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6G1V         
WWPDB D_1200009298 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2018-04-04 
_pdbx_database_PDB_obs_spr.pdb_id           6G1V 
_pdbx_database_PDB_obs_spr.replace_pdb_id   6FOU 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6G1V 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Coquelle, N.'    1 ? 
'Colletier, J.P.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CH 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Molecules 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1420-3049 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            23 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Increasing Polarity in Tacrine and Huprine Derivatives: Potent Anticholinesterase Agents for the Treatment of Myasthenia Gravis.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.3390/molecules23030634 
_citation.pdbx_database_id_PubMed   29534488 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Galdeano, C.'            1  ? 
primary 'Coquelle, N.'            2  ? 
primary 'Cieslikiewicz-Bouet, M.' 3  ? 
primary 'Bartolini, M.'           4  ? 
primary 'Perez, B.'               5  ? 
primary 'Clos, M.V.'              6  ? 
primary 'Silman, I.'              7  ? 
primary 'Jean, L.'                8  ? 
primary 'Colletier, J.P.'         9  ? 
primary 'Renard, P.Y.'            10 ? 
primary 'Munoz-Torrero, D.'       11 ? 
# 
_cell.entry_id           6G1V 
_cell.length_a           91.740 
_cell.length_b           106.440 
_cell.length_c           150.680 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         6G1V 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat Acetylcholinesterase                                                                         63763.965 2    
3.1.1.7 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                     221.208   6    ? ? 
? ? 
3 non-polymer syn '12-Amino-3-chloro-6,7,10,11-tetrahydro-5,9-dimethyl-7,11-methanocycloocta[b]quinolin-5-ium' 313.844   2    ? ? 
? ? 
4 non-polymer syn 'CHLORIDE ION'                                                                               35.453    4    ? ? 
? ? 
5 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                                                      106.120   3    ? ? 
? ? 
6 water       nat water                                                                                        18.015    1111 ? ? 
? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSSSGTSSSKGIIFYVLFSI
LYLIF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSSSGTSSSKGIIFYVLFSI
LYLIF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
1 538 ASP n 
1 539 GLY n 
1 540 GLU n 
1 541 LEU n 
1 542 SER n 
1 543 SER n 
1 544 SER n 
1 545 GLY n 
1 546 THR n 
1 547 SER n 
1 548 SER n 
1 549 SER n 
1 550 LYS n 
1 551 GLY n 
1 552 ILE n 
1 553 ILE n 
1 554 PHE n 
1 555 TYR n 
1 556 VAL n 
1 557 LEU n 
1 558 PHE n 
1 559 SER n 
1 560 ILE n 
1 561 LEU n 
1 562 TYR n 
1 563 LEU n 
1 564 ILE n 
1 565 PHE n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           1 
_entity_src_nat.pdbx_end_seq_num           565 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Tetronarce californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TETCF 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSSSGTSSSKGIIFYVLFSI
LYLIF
;
_struct_ref.pdbx_align_begin           22 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6G1V A 1 ? 565 ? P04058 22 ? 586 ? 1 565 
2 1 6G1V B 1 ? 565 ? P04058 22 ? 586 ? 1 565 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                                                      ? 
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'          y ARGININE                                                                                     ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                                   ? 
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                              ? 
'C4 H7 N O4'      133.103 
CL  non-polymer                  . 'CHLORIDE ION'                                                                               ? 
'Cl -1'           35.453  
CYS 'L-peptide linking'          y CYSTEINE                                                                                     ? 
'C3 H7 N O2 S'    121.158 
E1N non-polymer                  . '12-Amino-3-chloro-6,7,10,11-tetrahydro-5,9-dimethyl-7,11-methanocycloocta[b]quinolin-5-ium' ? 
'C19 H22 Cl N2 1' 313.844 
GLN 'L-peptide linking'          y GLUTAMINE                                                                                    ? 
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                              ? 
'C5 H9 N O4'      147.129 
GLY 'peptide linking'            y GLYCINE                                                                                      ? 
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                                                    ? 
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                  . WATER                                                                                        ? 
'H2 O'            18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                                   ? 
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                      ? 
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                       ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'          y METHIONINE                                                                                   ? 
'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                     ? 
'C8 H15 N O6'     221.208 
PEG non-polymer                  . 'DI(HYDROXYETHYL)ETHER'                                                                      ? 
'C4 H10 O3'       106.120 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                                ? 
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                      ? 
'C5 H9 N O2'      115.130 
SER 'L-peptide linking'          y SERINE                                                                                       ? 
'C3 H7 N O3'      105.093 
THR 'L-peptide linking'          y THREONINE                                                                                    ? 
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                                   ? 
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                                     ? 
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'          y VALINE                                                                                       ? 
'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6G1V 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.79 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.88 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '30% PEG 200/50 mM MES pH 6.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-04-29 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9801 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE MASSIF-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9801 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   MASSIF-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     6G1V 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             46.030 
_reflns.d_resolution_high            1.820 
_reflns.number_obs                   130469 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.4 
_reflns.pdbx_Rmerge_I_obs            0.07500 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.6000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.900 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.82 
_reflns_shell.d_res_low              1.89 
_reflns_shell.percent_possible_all   91.8 
_reflns_shell.Rmerge_I_obs           1.05400 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.90 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 6G1V 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     131495 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.03 
_refine.ls_d_res_high                            1.82 
_refine.ls_percent_reflns_obs                    99.3 
_refine.ls_R_factor_obs                          0.189 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.188 
_refine.ls_R_factor_R_free                       0.217 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.990 
_refine.ls_number_reflns_R_free                  6559 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2XI4 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.230 
_refine.pdbx_overall_phase_error                 26.470 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8480 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         153 
_refine_hist.number_atoms_solvent             1111 
_refine_hist.number_atoms_total               9744 
_refine_hist.d_res_high                       1.82 
_refine_hist.d_res_low                        46.03 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007 ? ? 9009  'X-RAY DIFFRACTION' ? 
f_angle_d          0.820 ? ? 12256 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 3.040 ? ? 7293  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.052 ? ? 1289  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005 ? ? 1589  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.8200 1.8407  4138 0.3468 99.00  0.3509 . . 215 . . 
'X-RAY DIFFRACTION' . 1.8407 1.8623  4103 0.3295 100.00 0.3509 . . 223 . . 
'X-RAY DIFFRACTION' . 1.8623 1.8851  4095 0.3149 99.00  0.2891 . . 224 . . 
'X-RAY DIFFRACTION' . 1.8851 1.9089  4156 0.3088 99.00  0.3381 . . 207 . . 
'X-RAY DIFFRACTION' . 1.9089 1.9340  4062 0.3014 98.00  0.3355 . . 209 . . 
'X-RAY DIFFRACTION' . 1.9340 1.9605  4149 0.2654 100.00 0.3256 . . 219 . . 
'X-RAY DIFFRACTION' . 1.9605 1.9885  4093 0.2584 100.00 0.2852 . . 223 . . 
'X-RAY DIFFRACTION' . 1.9885 2.0182  4159 0.2428 100.00 0.2909 . . 227 . . 
'X-RAY DIFFRACTION' . 2.0182 2.0498  4135 0.2276 100.00 0.2764 . . 222 . . 
'X-RAY DIFFRACTION' . 2.0498 2.0834  4103 0.2346 98.00  0.2588 . . 208 . . 
'X-RAY DIFFRACTION' . 2.0834 2.1193  4108 0.2193 99.00  0.2488 . . 207 . . 
'X-RAY DIFFRACTION' . 2.1193 2.1578  4099 0.2150 99.00  0.2599 . . 245 . . 
'X-RAY DIFFRACTION' . 2.1578 2.1993  4181 0.2045 100.00 0.2698 . . 200 . . 
'X-RAY DIFFRACTION' . 2.1993 2.2442  4127 0.2166 99.00  0.2638 . . 213 . . 
'X-RAY DIFFRACTION' . 2.2442 2.2930  4092 0.2028 98.00  0.2544 . . 213 . . 
'X-RAY DIFFRACTION' . 2.2930 2.3464  4160 0.1879 100.00 0.2113 . . 215 . . 
'X-RAY DIFFRACTION' . 2.3464 2.4050  4155 0.1847 100.00 0.2164 . . 207 . . 
'X-RAY DIFFRACTION' . 2.4050 2.4700  4207 0.1837 100.00 0.2381 . . 199 . . 
'X-RAY DIFFRACTION' . 2.4700 2.5427  4148 0.1816 100.00 0.2350 . . 239 . . 
'X-RAY DIFFRACTION' . 2.5427 2.6248  4167 0.1850 100.00 0.2314 . . 208 . . 
'X-RAY DIFFRACTION' . 2.6248 2.7186  4179 0.1881 99.00  0.2329 . . 214 . . 
'X-RAY DIFFRACTION' . 2.7186 2.8274  4207 0.1855 100.00 0.2200 . . 213 . . 
'X-RAY DIFFRACTION' . 2.8274 2.9561  4191 0.1781 100.00 0.1954 . . 230 . . 
'X-RAY DIFFRACTION' . 2.9561 3.1119  4136 0.1848 99.00  0.2049 . . 239 . . 
'X-RAY DIFFRACTION' . 3.1119 3.3068  4203 0.1770 100.00 0.2111 . . 229 . . 
'X-RAY DIFFRACTION' . 3.3068 3.5621  4194 0.1661 99.00  0.1951 . . 225 . . 
'X-RAY DIFFRACTION' . 3.5621 3.9204  4225 0.1531 99.00  0.1722 . . 198 . . 
'X-RAY DIFFRACTION' . 3.9204 4.4872  4247 0.1381 99.00  0.1570 . . 219 . . 
'X-RAY DIFFRACTION' . 4.4872 5.6518  4275 0.1462 99.00  0.1581 . . 224 . . 
'X-RAY DIFFRACTION' . 5.6518 46.0493 4442 0.1895 99.00  0.2094 . . 245 . . 
# 
_struct.entry_id                     6G1V 
_struct.title                        
;Crystal structure of Torpedo Californica acetylcholinesterase in complex with 12-Amino-3-chloro-6,7,10,11-tetrahydro-5,9-dimethyl-7,11-methanocycloocta[b]quinolin-5-ium
;
_struct.pdbx_descriptor              'Cholinesterase (E.C.3.1.1.8)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6G1V 
_struct_keywords.text            'Torpedo Californica acetylcholinesterase, AD, alzheimer disease, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
K N N 5 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 5 ? 
R N N 6 ? 
S N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  AA3 LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  AA4 GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  AA5 VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  AA6 ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  AA7 GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  AA8 SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  AA9 SER A 215 ? PHE A 219 ? SER A 215 PHE A 219 5 ? 5  
HELX_P HELX_P10 AB1 VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 AB2 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 AB3 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 AB4 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 AB5 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 AB6 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 AB7 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 AB8 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 AB9 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 AC1 VAL A 400 ? GLY A 415 ? VAL A 400 GLY A 415 1 ? 16 
HELX_P HELX_P20 AC2 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 AC3 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 AC4 GLY A 449 ? ASN A 457 ? GLY A 449 ASN A 457 5 ? 9  
HELX_P HELX_P23 AC5 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P24 AC6 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P25 AC7 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
HELX_P HELX_P26 AC8 VAL B 40  ? ARG B 44  ? VAL B 40  ARG B 44  5 ? 5  
HELX_P HELX_P27 AC9 PHE B 78  ? MET B 83  ? PHE B 78  MET B 83  1 ? 6  
HELX_P HELX_P28 AD1 LEU B 127 ? ASN B 131 ? LEU B 127 ASN B 131 5 ? 5  
HELX_P HELX_P29 AD2 GLY B 132 ? GLU B 140 ? GLY B 132 GLU B 140 1 ? 9  
HELX_P HELX_P30 AD3 VAL B 150 ? LEU B 156 ? VAL B 150 LEU B 156 1 ? 7  
HELX_P HELX_P31 AD4 ASN B 167 ? ILE B 184 ? ASN B 167 ILE B 184 1 ? 18 
HELX_P HELX_P32 AD5 GLN B 185 ? PHE B 187 ? GLN B 185 PHE B 187 5 ? 3  
HELX_P HELX_P33 AD6 SER B 200 ? SER B 212 ? SER B 200 SER B 212 1 ? 13 
HELX_P HELX_P34 AD7 SER B 212 ? ASP B 217 ? SER B 212 ASP B 217 1 ? 6  
HELX_P HELX_P35 AD8 VAL B 238 ? ASN B 251 ? VAL B 238 ASN B 251 1 ? 14 
HELX_P HELX_P36 AD9 SER B 258 ? GLU B 268 ? SER B 258 GLU B 268 1 ? 11 
HELX_P HELX_P37 AE1 LYS B 270 ? GLU B 278 ? LYS B 270 GLU B 278 1 ? 9  
HELX_P HELX_P38 AE2 TRP B 279 ? LEU B 282 ? TRP B 279 LEU B 282 5 ? 4  
HELX_P HELX_P39 AE3 SER B 304 ? GLY B 312 ? SER B 304 GLY B 312 1 ? 9  
HELX_P HELX_P40 AE4 GLY B 328 ? ALA B 336 ? GLY B 328 ALA B 336 1 ? 9  
HELX_P HELX_P41 AE5 SER B 348 ? VAL B 360 ? SER B 348 VAL B 360 1 ? 13 
HELX_P HELX_P42 AE6 ASN B 364 ? THR B 376 ? ASN B 364 THR B 376 1 ? 13 
HELX_P HELX_P43 AE7 ASN B 383 ? VAL B 400 ? ASN B 383 VAL B 400 1 ? 18 
HELX_P HELX_P44 AE8 VAL B 400 ? LYS B 413 ? VAL B 400 LYS B 413 1 ? 14 
HELX_P HELX_P45 AE9 PRO B 433 ? GLY B 437 ? PRO B 433 GLY B 437 5 ? 5  
HELX_P HELX_P46 AF1 GLU B 443 ? PHE B 448 ? GLU B 443 PHE B 448 1 ? 6  
HELX_P HELX_P47 AF2 GLY B 449 ? ASN B 457 ? GLY B 449 ASN B 457 5 ? 9  
HELX_P HELX_P48 AF3 THR B 459 ? GLY B 480 ? THR B 459 GLY B 480 1 ? 22 
HELX_P HELX_P49 AF4 ARG B 517 ? GLN B 526 ? ARG B 517 GLN B 526 1 ? 10 
HELX_P HELX_P50 AF5 GLN B 526 ? THR B 535 ? GLN B 526 THR B 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf4 disulf ?   ? B CYS 67  SG  ? ? ? 1_555 B CYS 94  SG ? ? B CYS 67  B CYS 94  1_555 ? ? ? ? ? ? ? 2.067 ? ?               
disulf5 disulf ?   ? B CYS 254 SG  ? ? ? 1_555 B CYS 265 SG ? ? B CYS 254 B CYS 265 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf6 disulf ?   ? B CYS 402 SG  ? ? ? 1_555 B CYS 521 SG ? ? B CYS 402 B CYS 521 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  A NAG 601 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 416 A NAG 602 1_555 ? ? ? ? ? ? ? 1.496 ? N-Glycosylation 
covale3 covale one ? A ASN 457 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 457 A NAG 603 1_555 ? ? ? ? ? ? ? 1.468 ? N-Glycosylation 
covale4 covale one ? B ASN 59  ND2 ? ? ? 1_555 L NAG .   C1 ? ? B ASN 59  B NAG 601 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale5 covale one ? B ASN 416 ND2 ? ? ? 1_555 M NAG .   C1 ? ? B ASN 416 B NAG 602 1_555 ? ? ? ? ? ? ? 1.479 ? N-Glycosylation 
covale6 covale one ? B ASN 457 ND2 ? ? ? 1_555 N NAG .   C1 ? ? B ASN 457 B NAG 603 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 1 4.40 
2 SER 103 B . ? SER 103 B PRO 104 B ? PRO 104 B 1 4.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
AA6 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
AA6 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA1 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA1 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AA2 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
AA2 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
AA2 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AA2 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AA2 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AA2 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AA2 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AA2 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AA2 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AA2 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AA2 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AA3 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
AA3 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
AA4 1  LEU B 7   ? THR B 10  ? LEU B 7   THR B 10  
AA4 2  GLY B 13  ? MET B 16  ? GLY B 13  MET B 16  
AA4 3  VAL B 57  ? ASN B 59  ? VAL B 57  ASN B 59  
AA5 1  THR B 18  ? VAL B 22  ? THR B 18  VAL B 22  
AA5 2  SER B 25  ? PRO B 34  ? SER B 25  PRO B 34  
AA5 3  TYR B 96  ? VAL B 101 ? TYR B 96  VAL B 101 
AA5 4  VAL B 142 ? SER B 145 ? VAL B 142 SER B 145 
AA5 5  THR B 109 ? ILE B 115 ? THR B 109 ILE B 115 
AA5 6  GLY B 189 ? GLU B 199 ? GLY B 189 GLU B 199 
AA5 7  ARG B 221 ? GLN B 225 ? ARG B 221 GLN B 225 
AA5 8  ILE B 319 ? ASN B 324 ? ILE B 319 ASN B 324 
AA5 9  THR B 418 ? PHE B 423 ? THR B 418 PHE B 423 
AA5 10 LYS B 501 ? LEU B 505 ? LYS B 501 LEU B 505 
AA5 11 VAL B 512 ? GLN B 514 ? VAL B 512 GLN B 514 
AA6 1  VAL B 236 ? SER B 237 ? VAL B 236 SER B 237 
AA6 2  VAL B 295 ? ILE B 296 ? VAL B 295 ILE B 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 8   ? N VAL A 8   O VAL A 15  ? O VAL A 15  
AA1 2  3  N LYS A 14  ? N LYS A 14  O TRP A 58  ? O TRP A 58  
AA2 1  2  N VAL A 20  ? N VAL A 20  O ILE A 27  ? O ILE A 27  
AA2 2  3  N PHE A 30  ? N PHE A 30  O ILE A 99  ? O ILE A 99  
AA2 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AA2 4  5  O VAL A 144 ? O VAL A 144 N TRP A 114 ? N TRP A 114 
AA2 5  6  N THR A 109 ? N THR A 109 O ASP A 190 ? O ASP A 190 
AA2 6  7  N GLY A 198 ? N GLY A 198 O GLN A 225 ? O GLN A 225 
AA2 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AA2 8  9  N VAL A 323 ? N VAL A 323 O PHE A 423 ? O PHE A 423 
AA2 9  10 N PHE A 422 ? N PHE A 422 O LEU A 505 ? O LEU A 505 
AA2 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AA3 1  2  N VAL A 236 ? N VAL A 236 O ILE A 296 ? O ILE A 296 
AA4 1  2  N VAL B 8   ? N VAL B 8   O VAL B 15  ? O VAL B 15  
AA4 2  3  N LYS B 14  ? N LYS B 14  O TRP B 58  ? O TRP B 58  
AA5 1  2  N VAL B 20  ? N VAL B 20  O ILE B 27  ? O ILE B 27  
AA5 2  3  N PHE B 30  ? N PHE B 30  O ILE B 99  ? O ILE B 99  
AA5 3  4  N TRP B 100 ? N TRP B 100 O LEU B 143 ? O LEU B 143 
AA5 4  5  O VAL B 144 ? O VAL B 144 N TRP B 114 ? N TRP B 114 
AA5 5  6  N VAL B 111 ? N VAL B 111 O THR B 195 ? O THR B 195 
AA5 6  7  N ILE B 196 ? N ILE B 196 O ILE B 223 ? O ILE B 223 
AA5 7  8  N LEU B 224 ? N LEU B 224 O LEU B 320 ? O LEU B 320 
AA5 8  9  N VAL B 323 ? N VAL B 323 O PHE B 423 ? O PHE B 423 
AA5 9  10 N PHE B 422 ? N PHE B 422 O LEU B 505 ? O LEU B 505 
AA5 10 11 N PHE B 502 ? N PHE B 502 O HIS B 513 ? O HIS B 513 
AA6 1  2  N VAL B 236 ? N VAL B 236 O ILE B 296 ? O ILE B 296 
# 
_atom_sites.entry_id                    6G1V 
_atom_sites.fract_transf_matrix[1][1]   0.010900 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009395 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006637 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 4   ? -19.608 -11.096 -9.433  1.00 50.68  ? 4    SER A N   1 
ATOM   2    C  CA  . SER A 1 4   ? -20.970 -11.262 -8.930  1.00 54.38  ? 4    SER A CA  1 
ATOM   3    C  C   . SER A 1 4   ? -20.961 -11.401 -7.408  1.00 53.74  ? 4    SER A C   1 
ATOM   4    O  O   . SER A 1 4   ? -21.432 -10.516 -6.685  1.00 54.77  ? 4    SER A O   1 
ATOM   5    C  CB  . SER A 1 4   ? -21.638 -12.478 -9.576  1.00 57.23  ? 4    SER A CB  1 
ATOM   6    O  OG  . SER A 1 4   ? -22.905 -12.729 -8.993  1.00 64.00  ? 4    SER A OG  1 
ATOM   7    N  N   . GLU A 1 5   ? -20.428 -12.522 -6.917  1.00 50.39  ? 5    GLU A N   1 
ATOM   8    C  CA  . GLU A 1 5   ? -20.177 -12.632 -5.486  1.00 48.66  ? 5    GLU A CA  1 
ATOM   9    C  C   . GLU A 1 5   ? -19.068 -11.680 -5.058  1.00 45.09  ? 5    GLU A C   1 
ATOM   10   O  O   . GLU A 1 5   ? -19.098 -11.148 -3.942  1.00 42.96  ? 5    GLU A O   1 
ATOM   11   C  CB  . GLU A 1 5   ? -19.819 -14.075 -5.126  1.00 49.73  ? 5    GLU A CB  1 
ATOM   12   C  CG  . GLU A 1 5   ? -19.826 -14.370 -3.635  1.00 45.40  ? 5    GLU A CG  1 
ATOM   13   C  CD  . GLU A 1 5   ? -19.611 -15.844 -3.322  1.00 48.91  ? 5    GLU A CD  1 
ATOM   14   O  OE1 . GLU A 1 5   ? -19.332 -16.624 -4.255  1.00 49.25  ? 5    GLU A OE1 1 
ATOM   15   O  OE2 . GLU A 1 5   ? -19.708 -16.221 -2.134  1.00 46.60  ? 5    GLU A OE2 1 
ATOM   16   N  N   . LEU A 1 6   ? -18.105 -11.436 -5.940  1.00 40.71  ? 6    LEU A N   1 
ATOM   17   C  CA  . LEU A 1 6   ? -16.970 -10.571 -5.663  1.00 39.40  ? 6    LEU A CA  1 
ATOM   18   C  C   . LEU A 1 6   ? -17.178 -9.142  -6.133  1.00 38.36  ? 6    LEU A C   1 
ATOM   19   O  O   . LEU A 1 6   ? -16.313 -8.297  -5.889  1.00 35.55  ? 6    LEU A O   1 
ATOM   20   C  CB  . LEU A 1 6   ? -15.711 -11.139 -6.317  1.00 37.03  ? 6    LEU A CB  1 
ATOM   21   C  CG  . LEU A 1 6   ? -15.279 -12.513 -5.810  1.00 41.59  ? 6    LEU A CG  1 
ATOM   22   C  CD1 . LEU A 1 6   ? -14.077 -13.012 -6.601  1.00 36.98  ? 6    LEU A CD1 1 
ATOM   23   C  CD2 . LEU A 1 6   ? -14.967 -12.460 -4.309  1.00 36.14  ? 6    LEU A CD2 1 
ATOM   24   N  N   . LEU A 1 7   ? -18.284 -8.844  -6.809  1.00 37.01  ? 7    LEU A N   1 
ATOM   25   C  CA  . LEU A 1 7   ? -18.521 -7.519  -7.370  1.00 34.75  ? 7    LEU A CA  1 
ATOM   26   C  C   . LEU A 1 7   ? -19.686 -6.893  -6.615  1.00 37.33  ? 7    LEU A C   1 
ATOM   27   O  O   . LEU A 1 7   ? -20.838 -7.299  -6.797  1.00 37.74  ? 7    LEU A O   1 
ATOM   28   C  CB  . LEU A 1 7   ? -18.795 -7.612  -8.875  1.00 36.26  ? 7    LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 7   ? -19.086 -6.327  -9.658  1.00 41.39  ? 7    LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 7   ? -18.055 -5.259  -9.362  1.00 35.82  ? 7    LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 7   ? -19.162 -6.604  -11.180 1.00 36.95  ? 7    LEU A CD2 1 
ATOM   32   N  N   . VAL A 1 8   ? -19.389 -5.919  -5.757  1.00 33.50  ? 8    VAL A N   1 
ATOM   33   C  CA  . VAL A 1 8   ? -20.387 -5.302  -4.893  1.00 29.63  ? 8    VAL A CA  1 
ATOM   34   C  C   . VAL A 1 8   ? -20.489 -3.826  -5.240  1.00 30.84  ? 8    VAL A C   1 
ATOM   35   O  O   . VAL A 1 8   ? -19.466 -3.142  -5.370  1.00 34.13  ? 8    VAL A O   1 
ATOM   36   C  CB  . VAL A 1 8   ? -20.034 -5.474  -3.398  1.00 33.38  ? 8    VAL A CB  1 
ATOM   37   C  CG1 . VAL A 1 8   ? -21.039 -4.751  -2.525  1.00 32.01  ? 8    VAL A CG1 1 
ATOM   38   C  CG2 . VAL A 1 8   ? -19.956 -6.944  -3.020  1.00 31.82  ? 8    VAL A CG2 1 
ATOM   39   N  N   . ASN A 1 9   ? -21.717 -3.327  -5.363  1.00 28.74  ? 9    ASN A N   1 
ATOM   40   C  CA  A ASN A 1 9   ? -21.962 -1.903  -5.565  0.75 32.22  ? 9    ASN A CA  1 
ATOM   41   C  CA  B ASN A 1 9   ? -21.972 -1.906  -5.569  0.25 32.23  ? 9    ASN A CA  1 
ATOM   42   C  C   . ASN A 1 9   ? -22.265 -1.266  -4.214  1.00 33.20  ? 9    ASN A C   1 
ATOM   43   O  O   . ASN A 1 9   ? -23.293 -1.561  -3.591  1.00 32.87  ? 9    ASN A O   1 
ATOM   44   C  CB  A ASN A 1 9   ? -23.108 -1.654  -6.549  0.75 32.98  ? 9    ASN A CB  1 
ATOM   45   C  CB  B ASN A 1 9   ? -23.139 -1.699  -6.533  0.25 33.01  ? 9    ASN A CB  1 
ATOM   46   C  CG  A ASN A 1 9   ? -23.237 -0.181  -6.920  0.75 33.42  ? 9    ASN A CG  1 
ATOM   47   C  CG  B ASN A 1 9   ? -22.824 -2.153  -7.949  0.25 33.99  ? 9    ASN A CG  1 
ATOM   48   O  OD1 A ASN A 1 9   ? -22.259 0.572   -6.852  0.75 28.58  ? 9    ASN A OD1 1 
ATOM   49   O  OD1 B ASN A 1 9   ? -21.757 -2.702  -8.218  0.25 36.41  ? 9    ASN A OD1 1 
ATOM   50   N  ND2 A ASN A 1 9   ? -24.443 0.239   -7.306  0.75 36.32  ? 9    ASN A ND2 1 
ATOM   51   N  ND2 B ASN A 1 9   ? -23.756 -1.917  -8.865  0.25 34.94  ? 9    ASN A ND2 1 
ATOM   52   N  N   . THR A 1 10  ? -21.374 -0.392  -3.763  1.00 29.08  ? 10   THR A N   1 
ATOM   53   C  CA  . THR A 1 10  ? -21.574 0.348   -2.528  1.00 28.33  ? 10   THR A CA  1 
ATOM   54   C  C   . THR A 1 10  ? -22.088 1.747   -2.831  1.00 31.47  ? 10   THR A C   1 
ATOM   55   O  O   . THR A 1 10  ? -22.137 2.186   -3.984  1.00 32.24  ? 10   THR A O   1 
ATOM   56   C  CB  . THR A 1 10  ? -20.270 0.435   -1.735  1.00 30.61  ? 10   THR A CB  1 
ATOM   57   O  OG1 . THR A 1 10  ? -19.464 1.472   -2.300  1.00 28.62  ? 10   THR A OG1 1 
ATOM   58   C  CG2 . THR A 1 10  ? -19.515 -0.888  -1.808  1.00 29.45  ? 10   THR A CG2 1 
ATOM   59   N  N   . LYS A 1 11  ? -22.453 2.463   -1.764  1.00 28.80  ? 11   LYS A N   1 
ATOM   60   C  CA  . LYS A 1 11  ? -22.969 3.815   -1.922  1.00 30.51  ? 11   LYS A CA  1 
ATOM   61   C  C   . LYS A 1 11  ? -21.949 4.768   -2.529  1.00 36.46  ? 11   LYS A C   1 
ATOM   62   O  O   . LYS A 1 11  ? -22.332 5.840   -3.014  1.00 37.27  ? 11   LYS A O   1 
ATOM   63   C  CB  . LYS A 1 11  ? -23.450 4.349   -0.580  1.00 35.76  ? 11   LYS A CB  1 
ATOM   64   C  CG  . LYS A 1 11  ? -24.645 3.578   -0.042  1.00 38.88  ? 11   LYS A CG  1 
ATOM   65   C  CD  . LYS A 1 11  ? -25.626 4.505   0.632   1.00 43.78  ? 11   LYS A CD  1 
ATOM   66   C  CE  . LYS A 1 11  ? -26.912 3.777   0.965   1.00 43.95  ? 11   LYS A CE  1 
ATOM   67   N  NZ  . LYS A 1 11  ? -26.791 3.070   2.272   1.00 47.60  ? 11   LYS A NZ  1 
ATOM   68   N  N   . SER A 1 12  ? -20.663 4.421   -2.515  1.00 31.45  ? 12   SER A N   1 
ATOM   69   C  CA  . SER A 1 12  ? -19.646 5.292   -3.082  1.00 33.52  ? 12   SER A CA  1 
ATOM   70   C  C   . SER A 1 12  ? -19.004 4.703   -4.328  1.00 34.83  ? 12   SER A C   1 
ATOM   71   O  O   . SER A 1 12  ? -18.034 5.269   -4.839  1.00 35.42  ? 12   SER A O   1 
ATOM   72   C  CB  . SER A 1 12  ? -18.574 5.614   -2.039  1.00 38.76  ? 12   SER A CB  1 
ATOM   73   O  OG  . SER A 1 12  ? -18.902 6.811   -1.350  1.00 48.86  ? 12   SER A OG  1 
ATOM   74   N  N   . GLY A 1 13  ? -19.516 3.587   -4.834  1.00 30.89  ? 13   GLY A N   1 
ATOM   75   C  CA  . GLY A 1 13  ? -18.997 3.055   -6.075  1.00 27.94  ? 13   GLY A CA  1 
ATOM   76   C  C   . GLY A 1 13  ? -18.810 1.558   -6.020  1.00 31.10  ? 13   GLY A C   1 
ATOM   77   O  O   . GLY A 1 13  ? -19.009 0.941   -4.970  1.00 28.64  ? 13   GLY A O   1 
ATOM   78   N  N   . LYS A 1 14  ? -18.433 0.968   -7.150  1.00 26.34  ? 14   LYS A N   1 
ATOM   79   C  CA  . LYS A 1 14  ? -18.260 -0.475  -7.240  1.00 29.71  ? 14   LYS A CA  1 
ATOM   80   C  C   . LYS A 1 14  ? -16.909 -0.907  -6.682  1.00 31.63  ? 14   LYS A C   1 
ATOM   81   O  O   . LYS A 1 14  ? -15.900 -0.214  -6.843  1.00 28.22  ? 14   LYS A O   1 
ATOM   82   C  CB  . LYS A 1 14  ? -18.382 -0.933  -8.695  1.00 31.94  ? 14   LYS A CB  1 
ATOM   83   C  CG  . LYS A 1 14  ? -19.691 -0.528  -9.358  1.00 31.32  ? 14   LYS A CG  1 
ATOM   84   C  CD  . LYS A 1 14  ? -19.774 -1.102  -10.760 1.00 37.75  ? 14   LYS A CD  1 
ATOM   85   C  CE  . LYS A 1 14  ? -21.006 -0.622  -11.486 1.00 38.84  ? 14   LYS A CE  1 
ATOM   86   N  NZ  . LYS A 1 14  ? -20.906 -0.937  -12.933 1.00 42.78  ? 14   LYS A NZ  1 
ATOM   87   N  N   . VAL A 1 15  ? -16.899 -2.079  -6.048  1.00 30.83  ? 15   VAL A N   1 
ATOM   88   C  CA  A VAL A 1 15  ? -15.695 -2.696  -5.512  0.16 29.73  ? 15   VAL A CA  1 
ATOM   89   C  CA  B VAL A 1 15  ? -15.686 -2.694  -5.527  0.84 29.72  ? 15   VAL A CA  1 
ATOM   90   C  C   . VAL A 1 15  ? -15.639 -4.140  -5.998  1.00 28.78  ? 15   VAL A C   1 
ATOM   91   O  O   . VAL A 1 15  ? -16.663 -4.828  -6.035  1.00 30.65  ? 15   VAL A O   1 
ATOM   92   C  CB  A VAL A 1 15  ? -15.681 -2.620  -3.969  0.16 29.78  ? 15   VAL A CB  1 
ATOM   93   C  CB  B VAL A 1 15  ? -15.605 -2.628  -3.983  0.84 29.81  ? 15   VAL A CB  1 
ATOM   94   C  CG1 A VAL A 1 15  ? -14.976 -3.814  -3.366  0.16 29.71  ? 15   VAL A CG1 1 
ATOM   95   C  CG1 B VAL A 1 15  ? -15.488 -1.191  -3.508  0.84 29.74  ? 15   VAL A CG1 1 
ATOM   96   C  CG2 A VAL A 1 15  ? -15.035 -1.324  -3.509  0.16 29.53  ? 15   VAL A CG2 1 
ATOM   97   C  CG2 B VAL A 1 15  ? -16.812 -3.305  -3.343  0.84 29.08  ? 15   VAL A CG2 1 
ATOM   98   N  N   . MET A 1 16  ? -14.445 -4.602  -6.366  1.00 28.77  ? 16   MET A N   1 
ATOM   99   C  CA  . MET A 1 16  ? -14.231 -5.983  -6.796  1.00 32.26  ? 16   MET A CA  1 
ATOM   100  C  C   . MET A 1 16  ? -13.285 -6.665  -5.812  1.00 31.59  ? 16   MET A C   1 
ATOM   101  O  O   . MET A 1 16  ? -12.100 -6.320  -5.753  1.00 31.32  ? 16   MET A O   1 
ATOM   102  C  CB  . MET A 1 16  ? -13.659 -6.029  -8.212  1.00 32.27  ? 16   MET A CB  1 
ATOM   103  C  CG  . MET A 1 16  ? -13.200 -7.401  -8.650  1.00 39.34  ? 16   MET A CG  1 
ATOM   104  S  SD  . MET A 1 16  ? -14.613 -8.467  -8.996  1.00 50.79  ? 16   MET A SD  1 
ATOM   105  C  CE  . MET A 1 16  ? -13.777 -9.919  -9.656  1.00 45.21  ? 16   MET A CE  1 
ATOM   106  N  N   . GLY A 1 17  ? -13.802 -7.638  -5.053  1.00 32.41  ? 17   GLY A N   1 
ATOM   107  C  CA  . GLY A 1 17  ? -12.996 -8.400  -4.119  1.00 32.69  ? 17   GLY A CA  1 
ATOM   108  C  C   . GLY A 1 17  ? -12.264 -9.554  -4.778  1.00 40.20  ? 17   GLY A C   1 
ATOM   109  O  O   . GLY A 1 17  ? -12.113 -9.617  -6.000  1.00 35.79  ? 17   GLY A O   1 
ATOM   110  N  N   . THR A 1 18  ? -11.808 -10.492 -3.945  1.00 31.92  ? 18   THR A N   1 
ATOM   111  C  CA  . THR A 1 18  ? -11.016 -11.627 -4.405  1.00 34.14  ? 18   THR A CA  1 
ATOM   112  C  C   . THR A 1 18  ? -11.399 -12.869 -3.607  1.00 37.91  ? 18   THR A C   1 
ATOM   113  O  O   . THR A 1 18  ? -11.810 -12.776 -2.445  1.00 38.70  ? 18   THR A O   1 
ATOM   114  C  CB  . THR A 1 18  ? -9.504  -11.338 -4.280  1.00 37.89  ? 18   THR A CB  1 
ATOM   115  O  OG1 . THR A 1 18  ? -8.753  -12.459 -4.755  1.00 40.52  ? 18   THR A OG1 1 
ATOM   116  C  CG2 . THR A 1 18  ? -9.116  -11.068 -2.818  1.00 36.21  ? 18   THR A CG2 1 
ATOM   117  N  N   . ARG A 1 19  ? -11.293 -14.034 -4.244  1.00 38.85  ? 19   ARG A N   1 
ATOM   118  C  CA  A ARG A 1 19  ? -11.612 -15.300 -3.595  0.61 39.38  ? 19   ARG A CA  1 
ATOM   119  C  CA  B ARG A 1 19  ? -11.611 -15.303 -3.601  0.39 39.40  ? 19   ARG A CA  1 
ATOM   120  C  C   . ARG A 1 19  ? -10.347 -15.847 -2.944  1.00 40.30  ? 19   ARG A C   1 
ATOM   121  O  O   . ARG A 1 19  ? -9.350  -16.103 -3.626  1.00 39.03  ? 19   ARG A O   1 
ATOM   122  C  CB  A ARG A 1 19  ? -12.194 -16.302 -4.592  0.61 41.56  ? 19   ARG A CB  1 
ATOM   123  C  CB  B ARG A 1 19  ? -12.177 -16.295 -4.618  0.39 41.56  ? 19   ARG A CB  1 
ATOM   124  C  CG  A ARG A 1 19  ? -12.754 -17.574 -3.959  0.61 42.09  ? 19   ARG A CG  1 
ATOM   125  C  CG  B ARG A 1 19  ? -12.821 -17.539 -4.019  0.39 42.10  ? 19   ARG A CG  1 
ATOM   126  C  CD  A ARG A 1 19  ? -13.941 -18.116 -4.759  0.61 42.72  ? 19   ARG A CD  1 
ATOM   127  C  CD  B ARG A 1 19  ? -12.914 -18.656 -5.052  0.39 43.23  ? 19   ARG A CD  1 
ATOM   128  N  NE  A ARG A 1 19  ? -14.328 -19.470 -4.357  0.61 42.97  ? 19   ARG A NE  1 
ATOM   129  N  NE  B ARG A 1 19  ? -13.657 -19.816 -4.564  0.39 43.74  ? 19   ARG A NE  1 
ATOM   130  C  CZ  A ARG A 1 19  ? -15.275 -19.753 -3.466  0.61 43.13  ? 19   ARG A CZ  1 
ATOM   131  C  CZ  B ARG A 1 19  ? -13.337 -21.076 -4.839  0.39 44.40  ? 19   ARG A CZ  1 
ATOM   132  N  NH1 A ARG A 1 19  ? -15.945 -18.776 -2.869  0.61 40.95  ? 19   ARG A NH1 1 
ATOM   133  N  NH1 B ARG A 1 19  ? -12.278 -21.342 -5.593  0.39 42.11  ? 19   ARG A NH1 1 
ATOM   134  N  NH2 A ARG A 1 19  ? -15.555 -21.016 -3.174  0.61 44.18  ? 19   ARG A NH2 1 
ATOM   135  N  NH2 B ARG A 1 19  ? -14.070 -22.069 -4.356  0.39 44.10  ? 19   ARG A NH2 1 
ATOM   136  N  N   . VAL A 1 20  ? -10.382 -16.009 -1.622  1.00 41.33  ? 20   VAL A N   1 
ATOM   137  C  CA  . VAL A 1 20  ? -9.176  -16.402 -0.894  1.00 41.71  ? 20   VAL A CA  1 
ATOM   138  C  C   . VAL A 1 20  ? -9.332  -17.795 -0.296  1.00 37.60  ? 20   VAL A C   1 
ATOM   139  O  O   . VAL A 1 20  ? -10.432 -18.179 0.123   1.00 37.70  ? 20   VAL A O   1 
ATOM   140  C  CB  . VAL A 1 20  ? -8.818  -15.375 0.197   1.00 42.94  ? 20   VAL A CB  1 
ATOM   141  C  CG1 . VAL A 1 20  ? -8.513  -14.019 -0.423  1.00 41.65  ? 20   VAL A CG1 1 
ATOM   142  C  CG2 . VAL A 1 20  ? -9.926  -15.258 1.226   1.00 37.33  ? 20   VAL A CG2 1 
ATOM   143  N  N   . PRO A 1 21  ? -8.260  -18.579 -0.228  1.00 38.25  ? 21   PRO A N   1 
ATOM   144  C  CA  . PRO A 1 21  ? -8.341  -19.861 0.472   1.00 40.85  ? 21   PRO A CA  1 
ATOM   145  C  C   . PRO A 1 21  ? -8.385  -19.640 1.975   1.00 36.53  ? 21   PRO A C   1 
ATOM   146  O  O   . PRO A 1 21  ? -7.702  -18.767 2.518   1.00 39.44  ? 21   PRO A O   1 
ATOM   147  C  CB  . PRO A 1 21  ? -7.057  -20.587 0.054   1.00 37.94  ? 21   PRO A CB  1 
ATOM   148  C  CG  . PRO A 1 21  ? -6.258  -19.595 -0.759  1.00 48.93  ? 21   PRO A CG  1 
ATOM   149  C  CD  . PRO A 1 21  ? -6.883  -18.251 -0.615  1.00 38.43  ? 21   PRO A CD  1 
ATOM   150  N  N   . VAL A 1 22  ? -9.211  -20.431 2.647   1.00 38.15  ? 22   VAL A N   1 
ATOM   151  C  CA  . VAL A 1 22  ? -9.232  -20.466 4.105   1.00 38.92  ? 22   VAL A CA  1 
ATOM   152  C  C   . VAL A 1 22  ? -9.397  -21.923 4.516   1.00 42.96  ? 22   VAL A C   1 
ATOM   153  O  O   . VAL A 1 22  ? -10.429 -22.544 4.229   1.00 40.29  ? 22   VAL A O   1 
ATOM   154  C  CB  . VAL A 1 22  ? -10.333 -19.577 4.715   1.00 36.42  ? 22   VAL A CB  1 
ATOM   155  C  CG1 . VAL A 1 22  ? -11.686 -19.811 4.052   1.00 37.16  ? 22   VAL A CG1 1 
ATOM   156  C  CG2 . VAL A 1 22  ? -10.417 -19.800 6.226   1.00 33.87  ? 22   VAL A CG2 1 
ATOM   157  N  N   . LEU A 1 23  ? -8.363  -22.477 5.151   1.00 42.80  ? 23   LEU A N   1 
ATOM   158  C  CA  . LEU A 1 23  ? -8.305  -23.886 5.554   1.00 51.85  ? 23   LEU A CA  1 
ATOM   159  C  C   . LEU A 1 23  ? -8.520  -24.725 4.300   1.00 52.48  ? 23   LEU A C   1 
ATOM   160  O  O   . LEU A 1 23  ? -7.754  -24.560 3.334   1.00 54.55  ? 23   LEU A O   1 
ATOM   161  C  CB  . LEU A 1 23  ? -9.278  -24.115 6.714   1.00 47.77  ? 23   LEU A CB  1 
ATOM   162  C  CG  . LEU A 1 23  ? -9.014  -23.161 7.887   1.00 48.10  ? 23   LEU A CG  1 
ATOM   163  C  CD1 . LEU A 1 23  ? -10.025 -23.330 9.007   1.00 47.03  ? 23   LEU A CD1 1 
ATOM   164  C  CD2 . LEU A 1 23  ? -7.595  -23.332 8.419   1.00 46.50  ? 23   LEU A CD2 1 
ATOM   165  N  N   . SER A 1 24  ? -9.512  -25.606 4.247   1.00 52.99  ? 24   SER A N   1 
ATOM   166  C  CA  . SER A 1 24  ? -9.766  -26.386 3.045   1.00 50.50  ? 24   SER A CA  1 
ATOM   167  C  C   . SER A 1 24  ? -10.849 -25.776 2.168   1.00 51.78  ? 24   SER A C   1 
ATOM   168  O  O   . SER A 1 24  ? -11.284 -26.417 1.207   1.00 54.30  ? 24   SER A O   1 
ATOM   169  C  CB  . SER A 1 24  ? -10.141 -27.820 3.419   1.00 55.86  ? 24   SER A CB  1 
ATOM   170  O  OG  . SER A 1 24  ? -9.047  -28.485 4.023   1.00 58.53  ? 24   SER A OG  1 
ATOM   171  N  N   . SER A 1 25  ? -11.284 -24.551 2.469   1.00 49.07  ? 25   SER A N   1 
ATOM   172  C  CA  . SER A 1 25  ? -12.398 -23.924 1.765   1.00 45.60  ? 25   SER A CA  1 
ATOM   173  C  C   . SER A 1 25  ? -11.993 -22.576 1.177   1.00 41.26  ? 25   SER A C   1 
ATOM   174  O  O   . SER A 1 25  ? -10.812 -22.335 0.914   1.00 44.46  ? 25   SER A O   1 
ATOM   175  C  CB  . SER A 1 25  ? -13.585 -23.756 2.717   1.00 46.80  ? 25   SER A CB  1 
ATOM   176  O  OG  . SER A 1 25  ? -14.805 -23.633 2.015   1.00 51.88  ? 25   SER A OG  1 
ATOM   177  N  N   . HIS A 1 26  ? -12.965 -21.689 0.972   1.00 38.32  ? 26   HIS A N   1 
ATOM   178  C  CA  . HIS A 1 26  ? -12.702 -20.360 0.438   1.00 37.81  ? 26   HIS A CA  1 
ATOM   179  C  C   . HIS A 1 26  ? -13.748 -19.399 0.981   1.00 39.28  ? 26   HIS A C   1 
ATOM   180  O  O   . HIS A 1 26  ? -14.852 -19.802 1.355   1.00 40.62  ? 26   HIS A O   1 
ATOM   181  C  CB  . HIS A 1 26  ? -12.723 -20.344 -1.107  1.00 40.39  ? 26   HIS A CB  1 
ATOM   182  C  CG  . HIS A 1 26  ? -11.714 -21.252 -1.742  1.00 45.25  ? 26   HIS A CG  1 
ATOM   183  N  ND1 . HIS A 1 26  ? -12.003 -22.553 -2.099  1.00 48.07  ? 26   HIS A ND1 1 
ATOM   184  C  CD2 . HIS A 1 26  ? -10.421 -21.046 -2.092  1.00 45.69  ? 26   HIS A CD2 1 
ATOM   185  C  CE1 . HIS A 1 26  ? -10.930 -23.110 -2.633  1.00 48.65  ? 26   HIS A CE1 1 
ATOM   186  N  NE2 . HIS A 1 26  ? -9.957  -22.217 -2.643  1.00 47.37  ? 26   HIS A NE2 1 
ATOM   187  N  N   . ILE A 1 27  ? -13.388 -18.117 1.030   1.00 34.43  ? 27   ILE A N   1 
ATOM   188  C  CA  . ILE A 1 27  ? -14.323 -17.037 1.316   1.00 34.76  ? 27   ILE A CA  1 
ATOM   189  C  C   . ILE A 1 27  ? -13.927 -15.830 0.473   1.00 35.44  ? 27   ILE A C   1 
ATOM   190  O  O   . ILE A 1 27  ? -12.908 -15.839 -0.221  1.00 34.17  ? 27   ILE A O   1 
ATOM   191  C  CB  . ILE A 1 27  ? -14.371 -16.660 2.817   1.00 35.14  ? 27   ILE A CB  1 
ATOM   192  C  CG1 . ILE A 1 27  ? -12.993 -16.268 3.331   1.00 35.34  ? 27   ILE A CG1 1 
ATOM   193  C  CG2 . ILE A 1 27  ? -14.961 -17.789 3.664   1.00 40.31  ? 27   ILE A CG2 1 
ATOM   194  C  CD1 . ILE A 1 27  ? -13.058 -15.711 4.737   1.00 43.85  ? 27   ILE A CD1 1 
ATOM   195  N  N   . SER A 1 28  ? -14.737 -14.777 0.550   1.00 30.29  ? 28   SER A N   1 
ATOM   196  C  CA  . SER A 1 28  ? -14.519 -13.559 -0.220  1.00 34.51  ? 28   SER A CA  1 
ATOM   197  C  C   . SER A 1 28  ? -13.811 -12.510 0.628   1.00 34.98  ? 28   SER A C   1 
ATOM   198  O  O   . SER A 1 28  ? -14.133 -12.326 1.805   1.00 31.86  ? 28   SER A O   1 
ATOM   199  C  CB  . SER A 1 28  ? -15.849 -12.996 -0.730  1.00 35.37  ? 28   SER A CB  1 
ATOM   200  O  OG  . SER A 1 28  ? -16.598 -13.990 -1.413  1.00 37.45  ? 28   SER A OG  1 
ATOM   201  N  N   . ALA A 1 29  ? -12.851 -11.815 0.024   1.00 32.22  ? 29   ALA A N   1 
ATOM   202  C  CA  . ALA A 1 29  ? -12.113 -10.766 0.712   1.00 32.86  ? 29   ALA A CA  1 
ATOM   203  C  C   . ALA A 1 29  ? -12.146 -9.491  -0.114  1.00 34.32  ? 29   ALA A C   1 
ATOM   204  O  O   . ALA A 1 29  ? -11.888 -9.517  -1.323  1.00 32.55  ? 29   ALA A O   1 
ATOM   205  C  CB  . ALA A 1 29  ? -10.667 -11.189 0.982   1.00 33.80  ? 29   ALA A CB  1 
ATOM   206  N  N   . PHE A 1 30  ? -12.472 -8.382  0.537   1.00 28.06  ? 30   PHE A N   1 
ATOM   207  C  CA  . PHE A 1 30  ? -12.449 -7.064  -0.089  1.00 30.93  ? 30   PHE A CA  1 
ATOM   208  C  C   . PHE A 1 30  ? -11.429 -6.246  0.692   1.00 29.82  ? 30   PHE A C   1 
ATOM   209  O  O   . PHE A 1 30  ? -11.714 -5.788  1.807   1.00 29.21  ? 30   PHE A O   1 
ATOM   210  C  CB  . PHE A 1 30  ? -13.830 -6.424  -0.079  1.00 27.96  ? 30   PHE A CB  1 
ATOM   211  C  CG  . PHE A 1 30  ? -14.895 -7.270  -0.720  1.00 31.12  ? 30   PHE A CG  1 
ATOM   212  C  CD1 . PHE A 1 30  ? -15.490 -8.313  -0.022  1.00 29.59  ? 30   PHE A CD1 1 
ATOM   213  C  CD2 . PHE A 1 30  ? -15.301 -7.026  -2.026  1.00 27.35  ? 30   PHE A CD2 1 
ATOM   214  C  CE1 . PHE A 1 30  ? -16.477 -9.095  -0.612  1.00 32.37  ? 30   PHE A CE1 1 
ATOM   215  C  CE2 . PHE A 1 30  ? -16.290 -7.805  -2.624  1.00 28.65  ? 30   PHE A CE2 1 
ATOM   216  C  CZ  . PHE A 1 30  ? -16.875 -8.840  -1.923  1.00 31.15  ? 30   PHE A CZ  1 
ATOM   217  N  N   . LEU A 1 31  ? -10.245 -6.078  0.110   1.00 26.84  ? 31   LEU A N   1 
ATOM   218  C  CA  . LEU A 1 31  ? -9.098  -5.500  0.795   1.00 27.55  ? 31   LEU A CA  1 
ATOM   219  C  C   . LEU A 1 31  ? -8.858  -4.085  0.299   1.00 28.42  ? 31   LEU A C   1 
ATOM   220  O  O   . LEU A 1 31  ? -8.867  -3.835  -0.913  1.00 29.26  ? 31   LEU A O   1 
ATOM   221  C  CB  . LEU A 1 31  ? -7.844  -6.358  0.584   1.00 24.26  ? 31   LEU A CB  1 
ATOM   222  C  CG  . LEU A 1 31  ? -7.962  -7.844  0.939   1.00 26.44  ? 31   LEU A CG  1 
ATOM   223  C  CD1 . LEU A 1 31  ? -6.659  -8.571  0.667   1.00 29.89  ? 31   LEU A CD1 1 
ATOM   224  C  CD2 . LEU A 1 31  ? -8.420  -8.055  2.406   1.00 28.77  ? 31   LEU A CD2 1 
ATOM   225  N  N   . GLY A 1 32  ? -8.648  -3.166  1.234   1.00 26.17  ? 32   GLY A N   1 
ATOM   226  C  CA  . GLY A 1 32  ? -8.276  -1.803  0.901   1.00 25.64  ? 32   GLY A CA  1 
ATOM   227  C  C   . GLY A 1 32  ? -9.379  -0.956  0.300   1.00 28.84  ? 32   GLY A C   1 
ATOM   228  O  O   . GLY A 1 32  ? -9.111  -0.155  -0.604  1.00 28.73  ? 32   GLY A O   1 
ATOM   229  N  N   . ILE A 1 33  ? -10.609 -1.115  0.774   1.00 22.66  ? 33   ILE A N   1 
ATOM   230  C  CA  . ILE A 1 33  ? -11.701 -0.226  0.362   1.00 24.54  ? 33   ILE A CA  1 
ATOM   231  C  C   . ILE A 1 33  ? -11.514 1.128   1.032   1.00 25.96  ? 33   ILE A C   1 
ATOM   232  O  O   . ILE A 1 33  ? -11.350 1.184   2.269   1.00 23.27  ? 33   ILE A O   1 
ATOM   233  C  CB  . ILE A 1 33  ? -13.054 -0.826  0.748   1.00 25.73  ? 33   ILE A CB  1 
ATOM   234  C  CG1 . ILE A 1 33  ? -13.333 -2.140  0.025   1.00 25.08  ? 33   ILE A CG1 1 
ATOM   235  C  CG2 . ILE A 1 33  ? -14.185 0.173   0.500   1.00 24.24  ? 33   ILE A CG2 1 
ATOM   236  C  CD1 . ILE A 1 33  ? -14.529 -2.876  0.658   1.00 24.33  ? 33   ILE A CD1 1 
ATOM   237  N  N   . PRO A 1 34  ? -11.569 2.233   0.294   1.00 23.25  ? 34   PRO A N   1 
ATOM   238  C  CA  . PRO A 1 34  ? -11.388 3.545   0.925   1.00 23.73  ? 34   PRO A CA  1 
ATOM   239  C  C   . PRO A 1 34  ? -12.664 4.014   1.599   1.00 26.11  ? 34   PRO A C   1 
ATOM   240  O  O   . PRO A 1 34  ? -13.766 3.849   1.070   1.00 25.36  ? 34   PRO A O   1 
ATOM   241  C  CB  . PRO A 1 34  ? -11.012 4.453   -0.252  1.00 25.15  ? 34   PRO A CB  1 
ATOM   242  C  CG  . PRO A 1 34  ? -11.716 3.810   -1.440  1.00 28.29  ? 34   PRO A CG  1 
ATOM   243  C  CD  . PRO A 1 34  ? -11.689 2.324   -1.179  1.00 26.01  ? 34   PRO A CD  1 
ATOM   244  N  N   . PHE A 1 35  ? -12.521 4.590   2.797   1.00 23.40  ? 35   PHE A N   1 
ATOM   245  C  CA  . PHE A 1 35  ? -13.684 5.129   3.479   1.00 20.45  ? 35   PHE A CA  1 
ATOM   246  C  C   . PHE A 1 35  ? -13.566 6.613   3.764   1.00 24.13  ? 35   PHE A C   1 
ATOM   247  O  O   . PHE A 1 35  ? -14.537 7.218   4.231   1.00 27.92  ? 35   PHE A O   1 
ATOM   248  C  CB  . PHE A 1 35  ? -13.974 4.357   4.781   1.00 21.28  ? 35   PHE A CB  1 
ATOM   249  C  CG  . PHE A 1 35  ? -12.906 4.485   5.844   1.00 23.84  ? 35   PHE A CG  1 
ATOM   250  C  CD1 . PHE A 1 35  ? -12.860 5.595   6.685   1.00 19.69  ? 35   PHE A CD1 1 
ATOM   251  C  CD2 . PHE A 1 35  ? -11.959 3.482   6.008   1.00 21.18  ? 35   PHE A CD2 1 
ATOM   252  C  CE1 . PHE A 1 35  ? -11.871 5.696   7.679   1.00 22.19  ? 35   PHE A CE1 1 
ATOM   253  C  CE2 . PHE A 1 35  ? -10.979 3.583   6.999   1.00 21.77  ? 35   PHE A CE2 1 
ATOM   254  C  CZ  . PHE A 1 35  ? -10.939 4.691   7.819   1.00 21.05  ? 35   PHE A CZ  1 
ATOM   255  N  N   . ALA A 1 36  ? -12.423 7.215   3.474   1.00 24.00  ? 36   ALA A N   1 
ATOM   256  C  CA  . ALA A 1 36  ? -12.210 8.634   3.693   1.00 25.93  ? 36   ALA A CA  1 
ATOM   257  C  C   . ALA A 1 36  ? -11.388 9.180   2.537   1.00 24.61  ? 36   ALA A C   1 
ATOM   258  O  O   . ALA A 1 36  ? -10.700 8.434   1.841   1.00 25.61  ? 36   ALA A O   1 
ATOM   259  C  CB  . ALA A 1 36  ? -11.483 8.898   5.019   1.00 26.64  ? 36   ALA A CB  1 
ATOM   260  N  N   . GLU A 1 37  ? -11.454 10.490  2.349   1.00 27.11  ? 37   GLU A N   1 
ATOM   261  C  CA  . GLU A 1 37  ? -10.507 11.142  1.460   1.00 30.20  ? 37   GLU A CA  1 
ATOM   262  C  C   . GLU A 1 37  ? -9.105  11.011  2.054   1.00 29.78  ? 37   GLU A C   1 
ATOM   263  O  O   . GLU A 1 37  ? -8.952  11.041  3.280   1.00 28.96  ? 37   GLU A O   1 
ATOM   264  C  CB  . GLU A 1 37  ? -10.874 12.615  1.278   1.00 30.88  ? 37   GLU A CB  1 
ATOM   265  C  CG  . GLU A 1 37  ? -12.101 12.825  0.397   1.00 29.93  ? 37   GLU A CG  1 
ATOM   266  C  CD  . GLU A 1 37  ? -11.798 12.483  -1.049  1.00 32.78  ? 37   GLU A CD  1 
ATOM   267  O  OE1 . GLU A 1 37  ? -10.983 13.201  -1.657  1.00 32.77  ? 37   GLU A OE1 1 
ATOM   268  O  OE2 . GLU A 1 37  ? -12.337 11.481  -1.560  1.00 33.50  ? 37   GLU A OE2 1 
ATOM   269  N  N   . PRO A 1 38  ? -8.075  10.828  1.231   1.00 27.39  ? 38   PRO A N   1 
ATOM   270  C  CA  . PRO A 1 38  ? -6.697  10.787  1.757   1.00 25.33  ? 38   PRO A CA  1 
ATOM   271  C  C   . PRO A 1 38  ? -6.405  12.021  2.589   1.00 25.90  ? 38   PRO A C   1 
ATOM   272  O  O   . PRO A 1 38  ? -6.558  13.149  2.107   1.00 23.51  ? 38   PRO A O   1 
ATOM   273  C  CB  . PRO A 1 38  ? -5.832  10.752  0.490   1.00 29.45  ? 38   PRO A CB  1 
ATOM   274  C  CG  . PRO A 1 38  ? -6.726  10.106  -0.543  1.00 26.91  ? 38   PRO A CG  1 
ATOM   275  C  CD  . PRO A 1 38  ? -8.132  10.568  -0.220  1.00 28.43  ? 38   PRO A CD  1 
ATOM   276  N  N   . PRO A 1 39  ? -6.030  11.850  3.873   1.00 27.34  ? 39   PRO A N   1 
ATOM   277  C  CA  . PRO A 1 39  ? -5.761  13.013  4.737   1.00 24.48  ? 39   PRO A CA  1 
ATOM   278  C  C   . PRO A 1 39  ? -4.355  13.567  4.528   1.00 27.66  ? 39   PRO A C   1 
ATOM   279  O  O   . PRO A 1 39  ? -3.536  13.627  5.442   1.00 26.86  ? 39   PRO A O   1 
ATOM   280  C  CB  . PRO A 1 39  ? -5.960  12.427  6.141   1.00 24.00  ? 39   PRO A CB  1 
ATOM   281  C  CG  . PRO A 1 39  ? -5.516  11.015  6.009   1.00 24.46  ? 39   PRO A CG  1 
ATOM   282  C  CD  . PRO A 1 39  ? -5.929  10.578  4.612   1.00 28.16  ? 39   PRO A CD  1 
ATOM   283  N  N   . VAL A 1 40  ? -4.064  13.986  3.299   1.00 29.08  ? 40   VAL A N   1 
ATOM   284  C  CA  . VAL A 1 40  ? -2.713  14.382  2.933   1.00 26.51  ? 40   VAL A CA  1 
ATOM   285  C  C   . VAL A 1 40  ? -2.662  15.881  2.675   1.00 30.69  ? 40   VAL A C   1 
ATOM   286  O  O   . VAL A 1 40  ? -3.685  16.544  2.475   1.00 27.85  ? 40   VAL A O   1 
ATOM   287  C  CB  . VAL A 1 40  ? -2.216  13.597  1.709   1.00 32.15  ? 40   VAL A CB  1 
ATOM   288  C  CG1 . VAL A 1 40  ? -2.298  12.116  2.001   1.00 30.32  ? 40   VAL A CG1 1 
ATOM   289  C  CG2 . VAL A 1 40  ? -3.049  13.968  0.478   1.00 30.81  ? 40   VAL A CG2 1 
ATOM   290  N  N   . GLY A 1 41  ? -1.440  16.414  2.682   1.00 32.37  ? 41   GLY A N   1 
ATOM   291  C  CA  . GLY A 1 41  ? -1.241  17.822  2.380   1.00 32.40  ? 41   GLY A CA  1 
ATOM   292  C  C   . GLY A 1 41  ? -1.912  18.711  3.404   1.00 32.16  ? 41   GLY A C   1 
ATOM   293  O  O   . GLY A 1 41  ? -1.723  18.557  4.613   1.00 32.86  ? 41   GLY A O   1 
ATOM   294  N  N   . ASN A 1 42  ? -2.721  19.653  2.919   1.00 35.00  ? 42   ASN A N   1 
ATOM   295  C  CA  . ASN A 1 42  ? -3.465  20.543  3.798   1.00 33.44  ? 42   ASN A CA  1 
ATOM   296  C  C   . ASN A 1 42  ? -4.460  19.807  4.680   1.00 29.76  ? 42   ASN A C   1 
ATOM   297  O  O   . ASN A 1 42  ? -4.981  20.405  5.626   1.00 33.27  ? 42   ASN A O   1 
ATOM   298  C  CB  . ASN A 1 42  ? -4.214  21.597  2.978   1.00 42.74  ? 42   ASN A CB  1 
ATOM   299  C  CG  . ASN A 1 42  ? -3.638  22.986  3.154   1.00 55.63  ? 42   ASN A CG  1 
ATOM   300  O  OD1 . ASN A 1 42  ? -2.434  23.149  3.408   1.00 56.29  ? 42   ASN A OD1 1 
ATOM   301  N  ND2 . ASN A 1 42  ? -4.493  24.004  3.020   1.00 48.84  ? 42   ASN A ND2 1 
ATOM   302  N  N   . MET A 1 43  ? -4.746  18.543  4.401   1.00 27.56  ? 43   MET A N   1 
ATOM   303  C  CA  . MET A 1 43  ? -5.677  17.806  5.241   1.00 27.69  ? 43   MET A CA  1 
ATOM   304  C  C   . MET A 1 43  ? -4.986  17.039  6.365   1.00 27.69  ? 43   MET A C   1 
ATOM   305  O  O   . MET A 1 43  ? -5.673  16.406  7.173   1.00 26.97  ? 43   MET A O   1 
ATOM   306  C  CB  . MET A 1 43  ? -6.516  16.866  4.382   1.00 27.93  ? 43   MET A CB  1 
ATOM   307  C  CG  . MET A 1 43  ? -7.391  17.654  3.403   1.00 34.04  ? 43   MET A CG  1 
ATOM   308  S  SD  . MET A 1 43  ? -8.463  16.615  2.425   1.00 49.95  ? 43   MET A SD  1 
ATOM   309  C  CE  . MET A 1 43  ? -9.631  16.087  3.671   1.00 39.19  ? 43   MET A CE  1 
ATOM   310  N  N   . ARG A 1 44  ? -3.656  17.082  6.434   1.00 27.32  ? 44   ARG A N   1 
ATOM   311  C  CA  . ARG A 1 44  ? -2.959  16.526  7.584   1.00 25.31  ? 44   ARG A CA  1 
ATOM   312  C  C   . ARG A 1 44  ? -3.416  17.234  8.850   1.00 26.33  ? 44   ARG A C   1 
ATOM   313  O  O   . ARG A 1 44  ? -3.475  18.465  8.896   1.00 25.65  ? 44   ARG A O   1 
ATOM   314  C  CB  . ARG A 1 44  ? -1.439  16.665  7.412   1.00 27.56  ? 44   ARG A CB  1 
ATOM   315  C  CG  . ARG A 1 44  ? -0.641  16.079  8.579   1.00 24.36  ? 44   ARG A CG  1 
ATOM   316  C  CD  . ARG A 1 44  ? 0.852   16.432  8.465   1.00 26.29  ? 44   ARG A CD  1 
ATOM   317  N  NE  . ARG A 1 44  ? 1.532   15.641  7.438   1.00 26.60  ? 44   ARG A NE  1 
ATOM   318  C  CZ  . ARG A 1 44  ? 2.792   15.846  7.052   1.00 27.44  ? 44   ARG A CZ  1 
ATOM   319  N  NH1 . ARG A 1 44  ? 3.500   16.834  7.586   1.00 27.98  ? 44   ARG A NH1 1 
ATOM   320  N  NH2 . ARG A 1 44  ? 3.340   15.072  6.124   1.00 25.33  ? 44   ARG A NH2 1 
ATOM   321  N  N   . PHE A 1 45  ? -3.738  16.441  9.880   1.00 26.49  ? 45   PHE A N   1 
ATOM   322  C  CA  . PHE A 1 45  ? -4.255  16.801  11.200  1.00 24.20  ? 45   PHE A CA  1 
ATOM   323  C  C   . PHE A 1 45  ? -5.734  17.141  11.179  1.00 26.83  ? 45   PHE A C   1 
ATOM   324  O  O   . PHE A 1 45  ? -6.321  17.297  12.242  1.00 24.44  ? 45   PHE A O   1 
ATOM   325  C  CB  . PHE A 1 45  ? -3.504  17.968  11.871  1.00 28.32  ? 45   PHE A CB  1 
ATOM   326  C  CG  . PHE A 1 45  ? -2.016  17.814  11.847  1.00 26.72  ? 45   PHE A CG  1 
ATOM   327  C  CD1 . PHE A 1 45  ? -1.410  16.702  12.424  1.00 27.25  ? 45   PHE A CD1 1 
ATOM   328  C  CD2 . PHE A 1 45  ? -1.221  18.779  11.260  1.00 27.18  ? 45   PHE A CD2 1 
ATOM   329  C  CE1 . PHE A 1 45  ? -0.031  16.553  12.404  1.00 28.16  ? 45   PHE A CE1 1 
ATOM   330  C  CE2 . PHE A 1 45  ? 0.164   18.640  11.227  1.00 28.81  ? 45   PHE A CE2 1 
ATOM   331  C  CZ  . PHE A 1 45  ? 0.760   17.526  11.801  1.00 30.47  ? 45   PHE A CZ  1 
ATOM   332  N  N   . ARG A 1 46  ? -6.364  17.253  10.020  1.00 25.63  ? 46   ARG A N   1 
ATOM   333  C  CA  A ARG A 1 46  ? -7.757  17.661  9.949   0.62 28.30  ? 46   ARG A CA  1 
ATOM   334  C  CA  B ARG A 1 46  ? -7.756  17.665  9.997   0.38 28.30  ? 46   ARG A CA  1 
ATOM   335  C  C   . ARG A 1 46  ? -8.680  16.468  10.188  1.00 24.71  ? 46   ARG A C   1 
ATOM   336  O  O   . ARG A 1 46  ? -8.296  15.308  10.001  1.00 26.82  ? 46   ARG A O   1 
ATOM   337  C  CB  A ARG A 1 46  ? -8.043  18.292  8.581   0.62 30.61  ? 46   ARG A CB  1 
ATOM   338  C  CB  B ARG A 1 46  ? -8.081  18.389  8.690   0.38 30.66  ? 46   ARG A CB  1 
ATOM   339  C  CG  A ARG A 1 46  ? -9.030  19.444  8.621   0.62 35.72  ? 46   ARG A CG  1 
ATOM   340  C  CG  B ARG A 1 46  ? -8.345  19.869  8.899   0.38 33.85  ? 46   ARG A CG  1 
ATOM   341  C  CD  A ARG A 1 46  ? -9.178  20.122  7.265   0.62 35.94  ? 46   ARG A CD  1 
ATOM   342  C  CD  B ARG A 1 46  ? -8.092  20.686  7.648   0.38 35.39  ? 46   ARG A CD  1 
ATOM   343  N  NE  A ARG A 1 46  ? -8.087  21.049  6.969   0.62 38.47  ? 46   ARG A NE  1 
ATOM   344  N  NE  B ARG A 1 46  ? -8.798  20.192  6.466   0.38 37.04  ? 46   ARG A NE  1 
ATOM   345  C  CZ  A ARG A 1 46  ? -7.798  21.494  5.748   0.62 37.15  ? 46   ARG A CZ  1 
ATOM   346  C  CZ  B ARG A 1 46  ? -10.112 20.273  6.284   0.38 37.75  ? 46   ARG A CZ  1 
ATOM   347  N  NH1 A ARG A 1 46  ? -8.513  21.084  4.705   0.62 30.54  ? 46   ARG A NH1 1 
ATOM   348  N  NH1 B ARG A 1 46  ? -10.886 20.806  7.222   0.38 39.20  ? 46   ARG A NH1 1 
ATOM   349  N  NH2 A ARG A 1 46  ? -6.797  22.347  5.571   0.62 30.46  ? 46   ARG A NH2 1 
ATOM   350  N  NH2 B ARG A 1 46  ? -10.659 19.801  5.168   0.38 36.42  ? 46   ARG A NH2 1 
ATOM   351  N  N   . ARG A 1 47  ? -9.914  16.765  10.594  1.00 23.01  ? 47   ARG A N   1 
ATOM   352  C  CA  . ARG A 1 47  ? -10.932 15.731  10.659  1.00 26.13  ? 47   ARG A CA  1 
ATOM   353  C  C   . ARG A 1 47  ? -11.053 15.059  9.295   1.00 26.67  ? 47   ARG A C   1 
ATOM   354  O  O   . ARG A 1 47  ? -10.844 15.703  8.257   1.00 27.95  ? 47   ARG A O   1 
ATOM   355  C  CB  . ARG A 1 47  ? -12.289 16.321  11.052  1.00 29.75  ? 47   ARG A CB  1 
ATOM   356  C  CG  . ARG A 1 47  ? -12.323 16.938  12.422  1.00 36.93  ? 47   ARG A CG  1 
ATOM   357  C  CD  . ARG A 1 47  ? -13.733 17.369  12.811  1.00 41.36  ? 47   ARG A CD  1 
ATOM   358  N  NE  . ARG A 1 47  ? -13.766 17.820  14.198  1.00 45.95  ? 47   ARG A NE  1 
ATOM   359  C  CZ  . ARG A 1 47  ? -13.424 19.043  14.589  1.00 47.32  ? 47   ARG A CZ  1 
ATOM   360  N  NH1 . ARG A 1 47  ? -13.036 19.946  13.691  1.00 46.17  ? 47   ARG A NH1 1 
ATOM   361  N  NH2 . ARG A 1 47  ? -13.476 19.364  15.876  1.00 45.87  ? 47   ARG A NH2 1 
ATOM   362  N  N   . PRO A 1 48  ? -11.371 13.767  9.258   1.00 25.41  ? 48   PRO A N   1 
ATOM   363  C  CA  . PRO A 1 48  ? -11.517 13.098  7.964   1.00 25.32  ? 48   PRO A CA  1 
ATOM   364  C  C   . PRO A 1 48  ? -12.758 13.590  7.237   1.00 26.99  ? 48   PRO A C   1 
ATOM   365  O  O   . PRO A 1 48  ? -13.728 14.047  7.850   1.00 27.46  ? 48   PRO A O   1 
ATOM   366  C  CB  . PRO A 1 48  ? -11.651 11.622  8.337   1.00 21.50  ? 48   PRO A CB  1 
ATOM   367  C  CG  . PRO A 1 48  ? -12.315 11.665  9.701   1.00 23.18  ? 48   PRO A CG  1 
ATOM   368  C  CD  . PRO A 1 48  ? -11.711 12.874  10.382  1.00 24.16  ? 48   PRO A CD  1 
ATOM   369  N  N   . GLU A 1 49  ? -12.710 13.501  5.929   1.00 28.00  ? 49   GLU A N   1 
ATOM   370  C  CA  . GLU A 1 49  ? -13.826 13.786  5.036   1.00 29.86  ? 49   GLU A CA  1 
ATOM   371  C  C   . GLU A 1 49  ? -14.234 12.512  4.308   1.00 28.26  ? 49   GLU A C   1 
ATOM   372  O  O   . GLU A 1 49  ? -13.363 11.710  3.949   1.00 29.76  ? 49   GLU A O   1 
ATOM   373  C  CB  . GLU A 1 49  ? -13.458 14.859  3.998   1.00 29.52  ? 49   GLU A CB  1 
ATOM   374  C  CG  . GLU A 1 49  ? -13.149 16.242  4.575   1.00 36.86  ? 49   GLU A CG  1 
ATOM   375  C  CD  . GLU A 1 49  ? -14.328 16.868  5.305   1.00 38.86  ? 49   GLU A CD  1 
ATOM   376  O  OE1 . GLU A 1 49  ? -15.486 16.596  4.923   1.00 44.92  ? 49   GLU A OE1 1 
ATOM   377  O  OE2 . GLU A 1 49  ? -14.099 17.636  6.267   1.00 44.93  ? 49   GLU A OE2 1 
ATOM   378  N  N   . PRO A 1 50  ? -15.534 12.281  4.091   1.00 30.78  ? 50   PRO A N   1 
ATOM   379  C  CA  . PRO A 1 50  ? -15.962 11.049  3.418   1.00 28.63  ? 50   PRO A CA  1 
ATOM   380  C  C   . PRO A 1 50  ? -15.292 10.911  2.060   1.00 28.23  ? 50   PRO A C   1 
ATOM   381  O  O   . PRO A 1 50  ? -15.002 11.902  1.393   1.00 28.76  ? 50   PRO A O   1 
ATOM   382  C  CB  . PRO A 1 50  ? -17.478 11.229  3.273   1.00 29.45  ? 50   PRO A CB  1 
ATOM   383  C  CG  . PRO A 1 50  ? -17.846 12.198  4.338   1.00 33.12  ? 50   PRO A CG  1 
ATOM   384  C  CD  . PRO A 1 50  ? -16.679 13.143  4.431   1.00 31.17  ? 50   PRO A CD  1 
ATOM   385  N  N   . LYS A 1 51  ? -15.011 9.669   1.678   1.00 26.31  ? 51   LYS A N   1 
ATOM   386  C  CA  . LYS A 1 51  ? -14.415 9.401   0.382   1.00 26.65  ? 51   LYS A CA  1 
ATOM   387  C  C   . LYS A 1 51  ? -15.407 9.771   -0.714  1.00 33.23  ? 51   LYS A C   1 
ATOM   388  O  O   . LYS A 1 51  ? -16.561 9.332   -0.687  1.00 29.40  ? 51   LYS A O   1 
ATOM   389  C  CB  . LYS A 1 51  ? -14.026 7.929   0.272   1.00 29.98  ? 51   LYS A CB  1 
ATOM   390  C  CG  . LYS A 1 51  ? -13.624 7.482   -1.131  1.00 29.16  ? 51   LYS A CG  1 
ATOM   391  C  CD  . LYS A 1 51  ? -12.257 8.039   -1.522  1.00 30.06  ? 51   LYS A CD  1 
ATOM   392  C  CE  . LYS A 1 51  ? -11.777 7.483   -2.865  1.00 26.67  ? 51   LYS A CE  1 
ATOM   393  N  NZ  . LYS A 1 51  ? -10.422 7.988   -3.179  1.00 29.35  ? 51   LYS A NZ  1 
ATOM   394  N  N   . LYS A 1 52  ? -14.971 10.600  -1.660  1.00 31.26  ? 52   LYS A N   1 
ATOM   395  C  CA  . LYS A 1 52  ? -15.849 10.966  -2.766  1.00 32.99  ? 52   LYS A CA  1 
ATOM   396  C  C   . LYS A 1 52  ? -16.112 9.742   -3.642  1.00 30.04  ? 52   LYS A C   1 
ATOM   397  O  O   . LYS A 1 52  ? -15.204 8.936   -3.876  1.00 30.11  ? 52   LYS A O   1 
ATOM   398  C  CB  . LYS A 1 52  ? -15.239 12.090  -3.606  1.00 35.15  ? 52   LYS A CB  1 
ATOM   399  C  CG  . LYS A 1 52  ? -14.674 13.256  -2.800  1.00 45.12  ? 52   LYS A CG  1 
ATOM   400  C  CD  . LYS A 1 52  ? -14.899 14.585  -3.514  1.00 49.74  ? 52   LYS A CD  1 
ATOM   401  C  CE  . LYS A 1 52  ? -13.872 15.633  -3.101  1.00 48.12  ? 52   LYS A CE  1 
ATOM   402  N  NZ  . LYS A 1 52  ? -12.588 15.517  -3.867  1.00 50.78  ? 52   LYS A NZ  1 
ATOM   403  N  N   . PRO A 1 53  ? -17.339 9.575   -4.133  1.00 34.73  ? 53   PRO A N   1 
ATOM   404  C  CA  . PRO A 1 53  ? -17.643 8.425   -4.991  1.00 33.92  ? 53   PRO A CA  1 
ATOM   405  C  C   . PRO A 1 53  ? -16.758 8.387   -6.226  1.00 34.50  ? 53   PRO A C   1 
ATOM   406  O  O   . PRO A 1 53  ? -16.351 9.419   -6.761  1.00 34.60  ? 53   PRO A O   1 
ATOM   407  C  CB  . PRO A 1 53  ? -19.114 8.643   -5.361  1.00 37.48  ? 53   PRO A CB  1 
ATOM   408  C  CG  . PRO A 1 53  ? -19.670 9.357   -4.159  1.00 45.78  ? 53   PRO A CG  1 
ATOM   409  C  CD  . PRO A 1 53  ? -18.559 10.282  -3.702  1.00 39.36  ? 53   PRO A CD  1 
ATOM   410  N  N   . TRP A 1 54  ? -16.446 7.172   -6.656  1.00 31.47  ? 54   TRP A N   1 
ATOM   411  C  CA  . TRP A 1 54  ? -15.611 6.928   -7.817  1.00 37.55  ? 54   TRP A CA  1 
ATOM   412  C  C   . TRP A 1 54  ? -16.425 6.214   -8.889  1.00 38.28  ? 54   TRP A C   1 
ATOM   413  O  O   . TRP A 1 54  ? -17.406 5.527   -8.592  1.00 36.34  ? 54   TRP A O   1 
ATOM   414  C  CB  . TRP A 1 54  ? -14.391 6.088   -7.441  1.00 33.66  ? 54   TRP A CB  1 
ATOM   415  C  CG  . TRP A 1 54  ? -14.764 4.773   -6.833  1.00 33.36  ? 54   TRP A CG  1 
ATOM   416  C  CD1 . TRP A 1 54  ? -14.966 3.597   -7.489  1.00 31.51  ? 54   TRP A CD1 1 
ATOM   417  C  CD2 . TRP A 1 54  ? -14.989 4.502   -5.443  1.00 29.42  ? 54   TRP A CD2 1 
ATOM   418  N  NE1 . TRP A 1 54  ? -15.308 2.607   -6.597  1.00 32.09  ? 54   TRP A NE1 1 
ATOM   419  C  CE2 . TRP A 1 54  ? -15.327 3.136   -5.334  1.00 30.08  ? 54   TRP A CE2 1 
ATOM   420  C  CE3 . TRP A 1 54  ? -14.935 5.281   -4.286  1.00 31.50  ? 54   TRP A CE3 1 
ATOM   421  C  CZ2 . TRP A 1 54  ? -15.612 2.529   -4.110  1.00 35.40  ? 54   TRP A CZ2 1 
ATOM   422  C  CZ3 . TRP A 1 54  ? -15.222 4.676   -3.059  1.00 31.98  ? 54   TRP A CZ3 1 
ATOM   423  C  CH2 . TRP A 1 54  ? -15.550 3.313   -2.984  1.00 28.38  ? 54   TRP A CH2 1 
ATOM   424  N  N   . SER A 1 55  ? -16.025 6.394   -10.141 1.00 39.03  ? 55   SER A N   1 
ATOM   425  C  CA  . SER A 1 55  ? -16.597 5.592   -11.205 1.00 38.92  ? 55   SER A CA  1 
ATOM   426  C  C   . SER A 1 55  ? -15.708 4.377   -11.445 1.00 36.57  ? 55   SER A C   1 
ATOM   427  O  O   . SER A 1 55  ? -14.595 4.280   -10.928 1.00 37.57  ? 55   SER A O   1 
ATOM   428  C  CB  . SER A 1 55  ? -16.768 6.427   -12.475 1.00 42.22  ? 55   SER A CB  1 
ATOM   429  O  OG  . SER A 1 55  ? -15.605 7.192   -12.723 1.00 44.31  ? 55   SER A OG  1 
ATOM   430  N  N   . GLY A 1 56  ? -16.214 3.433   -12.223 1.00 38.25  ? 56   GLY A N   1 
ATOM   431  C  CA  . GLY A 1 56  ? -15.461 2.221   -12.435 1.00 38.36  ? 56   GLY A CA  1 
ATOM   432  C  C   . GLY A 1 56  ? -15.429 1.354   -11.184 1.00 37.71  ? 56   GLY A C   1 
ATOM   433  O  O   . GLY A 1 56  ? -16.150 1.570   -10.212 1.00 36.27  ? 56   GLY A O   1 
ATOM   434  N  N   . VAL A 1 57  ? -14.556 0.355   -11.227 1.00 34.14  ? 57   VAL A N   1 
ATOM   435  C  CA  . VAL A 1 57  ? -14.527 -0.702  -10.224 1.00 35.98  ? 57   VAL A CA  1 
ATOM   436  C  C   . VAL A 1 57  ? -13.259 -0.553  -9.400  1.00 34.66  ? 57   VAL A C   1 
ATOM   437  O  O   . VAL A 1 57  ? -12.145 -0.656  -9.929  1.00 31.87  ? 57   VAL A O   1 
ATOM   438  C  CB  . VAL A 1 57  ? -14.608 -2.090  -10.870 1.00 39.87  ? 57   VAL A CB  1 
ATOM   439  C  CG1 . VAL A 1 57  ? -14.811 -3.147  -9.810  1.00 35.09  ? 57   VAL A CG1 1 
ATOM   440  C  CG2 . VAL A 1 57  ? -15.747 -2.124  -11.881 1.00 34.94  ? 57   VAL A CG2 1 
ATOM   441  N  N   . TRP A 1 58  ? -13.429 -0.308  -8.101  1.00 30.83  ? 58   TRP A N   1 
ATOM   442  C  CA  . TRP A 1 58  ? -12.282 -0.257  -7.203  1.00 31.04  ? 58   TRP A CA  1 
ATOM   443  C  C   . TRP A 1 58  ? -11.706 -1.656  -7.048  1.00 28.27  ? 58   TRP A C   1 
ATOM   444  O  O   . TRP A 1 58  ? -12.419 -2.593  -6.677  1.00 32.30  ? 58   TRP A O   1 
ATOM   445  C  CB  . TRP A 1 58  ? -12.678 0.319   -5.845  1.00 29.82  ? 58   TRP A CB  1 
ATOM   446  C  CG  . TRP A 1 58  ? -11.470 0.671   -5.012  1.00 29.83  ? 58   TRP A CG  1 
ATOM   447  C  CD1 . TRP A 1 58  ? -10.708 -0.185  -4.267  1.00 28.97  ? 58   TRP A CD1 1 
ATOM   448  C  CD2 . TRP A 1 58  ? -10.878 1.968   -4.863  1.00 28.60  ? 58   TRP A CD2 1 
ATOM   449  N  NE1 . TRP A 1 58  ? -9.677  0.500   -3.664  1.00 28.72  ? 58   TRP A NE1 1 
ATOM   450  C  CE2 . TRP A 1 58  ? -9.758  1.823   -4.016  1.00 30.00  ? 58   TRP A CE2 1 
ATOM   451  C  CE3 . TRP A 1 58  ? -11.191 3.238   -5.352  1.00 32.96  ? 58   TRP A CE3 1 
ATOM   452  C  CZ2 . TRP A 1 58  ? -8.953  2.898   -3.655  1.00 27.72  ? 58   TRP A CZ2 1 
ATOM   453  C  CZ3 . TRP A 1 58  ? -10.379 4.307   -4.994  1.00 31.89  ? 58   TRP A CZ3 1 
ATOM   454  C  CH2 . TRP A 1 58  ? -9.283  4.130   -4.146  1.00 29.59  ? 58   TRP A CH2 1 
ATOM   455  N  N   . ASN A 1 59  ? -10.421 -1.795  -7.339  1.00 28.32  ? 59   ASN A N   1 
ATOM   456  C  CA  . ASN A 1 59  ? -9.711  -3.060  -7.185  1.00 34.08  ? 59   ASN A CA  1 
ATOM   457  C  C   . ASN A 1 59  ? -9.451  -3.295  -5.704  1.00 31.42  ? 59   ASN A C   1 
ATOM   458  O  O   . ASN A 1 59  ? -8.523  -2.724  -5.128  1.00 32.64  ? 59   ASN A O   1 
ATOM   459  C  CB  . ASN A 1 59  ? -8.404  -3.035  -7.969  1.00 38.01  ? 59   ASN A CB  1 
ATOM   460  C  CG  . ASN A 1 59  ? -7.733  -4.394  -8.023  1.00 46.06  ? 59   ASN A CG  1 
ATOM   461  O  OD1 . ASN A 1 59  ? -7.905  -5.222  -7.126  1.00 41.71  ? 59   ASN A OD1 1 
ATOM   462  N  ND2 . ASN A 1 59  ? -6.964  -4.634  -9.082  1.00 46.90  ? 59   ASN A ND2 1 
ATOM   463  N  N   . ALA A 1 60  ? -10.262 -4.151  -5.092  1.00 29.53  ? 60   ALA A N   1 
ATOM   464  C  CA  . ALA A 1 60  ? -10.161 -4.467  -3.669  1.00 29.85  ? 60   ALA A CA  1 
ATOM   465  C  C   . ALA A 1 60  ? -9.524  -5.835  -3.446  1.00 28.95  ? 60   ALA A C   1 
ATOM   466  O  O   . ALA A 1 60  ? -9.938  -6.603  -2.576  1.00 32.03  ? 60   ALA A O   1 
ATOM   467  C  CB  . ALA A 1 60  ? -11.537 -4.401  -3.014  1.00 25.22  ? 60   ALA A CB  1 
ATOM   468  N  N   . SER A 1 61  ? -8.512  -6.165  -4.240  1.00 28.40  ? 61   SER A N   1 
ATOM   469  C  CA  . SER A 1 61  ? -7.871  -7.470  -4.160  1.00 31.83  ? 61   SER A CA  1 
ATOM   470  C  C   . SER A 1 61  ? -6.598  -7.457  -3.324  1.00 32.72  ? 61   SER A C   1 
ATOM   471  O  O   . SER A 1 61  ? -6.006  -8.517  -3.111  1.00 32.59  ? 61   SER A O   1 
ATOM   472  C  CB  . SER A 1 61  ? -7.511  -7.972  -5.564  1.00 40.84  ? 61   SER A CB  1 
ATOM   473  O  OG  . SER A 1 61  ? -6.363  -7.289  -6.043  1.00 38.72  ? 61   SER A OG  1 
ATOM   474  N  N   . THR A 1 62  ? -6.154  -6.289  -2.885  1.00 28.44  ? 62   THR A N   1 
ATOM   475  C  CA  . THR A 1 62  ? -4.819  -6.091  -2.337  1.00 32.21  ? 62   THR A CA  1 
ATOM   476  C  C   . THR A 1 62  ? -4.913  -5.288  -1.045  1.00 27.62  ? 62   THR A C   1 
ATOM   477  O  O   . THR A 1 62  ? -5.683  -4.330  -0.966  1.00 28.33  ? 62   THR A O   1 
ATOM   478  C  CB  . THR A 1 62  ? -3.944  -5.356  -3.378  1.00 29.06  ? 62   THR A CB  1 
ATOM   479  O  OG1 . THR A 1 62  ? -3.515  -6.283  -4.382  1.00 44.59  ? 62   THR A OG1 1 
ATOM   480  C  CG2 . THR A 1 62  ? -2.752  -4.714  -2.749  1.00 36.22  ? 62   THR A CG2 1 
ATOM   481  N  N   . TYR A 1 63  ? -4.120  -5.663  -0.033  1.00 28.69  ? 63   TYR A N   1 
ATOM   482  C  CA  . TYR A 1 63  ? -4.058  -4.871  1.185   1.00 28.63  ? 63   TYR A CA  1 
ATOM   483  C  C   . TYR A 1 63  ? -3.639  -3.432  0.867   1.00 26.38  ? 63   TYR A C   1 
ATOM   484  O  O   . TYR A 1 63  ? -2.826  -3.198  -0.026  1.00 29.07  ? 63   TYR A O   1 
ATOM   485  C  CB  . TYR A 1 63  ? -3.066  -5.489  2.173   1.00 27.83  ? 63   TYR A CB  1 
ATOM   486  C  CG  . TYR A 1 63  ? -3.649  -6.490  3.146   1.00 25.40  ? 63   TYR A CG  1 
ATOM   487  C  CD1 . TYR A 1 63  ? -4.895  -6.287  3.727   1.00 29.15  ? 63   TYR A CD1 1 
ATOM   488  C  CD2 . TYR A 1 63  ? -2.935  -7.629  3.511   1.00 30.64  ? 63   TYR A CD2 1 
ATOM   489  C  CE1 . TYR A 1 63  ? -5.416  -7.188  4.635   1.00 33.18  ? 63   TYR A CE1 1 
ATOM   490  C  CE2 . TYR A 1 63  ? -3.453  -8.539  4.424   1.00 32.93  ? 63   TYR A CE2 1 
ATOM   491  C  CZ  . TYR A 1 63  ? -4.690  -8.313  4.982   1.00 31.90  ? 63   TYR A CZ  1 
ATOM   492  O  OH  . TYR A 1 63  ? -5.225  -9.205  5.892   1.00 33.39  ? 63   TYR A OH  1 
ATOM   493  N  N   . PRO A 1 64  ? -4.156  -2.453  1.601   1.00 25.41  ? 64   PRO A N   1 
ATOM   494  C  CA  . PRO A 1 64  ? -3.758  -1.054  1.400   1.00 25.77  ? 64   PRO A CA  1 
ATOM   495  C  C   . PRO A 1 64  ? -2.419  -0.750  2.072   1.00 31.79  ? 64   PRO A C   1 
ATOM   496  O  O   . PRO A 1 64  ? -1.842  -1.583  2.771   1.00 29.04  ? 64   PRO A O   1 
ATOM   497  C  CB  . PRO A 1 64  ? -4.878  -0.285  2.096   1.00 27.00  ? 64   PRO A CB  1 
ATOM   498  C  CG  . PRO A 1 64  ? -5.200  -1.179  3.284   1.00 23.89  ? 64   PRO A CG  1 
ATOM   499  C  CD  . PRO A 1 64  ? -5.106  -2.594  2.727   1.00 26.56  ? 64   PRO A CD  1 
ATOM   500  N  N   . ASN A 1 65  ? -1.948  0.482   1.862   1.00 28.58  ? 65   ASN A N   1 
ATOM   501  C  CA  . ASN A 1 65  ? -0.846  1.028   2.644   1.00 29.34  ? 65   ASN A CA  1 
ATOM   502  C  C   . ASN A 1 65  ? -1.206  1.059   4.126   1.00 27.65  ? 65   ASN A C   1 
ATOM   503  O  O   . ASN A 1 65  ? -2.381  1.076   4.508   1.00 25.49  ? 65   ASN A O   1 
ATOM   504  C  CB  . ASN A 1 65  ? -0.522  2.462   2.224   1.00 28.77  ? 65   ASN A CB  1 
ATOM   505  C  CG  . ASN A 1 65  ? -0.114  2.580   0.778   1.00 32.82  ? 65   ASN A CG  1 
ATOM   506  O  OD1 . ASN A 1 65  ? 0.643   1.759   0.263   1.00 31.67  ? 65   ASN A OD1 1 
ATOM   507  N  ND2 . ASN A 1 65  ? -0.611  3.620   0.114   1.00 31.85  ? 65   ASN A ND2 1 
ATOM   508  N  N   . ASN A 1 66  ? -0.171  1.121   4.962   1.00 22.98  ? 66   ASN A N   1 
ATOM   509  C  CA  . ASN A 1 66  ? -0.318  1.343   6.397   1.00 23.08  ? 66   ASN A CA  1 
ATOM   510  C  C   . ASN A 1 66  ? -0.097  2.818   6.716   1.00 27.21  ? 66   ASN A C   1 
ATOM   511  O  O   . ASN A 1 66  ? 0.588   3.525   5.977   1.00 26.74  ? 66   ASN A O   1 
ATOM   512  C  CB  . ASN A 1 66  ? 0.683   0.496   7.193   1.00 20.34  ? 66   ASN A CB  1 
ATOM   513  C  CG  . ASN A 1 66  ? 0.548   -0.983  6.904   1.00 23.58  ? 66   ASN A CG  1 
ATOM   514  O  OD1 . ASN A 1 66  ? 1.536   -1.690  6.728   1.00 26.58  ? 66   ASN A OD1 1 
ATOM   515  N  ND2 . ASN A 1 66  ? -0.690  -1.452  6.822   1.00 20.18  ? 66   ASN A ND2 1 
ATOM   516  N  N   . CYS A 1 67  ? -0.677  3.286   7.825   1.00 20.87  ? 67   CYS A N   1 
ATOM   517  C  CA  . CYS A 1 67  ? -0.461  4.681   8.190   1.00 18.88  ? 67   CYS A CA  1 
ATOM   518  C  C   . CYS A 1 67  ? 0.984   4.901   8.634   1.00 21.89  ? 67   CYS A C   1 
ATOM   519  O  O   . CYS A 1 67  ? 1.708   3.962   8.979   1.00 22.75  ? 67   CYS A O   1 
ATOM   520  C  CB  . CYS A 1 67  ? -1.430  5.118   9.283   1.00 25.97  ? 67   CYS A CB  1 
ATOM   521  S  SG  . CYS A 1 67  ? -3.160  5.140   8.761   1.00 24.28  ? 67   CYS A SG  1 
ATOM   522  N  N   . GLN A 1 68  ? 1.416   6.157   8.572   1.00 18.81  ? 68   GLN A N   1 
ATOM   523  C  CA  . GLN A 1 68  ? 2.787   6.489   8.942   1.00 23.62  ? 68   GLN A CA  1 
ATOM   524  C  C   . GLN A 1 68  ? 2.966   6.324   10.445  1.00 19.99  ? 68   GLN A C   1 
ATOM   525  O  O   . GLN A 1 68  ? 2.130   6.776   11.227  1.00 24.40  ? 68   GLN A O   1 
ATOM   526  C  CB  . GLN A 1 68  ? 3.114   7.925   8.537   1.00 23.52  ? 68   GLN A CB  1 
ATOM   527  C  CG  . GLN A 1 68  ? 3.210   8.129   7.021   1.00 23.14  ? 68   GLN A CG  1 
ATOM   528  C  CD  . GLN A 1 68  ? 4.558   7.694   6.480   1.00 27.60  ? 68   GLN A CD  1 
ATOM   529  O  OE1 . GLN A 1 68  ? 5.412   7.219   7.228   1.00 27.56  ? 68   GLN A OE1 1 
ATOM   530  N  NE2 . GLN A 1 68  ? 4.763   7.871   5.179   1.00 28.65  ? 68   GLN A NE2 1 
ATOM   531  N  N   . GLN A 1 69  ? 4.069   5.684   10.843  1.00 22.90  ? 69   GLN A N   1 
ATOM   532  C  CA  . GLN A 1 69  ? 4.274   5.342   12.245  1.00 21.23  ? 69   GLN A CA  1 
ATOM   533  C  C   . GLN A 1 69  ? 5.738   5.021   12.517  1.00 22.85  ? 69   GLN A C   1 
ATOM   534  O  O   . GLN A 1 69  ? 6.496   4.639   11.620  1.00 23.08  ? 69   GLN A O   1 
ATOM   535  C  CB  . GLN A 1 69  ? 3.411   4.147   12.648  1.00 22.25  ? 69   GLN A CB  1 
ATOM   536  C  CG  . GLN A 1 69  ? 3.644   2.920   11.777  1.00 20.53  ? 69   GLN A CG  1 
ATOM   537  C  CD  . GLN A 1 69  ? 2.557   1.874   11.952  1.00 25.49  ? 69   GLN A CD  1 
ATOM   538  O  OE1 . GLN A 1 69  ? 2.637   1.020   12.846  1.00 25.08  ? 69   GLN A OE1 1 
ATOM   539  N  NE2 . GLN A 1 69  ? 1.520   1.950   11.120  1.00 23.38  ? 69   GLN A NE2 1 
ATOM   540  N  N   . TYR A 1 70  ? 6.104   5.160   13.790  1.00 22.78  ? 70   TYR A N   1 
ATOM   541  C  CA  . TYR A 1 70  ? 7.344   4.598   14.302  1.00 24.84  ? 70   TYR A CA  1 
ATOM   542  C  C   . TYR A 1 70  ? 7.424   3.116   13.958  1.00 27.89  ? 70   TYR A C   1 
ATOM   543  O  O   . TYR A 1 70  ? 6.444   2.380   14.097  1.00 28.54  ? 70   TYR A O   1 
ATOM   544  C  CB  . TYR A 1 70  ? 7.403   4.807   15.821  1.00 26.23  ? 70   TYR A CB  1 
ATOM   545  C  CG  . TYR A 1 70  ? 8.583   4.141   16.490  1.00 24.15  ? 70   TYR A CG  1 
ATOM   546  C  CD1 . TYR A 1 70  ? 9.795   4.795   16.597  1.00 27.27  ? 70   TYR A CD1 1 
ATOM   547  C  CD2 . TYR A 1 70  ? 8.470   2.861   17.028  1.00 29.74  ? 70   TYR A CD2 1 
ATOM   548  C  CE1 . TYR A 1 70  ? 10.880  4.193   17.211  1.00 28.65  ? 70   TYR A CE1 1 
ATOM   549  C  CE2 . TYR A 1 70  ? 9.544   2.252   17.649  1.00 31.56  ? 70   TYR A CE2 1 
ATOM   550  C  CZ  . TYR A 1 70  ? 10.749  2.924   17.727  1.00 31.03  ? 70   TYR A CZ  1 
ATOM   551  O  OH  . TYR A 1 70  ? 11.821  2.324   18.346  1.00 33.43  ? 70   TYR A OH  1 
ATOM   552  N  N   . VAL A 1 71  ? 8.588   2.679   13.481  1.00 20.79  ? 71   VAL A N   1 
ATOM   553  C  CA  . VAL A 1 71  ? 8.824   1.276   13.155  1.00 21.06  ? 71   VAL A CA  1 
ATOM   554  C  C   . VAL A 1 71  ? 9.841   0.726   14.147  1.00 28.39  ? 71   VAL A C   1 
ATOM   555  O  O   . VAL A 1 71  ? 10.904  1.325   14.343  1.00 24.93  ? 71   VAL A O   1 
ATOM   556  C  CB  . VAL A 1 71  ? 9.317   1.102   11.707  1.00 22.64  ? 71   VAL A CB  1 
ATOM   557  C  CG1 . VAL A 1 71  ? 9.692   -0.351  11.459  1.00 24.93  ? 71   VAL A CG1 1 
ATOM   558  C  CG2 . VAL A 1 71  ? 8.227   1.534   10.718  1.00 22.95  ? 71   VAL A CG2 1 
ATOM   559  N  N   . ASP A 1 72  ? 9.515   -0.408  14.769  1.00 25.01  ? 72   ASP A N   1 
ATOM   560  C  CA  . ASP A 1 72  ? 10.356  -0.991  15.813  1.00 25.22  ? 72   ASP A CA  1 
ATOM   561  C  C   . ASP A 1 72  ? 11.537  -1.729  15.185  1.00 25.17  ? 72   ASP A C   1 
ATOM   562  O  O   . ASP A 1 72  ? 11.343  -2.674  14.415  1.00 28.40  ? 72   ASP A O   1 
ATOM   563  C  CB  . ASP A 1 72  ? 9.516   -1.936  16.672  1.00 26.78  ? 72   ASP A CB  1 
ATOM   564  C  CG  . ASP A 1 72  ? 10.364  -2.799  17.614  1.00 26.47  ? 72   ASP A CG  1 
ATOM   565  O  OD1 . ASP A 1 72  ? 11.491  -2.390  17.962  1.00 24.00  ? 72   ASP A OD1 1 
ATOM   566  O  OD2 . ASP A 1 72  ? 9.886   -3.886  18.003  1.00 27.61  ? 72   ASP A OD2 1 
ATOM   567  N  N   . GLU A 1 73  ? 12.762  -1.307  15.509  1.00 23.82  ? 73   GLU A N   1 
ATOM   568  C  CA  A GLU A 1 73  ? 13.973  -1.942  14.996  0.57 28.17  ? 73   GLU A CA  1 
ATOM   569  C  CA  B GLU A 1 73  ? 13.956  -1.976  14.994  0.43 28.16  ? 73   GLU A CA  1 
ATOM   570  C  C   . GLU A 1 73  ? 14.840  -2.523  16.112  1.00 28.47  ? 73   GLU A C   1 
ATOM   571  O  O   . GLU A 1 73  ? 16.039  -2.754  15.905  1.00 25.23  ? 73   GLU A O   1 
ATOM   572  C  CB  A GLU A 1 73  ? 14.776  -0.945  14.152  0.57 27.99  ? 73   GLU A CB  1 
ATOM   573  C  CB  B GLU A 1 73  ? 14.756  -1.039  14.086  0.43 28.05  ? 73   GLU A CB  1 
ATOM   574  C  CG  A GLU A 1 73  ? 13.937  -0.252  13.078  0.57 29.52  ? 73   GLU A CG  1 
ATOM   575  C  CG  B GLU A 1 73  ? 14.201  -0.961  12.667  0.43 29.90  ? 73   GLU A CG  1 
ATOM   576  C  CD  A GLU A 1 73  ? 14.783  0.444   12.025  0.57 32.49  ? 73   GLU A CD  1 
ATOM   577  C  CD  B GLU A 1 73  ? 14.087  -2.323  12.005  0.43 33.28  ? 73   GLU A CD  1 
ATOM   578  O  OE1 A GLU A 1 73  ? 15.063  -0.185  10.986  0.57 38.64  ? 73   GLU A OE1 1 
ATOM   579  O  OE1 B GLU A 1 73  ? 15.111  -2.840  11.505  0.43 36.68  ? 73   GLU A OE1 1 
ATOM   580  O  OE2 A GLU A 1 73  ? 15.147  1.621   12.225  0.57 28.62  ? 73   GLU A OE2 1 
ATOM   581  O  OE2 B GLU A 1 73  ? 12.966  -2.877  11.968  0.43 34.68  ? 73   GLU A OE2 1 
ATOM   582  N  N   . GLN A 1 74  ? 14.264  -2.767  17.290  1.00 25.81  ? 74   GLN A N   1 
ATOM   583  C  CA  . GLN A 1 74  ? 15.057  -3.272  18.408  1.00 26.11  ? 74   GLN A CA  1 
ATOM   584  C  C   . GLN A 1 74  ? 15.665  -4.630  18.090  1.00 26.90  ? 74   GLN A C   1 
ATOM   585  O  O   . GLN A 1 74  ? 16.853  -4.864  18.340  1.00 30.71  ? 74   GLN A O   1 
ATOM   586  C  CB  . GLN A 1 74  ? 14.199  -3.367  19.669  1.00 27.05  ? 74   GLN A CB  1 
ATOM   587  C  CG  . GLN A 1 74  ? 15.010  -3.710  20.916  1.00 28.77  ? 74   GLN A CG  1 
ATOM   588  C  CD  . GLN A 1 74  ? 16.008  -2.633  21.246  1.00 37.80  ? 74   GLN A CD  1 
ATOM   589  O  OE1 . GLN A 1 74  ? 15.701  -1.445  21.151  1.00 39.62  ? 74   GLN A OE1 1 
ATOM   590  N  NE2 . GLN A 1 74  ? 17.220  -3.035  21.633  1.00 36.05  ? 74   GLN A NE2 1 
ATOM   591  N  N   . PHE A 1 75  ? 14.857  -5.548  17.563  1.00 22.41  ? 75   PHE A N   1 
ATOM   592  C  CA  . PHE A 1 75  ? 15.288  -6.899  17.215  1.00 26.31  ? 75   PHE A CA  1 
ATOM   593  C  C   . PHE A 1 75  ? 15.066  -7.110  15.722  1.00 28.31  ? 75   PHE A C   1 
ATOM   594  O  O   . PHE A 1 75  ? 14.097  -7.768  15.308  1.00 28.38  ? 75   PHE A O   1 
ATOM   595  C  CB  . PHE A 1 75  ? 14.543  -7.945  18.037  1.00 27.90  ? 75   PHE A CB  1 
ATOM   596  C  CG  . PHE A 1 75  ? 14.545  -7.666  19.510  1.00 27.38  ? 75   PHE A CG  1 
ATOM   597  C  CD1 . PHE A 1 75  ? 15.700  -7.829  20.261  1.00 30.34  ? 75   PHE A CD1 1 
ATOM   598  C  CD2 . PHE A 1 75  ? 13.387  -7.236  20.148  1.00 30.58  ? 75   PHE A CD2 1 
ATOM   599  C  CE1 . PHE A 1 75  ? 15.700  -7.576  21.625  1.00 30.60  ? 75   PHE A CE1 1 
ATOM   600  C  CE2 . PHE A 1 75  ? 13.378  -6.982  21.503  1.00 26.38  ? 75   PHE A CE2 1 
ATOM   601  C  CZ  . PHE A 1 75  ? 14.540  -7.145  22.244  1.00 30.11  ? 75   PHE A CZ  1 
ATOM   602  N  N   . PRO A 1 76  ? 15.963  -6.598  14.883  1.00 30.66  ? 76   PRO A N   1 
ATOM   603  C  CA  . PRO A 1 76  ? 15.737  -6.676  13.433  1.00 32.36  ? 76   PRO A CA  1 
ATOM   604  C  C   . PRO A 1 76  ? 15.609  -8.119  12.962  1.00 32.42  ? 76   PRO A C   1 
ATOM   605  O  O   . PRO A 1 76  ? 16.424  -8.977  13.302  1.00 30.36  ? 76   PRO A O   1 
ATOM   606  C  CB  . PRO A 1 76  ? 16.972  -5.988  12.845  1.00 32.26  ? 76   PRO A CB  1 
ATOM   607  C  CG  . PRO A 1 76  ? 17.548  -5.162  13.974  1.00 35.26  ? 76   PRO A CG  1 
ATOM   608  C  CD  . PRO A 1 76  ? 17.230  -5.928  15.224  1.00 32.68  ? 76   PRO A CD  1 
ATOM   609  N  N   . GLY A 1 77  ? 14.553  -8.389  12.190  1.00 33.03  ? 77   GLY A N   1 
ATOM   610  C  CA  . GLY A 1 77  ? 14.324  -9.724  11.670  1.00 31.63  ? 77   GLY A CA  1 
ATOM   611  C  C   . GLY A 1 77  ? 13.699  -10.708 12.639  1.00 33.00  ? 77   GLY A C   1 
ATOM   612  O  O   . GLY A 1 77  ? 13.352  -11.824 12.223  1.00 30.16  ? 77   GLY A O   1 
ATOM   613  N  N   . PHE A 1 78  ? 13.535  -10.340 13.914  1.00 28.99  ? 78   PHE A N   1 
ATOM   614  C  CA  . PHE A 1 78  ? 12.938  -11.233 14.901  1.00 29.74  ? 78   PHE A CA  1 
ATOM   615  C  C   . PHE A 1 78  ? 11.426  -11.270 14.717  1.00 31.25  ? 78   PHE A C   1 
ATOM   616  O  O   . PHE A 1 78  ? 10.765  -10.226 14.754  1.00 26.89  ? 78   PHE A O   1 
ATOM   617  C  CB  . PHE A 1 78  ? 13.294  -10.774 16.313  1.00 31.18  ? 78   PHE A CB  1 
ATOM   618  C  CG  . PHE A 1 78  ? 12.791  -11.684 17.388  1.00 33.37  ? 78   PHE A CG  1 
ATOM   619  C  CD1 . PHE A 1 78  ? 13.209  -13.004 17.445  1.00 31.95  ? 78   PHE A CD1 1 
ATOM   620  C  CD2 . PHE A 1 78  ? 11.907  -11.219 18.349  1.00 28.29  ? 78   PHE A CD2 1 
ATOM   621  C  CE1 . PHE A 1 78  ? 12.749  -13.848 18.438  1.00 37.57  ? 78   PHE A CE1 1 
ATOM   622  C  CE2 . PHE A 1 78  ? 11.440  -12.061 19.346  1.00 29.51  ? 78   PHE A CE2 1 
ATOM   623  C  CZ  . PHE A 1 78  ? 11.861  -13.371 19.392  1.00 31.99  ? 78   PHE A CZ  1 
ATOM   624  N  N   . SER A 1 79  ? 10.873  -12.473 14.540  1.00 27.94  ? 79   SER A N   1 
ATOM   625  C  CA  . SER A 1 79  ? 9.464   -12.575 14.182  1.00 30.65  ? 79   SER A CA  1 
ATOM   626  C  C   . SER A 1 79  ? 8.565   -12.007 15.270  1.00 32.62  ? 79   SER A C   1 
ATOM   627  O  O   . SER A 1 79  ? 7.500   -11.454 14.962  1.00 26.33  ? 79   SER A O   1 
ATOM   628  C  CB  . SER A 1 79  ? 9.089   -14.032 13.884  1.00 34.73  ? 79   SER A CB  1 
ATOM   629  O  OG  . SER A 1 79  ? 9.178   -14.846 15.040  1.00 36.92  ? 79   SER A OG  1 
ATOM   630  N  N   . GLY A 1 80  ? 8.995   -12.095 16.534  1.00 28.57  ? 80   GLY A N   1 
ATOM   631  C  CA  . GLY A 1 80  ? 8.137   -11.693 17.636  1.00 28.84  ? 80   GLY A CA  1 
ATOM   632  C  C   . GLY A 1 80  ? 7.870   -10.205 17.666  1.00 26.18  ? 80   GLY A C   1 
ATOM   633  O  O   . GLY A 1 80  ? 6.803   -9.772  18.110  1.00 27.01  ? 80   GLY A O   1 
ATOM   634  N  N   . SER A 1 81  ? 8.826   -9.404  17.205  1.00 23.53  ? 81   SER A N   1 
ATOM   635  C  CA  . SER A 1 81  ? 8.629   -7.969  17.080  1.00 23.25  ? 81   SER A CA  1 
ATOM   636  C  C   . SER A 1 81  ? 8.211   -7.560  15.672  1.00 26.77  ? 81   SER A C   1 
ATOM   637  O  O   . SER A 1 81  ? 7.374   -6.662  15.518  1.00 25.32  ? 81   SER A O   1 
ATOM   638  C  CB  . SER A 1 81  ? 9.903   -7.220  17.475  1.00 26.55  ? 81   SER A CB  1 
ATOM   639  O  OG  . SER A 1 81  ? 11.034  -7.740  16.795  1.00 31.38  ? 81   SER A OG  1 
ATOM   640  N  N   . GLU A 1 82  ? 8.770   -8.206  14.642  1.00 26.66  ? 82   GLU A N   1 
ATOM   641  C  CA  . GLU A 1 82  ? 8.422   -7.847  13.268  1.00 28.67  ? 82   GLU A CA  1 
ATOM   642  C  C   . GLU A 1 82  ? 6.949   -8.091  12.964  1.00 28.12  ? 82   GLU A C   1 
ATOM   643  O  O   . GLU A 1 82  ? 6.362   -7.373  12.145  1.00 28.05  ? 82   GLU A O   1 
ATOM   644  C  CB  . GLU A 1 82  ? 9.287   -8.623  12.270  1.00 27.46  ? 82   GLU A CB  1 
ATOM   645  C  CG  . GLU A 1 82  ? 10.780  -8.320  12.327  1.00 29.74  ? 82   GLU A CG  1 
ATOM   646  C  CD  . GLU A 1 82  ? 11.122  -6.921  11.863  1.00 34.99  ? 82   GLU A CD  1 
ATOM   647  O  OE1 . GLU A 1 82  ? 12.314  -6.540  11.941  1.00 34.17  ? 82   GLU A OE1 1 
ATOM   648  O  OE2 . GLU A 1 82  ? 10.200  -6.200  11.424  1.00 34.17  ? 82   GLU A OE2 1 
ATOM   649  N  N   . MET A 1 83  ? 6.328   -9.089  13.604  1.00 28.62  ? 83   MET A N   1 
ATOM   650  C  CA  . MET A 1 83  ? 4.924   -9.392  13.333  1.00 29.15  ? 83   MET A CA  1 
ATOM   651  C  C   . MET A 1 83  ? 3.999   -8.214  13.617  1.00 28.35  ? 83   MET A C   1 
ATOM   652  O  O   . MET A 1 83  ? 2.852   -8.223  13.159  1.00 26.04  ? 83   MET A O   1 
ATOM   653  C  CB  . MET A 1 83  ? 4.450   -10.596 14.155  1.00 29.85  ? 83   MET A CB  1 
ATOM   654  C  CG  . MET A 1 83  ? 4.355   -10.324 15.653  1.00 27.07  ? 83   MET A CG  1 
ATOM   655  S  SD  . MET A 1 83  ? 3.720   -11.736 16.591  1.00 36.41  ? 83   MET A SD  1 
ATOM   656  C  CE  . MET A 1 83  ? 1.949   -11.481 16.546  1.00 31.37  ? 83   MET A CE  1 
ATOM   657  N  N   . TRP A 1 84  ? 4.462   -7.210  14.355  1.00 24.62  ? 84   TRP A N   1 
ATOM   658  C  CA  . TRP A 1 84  ? 3.653   -6.048  14.703  1.00 23.34  ? 84   TRP A CA  1 
ATOM   659  C  C   . TRP A 1 84  ? 3.959   -4.833  13.843  1.00 23.91  ? 84   TRP A C   1 
ATOM   660  O  O   . TRP A 1 84  ? 3.189   -3.869  13.863  1.00 20.45  ? 84   TRP A O   1 
ATOM   661  C  CB  . TRP A 1 84  ? 3.861   -5.673  16.182  1.00 24.52  ? 84   TRP A CB  1 
ATOM   662  C  CG  . TRP A 1 84  ? 3.601   -6.800  17.104  1.00 23.08  ? 84   TRP A CG  1 
ATOM   663  C  CD1 . TRP A 1 84  ? 4.530   -7.605  17.691  1.00 25.24  ? 84   TRP A CD1 1 
ATOM   664  C  CD2 . TRP A 1 84  ? 2.322   -7.262  17.553  1.00 26.89  ? 84   TRP A CD2 1 
ATOM   665  N  NE1 . TRP A 1 84  ? 3.913   -8.545  18.480  1.00 25.17  ? 84   TRP A NE1 1 
ATOM   666  C  CE2 . TRP A 1 84  ? 2.556   -8.354  18.421  1.00 26.47  ? 84   TRP A CE2 1 
ATOM   667  C  CE3 . TRP A 1 84  ? 1.004   -6.861  17.309  1.00 23.00  ? 84   TRP A CE3 1 
ATOM   668  C  CZ2 . TRP A 1 84  ? 1.520   -9.047  19.044  1.00 29.92  ? 84   TRP A CZ2 1 
ATOM   669  C  CZ3 . TRP A 1 84  ? -0.037  -7.554  17.941  1.00 24.81  ? 84   TRP A CZ3 1 
ATOM   670  C  CH2 . TRP A 1 84  ? 0.231   -8.635  18.789  1.00 26.78  ? 84   TRP A CH2 1 
ATOM   671  N  N   . ASN A 1 85  ? 5.057   -4.856  13.104  1.00 22.57  ? 85   ASN A N   1 
ATOM   672  C  CA  . ASN A 1 85  ? 5.459   -3.734  12.282  1.00 24.59  ? 85   ASN A CA  1 
ATOM   673  C  C   . ASN A 1 85  ? 4.626   -3.684  11.002  1.00 23.19  ? 85   ASN A C   1 
ATOM   674  O  O   . ASN A 1 85  ? 4.046   -4.691  10.587  1.00 23.85  ? 85   ASN A O   1 
ATOM   675  C  CB  . ASN A 1 85  ? 6.942   -3.859  11.924  1.00 24.00  ? 85   ASN A CB  1 
ATOM   676  C  CG  . ASN A 1 85  ? 7.856   -3.254  12.967  1.00 26.15  ? 85   ASN A CG  1 
ATOM   677  O  OD1 . ASN A 1 85  ? 7.474   -2.343  13.693  1.00 25.79  ? 85   ASN A OD1 1 
ATOM   678  N  ND2 . ASN A 1 85  ? 9.099   -3.746  13.018  1.00 25.44  ? 85   ASN A ND2 1 
ATOM   679  N  N   . PRO A 1 86  ? 4.565   -2.526  10.350  1.00 23.85  ? 86   PRO A N   1 
ATOM   680  C  CA  . PRO A 1 86  ? 3.871   -2.447  9.057   1.00 25.87  ? 86   PRO A CA  1 
ATOM   681  C  C   . PRO A 1 86  ? 4.423   -3.469  8.078   1.00 25.27  ? 86   PRO A C   1 
ATOM   682  O  O   . PRO A 1 86  ? 5.638   -3.619  7.928   1.00 25.24  ? 86   PRO A O   1 
ATOM   683  C  CB  . PRO A 1 86  ? 4.152   -1.014  8.592   1.00 26.14  ? 86   PRO A CB  1 
ATOM   684  C  CG  . PRO A 1 86  ? 4.424   -0.257  9.830   1.00 22.84  ? 86   PRO A CG  1 
ATOM   685  C  CD  . PRO A 1 86  ? 5.087   -1.216  10.779  1.00 20.68  ? 86   PRO A CD  1 
ATOM   686  N  N   . ASN A 1 87  ? 3.522   -4.201  7.419   1.00 25.51  ? 87   ASN A N   1 
ATOM   687  C  CA  . ASN A 1 87  ? 3.930   -5.151  6.393   1.00 24.48  ? 87   ASN A CA  1 
ATOM   688  C  C   . ASN A 1 87  ? 3.579   -4.650  5.003   1.00 29.94  ? 87   ASN A C   1 
ATOM   689  O  O   . ASN A 1 87  ? 3.683   -5.400  4.036   1.00 30.70  ? 87   ASN A O   1 
ATOM   690  C  CB  . ASN A 1 87  ? 3.318   -6.532  6.638   1.00 26.01  ? 87   ASN A CB  1 
ATOM   691  C  CG  . ASN A 1 87  ? 1.806   -6.508  6.709   1.00 27.52  ? 87   ASN A CG  1 
ATOM   692  O  OD1 . ASN A 1 87  ? 1.193   -5.454  6.794   1.00 29.55  ? 87   ASN A OD1 1 
ATOM   693  N  ND2 . ASN A 1 87  ? 1.199   -7.683  6.690   1.00 30.54  ? 87   ASN A ND2 1 
ATOM   694  N  N   . ARG A 1 88  ? 3.168   -3.397  4.903   1.00 28.29  ? 88   ARG A N   1 
ATOM   695  C  CA  A ARG A 1 88  ? 2.904   -2.745  3.636   0.60 32.07  ? 88   ARG A CA  1 
ATOM   696  C  CA  B ARG A 1 88  ? 2.866   -2.721  3.654   0.40 32.04  ? 88   ARG A CA  1 
ATOM   697  C  C   . ARG A 1 88  ? 3.614   -1.397  3.649   1.00 33.13  ? 88   ARG A C   1 
ATOM   698  O  O   . ARG A 1 88  ? 4.103   -0.938  4.686   1.00 29.63  ? 88   ARG A O   1 
ATOM   699  C  CB  A ARG A 1 88  ? 1.389   -2.603  3.400   0.60 29.31  ? 88   ARG A CB  1 
ATOM   700  C  CB  B ARG A 1 88  ? 1.354   -2.489  3.497   0.40 29.34  ? 88   ARG A CB  1 
ATOM   701  C  CG  A ARG A 1 88  ? 0.679   -3.947  3.157   0.60 29.69  ? 88   ARG A CG  1 
ATOM   702  C  CG  B ARG A 1 88  ? 0.752   -3.097  2.250   0.40 34.47  ? 88   ARG A CG  1 
ATOM   703  C  CD  A ARG A 1 88  ? 1.378   -4.720  2.029   0.60 37.35  ? 88   ARG A CD  1 
ATOM   704  C  CD  B ARG A 1 88  ? 1.109   -4.560  2.117   0.40 36.72  ? 88   ARG A CD  1 
ATOM   705  N  NE  A ARG A 1 88  ? 0.656   -5.909  1.568   0.60 35.94  ? 88   ARG A NE  1 
ATOM   706  N  NE  B ARG A 1 88  ? 0.246   -5.239  1.160   0.40 34.26  ? 88   ARG A NE  1 
ATOM   707  C  CZ  A ARG A 1 88  ? 0.792   -7.125  2.093   0.60 39.44  ? 88   ARG A CZ  1 
ATOM   708  C  CZ  B ARG A 1 88  ? 0.353   -5.127  -0.160  0.40 35.65  ? 88   ARG A CZ  1 
ATOM   709  N  NH1 A ARG A 1 88  ? 1.613   -7.332  3.122   0.60 31.48  ? 88   ARG A NH1 1 
ATOM   710  N  NH1 B ARG A 1 88  ? 1.291   -4.361  -0.701  0.40 38.02  ? 88   ARG A NH1 1 
ATOM   711  N  NH2 A ARG A 1 88  ? 0.091   -8.139  1.595   0.60 38.21  ? 88   ARG A NH2 1 
ATOM   712  N  NH2 B ARG A 1 88  ? -0.485  -5.785  -0.941  0.40 32.69  ? 88   ARG A NH2 1 
ATOM   713  N  N   . GLU A 1 89  ? 3.701   -0.769  2.477   1.00 29.97  ? 89   GLU A N   1 
ATOM   714  C  CA  . GLU A 1 89  ? 4.290   0.561   2.422   1.00 30.58  ? 89   GLU A CA  1 
ATOM   715  C  C   . GLU A 1 89  ? 3.512   1.502   3.336   1.00 29.90  ? 89   GLU A C   1 
ATOM   716  O  O   . GLU A 1 89  ? 2.284   1.434   3.415   1.00 29.98  ? 89   GLU A O   1 
ATOM   717  C  CB  . GLU A 1 89  ? 4.285   1.096   0.982   1.00 29.67  ? 89   GLU A CB  1 
ATOM   718  C  CG  . GLU A 1 89  ? 5.492   0.678   0.160   0.67 42.71  ? 89   GLU A CG  1 
ATOM   719  C  CD  . GLU A 1 89  ? 6.805   1.069   0.808   0.39 46.97  ? 89   GLU A CD  1 
ATOM   720  O  OE1 . GLU A 1 89  ? 6.963   2.253   1.175   0.41 48.96  ? 89   GLU A OE1 1 
ATOM   721  O  OE2 . GLU A 1 89  ? 7.678   0.189   0.955   0.58 52.16  ? 89   GLU A OE2 1 
ATOM   722  N  N   . MET A 1 90  ? 4.228   2.372   4.040   1.00 23.19  ? 90   MET A N   1 
ATOM   723  C  CA  . MET A 1 90  ? 3.599   3.399   4.862   1.00 25.21  ? 90   MET A CA  1 
ATOM   724  C  C   . MET A 1 90  ? 3.280   4.637   4.032   1.00 28.42  ? 90   MET A C   1 
ATOM   725  O  O   . MET A 1 90  ? 4.055   5.035   3.153   1.00 26.86  ? 90   MET A O   1 
ATOM   726  C  CB  . MET A 1 90  ? 4.503   3.789   6.033   1.00 25.39  ? 90   MET A CB  1 
ATOM   727  C  CG  . MET A 1 90  ? 4.611   2.733   7.123   1.00 23.75  ? 90   MET A CG  1 
ATOM   728  S  SD  . MET A 1 90  ? 5.506   3.381   8.540   1.00 25.75  ? 90   MET A SD  1 
ATOM   729  C  CE  . MET A 1 90  ? 7.188   3.508   7.895   1.00 26.71  ? 90   MET A CE  1 
ATOM   730  N  N   . SER A 1 91  ? 2.132   5.245   4.317   1.00 25.24  ? 91   SER A N   1 
ATOM   731  C  CA  . SER A 1 91  ? 1.691   6.416   3.576   1.00 25.04  ? 91   SER A CA  1 
ATOM   732  C  C   . SER A 1 91  ? 0.644   7.149   4.396   1.00 26.71  ? 91   SER A C   1 
ATOM   733  O  O   . SER A 1 91  ? -0.120  6.528   5.142   1.00 23.75  ? 91   SER A O   1 
ATOM   734  C  CB  . SER A 1 91  ? 1.129   6.014   2.201   1.00 30.83  ? 91   SER A CB  1 
ATOM   735  O  OG  . SER A 1 91  ? 0.480   7.102   1.572   1.00 25.81  ? 91   SER A OG  1 
ATOM   736  N  N   . GLU A 1 92  ? 0.623   8.479   4.282   1.00 24.24  ? 92   GLU A N   1 
ATOM   737  C  CA  . GLU A 1 92  ? -0.498  9.193   4.893   1.00 23.98  ? 92   GLU A CA  1 
ATOM   738  C  C   . GLU A 1 92  ? -1.808  8.865   4.198   1.00 26.86  ? 92   GLU A C   1 
ATOM   739  O  O   . GLU A 1 92  ? -2.886  9.062   4.780   1.00 25.07  ? 92   GLU A O   1 
ATOM   740  C  CB  . GLU A 1 92  ? -0.260  10.699  4.870   1.00 24.13  ? 92   GLU A CB  1 
ATOM   741  C  CG  . GLU A 1 92  ? 0.847   11.138  5.809   1.00 25.69  ? 92   GLU A CG  1 
ATOM   742  C  CD  . GLU A 1 92  ? 1.026   12.633  5.832   1.00 28.95  ? 92   GLU A CD  1 
ATOM   743  O  OE1 . GLU A 1 92  ? 1.885   13.128  5.070   1.00 32.29  ? 92   GLU A OE1 1 
ATOM   744  O  OE2 . GLU A 1 92  ? 0.313   13.310  6.613   1.00 27.25  ? 92   GLU A OE2 1 
ATOM   745  N  N   . ASP A 1 93  ? -1.733  8.361   2.967   1.00 25.49  ? 93   ASP A N   1 
ATOM   746  C  CA  . ASP A 1 93  ? -2.898  7.849   2.254   1.00 21.06  ? 93   ASP A CA  1 
ATOM   747  C  C   . ASP A 1 93  ? -3.144  6.431   2.759   1.00 21.16  ? 93   ASP A C   1 
ATOM   748  O  O   . ASP A 1 93  ? -2.729  5.440   2.160   1.00 21.16  ? 93   ASP A O   1 
ATOM   749  C  CB  . ASP A 1 93  ? -2.654  7.894   0.746   1.00 25.10  ? 93   ASP A CB  1 
ATOM   750  C  CG  . ASP A 1 93  ? -3.849  7.420   -0.054  1.00 29.32  ? 93   ASP A CG  1 
ATOM   751  O  OD1 . ASP A 1 93  ? -4.867  7.047   0.561   1.00 23.80  ? 93   ASP A OD1 1 
ATOM   752  O  OD2 . ASP A 1 93  ? -3.780  7.431   -1.305  1.00 32.03  ? 93   ASP A OD2 1 
ATOM   753  N  N   . CYS A 1 94  ? -3.819  6.333   3.921   1.00 23.00  ? 94   CYS A N   1 
ATOM   754  C  CA  . CYS A 1 94  ? -3.934  5.043   4.589   1.00 22.03  ? 94   CYS A CA  1 
ATOM   755  C  C   . CYS A 1 94  ? -5.317  4.778   5.177   1.00 24.29  ? 94   CYS A C   1 
ATOM   756  O  O   . CYS A 1 94  ? -5.456  3.847   5.984   1.00 23.97  ? 94   CYS A O   1 
ATOM   757  C  CB  . CYS A 1 94  ? -2.897  4.932   5.731   1.00 21.97  ? 94   CYS A CB  1 
ATOM   758  S  SG  . CYS A 1 94  ? -3.192  6.186   6.990   1.00 23.58  ? 94   CYS A SG  1 
ATOM   759  N  N   . LEU A 1 95  ? -6.345  5.545   4.812   1.00 22.33  ? 95   LEU A N   1 
ATOM   760  C  CA  . LEU A 1 95  ? -7.662  5.362   5.435   1.00 24.05  ? 95   LEU A CA  1 
ATOM   761  C  C   . LEU A 1 95  ? -8.476  4.393   4.585   1.00 25.73  ? 95   LEU A C   1 
ATOM   762  O  O   . LEU A 1 95  ? -9.249  4.782   3.707   1.00 24.57  ? 95   LEU A O   1 
ATOM   763  C  CB  . LEU A 1 95  ? -8.352  6.703   5.640   1.00 24.80  ? 95   LEU A CB  1 
ATOM   764  C  CG  . LEU A 1 95  ? -7.643  7.551   6.702   1.00 23.01  ? 95   LEU A CG  1 
ATOM   765  C  CD1 . LEU A 1 95  ? -8.374  8.867   6.935   1.00 24.87  ? 95   LEU A CD1 1 
ATOM   766  C  CD2 . LEU A 1 95  ? -7.462  6.777   8.016   1.00 21.92  ? 95   LEU A CD2 1 
ATOM   767  N  N   . TYR A 1 96  ? -8.313  3.106   4.880   1.00 23.14  ? 96   TYR A N   1 
ATOM   768  C  CA  . TYR A 1 96  ? -8.941  2.023   4.142   1.00 21.94  ? 96   TYR A CA  1 
ATOM   769  C  C   . TYR A 1 96  ? -9.447  0.981   5.124   1.00 27.18  ? 96   TYR A C   1 
ATOM   770  O  O   . TYR A 1 96  ? -8.984  0.905   6.265   1.00 24.16  ? 96   TYR A O   1 
ATOM   771  C  CB  . TYR A 1 96  ? -7.946  1.378   3.165   1.00 23.05  ? 96   TYR A CB  1 
ATOM   772  C  CG  . TYR A 1 96  ? -7.434  2.366   2.152   1.00 23.88  ? 96   TYR A CG  1 
ATOM   773  C  CD1 . TYR A 1 96  ? -6.320  3.154   2.423   1.00 24.87  ? 96   TYR A CD1 1 
ATOM   774  C  CD2 . TYR A 1 96  ? -8.083  2.536   0.940   1.00 24.47  ? 96   TYR A CD2 1 
ATOM   775  C  CE1 . TYR A 1 96  ? -5.865  4.076   1.509   1.00 24.53  ? 96   TYR A CE1 1 
ATOM   776  C  CE2 . TYR A 1 96  ? -7.640  3.454   0.018   1.00 25.06  ? 96   TYR A CE2 1 
ATOM   777  C  CZ  . TYR A 1 96  ? -6.539  4.221   0.297   1.00 27.28  ? 96   TYR A CZ  1 
ATOM   778  O  OH  . TYR A 1 96  ? -6.116  5.135   -0.642  1.00 25.34  ? 96   TYR A OH  1 
ATOM   779  N  N   . LEU A 1 97  ? -10.400 0.164   4.681   1.00 24.02  ? 97   LEU A N   1 
ATOM   780  C  CA  . LEU A 1 97  ? -10.864 -0.940  5.511   1.00 24.18  ? 97   LEU A CA  1 
ATOM   781  C  C   . LEU A 1 97  ? -10.888 -2.216  4.679   1.00 23.62  ? 97   LEU A C   1 
ATOM   782  O  O   . LEU A 1 97  ? -10.867 -2.180  3.448   1.00 26.94  ? 97   LEU A O   1 
ATOM   783  C  CB  . LEU A 1 97  ? -12.236 -0.634  6.136   1.00 19.76  ? 97   LEU A CB  1 
ATOM   784  C  CG  . LEU A 1 97  ? -13.407 -0.224  5.220   1.00 25.17  ? 97   LEU A CG  1 
ATOM   785  C  CD1 . LEU A 1 97  ? -14.055 -1.452  4.647   1.00 24.35  ? 97   LEU A CD1 1 
ATOM   786  C  CD2 . LEU A 1 97  ? -14.424 0.630   5.991   1.00 20.39  ? 97   LEU A CD2 1 
ATOM   787  N  N   . ASN A 1 98  ? -10.931 -3.353  5.372   1.00 22.88  ? 98   ASN A N   1 
ATOM   788  C  CA  . ASN A 1 98  ? -10.911 -4.673  4.751   1.00 23.48  ? 98   ASN A CA  1 
ATOM   789  C  C   . ASN A 1 98  ? -12.103 -5.476  5.248   1.00 25.68  ? 98   ASN A C   1 
ATOM   790  O  O   . ASN A 1 98  ? -12.500 -5.358  6.412   1.00 23.97  ? 98   ASN A O   1 
ATOM   791  C  CB  . ASN A 1 98  ? -9.622  -5.443  5.085   1.00 24.64  ? 98   ASN A CB  1 
ATOM   792  C  CG  . ASN A 1 98  ? -8.393  -4.583  4.982   1.00 29.03  ? 98   ASN A CG  1 
ATOM   793  O  OD1 . ASN A 1 98  ? -7.991  -4.202  3.890   1.00 25.36  ? 98   ASN A OD1 1 
ATOM   794  N  ND2 . ASN A 1 98  ? -7.782  -4.269  6.129   1.00 26.31  ? 98   ASN A ND2 1 
ATOM   795  N  N   . ILE A 1 99  ? -12.656 -6.320  4.378   1.00 25.70  ? 99   ILE A N   1 
ATOM   796  C  CA  . ILE A 1 99  ? -13.849 -7.090  4.718   1.00 29.67  ? 99   ILE A CA  1 
ATOM   797  C  C   . ILE A 1 99  ? -13.669 -8.530  4.261   1.00 32.82  ? 99   ILE A C   1 
ATOM   798  O  O   . ILE A 1 99  ? -13.365 -8.779  3.092   1.00 29.17  ? 99   ILE A O   1 
ATOM   799  C  CB  . ILE A 1 99  ? -15.125 -6.495  4.089   1.00 27.32  ? 99   ILE A CB  1 
ATOM   800  C  CG1 . ILE A 1 99  ? -15.150 -4.976  4.226   1.00 26.39  ? 99   ILE A CG1 1 
ATOM   801  C  CG2 . ILE A 1 99  ? -16.359 -7.089  4.752   1.00 29.21  ? 99   ILE A CG2 1 
ATOM   802  C  CD1 . ILE A 1 99  ? -16.385 -4.327  3.600   1.00 26.59  ? 99   ILE A CD1 1 
ATOM   803  N  N   . TRP A 1 100 ? -13.865 -9.481  5.176   1.00 27.88  ? 100  TRP A N   1 
ATOM   804  C  CA  . TRP A 1 100 ? -13.965 -10.892 4.826   1.00 28.85  ? 100  TRP A CA  1 
ATOM   805  C  C   . TRP A 1 100 ? -15.428 -11.313 4.932   1.00 31.05  ? 100  TRP A C   1 
ATOM   806  O  O   . TRP A 1 100 ? -16.094 -11.024 5.937   1.00 28.87  ? 100  TRP A O   1 
ATOM   807  C  CB  . TRP A 1 100 ? -13.070 -11.752 5.722   1.00 30.61  ? 100  TRP A CB  1 
ATOM   808  C  CG  . TRP A 1 100 ? -11.592 -11.567 5.446   1.00 30.28  ? 100  TRP A CG  1 
ATOM   809  C  CD1 . TRP A 1 100 ? -10.805 -12.322 4.623   1.00 30.99  ? 100  TRP A CD1 1 
ATOM   810  C  CD2 . TRP A 1 100 ? -10.739 -10.551 5.993   1.00 29.37  ? 100  TRP A CD2 1 
ATOM   811  N  NE1 . TRP A 1 100 ? -9.514  -11.847 4.631   1.00 33.66  ? 100  TRP A NE1 1 
ATOM   812  C  CE2 . TRP A 1 100 ? -9.449  -10.758 5.463   1.00 30.56  ? 100  TRP A CE2 1 
ATOM   813  C  CE3 . TRP A 1 100 ? -10.943 -9.486  6.876   1.00 28.82  ? 100  TRP A CE3 1 
ATOM   814  C  CZ2 . TRP A 1 100 ? -8.359  -9.939  5.791   1.00 31.43  ? 100  TRP A CZ2 1 
ATOM   815  C  CZ3 . TRP A 1 100 ? -9.860  -8.675  7.208   1.00 28.54  ? 100  TRP A CZ3 1 
ATOM   816  C  CH2 . TRP A 1 100 ? -8.582  -8.909  6.665   1.00 28.54  ? 100  TRP A CH2 1 
ATOM   817  N  N   . VAL A 1 101 ? -15.928 -11.963 3.887   1.00 29.16  ? 101  VAL A N   1 
ATOM   818  C  CA  . VAL A 1 101 ? -17.345 -12.301 3.754   1.00 32.04  ? 101  VAL A CA  1 
ATOM   819  C  C   . VAL A 1 101 ? -17.463 -13.804 3.518   1.00 29.73  ? 101  VAL A C   1 
ATOM   820  O  O   . VAL A 1 101 ? -16.850 -14.331 2.586   1.00 31.79  ? 101  VAL A O   1 
ATOM   821  C  CB  . VAL A 1 101 ? -18.024 -11.528 2.614   1.00 32.55  ? 101  VAL A CB  1 
ATOM   822  C  CG1 . VAL A 1 101 ? -19.508 -11.891 2.545   1.00 30.24  ? 101  VAL A CG1 1 
ATOM   823  C  CG2 . VAL A 1 101 ? -17.852 -10.027 2.804   1.00 31.75  ? 101  VAL A CG2 1 
ATOM   824  N  N   . PRO A 1 102 ? -18.232 -14.531 4.329   1.00 30.26  ? 102  PRO A N   1 
ATOM   825  C  CA  . PRO A 1 102 ? -18.423 -15.964 4.075   1.00 30.40  ? 102  PRO A CA  1 
ATOM   826  C  C   . PRO A 1 102 ? -18.969 -16.209 2.675   1.00 37.24  ? 102  PRO A C   1 
ATOM   827  O  O   . PRO A 1 102 ? -19.736 -15.410 2.137   1.00 33.11  ? 102  PRO A O   1 
ATOM   828  C  CB  . PRO A 1 102 ? -19.436 -16.381 5.142   1.00 34.03  ? 102  PRO A CB  1 
ATOM   829  C  CG  . PRO A 1 102 ? -19.270 -15.351 6.246   1.00 36.74  ? 102  PRO A CG  1 
ATOM   830  C  CD  . PRO A 1 102 ? -18.951 -14.071 5.531   1.00 33.54  ? 102  PRO A CD  1 
ATOM   831  N  N   . SER A 1 103 ? -18.540 -17.325 2.085   1.00 32.96  ? 103  SER A N   1 
ATOM   832  C  CA  . SER A 1 103 ? -19.001 -17.769 0.776   1.00 41.45  ? 103  SER A CA  1 
ATOM   833  C  C   . SER A 1 103 ? -19.794 -19.058 0.933   1.00 41.68  ? 103  SER A C   1 
ATOM   834  O  O   . SER A 1 103 ? -19.240 -20.050 1.430   1.00 41.72  ? 103  SER A O   1 
ATOM   835  C  CB  . SER A 1 103 ? -17.820 -17.982 -0.167  1.00 39.39  ? 103  SER A CB  1 
ATOM   836  O  OG  . SER A 1 103 ? -18.258 -18.253 -1.488  1.00 44.24  ? 103  SER A OG  1 
ATOM   837  N  N   . PRO A 1 104 ? -21.067 -19.117 0.506   1.00 42.33  ? 104  PRO A N   1 
ATOM   838  C  CA  . PRO A 1 104 ? -21.770 -18.043 -0.206  1.00 44.67  ? 104  PRO A CA  1 
ATOM   839  C  C   . PRO A 1 104 ? -22.128 -16.872 0.702   1.00 41.61  ? 104  PRO A C   1 
ATOM   840  O  O   . PRO A 1 104 ? -22.190 -17.048 1.921   1.00 38.67  ? 104  PRO A O   1 
ATOM   841  C  CB  . PRO A 1 104 ? -23.034 -18.739 -0.724  1.00 48.32  ? 104  PRO A CB  1 
ATOM   842  C  CG  . PRO A 1 104 ? -23.289 -19.813 0.267   1.00 46.58  ? 104  PRO A CG  1 
ATOM   843  C  CD  . PRO A 1 104 ? -21.937 -20.285 0.736   1.00 45.96  ? 104  PRO A CD  1 
ATOM   844  N  N   . ARG A 1 105 ? -22.341 -15.698 0.119   1.00 36.43  ? 105  ARG A N   1 
ATOM   845  C  CA  . ARG A 1 105 ? -22.618 -14.506 0.910   1.00 41.00  ? 105  ARG A CA  1 
ATOM   846  C  C   . ARG A 1 105 ? -23.891 -14.681 1.736   1.00 43.97  ? 105  ARG A C   1 
ATOM   847  O  O   . ARG A 1 105 ? -24.952 -14.975 1.169   1.00 44.62  ? 105  ARG A O   1 
ATOM   848  C  CB  . ARG A 1 105 ? -22.747 -13.293 -0.001  1.00 37.61  ? 105  ARG A CB  1 
ATOM   849  C  CG  . ARG A 1 105 ? -23.172 -12.038 0.730   1.00 40.75  ? 105  ARG A CG  1 
ATOM   850  C  CD  . ARG A 1 105 ? -23.655 -10.994 -0.258  1.00 37.78  ? 105  ARG A CD  1 
ATOM   851  N  NE  . ARG A 1 105 ? -22.631 -10.684 -1.244  1.00 39.87  ? 105  ARG A NE  1 
ATOM   852  C  CZ  . ARG A 1 105 ? -22.843 -9.963  -2.339  1.00 42.61  ? 105  ARG A CZ  1 
ATOM   853  N  NH1 . ARG A 1 105 ? -24.052 -9.480  -2.592  1.00 42.18  ? 105  ARG A NH1 1 
ATOM   854  N  NH2 . ARG A 1 105 ? -21.847 -9.727  -3.183  1.00 39.72  ? 105  ARG A NH2 1 
ATOM   855  N  N   . PRO A 1 106 ? -23.836 -14.526 3.055   1.00 42.51  ? 106  PRO A N   1 
ATOM   856  C  CA  . PRO A 1 106 ? -25.054 -14.656 3.859   1.00 38.58  ? 106  PRO A CA  1 
ATOM   857  C  C   . PRO A 1 106 ? -26.027 -13.525 3.565   1.00 40.21  ? 106  PRO A C   1 
ATOM   858  O  O   . PRO A 1 106 ? -25.707 -12.524 2.920   1.00 37.16  ? 106  PRO A O   1 
ATOM   859  C  CB  . PRO A 1 106 ? -24.544 -14.605 5.303   1.00 46.26  ? 106  PRO A CB  1 
ATOM   860  C  CG  . PRO A 1 106 ? -23.224 -13.925 5.220   1.00 42.36  ? 106  PRO A CG  1 
ATOM   861  C  CD  . PRO A 1 106 ? -22.642 -14.305 3.889   1.00 38.58  ? 106  PRO A CD  1 
ATOM   862  N  N   . LYS A 1 107 ? -27.251 -13.701 4.057   1.00 44.15  ? 107  LYS A N   1 
ATOM   863  C  CA  . LYS A 1 107 ? -28.297 -12.725 3.781   1.00 42.89  ? 107  LYS A CA  1 
ATOM   864  C  C   . LYS A 1 107 ? -28.123 -11.474 4.632   1.00 42.86  ? 107  LYS A C   1 
ATOM   865  O  O   . LYS A 1 107 ? -28.040 -10.359 4.105   1.00 43.47  ? 107  LYS A O   1 
ATOM   866  C  CB  . LYS A 1 107 ? -29.676 -13.351 4.004   1.00 46.82  ? 107  LYS A CB  1 
ATOM   867  C  CG  . LYS A 1 107 ? -30.742 -12.820 3.065   1.00 47.05  ? 107  LYS A CG  1 
ATOM   868  C  CD  . LYS A 1 107 ? -31.939 -13.750 3.005   1.00 47.11  ? 107  LYS A CD  1 
ATOM   869  C  CE  . LYS A 1 107 ? -32.184 -14.244 1.591   1.00 48.90  ? 107  LYS A CE  1 
ATOM   870  N  NZ  . LYS A 1 107 ? -33.595 -14.686 1.422   1.00 51.75  ? 107  LYS A NZ  1 
ATOM   871  N  N   . SER A 1 108 ? -28.061 -11.642 5.954   1.00 41.62  ? 108  SER A N   1 
ATOM   872  C  CA  . SER A 1 108 ? -27.943 -10.513 6.864   1.00 37.52  ? 108  SER A CA  1 
ATOM   873  C  C   . SER A 1 108 ? -27.344 -10.984 8.187   1.00 38.37  ? 108  SER A C   1 
ATOM   874  O  O   . SER A 1 108 ? -28.074 -11.226 9.152   1.00 42.49  ? 108  SER A O   1 
ATOM   875  C  CB  . SER A 1 108 ? -29.311 -9.865  7.083   1.00 42.69  ? 108  SER A CB  1 
ATOM   876  O  OG  . SER A 1 108 ? -29.233 -8.764  7.969   1.00 48.26  ? 108  SER A OG  1 
ATOM   877  N  N   . THR A 1 109 ? -26.025 -11.117 8.249   1.00 36.90  ? 109  THR A N   1 
ATOM   878  C  CA  . THR A 1 109 ? -25.369 -11.761 9.377   1.00 36.43  ? 109  THR A CA  1 
ATOM   879  C  C   . THR A 1 109 ? -24.658 -10.743 10.267  1.00 34.27  ? 109  THR A C   1 
ATOM   880  O  O   . THR A 1 109 ? -24.476 -9.575  9.913   1.00 32.07  ? 109  THR A O   1 
ATOM   881  C  CB  . THR A 1 109 ? -24.373 -12.818 8.888   1.00 38.38  ? 109  THR A CB  1 
ATOM   882  O  OG1 . THR A 1 109 ? -24.033 -13.692 9.974   1.00 44.29  ? 109  THR A OG1 1 
ATOM   883  C  CG2 . THR A 1 109 ? -23.108 -12.154 8.395   1.00 36.61  ? 109  THR A CG2 1 
ATOM   884  N  N   . THR A 1 110 ? -24.264 -11.224 11.447  1.00 31.94  ? 110  THR A N   1 
ATOM   885  C  CA  . THR A 1 110 ? -23.529 -10.425 12.422  1.00 29.39  ? 110  THR A CA  1 
ATOM   886  C  C   . THR A 1 110 ? -22.236 -9.875  11.829  1.00 26.15  ? 110  THR A C   1 
ATOM   887  O  O   . THR A 1 110 ? -21.536 -10.556 11.075  1.00 27.45  ? 110  THR A O   1 
ATOM   888  C  CB  . THR A 1 110 ? -23.229 -11.293 13.643  1.00 28.21  ? 110  THR A CB  1 
ATOM   889  O  OG1 . THR A 1 110 ? -24.460 -11.636 14.274  1.00 31.49  ? 110  THR A OG1 1 
ATOM   890  C  CG2 . THR A 1 110 ? -22.355 -10.564 14.668  1.00 28.19  ? 110  THR A CG2 1 
ATOM   891  N  N   . VAL A 1 111 ? -21.936 -8.622  12.160  1.00 26.52  ? 111  VAL A N   1 
ATOM   892  C  CA  . VAL A 1 111 ? -20.721 -7.942  11.727  1.00 25.51  ? 111  VAL A CA  1 
ATOM   893  C  C   . VAL A 1 111 ? -19.829 -7.718  12.944  1.00 24.25  ? 111  VAL A C   1 
ATOM   894  O  O   . VAL A 1 111 ? -20.315 -7.345  14.016  1.00 23.61  ? 111  VAL A O   1 
ATOM   895  C  CB  . VAL A 1 111 ? -21.053 -6.603  11.037  1.00 27.17  ? 111  VAL A CB  1 
ATOM   896  C  CG1 . VAL A 1 111 ? -19.776 -5.893  10.584  1.00 25.81  ? 111  VAL A CG1 1 
ATOM   897  C  CG2 . VAL A 1 111 ? -22.001 -6.826  9.845   1.00 28.29  ? 111  VAL A CG2 1 
ATOM   898  N  N   . MET A 1 112 ? -18.526 -7.954  12.781  1.00 25.87  ? 112  MET A N   1 
ATOM   899  C  CA  . MET A 1 112 ? -17.529 -7.619  13.792  1.00 27.05  ? 112  MET A CA  1 
ATOM   900  C  C   . MET A 1 112 ? -16.476 -6.729  13.152  1.00 24.29  ? 112  MET A C   1 
ATOM   901  O  O   . MET A 1 112 ? -15.941 -7.072  12.093  1.00 25.96  ? 112  MET A O   1 
ATOM   902  C  CB  . MET A 1 112 ? -16.881 -8.878  14.385  1.00 23.63  ? 112  MET A CB  1 
ATOM   903  C  CG  . MET A 1 112 ? -17.872 -9.826  15.055  1.00 25.30  ? 112  MET A CG  1 
ATOM   904  S  SD  . MET A 1 112 ? -17.079 -11.351 15.624  1.00 27.29  ? 112  MET A SD  1 
ATOM   905  C  CE  . MET A 1 112 ? -16.125 -10.736 17.021  1.00 29.31  ? 112  MET A CE  1 
ATOM   906  N  N   . VAL A 1 113 ? -16.196 -5.588  13.780  1.00 23.35  ? 113  VAL A N   1 
ATOM   907  C  CA  . VAL A 1 113 ? -15.280 -4.589  13.234  1.00 22.44  ? 113  VAL A CA  1 
ATOM   908  C  C   . VAL A 1 113 ? -14.072 -4.516  14.165  1.00 21.80  ? 113  VAL A C   1 
ATOM   909  O  O   . VAL A 1 113 ? -14.194 -4.091  15.320  1.00 22.01  ? 113  VAL A O   1 
ATOM   910  C  CB  . VAL A 1 113 ? -15.949 -3.215  13.091  1.00 22.49  ? 113  VAL A CB  1 
ATOM   911  C  CG1 . VAL A 1 113 ? -14.954 -2.188  12.520  1.00 22.91  ? 113  VAL A CG1 1 
ATOM   912  C  CG2 . VAL A 1 113 ? -17.187 -3.315  12.199  1.00 24.75  ? 113  VAL A CG2 1 
ATOM   913  N  N   . TRP A 1 114 ? -12.906 -4.916  13.657  1.00 22.73  ? 114  TRP A N   1 
ATOM   914  C  CA  . TRP A 1 114 ? -11.674 -4.923  14.440  1.00 21.98  ? 114  TRP A CA  1 
ATOM   915  C  C   . TRP A 1 114 ? -11.000 -3.555  14.411  1.00 25.57  ? 114  TRP A C   1 
ATOM   916  O  O   . TRP A 1 114 ? -10.828 -2.962  13.341  1.00 20.98  ? 114  TRP A O   1 
ATOM   917  C  CB  . TRP A 1 114 ? -10.706 -5.971  13.891  1.00 20.35  ? 114  TRP A CB  1 
ATOM   918  C  CG  . TRP A 1 114 ? -9.346  -5.959  14.547  1.00 22.47  ? 114  TRP A CG  1 
ATOM   919  C  CD1 . TRP A 1 114 ? -8.150  -5.569  13.977  1.00 24.08  ? 114  TRP A CD1 1 
ATOM   920  C  CD2 . TRP A 1 114 ? -9.037  -6.375  15.877  1.00 21.75  ? 114  TRP A CD2 1 
ATOM   921  N  NE1 . TRP A 1 114 ? -7.124  -5.711  14.887  1.00 23.93  ? 114  TRP A NE1 1 
ATOM   922  C  CE2 . TRP A 1 114 ? -7.642  -6.200  16.061  1.00 22.23  ? 114  TRP A CE2 1 
ATOM   923  C  CE3 . TRP A 1 114 ? -9.803  -6.867  16.941  1.00 23.03  ? 114  TRP A CE3 1 
ATOM   924  C  CZ2 . TRP A 1 114 ? -7.001  -6.512  17.263  1.00 23.22  ? 114  TRP A CZ2 1 
ATOM   925  C  CZ3 . TRP A 1 114 ? -9.147  -7.183  18.148  1.00 21.32  ? 114  TRP A CZ3 1 
ATOM   926  C  CH2 . TRP A 1 114 ? -7.772  -6.999  18.290  1.00 21.90  ? 114  TRP A CH2 1 
ATOM   927  N  N   . ILE A 1 115 ? -10.588 -3.070  15.582  1.00 21.34  ? 115  ILE A N   1 
ATOM   928  C  CA  . ILE A 1 115 ? -9.862  -1.809  15.705  1.00 19.78  ? 115  ILE A CA  1 
ATOM   929  C  C   . ILE A 1 115 ? -8.493  -2.136  16.287  1.00 23.06  ? 115  ILE A C   1 
ATOM   930  O  O   . ILE A 1 115 ? -8.400  -2.532  17.454  1.00 20.39  ? 115  ILE A O   1 
ATOM   931  C  CB  . ILE A 1 115 ? -10.597 -0.802  16.596  1.00 20.99  ? 115  ILE A CB  1 
ATOM   932  C  CG1 . ILE A 1 115 ? -12.016 -0.534  16.078  1.00 18.85  ? 115  ILE A CG1 1 
ATOM   933  C  CG2 . ILE A 1 115 ? -9.789  0.495   16.691  1.00 21.05  ? 115  ILE A CG2 1 
ATOM   934  C  CD1 . ILE A 1 115 ? -12.812 0.435   16.980  1.00 22.10  ? 115  ILE A CD1 1 
ATOM   935  N  N   . TYR A 1 116 ? -7.431  -1.962  15.497  1.00 21.43  ? 116  TYR A N   1 
ATOM   936  C  CA  . TYR A 1 116 ? -6.112  -2.345  15.990  1.00 21.62  ? 116  TYR A CA  1 
ATOM   937  C  C   . TYR A 1 116 ? -5.634  -1.425  17.116  1.00 20.31  ? 116  TYR A C   1 
ATOM   938  O  O   . TYR A 1 116 ? -6.012  -0.250  17.219  1.00 20.50  ? 116  TYR A O   1 
ATOM   939  C  CB  . TYR A 1 116 ? -5.079  -2.388  14.846  1.00 22.18  ? 116  TYR A CB  1 
ATOM   940  C  CG  . TYR A 1 116 ? -4.887  -1.114  14.043  1.00 23.36  ? 116  TYR A CG  1 
ATOM   941  C  CD1 . TYR A 1 116 ? -4.266  0.006   14.595  1.00 22.06  ? 116  TYR A CD1 1 
ATOM   942  C  CD2 . TYR A 1 116 ? -5.292  -1.045  12.708  1.00 22.62  ? 116  TYR A CD2 1 
ATOM   943  C  CE1 . TYR A 1 116 ? -4.074  1.160   13.850  1.00 20.01  ? 116  TYR A CE1 1 
ATOM   944  C  CE2 . TYR A 1 116 ? -5.108  0.103   11.961  1.00 20.43  ? 116  TYR A CE2 1 
ATOM   945  C  CZ  . TYR A 1 116 ? -4.512  1.204   12.538  1.00 22.64  ? 116  TYR A CZ  1 
ATOM   946  O  OH  . TYR A 1 116 ? -4.332  2.350   11.793  1.00 23.02  ? 116  TYR A OH  1 
ATOM   947  N  N   . GLY A 1 117 ? -4.786  -1.981  17.981  1.00 19.90  ? 117  GLY A N   1 
ATOM   948  C  CA  . GLY A 1 117 ? -4.111  -1.216  19.001  1.00 21.33  ? 117  GLY A CA  1 
ATOM   949  C  C   . GLY A 1 117 ? -2.697  -0.869  18.578  1.00 25.89  ? 117  GLY A C   1 
ATOM   950  O  O   . GLY A 1 117 ? -2.307  -1.021  17.415  1.00 27.72  ? 117  GLY A O   1 
ATOM   951  N  N   . GLY A 1 118 ? -1.910  -0.421  19.552  1.00 22.57  ? 118  GLY A N   1 
ATOM   952  C  CA  . GLY A 1 118 ? -0.584  0.090   19.263  1.00 23.15  ? 118  GLY A CA  1 
ATOM   953  C  C   . GLY A 1 118 ? -0.311  1.430   19.913  1.00 22.74  ? 118  GLY A C   1 
ATOM   954  O  O   . GLY A 1 118 ? 0.406   2.256   19.349  1.00 21.13  ? 118  GLY A O   1 
ATOM   955  N  N   . GLY A 1 119 ? -0.888  1.672   21.093  1.00 21.28  ? 119  GLY A N   1 
ATOM   956  C  CA  . GLY A 1 119 ? -0.553  2.862   21.857  1.00 22.29  ? 119  GLY A CA  1 
ATOM   957  C  C   . GLY A 1 119 ? -0.987  4.170   21.240  1.00 20.26  ? 119  GLY A C   1 
ATOM   958  O  O   . GLY A 1 119 ? -0.521  5.227   21.678  1.00 22.87  ? 119  GLY A O   1 
ATOM   959  N  N   . PHE A 1 120 ? -1.864  4.131   20.240  1.00 20.26  ? 120  PHE A N   1 
ATOM   960  C  CA  . PHE A 1 120 ? -2.227  5.274   19.406  1.00 20.76  ? 120  PHE A CA  1 
ATOM   961  C  C   . PHE A 1 120 ? -1.052  5.842   18.592  1.00 22.42  ? 120  PHE A C   1 
ATOM   962  O  O   . PHE A 1 120 ? -1.217  6.880   17.929  1.00 22.49  ? 120  PHE A O   1 
ATOM   963  C  CB  . PHE A 1 120 ? -2.874  6.382   20.241  1.00 19.81  ? 120  PHE A CB  1 
ATOM   964  C  CG  . PHE A 1 120 ? -4.202  5.990   20.833  1.00 20.24  ? 120  PHE A CG  1 
ATOM   965  C  CD1 . PHE A 1 120 ? -5.311  5.824   20.018  1.00 22.16  ? 120  PHE A CD1 1 
ATOM   966  C  CD2 . PHE A 1 120 ? -4.338  5.804   22.198  1.00 21.17  ? 120  PHE A CD2 1 
ATOM   967  C  CE1 . PHE A 1 120 ? -6.547  5.465   20.552  1.00 20.38  ? 120  PHE A CE1 1 
ATOM   968  C  CE2 . PHE A 1 120 ? -5.568  5.455   22.757  1.00 21.34  ? 120  PHE A CE2 1 
ATOM   969  C  CZ  . PHE A 1 120 ? -6.679  5.279   21.926  1.00 21.41  ? 120  PHE A CZ  1 
ATOM   970  N  N   . TYR A 1 121 ? 0.121   5.185   18.600  1.00 20.89  ? 121  TYR A N   1 
ATOM   971  C  CA  . TYR A 1 121 ? 1.267   5.631   17.806  1.00 18.87  ? 121  TYR A CA  1 
ATOM   972  C  C   . TYR A 1 121 ? 1.649   4.667   16.693  1.00 22.68  ? 121  TYR A C   1 
ATOM   973  O  O   . TYR A 1 121 ? 2.531   4.996   15.880  1.00 22.13  ? 121  TYR A O   1 
ATOM   974  C  CB  . TYR A 1 121 ? 2.502   5.868   18.711  1.00 22.03  ? 121  TYR A CB  1 
ATOM   975  C  CG  . TYR A 1 121 ? 3.175   4.601   19.206  1.00 21.60  ? 121  TYR A CG  1 
ATOM   976  C  CD1 . TYR A 1 121 ? 4.156   3.957   18.449  1.00 25.05  ? 121  TYR A CD1 1 
ATOM   977  C  CD2 . TYR A 1 121 ? 2.840   4.056   20.447  1.00 25.95  ? 121  TYR A CD2 1 
ATOM   978  C  CE1 . TYR A 1 121 ? 4.775   2.795   18.914  1.00 27.26  ? 121  TYR A CE1 1 
ATOM   979  C  CE2 . TYR A 1 121 ? 3.452   2.900   20.919  1.00 25.83  ? 121  TYR A CE2 1 
ATOM   980  C  CZ  . TYR A 1 121 ? 4.414   2.275   20.148  1.00 29.92  ? 121  TYR A CZ  1 
ATOM   981  O  OH  . TYR A 1 121 ? 5.015   1.128   20.623  1.00 28.75  ? 121  TYR A OH  1 
ATOM   982  N  N   . SER A 1 122 ? 1.038   3.489   16.643  1.00 21.09  ? 122  SER A N   1 
ATOM   983  C  CA  . SER A 1 122 ? 1.403   2.460   15.679  1.00 24.93  ? 122  SER A CA  1 
ATOM   984  C  C   . SER A 1 122 ? 0.196   1.554   15.468  1.00 21.19  ? 122  SER A C   1 
ATOM   985  O  O   . SER A 1 122 ? -0.835  1.689   16.136  1.00 23.48  ? 122  SER A O   1 
ATOM   986  C  CB  . SER A 1 122 ? 2.609   1.657   16.167  1.00 25.30  ? 122  SER A CB  1 
ATOM   987  O  OG  . SER A 1 122 ? 2.261   0.964   17.356  1.00 26.03  ? 122  SER A OG  1 
ATOM   988  N  N   . GLY A 1 123 ? 0.337   0.612   14.547  1.00 20.28  ? 123  GLY A N   1 
ATOM   989  C  CA  . GLY A 1 123 ? -0.724  -0.342  14.287  1.00 18.93  ? 123  GLY A CA  1 
ATOM   990  C  C   . GLY A 1 123 ? -1.061  -0.354  12.805  1.00 21.78  ? 123  GLY A C   1 
ATOM   991  O  O   . GLY A 1 123 ? -0.917  0.652   12.100  1.00 21.48  ? 123  GLY A O   1 
ATOM   992  N  N   . SER A 1 124 ? -1.494  -1.511  12.322  1.00 21.84  ? 124  SER A N   1 
ATOM   993  C  CA  . SER A 1 124 ? -1.858  -1.695  10.929  1.00 23.58  ? 124  SER A CA  1 
ATOM   994  C  C   . SER A 1 124 ? -3.024  -2.669  10.863  1.00 23.37  ? 124  SER A C   1 
ATOM   995  O  O   . SER A 1 124 ? -3.079  -3.631  11.632  1.00 24.52  ? 124  SER A O   1 
ATOM   996  C  CB  . SER A 1 124 ? -0.673  -2.226  10.102  1.00 23.27  ? 124  SER A CB  1 
ATOM   997  O  OG  . SER A 1 124 ? 0.415   -1.322  10.138  1.00 24.36  ? 124  SER A OG  1 
ATOM   998  N  N   . SER A 1 125 ? -3.946  -2.433  9.929   1.00 22.71  ? 125  SER A N   1 
ATOM   999  C  CA  . SER A 1 125 ? -5.024  -3.395  9.730   1.00 24.61  ? 125  SER A CA  1 
ATOM   1000 C  C   . SER A 1 125 ? -4.557  -4.677  9.049   1.00 27.54  ? 125  SER A C   1 
ATOM   1001 O  O   . SER A 1 125 ? -5.305  -5.663  9.043   1.00 30.30  ? 125  SER A O   1 
ATOM   1002 C  CB  . SER A 1 125 ? -6.139  -2.762  8.897   1.00 24.34  ? 125  SER A CB  1 
ATOM   1003 O  OG  . SER A 1 125 ? -5.657  -2.522  7.582   1.00 22.89  ? 125  SER A OG  1 
ATOM   1004 N  N   . THR A 1 126 ? -3.348  -4.688  8.487   1.00 25.51  ? 126  THR A N   1 
ATOM   1005 C  CA  . THR A 1 126 ? -2.914  -5.699  7.533   1.00 26.33  ? 126  THR A CA  1 
ATOM   1006 C  C   . THR A 1 126 ? -1.986  -6.747  8.129   1.00 30.67  ? 126  THR A C   1 
ATOM   1007 O  O   . THR A 1 126 ? -1.484  -7.601  7.392   1.00 29.43  ? 126  THR A O   1 
ATOM   1008 C  CB  . THR A 1 126 ? -2.205  -5.023  6.360   1.00 28.09  ? 126  THR A CB  1 
ATOM   1009 O  OG1 . THR A 1 126 ? -1.049  -4.331  6.858   1.00 22.35  ? 126  THR A OG1 1 
ATOM   1010 C  CG2 . THR A 1 126 ? -3.146  -4.028  5.668   1.00 23.89  ? 126  THR A CG2 1 
ATOM   1011 N  N   . LEU A 1 127 ? -1.730  -6.693  9.432   1.00 25.52  ? 127  LEU A N   1 
ATOM   1012 C  CA  . LEU A 1 127 ? -0.867  -7.679  10.055  1.00 28.50  ? 127  LEU A CA  1 
ATOM   1013 C  C   . LEU A 1 127 ? -1.413  -9.083  9.822   1.00 26.08  ? 127  LEU A C   1 
ATOM   1014 O  O   . LEU A 1 127 ? -2.629  -9.300  9.772   1.00 28.32  ? 127  LEU A O   1 
ATOM   1015 C  CB  . LEU A 1 127 ? -0.763  -7.400  11.559  1.00 20.09  ? 127  LEU A CB  1 
ATOM   1016 C  CG  . LEU A 1 127 ? -0.343  -5.987  11.961  1.00 23.64  ? 127  LEU A CG  1 
ATOM   1017 C  CD1 . LEU A 1 127 ? -0.027  -5.950  13.460  1.00 21.38  ? 127  LEU A CD1 1 
ATOM   1018 C  CD2 . LEU A 1 127 ? 0.900   -5.543  11.150  1.00 26.08  ? 127  LEU A CD2 1 
ATOM   1019 N  N   . ASP A 1 128 ? -0.494  -10.043 9.688   1.00 28.61  ? 128  ASP A N   1 
ATOM   1020 C  CA  . ASP A 1 128 ? -0.890  -11.445 9.586   1.00 32.12  ? 128  ASP A CA  1 
ATOM   1021 C  C   . ASP A 1 128 ? -1.816  -11.846 10.732  1.00 32.56  ? 128  ASP A C   1 
ATOM   1022 O  O   . ASP A 1 128 ? -2.788  -12.582 10.530  1.00 29.91  ? 128  ASP A O   1 
ATOM   1023 C  CB  . ASP A 1 128 ? 0.349   -12.352 9.575   1.00 31.89  ? 128  ASP A CB  1 
ATOM   1024 C  CG  . ASP A 1 128 ? 1.196   -12.202 8.317   1.00 38.05  ? 128  ASP A CG  1 
ATOM   1025 O  OD1 . ASP A 1 128 ? 0.779   -11.498 7.374   1.00 41.72  ? 128  ASP A OD1 1 
ATOM   1026 O  OD2 . ASP A 1 128 ? 2.296   -12.793 8.277   1.00 43.18  ? 128  ASP A OD2 1 
ATOM   1027 N  N   . VAL A 1 129 ? -1.551  -11.345 11.942  1.00 29.88  ? 129  VAL A N   1 
ATOM   1028 C  CA  . VAL A 1 129 ? -2.324  -11.778 13.103  1.00 30.62  ? 129  VAL A CA  1 
ATOM   1029 C  C   . VAL A 1 129 ? -3.726  -11.180 13.134  1.00 32.01  ? 129  VAL A C   1 
ATOM   1030 O  O   . VAL A 1 129 ? -4.560  -11.611 13.946  1.00 29.76  ? 129  VAL A O   1 
ATOM   1031 C  CB  . VAL A 1 129 ? -1.529  -11.476 14.396  1.00 36.20  ? 129  VAL A CB  1 
ATOM   1032 C  CG1 . VAL A 1 129 ? -1.514  -9.978  14.717  1.00 28.65  ? 129  VAL A CG1 1 
ATOM   1033 C  CG2 . VAL A 1 129 ? -2.072  -12.288 15.565  1.00 30.05  ? 129  VAL A CG2 1 
ATOM   1034 N  N   . TYR A 1 130 ? -4.026  -10.215 12.260  1.00 27.84  ? 130  TYR A N   1 
ATOM   1035 C  CA  . TYR A 1 130 ? -5.375  -9.669  12.141  1.00 26.09  ? 130  TYR A CA  1 
ATOM   1036 C  C   . TYR A 1 130 ? -6.111  -10.193 10.909  1.00 29.99  ? 130  TYR A C   1 
ATOM   1037 O  O   . TYR A 1 130 ? -7.165  -9.654  10.551  1.00 27.27  ? 130  TYR A O   1 
ATOM   1038 C  CB  . TYR A 1 130 ? -5.350  -8.133  12.100  1.00 25.78  ? 130  TYR A CB  1 
ATOM   1039 C  CG  . TYR A 1 130 ? -4.644  -7.432  13.252  1.00 25.53  ? 130  TYR A CG  1 
ATOM   1040 C  CD1 . TYR A 1 130 ? -4.594  -7.989  14.532  1.00 25.51  ? 130  TYR A CD1 1 
ATOM   1041 C  CD2 . TYR A 1 130 ? -4.044  -6.197  13.054  1.00 22.06  ? 130  TYR A CD2 1 
ATOM   1042 C  CE1 . TYR A 1 130 ? -3.943  -7.325  15.578  1.00 22.45  ? 130  TYR A CE1 1 
ATOM   1043 C  CE2 . TYR A 1 130 ? -3.397  -5.532  14.080  1.00 21.57  ? 130  TYR A CE2 1 
ATOM   1044 C  CZ  . TYR A 1 130 ? -3.354  -6.101  15.344  1.00 24.17  ? 130  TYR A CZ  1 
ATOM   1045 O  OH  . TYR A 1 130 ? -2.696  -5.422  16.347  1.00 23.18  ? 130  TYR A OH  1 
ATOM   1046 N  N   . ASN A 1 131 ? -5.592  -11.235 10.265  1.00 26.91  ? 131  ASN A N   1 
ATOM   1047 C  CA  . ASN A 1 131 ? -6.241  -11.797 9.086   1.00 29.62  ? 131  ASN A CA  1 
ATOM   1048 C  C   . ASN A 1 131 ? -7.625  -12.309 9.451   1.00 29.90  ? 131  ASN A C   1 
ATOM   1049 O  O   . ASN A 1 131 ? -7.761  -13.272 10.211  1.00 31.47  ? 131  ASN A O   1 
ATOM   1050 C  CB  . ASN A 1 131 ? -5.391  -12.913 8.490   1.00 30.13  ? 131  ASN A CB  1 
ATOM   1051 C  CG  . ASN A 1 131 ? -5.893  -13.369 7.125   1.00 32.48  ? 131  ASN A CG  1 
ATOM   1052 O  OD1 . ASN A 1 131 ? -7.068  -13.207 6.784   1.00 30.66  ? 131  ASN A OD1 1 
ATOM   1053 N  ND2 . ASN A 1 131 ? -4.997  -13.954 6.343   1.00 37.45  ? 131  ASN A ND2 1 
ATOM   1054 N  N   . GLY A 1 132 ? -8.657  -11.673 8.917   1.00 28.53  ? 132  GLY A N   1 
ATOM   1055 C  CA  . GLY A 1 132 ? -10.003 -11.991 9.314   1.00 27.40  ? 132  GLY A CA  1 
ATOM   1056 C  C   . GLY A 1 132 ? -10.611 -13.265 8.770   1.00 30.96  ? 132  GLY A C   1 
ATOM   1057 O  O   . GLY A 1 132 ? -11.756 -13.580 9.120   1.00 29.83  ? 132  GLY A O   1 
ATOM   1058 N  N   . LYS A 1 133 ? -9.891  -14.017 7.932   1.00 29.63  ? 133  LYS A N   1 
ATOM   1059 C  CA  . LYS A 1 133 ? -10.548 -15.076 7.172   1.00 31.68  ? 133  LYS A CA  1 
ATOM   1060 C  C   . LYS A 1 133 ? -10.942 -16.271 8.038   1.00 35.78  ? 133  LYS A C   1 
ATOM   1061 O  O   . LYS A 1 133 ? -11.976 -16.898 7.778   1.00 33.11  ? 133  LYS A O   1 
ATOM   1062 C  CB  . LYS A 1 133 ? -9.661  -15.530 6.016   1.00 30.28  ? 133  LYS A CB  1 
ATOM   1063 C  CG  . LYS A 1 133 ? -8.375  -16.230 6.400   1.00 35.11  ? 133  LYS A CG  1 
ATOM   1064 C  CD  . LYS A 1 133 ? -7.536  -16.436 5.149   1.00 34.67  ? 133  LYS A CD  1 
ATOM   1065 C  CE  . LYS A 1 133 ? -6.336  -17.324 5.386   1.00 36.60  ? 133  LYS A CE  1 
ATOM   1066 N  NZ  . LYS A 1 133 ? -5.473  -17.354 4.179   1.00 37.70  ? 133  LYS A NZ  1 
ATOM   1067 N  N   . TYR A 1 134 ? -10.151 -16.606 9.062   1.00 30.47  ? 134  TYR A N   1 
ATOM   1068 C  CA  . TYR A 1 134 ? -10.504 -17.752 9.898   1.00 33.43  ? 134  TYR A CA  1 
ATOM   1069 C  C   . TYR A 1 134 ? -11.745 -17.466 10.738  1.00 30.67  ? 134  TYR A C   1 
ATOM   1070 O  O   . TYR A 1 134 ? -12.631 -18.323 10.859  1.00 31.27  ? 134  TYR A O   1 
ATOM   1071 C  CB  . TYR A 1 134 ? -9.317  -18.142 10.783  1.00 32.88  ? 134  TYR A CB  1 
ATOM   1072 C  CG  . TYR A 1 134 ? -8.038  -18.269 10.004  1.00 31.87  ? 134  TYR A CG  1 
ATOM   1073 C  CD1 . TYR A 1 134 ? -7.821  -19.350 9.156   1.00 36.30  ? 134  TYR A CD1 1 
ATOM   1074 C  CD2 . TYR A 1 134 ? -7.051  -17.295 10.091  1.00 34.04  ? 134  TYR A CD2 1 
ATOM   1075 C  CE1 . TYR A 1 134 ? -6.654  -19.457 8.419   1.00 36.52  ? 134  TYR A CE1 1 
ATOM   1076 C  CE2 . TYR A 1 134 ? -5.887  -17.393 9.360   1.00 32.86  ? 134  TYR A CE2 1 
ATOM   1077 C  CZ  . TYR A 1 134 ? -5.689  -18.476 8.531   1.00 36.58  ? 134  TYR A CZ  1 
ATOM   1078 O  OH  . TYR A 1 134 ? -4.518  -18.573 7.818   1.00 35.98  ? 134  TYR A OH  1 
ATOM   1079 N  N   . LEU A 1 135 ? -11.841 -16.260 11.298  1.00 29.49  ? 135  LEU A N   1 
ATOM   1080 C  CA  . LEU A 1 135 ? -12.992 -15.906 12.123  1.00 30.62  ? 135  LEU A CA  1 
ATOM   1081 C  C   . LEU A 1 135 ? -14.260 -15.785 11.282  1.00 34.59  ? 135  LEU A C   1 
ATOM   1082 O  O   . LEU A 1 135 ? -15.317 -16.312 11.650  1.00 31.77  ? 135  LEU A O   1 
ATOM   1083 C  CB  . LEU A 1 135 ? -12.697 -14.605 12.870  1.00 33.84  ? 135  LEU A CB  1 
ATOM   1084 C  CG  . LEU A 1 135 ? -13.668 -14.137 13.942  1.00 37.55  ? 135  LEU A CG  1 
ATOM   1085 C  CD1 . LEU A 1 135 ? -14.013 -15.290 14.865  1.00 34.75  ? 135  LEU A CD1 1 
ATOM   1086 C  CD2 . LEU A 1 135 ? -13.040 -12.985 14.713  1.00 34.50  ? 135  LEU A CD2 1 
ATOM   1087 N  N   . ALA A 1 136 ? -14.169 -15.105 10.138  1.00 31.50  ? 136  ALA A N   1 
ATOM   1088 C  CA  . ALA A 1 136 ? -15.317 -14.991 9.244   1.00 32.19  ? 136  ALA A CA  1 
ATOM   1089 C  C   . ALA A 1 136 ? -15.788 -16.365 8.781   1.00 33.96  ? 136  ALA A C   1 
ATOM   1090 O  O   . ALA A 1 136 ? -16.987 -16.668 8.809   1.00 35.02  ? 136  ALA A O   1 
ATOM   1091 C  CB  . ALA A 1 136 ? -14.955 -14.115 8.038   1.00 30.93  ? 136  ALA A CB  1 
ATOM   1092 N  N   . TYR A 1 137 ? -14.851 -17.208 8.348   1.00 33.82  ? 137  TYR A N   1 
ATOM   1093 C  CA  . TYR A 1 137 ? -15.212 -18.536 7.866   1.00 35.43  ? 137  TYR A CA  1 
ATOM   1094 C  C   . TYR A 1 137 ? -15.775 -19.401 8.984   1.00 37.89  ? 137  TYR A C   1 
ATOM   1095 O  O   . TYR A 1 137 ? -16.875 -19.952 8.857   1.00 33.02  ? 137  TYR A O   1 
ATOM   1096 C  CB  . TYR A 1 137 ? -13.999 -19.212 7.241   1.00 35.24  ? 137  TYR A CB  1 
ATOM   1097 C  CG  . TYR A 1 137 ? -14.218 -20.671 6.929   1.00 41.11  ? 137  TYR A CG  1 
ATOM   1098 C  CD1 . TYR A 1 137 ? -15.014 -21.056 5.860   1.00 40.22  ? 137  TYR A CD1 1 
ATOM   1099 C  CD2 . TYR A 1 137 ? -13.622 -21.665 7.696   1.00 38.65  ? 137  TYR A CD2 1 
ATOM   1100 C  CE1 . TYR A 1 137 ? -15.214 -22.386 5.565   1.00 43.35  ? 137  TYR A CE1 1 
ATOM   1101 C  CE2 . TYR A 1 137 ? -13.816 -23.000 7.407   1.00 42.83  ? 137  TYR A CE2 1 
ATOM   1102 C  CZ  . TYR A 1 137 ? -14.612 -23.354 6.338   1.00 47.38  ? 137  TYR A CZ  1 
ATOM   1103 O  OH  . TYR A 1 137 ? -14.811 -24.680 6.037   1.00 46.37  ? 137  TYR A OH  1 
ATOM   1104 N  N   . THR A 1 138 ? -15.034 -19.525 10.094  1.00 32.71  ? 138  THR A N   1 
ATOM   1105 C  CA  . THR A 1 138 ? -15.408 -20.469 11.144  1.00 35.15  ? 138  THR A CA  1 
ATOM   1106 C  C   . THR A 1 138 ? -16.729 -20.088 11.792  1.00 33.37  ? 138  THR A C   1 
ATOM   1107 O  O   . THR A 1 138 ? -17.562 -20.957 12.079  1.00 37.44  ? 138  THR A O   1 
ATOM   1108 C  CB  . THR A 1 138 ? -14.298 -20.553 12.196  1.00 33.08  ? 138  THR A CB  1 
ATOM   1109 O  OG1 . THR A 1 138 ? -13.098 -21.035 11.580  1.00 34.04  ? 138  THR A OG1 1 
ATOM   1110 C  CG2 . THR A 1 138 ? -14.690 -21.494 13.328  1.00 36.13  ? 138  THR A CG2 1 
ATOM   1111 N  N   . GLU A 1 139 ? -16.950 -18.798 12.025  1.00 32.99  ? 139  GLU A N   1 
ATOM   1112 C  CA  . GLU A 1 139 ? -18.119 -18.357 12.772  1.00 31.94  ? 139  GLU A CA  1 
ATOM   1113 C  C   . GLU A 1 139 ? -19.194 -17.714 11.908  1.00 30.20  ? 139  GLU A C   1 
ATOM   1114 O  O   . GLU A 1 139 ? -20.203 -17.251 12.452  1.00 31.40  ? 139  GLU A O   1 
ATOM   1115 C  CB  . GLU A 1 139 ? -17.696 -17.392 13.883  1.00 30.49  ? 139  GLU A CB  1 
ATOM   1116 C  CG  . GLU A 1 139 ? -16.826 -18.048 14.953  1.00 32.48  ? 139  GLU A CG  1 
ATOM   1117 C  CD  . GLU A 1 139 ? -17.565 -19.126 15.721  1.00 31.93  ? 139  GLU A CD  1 
ATOM   1118 O  OE1 . GLU A 1 139 ? -18.735 -18.899 16.083  1.00 36.40  ? 139  GLU A OE1 1 
ATOM   1119 O  OE2 . GLU A 1 139 ? -16.979 -20.202 15.962  1.00 37.73  ? 139  GLU A OE2 1 
ATOM   1120 N  N   . GLU A 1 140 ? -19.014 -17.675 10.584  1.00 34.64  ? 140  GLU A N   1 
ATOM   1121 C  CA  . GLU A 1 140 ? -20.043 -17.166 9.673   1.00 34.32  ? 140  GLU A CA  1 
ATOM   1122 C  C   . GLU A 1 140 ? -20.411 -15.724 10.018  1.00 34.73  ? 140  GLU A C   1 
ATOM   1123 O  O   . GLU A 1 140 ? -21.585 -15.373 10.159  1.00 35.44  ? 140  GLU A O   1 
ATOM   1124 C  CB  . GLU A 1 140 ? -21.286 -18.060 9.703   1.00 33.15  ? 140  GLU A CB  1 
ATOM   1125 C  CG  . GLU A 1 140 ? -21.263 -19.233 8.746   1.00 52.54  ? 140  GLU A CG  1 
ATOM   1126 C  CD  . GLU A 1 140 ? -21.448 -18.805 7.306   1.00 51.36  ? 140  GLU A CD  1 
ATOM   1127 O  OE1 . GLU A 1 140 ? -20.505 -19.001 6.516   1.00 55.59  ? 140  GLU A OE1 1 
ATOM   1128 O  OE2 . GLU A 1 140 ? -22.524 -18.258 6.971   1.00 60.51  ? 140  GLU A OE2 1 
ATOM   1129 N  N   . VAL A 1 141 ? -19.391 -14.888 10.198  1.00 30.07  ? 141  VAL A N   1 
ATOM   1130 C  CA  . VAL A 1 141 ? -19.602 -13.468 10.432  1.00 29.20  ? 141  VAL A CA  1 
ATOM   1131 C  C   . VAL A 1 141 ? -18.936 -12.705 9.298   1.00 27.20  ? 141  VAL A C   1 
ATOM   1132 O  O   . VAL A 1 141 ? -18.059 -13.220 8.601   1.00 30.01  ? 141  VAL A O   1 
ATOM   1133 C  CB  . VAL A 1 141 ? -19.059 -12.990 11.801  1.00 29.18  ? 141  VAL A CB  1 
ATOM   1134 C  CG1 . VAL A 1 141 ? -19.832 -13.635 12.929  1.00 28.66  ? 141  VAL A CG1 1 
ATOM   1135 C  CG2 . VAL A 1 141 ? -17.556 -13.261 11.921  1.00 30.50  ? 141  VAL A CG2 1 
ATOM   1136 N  N   . VAL A 1 142 ? -19.371 -11.464 9.115   1.00 27.47  ? 142  VAL A N   1 
ATOM   1137 C  CA  . VAL A 1 142 ? -18.691 -10.528 8.231   1.00 31.21  ? 142  VAL A CA  1 
ATOM   1138 C  C   . VAL A 1 142 ? -17.671 -9.775  9.080   1.00 29.20  ? 142  VAL A C   1 
ATOM   1139 O  O   . VAL A 1 142 ? -18.036 -9.076  10.033  1.00 27.89  ? 142  VAL A O   1 
ATOM   1140 C  CB  . VAL A 1 142 ? -19.684 -9.572  7.552   1.00 32.32  ? 142  VAL A CB  1 
ATOM   1141 C  CG1 . VAL A 1 142 ? -18.940 -8.493  6.764   1.00 28.55  ? 142  VAL A CG1 1 
ATOM   1142 C  CG2 . VAL A 1 142 ? -20.637 -10.344 6.622   1.00 29.96  ? 142  VAL A CG2 1 
ATOM   1143 N  N   . LEU A 1 143 ? -16.392 -9.934  8.753   1.00 28.48  ? 143  LEU A N   1 
ATOM   1144 C  CA  . LEU A 1 143 ? -15.311 -9.370  9.555   1.00 28.99  ? 143  LEU A CA  1 
ATOM   1145 C  C   . LEU A 1 143 ? -14.713 -8.185  8.816   1.00 29.03  ? 143  LEU A C   1 
ATOM   1146 O  O   . LEU A 1 143 ? -14.211 -8.330  7.688   1.00 27.44  ? 143  LEU A O   1 
ATOM   1147 C  CB  . LEU A 1 143 ? -14.247 -10.421 9.868   1.00 25.72  ? 143  LEU A CB  1 
ATOM   1148 C  CG  . LEU A 1 143 ? -13.210 -10.079 10.951  1.00 27.32  ? 143  LEU A CG  1 
ATOM   1149 C  CD1 . LEU A 1 143 ? -13.878 -9.648  12.229  1.00 28.54  ? 143  LEU A CD1 1 
ATOM   1150 C  CD2 . LEU A 1 143 ? -12.499 -11.334 11.265  1.00 37.43  ? 143  LEU A CD2 1 
ATOM   1151 N  N   . VAL A 1 144 ? -14.814 -7.015  9.438   1.00 23.54  ? 144  VAL A N   1 
ATOM   1152 C  CA  . VAL A 1 144 ? -14.234 -5.773  8.946   1.00 23.46  ? 144  VAL A CA  1 
ATOM   1153 C  C   . VAL A 1 144 ? -13.031 -5.451  9.821   1.00 26.52  ? 144  VAL A C   1 
ATOM   1154 O  O   . VAL A 1 144 ? -13.102 -5.599  11.046  1.00 22.55  ? 144  VAL A O   1 
ATOM   1155 C  CB  . VAL A 1 144 ? -15.259 -4.622  9.002   1.00 25.45  ? 144  VAL A CB  1 
ATOM   1156 C  CG1 . VAL A 1 144 ? -14.633 -3.313  8.537   1.00 24.40  ? 144  VAL A CG1 1 
ATOM   1157 C  CG2 . VAL A 1 144 ? -16.525 -4.966  8.192   1.00 24.66  ? 144  VAL A CG2 1 
ATOM   1158 N  N   . SER A 1 145 ? -11.939 -4.999  9.212   1.00 23.28  ? 145  SER A N   1 
ATOM   1159 C  CA  . SER A 1 145 ? -10.877 -4.345  9.973   1.00 23.11  ? 145  SER A CA  1 
ATOM   1160 C  C   . SER A 1 145 ? -10.716 -2.935  9.429   1.00 24.56  ? 145  SER A C   1 
ATOM   1161 O  O   . SER A 1 145 ? -10.628 -2.741  8.213   1.00 25.12  ? 145  SER A O   1 
ATOM   1162 C  CB  . SER A 1 145 ? -9.560  -5.137  9.925   1.00 23.32  ? 145  SER A CB  1 
ATOM   1163 O  OG  . SER A 1 145 ? -9.047  -5.299  8.611   1.00 25.65  ? 145  SER A OG  1 
ATOM   1164 N  N   . LEU A 1 146 ? -10.749 -1.943  10.310  1.00 22.34  ? 146  LEU A N   1 
ATOM   1165 C  CA  . LEU A 1 146 ? -10.615 -0.570  9.853   1.00 23.02  ? 146  LEU A CA  1 
ATOM   1166 C  C   . LEU A 1 146 ? -9.168  -0.113  10.033  1.00 24.33  ? 146  LEU A C   1 
ATOM   1167 O  O   . LEU A 1 146 ? -8.293  -0.869  10.468  1.00 23.71  ? 146  LEU A O   1 
ATOM   1168 C  CB  . LEU A 1 146 ? -11.610 0.347   10.576  1.00 21.44  ? 146  LEU A CB  1 
ATOM   1169 C  CG  . LEU A 1 146 ? -11.700 0.326   12.113  1.00 21.86  ? 146  LEU A CG  1 
ATOM   1170 C  CD1 . LEU A 1 146 ? -10.524 1.073   12.746  1.00 20.36  ? 146  LEU A CD1 1 
ATOM   1171 C  CD2 . LEU A 1 146 ? -13.002 0.941   12.603  1.00 23.55  ? 146  LEU A CD2 1 
ATOM   1172 N  N   . SER A 1 147 ? -8.914  1.144   9.684   1.00 22.81  ? 147  SER A N   1 
ATOM   1173 C  CA  . SER A 1 147 ? -7.640  1.775   9.972   1.00 19.81  ? 147  SER A CA  1 
ATOM   1174 C  C   . SER A 1 147 ? -7.926  3.181   10.459  1.00 24.01  ? 147  SER A C   1 
ATOM   1175 O  O   . SER A 1 147 ? -9.040  3.691   10.327  1.00 21.09  ? 147  SER A O   1 
ATOM   1176 C  CB  . SER A 1 147 ? -6.718  1.811   8.741   1.00 24.82  ? 147  SER A CB  1 
ATOM   1177 O  OG  . SER A 1 147 ? -7.278  2.648   7.748   1.00 29.16  ? 147  SER A OG  1 
ATOM   1178 N  N   . TYR A 1 148 ? -6.916  3.789   11.066  1.00 22.24  ? 148  TYR A N   1 
ATOM   1179 C  CA  . TYR A 1 148 ? -7.056  5.142   11.572  1.00 21.30  ? 148  TYR A CA  1 
ATOM   1180 C  C   . TYR A 1 148 ? -5.665  5.726   11.729  1.00 22.84  ? 148  TYR A C   1 
ATOM   1181 O  O   . TYR A 1 148 ? -4.704  4.999   11.995  1.00 23.89  ? 148  TYR A O   1 
ATOM   1182 C  CB  . TYR A 1 148 ? -7.831  5.168   12.905  1.00 21.61  ? 148  TYR A CB  1 
ATOM   1183 C  CG  . TYR A 1 148 ? -7.201  4.374   14.041  1.00 19.28  ? 148  TYR A CG  1 
ATOM   1184 C  CD1 . TYR A 1 148 ? -7.399  3.002   14.153  1.00 21.51  ? 148  TYR A CD1 1 
ATOM   1185 C  CD2 . TYR A 1 148 ? -6.425  5.002   15.004  1.00 18.33  ? 148  TYR A CD2 1 
ATOM   1186 C  CE1 . TYR A 1 148 ? -6.830  2.269   15.224  1.00 20.70  ? 148  TYR A CE1 1 
ATOM   1187 C  CE2 . TYR A 1 148 ? -5.860  4.283   16.074  1.00 20.55  ? 148  TYR A CE2 1 
ATOM   1188 C  CZ  . TYR A 1 148 ? -6.063  2.921   16.165  1.00 21.19  ? 148  TYR A CZ  1 
ATOM   1189 O  OH  . TYR A 1 148 ? -5.503  2.216   17.224  1.00 20.98  ? 148  TYR A OH  1 
ATOM   1190 N  N   . ARG A 1 149 ? -5.568  7.042   11.560  1.00 23.35  ? 149  ARG A N   1 
ATOM   1191 C  CA  . ARG A 1 149 ? -4.286  7.719   11.710  1.00 21.14  ? 149  ARG A CA  1 
ATOM   1192 C  C   . ARG A 1 149 ? -3.777  7.602   13.146  1.00 23.29  ? 149  ARG A C   1 
ATOM   1193 O  O   . ARG A 1 149 ? -4.534  7.775   14.108  1.00 20.14  ? 149  ARG A O   1 
ATOM   1194 C  CB  . ARG A 1 149 ? -4.433  9.190   11.341  1.00 18.75  ? 149  ARG A CB  1 
ATOM   1195 C  CG  . ARG A 1 149 ? -4.596  9.455   9.835   1.00 21.61  ? 149  ARG A CG  1 
ATOM   1196 C  CD  . ARG A 1 149 ? -4.983  10.907  9.633   1.00 21.82  ? 149  ARG A CD  1 
ATOM   1197 N  NE  . ARG A 1 149 ? -6.419  11.117  9.818   1.00 21.32  ? 149  ARG A NE  1 
ATOM   1198 C  CZ  . ARG A 1 149 ? -7.003  12.307  9.797   1.00 25.77  ? 149  ARG A CZ  1 
ATOM   1199 N  NH1 . ARG A 1 149 ? -6.259  13.386  9.610   1.00 21.05  ? 149  ARG A NH1 1 
ATOM   1200 N  NH2 . ARG A 1 149 ? -8.329  12.419  9.953   1.00 21.54  ? 149  ARG A NH2 1 
ATOM   1201 N  N   . VAL A 1 150 ? -2.473  7.356   13.284  1.00 19.80  ? 150  VAL A N   1 
ATOM   1202 C  CA  . VAL A 1 150 ? -1.824  7.226   14.584  1.00 23.48  ? 150  VAL A CA  1 
ATOM   1203 C  C   . VAL A 1 150 ? -0.742  8.300   14.706  1.00 25.22  ? 150  VAL A C   1 
ATOM   1204 O  O   . VAL A 1 150 ? -0.433  9.017   13.751  1.00 20.81  ? 150  VAL A O   1 
ATOM   1205 C  CB  . VAL A 1 150 ? -1.235  5.818   14.798  1.00 20.33  ? 150  VAL A CB  1 
ATOM   1206 C  CG1 . VAL A 1 150 ? -2.362  4.793   14.827  1.00 20.77  ? 150  VAL A CG1 1 
ATOM   1207 C  CG2 . VAL A 1 150 ? -0.232  5.488   13.680  1.00 22.52  ? 150  VAL A CG2 1 
ATOM   1208 N  N   . GLY A 1 151 ? -0.170  8.404   15.909  1.00 21.84  ? 151  GLY A N   1 
ATOM   1209 C  CA  . GLY A 1 151 ? 0.864   9.391   16.162  1.00 21.72  ? 151  GLY A CA  1 
ATOM   1210 C  C   . GLY A 1 151 ? 0.324   10.805  16.049  1.00 22.18  ? 151  GLY A C   1 
ATOM   1211 O  O   . GLY A 1 151 ? -0.873  11.060  16.216  1.00 21.24  ? 151  GLY A O   1 
ATOM   1212 N  N   . ALA A 1 152 ? 1.223   11.743  15.718  1.00 21.76  ? 152  ALA A N   1 
ATOM   1213 C  CA  . ALA A 1 152 ? 0.804   13.127  15.528  1.00 23.27  ? 152  ALA A CA  1 
ATOM   1214 C  C   . ALA A 1 152 ? -0.238  13.243  14.418  1.00 21.33  ? 152  ALA A C   1 
ATOM   1215 O  O   . ALA A 1 152 ? -1.133  14.091  14.490  1.00 22.71  ? 152  ALA A O   1 
ATOM   1216 C  CB  . ALA A 1 152 ? 2.016   14.007  15.199  1.00 22.33  ? 152  ALA A CB  1 
ATOM   1217 N  N   . PHE A 1 153 ? -0.131  12.402  13.392  1.00 21.12  ? 153  PHE A N   1 
ATOM   1218 C  CA  . PHE A 1 153 ? -1.060  12.468  12.268  1.00 21.29  ? 153  PHE A CA  1 
ATOM   1219 C  C   . PHE A 1 153 ? -2.495  12.256  12.719  1.00 23.25  ? 153  PHE A C   1 
ATOM   1220 O  O   . PHE A 1 153 ? -3.419  12.838  12.141  1.00 22.10  ? 153  PHE A O   1 
ATOM   1221 C  CB  . PHE A 1 153 ? -0.679  11.429  11.226  1.00 21.50  ? 153  PHE A CB  1 
ATOM   1222 C  CG  . PHE A 1 153 ? 0.772   11.485  10.847  1.00 24.40  ? 153  PHE A CG  1 
ATOM   1223 C  CD1 . PHE A 1 153 ? 1.203   12.360  9.863   1.00 25.98  ? 153  PHE A CD1 1 
ATOM   1224 C  CD2 . PHE A 1 153 ? 1.706   10.697  11.498  1.00 24.34  ? 153  PHE A CD2 1 
ATOM   1225 C  CE1 . PHE A 1 153 ? 2.546   12.434  9.522   1.00 28.74  ? 153  PHE A CE1 1 
ATOM   1226 C  CE2 . PHE A 1 153 ? 3.063   10.765  11.159  1.00 23.93  ? 153  PHE A CE2 1 
ATOM   1227 C  CZ  . PHE A 1 153 ? 3.479   11.639  10.176  1.00 27.51  ? 153  PHE A CZ  1 
ATOM   1228 N  N   . GLY A 1 154 ? -2.699  11.435  13.747  1.00 21.55  ? 154  GLY A N   1 
ATOM   1229 C  CA  . GLY A 1 154 ? -4.036  11.165  14.224  1.00 22.16  ? 154  GLY A CA  1 
ATOM   1230 C  C   . GLY A 1 154 ? -4.428  11.921  15.474  1.00 24.58  ? 154  GLY A C   1 
ATOM   1231 O  O   . GLY A 1 154 ? -5.620  12.034  15.775  1.00 22.56  ? 154  GLY A O   1 
ATOM   1232 N  N   . PHE A 1 155 ? -3.457  12.456  16.220  1.00 22.60  ? 155  PHE A N   1 
ATOM   1233 C  CA  . PHE A 1 155 ? -3.803  12.908  17.560  1.00 22.16  ? 155  PHE A CA  1 
ATOM   1234 C  C   . PHE A 1 155 ? -3.103  14.182  18.010  1.00 23.03  ? 155  PHE A C   1 
ATOM   1235 O  O   . PHE A 1 155 ? -3.291  14.585  19.162  1.00 23.39  ? 155  PHE A O   1 
ATOM   1236 C  CB  . PHE A 1 155 ? -3.575  11.760  18.554  1.00 23.15  ? 155  PHE A CB  1 
ATOM   1237 C  CG  . PHE A 1 155 ? -4.520  10.609  18.320  1.00 21.14  ? 155  PHE A CG  1 
ATOM   1238 C  CD1 . PHE A 1 155 ? -5.850  10.706  18.713  1.00 23.91  ? 155  PHE A CD1 1 
ATOM   1239 C  CD2 . PHE A 1 155 ? -4.106  9.477   17.642  1.00 21.86  ? 155  PHE A CD2 1 
ATOM   1240 C  CE1 . PHE A 1 155 ? -6.740  9.674   18.456  1.00 21.40  ? 155  PHE A CE1 1 
ATOM   1241 C  CE2 . PHE A 1 155 ? -4.991  8.437   17.382  1.00 19.25  ? 155  PHE A CE2 1 
ATOM   1242 C  CZ  . PHE A 1 155 ? -6.307  8.540   17.788  1.00 19.16  ? 155  PHE A CZ  1 
ATOM   1243 N  N   . LEU A 1 156 ? -2.354  14.858  17.135  1.00 24.82  ? 156  LEU A N   1 
ATOM   1244 C  CA  . LEU A 1 156 ? -1.904  16.207  17.453  1.00 25.66  ? 156  LEU A CA  1 
ATOM   1245 C  C   . LEU A 1 156 ? -3.113  17.075  17.774  1.00 24.91  ? 156  LEU A C   1 
ATOM   1246 O  O   . LEU A 1 156 ? -4.069  17.133  17.003  1.00 24.82  ? 156  LEU A O   1 
ATOM   1247 C  CB  . LEU A 1 156 ? -1.121  16.799  16.281  1.00 28.81  ? 156  LEU A CB  1 
ATOM   1248 C  CG  . LEU A 1 156 ? -0.507  18.176  16.536  1.00 30.89  ? 156  LEU A CG  1 
ATOM   1249 C  CD1 . LEU A 1 156 ? 0.980   18.030  16.836  1.00 27.79  ? 156  LEU A CD1 1 
ATOM   1250 C  CD2 . LEU A 1 156 ? -0.714  19.080  15.318  1.00 32.16  ? 156  LEU A CD2 1 
ATOM   1251 N  N   . ALA A 1 157 ? -3.095  17.725  18.936  1.00 27.69  ? 157  ALA A N   1 
ATOM   1252 C  CA  . ALA A 1 157 ? -4.296  18.379  19.449  1.00 24.96  ? 157  ALA A CA  1 
ATOM   1253 C  C   . ALA A 1 157 ? -3.978  19.813  19.842  1.00 28.05  ? 157  ALA A C   1 
ATOM   1254 O  O   . ALA A 1 157 ? -3.301  20.055  20.845  1.00 29.01  ? 157  ALA A O   1 
ATOM   1255 C  CB  . ALA A 1 157 ? -4.870  17.612  20.636  1.00 25.73  ? 157  ALA A CB  1 
ATOM   1256 N  N   . LEU A 1 158 ? -4.479  20.757  19.055  1.00 28.64  ? 158  LEU A N   1 
ATOM   1257 C  CA  . LEU A 1 158 ? -4.409  22.181  19.359  1.00 28.46  ? 158  LEU A CA  1 
ATOM   1258 C  C   . LEU A 1 158 ? -5.850  22.641  19.546  1.00 31.13  ? 158  LEU A C   1 
ATOM   1259 O  O   . LEU A 1 158 ? -6.454  23.223  18.639  1.00 29.88  ? 158  LEU A O   1 
ATOM   1260 C  CB  . LEU A 1 158 ? -3.668  22.948  18.226  1.00 27.85  ? 158  LEU A CB  1 
ATOM   1261 C  CG  . LEU A 1 158 ? -2.159  22.665  18.159  1.00 28.90  ? 158  LEU A CG  1 
ATOM   1262 C  CD1 . LEU A 1 158 ? -1.556  23.126  16.836  1.00 27.44  ? 158  LEU A CD1 1 
ATOM   1263 C  CD2 . LEU A 1 158 ? -1.455  23.327  19.327  1.00 32.22  ? 158  LEU A CD2 1 
ATOM   1264 N  N   . HIS A 1 159 ? -6.408  22.350  20.725  1.00 28.12  ? 159  HIS A N   1 
ATOM   1265 C  CA  . HIS A 1 159 ? -7.830  22.575  20.958  1.00 31.05  ? 159  HIS A CA  1 
ATOM   1266 C  C   . HIS A 1 159 ? -8.194  24.030  20.717  1.00 34.33  ? 159  HIS A C   1 
ATOM   1267 O  O   . HIS A 1 159 ? -7.516  24.942  21.197  1.00 36.66  ? 159  HIS A O   1 
ATOM   1268 C  CB  . HIS A 1 159 ? -8.219  22.177  22.381  1.00 34.91  ? 159  HIS A CB  1 
ATOM   1269 C  CG  . HIS A 1 159 ? -9.686  22.292  22.645  1.00 35.11  ? 159  HIS A CG  1 
ATOM   1270 N  ND1 . HIS A 1 159 ? -10.218 23.210  23.525  1.00 39.87  ? 159  HIS A ND1 1 
ATOM   1271 C  CD2 . HIS A 1 159 ? -10.737 21.616  22.125  1.00 34.67  ? 159  HIS A CD2 1 
ATOM   1272 C  CE1 . HIS A 1 159 ? -11.533 23.084  23.548  1.00 35.12  ? 159  HIS A CE1 1 
ATOM   1273 N  NE2 . HIS A 1 159 ? -11.874 22.126  22.704  1.00 43.44  ? 159  HIS A NE2 1 
ATOM   1274 N  N   . GLY A 1 160 ? -9.285  24.242  19.983  1.00 33.53  ? 160  GLY A N   1 
ATOM   1275 C  CA  . GLY A 1 160 ? -9.693  25.544  19.534  1.00 34.64  ? 160  GLY A CA  1 
ATOM   1276 C  C   . GLY A 1 160 ? -9.373  25.792  18.076  1.00 32.84  ? 160  GLY A C   1 
ATOM   1277 O  O   . GLY A 1 160 ? -10.053 26.587  17.433  1.00 31.78  ? 160  GLY A O   1 
ATOM   1278 N  N   . SER A 1 161 ? -8.336  25.139  17.553  1.00 32.58  ? 161  SER A N   1 
ATOM   1279 C  CA  . SER A 1 161 ? -8.094  25.118  16.121  1.00 35.11  ? 161  SER A CA  1 
ATOM   1280 C  C   . SER A 1 161 ? -9.029  24.118  15.457  1.00 34.92  ? 161  SER A C   1 
ATOM   1281 O  O   . SER A 1 161 ? -9.240  23.014  15.965  1.00 37.25  ? 161  SER A O   1 
ATOM   1282 C  CB  . SER A 1 161 ? -6.642  24.739  15.825  1.00 32.95  ? 161  SER A CB  1 
ATOM   1283 O  OG  . SER A 1 161 ? -6.472  24.483  14.437  1.00 35.67  ? 161  SER A OG  1 
ATOM   1284 N  N   . GLN A 1 162 ? -9.604  24.507  14.325  1.00 32.14  ? 162  GLN A N   1 
ATOM   1285 C  CA  . GLN A 1 162 ? -10.329 23.546  13.512  1.00 33.93  ? 162  GLN A CA  1 
ATOM   1286 C  C   . GLN A 1 162 ? -9.414  22.848  12.520  1.00 34.63  ? 162  GLN A C   1 
ATOM   1287 O  O   . GLN A 1 162 ? -9.860  21.932  11.821  1.00 35.75  ? 162  GLN A O   1 
ATOM   1288 C  CB  . GLN A 1 162 ? -11.490 24.225  12.763  0.68 39.04  ? 162  GLN A CB  1 
ATOM   1289 C  CG  . GLN A 1 162 ? -12.628 24.724  13.658  1.00 40.87  ? 162  GLN A CG  1 
ATOM   1290 C  CD  . GLN A 1 162 ? -12.974 23.761  14.787  0.27 41.38  ? 162  GLN A CD  1 
ATOM   1291 O  OE1 . GLN A 1 162 ? -13.291 22.596  14.553  0.84 45.32  ? 162  GLN A OE1 1 
ATOM   1292 N  NE2 . GLN A 1 162 ? -12.911 24.249  16.021  1.00 43.23  ? 162  GLN A NE2 1 
ATOM   1293 N  N   . GLU A 1 163 ? -8.148  23.260  12.451  1.00 29.53  ? 163  GLU A N   1 
ATOM   1294 C  CA  . GLU A 1 163 ? -7.187  22.663  11.535  1.00 32.27  ? 163  GLU A CA  1 
ATOM   1295 C  C   . GLU A 1 163 ? -6.466  21.472  12.149  1.00 29.73  ? 163  GLU A C   1 
ATOM   1296 O  O   . GLU A 1 163 ? -6.134  20.523  11.430  1.00 30.62  ? 163  GLU A O   1 
ATOM   1297 C  CB  . GLU A 1 163 ? -6.165  23.714  11.083  1.00 33.33  ? 163  GLU A CB  1 
ATOM   1298 C  CG  . GLU A 1 163 ? -6.741  24.779  10.142  1.00 34.43  ? 163  GLU A CG  1 
ATOM   1299 C  CD  . GLU A 1 163 ? -7.336  24.180  8.885   1.00 32.03  ? 163  GLU A CD  1 
ATOM   1300 O  OE1 . GLU A 1 163 ? -6.642  23.373  8.237   1.00 33.53  ? 163  GLU A OE1 1 
ATOM   1301 O  OE2 . GLU A 1 163 ? -8.491  24.514  8.540   1.00 35.18  ? 163  GLU A OE2 1 
ATOM   1302 N  N   . ALA A 1 164 ? -6.212  21.503  13.457  1.00 28.15  ? 164  ALA A N   1 
ATOM   1303 C  CA  . ALA A 1 164 ? -5.665  20.360  14.189  1.00 28.81  ? 164  ALA A CA  1 
ATOM   1304 C  C   . ALA A 1 164 ? -6.396  20.259  15.523  1.00 27.67  ? 164  ALA A C   1 
ATOM   1305 O  O   . ALA A 1 164 ? -5.850  20.584  16.582  1.00 28.00  ? 164  ALA A O   1 
ATOM   1306 C  CB  . ALA A 1 164 ? -4.153  20.504  14.381  1.00 29.74  ? 164  ALA A CB  1 
ATOM   1307 N  N   . PRO A 1 165 ? -7.656  19.814  15.499  1.00 26.84  ? 165  PRO A N   1 
ATOM   1308 C  CA  . PRO A 1 165 ? -8.472  19.837  16.724  1.00 30.19  ? 165  PRO A CA  1 
ATOM   1309 C  C   . PRO A 1 165 ? -8.119  18.758  17.726  1.00 28.76  ? 165  PRO A C   1 
ATOM   1310 O  O   . PRO A 1 165 ? -8.459  18.907  18.907  1.00 31.33  ? 165  PRO A O   1 
ATOM   1311 C  CB  . PRO A 1 165 ? -9.896  19.629  16.194  1.00 28.90  ? 165  PRO A CB  1 
ATOM   1312 C  CG  . PRO A 1 165 ? -9.702  18.773  14.985  1.00 28.34  ? 165  PRO A CG  1 
ATOM   1313 C  CD  . PRO A 1 165 ? -8.387  19.223  14.361  1.00 26.49  ? 165  PRO A CD  1 
ATOM   1314 N  N   . GLY A 1 166 ? -7.447  17.691  17.303  1.00 26.33  ? 166  GLY A N   1 
ATOM   1315 C  CA  . GLY A 1 166 ? -7.285  16.509  18.121  1.00 26.50  ? 166  GLY A CA  1 
ATOM   1316 C  C   . GLY A 1 166 ? -8.348  15.462  17.819  1.00 25.19  ? 166  GLY A C   1 
ATOM   1317 O  O   . GLY A 1 166 ? -9.346  15.712  17.142  1.00 25.35  ? 166  GLY A O   1 
ATOM   1318 N  N   . ASN A 1 167 ? -8.109  14.253  18.323  1.00 24.68  ? 167  ASN A N   1 
ATOM   1319 C  CA  . ASN A 1 167 ? -8.994  13.100  18.182  1.00 21.66  ? 167  ASN A CA  1 
ATOM   1320 C  C   . ASN A 1 167 ? -9.310  12.713  16.737  1.00 22.43  ? 167  ASN A C   1 
ATOM   1321 O  O   . ASN A 1 167 ? -10.235 11.918  16.515  1.00 22.18  ? 167  ASN A O   1 
ATOM   1322 C  CB  . ASN A 1 167 ? -10.309 13.319  18.936  1.00 22.46  ? 167  ASN A CB  1 
ATOM   1323 C  CG  . ASN A 1 167 ? -10.093 13.482  20.409  1.00 24.21  ? 167  ASN A CG  1 
ATOM   1324 O  OD1 . ASN A 1 167 ? -9.131  12.950  20.961  1.00 23.94  ? 167  ASN A OD1 1 
ATOM   1325 N  ND2 . ASN A 1 167 ? -10.976 14.226  21.063  1.00 25.99  ? 167  ASN A ND2 1 
ATOM   1326 N  N   . VAL A 1 168 ? -8.565  13.200  15.737  1.00 21.59  ? 168  VAL A N   1 
ATOM   1327 C  CA  . VAL A 1 168 ? -8.997  12.890  14.371  1.00 22.90  ? 168  VAL A CA  1 
ATOM   1328 C  C   . VAL A 1 168 ? -8.814  11.402  14.060  1.00 23.43  ? 168  VAL A C   1 
ATOM   1329 O  O   . VAL A 1 168 ? -9.550  10.842  13.240  1.00 23.42  ? 168  VAL A O   1 
ATOM   1330 C  CB  . VAL A 1 168 ? -8.302  13.803  13.330  1.00 21.70  ? 168  VAL A CB  1 
ATOM   1331 C  CG1 . VAL A 1 168 ? -8.555  15.275  13.670  1.00 23.73  ? 168  VAL A CG1 1 
ATOM   1332 C  CG2 . VAL A 1 168 ? -6.798  13.508  13.203  1.00 21.43  ? 168  VAL A CG2 1 
ATOM   1333 N  N   . GLY A 1 169 ? -7.874  10.721  14.723  1.00 21.00  ? 169  GLY A N   1 
ATOM   1334 C  CA  . GLY A 1 169 ? -7.800  9.272   14.563  1.00 19.27  ? 169  GLY A CA  1 
ATOM   1335 C  C   . GLY A 1 169 ? -9.054  8.562   15.062  1.00 21.96  ? 169  GLY A C   1 
ATOM   1336 O  O   . GLY A 1 169 ? -9.487  7.556   14.487  1.00 20.71  ? 169  GLY A O   1 
ATOM   1337 N  N   . LEU A 1 170 ? -9.658  9.075   16.134  1.00 19.55  ? 170  LEU A N   1 
ATOM   1338 C  CA  . LEU A 1 170 ? -10.924 8.502   16.579  1.00 20.77  ? 170  LEU A CA  1 
ATOM   1339 C  C   . LEU A 1 170 ? -12.042 8.786   15.583  1.00 21.68  ? 170  LEU A C   1 
ATOM   1340 O  O   . LEU A 1 170 ? -12.937 7.955   15.409  1.00 23.74  ? 170  LEU A O   1 
ATOM   1341 C  CB  . LEU A 1 170 ? -11.306 9.037   17.956  1.00 22.37  ? 170  LEU A CB  1 
ATOM   1342 C  CG  . LEU A 1 170 ? -10.449 8.522   19.118  1.00 22.25  ? 170  LEU A CG  1 
ATOM   1343 C  CD1 . LEU A 1 170 ? -10.700 9.340   20.373  1.00 20.76  ? 170  LEU A CD1 1 
ATOM   1344 C  CD2 . LEU A 1 170 ? -10.752 7.052   19.382  1.00 22.51  ? 170  LEU A CD2 1 
ATOM   1345 N  N   . LEU A 1 171 ? -12.014 9.959   14.941  1.00 20.36  ? 171  LEU A N   1 
ATOM   1346 C  CA  . LEU A 1 171 ? -13.008 10.277  13.925  1.00 23.42  ? 171  LEU A CA  1 
ATOM   1347 C  C   . LEU A 1 171 ? -12.799 9.455   12.663  1.00 22.05  ? 171  LEU A C   1 
ATOM   1348 O  O   . LEU A 1 171 ? -13.779 9.124   11.984  1.00 21.84  ? 171  LEU A O   1 
ATOM   1349 C  CB  . LEU A 1 171 ? -12.974 11.776  13.622  1.00 25.34  ? 171  LEU A CB  1 
ATOM   1350 C  CG  . LEU A 1 171 ? -13.412 12.597  14.837  1.00 26.04  ? 171  LEU A CG  1 
ATOM   1351 C  CD1 . LEU A 1 171 ? -13.100 14.071  14.660  1.00 27.44  ? 171  LEU A CD1 1 
ATOM   1352 C  CD2 . LEU A 1 171 ? -14.913 12.367  15.123  1.00 26.62  ? 171  LEU A CD2 1 
ATOM   1353 N  N   . ASP A 1 172 ? -11.541 9.116   12.328  1.00 23.43  ? 172  ASP A N   1 
ATOM   1354 C  CA  . ASP A 1 172 ? -11.297 8.125   11.283  1.00 20.20  ? 172  ASP A CA  1 
ATOM   1355 C  C   . ASP A 1 172 ? -12.022 6.833   11.606  1.00 21.48  ? 172  ASP A C   1 
ATOM   1356 O  O   . ASP A 1 172 ? -12.693 6.257   10.747  1.00 19.69  ? 172  ASP A O   1 
ATOM   1357 C  CB  . ASP A 1 172 ? -9.796  7.823   11.114  1.00 21.62  ? 172  ASP A CB  1 
ATOM   1358 C  CG  . ASP A 1 172 ? -8.982  9.020   10.686  1.00 23.67  ? 172  ASP A CG  1 
ATOM   1359 O  OD1 . ASP A 1 172 ? -9.558  9.997   10.175  1.00 23.52  ? 172  ASP A OD1 1 
ATOM   1360 O  OD2 . ASP A 1 172 ? -7.740  8.971   10.855  1.00 23.47  ? 172  ASP A OD2 1 
ATOM   1361 N  N   . GLN A 1 173 ? -11.874 6.342   12.844  1.00 20.83  ? 173  GLN A N   1 
ATOM   1362 C  CA  . GLN A 1 173 ? -12.565 5.110   13.210  1.00 20.97  ? 173  GLN A CA  1 
ATOM   1363 C  C   . GLN A 1 173 ? -14.068 5.272   13.057  1.00 19.96  ? 173  GLN A C   1 
ATOM   1364 O  O   . GLN A 1 173 ? -14.743 4.396   12.507  1.00 20.40  ? 173  GLN A O   1 
ATOM   1365 C  CB  . GLN A 1 173 ? -12.229 4.704   14.646  1.00 21.61  ? 173  GLN A CB  1 
ATOM   1366 C  CG  . GLN A 1 173 ? -10.745 4.467   14.926  1.00 18.62  ? 173  GLN A CG  1 
ATOM   1367 C  CD  . GLN A 1 173 ? -10.516 4.199   16.413  1.00 21.29  ? 173  GLN A CD  1 
ATOM   1368 O  OE1 . GLN A 1 173 ? -11.474 3.999   17.160  1.00 21.09  ? 173  GLN A OE1 1 
ATOM   1369 N  NE2 . GLN A 1 173 ? -9.252  4.195   16.842  1.00 19.60  ? 173  GLN A NE2 1 
ATOM   1370 N  N   . ARG A 1 174 ? -14.602 6.405   13.515  1.00 19.44  ? 174  ARG A N   1 
ATOM   1371 C  CA  . ARG A 1 174 ? -16.040 6.625   13.449  1.00 19.64  ? 174  ARG A CA  1 
ATOM   1372 C  C   . ARG A 1 174 ? -16.514 6.686   12.003  1.00 22.97  ? 174  ARG A C   1 
ATOM   1373 O  O   . ARG A 1 174 ? -17.592 6.182   11.672  1.00 23.98  ? 174  ARG A O   1 
ATOM   1374 C  CB  . ARG A 1 174 ? -16.399 7.910   14.189  1.00 20.67  ? 174  ARG A CB  1 
ATOM   1375 C  CG  . ARG A 1 174 ? -17.882 8.302   14.067  1.00 24.68  ? 174  ARG A CG  1 
ATOM   1376 C  CD  . ARG A 1 174 ? -18.109 9.677   14.643  1.00 23.69  ? 174  ARG A CD  1 
ATOM   1377 N  NE  . ARG A 1 174 ? -18.010 9.678   16.108  1.00 24.84  ? 174  ARG A NE  1 
ATOM   1378 C  CZ  . ARG A 1 174 ? -18.037 10.783  16.844  1.00 27.48  ? 174  ARG A CZ  1 
ATOM   1379 N  NH1 . ARG A 1 174 ? -18.155 11.964  16.249  1.00 29.63  ? 174  ARG A NH1 1 
ATOM   1380 N  NH2 . ARG A 1 174 ? -17.954 10.717  18.168  1.00 26.16  ? 174  ARG A NH2 1 
ATOM   1381 N  N   . MET A 1 175 ? -15.698 7.257   11.116  1.00 22.86  ? 175  MET A N   1 
ATOM   1382 C  CA  . MET A 1 175 ? -16.125 7.335   9.727   1.00 19.98  ? 175  MET A CA  1 
ATOM   1383 C  C   . MET A 1 175 ? -16.140 5.961   9.078   1.00 22.43  ? 175  MET A C   1 
ATOM   1384 O  O   . MET A 1 175 ? -17.023 5.666   8.264   1.00 21.08  ? 175  MET A O   1 
ATOM   1385 C  CB  . MET A 1 175 ? -15.250 8.292   8.947   1.00 21.13  ? 175  MET A CB  1 
ATOM   1386 C  CG  . MET A 1 175 ? -15.939 8.638   7.643   1.00 36.82  ? 175  MET A CG  1 
ATOM   1387 S  SD  . MET A 1 175 ? -15.704 10.370  7.293   1.00 47.02  ? 175  MET A SD  1 
ATOM   1388 C  CE  . MET A 1 175 ? -14.299 10.060  6.444   1.00 18.15  ? 175  MET A CE  1 
ATOM   1389 N  N   . ALA A 1 176 ? -15.194 5.094   9.441   1.00 22.85  ? 176  ALA A N   1 
ATOM   1390 C  CA  . ALA A 1 176 ? -15.274 3.713   8.973   1.00 19.52  ? 176  ALA A CA  1 
ATOM   1391 C  C   . ALA A 1 176 ? -16.512 3.018   9.539   1.00 23.70  ? 176  ALA A C   1 
ATOM   1392 O  O   . ALA A 1 176 ? -17.172 2.250   8.827   1.00 22.66  ? 176  ALA A O   1 
ATOM   1393 C  CB  . ALA A 1 176 ? -13.997 2.945   9.338   1.00 20.59  ? 176  ALA A CB  1 
ATOM   1394 N  N   . LEU A 1 177 ? -16.833 3.255   10.823  1.00 20.63  ? 177  LEU A N   1 
ATOM   1395 C  CA  . LEU A 1 177 ? -18.074 2.719   11.387  1.00 20.36  ? 177  LEU A CA  1 
ATOM   1396 C  C   . LEU A 1 177 ? -19.293 3.247   10.633  1.00 24.53  ? 177  LEU A C   1 
ATOM   1397 O  O   . LEU A 1 177 ? -20.250 2.506   10.395  1.00 24.34  ? 177  LEU A O   1 
ATOM   1398 C  CB  . LEU A 1 177 ? -18.189 3.058   12.880  1.00 21.34  ? 177  LEU A CB  1 
ATOM   1399 C  CG  . LEU A 1 177 ? -17.114 2.440   13.787  1.00 20.87  ? 177  LEU A CG  1 
ATOM   1400 C  CD1 . LEU A 1 177 ? -17.394 2.662   15.279  1.00 24.40  ? 177  LEU A CD1 1 
ATOM   1401 C  CD2 . LEU A 1 177 ? -17.031 0.964   13.475  1.00 21.10  ? 177  LEU A CD2 1 
ATOM   1402 N  N   . GLN A 1 178 ? -19.284 4.536   10.286  1.00 22.22  ? 178  GLN A N   1 
ATOM   1403 C  CA  . GLN A 1 178 ? -20.362 5.107   9.486   1.00 25.44  ? 178  GLN A CA  1 
ATOM   1404 C  C   . GLN A 1 178 ? -20.440 4.442   8.120   1.00 26.17  ? 178  GLN A C   1 
ATOM   1405 O  O   . GLN A 1 178 ? -21.537 4.225   7.590   1.00 27.18  ? 178  GLN A O   1 
ATOM   1406 C  CB  . GLN A 1 178 ? -20.164 6.615   9.339   1.00 25.61  ? 178  GLN A CB  1 
ATOM   1407 C  CG  . GLN A 1 178 ? -21.266 7.314   8.525   1.00 27.78  ? 178  GLN A CG  1 
ATOM   1408 C  CD  . GLN A 1 178 ? -22.591 7.321   9.269   1.00 29.87  ? 178  GLN A CD  1 
ATOM   1409 O  OE1 . GLN A 1 178 ? -22.665 7.823   10.380  1.00 30.06  ? 178  GLN A OE1 1 
ATOM   1410 N  NE2 . GLN A 1 178 ? -23.643 6.757   8.653   1.00 26.38  ? 178  GLN A NE2 1 
ATOM   1411 N  N   . TRP A 1 179 ? -19.284 4.130   7.519   1.00 22.65  ? 179  TRP A N   1 
ATOM   1412 C  CA  . TRP A 1 179 ? -19.284 3.438   6.236   1.00 26.43  ? 179  TRP A CA  1 
ATOM   1413 C  C   . TRP A 1 179 ? -19.869 2.037   6.373   1.00 27.23  ? 179  TRP A C   1 
ATOM   1414 O  O   . TRP A 1 179 ? -20.655 1.600   5.522   1.00 23.29  ? 179  TRP A O   1 
ATOM   1415 C  CB  . TRP A 1 179 ? -17.858 3.385   5.668   1.00 23.63  ? 179  TRP A CB  1 
ATOM   1416 C  CG  . TRP A 1 179 ? -17.794 2.936   4.260   1.00 25.17  ? 179  TRP A CG  1 
ATOM   1417 C  CD1 . TRP A 1 179 ? -17.720 3.725   3.145   1.00 25.37  ? 179  TRP A CD1 1 
ATOM   1418 C  CD2 . TRP A 1 179 ? -17.784 1.585   3.795   1.00 21.64  ? 179  TRP A CD2 1 
ATOM   1419 N  NE1 . TRP A 1 179 ? -17.678 2.945   2.014   1.00 24.86  ? 179  TRP A NE1 1 
ATOM   1420 C  CE2 . TRP A 1 179 ? -17.716 1.627   2.386   1.00 23.91  ? 179  TRP A CE2 1 
ATOM   1421 C  CE3 . TRP A 1 179 ? -17.833 0.343   4.433   1.00 23.52  ? 179  TRP A CE3 1 
ATOM   1422 C  CZ2 . TRP A 1 179 ? -17.694 0.477   1.609   1.00 27.51  ? 179  TRP A CZ2 1 
ATOM   1423 C  CZ3 . TRP A 1 179 ? -17.808 -0.794  3.661   1.00 26.79  ? 179  TRP A CZ3 1 
ATOM   1424 C  CH2 . TRP A 1 179 ? -17.744 -0.723  2.267   1.00 26.66  ? 179  TRP A CH2 1 
ATOM   1425 N  N   . VAL A 1 180 ? -19.497 1.319   7.441   1.00 24.09  ? 180  VAL A N   1 
ATOM   1426 C  CA  . VAL A 1 180 ? -20.068 -0.003  7.698   1.00 24.07  ? 180  VAL A CA  1 
ATOM   1427 C  C   . VAL A 1 180 ? -21.584 0.101   7.857   1.00 20.38  ? 180  VAL A C   1 
ATOM   1428 O  O   . VAL A 1 180 ? -22.343 -0.697  7.298   1.00 26.37  ? 180  VAL A O   1 
ATOM   1429 C  CB  . VAL A 1 180 ? -19.416 -0.637  8.947   1.00 23.24  ? 180  VAL A CB  1 
ATOM   1430 C  CG1 . VAL A 1 180 ? -20.194 -1.852  9.396   1.00 22.35  ? 180  VAL A CG1 1 
ATOM   1431 C  CG2 . VAL A 1 180 ? -17.966 -1.044  8.668   1.00 26.28  ? 180  VAL A CG2 1 
ATOM   1432 N  N   . HIS A 1 181 ? -22.037 1.079   8.645   1.00 23.09  ? 181  HIS A N   1 
ATOM   1433 C  CA  . HIS A 1 181 ? -23.467 1.322   8.828   1.00 21.59  ? 181  HIS A CA  1 
ATOM   1434 C  C   . HIS A 1 181 ? -24.179 1.512   7.489   1.00 26.43  ? 181  HIS A C   1 
ATOM   1435 O  O   . HIS A 1 181 ? -25.287 0.998   7.280   1.00 25.63  ? 181  HIS A O   1 
ATOM   1436 C  CB  . HIS A 1 181 ? -23.655 2.556   9.701   1.00 22.57  ? 181  HIS A CB  1 
ATOM   1437 C  CG  . HIS A 1 181 ? -25.083 2.974   9.861   1.00 27.80  ? 181  HIS A CG  1 
ATOM   1438 N  ND1 . HIS A 1 181 ? -25.896 2.470   10.852  1.00 27.61  ? 181  HIS A ND1 1 
ATOM   1439 C  CD2 . HIS A 1 181 ? -25.837 3.863   9.167   1.00 27.45  ? 181  HIS A CD2 1 
ATOM   1440 C  CE1 . HIS A 1 181 ? -27.094 3.021   10.757  1.00 28.15  ? 181  HIS A CE1 1 
ATOM   1441 N  NE2 . HIS A 1 181 ? -27.084 3.873   9.746   1.00 30.88  ? 181  HIS A NE2 1 
ATOM   1442 N  N   . ASP A 1 182 ? -23.558 2.257   6.581   1.00 26.20  ? 182  ASP A N   1 
ATOM   1443 C  CA  . ASP A 1 182 ? -24.173 2.618   5.309   1.00 27.92  ? 182  ASP A CA  1 
ATOM   1444 C  C   . ASP A 1 182 ? -24.052 1.534   4.247   1.00 29.20  ? 182  ASP A C   1 
ATOM   1445 O  O   . ASP A 1 182 ? -24.879 1.499   3.323   1.00 30.29  ? 182  ASP A O   1 
ATOM   1446 C  CB  . ASP A 1 182 ? -23.538 3.906   4.774   1.00 27.87  ? 182  ASP A CB  1 
ATOM   1447 C  CG  . ASP A 1 182 ? -23.917 5.123   5.586   1.00 28.86  ? 182  ASP A CG  1 
ATOM   1448 O  OD1 . ASP A 1 182 ? -24.961 5.073   6.261   1.00 33.74  ? 182  ASP A OD1 1 
ATOM   1449 O  OD2 . ASP A 1 182 ? -23.181 6.135   5.537   1.00 30.30  ? 182  ASP A OD2 1 
ATOM   1450 N  N   . ASN A 1 183 ? -23.056 0.650   4.344   1.00 25.66  ? 183  ASN A N   1 
ATOM   1451 C  CA  . ASN A 1 183 ? -22.713 -0.217  3.226   1.00 19.73  ? 183  ASN A CA  1 
ATOM   1452 C  C   . ASN A 1 183 ? -22.637 -1.699  3.535   1.00 24.23  ? 183  ASN A C   1 
ATOM   1453 O  O   . ASN A 1 183 ? -22.684 -2.499  2.592   1.00 25.75  ? 183  ASN A O   1 
ATOM   1454 C  CB  . ASN A 1 183 ? -21.365 0.205   2.615   1.00 25.71  ? 183  ASN A CB  1 
ATOM   1455 C  CG  . ASN A 1 183 ? -21.436 1.547   1.959   1.00 29.97  ? 183  ASN A CG  1 
ATOM   1456 O  OD1 . ASN A 1 183 ? -21.978 1.672   0.862   1.00 27.95  ? 183  ASN A OD1 1 
ATOM   1457 N  ND2 . ASN A 1 183 ? -20.900 2.572   2.623   1.00 25.03  ? 183  ASN A ND2 1 
ATOM   1458 N  N   . ILE A 1 184 ? -22.502 -2.107  4.797   1.00 24.68  ? 184  ILE A N   1 
ATOM   1459 C  CA  . ILE A 1 184 ? -22.244 -3.520  5.049   1.00 27.36  ? 184  ILE A CA  1 
ATOM   1460 C  C   . ILE A 1 184 ? -23.409 -4.401  4.602   1.00 25.78  ? 184  ILE A C   1 
ATOM   1461 O  O   . ILE A 1 184 ? -23.211 -5.592  4.330   1.00 26.20  ? 184  ILE A O   1 
ATOM   1462 C  CB  . ILE A 1 184 ? -21.894 -3.732  6.544   1.00 25.15  ? 184  ILE A CB  1 
ATOM   1463 C  CG1 . ILE A 1 184 ? -20.979 -4.952  6.701   1.00 21.43  ? 184  ILE A CG1 1 
ATOM   1464 C  CG2 . ILE A 1 184 ? -23.164 -3.832  7.407   1.00 24.38  ? 184  ILE A CG2 1 
ATOM   1465 C  CD1 . ILE A 1 184 ? -19.612 -4.824  6.002   1.00 27.20  ? 184  ILE A CD1 1 
ATOM   1466 N  N   . GLN A 1 185 ? -24.622 -3.841  4.494   1.00 27.43  ? 185  GLN A N   1 
ATOM   1467 C  CA  . GLN A 1 185 ? -25.748 -4.631  3.995   1.00 31.19  ? 185  GLN A CA  1 
ATOM   1468 C  C   . GLN A 1 185 ? -25.493 -5.152  2.584   1.00 31.90  ? 185  GLN A C   1 
ATOM   1469 O  O   . GLN A 1 185 ? -26.020 -6.207  2.205   1.00 30.96  ? 185  GLN A O   1 
ATOM   1470 C  CB  . GLN A 1 185 ? -27.041 -3.807  4.038   1.00 37.46  ? 185  GLN A CB  1 
ATOM   1471 C  CG  . GLN A 1 185 ? -27.108 -2.643  3.056   1.00 27.27  ? 185  GLN A CG  1 
ATOM   1472 C  CD  . GLN A 1 185 ? -28.157 -1.610  3.450   1.00 39.01  ? 185  GLN A CD  1 
ATOM   1473 O  OE1 . GLN A 1 185 ? -28.105 -1.031  4.543   1.00 35.73  ? 185  GLN A OE1 1 
ATOM   1474 N  NE2 . GLN A 1 185 ? -29.126 -1.379  2.561   1.00 38.25  ? 185  GLN A NE2 1 
ATOM   1475 N  N   . PHE A 1 186 ? -24.674 -4.449  1.799   1.00 28.28  ? 186  PHE A N   1 
ATOM   1476 C  CA  . PHE A 1 186 ? -24.390 -4.904  0.439   1.00 31.36  ? 186  PHE A CA  1 
ATOM   1477 C  C   . PHE A 1 186 ? -23.428 -6.079  0.419   1.00 34.98  ? 186  PHE A C   1 
ATOM   1478 O  O   . PHE A 1 186 ? -23.308 -6.751  -0.610  1.00 30.63  ? 186  PHE A O   1 
ATOM   1479 C  CB  . PHE A 1 186 ? -23.842 -3.746  -0.388  1.00 27.24  ? 186  PHE A CB  1 
ATOM   1480 C  CG  . PHE A 1 186 ? -24.709 -2.523  -0.348  1.00 29.49  ? 186  PHE A CG  1 
ATOM   1481 C  CD1 . PHE A 1 186 ? -26.067 -2.610  -0.631  1.00 33.11  ? 186  PHE A CD1 1 
ATOM   1482 C  CD2 . PHE A 1 186 ? -24.176 -1.294  -0.013  1.00 27.18  ? 186  PHE A CD2 1 
ATOM   1483 C  CE1 . PHE A 1 186 ? -26.877 -1.484  -0.585  1.00 32.40  ? 186  PHE A CE1 1 
ATOM   1484 C  CE2 . PHE A 1 186 ? -24.975 -0.165  0.040   1.00 32.26  ? 186  PHE A CE2 1 
ATOM   1485 C  CZ  . PHE A 1 186 ? -26.335 -0.260  -0.250  1.00 34.36  ? 186  PHE A CZ  1 
ATOM   1486 N  N   . PHE A 1 187 ? -22.752 -6.342  1.538   1.00 31.22  ? 187  PHE A N   1 
ATOM   1487 C  CA  . PHE A 1 187 ? -21.852 -7.479  1.685   1.00 33.28  ? 187  PHE A CA  1 
ATOM   1488 C  C   . PHE A 1 187 ? -22.474 -8.603  2.506   1.00 35.36  ? 187  PHE A C   1 
ATOM   1489 O  O   . PHE A 1 187 ? -21.768 -9.539  2.897   1.00 37.74  ? 187  PHE A O   1 
ATOM   1490 C  CB  . PHE A 1 187 ? -20.540 -7.038  2.343   1.00 32.29  ? 187  PHE A CB  1 
ATOM   1491 C  CG  . PHE A 1 187 ? -19.780 -6.000  1.560   1.00 30.42  ? 187  PHE A CG  1 
ATOM   1492 C  CD1 . PHE A 1 187 ? -20.080 -4.651  1.702   1.00 28.03  ? 187  PHE A CD1 1 
ATOM   1493 C  CD2 . PHE A 1 187 ? -18.760 -6.372  0.697   1.00 30.25  ? 187  PHE A CD2 1 
ATOM   1494 C  CE1 . PHE A 1 187 ? -19.383 -3.690  0.991   1.00 24.05  ? 187  PHE A CE1 1 
ATOM   1495 C  CE2 . PHE A 1 187 ? -18.058 -5.418  -0.025  1.00 29.92  ? 187  PHE A CE2 1 
ATOM   1496 C  CZ  . PHE A 1 187 ? -18.371 -4.072  0.126   1.00 26.56  ? 187  PHE A CZ  1 
ATOM   1497 N  N   . GLY A 1 188 ? -23.767 -8.523  2.795   1.00 33.23  ? 188  GLY A N   1 
ATOM   1498 C  CA  . GLY A 1 188 ? -24.426 -9.540  3.589   1.00 31.33  ? 188  GLY A CA  1 
ATOM   1499 C  C   . GLY A 1 188 ? -24.313 -9.360  5.084   1.00 35.08  ? 188  GLY A C   1 
ATOM   1500 O  O   . GLY A 1 188 ? -24.548 -10.320 5.829   1.00 38.85  ? 188  GLY A O   1 
ATOM   1501 N  N   . GLY A 1 189 ? -23.987 -8.161  5.551   1.00 31.52  ? 189  GLY A N   1 
ATOM   1502 C  CA  . GLY A 1 189 ? -23.900 -7.877  6.968   1.00 31.09  ? 189  GLY A CA  1 
ATOM   1503 C  C   . GLY A 1 189 ? -25.103 -7.094  7.459   1.00 35.40  ? 189  GLY A C   1 
ATOM   1504 O  O   . GLY A 1 189 ? -25.692 -6.303  6.726   1.00 33.36  ? 189  GLY A O   1 
ATOM   1505 N  N   . ASP A 1 190 ? -25.467 -7.324  8.717   1.00 30.59  ? 190  ASP A N   1 
ATOM   1506 C  CA  . ASP A 1 190 ? -26.579 -6.606  9.319   1.00 29.98  ? 190  ASP A CA  1 
ATOM   1507 C  C   . ASP A 1 190 ? -26.047 -5.366  10.018  1.00 31.44  ? 190  ASP A C   1 
ATOM   1508 O  O   . ASP A 1 190 ? -25.368 -5.486  11.053  1.00 29.16  ? 190  ASP A O   1 
ATOM   1509 C  CB  . ASP A 1 190 ? -27.322 -7.501  10.304  1.00 31.10  ? 190  ASP A CB  1 
ATOM   1510 C  CG  . ASP A 1 190 ? -28.439 -6.776  11.025  1.00 29.67  ? 190  ASP A CG  1 
ATOM   1511 O  OD1 . ASP A 1 190 ? -28.783 -5.641  10.630  1.00 33.55  ? 190  ASP A OD1 1 
ATOM   1512 O  OD2 . ASP A 1 190 ? -28.954 -7.330  12.021  1.00 36.22  ? 190  ASP A OD2 1 
ATOM   1513 N  N   . PRO A 1 191 ? -26.340 -4.156  9.520   1.00 30.14  ? 191  PRO A N   1 
ATOM   1514 C  CA  . PRO A 1 191 ? -25.839 -2.939  10.179  1.00 28.19  ? 191  PRO A CA  1 
ATOM   1515 C  C   . PRO A 1 191 ? -26.430 -2.686  11.561  1.00 29.81  ? 191  PRO A C   1 
ATOM   1516 O  O   . PRO A 1 191 ? -25.942 -1.794  12.270  1.00 25.99  ? 191  PRO A O   1 
ATOM   1517 C  CB  . PRO A 1 191 ? -26.234 -1.827  9.198   1.00 28.72  ? 191  PRO A CB  1 
ATOM   1518 C  CG  . PRO A 1 191 ? -27.420 -2.411  8.416   1.00 30.54  ? 191  PRO A CG  1 
ATOM   1519 C  CD  . PRO A 1 191 ? -27.071 -3.864  8.267   1.00 31.75  ? 191  PRO A CD  1 
ATOM   1520 N  N   . LYS A 1 192 ? -27.480 -3.406  11.947  1.00 25.46  ? 192  LYS A N   1 
ATOM   1521 C  CA  . LYS A 1 192 ? -28.047 -3.309  13.287  1.00 27.14  ? 192  LYS A CA  1 
ATOM   1522 C  C   . LYS A 1 192 ? -27.395 -4.260  14.279  1.00 27.59  ? 192  LYS A C   1 
ATOM   1523 O  O   . LYS A 1 192 ? -27.733 -4.219  15.472  1.00 30.01  ? 192  LYS A O   1 
ATOM   1524 C  CB  . LYS A 1 192 ? -29.556 -3.590  13.242  1.00 30.10  ? 192  LYS A CB  1 
ATOM   1525 C  CG  . LYS A 1 192 ? -30.318 -2.692  12.283  1.00 35.75  ? 192  LYS A CG  1 
ATOM   1526 C  CD  . LYS A 1 192 ? -31.724 -3.240  12.023  1.00 37.83  ? 192  LYS A CD  1 
ATOM   1527 C  CE  . LYS A 1 192 ? -32.777 -2.500  12.825  1.00 39.08  ? 192  LYS A CE  1 
ATOM   1528 N  NZ  . LYS A 1 192 ? -32.599 -2.528  14.298  1.00 41.53  ? 192  LYS A NZ  1 
ATOM   1529 N  N   . THR A 1 193 ? -26.497 -5.129  13.822  1.00 26.72  ? 193  THR A N   1 
ATOM   1530 C  CA  . THR A 1 193 ? -25.826 -6.090  14.695  1.00 29.35  ? 193  THR A CA  1 
ATOM   1531 C  C   . THR A 1 193 ? -24.308 -6.031  14.440  1.00 23.64  ? 193  THR A C   1 
ATOM   1532 O  O   . THR A 1 193 ? -23.663 -6.995  14.030  1.00 26.17  ? 193  THR A O   1 
ATOM   1533 C  CB  . THR A 1 193 ? -26.436 -7.482  14.492  1.00 30.10  ? 193  THR A CB  1 
ATOM   1534 O  OG1 . THR A 1 193 ? -27.871 -7.377  14.574  1.00 30.37  ? 193  THR A OG1 1 
ATOM   1535 C  CG2 . THR A 1 193 ? -25.976 -8.437  15.592  1.00 30.13  ? 193  THR A CG2 1 
ATOM   1536 N  N   . VAL A 1 194 ? -23.738 -4.855  14.688  1.00 25.79  ? 194  VAL A N   1 
ATOM   1537 C  CA  . VAL A 1 194 ? -22.299 -4.624  14.547  1.00 23.61  ? 194  VAL A CA  1 
ATOM   1538 C  C   . VAL A 1 194 ? -21.664 -4.643  15.929  1.00 22.85  ? 194  VAL A C   1 
ATOM   1539 O  O   . VAL A 1 194 ? -22.059 -3.870  16.809  1.00 23.50  ? 194  VAL A O   1 
ATOM   1540 C  CB  . VAL A 1 194 ? -22.003 -3.290  13.844  1.00 23.87  ? 194  VAL A CB  1 
ATOM   1541 C  CG1 . VAL A 1 194 ? -20.491 -3.077  13.722  1.00 24.20  ? 194  VAL A CG1 1 
ATOM   1542 C  CG2 . VAL A 1 194 ? -22.667 -3.260  12.446  1.00 23.21  ? 194  VAL A CG2 1 
ATOM   1543 N  N   . THR A 1 195 ? -20.669 -5.504  16.110  1.00 23.72  ? 195  THR A N   1 
ATOM   1544 C  CA  . THR A 1 195 ? -19.826 -5.494  17.298  1.00 19.93  ? 195  THR A CA  1 
ATOM   1545 C  C   . THR A 1 195 ? -18.485 -4.876  16.942  1.00 22.54  ? 195  THR A C   1 
ATOM   1546 O  O   . THR A 1 195 ? -17.846 -5.290  15.971  1.00 24.14  ? 195  THR A O   1 
ATOM   1547 C  CB  . THR A 1 195 ? -19.606 -6.904  17.842  1.00 24.79  ? 195  THR A CB  1 
ATOM   1548 O  OG1 . THR A 1 195 ? -20.847 -7.408  18.345  1.00 22.82  ? 195  THR A OG1 1 
ATOM   1549 C  CG2 . THR A 1 195 ? -18.582 -6.881  18.983  1.00 24.31  ? 195  THR A CG2 1 
ATOM   1550 N  N   . ILE A 1 196 ? -18.078 -3.885  17.690  1.00 19.47  ? 196  ILE A N   1 
ATOM   1551 C  CA  . ILE A 1 196 ? -16.716 -3.386  17.552  1.00 22.98  ? 196  ILE A CA  1 
ATOM   1552 C  C   . ILE A 1 196 ? -15.866 -4.083  18.598  1.00 22.44  ? 196  ILE A C   1 
ATOM   1553 O  O   . ILE A 1 196 ? -16.310 -4.292  19.738  1.00 21.12  ? 196  ILE A O   1 
ATOM   1554 C  CB  . ILE A 1 196 ? -16.657 -1.852  17.684  1.00 21.58  ? 196  ILE A CB  1 
ATOM   1555 C  CG1 . ILE A 1 196 ? -17.289 -1.394  18.996  1.00 23.80  ? 196  ILE A CG1 1 
ATOM   1556 C  CG2 . ILE A 1 196 ? -17.358 -1.177  16.484  1.00 21.82  ? 196  ILE A CG2 1 
ATOM   1557 C  CD1 . ILE A 1 196 ? -17.092 0.075   19.288  1.00 19.68  ? 196  ILE A CD1 1 
ATOM   1558 N  N   . PHE A 1 197 ? -14.660 -4.486  18.202  1.00 24.42  ? 197  PHE A N   1 
ATOM   1559 C  CA  . PHE A 1 197 ? -13.720 -5.099  19.125  1.00 20.57  ? 197  PHE A CA  1 
ATOM   1560 C  C   . PHE A 1 197 ? -12.307 -4.638  18.795  1.00 20.82  ? 197  PHE A C   1 
ATOM   1561 O  O   . PHE A 1 197 ? -12.002 -4.267  17.661  1.00 23.93  ? 197  PHE A O   1 
ATOM   1562 C  CB  . PHE A 1 197 ? -13.848 -6.650  19.162  1.00 22.45  ? 197  PHE A CB  1 
ATOM   1563 C  CG  . PHE A 1 197 ? -13.396 -7.398  17.923  1.00 23.84  ? 197  PHE A CG  1 
ATOM   1564 C  CD1 . PHE A 1 197 ? -13.904 -7.115  16.653  1.00 23.83  ? 197  PHE A CD1 1 
ATOM   1565 C  CD2 . PHE A 1 197 ? -12.535 -8.484  18.057  1.00 22.07  ? 197  PHE A CD2 1 
ATOM   1566 C  CE1 . PHE A 1 197 ? -13.506 -7.861  15.552  1.00 24.58  ? 197  PHE A CE1 1 
ATOM   1567 C  CE2 . PHE A 1 197 ? -12.131 -9.230  16.962  1.00 25.57  ? 197  PHE A CE2 1 
ATOM   1568 C  CZ  . PHE A 1 197 ? -12.605 -8.917  15.697  1.00 23.28  ? 197  PHE A CZ  1 
ATOM   1569 N  N   . GLY A 1 198 ? -11.465 -4.597  19.823  1.00 21.84  ? 198  GLY A N   1 
ATOM   1570 C  CA  . GLY A 1 198 ? -10.105 -4.124  19.644  1.00 19.88  ? 198  GLY A CA  1 
ATOM   1571 C  C   . GLY A 1 198 ? -9.279  -4.423  20.872  1.00 19.10  ? 198  GLY A C   1 
ATOM   1572 O  O   . GLY A 1 198 ? -9.817  -4.650  21.962  1.00 21.46  ? 198  GLY A O   1 
ATOM   1573 N  N   . GLU A 1 199 ? -7.958  -4.390  20.684  1.00 19.82  ? 199  GLU A N   1 
ATOM   1574 C  CA  . GLU A 1 199 ? -6.996  -4.687  21.736  1.00 20.07  ? 199  GLU A CA  1 
ATOM   1575 C  C   . GLU A 1 199 ? -6.125  -3.466  22.015  1.00 21.83  ? 199  GLU A C   1 
ATOM   1576 O  O   . GLU A 1 199 ? -5.818  -2.681  21.108  1.00 20.42  ? 199  GLU A O   1 
ATOM   1577 C  CB  . GLU A 1 199 ? -6.129  -5.893  21.328  1.00 22.34  ? 199  GLU A CB  1 
ATOM   1578 C  CG  . GLU A 1 199 ? -5.177  -6.421  22.405  1.00 20.52  ? 199  GLU A CG  1 
ATOM   1579 C  CD  . GLU A 1 199 ? -3.815  -5.742  22.377  1.00 24.31  ? 199  GLU A CD  1 
ATOM   1580 O  OE1 . GLU A 1 199 ? -3.515  -5.020  21.395  1.00 22.17  ? 199  GLU A OE1 1 
ATOM   1581 O  OE2 . GLU A 1 199 ? -3.047  -5.918  23.359  1.00 23.67  ? 199  GLU A OE2 1 
ATOM   1582 N  N   . SER A 1 200 ? -5.716  -3.310  23.286  1.00 22.12  ? 200  SER A N   1 
ATOM   1583 C  CA  . SER A 1 200 ? -4.815  -2.229  23.700  1.00 24.80  ? 200  SER A CA  1 
ATOM   1584 C  C   . SER A 1 200 ? -5.452  -0.896  23.325  1.00 25.05  ? 200  SER A C   1 
ATOM   1585 O  O   . SER A 1 200 ? -6.589  -0.640  23.759  1.00 21.76  ? 200  SER A O   1 
ATOM   1586 C  CB  . SER A 1 200 ? -3.433  -2.518  23.101  1.00 29.87  ? 200  SER A CB  1 
ATOM   1587 O  OG  . SER A 1 200 ? -2.635  -1.360  23.032  1.00 42.13  ? 200  SER A OG  1 
ATOM   1588 N  N   . ALA A 1 201 ? -4.797  -0.037  22.534  1.00 22.43  ? 201  ALA A N   1 
ATOM   1589 C  CA  . ALA A 1 201 ? -5.419  1.226   22.140  1.00 23.09  ? 201  ALA A CA  1 
ATOM   1590 C  C   . ALA A 1 201 ? -6.715  1.002   21.375  1.00 19.75  ? 201  ALA A C   1 
ATOM   1591 O  O   . ALA A 1 201 ? -7.606  1.860   21.396  1.00 19.14  ? 201  ALA A O   1 
ATOM   1592 C  CB  . ALA A 1 201 ? -4.450  2.058   21.301  1.00 18.80  ? 201  ALA A CB  1 
ATOM   1593 N  N   . GLY A 1 202 ? -6.839  -0.135  20.693  1.00 20.19  ? 202  GLY A N   1 
ATOM   1594 C  CA  . GLY A 1 202 ? -8.106  -0.462  20.055  1.00 18.84  ? 202  GLY A CA  1 
ATOM   1595 C  C   . GLY A 1 202 ? -9.199  -0.742  21.073  1.00 21.48  ? 202  GLY A C   1 
ATOM   1596 O  O   . GLY A 1 202 ? -10.356 -0.357  20.877  1.00 21.98  ? 202  GLY A O   1 
ATOM   1597 N  N   . GLY A 1 203 ? -8.850  -1.426  22.164  1.00 20.44  ? 203  GLY A N   1 
ATOM   1598 C  CA  . GLY A 1 203 ? -9.806  -1.618  23.251  1.00 19.40  ? 203  GLY A CA  1 
ATOM   1599 C  C   . GLY A 1 203 ? -10.205 -0.314  23.916  1.00 19.68  ? 203  GLY A C   1 
ATOM   1600 O  O   . GLY A 1 203 ? -11.387 -0.075  24.183  1.00 21.94  ? 203  GLY A O   1 
ATOM   1601 N  N   . ALA A 1 204 ? -9.226  0.548   24.204  1.00 19.79  ? 204  ALA A N   1 
ATOM   1602 C  CA  . ALA A 1 204 ? -9.559  1.879   24.705  1.00 21.80  ? 204  ALA A CA  1 
ATOM   1603 C  C   . ALA A 1 204 ? -10.463 2.621   23.729  1.00 22.13  ? 204  ALA A C   1 
ATOM   1604 O  O   . ALA A 1 204 ? -11.410 3.305   24.146  1.00 20.24  ? 204  ALA A O   1 
ATOM   1605 C  CB  . ALA A 1 204 ? -8.294  2.697   24.958  1.00 23.28  ? 204  ALA A CB  1 
ATOM   1606 N  N   . SER A 1 205 ? -10.152 2.536   22.431  1.00 20.33  ? 205  SER A N   1 
ATOM   1607 C  CA  . SER A 1 205 ? -10.978 3.178   21.407  1.00 21.09  ? 205  SER A CA  1 
ATOM   1608 C  C   . SER A 1 205 ? -12.410 2.673   21.458  1.00 23.05  ? 205  SER A C   1 
ATOM   1609 O  O   . SER A 1 205 ? -13.358 3.459   21.360  1.00 22.35  ? 205  SER A O   1 
ATOM   1610 C  CB  . SER A 1 205 ? -10.394 2.926   20.016  1.00 19.22  ? 205  SER A CB  1 
ATOM   1611 O  OG  . SER A 1 205 ? -9.162  3.596   19.841  1.00 20.83  ? 205  SER A OG  1 
ATOM   1612 N  N   . VAL A 1 206 ? -12.584 1.354   21.561  1.00 22.19  ? 206  VAL A N   1 
ATOM   1613 C  CA  . VAL A 1 206 ? -13.927 0.792   21.654  1.00 23.20  ? 206  VAL A CA  1 
ATOM   1614 C  C   . VAL A 1 206 ? -14.681 1.421   22.810  1.00 23.83  ? 206  VAL A C   1 
ATOM   1615 O  O   . VAL A 1 206 ? -15.840 1.831   22.664  1.00 22.32  ? 206  VAL A O   1 
ATOM   1616 C  CB  . VAL A 1 206 ? -13.859 -0.735  21.798  1.00 21.72  ? 206  VAL A CB  1 
ATOM   1617 C  CG1 . VAL A 1 206 ? -15.184 -1.271  22.340  1.00 21.79  ? 206  VAL A CG1 1 
ATOM   1618 C  CG2 . VAL A 1 206 ? -13.526 -1.355  20.471  1.00 20.04  ? 206  VAL A CG2 1 
ATOM   1619 N  N   . GLY A 1 207 ? -14.024 1.538   23.967  1.00 21.96  ? 207  GLY A N   1 
ATOM   1620 C  CA  . GLY A 1 207 ? -14.657 2.181   25.102  1.00 23.41  ? 207  GLY A CA  1 
ATOM   1621 C  C   . GLY A 1 207 ? -14.952 3.644   24.854  1.00 24.58  ? 207  GLY A C   1 
ATOM   1622 O  O   . GLY A 1 207 ? -15.956 4.172   25.344  1.00 24.52  ? 207  GLY A O   1 
ATOM   1623 N  N   . MET A 1 208 ? -14.102 4.313   24.075  1.00 20.94  ? 208  MET A N   1 
ATOM   1624 C  CA  . MET A 1 208 ? -14.331 5.722   23.784  1.00 23.14  ? 208  MET A CA  1 
ATOM   1625 C  C   . MET A 1 208 ? -15.552 5.912   22.896  1.00 20.00  ? 208  MET A C   1 
ATOM   1626 O  O   . MET A 1 208 ? -16.271 6.904   23.051  1.00 23.59  ? 208  MET A O   1 
ATOM   1627 C  CB  . MET A 1 208 ? -13.081 6.330   23.140  1.00 21.32  ? 208  MET A CB  1 
ATOM   1628 C  CG  . MET A 1 208 ? -11.933 6.417   24.162  1.00 23.21  ? 208  MET A CG  1 
ATOM   1629 S  SD  . MET A 1 208 ? -10.338 6.854   23.425  1.00 21.71  ? 208  MET A SD  1 
ATOM   1630 C  CE  . MET A 1 208 ? -9.423  7.216   24.918  1.00 21.12  ? 208  MET A CE  1 
ATOM   1631 N  N   . HIS A 1 209 ? -15.801 4.972   21.982  1.00 21.20  ? 209  HIS A N   1 
ATOM   1632 C  CA  . HIS A 1 209 ? -17.006 5.029   21.161  1.00 21.49  ? 209  HIS A CA  1 
ATOM   1633 C  C   . HIS A 1 209 ? -18.245 4.709   21.986  1.00 25.00  ? 209  HIS A C   1 
ATOM   1634 O  O   . HIS A 1 209 ? -19.330 5.220   21.692  1.00 25.18  ? 209  HIS A O   1 
ATOM   1635 C  CB  . HIS A 1 209 ? -16.902 4.068   19.980  1.00 22.11  ? 209  HIS A CB  1 
ATOM   1636 C  CG  . HIS A 1 209 ? -15.871 4.473   18.972  1.00 22.08  ? 209  HIS A CG  1 
ATOM   1637 N  ND1 . HIS A 1 209 ? -15.923 5.675   18.301  1.00 24.94  ? 209  HIS A ND1 1 
ATOM   1638 C  CD2 . HIS A 1 209 ? -14.739 3.857   18.555  1.00 21.31  ? 209  HIS A CD2 1 
ATOM   1639 C  CE1 . HIS A 1 209 ? -14.874 5.778   17.502  1.00 23.72  ? 209  HIS A CE1 1 
ATOM   1640 N  NE2 . HIS A 1 209 ? -14.144 4.685   17.633  1.00 21.83  ? 209  HIS A NE2 1 
ATOM   1641 N  N   . ILE A 1 210 ? -18.108 3.852   22.998  1.00 24.23  ? 210  ILE A N   1 
ATOM   1642 C  CA  . ILE A 1 210 ? -19.192 3.665   23.960  1.00 23.82  ? 210  ILE A CA  1 
ATOM   1643 C  C   . ILE A 1 210 ? -19.532 4.989   24.625  1.00 26.81  ? 210  ILE A C   1 
ATOM   1644 O  O   . ILE A 1 210 ? -20.707 5.357   24.759  1.00 31.84  ? 210  ILE A O   1 
ATOM   1645 C  CB  . ILE A 1 210 ? -18.799 2.596   24.997  1.00 25.38  ? 210  ILE A CB  1 
ATOM   1646 C  CG1 . ILE A 1 210 ? -18.840 1.203   24.357  1.00 25.74  ? 210  ILE A CG1 1 
ATOM   1647 C  CG2 . ILE A 1 210 ? -19.733 2.652   26.227  1.00 25.50  ? 210  ILE A CG2 1 
ATOM   1648 C  CD1 . ILE A 1 210 ? -18.222 0.134   25.253  1.00 29.45  ? 210  ILE A CD1 1 
ATOM   1649 N  N   . LEU A 1 211 ? -18.506 5.736   25.031  1.00 25.17  ? 211  LEU A N   1 
ATOM   1650 C  CA  . LEU A 1 211 ? -18.723 7.000   25.723  1.00 27.67  ? 211  LEU A CA  1 
ATOM   1651 C  C   . LEU A 1 211 ? -19.245 8.082   24.781  1.00 29.40  ? 211  LEU A C   1 
ATOM   1652 O  O   . LEU A 1 211 ? -20.194 8.801   25.115  1.00 34.63  ? 211  LEU A O   1 
ATOM   1653 C  CB  . LEU A 1 211 ? -17.425 7.446   26.397  1.00 25.14  ? 211  LEU A CB  1 
ATOM   1654 C  CG  . LEU A 1 211 ? -17.080 6.615   27.637  1.00 26.44  ? 211  LEU A CG  1 
ATOM   1655 C  CD1 . LEU A 1 211 ? -15.639 6.848   28.049  1.00 29.16  ? 211  LEU A CD1 1 
ATOM   1656 C  CD2 . LEU A 1 211 ? -18.026 6.951   28.777  1.00 30.61  ? 211  LEU A CD2 1 
ATOM   1657 N  N   . SER A 1 212 ? -18.660 8.195   23.593  1.00 24.45  ? 212  SER A N   1 
ATOM   1658 C  CA  . SER A 1 212 ? -18.891 9.367   22.752  1.00 27.48  ? 212  SER A CA  1 
ATOM   1659 C  C   . SER A 1 212 ? -20.285 9.359   22.137  1.00 28.37  ? 212  SER A C   1 
ATOM   1660 O  O   . SER A 1 212 ? -20.622 8.419   21.407  1.00 25.43  ? 212  SER A O   1 
ATOM   1661 C  CB  . SER A 1 212 ? -17.854 9.437   21.643  1.00 25.18  ? 212  SER A CB  1 
ATOM   1662 O  OG  . SER A 1 212 ? -18.022 10.621  20.889  1.00 26.94  ? 212  SER A OG  1 
ATOM   1663 N  N   . PRO A 1 213 ? -21.108 10.388  22.380  1.00 30.41  ? 213  PRO A N   1 
ATOM   1664 C  CA  . PRO A 1 213 ? -22.467 10.410  21.794  1.00 30.17  ? 213  PRO A CA  1 
ATOM   1665 C  C   . PRO A 1 213 ? -22.477 10.301  20.278  1.00 28.32  ? 213  PRO A C   1 
ATOM   1666 O  O   . PRO A 1 213 ? -23.357 9.643   19.718  1.00 29.09  ? 213  PRO A O   1 
ATOM   1667 C  CB  . PRO A 1 213 ? -23.029 11.762  22.261  1.00 31.30  ? 213  PRO A CB  1 
ATOM   1668 C  CG  . PRO A 1 213 ? -22.231 12.111  23.490  1.00 33.46  ? 213  PRO A CG  1 
ATOM   1669 C  CD  . PRO A 1 213 ? -20.849 11.549  23.250  1.00 32.25  ? 213  PRO A CD  1 
ATOM   1670 N  N   . GLY A 1 214 ? -21.498 10.902  19.599  1.00 29.66  ? 214  GLY A N   1 
ATOM   1671 C  CA  . GLY A 1 214 ? -21.417 10.853  18.147  1.00 30.35  ? 214  GLY A CA  1 
ATOM   1672 C  C   . GLY A 1 214 ? -21.073 9.493   17.570  1.00 28.38  ? 214  GLY A C   1 
ATOM   1673 O  O   . GLY A 1 214 ? -21.134 9.330   16.345  1.00 29.45  ? 214  GLY A O   1 
ATOM   1674 N  N   . SER A 1 215 ? -20.733 8.514   18.413  1.00 24.73  ? 215  SER A N   1 
ATOM   1675 C  CA  . SER A 1 215 ? -20.394 7.173   17.953  1.00 23.44  ? 215  SER A CA  1 
ATOM   1676 C  C   . SER A 1 215 ? -21.421 6.114   18.322  1.00 20.04  ? 215  SER A C   1 
ATOM   1677 O  O   . SER A 1 215 ? -21.425 5.042   17.710  1.00 26.19  ? 215  SER A O   1 
ATOM   1678 C  CB  . SER A 1 215 ? -19.038 6.730   18.535  1.00 25.43  ? 215  SER A CB  1 
ATOM   1679 O  OG  . SER A 1 215 ? -17.958 7.465   17.982  1.00 28.35  ? 215  SER A OG  1 
ATOM   1680 N  N   . ARG A 1 216 ? -22.284 6.383   19.295  1.00 24.39  ? 216  ARG A N   1 
ATOM   1681 C  CA  . ARG A 1 216 ? -23.011 5.302   19.955  1.00 29.58  ? 216  ARG A CA  1 
ATOM   1682 C  C   . ARG A 1 216 ? -23.977 4.593   19.018  1.00 30.44  ? 216  ARG A C   1 
ATOM   1683 O  O   . ARG A 1 216 ? -24.188 3.383   19.148  1.00 29.20  ? 216  ARG A O   1 
ATOM   1684 C  CB  . ARG A 1 216 ? -23.758 5.843   21.173  1.00 26.54  ? 216  ARG A CB  1 
ATOM   1685 C  CG  . ARG A 1 216 ? -22.856 6.378   22.271  1.00 30.22  ? 216  ARG A CG  1 
ATOM   1686 C  CD  . ARG A 1 216 ? -23.718 6.920   23.406  1.00 32.93  ? 216  ARG A CD  1 
ATOM   1687 N  NE  . ARG A 1 216 ? -22.981 7.796   24.315  1.00 31.90  ? 216  ARG A NE  1 
ATOM   1688 C  CZ  . ARG A 1 216 ? -23.568 8.618   25.177  1.00 34.87  ? 216  ARG A CZ  1 
ATOM   1689 N  NH1 . ARG A 1 216 ? -24.897 8.670   25.239  1.00 35.84  ? 216  ARG A NH1 1 
ATOM   1690 N  NH2 . ARG A 1 216 ? -22.835 9.389   25.967  1.00 35.13  ? 216  ARG A NH2 1 
ATOM   1691 N  N   . ASP A 1 217 ? -24.548 5.307   18.054  1.00 31.16  ? 217  ASP A N   1 
ATOM   1692 C  CA  . ASP A 1 217 ? -25.549 4.684   17.204  1.00 30.44  ? 217  ASP A CA  1 
ATOM   1693 C  C   . ASP A 1 217 ? -24.946 3.934   16.027  1.00 30.51  ? 217  ASP A C   1 
ATOM   1694 O  O   . ASP A 1 217 ? -25.699 3.417   15.193  1.00 27.31  ? 217  ASP A O   1 
ATOM   1695 C  CB  . ASP A 1 217 ? -26.535 5.746   16.726  1.00 31.50  ? 217  ASP A CB  1 
ATOM   1696 C  CG  . ASP A 1 217 ? -27.310 6.356   17.872  1.00 35.40  ? 217  ASP A CG  1 
ATOM   1697 O  OD1 . ASP A 1 217 ? -27.701 5.591   18.773  1.00 38.16  ? 217  ASP A OD1 1 
ATOM   1698 O  OD2 . ASP A 1 217 ? -27.520 7.586   17.886  1.00 40.07  ? 217  ASP A OD2 1 
ATOM   1699 N  N   . LEU A 1 218 ? -23.620 3.832   15.955  1.00 29.07  ? 218  LEU A N   1 
ATOM   1700 C  CA  . LEU A 1 218 ? -22.956 3.183   14.835  1.00 27.03  ? 218  LEU A CA  1 
ATOM   1701 C  C   . LEU A 1 218 ? -22.480 1.773   15.156  1.00 29.56  ? 218  LEU A C   1 
ATOM   1702 O  O   . LEU A 1 218 ? -21.682 1.217   14.396  1.00 31.19  ? 218  LEU A O   1 
ATOM   1703 C  CB  . LEU A 1 218 ? -21.778 4.030   14.362  1.00 29.39  ? 218  LEU A CB  1 
ATOM   1704 C  CG  . LEU A 1 218 ? -22.148 5.415   13.853  1.00 29.34  ? 218  LEU A CG  1 
ATOM   1705 C  CD1 . LEU A 1 218 ? -20.869 6.206   13.562  1.00 30.36  ? 218  LEU A CD1 1 
ATOM   1706 C  CD2 . LEU A 1 218 ? -23.029 5.294   12.624  1.00 31.60  ? 218  LEU A CD2 1 
ATOM   1707 N  N   . PHE A 1 219 ? -22.925 1.195   16.271  1.00 24.13  ? 219  PHE A N   1 
ATOM   1708 C  CA  . PHE A 1 219 ? -22.605 -0.189  16.595  1.00 26.16  ? 219  PHE A CA  1 
ATOM   1709 C  C   . PHE A 1 219 ? -23.598 -0.655  17.655  1.00 21.86  ? 219  PHE A C   1 
ATOM   1710 O  O   . PHE A 1 219 ? -24.276 0.152   18.286  1.00 24.60  ? 219  PHE A O   1 
ATOM   1711 C  CB  . PHE A 1 219 ? -21.145 -0.351  17.075  1.00 22.96  ? 219  PHE A CB  1 
ATOM   1712 C  CG  . PHE A 1 219 ? -20.832 0.399   18.336  1.00 26.90  ? 219  PHE A CG  1 
ATOM   1713 C  CD1 . PHE A 1 219 ? -20.564 1.757   18.298  1.00 24.47  ? 219  PHE A CD1 1 
ATOM   1714 C  CD2 . PHE A 1 219 ? -20.819 -0.247  19.570  1.00 24.58  ? 219  PHE A CD2 1 
ATOM   1715 C  CE1 . PHE A 1 219 ? -20.293 2.454   19.460  1.00 21.52  ? 219  PHE A CE1 1 
ATOM   1716 C  CE2 . PHE A 1 219 ? -20.543 0.450   20.725  1.00 24.19  ? 219  PHE A CE2 1 
ATOM   1717 C  CZ  . PHE A 1 219 ? -20.281 1.798   20.671  1.00 25.41  ? 219  PHE A CZ  1 
ATOM   1718 N  N   . ARG A 1 220 ? -23.704 -1.973  17.797  1.00 24.47  ? 220  ARG A N   1 
ATOM   1719 C  CA  . ARG A 1 220 ? -24.649 -2.633  18.695  1.00 22.79  ? 220  ARG A CA  1 
ATOM   1720 C  C   . ARG A 1 220 ? -24.040 -2.956  20.060  1.00 24.91  ? 220  ARG A C   1 
ATOM   1721 O  O   . ARG A 1 220 ? -24.637 -2.644  21.100  1.00 26.04  ? 220  ARG A O   1 
ATOM   1722 C  CB  . ARG A 1 220 ? -25.153 -3.923  18.040  1.00 22.87  ? 220  ARG A CB  1 
ATOM   1723 C  CG  . ARG A 1 220 ? -26.148 -4.718  18.877  1.00 28.37  ? 220  ARG A CG  1 
ATOM   1724 C  CD  . ARG A 1 220 ? -27.412 -3.909  19.126  1.00 30.87  ? 220  ARG A CD  1 
ATOM   1725 N  NE  . ARG A 1 220 ? -28.463 -4.720  19.748  1.00 37.98  ? 220  ARG A NE  1 
ATOM   1726 C  CZ  . ARG A 1 220 ? -29.218 -5.601  19.095  1.00 40.03  ? 220  ARG A CZ  1 
ATOM   1727 N  NH1 . ARG A 1 220 ? -29.050 -5.796  17.786  1.00 36.35  ? 220  ARG A NH1 1 
ATOM   1728 N  NH2 . ARG A 1 220 ? -30.145 -6.291  19.753  1.00 38.10  ? 220  ARG A NH2 1 
ATOM   1729 N  N   . ARG A 1 221 ? -22.855 -3.574  20.077  1.00 23.22  ? 221  ARG A N   1 
ATOM   1730 C  CA  . ARG A 1 221 ? -22.206 -3.994  21.317  1.00 24.05  ? 221  ARG A CA  1 
ATOM   1731 C  C   . ARG A 1 221 ? -20.692 -4.009  21.105  1.00 22.93  ? 221  ARG A C   1 
ATOM   1732 O  O   . ARG A 1 221 ? -20.195 -3.705  20.018  1.00 22.01  ? 221  ARG A O   1 
ATOM   1733 C  CB  . ARG A 1 221 ? -22.739 -5.357  21.776  1.00 27.64  ? 221  ARG A CB  1 
ATOM   1734 C  CG  . ARG A 1 221 ? -22.874 -6.370  20.675  1.00 28.09  ? 221  ARG A CG  1 
ATOM   1735 C  CD  . ARG A 1 221 ? -23.483 -7.670  21.186  1.00 27.71  ? 221  ARG A CD  1 
ATOM   1736 N  NE  . ARG A 1 221 ? -24.864 -7.503  21.623  1.00 29.90  ? 221  ARG A NE  1 
ATOM   1737 C  CZ  . ARG A 1 221 ? -25.931 -7.862  20.914  1.00 29.56  ? 221  ARG A CZ  1 
ATOM   1738 N  NH1 . ARG A 1 221 ? -25.795 -8.395  19.705  1.00 29.54  ? 221  ARG A NH1 1 
ATOM   1739 N  NH2 . ARG A 1 221 ? -27.143 -7.662  21.413  1.00 30.26  ? 221  ARG A NH2 1 
ATOM   1740 N  N   . ALA A 1 222 ? -19.950 -4.352  22.159  1.00 22.95  ? 222  ALA A N   1 
ATOM   1741 C  CA  . ALA A 1 222 ? -18.527 -4.034  22.168  1.00 22.03  ? 222  ALA A CA  1 
ATOM   1742 C  C   . ALA A 1 222 ? -17.715 -5.085  22.914  1.00 26.22  ? 222  ALA A C   1 
ATOM   1743 O  O   . ALA A 1 222 ? -18.176 -5.656  23.910  1.00 22.16  ? 222  ALA A O   1 
ATOM   1744 C  CB  . ALA A 1 222 ? -18.295 -2.670  22.809  1.00 21.10  ? 222  ALA A CB  1 
ATOM   1745 N  N   . ILE A 1 223 ? -16.486 -5.311  22.429  1.00 22.23  ? 223  ILE A N   1 
ATOM   1746 C  CA  . ILE A 1 223 ? -15.501 -6.179  23.071  1.00 20.13  ? 223  ILE A CA  1 
ATOM   1747 C  C   . ILE A 1 223 ? -14.214 -5.381  23.272  1.00 24.93  ? 223  ILE A C   1 
ATOM   1748 O  O   . ILE A 1 223 ? -13.739 -4.722  22.341  1.00 23.20  ? 223  ILE A O   1 
ATOM   1749 C  CB  . ILE A 1 223 ? -15.226 -7.444  22.235  1.00 24.49  ? 223  ILE A CB  1 
ATOM   1750 C  CG1 . ILE A 1 223 ? -16.496 -8.287  22.083  1.00 23.91  ? 223  ILE A CG1 1 
ATOM   1751 C  CG2 . ILE A 1 223 ? -14.034 -8.236  22.815  1.00 21.77  ? 223  ILE A CG2 1 
ATOM   1752 C  CD1 . ILE A 1 223 ? -16.369 -9.425  21.055  1.00 23.95  ? 223  ILE A CD1 1 
ATOM   1753 N  N   . LEU A 1 224 ? -13.658 -5.425  24.484  1.00 21.54  ? 224  LEU A N   1 
ATOM   1754 C  CA  . LEU A 1 224 ? -12.457 -4.668  24.832  1.00 21.66  ? 224  LEU A CA  1 
ATOM   1755 C  C   . LEU A 1 224 ? -11.396 -5.632  25.343  1.00 25.90  ? 224  LEU A C   1 
ATOM   1756 O  O   . LEU A 1 224 ? -11.607 -6.301  26.358  1.00 22.54  ? 224  LEU A O   1 
ATOM   1757 C  CB  . LEU A 1 224 ? -12.759 -3.610  25.899  1.00 24.18  ? 224  LEU A CB  1 
ATOM   1758 C  CG  . LEU A 1 224 ? -13.775 -2.501  25.589  1.00 22.49  ? 224  LEU A CG  1 
ATOM   1759 C  CD1 . LEU A 1 224 ? -15.235 -2.989  25.738  1.00 20.60  ? 224  LEU A CD1 1 
ATOM   1760 C  CD2 . LEU A 1 224 ? -13.522 -1.305  26.490  1.00 23.91  ? 224  LEU A CD2 1 
ATOM   1761 N  N   . GLN A 1 225 ? -10.246 -5.674  24.675  1.00 25.19  ? 225  GLN A N   1 
ATOM   1762 C  CA  . GLN A 1 225 ? -9.172  -6.599  25.022  1.00 24.23  ? 225  GLN A CA  1 
ATOM   1763 C  C   . GLN A 1 225 ? -7.974  -5.793  25.518  1.00 24.05  ? 225  GLN A C   1 
ATOM   1764 O  O   . GLN A 1 225 ? -7.372  -5.037  24.752  1.00 21.39  ? 225  GLN A O   1 
ATOM   1765 C  CB  . GLN A 1 225 ? -8.807  -7.474  23.818  1.00 21.31  ? 225  GLN A CB  1 
ATOM   1766 C  CG  . GLN A 1 225 ? -9.985  -8.264  23.272  1.00 22.39  ? 225  GLN A CG  1 
ATOM   1767 C  CD  . GLN A 1 225 ? -9.722  -8.933  21.935  1.00 25.19  ? 225  GLN A CD  1 
ATOM   1768 O  OE1 . GLN A 1 225 ? -10.661 -9.260  21.212  1.00 23.14  ? 225  GLN A OE1 1 
ATOM   1769 N  NE2 . GLN A 1 225 ? -8.444  -9.162  21.607  1.00 23.90  ? 225  GLN A NE2 1 
ATOM   1770 N  N   . SER A 1 226 ? -7.632  -5.951  26.802  1.00 21.25  ? 226  SER A N   1 
ATOM   1771 C  CA  . SER A 1 226 ? -6.445  -5.317  27.386  1.00 21.69  ? 226  SER A CA  1 
ATOM   1772 C  C   . SER A 1 226 ? -6.404  -3.821  27.090  1.00 22.02  ? 226  SER A C   1 
ATOM   1773 O  O   . SER A 1 226 ? -5.378  -3.269  26.690  1.00 23.17  ? 226  SER A O   1 
ATOM   1774 C  CB  . SER A 1 226 ? -5.152  -5.976  26.909  1.00 20.01  ? 226  SER A CB  1 
ATOM   1775 O  OG  . SER A 1 226 ? -5.157  -7.377  27.105  1.00 25.71  ? 226  SER A OG  1 
ATOM   1776 N  N   . GLY A 1 227 ? -7.539  -3.166  27.278  1.00 23.50  ? 227  GLY A N   1 
ATOM   1777 C  CA  . GLY A 1 227 ? -7.562  -1.723  27.176  1.00 22.41  ? 227  GLY A CA  1 
ATOM   1778 C  C   . GLY A 1 227 ? -8.920  -1.168  27.524  1.00 22.06  ? 227  GLY A C   1 
ATOM   1779 O  O   . GLY A 1 227 ? -9.937  -1.840  27.350  1.00 27.42  ? 227  GLY A O   1 
ATOM   1780 N  N   . SER A 1 228 ? -8.955  0.050   28.037  1.00 23.12  ? 228  SER A N   1 
ATOM   1781 C  CA  . SER A 1 228 ? -10.218 0.669   28.394  1.00 22.19  ? 228  SER A CA  1 
ATOM   1782 C  C   . SER A 1 228 ? -10.035 2.164   28.273  1.00 23.13  ? 228  SER A C   1 
ATOM   1783 O  O   . SER A 1 228 ? -8.891  2.660   28.288  1.00 20.92  ? 228  SER A O   1 
ATOM   1784 C  CB  . SER A 1 228 ? -10.674 0.263   29.811  1.00 27.51  ? 228  SER A CB  1 
ATOM   1785 O  OG  . SER A 1 228 ? -9.677  0.523   30.762  1.00 31.56  ? 228  SER A OG  1 
ATOM   1786 N  N   . PRO A 1 229 ? -11.124 2.922   28.124  1.00 22.63  ? 229  PRO A N   1 
ATOM   1787 C  CA  . PRO A 1 229 ? -10.997 4.350   27.800  1.00 24.24  ? 229  PRO A CA  1 
ATOM   1788 C  C   . PRO A 1 229 ? -10.309 5.157   28.874  1.00 25.84  ? 229  PRO A C   1 
ATOM   1789 O  O   . PRO A 1 229 ? -9.693  6.183   28.561  1.00 21.74  ? 229  PRO A O   1 
ATOM   1790 C  CB  . PRO A 1 229 ? -12.456 4.801   27.606  1.00 23.13  ? 229  PRO A CB  1 
ATOM   1791 C  CG  . PRO A 1 229 ? -13.274 3.781   28.356  1.00 28.02  ? 229  PRO A CG  1 
ATOM   1792 C  CD  . PRO A 1 229 ? -12.538 2.491   28.157  1.00 25.82  ? 229  PRO A CD  1 
ATOM   1793 N  N   . ASN A 1 230 ? -10.398 4.720   30.133  1.00 20.89  ? 230  ASN A N   1 
ATOM   1794 C  CA  . ASN A 1 230 ? -9.848  5.430   31.275  1.00 23.70  ? 230  ASN A CA  1 
ATOM   1795 C  C   . ASN A 1 230 ? -8.393  5.070   31.578  1.00 24.38  ? 230  ASN A C   1 
ATOM   1796 O  O   . ASN A 1 230 ? -7.862  5.529   32.596  1.00 25.23  ? 230  ASN A O   1 
ATOM   1797 C  CB  . ASN A 1 230 ? -10.708 5.132   32.513  1.00 22.44  ? 230  ASN A CB  1 
ATOM   1798 C  CG  . ASN A 1 230 ? -10.840 3.651   32.761  1.00 22.82  ? 230  ASN A CG  1 
ATOM   1799 O  OD1 . ASN A 1 230 ? -11.230 2.908   31.865  1.00 26.38  ? 230  ASN A OD1 1 
ATOM   1800 N  ND2 . ASN A 1 230 ? -10.493 3.200   33.975  1.00 20.81  ? 230  ASN A ND2 1 
ATOM   1801 N  N   . CYS A 1 231 ? -7.736  4.272   30.733  1.00 24.47  ? 231  CYS A N   1 
ATOM   1802 C  CA  . CYS A 1 231 ? -6.340  3.911   30.972  1.00 23.35  ? 231  CYS A CA  1 
ATOM   1803 C  C   . CYS A 1 231 ? -5.463  5.164   31.057  1.00 21.72  ? 231  CYS A C   1 
ATOM   1804 O  O   . CYS A 1 231 ? -5.719  6.161   30.375  1.00 22.99  ? 231  CYS A O   1 
ATOM   1805 C  CB  . CYS A 1 231 ? -5.830  2.991   29.864  1.00 19.30  ? 231  CYS A CB  1 
ATOM   1806 S  SG  . CYS A 1 231 ? -6.427  1.293   29.949  1.00 24.69  ? 231  CYS A SG  1 
ATOM   1807 N  N   . PRO A 1 232 ? -4.435  5.152   31.915  1.00 22.45  ? 232  PRO A N   1 
ATOM   1808 C  CA  . PRO A 1 232 ? -3.686  6.394   32.169  1.00 23.08  ? 232  PRO A CA  1 
ATOM   1809 C  C   . PRO A 1 232 ? -2.881  6.852   30.967  1.00 23.45  ? 232  PRO A C   1 
ATOM   1810 O  O   . PRO A 1 232 ? -2.514  8.033   30.896  1.00 25.60  ? 232  PRO A O   1 
ATOM   1811 C  CB  . PRO A 1 232 ? -2.771  6.027   33.353  1.00 24.91  ? 232  PRO A CB  1 
ATOM   1812 C  CG  . PRO A 1 232 ? -2.635  4.525   33.284  1.00 22.96  ? 232  PRO A CG  1 
ATOM   1813 C  CD  . PRO A 1 232 ? -3.941  4.015   32.718  1.00 23.07  ? 232  PRO A CD  1 
ATOM   1814 N  N   . TRP A 1 233 ? -2.613  5.955   30.030  1.00 21.74  ? 233  TRP A N   1 
ATOM   1815 C  CA  . TRP A 1 233 ? -1.883  6.259   28.806  1.00 20.97  ? 233  TRP A CA  1 
ATOM   1816 C  C   . TRP A 1 233 ? -2.800  6.655   27.656  1.00 21.47  ? 233  TRP A C   1 
ATOM   1817 O  O   . TRP A 1 233 ? -2.302  7.068   26.603  1.00 22.59  ? 233  TRP A O   1 
ATOM   1818 C  CB  . TRP A 1 233 ? -1.051  5.038   28.378  1.00 21.15  ? 233  TRP A CB  1 
ATOM   1819 C  CG  . TRP A 1 233 ? -1.835  3.746   28.407  1.00 20.47  ? 233  TRP A CG  1 
ATOM   1820 C  CD1 . TRP A 1 233 ? -1.904  2.848   29.443  1.00 22.81  ? 233  TRP A CD1 1 
ATOM   1821 C  CD2 . TRP A 1 233 ? -2.688  3.224   27.372  1.00 22.85  ? 233  TRP A CD2 1 
ATOM   1822 N  NE1 . TRP A 1 233 ? -2.728  1.798   29.109  1.00 21.25  ? 233  TRP A NE1 1 
ATOM   1823 C  CE2 . TRP A 1 233 ? -3.229  2.009   27.848  1.00 21.24  ? 233  TRP A CE2 1 
ATOM   1824 C  CE3 . TRP A 1 233 ? -3.045  3.667   26.091  1.00 20.05  ? 233  TRP A CE3 1 
ATOM   1825 C  CZ2 . TRP A 1 233 ? -4.102  1.234   27.095  1.00 23.72  ? 233  TRP A CZ2 1 
ATOM   1826 C  CZ3 . TRP A 1 233 ? -3.919  2.891   25.342  1.00 21.94  ? 233  TRP A CZ3 1 
ATOM   1827 C  CH2 . TRP A 1 233 ? -4.430  1.687   25.834  1.00 21.01  ? 233  TRP A CH2 1 
ATOM   1828 N  N   . ALA A 1 234 ? -4.117  6.530   27.820  1.00 21.03  ? 234  ALA A N   1 
ATOM   1829 C  CA  . ALA A 1 234 ? -5.014  6.558   26.670  1.00 21.52  ? 234  ALA A CA  1 
ATOM   1830 C  C   . ALA A 1 234 ? -5.591  7.936   26.370  1.00 21.90  ? 234  ALA A C   1 
ATOM   1831 O  O   . ALA A 1 234 ? -6.209  8.106   25.318  1.00 21.86  ? 234  ALA A O   1 
ATOM   1832 C  CB  . ALA A 1 234 ? -6.154  5.551   26.871  1.00 20.97  ? 234  ALA A CB  1 
ATOM   1833 N  N   . SER A 1 235 ? -5.413  8.923   27.246  1.00 22.67  ? 235  SER A N   1 
ATOM   1834 C  CA  . SER A 1 235 ? -5.868  10.268  26.925  1.00 21.22  ? 235  SER A CA  1 
ATOM   1835 C  C   . SER A 1 235 ? -5.025  11.281  27.674  1.00 27.12  ? 235  SER A C   1 
ATOM   1836 O  O   . SER A 1 235 ? -4.315  10.944  28.624  1.00 26.59  ? 235  SER A O   1 
ATOM   1837 C  CB  . SER A 1 235 ? -7.359  10.470  27.253  1.00 23.55  ? 235  SER A CB  1 
ATOM   1838 O  OG  . SER A 1 235 ? -7.614  10.344  28.634  1.00 27.22  ? 235  SER A OG  1 
ATOM   1839 N  N   . VAL A 1 236 ? -5.110  12.536  27.222  1.00 24.39  ? 236  VAL A N   1 
ATOM   1840 C  CA  . VAL A 1 236 ? -4.490  13.676  27.881  1.00 27.78  ? 236  VAL A CA  1 
ATOM   1841 C  C   . VAL A 1 236 ? -5.511  14.805  27.929  1.00 28.26  ? 236  VAL A C   1 
ATOM   1842 O  O   . VAL A 1 236 ? -6.522  14.780  27.231  1.00 25.77  ? 236  VAL A O   1 
ATOM   1843 C  CB  . VAL A 1 236 ? -3.195  14.144  27.171  1.00 26.97  ? 236  VAL A CB  1 
ATOM   1844 C  CG1 . VAL A 1 236 ? -2.113  13.078  27.288  1.00 29.16  ? 236  VAL A CG1 1 
ATOM   1845 C  CG2 . VAL A 1 236 ? -3.463  14.474  25.702  1.00 28.86  ? 236  VAL A CG2 1 
ATOM   1846 N  N   . SER A 1 237 ? -5.233  15.805  28.768  1.00 27.79  ? 237  SER A N   1 
ATOM   1847 C  CA  . SER A 1 237 ? -6.051  17.013  28.806  1.00 28.75  ? 237  SER A CA  1 
ATOM   1848 C  C   . SER A 1 237 ? -5.773  17.881  27.577  1.00 28.55  ? 237  SER A C   1 
ATOM   1849 O  O   . SER A 1 237 ? -4.779  17.694  26.872  1.00 27.81  ? 237  SER A O   1 
ATOM   1850 C  CB  . SER A 1 237 ? -5.754  17.819  30.064  1.00 34.27  ? 237  SER A CB  1 
ATOM   1851 O  OG  . SER A 1 237 ? -4.417  18.298  30.023  1.00 29.29  ? 237  SER A OG  1 
ATOM   1852 N  N   . VAL A 1 238 ? -6.645  18.870  27.335  1.00 30.47  ? 238  VAL A N   1 
ATOM   1853 C  CA  . VAL A 1 238 ? -6.397  19.773  26.208  1.00 33.64  ? 238  VAL A CA  1 
ATOM   1854 C  C   . VAL A 1 238 ? -5.125  20.573  26.445  1.00 33.49  ? 238  VAL A C   1 
ATOM   1855 O  O   . VAL A 1 238 ? -4.387  20.879  25.498  1.00 32.20  ? 238  VAL A O   1 
ATOM   1856 C  CB  . VAL A 1 238 ? -7.601  20.708  25.927  1.00 35.96  ? 238  VAL A CB  1 
ATOM   1857 C  CG1 . VAL A 1 238 ? -8.823  19.918  25.466  1.00 33.11  ? 238  VAL A CG1 1 
ATOM   1858 C  CG2 . VAL A 1 238 ? -7.929  21.562  27.126  1.00 35.85  ? 238  VAL A CG2 1 
ATOM   1859 N  N   . ALA A 1 239 ? -4.831  20.909  27.701  1.00 30.77  ? 239  ALA A N   1 
ATOM   1860 C  CA  . ALA A 1 239 ? -3.604  21.643  27.986  1.00 30.07  ? 239  ALA A CA  1 
ATOM   1861 C  C   . ALA A 1 239 ? -2.371  20.797  27.689  1.00 28.84  ? 239  ALA A C   1 
ATOM   1862 O  O   . ALA A 1 239 ? -1.391  21.298  27.128  1.00 29.56  ? 239  ALA A O   1 
ATOM   1863 C  CB  . ALA A 1 239 ? -3.595  22.107  29.444  1.00 33.78  ? 239  ALA A CB  1 
ATOM   1864 N  N   . GLU A 1 240 ? -2.390  19.519  28.079  1.00 31.28  ? 240  GLU A N   1 
ATOM   1865 C  CA  . GLU A 1 240 ? -1.229  18.667  27.850  1.00 30.67  ? 240  GLU A CA  1 
ATOM   1866 C  C   . GLU A 1 240 ? -1.071  18.341  26.372  1.00 25.38  ? 240  GLU A C   1 
ATOM   1867 O  O   . GLU A 1 240 ? 0.050   18.308  25.855  1.00 26.10  ? 240  GLU A O   1 
ATOM   1868 C  CB  . GLU A 1 240 ? -1.330  17.385  28.682  1.00 27.25  ? 240  GLU A CB  1 
ATOM   1869 C  CG  . GLU A 1 240 ? -0.181  16.378  28.481  1.00 27.90  ? 240  GLU A CG  1 
ATOM   1870 C  CD  . GLU A 1 240 ? 1.215   16.928  28.836  1.00 30.80  ? 240  GLU A CD  1 
ATOM   1871 O  OE1 . GLU A 1 240 ? 1.316   18.013  29.444  1.00 34.78  ? 240  GLU A OE1 1 
ATOM   1872 O  OE2 . GLU A 1 240 ? 2.222   16.259  28.510  1.00 28.55  ? 240  GLU A OE2 1 
ATOM   1873 N  N   . GLY A 1 241 ? -2.177  18.083  25.671  1.00 29.19  ? 241  GLY A N   1 
ATOM   1874 C  CA  . GLY A 1 241 ? -2.075  17.912  24.233  1.00 24.37  ? 241  GLY A CA  1 
ATOM   1875 C  C   . GLY A 1 241 ? -1.505  19.143  23.560  1.00 26.73  ? 241  GLY A C   1 
ATOM   1876 O  O   . GLY A 1 241 ? -0.660  19.042  22.667  1.00 27.91  ? 241  GLY A O   1 
ATOM   1877 N  N   . ARG A 1 242 ? -1.937  20.326  24.001  1.00 27.89  ? 242  ARG A N   1 
ATOM   1878 C  CA  . ARG A 1 242 ? -1.409  21.556  23.421  1.00 30.33  ? 242  ARG A CA  1 
ATOM   1879 C  C   . ARG A 1 242 ? 0.079   21.697  23.716  1.00 30.28  ? 242  ARG A C   1 
ATOM   1880 O  O   . ARG A 1 242 ? 0.864   22.077  22.840  1.00 27.25  ? 242  ARG A O   1 
ATOM   1881 C  CB  . ARG A 1 242 ? -2.190  22.759  23.954  1.00 31.02  ? 242  ARG A CB  1 
ATOM   1882 C  CG  . ARG A 1 242 ? -1.604  24.106  23.556  1.00 33.13  ? 242  ARG A CG  1 
ATOM   1883 C  CD  . ARG A 1 242 ? -2.610  25.243  23.755  1.00 35.62  ? 242  ARG A CD  1 
ATOM   1884 N  NE  . ARG A 1 242 ? -3.707  25.204  22.791  1.00 35.07  ? 242  ARG A NE  1 
ATOM   1885 C  CZ  . ARG A 1 242 ? -3.641  25.725  21.572  1.00 32.79  ? 242  ARG A CZ  1 
ATOM   1886 N  NH1 . ARG A 1 242 ? -2.528  26.321  21.161  1.00 32.87  ? 242  ARG A NH1 1 
ATOM   1887 N  NH2 . ARG A 1 242 ? -4.683  25.648  20.763  1.00 34.34  ? 242  ARG A NH2 1 
ATOM   1888 N  N   . ARG A 1 243 ? 0.491   21.372  24.945  1.00 28.23  ? 243  ARG A N   1 
ATOM   1889 C  CA  . ARG A 1 243 ? 1.911   21.436  25.286  1.00 27.86  ? 243  ARG A CA  1 
ATOM   1890 C  C   . ARG A 1 243 ? 2.733   20.506  24.407  1.00 26.61  ? 243  ARG A C   1 
ATOM   1891 O  O   . ARG A 1 243 ? 3.809   20.880  23.931  1.00 28.79  ? 243  ARG A O   1 
ATOM   1892 C  CB  . ARG A 1 243 ? 2.119   21.093  26.765  1.00 26.99  ? 243  ARG A CB  1 
ATOM   1893 C  CG  . ARG A 1 243 ? 3.558   21.299  27.251  1.00 33.79  ? 243  ARG A CG  1 
ATOM   1894 C  CD  . ARG A 1 243 ? 3.829   20.573  28.574  1.00 36.80  ? 243  ARG A CD  1 
ATOM   1895 N  NE  . ARG A 1 243 ? 3.879   19.120  28.413  1.00 34.56  ? 243  ARG A NE  1 
ATOM   1896 C  CZ  . ARG A 1 243 ? 4.872   18.461  27.822  1.00 36.64  ? 243  ARG A CZ  1 
ATOM   1897 N  NH1 . ARG A 1 243 ? 5.926   19.113  27.336  1.00 31.89  ? 243  ARG A NH1 1 
ATOM   1898 N  NH2 . ARG A 1 243 ? 4.814   17.143  27.717  1.00 37.61  ? 243  ARG A NH2 1 
ATOM   1899 N  N   . ARG A 1 244 ? 2.254   19.285  24.186  1.00 26.76  ? 244  ARG A N   1 
ATOM   1900 C  CA  . ARG A 1 244 ? 3.022   18.350  23.370  1.00 25.67  ? 244  ARG A CA  1 
ATOM   1901 C  C   . ARG A 1 244 ? 3.073   18.773  21.905  1.00 26.33  ? 244  ARG A C   1 
ATOM   1902 O  O   . ARG A 1 244 ? 4.074   18.511  21.223  1.00 27.47  ? 244  ARG A O   1 
ATOM   1903 C  CB  . ARG A 1 244 ? 2.439   16.945  23.515  1.00 27.97  ? 244  ARG A CB  1 
ATOM   1904 C  CG  . ARG A 1 244 ? 2.483   16.426  24.966  1.00 25.11  ? 244  ARG A CG  1 
ATOM   1905 C  CD  . ARG A 1 244 ? 2.001   14.994  25.054  1.00 25.89  ? 244  ARG A CD  1 
ATOM   1906 N  NE  . ARG A 1 244 ? 1.989   14.522  26.440  1.00 24.12  ? 244  ARG A NE  1 
ATOM   1907 C  CZ  . ARG A 1 244 ? 1.664   13.282  26.791  1.00 28.31  ? 244  ARG A CZ  1 
ATOM   1908 N  NH1 . ARG A 1 244 ? 1.338   12.404  25.848  1.00 22.66  ? 244  ARG A NH1 1 
ATOM   1909 N  NH2 . ARG A 1 244 ? 1.669   12.926  28.078  1.00 24.29  ? 244  ARG A NH2 1 
ATOM   1910 N  N   . ALA A 1 245 ? 2.010   19.410  21.399  1.00 26.23  ? 245  ALA A N   1 
ATOM   1911 C  CA  . ALA A 1 245 ? 2.027   19.868  20.011  1.00 24.85  ? 245  ALA A CA  1 
ATOM   1912 C  C   . ALA A 1 245 ? 2.992   21.032  19.834  1.00 30.02  ? 245  ALA A C   1 
ATOM   1913 O  O   . ALA A 1 245 ? 3.759   21.069  18.866  1.00 28.06  ? 245  ALA A O   1 
ATOM   1914 C  CB  . ALA A 1 245 ? 0.621   20.262  19.562  1.00 25.46  ? 245  ALA A CB  1 
ATOM   1915 N  N   . VAL A 1 246 ? 2.980   21.982  20.771  1.00 29.05  ? 246  VAL A N   1 
ATOM   1916 C  CA  . VAL A 1 246 ? 3.943   23.080  20.740  1.00 30.58  ? 246  VAL A CA  1 
ATOM   1917 C  C   . VAL A 1 246 ? 5.374   22.545  20.823  1.00 33.24  ? 246  VAL A C   1 
ATOM   1918 O  O   . VAL A 1 246 ? 6.259   22.975  20.070  1.00 34.07  ? 246  VAL A O   1 
ATOM   1919 C  CB  . VAL A 1 246 ? 3.622   24.076  21.875  1.00 32.15  ? 246  VAL A CB  1 
ATOM   1920 C  CG1 . VAL A 1 246 ? 4.751   25.093  22.061  1.00 33.56  ? 246  VAL A CG1 1 
ATOM   1921 C  CG2 . VAL A 1 246 ? 2.302   24.779  21.597  1.00 31.47  ? 246  VAL A CG2 1 
ATOM   1922 N  N   . GLU A 1 247 ? 5.619   21.580  21.720  1.00 31.87  ? 247  GLU A N   1 
ATOM   1923 C  CA  . GLU A 1 247 ? 6.957   21.003  21.854  1.00 34.70  ? 247  GLU A CA  1 
ATOM   1924 C  C   . GLU A 1 247 ? 7.369   20.224  20.606  1.00 31.15  ? 247  GLU A C   1 
ATOM   1925 O  O   . GLU A 1 247 ? 8.559   20.167  20.282  1.00 28.31  ? 247  GLU A O   1 
ATOM   1926 C  CB  . GLU A 1 247 ? 7.016   20.107  23.095  1.00 32.99  ? 247  GLU A CB  1 
ATOM   1927 C  CG  . GLU A 1 247 ? 8.381   19.482  23.416  1.00 33.58  ? 247  GLU A CG  1 
ATOM   1928 C  CD  . GLU A 1 247 ? 9.470   20.511  23.737  1.00 41.41  ? 247  GLU A CD  1 
ATOM   1929 O  OE1 . GLU A 1 247 ? 9.133   21.620  24.205  1.00 41.03  ? 247  GLU A OE1 1 
ATOM   1930 O  OE2 . GLU A 1 247 ? 10.666  20.190  23.554  1.00 43.72  ? 247  GLU A OE2 1 
ATOM   1931 N  N   . LEU A 1 248 ? 6.417   19.610  19.900  1.00 30.16  ? 248  LEU A N   1 
ATOM   1932 C  CA  . LEU A 1 248 ? 6.764   18.979  18.629  1.00 28.23  ? 248  LEU A CA  1 
ATOM   1933 C  C   . LEU A 1 248 ? 7.268   20.017  17.637  1.00 30.32  ? 248  LEU A C   1 
ATOM   1934 O  O   . LEU A 1 248 ? 8.277   19.801  16.953  1.00 30.59  ? 248  LEU A O   1 
ATOM   1935 C  CB  . LEU A 1 248 ? 5.560   18.232  18.049  1.00 23.23  ? 248  LEU A CB  1 
ATOM   1936 C  CG  . LEU A 1 248 ? 5.884   17.345  16.851  1.00 26.31  ? 248  LEU A CG  1 
ATOM   1937 C  CD1 . LEU A 1 248 ? 6.625   16.092  17.289  1.00 28.22  ? 248  LEU A CD1 1 
ATOM   1938 C  CD2 . LEU A 1 248 ? 4.623   16.996  16.056  1.00 30.18  ? 248  LEU A CD2 1 
ATOM   1939 N  N   . GLY A 1 249 ? 6.576   21.153  17.549  1.00 30.48  ? 249  GLY A N   1 
ATOM   1940 C  CA  . GLY A 1 249 ? 7.048   22.229  16.698  1.00 28.75  ? 249  GLY A CA  1 
ATOM   1941 C  C   . GLY A 1 249 ? 8.407   22.746  17.127  1.00 33.25  ? 249  GLY A C   1 
ATOM   1942 O  O   . GLY A 1 249 ? 9.268   23.016  16.287  1.00 33.24  ? 249  GLY A O   1 
ATOM   1943 N  N   . ARG A 1 250 ? 8.621   22.873  18.441  1.00 30.32  ? 250  ARG A N   1 
ATOM   1944 C  CA  . ARG A 1 250 ? 9.911   23.337  18.949  1.00 34.89  ? 250  ARG A CA  1 
ATOM   1945 C  C   . ARG A 1 250 ? 11.034  22.400  18.529  1.00 34.37  ? 250  ARG A C   1 
ATOM   1946 O  O   . ARG A 1 250 ? 12.114  22.852  18.124  1.00 38.52  ? 250  ARG A O   1 
ATOM   1947 C  CB  . ARG A 1 250 ? 9.857   23.468  20.472  1.00 33.17  ? 250  ARG A CB  1 
ATOM   1948 C  CG  . ARG A 1 250 ? 11.129  24.019  21.117  1.00 38.81  ? 250  ARG A CG  1 
ATOM   1949 C  CD  . ARG A 1 250 ? 10.940  24.267  22.625  1.00 40.98  ? 250  ARG A CD  1 
ATOM   1950 N  NE  . ARG A 1 250 ? 9.998   25.360  22.902  1.00 43.95  ? 250  ARG A NE  1 
ATOM   1951 C  CZ  . ARG A 1 250 ? 8.776   25.215  23.419  1.00 46.80  ? 250  ARG A CZ  1 
ATOM   1952 N  NH1 . ARG A 1 250 ? 8.301   24.010  23.730  1.00 44.93  ? 250  ARG A NH1 1 
ATOM   1953 N  NH2 . ARG A 1 250 ? 8.019   26.287  23.631  1.00 41.56  ? 250  ARG A NH2 1 
ATOM   1954 N  N   . ASN A 1 251 ? 10.793  21.088  18.596  1.00 30.26  ? 251  ASN A N   1 
ATOM   1955 C  CA  . ASN A 1 251 ? 11.802  20.131  18.153  1.00 33.30  ? 251  ASN A CA  1 
ATOM   1956 C  C   . ASN A 1 251 ? 12.112  20.266  16.671  1.00 33.65  ? 251  ASN A C   1 
ATOM   1957 O  O   . ASN A 1 251 ? 13.178  19.827  16.229  1.00 38.05  ? 251  ASN A O   1 
ATOM   1958 C  CB  . ASN A 1 251 ? 11.345  18.702  18.442  1.00 29.13  ? 251  ASN A CB  1 
ATOM   1959 C  CG  . ASN A 1 251 ? 11.708  18.243  19.842  1.00 36.18  ? 251  ASN A CG  1 
ATOM   1960 O  OD1 . ASN A 1 251 ? 12.733  17.585  20.050  1.00 35.01  ? 251  ASN A OD1 1 
ATOM   1961 N  ND2 . ASN A 1 251 ? 10.868  18.592  20.813  1.00 31.70  ? 251  ASN A ND2 1 
ATOM   1962 N  N   . LEU A 1 252 ? 11.205  20.852  15.892  1.00 33.52  ? 252  LEU A N   1 
ATOM   1963 C  CA  . LEU A 1 252 ? 11.378  20.957  14.451  1.00 38.47  ? 252  LEU A CA  1 
ATOM   1964 C  C   . LEU A 1 252 ? 11.592  22.399  13.993  1.00 38.16  ? 252  LEU A C   1 
ATOM   1965 O  O   . LEU A 1 252 ? 11.402  22.704  12.809  1.00 35.91  ? 252  LEU A O   1 
ATOM   1966 C  CB  . LEU A 1 252 ? 10.176  20.326  13.741  1.00 35.65  ? 252  LEU A CB  1 
ATOM   1967 C  CG  . LEU A 1 252 ? 10.024  18.821  13.991  1.00 31.99  ? 252  LEU A CG  1 
ATOM   1968 C  CD1 . LEU A 1 252 ? 8.620   18.350  13.650  1.00 32.92  ? 252  LEU A CD1 1 
ATOM   1969 C  CD2 . LEU A 1 252 ? 11.073  18.018  13.215  1.00 34.80  ? 252  LEU A CD2 1 
ATOM   1970 N  N   . ASN A 1 253 ? 11.980  23.290  14.909  1.00 34.26  ? 253  ASN A N   1 
ATOM   1971 C  CA  . ASN A 1 253 ? 12.279  24.688  14.587  1.00 38.65  ? 253  ASN A CA  1 
ATOM   1972 C  C   . ASN A 1 253 ? 11.082  25.382  13.945  1.00 42.54  ? 253  ASN A C   1 
ATOM   1973 O  O   . ASN A 1 253 ? 11.229  26.151  12.993  1.00 34.99  ? 253  ASN A O   1 
ATOM   1974 C  CB  . ASN A 1 253 ? 13.509  24.803  13.682  1.00 45.20  ? 253  ASN A CB  1 
ATOM   1975 C  CG  . ASN A 1 253 ? 14.774  24.326  14.361  1.00 51.68  ? 253  ASN A CG  1 
ATOM   1976 O  OD1 . ASN A 1 253 ? 15.068  24.716  15.494  1.00 55.40  ? 253  ASN A OD1 1 
ATOM   1977 N  ND2 . ASN A 1 253 ? 15.537  23.484  13.671  1.00 52.92  ? 253  ASN A ND2 1 
ATOM   1978 N  N   . CYS A 1 254 ? 9.891   25.112  14.470  1.00 34.08  ? 254  CYS A N   1 
ATOM   1979 C  CA  . CYS A 1 254 ? 8.674   25.690  13.929  1.00 36.14  ? 254  CYS A CA  1 
ATOM   1980 C  C   . CYS A 1 254 ? 8.381   27.037  14.575  1.00 39.46  ? 254  CYS A C   1 
ATOM   1981 O  O   . CYS A 1 254 ? 8.712   27.278  15.739  1.00 39.51  ? 254  CYS A O   1 
ATOM   1982 C  CB  . CYS A 1 254 ? 7.487   24.748  14.149  1.00 32.99  ? 254  CYS A CB  1 
ATOM   1983 S  SG  . CYS A 1 254 ? 7.418   23.401  12.962  1.00 36.06  ? 254  CYS A SG  1 
ATOM   1984 N  N   . ASN A 1 255 ? 7.758   27.920  13.798  1.00 40.93  ? 255  ASN A N   1 
ATOM   1985 C  CA  . ASN A 1 255 ? 7.158   29.126  14.354  1.00 40.94  ? 255  ASN A CA  1 
ATOM   1986 C  C   . ASN A 1 255 ? 6.076   28.744  15.359  1.00 42.41  ? 255  ASN A C   1 
ATOM   1987 O  O   . ASN A 1 255 ? 5.140   28.014  15.021  1.00 41.63  ? 255  ASN A O   1 
ATOM   1988 C  CB  . ASN A 1 255 ? 6.573   29.970  13.219  1.00 45.28  ? 255  ASN A CB  1 
ATOM   1989 C  CG  . ASN A 1 255 ? 6.221   31.386  13.651  1.00 50.42  ? 255  ASN A CG  1 
ATOM   1990 O  OD1 . ASN A 1 255 ? 5.635   31.603  14.713  1.00 47.56  ? 255  ASN A OD1 1 
ATOM   1991 N  ND2 . ASN A 1 255 ? 6.566   32.358  12.812  1.00 56.56  ? 255  ASN A ND2 1 
ATOM   1992 N  N   . LEU A 1 256 ? 6.194   29.238  16.595  1.00 39.26  ? 256  LEU A N   1 
ATOM   1993 C  CA  . LEU A 1 256 ? 5.275   28.859  17.663  1.00 39.85  ? 256  LEU A CA  1 
ATOM   1994 C  C   . LEU A 1 256 ? 4.292   29.963  18.037  1.00 39.11  ? 256  LEU A C   1 
ATOM   1995 O  O   . LEU A 1 256 ? 3.527   29.795  18.991  1.00 41.31  ? 256  LEU A O   1 
ATOM   1996 C  CB  . LEU A 1 256 ? 6.055   28.424  18.909  1.00 39.21  ? 256  LEU A CB  1 
ATOM   1997 C  CG  . LEU A 1 256 ? 7.106   27.325  18.721  1.00 41.18  ? 256  LEU A CG  1 
ATOM   1998 C  CD1 . LEU A 1 256 ? 7.759   26.951  20.052  1.00 38.42  ? 256  LEU A CD1 1 
ATOM   1999 C  CD2 . LEU A 1 256 ? 6.483   26.104  18.051  1.00 39.42  ? 256  LEU A CD2 1 
ATOM   2000 N  N   . ASN A 1 257 ? 4.279   31.079  17.305  1.00 40.39  ? 257  ASN A N   1 
ATOM   2001 C  CA  . ASN A 1 257 ? 3.489   32.240  17.718  1.00 41.23  ? 257  ASN A CA  1 
ATOM   2002 C  C   . ASN A 1 257 ? 1.987   31.975  17.687  1.00 41.22  ? 257  ASN A C   1 
ATOM   2003 O  O   . ASN A 1 257 ? 1.234   32.611  18.431  1.00 42.82  ? 257  ASN A O   1 
ATOM   2004 C  CB  . ASN A 1 257 ? 3.817   33.439  16.826  1.00 49.19  ? 257  ASN A CB  1 
ATOM   2005 C  CG  . ASN A 1 257 ? 5.193   34.006  17.097  1.00 55.38  ? 257  ASN A CG  1 
ATOM   2006 O  OD1 . ASN A 1 257 ? 5.847   33.637  18.076  1.00 54.23  ? 257  ASN A OD1 1 
ATOM   2007 N  ND2 . ASN A 1 257 ? 5.646   34.901  16.225  1.00 56.18  ? 257  ASN A ND2 1 
ATOM   2008 N  N   . SER A 1 258 ? 1.525   31.069  16.831  1.00 36.19  ? 258  SER A N   1 
ATOM   2009 C  CA  . SER A 1 258 ? 0.092   30.845  16.695  1.00 41.62  ? 258  SER A CA  1 
ATOM   2010 C  C   . SER A 1 258 ? -0.163  29.435  16.184  1.00 35.48  ? 258  SER A C   1 
ATOM   2011 O  O   . SER A 1 258 ? 0.699   28.815  15.552  1.00 34.13  ? 258  SER A O   1 
ATOM   2012 C  CB  . SER A 1 258 ? -0.554  31.867  15.746  1.00 38.15  ? 258  SER A CB  1 
ATOM   2013 O  OG  . SER A 1 258 ? -0.186  31.602  14.399  1.00 38.10  ? 258  SER A OG  1 
ATOM   2014 N  N   . ASP A 1 259 ? -1.372  28.943  16.466  1.00 34.29  ? 259  ASP A N   1 
ATOM   2015 C  CA  . ASP A 1 259 ? -1.789  27.637  15.969  1.00 33.95  ? 259  ASP A CA  1 
ATOM   2016 C  C   . ASP A 1 259 ? -1.631  27.547  14.453  1.00 31.31  ? 259  ASP A C   1 
ATOM   2017 O  O   . ASP A 1 259 ? -1.040  26.595  13.935  1.00 32.85  ? 259  ASP A O   1 
ATOM   2018 C  CB  . ASP A 1 259 ? -3.236  27.359  16.375  1.00 32.30  ? 259  ASP A CB  1 
ATOM   2019 C  CG  . ASP A 1 259 ? -3.391  27.108  17.874  1.00 38.52  ? 259  ASP A CG  1 
ATOM   2020 O  OD1 . ASP A 1 259 ? -2.363  26.962  18.571  1.00 32.29  ? 259  ASP A OD1 1 
ATOM   2021 O  OD2 . ASP A 1 259 ? -4.545  27.045  18.349  1.00 34.91  ? 259  ASP A OD2 1 
ATOM   2022 N  N   . GLU A 1 260 ? -2.140  28.548  13.726  1.00 34.82  ? 260  GLU A N   1 
ATOM   2023 C  CA  . GLU A 1 260 ? -2.051  28.519  12.267  1.00 34.38  ? 260  GLU A CA  1 
ATOM   2024 C  C   . GLU A 1 260 ? -0.603  28.452  11.792  1.00 33.92  ? 260  GLU A C   1 
ATOM   2025 O  O   . GLU A 1 260 ? -0.280  27.681  10.883  1.00 34.94  ? 260  GLU A O   1 
ATOM   2026 C  CB  . GLU A 1 260 ? -2.757  29.737  11.670  1.00 38.16  ? 260  GLU A CB  1 
ATOM   2027 C  CG  . GLU A 1 260 ? -4.274  29.555  11.549  1.00 42.66  ? 260  GLU A CG  1 
ATOM   2028 C  CD  . GLU A 1 260 ? -4.650  28.547  10.477  0.68 39.54  ? 260  GLU A CD  1 
ATOM   2029 O  OE1 . GLU A 1 260 ? -4.048  28.585  9.383   1.00 38.55  ? 260  GLU A OE1 1 
ATOM   2030 O  OE2 . GLU A 1 260 ? -5.531  27.700  10.738  0.94 36.46  ? 260  GLU A OE2 1 
ATOM   2031 N  N   . GLU A 1 261 ? 0.286   29.246  12.398  1.00 33.25  ? 261  GLU A N   1 
ATOM   2032 C  CA  . GLU A 1 261 ? 1.687   29.227  11.985  1.00 35.84  ? 261  GLU A CA  1 
ATOM   2033 C  C   . GLU A 1 261 ? 2.362   27.920  12.376  1.00 35.72  ? 261  GLU A C   1 
ATOM   2034 O  O   . GLU A 1 261 ? 3.176   27.384  11.613  1.00 31.47  ? 261  GLU A O   1 
ATOM   2035 C  CB  . GLU A 1 261 ? 2.434   30.410  12.597  1.00 40.26  ? 261  GLU A CB  1 
ATOM   2036 C  CG  . GLU A 1 261 ? 2.227   31.722  11.866  1.00 43.44  ? 261  GLU A CG  1 
ATOM   2037 C  CD  . GLU A 1 261 ? 2.642   32.911  12.706  1.00 47.94  ? 261  GLU A CD  1 
ATOM   2038 O  OE1 . GLU A 1 261 ? 2.247   32.962  13.890  1.00 52.04  ? 261  GLU A OE1 1 
ATOM   2039 O  OE2 . GLU A 1 261 ? 3.360   33.791  12.185  1.00 57.34  ? 261  GLU A OE2 1 
ATOM   2040 N  N   . LEU A 1 262 ? 2.050   27.403  13.572  1.00 32.45  ? 262  LEU A N   1 
ATOM   2041 C  CA  . LEU A 1 262 ? 2.592   26.113  13.988  1.00 33.90  ? 262  LEU A CA  1 
ATOM   2042 C  C   . LEU A 1 262 ? 2.110   25.001  13.068  1.00 30.00  ? 262  LEU A C   1 
ATOM   2043 O  O   . LEU A 1 262 ? 2.903   24.184  12.586  1.00 30.06  ? 262  LEU A O   1 
ATOM   2044 C  CB  . LEU A 1 262 ? 2.193   25.815  15.437  1.00 27.88  ? 262  LEU A CB  1 
ATOM   2045 C  CG  . LEU A 1 262 ? 2.537   24.415  15.953  1.00 29.87  ? 262  LEU A CG  1 
ATOM   2046 C  CD1 . LEU A 1 262 ? 4.029   24.119  15.826  1.00 30.03  ? 262  LEU A CD1 1 
ATOM   2047 C  CD2 . LEU A 1 262 ? 2.070   24.222  17.408  1.00 26.89  ? 262  LEU A CD2 1 
ATOM   2048 N  N   . ILE A 1 263 ? 0.800   24.958  12.815  1.00 28.95  ? 263  ILE A N   1 
ATOM   2049 C  CA  . ILE A 1 263 ? 0.237   23.926  11.950  1.00 31.36  ? 263  ILE A CA  1 
ATOM   2050 C  C   . ILE A 1 263 ? 0.802   24.031  10.536  1.00 30.74  ? 263  ILE A C   1 
ATOM   2051 O  O   . ILE A 1 263 ? 1.150   23.018  9.918   1.00 28.04  ? 263  ILE A O   1 
ATOM   2052 C  CB  . ILE A 1 263 ? -1.299  24.012  11.963  1.00 30.53  ? 263  ILE A CB  1 
ATOM   2053 C  CG1 . ILE A 1 263 ? -1.825  23.650  13.359  1.00 29.35  ? 263  ILE A CG1 1 
ATOM   2054 C  CG2 . ILE A 1 263 ? -1.886  23.103  10.903  1.00 30.24  ? 263  ILE A CG2 1 
ATOM   2055 C  CD1 . ILE A 1 263 ? -3.298  23.965  13.568  1.00 28.38  ? 263  ILE A CD1 1 
ATOM   2056 N  N   . HIS A 1 264 ? 0.898   25.253  9.997   1.00 30.45  ? 264  HIS A N   1 
ATOM   2057 C  CA  . HIS A 1 264 ? 1.475   25.415  8.663   1.00 34.81  ? 264  HIS A CA  1 
ATOM   2058 C  C   . HIS A 1 264 ? 2.888   24.845  8.614   1.00 33.18  ? 264  HIS A C   1 
ATOM   2059 O  O   . HIS A 1 264 ? 3.254   24.152  7.657   1.00 33.90  ? 264  HIS A O   1 
ATOM   2060 C  CB  . HIS A 1 264 ? 1.460   26.891  8.254   1.00 35.61  ? 264  HIS A CB  1 
ATOM   2061 C  CG  . HIS A 1 264 ? 1.861   27.134  6.829   1.00 43.92  ? 264  HIS A CG  1 
ATOM   2062 N  ND1 . HIS A 1 264 ? 3.171   27.066  6.399   1.00 43.92  ? 264  HIS A ND1 1 
ATOM   2063 C  CD2 . HIS A 1 264 ? 1.125   27.450  5.737   1.00 43.18  ? 264  HIS A CD2 1 
ATOM   2064 C  CE1 . HIS A 1 264 ? 3.222   27.325  5.105   1.00 46.14  ? 264  HIS A CE1 1 
ATOM   2065 N  NE2 . HIS A 1 264 ? 1.994   27.561  4.679   1.00 45.98  ? 264  HIS A NE2 1 
ATOM   2066 N  N   . CYS A 1 265 ? 3.679   25.087  9.662   1.00 32.89  ? 265  CYS A N   1 
ATOM   2067 C  CA  . CYS A 1 265 ? 5.033   24.544  9.718   1.00 32.69  ? 265  CYS A CA  1 
ATOM   2068 C  C   . CYS A 1 265 ? 5.021   23.020  9.724   1.00 32.60  ? 265  CYS A C   1 
ATOM   2069 O  O   . CYS A 1 265 ? 5.742   22.377  8.949   1.00 32.71  ? 265  CYS A O   1 
ATOM   2070 C  CB  . CYS A 1 265 ? 5.763   25.068  10.956  1.00 35.30  ? 265  CYS A CB  1 
ATOM   2071 S  SG  . CYS A 1 265 ? 7.416   24.335  11.142  1.00 41.04  ? 265  CYS A SG  1 
ATOM   2072 N  N   . LEU A 1 266 ? 4.203   22.423  10.599  1.00 30.66  ? 266  LEU A N   1 
ATOM   2073 C  CA  . LEU A 1 266 ? 4.182   20.968  10.715  1.00 29.70  ? 266  LEU A CA  1 
ATOM   2074 C  C   . LEU A 1 266 ? 3.680   20.305  9.437   1.00 32.22  ? 266  LEU A C   1 
ATOM   2075 O  O   . LEU A 1 266 ? 4.104   19.190  9.114   1.00 32.87  ? 266  LEU A O   1 
ATOM   2076 C  CB  . LEU A 1 266 ? 3.325   20.547  11.912  1.00 30.48  ? 266  LEU A CB  1 
ATOM   2077 C  CG  . LEU A 1 266 ? 3.899   20.935  13.280  1.00 27.80  ? 266  LEU A CG  1 
ATOM   2078 C  CD1 . LEU A 1 266 ? 2.869   20.789  14.388  1.00 29.23  ? 266  LEU A CD1 1 
ATOM   2079 C  CD2 . LEU A 1 266 ? 5.159   20.125  13.585  1.00 27.59  ? 266  LEU A CD2 1 
ATOM   2080 N  N   . ARG A 1 267 ? 2.794   20.969  8.685   1.00 29.50  ? 267  ARG A N   1 
ATOM   2081 C  CA  . ARG A 1 267 ? 2.311   20.373  7.441   1.00 27.82  ? 267  ARG A CA  1 
ATOM   2082 C  C   . ARG A 1 267 ? 3.370   20.367  6.346   1.00 31.59  ? 267  ARG A C   1 
ATOM   2083 O  O   . ARG A 1 267 ? 3.240   19.606  5.378   1.00 30.91  ? 267  ARG A O   1 
ATOM   2084 C  CB  . ARG A 1 267 ? 1.057   21.102  6.964   1.00 29.42  ? 267  ARG A CB  1 
ATOM   2085 C  CG  . ARG A 1 267 ? -0.183  20.725  7.770   1.00 27.28  ? 267  ARG A CG  1 
ATOM   2086 C  CD  . ARG A 1 267 ? -1.402  21.525  7.351   1.00 31.23  ? 267  ARG A CD  1 
ATOM   2087 N  NE  . ARG A 1 267 ? -2.602  21.066  8.048   1.00 29.05  ? 267  ARG A NE  1 
ATOM   2088 C  CZ  . ARG A 1 267 ? -3.716  21.780  8.170   1.00 30.29  ? 267  ARG A CZ  1 
ATOM   2089 N  NH1 . ARG A 1 267 ? -3.790  22.995  7.636   1.00 31.51  ? 267  ARG A NH1 1 
ATOM   2090 N  NH2 . ARG A 1 267 ? -4.754  21.282  8.830   1.00 29.03  ? 267  ARG A NH2 1 
ATOM   2091 N  N   . GLU A 1 268 ? 4.418   21.186  6.479   1.00 31.68  ? 268  GLU A N   1 
ATOM   2092 C  CA  . GLU A 1 268 ? 5.503   21.187  5.501   1.00 36.51  ? 268  GLU A CA  1 
ATOM   2093 C  C   . GLU A 1 268 ? 6.501   20.060  5.729   1.00 34.54  ? 268  GLU A C   1 
ATOM   2094 O  O   . GLU A 1 268 ? 7.225   19.686  4.798   1.00 34.30  ? 268  GLU A O   1 
ATOM   2095 C  CB  . GLU A 1 268 ? 6.232   22.537  5.523   1.00 39.15  ? 268  GLU A CB  1 
ATOM   2096 C  CG  . GLU A 1 268 ? 5.419   23.685  4.918   1.00 46.73  ? 268  GLU A CG  1 
ATOM   2097 C  CD  . GLU A 1 268 ? 4.902   23.387  3.506   1.00 55.01  ? 268  GLU A CD  1 
ATOM   2098 O  OE1 . GLU A 1 268 ? 5.590   22.674  2.736   1.00 55.77  ? 268  GLU A OE1 1 
ATOM   2099 O  OE2 . GLU A 1 268 ? 3.793   23.864  3.172   1.00 60.26  ? 268  GLU A OE2 1 
ATOM   2100 N  N   . LYS A 1 269 ? 6.543   19.497  6.932   1.00 32.84  ? 269  LYS A N   1 
ATOM   2101 C  CA  . LYS A 1 269 ? 7.509   18.456  7.228   1.00 29.84  ? 269  LYS A CA  1 
ATOM   2102 C  C   . LYS A 1 269 ? 7.121   17.144  6.560   1.00 29.70  ? 269  LYS A C   1 
ATOM   2103 O  O   . LYS A 1 269 ? 5.940   16.845  6.351   1.00 28.09  ? 269  LYS A O   1 
ATOM   2104 C  CB  . LYS A 1 269 ? 7.619   18.263  8.734   1.00 30.93  ? 269  LYS A CB  1 
ATOM   2105 C  CG  . LYS A 1 269 ? 7.884   19.561  9.477   1.00 34.99  ? 269  LYS A CG  1 
ATOM   2106 C  CD  . LYS A 1 269 ? 9.212   20.194  9.044   1.00 36.04  ? 269  LYS A CD  1 
ATOM   2107 C  CE  . LYS A 1 269 ? 9.410   21.546  9.726   1.00 38.68  ? 269  LYS A CE  1 
ATOM   2108 N  NZ  . LYS A 1 269 ? 10.763  22.116  9.474   1.00 46.41  ? 269  LYS A NZ  1 
ATOM   2109 N  N   . LYS A 1 270 ? 8.132   16.360  6.213   1.00 30.85  ? 270  LYS A N   1 
ATOM   2110 C  CA  . LYS A 1 270 ? 7.868   15.008  5.759   1.00 31.14  ? 270  LYS A CA  1 
ATOM   2111 C  C   . LYS A 1 270 ? 7.449   14.143  6.950   1.00 32.40  ? 270  LYS A C   1 
ATOM   2112 O  O   . LYS A 1 270 ? 7.835   14.421  8.086   1.00 30.15  ? 270  LYS A O   1 
ATOM   2113 C  CB  . LYS A 1 270 ? 9.093   14.434  5.059   1.00 35.70  ? 270  LYS A CB  1 
ATOM   2114 C  CG  . LYS A 1 270 ? 9.926   15.510  4.334   1.00 44.31  ? 270  LYS A CG  1 
ATOM   2115 C  CD  . LYS A 1 270 ? 11.097  14.937  3.539   1.00 45.36  ? 270  LYS A CD  1 
ATOM   2116 C  CE  . LYS A 1 270 ? 12.367  14.809  4.395   1.00 55.48  ? 270  LYS A CE  1 
ATOM   2117 N  NZ  . LYS A 1 270 ? 12.778  16.090  5.046   1.00 56.13  ? 270  LYS A NZ  1 
ATOM   2118 N  N   . PRO A 1 271 ? 6.633   13.106  6.724   1.00 28.70  ? 271  PRO A N   1 
ATOM   2119 C  CA  . PRO A 1 271 ? 6.128   12.299  7.854   1.00 31.18  ? 271  PRO A CA  1 
ATOM   2120 C  C   . PRO A 1 271 ? 7.212   11.784  8.791   1.00 31.39  ? 271  PRO A C   1 
ATOM   2121 O  O   . PRO A 1 271 ? 7.084   11.899  10.018  1.00 26.34  ? 271  PRO A O   1 
ATOM   2122 C  CB  . PRO A 1 271 ? 5.394   11.158  7.139   1.00 30.03  ? 271  PRO A CB  1 
ATOM   2123 C  CG  . PRO A 1 271 ? 4.940   11.777  5.842   1.00 32.92  ? 271  PRO A CG  1 
ATOM   2124 C  CD  . PRO A 1 271 ? 6.084   12.652  5.429   1.00 30.40  ? 271  PRO A CD  1 
ATOM   2125 N  N   . GLN A 1 272 ? 8.298   11.240  8.242   1.00 30.54  ? 272  GLN A N   1 
ATOM   2126 C  CA  . GLN A 1 272 ? 9.357   10.710  9.092   1.00 29.94  ? 272  GLN A CA  1 
ATOM   2127 C  C   . GLN A 1 272 ? 10.027  11.790  9.932   1.00 31.18  ? 272  GLN A C   1 
ATOM   2128 O  O   . GLN A 1 272 ? 10.606  11.472  10.975  1.00 30.92  ? 272  GLN A O   1 
ATOM   2129 C  CB  . GLN A 1 272 ? 10.399  9.982   8.239   1.00 37.31  ? 272  GLN A CB  1 
ATOM   2130 C  CG  . GLN A 1 272 ? 11.279  9.034   9.035   1.00 38.76  ? 272  GLN A CG  1 
ATOM   2131 C  CD  . GLN A 1 272 ? 10.461  8.061   9.863   1.00 38.32  ? 272  GLN A CD  1 
ATOM   2132 O  OE1 . GLN A 1 272 ? 9.441   7.536   9.401   1.00 42.31  ? 272  GLN A OE1 1 
ATOM   2133 N  NE2 . GLN A 1 272 ? 10.903  7.811   11.091  1.00 39.97  ? 272  GLN A NE2 1 
ATOM   2134 N  N   . GLU A 1 273 ? 9.964   13.055  9.511   1.00 29.07  ? 273  GLU A N   1 
ATOM   2135 C  CA  . GLU A 1 273 ? 10.507  14.123  10.340  1.00 29.59  ? 273  GLU A CA  1 
ATOM   2136 C  C   . GLU A 1 273 ? 9.719   14.258  11.632  1.00 29.42  ? 273  GLU A C   1 
ATOM   2137 O  O   . GLU A 1 273 ? 10.301  14.494  12.700  1.00 26.14  ? 273  GLU A O   1 
ATOM   2138 C  CB  . GLU A 1 273 ? 10.495  15.451  9.590   1.00 31.59  ? 273  GLU A CB  1 
ATOM   2139 C  CG  . GLU A 1 273 ? 11.618  15.624  8.584   1.00 40.12  ? 273  GLU A CG  1 
ATOM   2140 C  CD  . GLU A 1 273 ? 11.575  16.994  7.948   1.00 38.83  ? 273  GLU A CD  1 
ATOM   2141 O  OE1 . GLU A 1 273 ? 10.790  17.174  7.002   1.00 39.68  ? 273  GLU A OE1 1 
ATOM   2142 O  OE2 . GLU A 1 273 ? 12.307  17.895  8.412   1.00 43.15  ? 273  GLU A OE2 1 
ATOM   2143 N  N   . LEU A 1 274 ? 8.386   14.134  11.549  1.00 28.91  ? 274  LEU A N   1 
ATOM   2144 C  CA  . LEU A 1 274 ? 7.567   14.164  12.760  1.00 28.06  ? 274  LEU A CA  1 
ATOM   2145 C  C   . LEU A 1 274 ? 7.836   12.945  13.626  1.00 26.80  ? 274  LEU A C   1 
ATOM   2146 O  O   . LEU A 1 274 ? 7.979   13.053  14.849  1.00 24.45  ? 274  LEU A O   1 
ATOM   2147 C  CB  . LEU A 1 274 ? 6.074   14.225  12.413  1.00 24.59  ? 274  LEU A CB  1 
ATOM   2148 C  CG  . LEU A 1 274 ? 5.581   15.276  11.423  1.00 34.68  ? 274  LEU A CG  1 
ATOM   2149 C  CD1 . LEU A 1 274 ? 4.057   15.285  11.380  1.00 31.19  ? 274  LEU A CD1 1 
ATOM   2150 C  CD2 . LEU A 1 274 ? 6.112   16.636  11.804  1.00 32.23  ? 274  LEU A CD2 1 
ATOM   2151 N  N   . ILE A 1 275 ? 7.874   11.768  13.004  1.00 27.01  ? 275  ILE A N   1 
ATOM   2152 C  CA  . ILE A 1 275 ? 8.045   10.532  13.761  1.00 27.02  ? 275  ILE A CA  1 
ATOM   2153 C  C   . ILE A 1 275 ? 9.384   10.532  14.491  1.00 29.13  ? 275  ILE A C   1 
ATOM   2154 O  O   . ILE A 1 275 ? 9.479   10.089  15.646  1.00 25.41  ? 275  ILE A O   1 
ATOM   2155 C  CB  . ILE A 1 275 ? 7.892   9.328   12.813  1.00 26.94  ? 275  ILE A CB  1 
ATOM   2156 C  CG1 . ILE A 1 275 ? 6.453   9.271   12.273  1.00 25.01  ? 275  ILE A CG1 1 
ATOM   2157 C  CG2 . ILE A 1 275 ? 8.283   8.032   13.495  1.00 26.49  ? 275  ILE A CG2 1 
ATOM   2158 C  CD1 . ILE A 1 275 ? 6.282   8.328   11.104  1.00 26.43  ? 275  ILE A CD1 1 
ATOM   2159 N  N   . ASP A 1 276 ? 10.430  11.071  13.854  1.00 26.11  ? 276  ASP A N   1 
ATOM   2160 C  CA  . ASP A 1 276 ? 11.770  11.019  14.444  1.00 27.63  ? 276  ASP A CA  1 
ATOM   2161 C  C   . ASP A 1 276 ? 11.850  11.754  15.778  1.00 28.08  ? 276  ASP A C   1 
ATOM   2162 O  O   . ASP A 1 276 ? 12.709  11.432  16.607  1.00 33.40  ? 276  ASP A O   1 
ATOM   2163 C  CB  . ASP A 1 276 ? 12.807  11.603  13.478  1.00 32.13  ? 276  ASP A CB  1 
ATOM   2164 C  CG  . ASP A 1 276 ? 13.242  10.616  12.395  1.00 36.91  ? 276  ASP A CG  1 
ATOM   2165 O  OD1 . ASP A 1 276 ? 13.029  9.391   12.544  1.00 34.78  ? 276  ASP A OD1 1 
ATOM   2166 O  OD2 . ASP A 1 276 ? 13.806  11.075  11.380  1.00 38.33  ? 276  ASP A OD2 1 
ATOM   2167 N  N   . VAL A 1 277 ? 10.979  12.737  16.016  1.00 29.80  ? 277  VAL A N   1 
ATOM   2168 C  CA  . VAL A 1 277 ? 11.010  13.512  17.257  1.00 27.22  ? 277  VAL A CA  1 
ATOM   2169 C  C   . VAL A 1 277 ? 9.779   13.251  18.123  1.00 28.40  ? 277  VAL A C   1 
ATOM   2170 O  O   . VAL A 1 277 ? 9.611   13.899  19.164  1.00 27.97  ? 277  VAL A O   1 
ATOM   2171 C  CB  . VAL A 1 277 ? 11.162  15.016  16.977  1.00 29.27  ? 277  VAL A CB  1 
ATOM   2172 C  CG1 . VAL A 1 277 ? 12.523  15.297  16.321  1.00 28.82  ? 277  VAL A CG1 1 
ATOM   2173 C  CG2 . VAL A 1 277 ? 10.025  15.496  16.087  1.00 25.74  ? 277  VAL A CG2 1 
ATOM   2174 N  N   . GLU A 1 278 ? 8.935   12.294  17.727  1.00 23.74  ? 278  GLU A N   1 
ATOM   2175 C  CA  . GLU A 1 278 ? 7.650   12.070  18.389  1.00 25.47  ? 278  GLU A CA  1 
ATOM   2176 C  C   . GLU A 1 278 ? 7.818   11.835  19.888  1.00 25.97  ? 278  GLU A C   1 
ATOM   2177 O  O   . GLU A 1 278 ? 7.076   12.388  20.706  1.00 27.07  ? 278  GLU A O   1 
ATOM   2178 C  CB  . GLU A 1 278 ? 6.958   10.872  17.742  1.00 25.11  ? 278  GLU A CB  1 
ATOM   2179 C  CG  . GLU A 1 278 ? 5.719   10.390  18.482  1.00 32.43  ? 278  GLU A CG  1 
ATOM   2180 C  CD  . GLU A 1 278 ? 5.092   9.156   17.844  1.00 29.70  ? 278  GLU A CD  1 
ATOM   2181 O  OE1 . GLU A 1 278 ? 5.306   8.915   16.639  1.00 26.69  ? 278  GLU A OE1 1 
ATOM   2182 O  OE2 . GLU A 1 278 ? 4.375   8.423   18.559  1.00 33.34  ? 278  GLU A OE2 1 
ATOM   2183 N  N   . TRP A 1 279 ? 8.781   11.000  20.261  1.00 25.06  ? 279  TRP A N   1 
ATOM   2184 C  CA  . TRP A 1 279 ? 8.948   10.624  21.659  1.00 25.08  ? 279  TRP A CA  1 
ATOM   2185 C  C   . TRP A 1 279 ? 9.532   11.743  22.505  1.00 30.31  ? 279  TRP A C   1 
ATOM   2186 O  O   . TRP A 1 279 ? 9.427   11.684  23.740  1.00 33.53  ? 279  TRP A O   1 
ATOM   2187 C  CB  . TRP A 1 279 ? 9.810   9.364   21.734  1.00 30.72  ? 279  TRP A CB  1 
ATOM   2188 C  CG  . TRP A 1 279 ? 9.207   8.222   20.956  1.00 31.73  ? 279  TRP A CG  1 
ATOM   2189 C  CD1 . TRP A 1 279 ? 9.472   7.874   19.651  1.00 34.54  ? 279  TRP A CD1 1 
ATOM   2190 C  CD2 . TRP A 1 279 ? 8.212   7.299   21.420  1.00 33.92  ? 279  TRP A CD2 1 
ATOM   2191 N  NE1 . TRP A 1 279 ? 8.712   6.787   19.289  1.00 30.35  ? 279  TRP A NE1 1 
ATOM   2192 C  CE2 . TRP A 1 279 ? 7.931   6.414   20.353  1.00 33.24  ? 279  TRP A CE2 1 
ATOM   2193 C  CE3 . TRP A 1 279 ? 7.531   7.133   22.633  1.00 30.89  ? 279  TRP A CE3 1 
ATOM   2194 C  CZ2 . TRP A 1 279 ? 6.999   5.380   20.465  1.00 29.62  ? 279  TRP A CZ2 1 
ATOM   2195 C  CZ3 . TRP A 1 279 ? 6.610   6.100   22.743  1.00 30.26  ? 279  TRP A CZ3 1 
ATOM   2196 C  CH2 . TRP A 1 279 ? 6.353   5.239   21.666  1.00 30.12  ? 279  TRP A CH2 1 
ATOM   2197 N  N   . ASN A 1 280 ? 10.097  12.778  21.878  1.00 27.92  ? 280  ASN A N   1 
ATOM   2198 C  CA  . ASN A 1 280 ? 10.745  13.870  22.597  1.00 30.06  ? 280  ASN A CA  1 
ATOM   2199 C  C   . ASN A 1 280 ? 9.771   14.767  23.340  1.00 29.50  ? 280  ASN A C   1 
ATOM   2200 O  O   . ASN A 1 280 ? 10.213  15.547  24.186  1.00 33.03  ? 280  ASN A O   1 
ATOM   2201 C  CB  . ASN A 1 280 ? 11.563  14.748  21.638  1.00 29.85  ? 280  ASN A CB  1 
ATOM   2202 C  CG  . ASN A 1 280 ? 12.681  13.993  20.953  1.00 33.26  ? 280  ASN A CG  1 
ATOM   2203 O  OD1 . ASN A 1 280 ? 12.866  12.794  21.163  1.00 33.42  ? 280  ASN A OD1 1 
ATOM   2204 N  ND2 . ASN A 1 280 ? 13.428  14.697  20.109  1.00 27.74  ? 280  ASN A ND2 1 
ATOM   2205 N  N   . VAL A 1 281 ? 8.464   14.690  23.056  1.00 27.21  ? 281  VAL A N   1 
ATOM   2206 C  CA  . VAL A 1 281 ? 7.515   15.584  23.709  1.00 28.19  ? 281  VAL A CA  1 
ATOM   2207 C  C   . VAL A 1 281 ? 6.928   14.999  24.990  1.00 28.22  ? 281  VAL A C   1 
ATOM   2208 O  O   . VAL A 1 281 ? 6.168   15.694  25.677  1.00 28.83  ? 281  VAL A O   1 
ATOM   2209 C  CB  . VAL A 1 281 ? 6.368   15.977  22.755  1.00 30.17  ? 281  VAL A CB  1 
ATOM   2210 C  CG1 . VAL A 1 281 ? 6.931   16.492  21.423  1.00 28.14  ? 281  VAL A CG1 1 
ATOM   2211 C  CG2 . VAL A 1 281 ? 5.437   14.799  22.537  1.00 27.30  ? 281  VAL A CG2 1 
ATOM   2212 N  N   . LEU A 1 282 ? 7.256   13.756  25.340  1.00 30.11  ? 282  LEU A N   1 
ATOM   2213 C  CA  . LEU A 1 282 ? 6.730   13.188  26.579  1.00 31.72  ? 282  LEU A CA  1 
ATOM   2214 C  C   . LEU A 1 282 ? 7.276   13.967  27.774  1.00 32.32  ? 282  LEU A C   1 
ATOM   2215 O  O   . LEU A 1 282 ? 8.439   14.384  27.762  1.00 30.44  ? 282  LEU A O   1 
ATOM   2216 C  CB  . LEU A 1 282 ? 7.098   11.708  26.708  1.00 27.79  ? 282  LEU A CB  1 
ATOM   2217 C  CG  . LEU A 1 282 ? 6.277   10.727  25.862  1.00 31.23  ? 282  LEU A CG  1 
ATOM   2218 C  CD1 . LEU A 1 282 ? 6.847   9.310   25.965  1.00 29.14  ? 282  LEU A CD1 1 
ATOM   2219 C  CD2 . LEU A 1 282 ? 4.796   10.761  26.252  1.00 25.00  ? 282  LEU A CD2 1 
ATOM   2220 N  N   . PRO A 1 283 ? 6.465   14.200  28.811  1.00 31.47  ? 283  PRO A N   1 
ATOM   2221 C  CA  . PRO A 1 283 ? 6.938   15.019  29.937  1.00 34.72  ? 283  PRO A CA  1 
ATOM   2222 C  C   . PRO A 1 283 ? 7.876   14.292  30.886  1.00 37.60  ? 283  PRO A C   1 
ATOM   2223 O  O   . PRO A 1 283 ? 8.614   14.962  31.619  1.00 37.77  ? 283  PRO A O   1 
ATOM   2224 C  CB  . PRO A 1 283 ? 5.637   15.419  30.650  1.00 36.02  ? 283  PRO A CB  1 
ATOM   2225 C  CG  . PRO A 1 283 ? 4.683   14.333  30.320  1.00 34.95  ? 283  PRO A CG  1 
ATOM   2226 C  CD  . PRO A 1 283 ? 5.033   13.868  28.929  1.00 30.22  ? 283  PRO A CD  1 
ATOM   2227 N  N   . PHE A 1 284 ? 7.879   12.963  30.899  1.00 35.08  ? 284  PHE A N   1 
ATOM   2228 C  CA  . PHE A 1 284 ? 8.694   12.197  31.827  1.00 37.22  ? 284  PHE A CA  1 
ATOM   2229 C  C   . PHE A 1 284 ? 9.402   11.068  31.100  1.00 36.01  ? 284  PHE A C   1 
ATOM   2230 O  O   . PHE A 1 284 ? 8.903   10.541  30.101  1.00 34.24  ? 284  PHE A O   1 
ATOM   2231 C  CB  . PHE A 1 284 ? 7.855   11.564  32.952  1.00 35.20  ? 284  PHE A CB  1 
ATOM   2232 C  CG  . PHE A 1 284 ? 6.911   12.506  33.619  1.00 38.22  ? 284  PHE A CG  1 
ATOM   2233 C  CD1 . PHE A 1 284 ? 7.385   13.543  34.406  1.00 43.50  ? 284  PHE A CD1 1 
ATOM   2234 C  CD2 . PHE A 1 284 ? 5.545   12.338  33.484  1.00 35.91  ? 284  PHE A CD2 1 
ATOM   2235 C  CE1 . PHE A 1 284 ? 6.506   14.407  35.034  1.00 46.15  ? 284  PHE A CE1 1 
ATOM   2236 C  CE2 . PHE A 1 284 ? 4.661   13.198  34.107  1.00 46.32  ? 284  PHE A CE2 1 
ATOM   2237 C  CZ  . PHE A 1 284 ? 5.141   14.233  34.887  1.00 45.76  ? 284  PHE A CZ  1 
ATOM   2238 N  N   . ASP A 1 285 ? 10.562  10.682  31.629  1.00 30.57  ? 285  ASP A N   1 
ATOM   2239 C  CA  . ASP A 1 285 ? 11.068  9.343   31.362  1.00 32.96  ? 285  ASP A CA  1 
ATOM   2240 C  C   . ASP A 1 285 ? 10.033  8.343   31.848  1.00 33.91  ? 285  ASP A C   1 
ATOM   2241 O  O   . ASP A 1 285 ? 9.580   8.417   32.997  1.00 31.05  ? 285  ASP A O   1 
ATOM   2242 C  CB  . ASP A 1 285 ? 12.398  9.110   32.081  1.00 37.50  ? 285  ASP A CB  1 
ATOM   2243 C  CG  . ASP A 1 285 ? 13.538  9.851   31.438  1.00 44.68  ? 285  ASP A CG  1 
ATOM   2244 O  OD1 . ASP A 1 285 ? 13.559  9.936   30.194  1.00 47.51  ? 285  ASP A OD1 1 
ATOM   2245 O  OD2 . ASP A 1 285 ? 14.410  10.348  32.180  1.00 60.41  ? 285  ASP A OD2 1 
ATOM   2246 N  N   . SER A 1 286 ? 9.649   7.411   30.985  1.00 26.91  ? 286  SER A N   1 
ATOM   2247 C  CA  . SER A 1 286 ? 8.503   6.581   31.327  1.00 29.16  ? 286  SER A CA  1 
ATOM   2248 C  C   . SER A 1 286 ? 8.460   5.369   30.420  1.00 29.15  ? 286  SER A C   1 
ATOM   2249 O  O   . SER A 1 286 ? 9.146   5.300   29.400  1.00 27.54  ? 286  SER A O   1 
ATOM   2250 C  CB  . SER A 1 286 ? 7.198   7.365   31.205  1.00 29.73  ? 286  SER A CB  1 
ATOM   2251 O  OG  . SER A 1 286 ? 7.072   7.867   29.889  1.00 32.02  ? 286  SER A OG  1 
ATOM   2252 N  N   . ILE A 1 287 ? 7.630   4.410   30.811  1.00 23.72  ? 287  ILE A N   1 
ATOM   2253 C  CA  . ILE A 1 287 ? 7.218   3.329   29.933  1.00 24.31  ? 287  ILE A CA  1 
ATOM   2254 C  C   . ILE A 1 287 ? 5.695   3.305   29.936  1.00 22.18  ? 287  ILE A C   1 
ATOM   2255 O  O   . ILE A 1 287 ? 5.046   3.848   30.836  1.00 22.89  ? 287  ILE A O   1 
ATOM   2256 C  CB  . ILE A 1 287 ? 7.802   1.966   30.356  1.00 23.26  ? 287  ILE A CB  1 
ATOM   2257 C  CG1 . ILE A 1 287 ? 7.336   1.590   31.754  1.00 24.41  ? 287  ILE A CG1 1 
ATOM   2258 C  CG2 . ILE A 1 287 ? 9.343   2.007   30.296  1.00 27.30  ? 287  ILE A CG2 1 
ATOM   2259 C  CD1 . ILE A 1 287 ? 7.788   0.196   32.161  1.00 25.49  ? 287  ILE A CD1 1 
ATOM   2260 N  N   . PHE A 1 288 ? 5.126   2.679   28.904  1.00 22.78  ? 288  PHE A N   1 
ATOM   2261 C  CA  . PHE A 1 288 ? 3.666   2.635   28.726  1.00 21.55  ? 288  PHE A CA  1 
ATOM   2262 C  C   . PHE A 1 288 ? 3.071   4.043   28.718  1.00 23.76  ? 288  PHE A C   1 
ATOM   2263 O  O   . PHE A 1 288 ? 1.989   4.292   29.262  1.00 24.24  ? 288  PHE A O   1 
ATOM   2264 C  CB  . PHE A 1 288 ? 3.001   1.763   29.801  1.00 22.21  ? 288  PHE A CB  1 
ATOM   2265 C  CG  . PHE A 1 288 ? 1.875   0.901   29.285  1.00 23.27  ? 288  PHE A CG  1 
ATOM   2266 C  CD1 . PHE A 1 288 ? 1.753   -0.410  29.695  1.00 20.26  ? 288  PHE A CD1 1 
ATOM   2267 C  CD2 . PHE A 1 288 ? 0.944   1.403   28.372  1.00 20.49  ? 288  PHE A CD2 1 
ATOM   2268 C  CE1 . PHE A 1 288 ? 0.725   -1.201  29.232  1.00 18.71  ? 288  PHE A CE1 1 
ATOM   2269 C  CE2 . PHE A 1 288 ? -0.081  0.612   27.890  1.00 21.28  ? 288  PHE A CE2 1 
ATOM   2270 C  CZ  . PHE A 1 288 ? -0.198  -0.692  28.319  1.00 20.89  ? 288  PHE A CZ  1 
ATOM   2271 N  N   . ARG A 1 289 ? 3.798   4.987   28.113  1.00 20.65  ? 289  ARG A N   1 
ATOM   2272 C  CA  . ARG A 1 289 ? 3.278   6.322   27.846  1.00 22.29  ? 289  ARG A CA  1 
ATOM   2273 C  C   . ARG A 1 289 ? 3.587   6.681   26.402  1.00 25.68  ? 289  ARG A C   1 
ATOM   2274 O  O   . ARG A 1 289 ? 4.673   6.372   25.900  1.00 22.51  ? 289  ARG A O   1 
ATOM   2275 C  CB  . ARG A 1 289 ? 3.866   7.380   28.796  1.00 26.01  ? 289  ARG A CB  1 
ATOM   2276 C  CG  . ARG A 1 289 ? 3.431   7.221   30.268  1.00 22.84  ? 289  ARG A CG  1 
ATOM   2277 C  CD  . ARG A 1 289 ? 1.929   7.480   30.477  1.00 24.33  ? 289  ARG A CD  1 
ATOM   2278 N  NE  . ARG A 1 289 ? 1.561   7.428   31.903  1.00 26.17  ? 289  ARG A NE  1 
ATOM   2279 C  CZ  . ARG A 1 289 ? 1.265   6.308   32.554  1.00 26.41  ? 289  ARG A CZ  1 
ATOM   2280 N  NH1 . ARG A 1 289 ? 1.315   5.144   31.919  1.00 23.94  ? 289  ARG A NH1 1 
ATOM   2281 N  NH2 . ARG A 1 289 ? 0.943   6.345   33.844  1.00 24.42  ? 289  ARG A NH2 1 
ATOM   2282 N  N   . PHE A 1 290 ? 2.627   7.333   25.745  1.00 22.48  ? 290  PHE A N   1 
ATOM   2283 C  CA  . PHE A 1 290 ? 2.686   7.605   24.313  1.00 25.74  ? 290  PHE A CA  1 
ATOM   2284 C  C   . PHE A 1 290 ? 2.330   9.064   24.062  1.00 23.91  ? 290  PHE A C   1 
ATOM   2285 O  O   . PHE A 1 290 ? 1.542   9.666   24.799  1.00 24.59  ? 290  PHE A O   1 
ATOM   2286 C  CB  . PHE A 1 290 ? 1.751   6.659   23.545  1.00 22.66  ? 290  PHE A CB  1 
ATOM   2287 C  CG  . PHE A 1 290 ? 1.765   5.243   24.073  1.00 24.11  ? 290  PHE A CG  1 
ATOM   2288 C  CD1 . PHE A 1 290 ? 2.906   4.460   23.969  1.00 25.84  ? 290  PHE A CD1 1 
ATOM   2289 C  CD2 . PHE A 1 290 ? 0.651   4.714   24.711  1.00 24.43  ? 290  PHE A CD2 1 
ATOM   2290 C  CE1 . PHE A 1 290 ? 2.942   3.165   24.472  1.00 23.55  ? 290  PHE A CE1 1 
ATOM   2291 C  CE2 . PHE A 1 290 ? 0.666   3.417   25.210  1.00 25.06  ? 290  PHE A CE2 1 
ATOM   2292 C  CZ  . PHE A 1 290 ? 1.804   2.634   25.087  1.00 21.81  ? 290  PHE A CZ  1 
ATOM   2293 N  N   . SER A 1 291 ? 2.931   9.635   23.017  1.00 23.02  ? 291  SER A N   1 
ATOM   2294 C  CA  . SER A 1 291 ? 2.948   11.089  22.877  1.00 21.29  ? 291  SER A CA  1 
ATOM   2295 C  C   . SER A 1 291 ? 1.594   11.644  22.454  1.00 22.36  ? 291  SER A C   1 
ATOM   2296 O  O   . SER A 1 291 ? 1.072   12.567  23.083  1.00 24.26  ? 291  SER A O   1 
ATOM   2297 C  CB  . SER A 1 291 ? 4.031   11.499  21.882  1.00 23.13  ? 291  SER A CB  1 
ATOM   2298 O  OG  . SER A 1 291 ? 5.301   11.343  22.487  1.00 23.89  ? 291  SER A OG  1 
ATOM   2299 N  N   . PHE A 1 292 ? 1.035   11.132  21.365  1.00 23.20  ? 292  PHE A N   1 
ATOM   2300 C  CA  . PHE A 1 292 ? -0.154  11.713  20.749  1.00 21.60  ? 292  PHE A CA  1 
ATOM   2301 C  C   . PHE A 1 292 ? -1.299  10.721  20.888  1.00 21.36  ? 292  PHE A C   1 
ATOM   2302 O  O   . PHE A 1 292 ? -1.306  9.663   20.243  1.00 21.96  ? 292  PHE A O   1 
ATOM   2303 C  CB  . PHE A 1 292 ? 0.155   12.116  19.300  1.00 19.12  ? 292  PHE A CB  1 
ATOM   2304 C  CG  . PHE A 1 292 ? 1.215   13.192  19.234  1.00 20.75  ? 292  PHE A CG  1 
ATOM   2305 C  CD1 . PHE A 1 292 ? 0.911   14.496  19.600  1.00 23.20  ? 292  PHE A CD1 1 
ATOM   2306 C  CD2 . PHE A 1 292 ? 2.526   12.881  18.912  1.00 22.50  ? 292  PHE A CD2 1 
ATOM   2307 C  CE1 . PHE A 1 292 ? 1.893   15.482  19.621  1.00 23.72  ? 292  PHE A CE1 1 
ATOM   2308 C  CE2 . PHE A 1 292 ? 3.514   13.861  18.914  1.00 24.74  ? 292  PHE A CE2 1 
ATOM   2309 C  CZ  . PHE A 1 292 ? 3.195   15.166  19.273  1.00 21.61  ? 292  PHE A CZ  1 
ATOM   2310 N  N   . VAL A 1 293 ? -2.242  11.065  21.763  1.00 22.61  ? 293  VAL A N   1 
ATOM   2311 C  CA  . VAL A 1 293 ? -3.336  10.198  22.196  1.00 20.68  ? 293  VAL A CA  1 
ATOM   2312 C  C   . VAL A 1 293 ? -4.628  11.016  22.200  1.00 24.43  ? 293  VAL A C   1 
ATOM   2313 O  O   . VAL A 1 293 ? -4.574  12.250  22.077  1.00 22.27  ? 293  VAL A O   1 
ATOM   2314 C  CB  . VAL A 1 293 ? -3.057  9.599   23.590  1.00 20.47  ? 293  VAL A CB  1 
ATOM   2315 C  CG1 . VAL A 1 293 ? -1.758  8.780   23.594  1.00 21.74  ? 293  VAL A CG1 1 
ATOM   2316 C  CG2 . VAL A 1 293 ? -2.993  10.689  24.664  1.00 23.01  ? 293  VAL A CG2 1 
ATOM   2317 N  N   . PRO A 1 294 ? -5.799  10.383  22.327  1.00 24.12  ? 294  PRO A N   1 
ATOM   2318 C  CA  . PRO A 1 294 ? -7.054  11.147  22.444  1.00 24.90  ? 294  PRO A CA  1 
ATOM   2319 C  C   . PRO A 1 294 ? -6.974  12.263  23.480  1.00 24.79  ? 294  PRO A C   1 
ATOM   2320 O  O   . PRO A 1 294 ? -6.267  12.159  24.483  1.00 24.10  ? 294  PRO A O   1 
ATOM   2321 C  CB  . PRO A 1 294 ? -8.068  10.080  22.864  1.00 22.49  ? 294  PRO A CB  1 
ATOM   2322 C  CG  . PRO A 1 294 ? -7.590  8.850   22.175  1.00 21.69  ? 294  PRO A CG  1 
ATOM   2323 C  CD  . PRO A 1 294 ? -6.059  8.944   22.152  1.00 22.16  ? 294  PRO A CD  1 
ATOM   2324 N  N   . VAL A 1 295 ? -7.704  13.348  23.222  1.00 22.89  ? 295  VAL A N   1 
ATOM   2325 C  CA  A VAL A 1 295 ? -7.766  14.500  24.117  0.30 25.05  ? 295  VAL A CA  1 
ATOM   2326 C  CA  B VAL A 1 295 ? -7.763  14.496  24.114  0.70 25.07  ? 295  VAL A CA  1 
ATOM   2327 C  C   . VAL A 1 295 ? -9.186  14.635  24.644  1.00 26.98  ? 295  VAL A C   1 
ATOM   2328 O  O   . VAL A 1 295 ? -10.154 14.426  23.908  1.00 27.28  ? 295  VAL A O   1 
ATOM   2329 C  CB  A VAL A 1 295 ? -7.329  15.807  23.427  0.30 25.27  ? 295  VAL A CB  1 
ATOM   2330 C  CB  B VAL A 1 295 ? -7.282  15.777  23.399  0.70 25.27  ? 295  VAL A CB  1 
ATOM   2331 C  CG1 A VAL A 1 295 ? -5.822  15.923  23.444  0.30 23.97  ? 295  VAL A CG1 1 
ATOM   2332 C  CG1 B VAL A 1 295 ? -8.189  16.140  22.219  0.70 23.51  ? 295  VAL A CG1 1 
ATOM   2333 C  CG2 A VAL A 1 295 ? -7.876  15.881  22.002  0.30 23.80  ? 295  VAL A CG2 1 
ATOM   2334 C  CG2 B VAL A 1 295 ? -7.174  16.915  24.365  0.70 26.59  ? 295  VAL A CG2 1 
ATOM   2335 N  N   . ILE A 1 296 ? -9.305  14.965  25.930  1.00 25.63  ? 296  ILE A N   1 
ATOM   2336 C  CA  . ILE A 1 296 ? -10.604 15.182  26.568  1.00 27.13  ? 296  ILE A CA  1 
ATOM   2337 C  C   . ILE A 1 296 ? -11.046 16.590  26.203  1.00 27.22  ? 296  ILE A C   1 
ATOM   2338 O  O   . ILE A 1 296 ? -10.665 17.561  26.868  1.00 28.34  ? 296  ILE A O   1 
ATOM   2339 C  CB  . ILE A 1 296 ? -10.530 14.982  28.091  1.00 27.83  ? 296  ILE A CB  1 
ATOM   2340 C  CG1 . ILE A 1 296 ? -9.908  13.620  28.424  1.00 28.01  ? 296  ILE A CG1 1 
ATOM   2341 C  CG2 . ILE A 1 296 ? -11.919 15.088  28.709  1.00 31.01  ? 296  ILE A CG2 1 
ATOM   2342 C  CD1 . ILE A 1 296 ? -10.629 12.445  27.787  1.00 24.11  ? 296  ILE A CD1 1 
ATOM   2343 N  N   . ASP A 1 297 ? -11.839 16.706  25.134  1.00 27.36  ? 297  ASP A N   1 
ATOM   2344 C  CA  . ASP A 1 297 ? -11.982 17.955  24.393  1.00 30.77  ? 297  ASP A CA  1 
ATOM   2345 C  C   . ASP A 1 297 ? -13.303 18.682  24.622  1.00 39.95  ? 297  ASP A C   1 
ATOM   2346 O  O   . ASP A 1 297 ? -13.447 19.820  24.163  1.00 40.71  ? 297  ASP A O   1 
ATOM   2347 C  CB  . ASP A 1 297 ? -11.834 17.692  22.885  1.00 29.58  ? 297  ASP A CB  1 
ATOM   2348 C  CG  . ASP A 1 297 ? -12.856 16.691  22.370  1.00 34.27  ? 297  ASP A CG  1 
ATOM   2349 O  OD1 . ASP A 1 297 ? -13.551 16.069  23.202  1.00 33.15  ? 297  ASP A OD1 1 
ATOM   2350 O  OD2 . ASP A 1 297 ? -12.990 16.532  21.138  1.00 37.99  ? 297  ASP A OD2 1 
ATOM   2351 N  N   . GLY A 1 298 ? -14.275 18.063  25.287  1.00 33.47  ? 298  GLY A N   1 
ATOM   2352 C  CA  . GLY A 1 298 ? -15.588 18.663  25.385  1.00 36.10  ? 298  GLY A CA  1 
ATOM   2353 C  C   . GLY A 1 298 ? -16.471 18.454  24.173  1.00 37.68  ? 298  GLY A C   1 
ATOM   2354 O  O   . GLY A 1 298 ? -17.612 18.939  24.166  1.00 36.83  ? 298  GLY A O   1 
ATOM   2355 N  N   . GLU A 1 299 ? -15.988 17.743  23.155  1.00 34.30  ? 299  GLU A N   1 
ATOM   2356 C  CA  . GLU A 1 299 ? -16.754 17.514  21.938  1.00 36.42  ? 299  GLU A CA  1 
ATOM   2357 C  C   . GLU A 1 299 ? -16.896 16.019  21.669  1.00 37.31  ? 299  GLU A C   1 
ATOM   2358 O  O   . GLU A 1 299 ? -18.002 15.480  21.745  1.00 39.84  ? 299  GLU A O   1 
ATOM   2359 C  CB  . GLU A 1 299 ? -16.097 18.228  20.755  1.00 38.83  ? 299  GLU A CB  1 
ATOM   2360 C  CG  . GLU A 1 299 ? -16.720 17.887  19.412  1.00 50.58  ? 299  GLU A CG  1 
ATOM   2361 C  CD  . GLU A 1 299 ? -15.982 18.520  18.239  1.00 57.06  ? 299  GLU A CD  1 
ATOM   2362 O  OE1 . GLU A 1 299 ? -16.548 19.438  17.608  1.00 59.02  ? 299  GLU A OE1 1 
ATOM   2363 O  OE2 . GLU A 1 299 ? -14.841 18.096  17.940  1.00 60.15  ? 299  GLU A OE2 1 
ATOM   2364 N  N   . PHE A 1 300 ? -15.794 15.331  21.351  1.00 31.98  ? 300  PHE A N   1 
ATOM   2365 C  CA  . PHE A 1 300 ? -15.848 13.872  21.284  1.00 31.05  ? 300  PHE A CA  1 
ATOM   2366 C  C   . PHE A 1 300 ? -16.182 13.291  22.656  1.00 31.23  ? 300  PHE A C   1 
ATOM   2367 O  O   . PHE A 1 300 ? -16.937 12.315  22.773  1.00 29.67  ? 300  PHE A O   1 
ATOM   2368 C  CB  . PHE A 1 300 ? -14.519 13.310  20.761  1.00 28.56  ? 300  PHE A CB  1 
ATOM   2369 C  CG  . PHE A 1 300 ? -14.591 11.859  20.362  1.00 28.79  ? 300  PHE A CG  1 
ATOM   2370 C  CD1 . PHE A 1 300 ? -14.519 10.851  21.319  1.00 26.00  ? 300  PHE A CD1 1 
ATOM   2371 C  CD2 . PHE A 1 300 ? -14.737 11.504  19.031  1.00 21.87  ? 300  PHE A CD2 1 
ATOM   2372 C  CE1 . PHE A 1 300 ? -14.601 9.513   20.939  1.00 25.63  ? 300  PHE A CE1 1 
ATOM   2373 C  CE2 . PHE A 1 300 ? -14.811 10.173  18.647  1.00 24.43  ? 300  PHE A CE2 1 
ATOM   2374 C  CZ  . PHE A 1 300 ? -14.753 9.181   19.590  1.00 23.16  ? 300  PHE A CZ  1 
ATOM   2375 N  N   . PHE A 1 301 ? -15.637 13.888  23.700  1.00 30.00  ? 301  PHE A N   1 
ATOM   2376 C  CA  . PHE A 1 301 ? -15.930 13.523  25.081  1.00 31.18  ? 301  PHE A CA  1 
ATOM   2377 C  C   . PHE A 1 301 ? -16.584 14.731  25.731  1.00 33.65  ? 301  PHE A C   1 
ATOM   2378 O  O   . PHE A 1 301 ? -15.890 15.726  26.009  1.00 34.27  ? 301  PHE A O   1 
ATOM   2379 C  CB  . PHE A 1 301 ? -14.650 13.123  25.823  1.00 30.96  ? 301  PHE A CB  1 
ATOM   2380 C  CG  . PHE A 1 301 ? -13.900 11.981  25.177  1.00 27.21  ? 301  PHE A CG  1 
ATOM   2381 C  CD1 . PHE A 1 301 ? -14.376 10.684  25.269  1.00 27.68  ? 301  PHE A CD1 1 
ATOM   2382 C  CD2 . PHE A 1 301 ? -12.709 12.206  24.491  1.00 27.58  ? 301  PHE A CD2 1 
ATOM   2383 C  CE1 . PHE A 1 301 ? -13.700 9.631   24.677  1.00 27.21  ? 301  PHE A CE1 1 
ATOM   2384 C  CE2 . PHE A 1 301 ? -12.027 11.159  23.893  1.00 25.74  ? 301  PHE A CE2 1 
ATOM   2385 C  CZ  . PHE A 1 301 ? -12.518 9.869   23.986  1.00 25.17  ? 301  PHE A CZ  1 
ATOM   2386 N  N   . PRO A 1 302 ? -17.901 14.720  25.961  1.00 34.67  ? 302  PRO A N   1 
ATOM   2387 C  CA  . PRO A 1 302 ? -18.561 15.934  26.480  1.00 32.12  ? 302  PRO A CA  1 
ATOM   2388 C  C   . PRO A 1 302 ? -18.034 16.401  27.821  1.00 34.03  ? 302  PRO A C   1 
ATOM   2389 O  O   . PRO A 1 302 ? -17.943 17.612  28.053  1.00 37.18  ? 302  PRO A O   1 
ATOM   2390 C  CB  . PRO A 1 302 ? -20.040 15.522  26.564  1.00 35.18  ? 302  PRO A CB  1 
ATOM   2391 C  CG  . PRO A 1 302 ? -20.053 14.031  26.431  1.00 40.01  ? 302  PRO A CG  1 
ATOM   2392 C  CD  . PRO A 1 302 ? -18.864 13.671  25.604  1.00 31.15  ? 302  PRO A CD  1 
ATOM   2393 N  N   . THR A 1 303 ? -17.691 15.483  28.721  1.00 31.02  ? 303  THR A N   1 
ATOM   2394 C  CA  . THR A 1 303 ? -17.096 15.843  30.002  1.00 31.16  ? 303  THR A CA  1 
ATOM   2395 C  C   . THR A 1 303 ? -15.961 14.862  30.280  1.00 31.89  ? 303  THR A C   1 
ATOM   2396 O  O   . THR A 1 303 ? -15.610 14.035  29.435  1.00 28.55  ? 303  THR A O   1 
ATOM   2397 C  CB  . THR A 1 303 ? -18.143 15.836  31.129  1.00 33.38  ? 303  THR A CB  1 
ATOM   2398 O  OG1 . THR A 1 303 ? -18.775 14.551  31.194  1.00 34.41  ? 303  THR A OG1 1 
ATOM   2399 C  CG2 . THR A 1 303 ? -19.212 16.902  30.901  1.00 37.80  ? 303  THR A CG2 1 
ATOM   2400 N  N   . SER A 1 304 ? -15.390 14.942  31.481  1.00 30.66  ? 304  SER A N   1 
ATOM   2401 C  CA  . SER A 1 304 ? -14.357 13.991  31.868  1.00 29.10  ? 304  SER A CA  1 
ATOM   2402 C  C   . SER A 1 304 ? -14.885 12.564  31.761  1.00 28.74  ? 304  SER A C   1 
ATOM   2403 O  O   . SER A 1 304 ? -16.081 12.305  31.925  1.00 31.31  ? 304  SER A O   1 
ATOM   2404 C  CB  . SER A 1 304 ? -13.877 14.270  33.300  1.00 34.02  ? 304  SER A CB  1 
ATOM   2405 O  OG  . SER A 1 304 ? -14.836 13.839  34.246  1.00 34.38  ? 304  SER A OG  1 
ATOM   2406 N  N   . LEU A 1 305 ? -13.980 11.632  31.453  1.00 25.28  ? 305  LEU A N   1 
ATOM   2407 C  CA  . LEU A 1 305 ? -14.371 10.228  31.378  1.00 28.05  ? 305  LEU A CA  1 
ATOM   2408 C  C   . LEU A 1 305 ? -14.997 9.753   32.686  1.00 28.71  ? 305  LEU A C   1 
ATOM   2409 O  O   . LEU A 1 305 ? -15.993 9.020   32.679  1.00 29.25  ? 305  LEU A O   1 
ATOM   2410 C  CB  . LEU A 1 305 ? -13.165 9.364   31.031  1.00 29.23  ? 305  LEU A CB  1 
ATOM   2411 C  CG  . LEU A 1 305 ? -12.407 9.757   29.765  1.00 27.06  ? 305  LEU A CG  1 
ATOM   2412 C  CD1 . LEU A 1 305 ? -11.248 8.797   29.563  1.00 29.59  ? 305  LEU A CD1 1 
ATOM   2413 C  CD2 . LEU A 1 305 ? -13.340 9.758   28.566  1.00 28.40  ? 305  LEU A CD2 1 
ATOM   2414 N  N   . GLU A 1 306 ? -14.425 10.152  33.819  1.00 28.55  ? 306  GLU A N   1 
ATOM   2415 C  CA  . GLU A 1 306 ? -14.950 9.669   35.095  1.00 28.95  ? 306  GLU A CA  1 
ATOM   2416 C  C   . GLU A 1 306 ? -16.372 10.171  35.345  1.00 31.10  ? 306  GLU A C   1 
ATOM   2417 O  O   . GLU A 1 306 ? -17.234 9.405   35.792  1.00 32.13  ? 306  GLU A O   1 
ATOM   2418 C  CB  . GLU A 1 306 ? -14.013 10.068  36.232  1.00 29.95  ? 306  GLU A CB  1 
ATOM   2419 C  CG  . GLU A 1 306 ? -14.455 9.574   37.618  1.00 35.71  ? 306  GLU A CG  1 
ATOM   2420 C  CD  . GLU A 1 306 ? -14.313 8.068   37.796  1.00 36.67  ? 306  GLU A CD  1 
ATOM   2421 O  OE1 . GLU A 1 306 ? -13.864 7.384   36.857  1.00 35.37  ? 306  GLU A OE1 1 
ATOM   2422 O  OE2 . GLU A 1 306 ? -14.655 7.556   38.884  1.00 39.54  ? 306  GLU A OE2 1 
ATOM   2423 N  N   . SER A 1 307 ? -16.648 11.445  35.052  1.00 31.54  ? 307  SER A N   1 
ATOM   2424 C  CA  . SER A 1 307 ? -18.011 11.939  35.244  1.00 30.94  ? 307  SER A CA  1 
ATOM   2425 C  C   . SER A 1 307 ? -18.992 11.250  34.302  1.00 33.48  ? 307  SER A C   1 
ATOM   2426 O  O   . SER A 1 307 ? -20.100 10.890  34.715  1.00 32.72  ? 307  SER A O   1 
ATOM   2427 C  CB  . SER A 1 307 ? -18.065 13.458  35.078  1.00 35.78  ? 307  SER A CB  1 
ATOM   2428 O  OG  . SER A 1 307 ? -17.686 13.872  33.779  1.00 37.08  ? 307  SER A OG  1 
ATOM   2429 N  N   . MET A 1 308 ? -18.607 11.047  33.033  1.00 28.58  ? 308  MET A N   1 
ATOM   2430 C  CA  . MET A 1 308 ? -19.468 10.292  32.126  1.00 32.02  ? 308  MET A CA  1 
ATOM   2431 C  C   . MET A 1 308 ? -19.734 8.897   32.676  1.00 32.76  ? 308  MET A C   1 
ATOM   2432 O  O   . MET A 1 308 ? -20.876 8.415   32.658  1.00 33.20  ? 308  MET A O   1 
ATOM   2433 C  CB  . MET A 1 308 ? -18.839 10.210  30.730  1.00 27.69  ? 308  MET A CB  1 
ATOM   2434 C  CG  . MET A 1 308 ? -18.616 11.558  30.054  1.00 28.71  ? 308  MET A CG  1 
ATOM   2435 S  SD  . MET A 1 308 ? -17.982 11.387  28.360  1.00 32.71  ? 308  MET A SD  1 
ATOM   2436 C  CE  . MET A 1 308 ? -19.407 10.619  27.603  1.00 29.70  ? 308  MET A CE  1 
ATOM   2437 N  N   . LEU A 1 309 ? -18.693 8.244   33.195  1.00 26.61  ? 309  LEU A N   1 
ATOM   2438 C  CA  . LEU A 1 309 ? -18.869 6.914   33.762  1.00 29.72  ? 309  LEU A CA  1 
ATOM   2439 C  C   . LEU A 1 309 ? -19.758 6.962   34.999  1.00 32.50  ? 309  LEU A C   1 
ATOM   2440 O  O   . LEU A 1 309 ? -20.604 6.083   35.194  1.00 30.82  ? 309  LEU A O   1 
ATOM   2441 C  CB  . LEU A 1 309 ? -17.514 6.306   34.112  1.00 28.56  ? 309  LEU A CB  1 
ATOM   2442 C  CG  . LEU A 1 309 ? -16.636 5.821   32.952  1.00 29.05  ? 309  LEU A CG  1 
ATOM   2443 C  CD1 . LEU A 1 309 ? -15.337 5.301   33.532  1.00 29.64  ? 309  LEU A CD1 1 
ATOM   2444 C  CD2 . LEU A 1 309 ? -17.346 4.736   32.188  1.00 24.18  ? 309  LEU A CD2 1 
ATOM   2445 N  N   . ASN A 1 310 ? -19.585 7.990   35.834  1.00 29.27  ? 310  ASN A N   1 
ATOM   2446 C  CA  . ASN A 1 310 ? -20.353 8.073   37.076  1.00 36.87  ? 310  ASN A CA  1 
ATOM   2447 C  C   . ASN A 1 310 ? -21.822 8.343   36.802  1.00 33.03  ? 310  ASN A C   1 
ATOM   2448 O  O   . ASN A 1 310 ? -22.693 7.816   37.498  1.00 39.27  ? 310  ASN A O   1 
ATOM   2449 C  CB  . ASN A 1 310 ? -19.801 9.169   37.982  1.00 35.21  ? 310  ASN A CB  1 
ATOM   2450 C  CG  . ASN A 1 310 ? -18.618 8.714   38.784  1.00 37.14  ? 310  ASN A CG  1 
ATOM   2451 O  OD1 . ASN A 1 310 ? -18.412 7.516   38.977  1.00 41.48  ? 310  ASN A OD1 1 
ATOM   2452 N  ND2 . ASN A 1 310 ? -17.826 9.668   39.264  1.00 39.47  ? 310  ASN A ND2 1 
ATOM   2453 N  N   . SER A 1 311 ? -22.115 9.172   35.805  1.00 35.82  ? 311  SER A N   1 
ATOM   2454 C  CA  . SER A 1 311 ? -23.486 9.563   35.514  1.00 34.45  ? 311  SER A CA  1 
ATOM   2455 C  C   . SER A 1 311 ? -24.210 8.587   34.602  1.00 38.78  ? 311  SER A C   1 
ATOM   2456 O  O   . SER A 1 311 ? -25.417 8.742   34.392  1.00 39.80  ? 311  SER A O   1 
ATOM   2457 C  CB  . SER A 1 311 ? -23.507 10.954  34.877  1.00 36.96  ? 311  SER A CB  1 
ATOM   2458 O  OG  . SER A 1 311 ? -22.911 10.916  33.593  1.00 38.97  ? 311  SER A OG  1 
ATOM   2459 N  N   . GLY A 1 312 ? -23.521 7.584   34.065  1.00 33.86  ? 312  GLY A N   1 
ATOM   2460 C  CA  . GLY A 1 312 ? -24.155 6.735   33.080  1.00 31.61  ? 312  GLY A CA  1 
ATOM   2461 C  C   . GLY A 1 312 ? -24.295 7.366   31.714  1.00 31.93  ? 312  GLY A C   1 
ATOM   2462 O  O   . GLY A 1 312 ? -25.113 6.909   30.908  1.00 31.25  ? 312  GLY A O   1 
ATOM   2463 N  N   . ASN A 1 313 ? -23.524 8.418   31.430  1.00 35.28  ? 313  ASN A N   1 
ATOM   2464 C  CA  . ASN A 1 313 ? -23.551 9.072   30.122  1.00 33.41  ? 313  ASN A CA  1 
ATOM   2465 C  C   . ASN A 1 313 ? -22.725 8.252   29.131  1.00 32.13  ? 313  ASN A C   1 
ATOM   2466 O  O   . ASN A 1 313 ? -21.595 8.588   28.777  1.00 33.47  ? 313  ASN A O   1 
ATOM   2467 C  CB  . ASN A 1 313 ? -23.034 10.502  30.215  1.00 33.75  ? 313  ASN A CB  1 
ATOM   2468 C  CG  . ASN A 1 313 ? -23.276 11.287  28.931  1.00 38.48  ? 313  ASN A CG  1 
ATOM   2469 O  OD1 . ASN A 1 313 ? -23.988 10.824  28.044  1.00 36.49  ? 313  ASN A OD1 1 
ATOM   2470 N  ND2 . ASN A 1 313 ? -22.689 12.472  28.829  1.00 37.46  ? 313  ASN A ND2 1 
ATOM   2471 N  N   . PHE A 1 314 ? -23.310 7.143   28.691  1.00 30.52  ? 314  PHE A N   1 
ATOM   2472 C  CA  . PHE A 1 314 ? -22.644 6.273   27.727  1.00 29.74  ? 314  PHE A CA  1 
ATOM   2473 C  C   . PHE A 1 314 ? -23.672 5.314   27.157  1.00 31.79  ? 314  PHE A C   1 
ATOM   2474 O  O   . PHE A 1 314 ? -24.786 5.191   27.671  1.00 28.80  ? 314  PHE A O   1 
ATOM   2475 C  CB  . PHE A 1 314 ? -21.455 5.503   28.343  1.00 26.13  ? 314  PHE A CB  1 
ATOM   2476 C  CG  . PHE A 1 314 ? -21.759 4.820   29.659  1.00 29.90  ? 314  PHE A CG  1 
ATOM   2477 C  CD1 . PHE A 1 314 ? -22.477 3.629   29.700  1.00 27.97  ? 314  PHE A CD1 1 
ATOM   2478 C  CD2 . PHE A 1 314 ? -21.273 5.339   30.850  1.00 29.31  ? 314  PHE A CD2 1 
ATOM   2479 C  CE1 . PHE A 1 314 ? -22.728 2.989   30.916  1.00 27.57  ? 314  PHE A CE1 1 
ATOM   2480 C  CE2 . PHE A 1 314 ? -21.528 4.717   32.064  1.00 28.24  ? 314  PHE A CE2 1 
ATOM   2481 C  CZ  . PHE A 1 314 ? -22.249 3.536   32.093  1.00 27.76  ? 314  PHE A CZ  1 
ATOM   2482 N  N   . LYS A 1 315 ? -23.286 4.651   26.068  1.00 27.31  ? 315  LYS A N   1 
ATOM   2483 C  CA  . LYS A 1 315 ? -24.156 3.687   25.414  1.00 26.85  ? 315  LYS A CA  1 
ATOM   2484 C  C   . LYS A 1 315 ? -24.414 2.492   26.324  1.00 29.82  ? 315  LYS A C   1 
ATOM   2485 O  O   . LYS A 1 315 ? -23.474 1.842   26.799  1.00 26.14  ? 315  LYS A O   1 
ATOM   2486 C  CB  . LYS A 1 315 ? -23.540 3.211   24.102  1.00 27.27  ? 315  LYS A CB  1 
ATOM   2487 C  CG  . LYS A 1 315 ? -24.394 2.186   23.360  1.00 26.34  ? 315  LYS A CG  1 
ATOM   2488 C  CD  . LYS A 1 315 ? -23.632 1.581   22.176  1.00 29.49  ? 315  LYS A CD  1 
ATOM   2489 C  CE  . LYS A 1 315 ? -24.533 0.658   21.365  1.00 28.95  ? 315  LYS A CE  1 
ATOM   2490 N  NZ  . LYS A 1 315 ? -25.469 1.452   20.525  1.00 27.52  ? 315  LYS A NZ  1 
ATOM   2491 N  N   . LYS A 1 316 ? -25.692 2.184   26.540  1.00 25.85  ? 316  LYS A N   1 
ATOM   2492 C  CA  . LYS A 1 316 ? -26.090 1.101   27.429  1.00 28.56  ? 316  LYS A CA  1 
ATOM   2493 C  C   . LYS A 1 316 ? -26.339 -0.136  26.585  1.00 27.69  ? 316  LYS A C   1 
ATOM   2494 O  O   . LYS A 1 316 ? -27.328 -0.205  25.843  1.00 31.08  ? 316  LYS A O   1 
ATOM   2495 C  CB  . LYS A 1 316 ? -27.328 1.483   28.241  1.00 28.27  ? 316  LYS A CB  1 
ATOM   2496 C  CG  . LYS A 1 316 ? -27.015 2.243   29.513  1.00 36.13  ? 316  LYS A CG  1 
ATOM   2497 C  CD  . LYS A 1 316 ? -27.018 3.732   29.284  1.00 37.43  ? 316  LYS A CD  1 
ATOM   2498 C  CE  . LYS A 1 316 ? -27.196 4.472   30.588  1.00 39.12  ? 316  LYS A CE  1 
ATOM   2499 N  NZ  . LYS A 1 316 ? -27.548 5.902   30.357  1.00 47.15  ? 316  LYS A NZ  1 
ATOM   2500 N  N   . THR A 1 317 ? -25.441 -1.107  26.689  1.00 24.21  ? 317  THR A N   1 
ATOM   2501 C  CA  . THR A 1 317 ? -25.545 -2.307  25.875  1.00 21.90  ? 317  THR A CA  1 
ATOM   2502 C  C   . THR A 1 317 ? -24.819 -3.433  26.602  1.00 23.29  ? 317  THR A C   1 
ATOM   2503 O  O   . THR A 1 317 ? -24.625 -3.359  27.831  1.00 26.81  ? 317  THR A O   1 
ATOM   2504 C  CB  . THR A 1 317 ? -25.020 -2.039  24.446  1.00 23.06  ? 317  THR A CB  1 
ATOM   2505 O  OG1 . THR A 1 317 ? -25.193 -3.213  23.652  1.00 29.83  ? 317  THR A OG1 1 
ATOM   2506 C  CG2 . THR A 1 317 ? -23.533 -1.655  24.450  1.00 25.96  ? 317  THR A CG2 1 
ATOM   2507 N  N   . GLN A 1 318 ? -24.452 -4.488  25.879  1.00 23.95  ? 318  GLN A N   1 
ATOM   2508 C  CA  . GLN A 1 318 ? -23.667 -5.589  26.425  1.00 26.68  ? 318  GLN A CA  1 
ATOM   2509 C  C   . GLN A 1 318 ? -22.201 -5.401  26.069  1.00 25.88  ? 318  GLN A C   1 
ATOM   2510 O  O   . GLN A 1 318 ? -21.873 -4.959  24.960  1.00 21.79  ? 318  GLN A O   1 
ATOM   2511 C  CB  . GLN A 1 318 ? -24.130 -6.944  25.884  1.00 25.00  ? 318  GLN A CB  1 
ATOM   2512 C  CG  . GLN A 1 318 ? -25.620 -7.231  26.117  1.00 25.41  ? 318  GLN A CG  1 
ATOM   2513 C  CD  . GLN A 1 318 ? -26.465 -6.671  24.999  1.00 30.39  ? 318  GLN A CD  1 
ATOM   2514 O  OE1 . GLN A 1 318 ? -26.055 -6.706  23.846  1.00 28.80  ? 318  GLN A OE1 1 
ATOM   2515 N  NE2 . GLN A 1 318 ? -27.638 -6.139  25.331  1.00 33.70  ? 318  GLN A NE2 1 
ATOM   2516 N  N   . ILE A 1 319 ? -21.317 -5.763  26.997  1.00 22.72  ? 319  ILE A N   1 
ATOM   2517 C  CA  . ILE A 1 319 ? -19.889 -5.735  26.713  1.00 21.02  ? 319  ILE A CA  1 
ATOM   2518 C  C   . ILE A 1 319 ? -19.256 -7.042  27.156  1.00 26.78  ? 319  ILE A C   1 
ATOM   2519 O  O   . ILE A 1 319 ? -19.728 -7.719  28.077  1.00 25.55  ? 319  ILE A O   1 
ATOM   2520 C  CB  . ILE A 1 319 ? -19.173 -4.541  27.375  1.00 22.73  ? 319  ILE A CB  1 
ATOM   2521 C  CG1 . ILE A 1 319 ? -19.230 -4.651  28.904  1.00 21.62  ? 319  ILE A CG1 1 
ATOM   2522 C  CG2 . ILE A 1 319 ? -19.757 -3.230  26.899  1.00 22.74  ? 319  ILE A CG2 1 
ATOM   2523 C  CD1 . ILE A 1 319 ? -18.354 -3.643  29.633  1.00 27.41  ? 319  ILE A CD1 1 
ATOM   2524 N  N   . LEU A 1 320 ? -18.164 -7.387  26.483  1.00 24.38  ? 320  LEU A N   1 
ATOM   2525 C  CA  . LEU A 1 320 ? -17.339 -8.530  26.831  1.00 24.21  ? 320  LEU A CA  1 
ATOM   2526 C  C   . LEU A 1 320 ? -15.908 -8.026  26.817  1.00 24.64  ? 320  LEU A C   1 
ATOM   2527 O  O   . LEU A 1 320 ? -15.517 -7.337  25.874  1.00 24.07  ? 320  LEU A O   1 
ATOM   2528 C  CB  . LEU A 1 320 ? -17.549 -9.677  25.835  1.00 21.58  ? 320  LEU A CB  1 
ATOM   2529 C  CG  . LEU A 1 320 ? -16.782 -10.987 26.035  1.00 27.37  ? 320  LEU A CG  1 
ATOM   2530 C  CD1 . LEU A 1 320 ? -17.614 -12.161 25.554  1.00 25.98  ? 320  LEU A CD1 1 
ATOM   2531 C  CD2 . LEU A 1 320 ? -15.443 -10.954 25.309  1.00 24.81  ? 320  LEU A CD2 1 
ATOM   2532 N  N   . LEU A 1 321 ? -15.140 -8.311  27.867  1.00 24.51  ? 321  LEU A N   1 
ATOM   2533 C  CA  . LEU A 1 321 ? -13.836 -7.668  27.962  1.00 25.15  ? 321  LEU A CA  1 
ATOM   2534 C  C   . LEU A 1 321 ? -12.953 -8.430  28.938  1.00 24.13  ? 321  LEU A C   1 
ATOM   2535 O  O   . LEU A 1 321 ? -13.427 -9.243  29.734  1.00 21.57  ? 321  LEU A O   1 
ATOM   2536 C  CB  . LEU A 1 321 ? -13.973 -6.202  28.388  1.00 21.86  ? 321  LEU A CB  1 
ATOM   2537 C  CG  . LEU A 1 321 ? -14.333 -5.866  29.836  1.00 23.61  ? 321  LEU A CG  1 
ATOM   2538 C  CD1 . LEU A 1 321 ? -14.138 -4.381  30.050  1.00 22.36  ? 321  LEU A CD1 1 
ATOM   2539 C  CD2 . LEU A 1 321 ? -15.786 -6.274  30.219  1.00 20.36  ? 321  LEU A CD2 1 
ATOM   2540 N  N   . GLY A 1 322 ? -11.657 -8.176  28.851  1.00 21.94  ? 322  GLY A N   1 
ATOM   2541 C  CA  . GLY A 1 322 ? -10.752 -8.843  29.763  1.00 21.78  ? 322  GLY A CA  1 
ATOM   2542 C  C   . GLY A 1 322 ? -9.316  -8.448  29.506  1.00 26.24  ? 322  GLY A C   1 
ATOM   2543 O  O   . GLY A 1 322 ? -9.023  -7.511  28.752  1.00 21.09  ? 322  GLY A O   1 
ATOM   2544 N  N   . VAL A 1 323 ? -8.419  -9.191  30.160  1.00 22.34  ? 323  VAL A N   1 
ATOM   2545 C  CA  . VAL A 1 323 ? -7.002  -8.860  30.238  1.00 22.83  ? 323  VAL A CA  1 
ATOM   2546 C  C   . VAL A 1 323 ? -6.195  -10.151 30.178  1.00 26.22  ? 323  VAL A C   1 
ATOM   2547 O  O   . VAL A 1 323 ? -6.738  -11.257 30.272  1.00 25.56  ? 323  VAL A O   1 
ATOM   2548 C  CB  . VAL A 1 323 ? -6.662  -8.084  31.527  1.00 20.82  ? 323  VAL A CB  1 
ATOM   2549 C  CG1 . VAL A 1 323 ? -7.498  -6.803  31.628  1.00 21.43  ? 323  VAL A CG1 1 
ATOM   2550 C  CG2 . VAL A 1 323 ? -6.890  -8.980  32.758  1.00 25.41  ? 323  VAL A CG2 1 
ATOM   2551 N  N   . ASN A 1 324 ? -4.875  -9.994  30.017  1.00 22.47  ? 324  ASN A N   1 
ATOM   2552 C  CA  . ASN A 1 324 ? -3.935  -11.101 30.012  1.00 23.40  ? 324  ASN A CA  1 
ATOM   2553 C  C   . ASN A 1 324 ? -3.153  -11.105 31.319  1.00 24.20  ? 324  ASN A C   1 
ATOM   2554 O  O   . ASN A 1 324 ? -3.094  -10.101 32.030  1.00 21.86  ? 324  ASN A O   1 
ATOM   2555 C  CB  . ASN A 1 324 ? -2.951  -11.006 28.850  1.00 23.66  ? 324  ASN A CB  1 
ATOM   2556 C  CG  . ASN A 1 324 ? -3.637  -11.063 27.510  1.00 25.10  ? 324  ASN A CG  1 
ATOM   2557 O  OD1 . ASN A 1 324 ? -4.857  -11.240 27.431  1.00 22.33  ? 324  ASN A OD1 1 
ATOM   2558 N  ND2 . ASN A 1 324 ? -2.862  -10.895 26.446  1.00 23.37  ? 324  ASN A ND2 1 
ATOM   2559 N  N   . LYS A 1 325 ? -2.519  -12.242 31.600  1.00 24.47  ? 325  LYS A N   1 
ATOM   2560 C  CA  . LYS A 1 325 ? -1.879  -12.418 32.904  1.00 25.73  ? 325  LYS A CA  1 
ATOM   2561 C  C   . LYS A 1 325 ? -0.684  -11.490 33.088  1.00 25.65  ? 325  LYS A C   1 
ATOM   2562 O  O   . LYS A 1 325 ? -0.498  -10.929 34.173  1.00 25.06  ? 325  LYS A O   1 
ATOM   2563 C  CB  . LYS A 1 325 ? -1.462  -13.874 33.101  1.00 27.32  ? 325  LYS A CB  1 
ATOM   2564 C  CG  . LYS A 1 325 ? -0.707  -14.092 34.416  1.00 33.76  ? 325  LYS A CG  1 
ATOM   2565 C  CD  . LYS A 1 325 ? -0.312  -15.537 34.630  1.00 38.79  ? 325  LYS A CD  1 
ATOM   2566 C  CE  . LYS A 1 325 ? 0.366   -15.700 35.991  1.00 47.33  ? 325  LYS A CE  1 
ATOM   2567 N  NZ  . LYS A 1 325 ? 1.498   -14.728 36.172  1.00 49.87  ? 325  LYS A NZ  1 
ATOM   2568 N  N   . ASP A 1 326 ? 0.123   -11.290 32.053  1.00 27.61  ? 326  ASP A N   1 
ATOM   2569 C  CA  . ASP A 1 326 ? 1.382   -10.560 32.203  1.00 27.69  ? 326  ASP A CA  1 
ATOM   2570 C  C   . ASP A 1 326 ? 1.428   -9.380  31.235  1.00 28.12  ? 326  ASP A C   1 
ATOM   2571 O  O   . ASP A 1 326 ? 2.284   -9.326  30.353  1.00 24.53  ? 326  ASP A O   1 
ATOM   2572 C  CB  . ASP A 1 326 ? 2.558   -11.498 31.993  1.00 26.49  ? 326  ASP A CB  1 
ATOM   2573 C  CG  . ASP A 1 326 ? 2.515   -12.682 32.920  1.00 29.97  ? 326  ASP A CG  1 
ATOM   2574 O  OD1 . ASP A 1 326 ? 2.725   -12.471 34.127  1.00 28.09  ? 326  ASP A OD1 1 
ATOM   2575 O  OD2 . ASP A 1 326 ? 2.244   -13.810 32.452  1.00 26.90  ? 326  ASP A OD2 1 
ATOM   2576 N  N   . GLU A 1 327 ? 0.525   -8.419  31.431  1.00 27.36  ? 327  GLU A N   1 
ATOM   2577 C  CA  . GLU A 1 327 ? 0.435   -7.291  30.512  1.00 28.04  ? 327  GLU A CA  1 
ATOM   2578 C  C   . GLU A 1 327 ? 1.702   -6.439  30.499  1.00 26.53  ? 327  GLU A C   1 
ATOM   2579 O  O   . GLU A 1 327 ? 1.983   -5.780  29.491  1.00 25.54  ? 327  GLU A O   1 
ATOM   2580 C  CB  . GLU A 1 327 ? -0.777  -6.429  30.883  1.00 25.54  ? 327  GLU A CB  1 
ATOM   2581 C  CG  . GLU A 1 327 ? -2.101  -7.194  30.827  1.00 21.38  ? 327  GLU A CG  1 
ATOM   2582 C  CD  . GLU A 1 327 ? -2.703  -7.268  29.421  1.00 26.32  ? 327  GLU A CD  1 
ATOM   2583 O  OE1 . GLU A 1 327 ? -1.985  -6.991  28.431  1.00 27.09  ? 327  GLU A OE1 1 
ATOM   2584 O  OE2 . GLU A 1 327 ? -3.904  -7.620  29.307  1.00 25.70  ? 327  GLU A OE2 1 
ATOM   2585 N  N   . GLY A 1 328 ? 2.494   -6.460  31.570  1.00 22.11  ? 328  GLY A N   1 
ATOM   2586 C  CA  . GLY A 1 328 ? 3.607   -5.534  31.666  1.00 25.24  ? 328  GLY A CA  1 
ATOM   2587 C  C   . GLY A 1 328 ? 4.923   -5.925  31.013  1.00 23.16  ? 328  GLY A C   1 
ATOM   2588 O  O   . GLY A 1 328 ? 5.770   -5.061  30.779  1.00 22.44  ? 328  GLY A O   1 
ATOM   2589 N  N   . SER A 1 329 ? 5.123   -7.211  30.727  1.00 24.83  ? 329  SER A N   1 
ATOM   2590 C  CA  . SER A 1 329 ? 6.467   -7.693  30.398  1.00 24.89  ? 329  SER A CA  1 
ATOM   2591 C  C   . SER A 1 329 ? 7.018   -7.065  29.114  1.00 25.14  ? 329  SER A C   1 
ATOM   2592 O  O   . SER A 1 329 ? 8.211   -6.740  29.035  1.00 21.85  ? 329  SER A O   1 
ATOM   2593 C  CB  . SER A 1 329 ? 6.448   -9.210  30.280  1.00 24.18  ? 329  SER A CB  1 
ATOM   2594 O  OG  . SER A 1 329 ? 5.509   -9.637  29.301  1.00 24.92  ? 329  SER A OG  1 
ATOM   2595 N  N   . PHE A 1 330 ? 6.168   -6.909  28.096  1.00 22.68  ? 330  PHE A N   1 
ATOM   2596 C  CA  . PHE A 1 330 ? 6.557   -6.255  26.849  1.00 25.91  ? 330  PHE A CA  1 
ATOM   2597 C  C   . PHE A 1 330 ? 7.185   -4.893  27.119  1.00 21.14  ? 330  PHE A C   1 
ATOM   2598 O  O   . PHE A 1 330 ? 8.280   -4.589  26.626  1.00 23.48  ? 330  PHE A O   1 
ATOM   2599 C  CB  . PHE A 1 330 ? 5.307   -6.164  25.945  1.00 26.91  ? 330  PHE A CB  1 
ATOM   2600 C  CG  . PHE A 1 330 ? 5.369   -5.130  24.832  1.00 26.26  ? 330  PHE A CG  1 
ATOM   2601 C  CD1 . PHE A 1 330 ? 6.539   -4.862  24.132  1.00 24.18  ? 330  PHE A CD1 1 
ATOM   2602 C  CD2 . PHE A 1 330 ? 4.195   -4.473  24.447  1.00 27.02  ? 330  PHE A CD2 1 
ATOM   2603 C  CE1 . PHE A 1 330 ? 6.557   -3.916  23.090  1.00 25.60  ? 330  PHE A CE1 1 
ATOM   2604 C  CE2 . PHE A 1 330 ? 4.194   -3.545  23.410  1.00 28.06  ? 330  PHE A CE2 1 
ATOM   2605 C  CZ  . PHE A 1 330 ? 5.378   -3.261  22.728  1.00 26.34  ? 330  PHE A CZ  1 
ATOM   2606 N  N   . PHE A 1 331 ? 6.529   -4.079  27.943  1.00 21.31  ? 331  PHE A N   1 
ATOM   2607 C  CA  . PHE A 1 331 ? 6.974   -2.709  28.135  1.00 19.27  ? 331  PHE A CA  1 
ATOM   2608 C  C   . PHE A 1 331 ? 8.247   -2.650  28.972  1.00 23.99  ? 331  PHE A C   1 
ATOM   2609 O  O   . PHE A 1 331 ? 9.090   -1.774  28.751  1.00 21.06  ? 331  PHE A O   1 
ATOM   2610 C  CB  . PHE A 1 331 ? 5.844   -1.893  28.765  1.00 23.81  ? 331  PHE A CB  1 
ATOM   2611 C  CG  . PHE A 1 331 ? 4.575   -1.935  27.948  1.00 24.01  ? 331  PHE A CG  1 
ATOM   2612 C  CD1 . PHE A 1 331 ? 4.339   -0.986  26.966  1.00 26.37  ? 331  PHE A CD1 1 
ATOM   2613 C  CD2 . PHE A 1 331 ? 3.655   -2.959  28.124  1.00 23.37  ? 331  PHE A CD2 1 
ATOM   2614 C  CE1 . PHE A 1 331 ? 3.179   -1.033  26.185  1.00 24.58  ? 331  PHE A CE1 1 
ATOM   2615 C  CE2 . PHE A 1 331 ? 2.500   -3.026  27.337  1.00 24.95  ? 331  PHE A CE2 1 
ATOM   2616 C  CZ  . PHE A 1 331 ? 2.260   -2.053  26.379  1.00 24.21  ? 331  PHE A CZ  1 
ATOM   2617 N  N   . LEU A 1 332 ? 8.413   -3.581  29.915  1.00 21.61  ? 332  LEU A N   1 
ATOM   2618 C  CA  . LEU A 1 332 ? 9.654   -3.615  30.689  1.00 22.60  ? 332  LEU A CA  1 
ATOM   2619 C  C   . LEU A 1 332 ? 10.836  -4.040  29.817  1.00 22.28  ? 332  LEU A C   1 
ATOM   2620 O  O   . LEU A 1 332 ? 11.919  -3.439  29.891  1.00 24.99  ? 332  LEU A O   1 
ATOM   2621 C  CB  . LEU A 1 332 ? 9.483   -4.548  31.888  1.00 24.26  ? 332  LEU A CB  1 
ATOM   2622 C  CG  . LEU A 1 332 ? 8.481   -4.046  32.934  1.00 24.10  ? 332  LEU A CG  1 
ATOM   2623 C  CD1 . LEU A 1 332 ? 8.008   -5.168  33.847  1.00 22.57  ? 332  LEU A CD1 1 
ATOM   2624 C  CD2 . LEU A 1 332 ? 9.060   -2.893  33.744  1.00 19.63  ? 332  LEU A CD2 1 
ATOM   2625 N  N   . LEU A 1 333 ? 10.641  -5.074  28.989  1.00 21.00  ? 333  LEU A N   1 
ATOM   2626 C  CA  . LEU A 1 333 ? 11.679  -5.524  28.066  1.00 26.67  ? 333  LEU A CA  1 
ATOM   2627 C  C   . LEU A 1 333 ? 12.225  -4.372  27.246  1.00 26.58  ? 333  LEU A C   1 
ATOM   2628 O  O   . LEU A 1 333 ? 13.444  -4.244  27.074  1.00 21.62  ? 333  LEU A O   1 
ATOM   2629 C  CB  . LEU A 1 333 ? 11.123  -6.603  27.137  1.00 24.59  ? 333  LEU A CB  1 
ATOM   2630 C  CG  . LEU A 1 333 ? 11.976  -6.997  25.923  1.00 28.25  ? 333  LEU A CG  1 
ATOM   2631 C  CD1 . LEU A 1 333 ? 13.373  -7.478  26.345  1.00 24.72  ? 333  LEU A CD1 1 
ATOM   2632 C  CD2 . LEU A 1 333 ? 11.267  -8.065  25.136  1.00 24.80  ? 333  LEU A CD2 1 
ATOM   2633 N  N   . TYR A 1 334 ? 11.335  -3.518  26.736  1.00 23.66  ? 334  TYR A N   1 
ATOM   2634 C  CA  . TYR A 1 334 ? 11.744  -2.453  25.832  1.00 27.50  ? 334  TYR A CA  1 
ATOM   2635 C  C   . TYR A 1 334 ? 12.221  -1.201  26.548  1.00 30.71  ? 334  TYR A C   1 
ATOM   2636 O  O   . TYR A 1 334 ? 12.994  -0.436  25.969  1.00 28.36  ? 334  TYR A O   1 
ATOM   2637 C  CB  . TYR A 1 334 ? 10.590  -2.073  24.902  1.00 27.02  ? 334  TYR A CB  1 
ATOM   2638 C  CG  . TYR A 1 334 ? 10.500  -2.943  23.672  1.00 27.06  ? 334  TYR A CG  1 
ATOM   2639 C  CD1 . TYR A 1 334 ? 10.123  -4.273  23.772  1.00 22.48  ? 334  TYR A CD1 1 
ATOM   2640 C  CD2 . TYR A 1 334 ? 10.816  -2.440  22.407  1.00 24.38  ? 334  TYR A CD2 1 
ATOM   2641 C  CE1 . TYR A 1 334 ? 10.023  -5.078  22.636  1.00 25.31  ? 334  TYR A CE1 1 
ATOM   2642 C  CE2 . TYR A 1 334 ? 10.727  -3.233  21.287  1.00 24.27  ? 334  TYR A CE2 1 
ATOM   2643 C  CZ  . TYR A 1 334 ? 10.336  -4.549  21.410  1.00 22.45  ? 334  TYR A CZ  1 
ATOM   2644 O  OH  . TYR A 1 334 ? 10.246  -5.346  20.299  1.00 22.12  ? 334  TYR A OH  1 
ATOM   2645 N  N   . GLY A 1 335 ? 11.810  -0.972  27.793  1.00 24.73  ? 335  GLY A N   1 
ATOM   2646 C  CA  . GLY A 1 335 ? 12.092  0.323   28.374  1.00 21.10  ? 335  GLY A CA  1 
ATOM   2647 C  C   . GLY A 1 335 ? 12.687  0.351   29.769  1.00 25.83  ? 335  GLY A C   1 
ATOM   2648 O  O   . GLY A 1 335 ? 13.002  1.439   30.255  1.00 27.83  ? 335  GLY A O   1 
ATOM   2649 N  N   . ALA A 1 336 ? 12.849  -0.805  30.425  1.00 22.53  ? 336  ALA A N   1 
ATOM   2650 C  CA  . ALA A 1 336 ? 13.278  -0.781  31.827  1.00 23.73  ? 336  ALA A CA  1 
ATOM   2651 C  C   . ALA A 1 336 ? 14.625  -1.473  32.027  1.00 21.69  ? 336  ALA A C   1 
ATOM   2652 O  O   . ALA A 1 336 ? 14.910  -2.488  31.381  1.00 24.60  ? 336  ALA A O   1 
ATOM   2653 C  CB  . ALA A 1 336 ? 12.227  -1.449  32.743  1.00 22.38  ? 336  ALA A CB  1 
ATOM   2654 N  N   . PRO A 1 337 ? 15.461  -0.959  32.935  1.00 25.61  ? 337  PRO A N   1 
ATOM   2655 C  CA  . PRO A 1 337 ? 16.799  -1.540  33.132  1.00 26.75  ? 337  PRO A CA  1 
ATOM   2656 C  C   . PRO A 1 337 ? 16.747  -2.938  33.729  1.00 28.25  ? 337  PRO A C   1 
ATOM   2657 O  O   . PRO A 1 337 ? 15.969  -3.216  34.646  1.00 28.70  ? 337  PRO A O   1 
ATOM   2658 C  CB  . PRO A 1 337 ? 17.474  -0.556  34.096  1.00 26.79  ? 337  PRO A CB  1 
ATOM   2659 C  CG  . PRO A 1 337 ? 16.330  0.142   34.807  1.00 26.20  ? 337  PRO A CG  1 
ATOM   2660 C  CD  . PRO A 1 337 ? 15.258  0.261   33.733  1.00 21.78  ? 337  PRO A CD  1 
ATOM   2661 N  N   . GLY A 1 338 ? 17.606  -3.816  33.207  1.00 26.81  ? 338  GLY A N   1 
ATOM   2662 C  CA  . GLY A 1 338 ? 17.758  -5.164  33.717  1.00 23.88  ? 338  GLY A CA  1 
ATOM   2663 C  C   . GLY A 1 338 ? 17.013  -6.240  32.957  1.00 28.31  ? 338  GLY A C   1 
ATOM   2664 O  O   . GLY A 1 338 ? 17.196  -7.426  33.261  1.00 22.74  ? 338  GLY A O   1 
ATOM   2665 N  N   . PHE A 1 339 ? 16.186  -5.875  31.980  1.00 23.84  ? 339  PHE A N   1 
ATOM   2666 C  CA  . PHE A 1 339 ? 15.400  -6.847  31.243  1.00 24.51  ? 339  PHE A CA  1 
ATOM   2667 C  C   . PHE A 1 339 ? 16.063  -7.145  29.909  1.00 27.37  ? 339  PHE A C   1 
ATOM   2668 O  O   . PHE A 1 339 ? 16.694  -6.280  29.304  1.00 27.28  ? 339  PHE A O   1 
ATOM   2669 C  CB  . PHE A 1 339 ? 13.983  -6.338  31.005  1.00 22.98  ? 339  PHE A CB  1 
ATOM   2670 C  CG  . PHE A 1 339 ? 13.191  -6.190  32.263  1.00 23.46  ? 339  PHE A CG  1 
ATOM   2671 C  CD1 . PHE A 1 339 ? 13.267  -5.031  33.004  1.00 22.87  ? 339  PHE A CD1 1 
ATOM   2672 C  CD2 . PHE A 1 339 ? 12.387  -7.223  32.712  1.00 25.98  ? 339  PHE A CD2 1 
ATOM   2673 C  CE1 . PHE A 1 339 ? 12.539  -4.891  34.176  1.00 24.11  ? 339  PHE A CE1 1 
ATOM   2674 C  CE2 . PHE A 1 339 ? 11.664  -7.094  33.874  1.00 22.03  ? 339  PHE A CE2 1 
ATOM   2675 C  CZ  . PHE A 1 339 ? 11.744  -5.927  34.611  1.00 25.18  ? 339  PHE A CZ  1 
ATOM   2676 N  N   . SER A 1 340 ? 15.896  -8.377  29.453  1.00 26.64  ? 340  SER A N   1 
ATOM   2677 C  CA  . SER A 1 340 ? 16.549  -8.817  28.238  1.00 28.66  ? 340  SER A CA  1 
ATOM   2678 C  C   . SER A 1 340 ? 15.721  -9.923  27.620  1.00 27.66  ? 340  SER A C   1 
ATOM   2679 O  O   . SER A 1 340 ? 15.130  -10.742 28.327  1.00 29.89  ? 340  SER A O   1 
ATOM   2680 C  CB  . SER A 1 340 ? 17.981  -9.312  28.517  1.00 27.44  ? 340  SER A CB  1 
ATOM   2681 O  OG  . SER A 1 340 ? 18.533  -9.953  27.376  1.00 36.98  ? 340  SER A OG  1 
ATOM   2682 N  N   . LYS A 1 341 ? 15.699  -9.936  26.291  1.00 27.84  ? 341  LYS A N   1 
ATOM   2683 C  CA  . LYS A 1 341 ? 15.046  -10.999 25.544  1.00 31.80  ? 341  LYS A CA  1 
ATOM   2684 C  C   . LYS A 1 341 ? 15.754  -12.336 25.724  1.00 28.79  ? 341  LYS A C   1 
ATOM   2685 O  O   . LYS A 1 341 ? 15.131  -13.392 25.558  1.00 31.84  ? 341  LYS A O   1 
ATOM   2686 C  CB  . LYS A 1 341 ? 15.009  -10.599 24.060  1.00 35.44  ? 341  LYS A CB  1 
ATOM   2687 C  CG  . LYS A 1 341 ? 14.402  -11.605 23.121  1.00 38.99  ? 341  LYS A CG  1 
ATOM   2688 C  CD  . LYS A 1 341 ? 14.354  -11.050 21.705  1.00 31.22  ? 341  LYS A CD  1 
ATOM   2689 C  CE  . LYS A 1 341 ? 15.676  -11.231 21.009  1.00 38.93  ? 341  LYS A CE  1 
ATOM   2690 N  NZ  . LYS A 1 341 ? 15.995  -12.671 20.874  1.00 43.70  ? 341  LYS A NZ  1 
ATOM   2691 N  N   . ASP A 1 342 ? 17.049  -12.315 26.049  1.00 29.75  ? 342  ASP A N   1 
ATOM   2692 C  CA  . ASP A 1 342 ? 17.883  -13.512 26.048  1.00 31.12  ? 342  ASP A CA  1 
ATOM   2693 C  C   . ASP A 1 342 ? 18.341  -13.930 27.445  1.00 35.73  ? 342  ASP A C   1 
ATOM   2694 O  O   . ASP A 1 342 ? 19.322  -14.669 27.579  1.00 34.12  ? 342  ASP A O   1 
ATOM   2695 C  CB  . ASP A 1 342 ? 19.095  -13.291 25.145  1.00 37.77  ? 342  ASP A CB  1 
ATOM   2696 C  CG  . ASP A 1 342 ? 18.702  -12.760 23.785  1.00 41.57  ? 342  ASP A CG  1 
ATOM   2697 O  OD1 . ASP A 1 342 ? 17.784  -13.351 23.172  1.00 37.08  ? 342  ASP A OD1 1 
ATOM   2698 O  OD2 . ASP A 1 342 ? 19.297  -11.756 23.336  1.00 46.43  ? 342  ASP A OD2 1 
ATOM   2699 N  N   . SER A 1 343 ? 17.666  -13.469 28.490  1.00 29.31  ? 343  SER A N   1 
ATOM   2700 C  CA  . SER A 1 343 ? 17.981  -13.926 29.837  1.00 32.44  ? 343  SER A CA  1 
ATOM   2701 C  C   . SER A 1 343 ? 16.688  -13.981 30.627  1.00 31.85  ? 343  SER A C   1 
ATOM   2702 O  O   . SER A 1 343 ? 15.661  -13.449 30.204  1.00 28.72  ? 343  SER A O   1 
ATOM   2703 C  CB  . SER A 1 343 ? 18.998  -13.016 30.539  1.00 31.39  ? 343  SER A CB  1 
ATOM   2704 O  OG  . SER A 1 343 ? 18.349  -11.886 31.092  1.00 35.75  ? 343  SER A OG  1 
ATOM   2705 N  N   . GLU A 1 344 ? 16.751  -14.642 31.786  1.00 32.11  ? 344  GLU A N   1 
ATOM   2706 C  CA  . GLU A 1 344 ? 15.628  -14.684 32.710  1.00 33.14  ? 344  GLU A CA  1 
ATOM   2707 C  C   . GLU A 1 344 ? 15.332  -13.335 33.341  1.00 27.93  ? 344  GLU A C   1 
ATOM   2708 O  O   . GLU A 1 344 ? 14.299  -13.204 34.009  1.00 30.77  ? 344  GLU A O   1 
ATOM   2709 C  CB  . GLU A 1 344 ? 15.892  -15.705 33.815  1.00 39.11  ? 344  GLU A CB  1 
ATOM   2710 C  CG  . GLU A 1 344 ? 16.050  -17.116 33.311  1.00 45.61  ? 344  GLU A CG  1 
ATOM   2711 C  CD  . GLU A 1 344 ? 16.299  -18.094 34.434  1.00 55.77  ? 344  GLU A CD  1 
ATOM   2712 O  OE1 . GLU A 1 344 ? 16.301  -17.661 35.610  1.00 46.92  ? 344  GLU A OE1 1 
ATOM   2713 O  OE2 . GLU A 1 344 ? 16.500  -19.291 34.136  1.00 61.68  ? 344  GLU A OE2 1 
ATOM   2714 N  N   . SER A 1 345 ? 16.213  -12.353 33.175  1.00 25.61  ? 345  SER A N   1 
ATOM   2715 C  CA  . SER A 1 345 ? 15.931  -10.973 33.563  1.00 28.86  ? 345  SER A CA  1 
ATOM   2716 C  C   . SER A 1 345 ? 15.643  -10.870 35.059  1.00 28.35  ? 345  SER A C   1 
ATOM   2717 O  O   . SER A 1 345 ? 14.662  -10.261 35.487  1.00 25.93  ? 345  SER A O   1 
ATOM   2718 C  CB  . SER A 1 345 ? 14.769  -10.398 32.742  1.00 27.08  ? 345  SER A CB  1 
ATOM   2719 O  OG  . SER A 1 345 ? 15.124  -10.303 31.370  1.00 26.71  ? 345  SER A OG  1 
ATOM   2720 N  N   . LYS A 1 346 ? 16.505  -11.478 35.866  1.00 28.19  ? 346  LYS A N   1 
ATOM   2721 C  CA  . LYS A 1 346 ? 16.403  -11.258 37.303  1.00 29.53  ? 346  LYS A CA  1 
ATOM   2722 C  C   . LYS A 1 346 ? 16.793  -9.820  37.599  1.00 27.42  ? 346  LYS A C   1 
ATOM   2723 O  O   . LYS A 1 346 ? 17.810  -9.323  37.108  1.00 31.41  ? 346  LYS A O   1 
ATOM   2724 C  CB  . LYS A 1 346 ? 17.288  -12.237 38.075  1.00 37.19  ? 346  LYS A CB  1 
ATOM   2725 C  CG  . LYS A 1 346 ? 16.726  -13.650 38.119  1.00 36.77  ? 346  LYS A CG  1 
ATOM   2726 C  CD  . LYS A 1 346 ? 17.820  -14.690 38.301  1.00 50.09  ? 346  LYS A CD  1 
ATOM   2727 C  CE  . LYS A 1 346 ? 17.241  -16.099 38.293  1.00 52.66  ? 346  LYS A CE  1 
ATOM   2728 N  NZ  . LYS A 1 346 ? 18.299  -17.156 38.269  1.00 55.63  ? 346  LYS A NZ  1 
ATOM   2729 N  N   . ILE A 1 347 ? 15.982  -9.156  38.399  1.00 25.46  ? 347  ILE A N   1 
ATOM   2730 C  CA  . ILE A 1 347 ? 16.012  -7.711  38.552  1.00 26.40  ? 347  ILE A CA  1 
ATOM   2731 C  C   . ILE A 1 347 ? 16.595  -7.385  39.920  1.00 31.36  ? 347  ILE A C   1 
ATOM   2732 O  O   . ILE A 1 347 ? 16.065  -7.825  40.947  1.00 28.77  ? 347  ILE A O   1 
ATOM   2733 C  CB  . ILE A 1 347 ? 14.598  -7.123  38.385  1.00 28.64  ? 347  ILE A CB  1 
ATOM   2734 C  CG1 . ILE A 1 347 ? 14.186  -7.228  36.917  1.00 31.68  ? 347  ILE A CG1 1 
ATOM   2735 C  CG2 . ILE A 1 347 ? 14.529  -5.684  38.847  1.00 26.86  ? 347  ILE A CG2 1 
ATOM   2736 C  CD1 . ILE A 1 347 ? 15.183  -6.571  35.993  1.00 25.57  ? 347  ILE A CD1 1 
ATOM   2737 N  N   . SER A 1 348 ? 17.670  -6.601  39.931  1.00 27.80  ? 348  SER A N   1 
ATOM   2738 C  CA  . SER A 1 348 ? 18.252  -6.130  41.176  1.00 32.76  ? 348  SER A CA  1 
ATOM   2739 C  C   . SER A 1 348 ? 17.281  -5.194  41.883  1.00 29.21  ? 348  SER A C   1 
ATOM   2740 O  O   . SER A 1 348 ? 16.344  -4.660  41.284  1.00 29.34  ? 348  SER A O   1 
ATOM   2741 C  CB  . SER A 1 348 ? 19.563  -5.391  40.914  1.00 30.79  ? 348  SER A CB  1 
ATOM   2742 O  OG  . SER A 1 348 ? 19.307  -4.109  40.347  1.00 30.28  ? 348  SER A OG  1 
ATOM   2743 N  N   . ARG A 1 349 ? 17.531  -4.992  43.177  1.00 27.87  ? 349  ARG A N   1 
ATOM   2744 C  CA  . ARG A 1 349 ? 16.788  -3.993  43.936  1.00 30.08  ? 349  ARG A CA  1 
ATOM   2745 C  C   . ARG A 1 349 ? 16.921  -2.610  43.314  1.00 25.62  ? 349  ARG A C   1 
ATOM   2746 O  O   . ARG A 1 349 ? 15.939  -1.866  43.216  1.00 25.28  ? 349  ARG A O   1 
ATOM   2747 C  CB  . ARG A 1 349 ? 17.284  -3.968  45.385  1.00 32.48  ? 349  ARG A CB  1 
ATOM   2748 C  CG  . ARG A 1 349 ? 16.341  -3.302  46.313  1.00 36.74  ? 349  ARG A CG  1 
ATOM   2749 C  CD  . ARG A 1 349 ? 15.115  -4.164  46.519  1.00 44.09  ? 349  ARG A CD  1 
ATOM   2750 N  NE  . ARG A 1 349 ? 13.945  -3.332  46.750  1.00 44.04  ? 349  ARG A NE  1 
ATOM   2751 C  CZ  . ARG A 1 349 ? 12.688  -3.723  46.582  1.00 39.60  ? 349  ARG A CZ  1 
ATOM   2752 N  NH1 . ARG A 1 349 ? 12.411  -4.959  46.191  1.00 37.47  ? 349  ARG A NH1 1 
ATOM   2753 N  NH2 . ARG A 1 349 ? 11.707  -2.866  46.814  1.00 33.79  ? 349  ARG A NH2 1 
ATOM   2754 N  N   . GLU A 1 350 ? 18.132  -2.245  42.899  1.00 25.17  ? 350  GLU A N   1 
ATOM   2755 C  CA  . GLU A 1 350 ? 18.350  -0.936  42.292  1.00 27.12  ? 350  GLU A CA  1 
ATOM   2756 C  C   . GLU A 1 350 ? 17.538  -0.779  41.005  1.00 22.29  ? 350  GLU A C   1 
ATOM   2757 O  O   . GLU A 1 350 ? 16.900  0.255   40.781  1.00 25.95  ? 350  GLU A O   1 
ATOM   2758 C  CB  . GLU A 1 350 ? 19.844  -0.744  42.015  1.00 28.50  ? 350  GLU A CB  1 
ATOM   2759 C  CG  . GLU A 1 350 ? 20.198  0.584   41.369  1.00 30.58  ? 350  GLU A CG  1 
ATOM   2760 C  CD  . GLU A 1 350 ? 21.695  0.705   41.109  0.93 35.61  ? 350  GLU A CD  1 
ATOM   2761 O  OE1 . GLU A 1 350 ? 22.469  0.747   42.085  0.85 48.58  ? 350  GLU A OE1 1 
ATOM   2762 O  OE2 . GLU A 1 350 ? 22.091  0.741   39.933  0.73 38.34  ? 350  GLU A OE2 1 
ATOM   2763 N  N   . ASP A 1 351 ? 17.547  -1.801  40.151  1.00 25.06  ? 351  ASP A N   1 
ATOM   2764 C  CA  . ASP A 1 351 ? 16.778  -1.734  38.909  1.00 24.31  ? 351  ASP A CA  1 
ATOM   2765 C  C   . ASP A 1 351 ? 15.279  -1.826  39.169  1.00 26.12  ? 351  ASP A C   1 
ATOM   2766 O  O   . ASP A 1 351 ? 14.478  -1.314  38.376  1.00 26.39  ? 351  ASP A O   1 
ATOM   2767 C  CB  . ASP A 1 351 ? 17.229  -2.839  37.961  1.00 27.41  ? 351  ASP A CB  1 
ATOM   2768 C  CG  . ASP A 1 351 ? 18.534  -2.498  37.270  1.00 31.33  ? 351  ASP A CG  1 
ATOM   2769 O  OD1 . ASP A 1 351 ? 18.963  -1.319  37.357  1.00 29.62  ? 351  ASP A OD1 1 
ATOM   2770 O  OD2 . ASP A 1 351 ? 19.116  -3.405  36.642  1.00 28.66  ? 351  ASP A OD2 1 
ATOM   2771 N  N   . PHE A 1 352 ? 14.882  -2.473  40.266  1.00 26.08  ? 352  PHE A N   1 
ATOM   2772 C  CA  . PHE A 1 352 ? 13.473  -2.473  40.638  1.00 25.05  ? 352  PHE A CA  1 
ATOM   2773 C  C   . PHE A 1 352 ? 13.001  -1.058  40.935  1.00 27.89  ? 352  PHE A C   1 
ATOM   2774 O  O   . PHE A 1 352 ? 11.975  -0.610  40.408  1.00 27.44  ? 352  PHE A O   1 
ATOM   2775 C  CB  . PHE A 1 352 ? 13.244  -3.385  41.842  1.00 24.22  ? 352  PHE A CB  1 
ATOM   2776 C  CG  . PHE A 1 352 ? 11.817  -3.441  42.288  1.00 25.73  ? 352  PHE A CG  1 
ATOM   2777 C  CD1 . PHE A 1 352 ? 10.919  -4.286  41.659  1.00 22.84  ? 352  PHE A CD1 1 
ATOM   2778 C  CD2 . PHE A 1 352 ? 11.372  -2.649  43.335  1.00 25.96  ? 352  PHE A CD2 1 
ATOM   2779 C  CE1 . PHE A 1 352 ? 9.584   -4.343  42.069  1.00 24.40  ? 352  PHE A CE1 1 
ATOM   2780 C  CE2 . PHE A 1 352 ? 10.040  -2.703  43.749  1.00 25.57  ? 352  PHE A CE2 1 
ATOM   2781 C  CZ  . PHE A 1 352 ? 9.151   -3.547  43.116  1.00 22.37  ? 352  PHE A CZ  1 
ATOM   2782 N  N   . MET A 1 353 ? 13.749  -0.334  41.771  1.00 23.64  ? 353  MET A N   1 
ATOM   2783 C  CA  . MET A 1 353 ? 13.382  1.041   42.096  1.00 25.02  ? 353  MET A CA  1 
ATOM   2784 C  C   . MET A 1 353 ? 13.339  1.912   40.844  1.00 25.71  ? 353  MET A C   1 
ATOM   2785 O  O   . MET A 1 353 ? 12.453  2.763   40.702  1.00 27.71  ? 353  MET A O   1 
ATOM   2786 C  CB  . MET A 1 353 ? 14.361  1.628   43.121  1.00 26.35  ? 353  MET A CB  1 
ATOM   2787 C  CG  . MET A 1 353 ? 14.418  0.909   44.483  1.00 39.56  ? 353  MET A CG  1 
ATOM   2788 S  SD  . MET A 1 353 ? 12.808  0.600   45.258  1.00 48.20  ? 353  MET A SD  1 
ATOM   2789 C  CE  . MET A 1 353 ? 12.049  2.224   45.204  1.00 36.98  ? 353  MET A CE  1 
ATOM   2790 N  N   . SER A 1 354 ? 14.288  1.715   39.920  1.00 25.99  ? 354  SER A N   1 
ATOM   2791 C  CA  . SER A 1 354 ? 14.254  2.478   38.673  1.00 24.47  ? 354  SER A CA  1 
ATOM   2792 C  C   . SER A 1 354 ? 13.010  2.145   37.863  1.00 24.33  ? 354  SER A C   1 
ATOM   2793 O  O   . SER A 1 354 ? 12.373  3.036   37.296  1.00 24.87  ? 354  SER A O   1 
ATOM   2794 C  CB  . SER A 1 354 ? 15.521  2.206   37.854  1.00 22.23  ? 354  SER A CB  1 
ATOM   2795 O  OG  . SER A 1 354 ? 16.631  2.779   38.524  1.00 27.77  ? 354  SER A OG  1 
ATOM   2796 N  N   . GLY A 1 355 ? 12.647  0.864   37.806  1.00 24.12  ? 355  GLY A N   1 
ATOM   2797 C  CA  . GLY A 1 355 ? 11.468  0.469   37.062  1.00 22.36  ? 355  GLY A CA  1 
ATOM   2798 C  C   . GLY A 1 355 ? 10.182  1.035   37.633  1.00 25.24  ? 355  GLY A C   1 
ATOM   2799 O  O   . GLY A 1 355 ? 9.261   1.368   36.883  1.00 22.51  ? 355  GLY A O   1 
ATOM   2800 N  N   . VAL A 1 356 ? 10.088  1.133   38.963  1.00 23.68  ? 356  VAL A N   1 
ATOM   2801 C  CA  . VAL A 1 356 ? 8.889   1.709   39.570  1.00 26.01  ? 356  VAL A CA  1 
ATOM   2802 C  C   . VAL A 1 356 ? 8.731   3.159   39.139  1.00 27.67  ? 356  VAL A C   1 
ATOM   2803 O  O   . VAL A 1 356 ? 7.626   3.617   38.810  1.00 26.76  ? 356  VAL A O   1 
ATOM   2804 C  CB  . VAL A 1 356 ? 8.946   1.592   41.107  1.00 28.01  ? 356  VAL A CB  1 
ATOM   2805 C  CG1 . VAL A 1 356 ? 7.773   2.346   41.733  1.00 28.71  ? 356  VAL A CG1 1 
ATOM   2806 C  CG2 . VAL A 1 356 ? 8.939   0.141   41.531  1.00 25.96  ? 356  VAL A CG2 1 
ATOM   2807 N  N   . LYS A 1 357 ? 9.838   3.900   39.127  1.00 21.03  ? 357  LYS A N   1 
ATOM   2808 C  CA  . LYS A 1 357 ? 9.794   5.304   38.738  1.00 24.12  ? 357  LYS A CA  1 
ATOM   2809 C  C   . LYS A 1 357 ? 9.373   5.452   37.278  1.00 23.36  ? 357  LYS A C   1 
ATOM   2810 O  O   . LYS A 1 357 ? 8.548   6.312   36.944  1.00 26.14  ? 357  LYS A O   1 
ATOM   2811 C  CB  . LYS A 1 357 ? 11.166  5.930   38.988  1.00 30.46  ? 357  LYS A CB  1 
ATOM   2812 C  CG  . LYS A 1 357 ? 11.358  7.324   38.469  1.00 35.63  ? 357  LYS A CG  1 
ATOM   2813 C  CD  . LYS A 1 357 ? 10.745  8.334   39.400  1.00 35.66  ? 357  LYS A CD  1 
ATOM   2814 C  CE  . LYS A 1 357 ? 11.419  9.686   39.260  1.00 40.28  ? 357  LYS A CE  1 
ATOM   2815 N  NZ  . LYS A 1 357 ? 10.634  10.731  39.961  1.00 46.44  ? 357  LYS A NZ  1 
ATOM   2816 N  N   . LEU A 1 358 ? 9.926   4.614   36.397  1.00 24.86  ? 358  LEU A N   1 
ATOM   2817 C  CA  . LEU A 1 358 ? 9.515   4.623   34.990  1.00 20.82  ? 358  LEU A CA  1 
ATOM   2818 C  C   . LEU A 1 358 ? 8.050   4.240   34.826  1.00 26.25  ? 358  LEU A C   1 
ATOM   2819 O  O   . LEU A 1 358 ? 7.381   4.742   33.917  1.00 27.69  ? 358  LEU A O   1 
ATOM   2820 C  CB  . LEU A 1 358 ? 10.382  3.663   34.178  1.00 23.03  ? 358  LEU A CB  1 
ATOM   2821 C  CG  . LEU A 1 358 ? 11.863  4.025   34.073  1.00 25.87  ? 358  LEU A CG  1 
ATOM   2822 C  CD1 . LEU A 1 358 ? 12.660  2.895   33.426  1.00 25.33  ? 358  LEU A CD1 1 
ATOM   2823 C  CD2 . LEU A 1 358 ? 12.015  5.315   33.273  1.00 27.61  ? 358  LEU A CD2 1 
ATOM   2824 N  N   . SER A 1 359 ? 7.538   3.348   35.686  1.00 25.51  ? 359  SER A N   1 
ATOM   2825 C  CA  . SER A 1 359 ? 6.193   2.811   35.517  1.00 24.11  ? 359  SER A CA  1 
ATOM   2826 C  C   . SER A 1 359 ? 5.121   3.758   36.027  1.00 25.24  ? 359  SER A C   1 
ATOM   2827 O  O   . SER A 1 359 ? 3.986   3.739   35.528  1.00 26.25  ? 359  SER A O   1 
ATOM   2828 C  CB  . SER A 1 359 ? 6.066   1.467   36.237  1.00 24.75  ? 359  SER A CB  1 
ATOM   2829 O  OG  . SER A 1 359 ? 7.024   0.544   35.749  1.00 28.04  ? 359  SER A OG  1 
ATOM   2830 N  N   . VAL A 1 360 ? 5.439   4.564   37.031  1.00 24.56  ? 360  VAL A N   1 
ATOM   2831 C  CA  . VAL A 1 360 ? 4.465   5.494   37.590  1.00 25.16  ? 360  VAL A CA  1 
ATOM   2832 C  C   . VAL A 1 360 ? 5.098   6.877   37.543  1.00 28.91  ? 360  VAL A C   1 
ATOM   2833 O  O   . VAL A 1 360 ? 5.405   7.468   38.592  1.00 31.66  ? 360  VAL A O   1 
ATOM   2834 C  CB  . VAL A 1 360 ? 4.037   5.080   39.009  1.00 28.39  ? 360  VAL A CB  1 
ATOM   2835 C  CG1 . VAL A 1 360 ? 2.729   5.771   39.385  1.00 28.00  ? 360  VAL A CG1 1 
ATOM   2836 C  CG2 . VAL A 1 360 ? 3.861   3.573   39.077  1.00 25.05  ? 360  VAL A CG2 1 
ATOM   2837 N  N   . PRO A 1 361 ? 5.293   7.426   36.341  1.00 27.77  ? 361  PRO A N   1 
ATOM   2838 C  CA  . PRO A 1 361 ? 6.104   8.642   36.201  1.00 29.93  ? 361  PRO A CA  1 
ATOM   2839 C  C   . PRO A 1 361 ? 5.483   9.856   36.844  1.00 29.50  ? 361  PRO A C   1 
ATOM   2840 O  O   . PRO A 1 361 ? 6.211   10.784  37.215  1.00 33.89  ? 361  PRO A O   1 
ATOM   2841 C  CB  . PRO A 1 361 ? 6.209   8.816   34.679  1.00 28.52  ? 361  PRO A CB  1 
ATOM   2842 C  CG  . PRO A 1 361 ? 4.971   8.157   34.148  1.00 29.78  ? 361  PRO A CG  1 
ATOM   2843 C  CD  . PRO A 1 361 ? 4.715   6.981   35.060  1.00 29.15  ? 361  PRO A CD  1 
ATOM   2844 N  N   . HIS A 1 362 ? 4.167   9.880   36.984  1.00 29.22  ? 362  HIS A N   1 
ATOM   2845 C  CA  . HIS A 1 362 ? 3.445   10.994  37.578  1.00 33.38  ? 362  HIS A CA  1 
ATOM   2846 C  C   . HIS A 1 362 ? 3.460   10.986  39.102  1.00 34.19  ? 362  HIS A C   1 
ATOM   2847 O  O   . HIS A 1 362 ? 2.955   11.936  39.706  1.00 40.10  ? 362  HIS A O   1 
ATOM   2848 C  CB  . HIS A 1 362 ? 1.993   10.970  37.095  1.00 40.31  ? 362  HIS A CB  1 
ATOM   2849 C  CG  . HIS A 1 362 ? 1.288   9.677   37.374  1.00 40.20  ? 362  HIS A CG  1 
ATOM   2850 N  ND1 . HIS A 1 362 ? 1.609   8.497   36.731  1.00 35.51  ? 362  HIS A ND1 1 
ATOM   2851 C  CD2 . HIS A 1 362 ? 0.278   9.378   38.228  1.00 34.83  ? 362  HIS A CD2 1 
ATOM   2852 C  CE1 . HIS A 1 362 ? 0.826   7.530   37.177  1.00 33.10  ? 362  HIS A CE1 1 
ATOM   2853 N  NE2 . HIS A 1 362 ? 0.008   8.038   38.084  1.00 35.47  ? 362  HIS A NE2 1 
ATOM   2854 N  N   . ALA A 1 363 ? 4.013   9.955   39.738  1.00 37.74  ? 363  ALA A N   1 
ATOM   2855 C  CA  . ALA A 1 363 ? 3.915   9.820   41.188  1.00 33.88  ? 363  ALA A CA  1 
ATOM   2856 C  C   . ALA A 1 363 ? 4.979   10.643  41.897  1.00 37.56  ? 363  ALA A C   1 
ATOM   2857 O  O   . ALA A 1 363 ? 6.132   10.702  41.459  1.00 39.71  ? 363  ALA A O   1 
ATOM   2858 C  CB  . ALA A 1 363 ? 4.055   8.352   41.599  1.00 31.58  ? 363  ALA A CB  1 
ATOM   2859 N  N   . ASN A 1 364 ? 4.600   11.259  43.015  1.00 35.92  ? 364  ASN A N   1 
ATOM   2860 C  CA  . ASN A 1 364 ? 5.608   11.857  43.874  1.00 37.58  ? 364  ASN A CA  1 
ATOM   2861 C  C   . ASN A 1 364 ? 6.343   10.760  44.643  1.00 34.99  ? 364  ASN A C   1 
ATOM   2862 O  O   . ASN A 1 364 ? 6.047   9.567   44.533  1.00 33.08  ? 364  ASN A O   1 
ATOM   2863 C  CB  . ASN A 1 364 ? 4.992   12.897  44.818  1.00 39.53  ? 364  ASN A CB  1 
ATOM   2864 C  CG  . ASN A 1 364 ? 3.850   12.343  45.657  1.00 39.63  ? 364  ASN A CG  1 
ATOM   2865 O  OD1 . ASN A 1 364 ? 3.627   11.134  45.711  1.00 36.05  ? 364  ASN A OD1 1 
ATOM   2866 N  ND2 . ASN A 1 364 ? 3.136   13.231  46.339  1.00 42.85  ? 364  ASN A ND2 1 
ATOM   2867 N  N   . ASP A 1 365 ? 7.321   11.185  45.436  1.00 33.32  ? 365  ASP A N   1 
ATOM   2868 C  CA  . ASP A 1 365 ? 8.152   10.249  46.190  1.00 37.63  ? 365  ASP A CA  1 
ATOM   2869 C  C   . ASP A 1 365 ? 7.318   9.404   47.160  1.00 35.38  ? 365  ASP A C   1 
ATOM   2870 O  O   . ASP A 1 365 ? 7.560   8.196   47.314  1.00 34.24  ? 365  ASP A O   1 
ATOM   2871 C  CB  . ASP A 1 365 ? 9.249   11.047  46.911  1.00 43.35  ? 365  ASP A CB  1 
ATOM   2872 C  CG  . ASP A 1 365 ? 9.879   10.303  48.058  1.00 53.05  ? 365  ASP A CG  1 
ATOM   2873 O  OD1 . ASP A 1 365 ? 9.418   10.507  49.206  1.00 59.13  ? 365  ASP A OD1 1 
ATOM   2874 O  OD2 . ASP A 1 365 ? 10.830  9.507   47.840  1.00 56.54  ? 365  ASP A OD2 1 
ATOM   2875 N  N   . LEU A 1 366 ? 6.317   10.013  47.807  1.00 32.56  ? 366  LEU A N   1 
ATOM   2876 C  CA  . LEU A 1 366 ? 5.434   9.240   48.677  1.00 33.79  ? 366  LEU A CA  1 
ATOM   2877 C  C   . LEU A 1 366 ? 4.669   8.187   47.883  1.00 33.47  ? 366  LEU A C   1 
ATOM   2878 O  O   . LEU A 1 366 ? 4.524   7.041   48.329  1.00 29.32  ? 366  LEU A O   1 
ATOM   2879 C  CB  . LEU A 1 366 ? 4.466   10.171  49.398  1.00 32.34  ? 366  LEU A CB  1 
ATOM   2880 C  CG  . LEU A 1 366 ? 3.557   9.509   50.454  1.00 33.77  ? 366  LEU A CG  1 
ATOM   2881 C  CD1 . LEU A 1 366 ? 4.346   9.019   51.646  1.00 32.56  ? 366  LEU A CD1 1 
ATOM   2882 C  CD2 . LEU A 1 366 ? 2.442   10.458  50.902  1.00 34.25  ? 366  LEU A CD2 1 
ATOM   2883 N  N   . GLY A 1 367 ? 4.194   8.552   46.692  1.00 29.70  ? 367  GLY A N   1 
ATOM   2884 C  CA  . GLY A 1 367 ? 3.488   7.584   45.868  1.00 26.96  ? 367  GLY A CA  1 
ATOM   2885 C  C   . GLY A 1 367 ? 4.382   6.442   45.437  1.00 27.08  ? 367  GLY A C   1 
ATOM   2886 O  O   . GLY A 1 367 ? 3.985   5.276   45.493  1.00 27.42  ? 367  GLY A O   1 
ATOM   2887 N  N   . LEU A 1 368 ? 5.612   6.761   45.016  1.00 26.21  ? 368  LEU A N   1 
ATOM   2888 C  CA  . LEU A 1 368 ? 6.569   5.713   44.680  1.00 30.95  ? 368  LEU A CA  1 
ATOM   2889 C  C   . LEU A 1 368 ? 6.817   4.779   45.859  1.00 25.52  ? 368  LEU A C   1 
ATOM   2890 O  O   . LEU A 1 368 ? 6.897   3.558   45.678  1.00 24.95  ? 368  LEU A O   1 
ATOM   2891 C  CB  . LEU A 1 368 ? 7.881   6.328   44.193  1.00 31.73  ? 368  LEU A CB  1 
ATOM   2892 C  CG  . LEU A 1 368 ? 7.825   7.103   42.869  1.00 33.50  ? 368  LEU A CG  1 
ATOM   2893 C  CD1 . LEU A 1 368 ? 9.205   7.652   42.541  1.00 38.38  ? 368  LEU A CD1 1 
ATOM   2894 C  CD2 . LEU A 1 368 ? 7.279   6.253   41.717  1.00 33.94  ? 368  LEU A CD2 1 
ATOM   2895 N  N   . ASP A 1 369 ? 6.959   5.331   47.069  1.00 30.41  ? 369  ASP A N   1 
ATOM   2896 C  CA  . ASP A 1 369 ? 7.106   4.486   48.254  1.00 28.32  ? 369  ASP A CA  1 
ATOM   2897 C  C   . ASP A 1 369 ? 5.910   3.560   48.420  1.00 25.23  ? 369  ASP A C   1 
ATOM   2898 O  O   . ASP A 1 369 ? 6.071   2.387   48.783  1.00 25.24  ? 369  ASP A O   1 
ATOM   2899 C  CB  . ASP A 1 369 ? 7.271   5.342   49.514  1.00 28.11  ? 369  ASP A CB  1 
ATOM   2900 C  CG  . ASP A 1 369 ? 8.611   6.036   49.585  1.00 37.13  ? 369  ASP A CG  1 
ATOM   2901 O  OD1 . ASP A 1 369 ? 9.482   5.770   48.730  1.00 36.34  ? 369  ASP A OD1 1 
ATOM   2902 O  OD2 . ASP A 1 369 ? 8.797   6.843   50.520  1.00 42.89  ? 369  ASP A OD2 1 
ATOM   2903 N  N   . ALA A 1 370 ? 4.699   4.076   48.176  1.00 21.95  ? 370  ALA A N   1 
ATOM   2904 C  CA  . ALA A 1 370 ? 3.500   3.262   48.338  1.00 23.51  ? 370  ALA A CA  1 
ATOM   2905 C  C   . ALA A 1 370 ? 3.501   2.092   47.368  1.00 25.39  ? 370  ALA A C   1 
ATOM   2906 O  O   . ALA A 1 370 ? 3.227   0.951   47.757  1.00 22.60  ? 370  ALA A O   1 
ATOM   2907 C  CB  . ALA A 1 370 ? 2.246   4.120   48.143  1.00 24.85  ? 370  ALA A CB  1 
ATOM   2908 N  N   . VAL A 1 371 ? 3.785   2.365   46.083  1.00 23.00  ? 371  VAL A N   1 
ATOM   2909 C  CA  . VAL A 1 371 ? 3.866   1.297   45.086  1.00 25.10  ? 371  VAL A CA  1 
ATOM   2910 C  C   . VAL A 1 371 ? 4.923   0.276   45.485  1.00 23.84  ? 371  VAL A C   1 
ATOM   2911 O  O   . VAL A 1 371 ? 4.689   -0.937  45.434  1.00 24.32  ? 371  VAL A O   1 
ATOM   2912 C  CB  . VAL A 1 371 ? 4.164   1.877   43.691  1.00 23.01  ? 371  VAL A CB  1 
ATOM   2913 C  CG1 . VAL A 1 371 ? 4.333   0.750   42.680  1.00 23.60  ? 371  VAL A CG1 1 
ATOM   2914 C  CG2 . VAL A 1 371 ? 3.056   2.819   43.272  1.00 24.76  ? 371  VAL A CG2 1 
ATOM   2915 N  N   . THR A 1 372 ? 6.104   0.757   45.881  1.00 22.88  ? 372  THR A N   1 
ATOM   2916 C  CA  . THR A 1 372 ? 7.191   -0.144  46.255  1.00 27.06  ? 372  THR A CA  1 
ATOM   2917 C  C   . THR A 1 372 ? 6.777   -1.039  47.414  1.00 25.80  ? 372  THR A C   1 
ATOM   2918 O  O   . THR A 1 372 ? 6.963   -2.261  47.371  1.00 23.73  ? 372  THR A O   1 
ATOM   2919 C  CB  . THR A 1 372 ? 8.435   0.662   46.632  1.00 29.13  ? 372  THR A CB  1 
ATOM   2920 O  OG1 . THR A 1 372 ? 8.848   1.446   45.509  1.00 30.47  ? 372  THR A OG1 1 
ATOM   2921 C  CG2 . THR A 1 372 ? 9.567   -0.267  47.050  1.00 29.02  ? 372  THR A CG2 1 
ATOM   2922 N  N   . LEU A 1 373 ? 6.186   -0.446  48.451  1.00 22.80  ? 373  LEU A N   1 
ATOM   2923 C  CA  . LEU A 1 373 ? 5.790   -1.239  49.610  1.00 27.60  ? 373  LEU A CA  1 
ATOM   2924 C  C   . LEU A 1 373 ? 4.730   -2.257  49.225  1.00 29.03  ? 373  LEU A C   1 
ATOM   2925 O  O   . LEU A 1 373 ? 4.739   -3.404  49.691  1.00 27.89  ? 373  LEU A O   1 
ATOM   2926 C  CB  . LEU A 1 373 ? 5.269   -0.321  50.711  1.00 27.16  ? 373  LEU A CB  1 
ATOM   2927 C  CG  . LEU A 1 373 ? 4.758   -1.042  51.958  1.00 32.08  ? 373  LEU A CG  1 
ATOM   2928 C  CD1 . LEU A 1 373 ? 5.810   -2.027  52.471  1.00 29.40  ? 373  LEU A CD1 1 
ATOM   2929 C  CD2 . LEU A 1 373 ? 4.397   -0.022  53.021  1.00 30.22  ? 373  LEU A CD2 1 
ATOM   2930 N  N   . GLN A 1 374 ? 3.824   -1.859  48.343  1.00 23.84  ? 374  GLN A N   1 
ATOM   2931 C  CA  . GLN A 1 374 ? 2.726   -2.730  47.979  1.00 24.98  ? 374  GLN A CA  1 
ATOM   2932 C  C   . GLN A 1 374 ? 3.200   -3.957  47.208  1.00 28.28  ? 374  GLN A C   1 
ATOM   2933 O  O   . GLN A 1 374 ? 2.550   -5.010  47.261  1.00 26.85  ? 374  GLN A O   1 
ATOM   2934 C  CB  . GLN A 1 374 ? 1.734   -1.917  47.170  1.00 30.20  ? 374  GLN A CB  1 
ATOM   2935 C  CG  . GLN A 1 374 ? 0.505   -2.632  46.912  1.00 27.62  ? 374  GLN A CG  1 
ATOM   2936 C  CD  . GLN A 1 374 ? -0.489  -2.575  48.045  1.00 35.14  ? 374  GLN A CD  1 
ATOM   2937 O  OE1 . GLN A 1 374 ? -0.246  -1.962  49.082  1.00 34.38  ? 374  GLN A OE1 1 
ATOM   2938 N  NE2 . GLN A 1 374 ? -1.619  -3.232  47.851  1.00 31.50  ? 374  GLN A NE2 1 
ATOM   2939 N  N   . TYR A 1 375 ? 4.341   -3.855  46.515  1.00 21.53  ? 375  TYR A N   1 
ATOM   2940 C  CA  . TYR A 1 375 ? 4.822   -4.924  45.650  1.00 25.37  ? 375  TYR A CA  1 
ATOM   2941 C  C   . TYR A 1 375 ? 6.148   -5.532  46.094  1.00 29.02  ? 375  TYR A C   1 
ATOM   2942 O  O   . TYR A 1 375 ? 6.737   -6.319  45.332  1.00 27.95  ? 375  TYR A O   1 
ATOM   2943 C  CB  . TYR A 1 375 ? 4.949   -4.414  44.202  1.00 24.82  ? 375  TYR A CB  1 
ATOM   2944 C  CG  . TYR A 1 375 ? 3.616   -4.286  43.512  1.00 21.52  ? 375  TYR A CG  1 
ATOM   2945 C  CD1 . TYR A 1 375 ? 2.884   -3.109  43.594  1.00 22.53  ? 375  TYR A CD1 1 
ATOM   2946 C  CD2 . TYR A 1 375 ? 3.087   -5.343  42.795  1.00 25.66  ? 375  TYR A CD2 1 
ATOM   2947 C  CE1 . TYR A 1 375 ? 1.654   -2.986  42.966  1.00 24.78  ? 375  TYR A CE1 1 
ATOM   2948 C  CE2 . TYR A 1 375 ? 1.839   -5.239  42.166  1.00 24.55  ? 375  TYR A CE2 1 
ATOM   2949 C  CZ  . TYR A 1 375 ? 1.137   -4.057  42.254  1.00 25.37  ? 375  TYR A CZ  1 
ATOM   2950 O  OH  . TYR A 1 375 ? -0.089  -3.938  41.634  1.00 26.24  ? 375  TYR A OH  1 
ATOM   2951 N  N   . THR A 1 376 ? 6.644   -5.210  47.289  1.00 25.18  ? 376  THR A N   1 
ATOM   2952 C  CA  . THR A 1 376 ? 7.921   -5.741  47.751  1.00 28.17  ? 376  THR A CA  1 
ATOM   2953 C  C   . THR A 1 376 ? 7.686   -6.717  48.894  1.00 29.60  ? 376  THR A C   1 
ATOM   2954 O  O   . THR A 1 376 ? 6.949   -6.412  49.840  1.00 25.17  ? 376  THR A O   1 
ATOM   2955 C  CB  . THR A 1 376 ? 8.876   -4.632  48.207  1.00 29.22  ? 376  THR A CB  1 
ATOM   2956 O  OG1 . THR A 1 376 ? 9.218   -3.799  47.096  1.00 27.89  ? 376  THR A OG1 1 
ATOM   2957 C  CG2 . THR A 1 376 ? 10.154  -5.230  48.792  1.00 31.77  ? 376  THR A CG2 1 
ATOM   2958 N  N   . ASP A 1 377 ? 8.287   -7.898  48.780  1.00 25.76  ? 377  ASP A N   1 
ATOM   2959 C  CA  . ASP A 1 377 ? 8.305   -8.889  49.849  1.00 27.04  ? 377  ASP A CA  1 
ATOM   2960 C  C   . ASP A 1 377 ? 9.540   -8.583  50.684  1.00 26.04  ? 377  ASP A C   1 
ATOM   2961 O  O   . ASP A 1 377 ? 10.661  -8.958  50.324  1.00 24.89  ? 377  ASP A O   1 
ATOM   2962 C  CB  . ASP A 1 377 ? 8.330   -10.301 49.277  1.00 30.82  ? 377  ASP A CB  1 
ATOM   2963 C  CG  . ASP A 1 377 ? 8.450   -11.379 50.346  1.00 31.42  ? 377  ASP A CG  1 
ATOM   2964 O  OD1 . ASP A 1 377 ? 8.514   -11.059 51.558  1.00 30.37  ? 377  ASP A OD1 1 
ATOM   2965 O  OD2 . ASP A 1 377 ? 8.463   -12.571 49.963  1.00 30.74  ? 377  ASP A OD2 1 
ATOM   2966 N  N   . TRP A 1 378 ? 9.336   -7.898  51.806  1.00 27.43  ? 378  TRP A N   1 
ATOM   2967 C  CA  . TRP A 1 378 ? 10.465  -7.496  52.635  1.00 28.23  ? 378  TRP A CA  1 
ATOM   2968 C  C   . TRP A 1 378 ? 11.061  -8.635  53.460  1.00 28.45  ? 378  TRP A C   1 
ATOM   2969 O  O   . TRP A 1 378 ? 12.053  -8.407  54.164  1.00 25.56  ? 378  TRP A O   1 
ATOM   2970 C  CB  . TRP A 1 378 ? 10.055  -6.327  53.528  1.00 27.10  ? 378  TRP A CB  1 
ATOM   2971 C  CG  . TRP A 1 378 ? 10.084  -5.051  52.753  1.00 30.30  ? 378  TRP A CG  1 
ATOM   2972 C  CD1 . TRP A 1 378 ? 9.020   -4.290  52.392  1.00 32.01  ? 378  TRP A CD1 1 
ATOM   2973 C  CD2 . TRP A 1 378 ? 11.245  -4.410  52.205  1.00 30.79  ? 378  TRP A CD2 1 
ATOM   2974 N  NE1 . TRP A 1 378 ? 9.442   -3.199  51.671  1.00 30.72  ? 378  TRP A NE1 1 
ATOM   2975 C  CE2 . TRP A 1 378 ? 10.806  -3.246  51.550  1.00 36.96  ? 378  TRP A CE2 1 
ATOM   2976 C  CE3 . TRP A 1 378 ? 12.615  -4.699  52.226  1.00 36.66  ? 378  TRP A CE3 1 
ATOM   2977 C  CZ2 . TRP A 1 378 ? 11.682  -2.376  50.900  1.00 42.76  ? 378  TRP A CZ2 1 
ATOM   2978 C  CZ3 . TRP A 1 378 ? 13.488  -3.831  51.588  1.00 42.62  ? 378  TRP A CZ3 1 
ATOM   2979 C  CH2 . TRP A 1 378 ? 13.017  -2.684  50.929  1.00 43.77  ? 378  TRP A CH2 1 
ATOM   2980 N  N   . MET A 1 379 ? 10.516  -9.853  53.381  1.00 26.69  ? 379  MET A N   1 
ATOM   2981 C  CA  . MET A 1 379 ? 11.275  -11.005 53.854  1.00 25.74  ? 379  MET A CA  1 
ATOM   2982 C  C   . MET A 1 379 ? 12.289  -11.494 52.822  1.00 31.25  ? 379  MET A C   1 
ATOM   2983 O  O   . MET A 1 379 ? 13.167  -12.291 53.168  1.00 31.82  ? 379  MET A O   1 
ATOM   2984 C  CB  . MET A 1 379 ? 10.337  -12.159 54.225  1.00 25.71  ? 379  MET A CB  1 
ATOM   2985 C  CG  . MET A 1 379 ? 9.431   -11.863 55.432  1.00 34.13  ? 379  MET A CG  1 
ATOM   2986 S  SD  . MET A 1 379 ? 8.109   -13.074 55.608  1.00 45.27  ? 379  MET A SD  1 
ATOM   2987 C  CE  . MET A 1 379 ? 9.089   -14.514 56.025  1.00 41.85  ? 379  MET A CE  1 
ATOM   2988 N  N   . ASP A 1 380 ? 12.205  -11.019 51.578  1.00 29.05  ? 380  ASP A N   1 
ATOM   2989 C  CA  . ASP A 1 380 ? 12.996  -11.578 50.486  1.00 28.78  ? 380  ASP A CA  1 
ATOM   2990 C  C   . ASP A 1 380 ? 13.240  -10.529 49.404  1.00 32.25  ? 380  ASP A C   1 
ATOM   2991 O  O   . ASP A 1 380 ? 13.007  -10.786 48.215  1.00 28.66  ? 380  ASP A O   1 
ATOM   2992 C  CB  . ASP A 1 380 ? 12.256  -12.794 49.919  1.00 34.68  ? 380  ASP A CB  1 
ATOM   2993 C  CG  . ASP A 1 380 ? 13.125  -13.670 49.041  1.00 35.99  ? 380  ASP A CG  1 
ATOM   2994 O  OD1 . ASP A 1 380 ? 14.363  -13.514 49.080  1.00 32.44  ? 380  ASP A OD1 1 
ATOM   2995 O  OD2 . ASP A 1 380 ? 12.548  -14.518 48.321  1.00 33.50  ? 380  ASP A OD2 1 
ATOM   2996 N  N   . ASP A 1 381 ? 13.699  -9.340  49.803  1.00 28.26  ? 381  ASP A N   1 
ATOM   2997 C  CA  . ASP A 1 381 ? 13.704  -8.189  48.910  1.00 29.80  ? 381  ASP A CA  1 
ATOM   2998 C  C   . ASP A 1 381 ? 14.781  -8.255  47.838  1.00 32.86  ? 381  ASP A C   1 
ATOM   2999 O  O   . ASP A 1 381 ? 14.715  -7.479  46.880  1.00 34.92  ? 381  ASP A O   1 
ATOM   3000 C  CB  . ASP A 1 381 ? 13.882  -6.893  49.698  1.00 29.96  ? 381  ASP A CB  1 
ATOM   3001 C  CG  . ASP A 1 381 ? 15.011  -6.979  50.715  1.00 35.51  ? 381  ASP A CG  1 
ATOM   3002 O  OD1 . ASP A 1 381 ? 14.940  -7.847  51.608  1.00 34.12  ? 381  ASP A OD1 1 
ATOM   3003 O  OD2 . ASP A 1 381 ? 15.960  -6.173  50.619  1.00 35.01  ? 381  ASP A OD2 1 
ATOM   3004 N  N   . ASN A 1 382 ? 15.768  -9.139  47.974  1.00 31.06  ? 382  ASN A N   1 
ATOM   3005 C  CA  . ASN A 1 382 ? 16.815  -9.272  46.967  1.00 33.64  ? 382  ASN A CA  1 
ATOM   3006 C  C   . ASN A 1 382 ? 16.575  -10.449 46.037  1.00 33.19  ? 382  ASN A C   1 
ATOM   3007 O  O   . ASN A 1 382 ? 17.501  -10.902 45.360  1.00 36.35  ? 382  ASN A O   1 
ATOM   3008 C  CB  . ASN A 1 382 ? 18.182  -9.386  47.637  1.00 35.25  ? 382  ASN A CB  1 
ATOM   3009 C  CG  . ASN A 1 382 ? 18.670  -8.059  48.144  1.00 40.83  ? 382  ASN A CG  1 
ATOM   3010 O  OD1 . ASN A 1 382 ? 18.718  -7.083  47.394  1.00 36.61  ? 382  ASN A OD1 1 
ATOM   3011 N  ND2 . ASN A 1 382 ? 19.006  -7.997  49.432  1.00 38.19  ? 382  ASN A ND2 1 
ATOM   3012 N  N   . ASN A 1 383 ? 15.347  -10.949 45.991  1.00 29.58  ? 383  ASN A N   1 
ATOM   3013 C  CA  . ASN A 1 383 ? 14.983  -12.035 45.098  1.00 29.40  ? 383  ASN A CA  1 
ATOM   3014 C  C   . ASN A 1 383 ? 14.767  -11.442 43.707  1.00 27.82  ? 383  ASN A C   1 
ATOM   3015 O  O   . ASN A 1 383 ? 13.810  -10.692 43.492  1.00 26.82  ? 383  ASN A O   1 
ATOM   3016 C  CB  . ASN A 1 383 ? 13.734  -12.722 45.641  1.00 30.23  ? 383  ASN A CB  1 
ATOM   3017 C  CG  . ASN A 1 383 ? 13.365  -13.966 44.874  1.00 34.13  ? 383  ASN A CG  1 
ATOM   3018 O  OD1 . ASN A 1 383 ? 13.426  -13.999 43.639  1.00 30.86  ? 383  ASN A OD1 1 
ATOM   3019 N  ND2 . ASN A 1 383 ? 12.968  -15.003 45.601  1.00 33.40  ? 383  ASN A ND2 1 
ATOM   3020 N  N   . GLY A 1 384 ? 15.667  -11.751 42.768  1.00 29.35  ? 384  GLY A N   1 
ATOM   3021 C  CA  . GLY A 1 384 ? 15.568  -11.171 41.434  1.00 27.09  ? 384  GLY A CA  1 
ATOM   3022 C  C   . GLY A 1 384 ? 14.331  -11.605 40.670  1.00 27.61  ? 384  GLY A C   1 
ATOM   3023 O  O   . GLY A 1 384 ? 13.824  -10.859 39.823  1.00 28.73  ? 384  GLY A O   1 
ATOM   3024 N  N   . ILE A 1 385 ? 13.832  -12.811 40.941  1.00 23.85  ? 385  ILE A N   1 
ATOM   3025 C  CA  . ILE A 1 385 ? 12.617  -13.272 40.284  1.00 25.62  ? 385  ILE A CA  1 
ATOM   3026 C  C   . ILE A 1 385 ? 11.406  -12.531 40.832  1.00 29.57  ? 385  ILE A C   1 
ATOM   3027 O  O   . ILE A 1 385 ? 10.505  -12.133 40.078  1.00 27.06  ? 385  ILE A O   1 
ATOM   3028 C  CB  . ILE A 1 385 ? 12.480  -14.796 40.448  1.00 27.13  ? 385  ILE A CB  1 
ATOM   3029 C  CG1 . ILE A 1 385 ? 13.514  -15.521 39.588  1.00 36.07  ? 385  ILE A CG1 1 
ATOM   3030 C  CG2 . ILE A 1 385 ? 11.085  -15.258 40.086  1.00 30.78  ? 385  ILE A CG2 1 
ATOM   3031 C  CD1 . ILE A 1 385 ? 13.502  -17.017 39.776  1.00 35.20  ? 385  ILE A CD1 1 
ATOM   3032 N  N   . LYS A 1 386 ? 11.363  -12.323 42.150  1.00 24.99  ? 386  LYS A N   1 
ATOM   3033 C  CA  . LYS A 1 386 ? 10.244  -11.592 42.734  1.00 25.64  ? 386  LYS A CA  1 
ATOM   3034 C  C   . LYS A 1 386 ? 10.278  -10.125 42.328  1.00 23.04  ? 386  LYS A C   1 
ATOM   3035 O  O   . LYS A 1 386 ? 9.228   -9.502  42.134  1.00 23.85  ? 386  LYS A O   1 
ATOM   3036 C  CB  . LYS A 1 386 ? 10.269  -11.727 44.257  1.00 25.39  ? 386  LYS A CB  1 
ATOM   3037 C  CG  . LYS A 1 386 ? 9.812   -13.088 44.745  1.00 26.48  ? 386  LYS A CG  1 
ATOM   3038 C  CD  . LYS A 1 386 ? 9.939   -13.184 46.280  1.00 29.94  ? 386  LYS A CD  1 
ATOM   3039 C  CE  . LYS A 1 386 ? 9.340   -14.479 46.795  1.00 32.25  ? 386  LYS A CE  1 
ATOM   3040 N  NZ  . LYS A 1 386 ? 9.710   -14.682 48.239  1.00 39.89  ? 386  LYS A NZ  1 
ATOM   3041 N  N   . ASN A 1 387 ? 11.471  -9.553  42.204  1.00 23.74  ? 387  ASN A N   1 
ATOM   3042 C  CA  . ASN A 1 387 ? 11.557  -8.161  41.783  1.00 24.07  ? 387  ASN A CA  1 
ATOM   3043 C  C   . ASN A 1 387 ? 11.111  -8.017  40.338  1.00 23.31  ? 387  ASN A C   1 
ATOM   3044 O  O   . ASN A 1 387 ? 10.363  -7.094  40.001  1.00 24.19  ? 387  ASN A O   1 
ATOM   3045 C  CB  . ASN A 1 387 ? 12.984  -7.652  41.968  1.00 23.60  ? 387  ASN A CB  1 
ATOM   3046 C  CG  . ASN A 1 387 ? 13.312  -7.446  43.428  1.00 29.38  ? 387  ASN A CG  1 
ATOM   3047 O  OD1 . ASN A 1 387 ? 12.403  -7.400  44.247  1.00 28.81  ? 387  ASN A OD1 1 
ATOM   3048 N  ND2 . ASN A 1 387 ? 14.591  -7.337  43.763  1.00 30.11  ? 387  ASN A ND2 1 
ATOM   3049 N  N   . ARG A 1 388 ? 11.540  -8.946  39.488  1.00 23.00  ? 388  ARG A N   1 
ATOM   3050 C  CA  . ARG A 1 388 ? 11.119  -8.946  38.088  1.00 22.43  ? 388  ARG A CA  1 
ATOM   3051 C  C   . ARG A 1 388 ? 9.607   -9.100  37.964  1.00 25.33  ? 388  ARG A C   1 
ATOM   3052 O  O   . ARG A 1 388 ? 8.944   -8.313  37.278  1.00 23.80  ? 388  ARG A O   1 
ATOM   3053 C  CB  . ARG A 1 388 ? 11.831  -10.066 37.344  1.00 22.61  ? 388  ARG A CB  1 
ATOM   3054 C  CG  . ARG A 1 388 ? 11.428  -10.213 35.860  1.00 20.78  ? 388  ARG A CG  1 
ATOM   3055 C  CD  . ARG A 1 388 ? 11.767  -11.605 35.379  1.00 20.17  ? 388  ARG A CD  1 
ATOM   3056 N  NE  . ARG A 1 388 ? 10.846  -12.596 35.928  1.00 25.18  ? 388  ARG A NE  1 
ATOM   3057 C  CZ  . ARG A 1 388 ? 11.134  -13.884 36.068  1.00 25.89  ? 388  ARG A CZ  1 
ATOM   3058 N  NH1 . ARG A 1 388 ? 12.325  -14.344 35.710  1.00 26.41  ? 388  ARG A NH1 1 
ATOM   3059 N  NH2 . ARG A 1 388 ? 10.236  -14.712 36.576  1.00 29.32  ? 388  ARG A NH2 1 
ATOM   3060 N  N   . ASP A 1 389 ? 9.042   -10.109 38.630  1.00 24.29  ? 389  ASP A N   1 
ATOM   3061 C  CA  . ASP A 1 389 ? 7.603   -10.337 38.541  1.00 26.37  ? 389  ASP A CA  1 
ATOM   3062 C  C   . ASP A 1 389 ? 6.807   -9.227  39.222  1.00 29.33  ? 389  ASP A C   1 
ATOM   3063 O  O   . ASP A 1 389 ? 5.679   -8.930  38.801  1.00 27.60  ? 389  ASP A O   1 
ATOM   3064 C  CB  . ASP A 1 389 ? 7.249   -11.694 39.148  1.00 27.68  ? 389  ASP A CB  1 
ATOM   3065 C  CG  . ASP A 1 389 ? 7.800   -12.858 38.350  1.00 33.50  ? 389  ASP A CG  1 
ATOM   3066 O  OD1 . ASP A 1 389 ? 8.170   -12.681 37.157  1.00 30.90  ? 389  ASP A OD1 1 
ATOM   3067 O  OD2 . ASP A 1 389 ? 7.858   -13.969 38.921  1.00 37.09  ? 389  ASP A OD2 1 
ATOM   3068 N  N   . GLY A 1 390 ? 7.359   -8.622  40.280  1.00 25.22  ? 390  GLY A N   1 
ATOM   3069 C  CA  . GLY A 1 390 ? 6.681   -7.500  40.913  1.00 26.56  ? 390  GLY A CA  1 
ATOM   3070 C  C   . GLY A 1 390 ? 6.554   -6.314  39.977  1.00 26.58  ? 390  GLY A C   1 
ATOM   3071 O  O   . GLY A 1 390 ? 5.488   -5.706  39.862  1.00 23.75  ? 390  GLY A O   1 
ATOM   3072 N  N   . LEU A 1 391 ? 7.647   -5.984  39.279  1.00 25.32  ? 391  LEU A N   1 
ATOM   3073 C  CA  . LEU A 1 391 ? 7.607   -4.940  38.261  1.00 24.40  ? 391  LEU A CA  1 
ATOM   3074 C  C   . LEU A 1 391 ? 6.619   -5.288  37.155  1.00 21.12  ? 391  LEU A C   1 
ATOM   3075 O  O   . LEU A 1 391 ? 5.869   -4.425  36.691  1.00 24.20  ? 391  LEU A O   1 
ATOM   3076 C  CB  . LEU A 1 391 ? 9.013   -4.738  37.688  1.00 26.70  ? 391  LEU A CB  1 
ATOM   3077 C  CG  . LEU A 1 391 ? 9.586   -3.331  37.537  1.00 33.49  ? 391  LEU A CG  1 
ATOM   3078 C  CD1 . LEU A 1 391 ? 9.334   -2.528  38.766  1.00 31.41  ? 391  LEU A CD1 1 
ATOM   3079 C  CD2 . LEU A 1 391 ? 11.105  -3.409  37.290  1.00 27.26  ? 391  LEU A CD2 1 
ATOM   3080 N  N   . ASP A 1 392 ? 6.618   -6.548  36.715  1.00 22.84  ? 392  ASP A N   1 
ATOM   3081 C  CA  . ASP A 1 392 ? 5.669   -6.996  35.705  1.00 22.98  ? 392  ASP A CA  1 
ATOM   3082 C  C   . ASP A 1 392 ? 4.242   -6.718  36.156  1.00 27.02  ? 392  ASP A C   1 
ATOM   3083 O  O   . ASP A 1 392 ? 3.437   -6.149  35.408  1.00 25.66  ? 392  ASP A O   1 
ATOM   3084 C  CB  . ASP A 1 392 ? 5.876   -8.488  35.431  1.00 23.90  ? 392  ASP A CB  1 
ATOM   3085 C  CG  . ASP A 1 392 ? 5.303   -8.935  34.095  1.00 30.43  ? 392  ASP A CG  1 
ATOM   3086 O  OD1 . ASP A 1 392 ? 4.427   -8.238  33.533  1.00 27.35  ? 392  ASP A OD1 1 
ATOM   3087 O  OD2 . ASP A 1 392 ? 5.714   -10.010 33.621  1.00 30.86  ? 392  ASP A OD2 1 
ATOM   3088 N  N   . ASP A 1 393 ? 3.922   -7.077  37.401  1.00 19.49  ? 393  ASP A N   1 
ATOM   3089 C  CA  . ASP A 1 393 ? 2.573   -6.858  37.906  1.00 25.42  ? 393  ASP A CA  1 
ATOM   3090 C  C   . ASP A 1 393 ? 2.263   -5.374  38.043  1.00 23.29  ? 393  ASP A C   1 
ATOM   3091 O  O   . ASP A 1 393 ? 1.136   -4.949  37.764  1.00 22.65  ? 393  ASP A O   1 
ATOM   3092 C  CB  . ASP A 1 393 ? 2.380   -7.554  39.261  1.00 28.72  ? 393  ASP A CB  1 
ATOM   3093 C  CG  . ASP A 1 393 ? 2.265   -9.057  39.137  1.00 34.30  ? 393  ASP A CG  1 
ATOM   3094 O  OD1 . ASP A 1 393 ? 1.816   -9.541  38.075  1.00 38.73  ? 393  ASP A OD1 1 
ATOM   3095 O  OD2 . ASP A 1 393 ? 2.600   -9.760  40.113  1.00 34.78  ? 393  ASP A OD2 1 
ATOM   3096 N  N   . ILE A 1 394 ? 3.237   -4.573  38.492  1.00 20.22  ? 394  ILE A N   1 
ATOM   3097 C  CA  . ILE A 1 394 ? 3.015   -3.131  38.613  1.00 19.78  ? 394  ILE A CA  1 
ATOM   3098 C  C   . ILE A 1 394 ? 2.583   -2.550  37.272  1.00 20.65  ? 394  ILE A C   1 
ATOM   3099 O  O   . ILE A 1 394 ? 1.549   -1.876  37.161  1.00 22.91  ? 394  ILE A O   1 
ATOM   3100 C  CB  . ILE A 1 394 ? 4.277   -2.423  39.130  1.00 22.03  ? 394  ILE A CB  1 
ATOM   3101 C  CG1 . ILE A 1 394 ? 4.544   -2.759  40.603  1.00 22.69  ? 394  ILE A CG1 1 
ATOM   3102 C  CG2 . ILE A 1 394 ? 4.132   -0.927  38.975  1.00 19.80  ? 394  ILE A CG2 1 
ATOM   3103 C  CD1 . ILE A 1 394 ? 5.935   -2.295  41.091  1.00 24.22  ? 394  ILE A CD1 1 
ATOM   3104 N  N   . VAL A 1 395 ? 3.383   -2.792  36.240  1.00 18.66  ? 395  VAL A N   1 
ATOM   3105 C  CA  . VAL A 1 395 ? 3.080   -2.229  34.923  1.00 20.84  ? 395  VAL A CA  1 
ATOM   3106 C  C   . VAL A 1 395 ? 1.707   -2.684  34.446  1.00 21.52  ? 395  VAL A C   1 
ATOM   3107 O  O   . VAL A 1 395 ? 0.888   -1.873  33.991  1.00 22.04  ? 395  VAL A O   1 
ATOM   3108 C  CB  . VAL A 1 395 ? 4.188   -2.597  33.922  1.00 19.20  ? 395  VAL A CB  1 
ATOM   3109 C  CG1 . VAL A 1 395 ? 3.892   -2.010  32.544  1.00 19.44  ? 395  VAL A CG1 1 
ATOM   3110 C  CG2 . VAL A 1 395 ? 5.528   -2.064  34.417  1.00 21.70  ? 395  VAL A CG2 1 
ATOM   3111 N  N   . GLY A 1 396 ? 1.421   -3.982  34.558  1.00 20.50  ? 396  GLY A N   1 
ATOM   3112 C  CA  . GLY A 1 396 ? 0.148   -4.487  34.066  1.00 19.41  ? 396  GLY A CA  1 
ATOM   3113 C  C   . GLY A 1 396 ? -1.035  -4.014  34.894  1.00 23.25  ? 396  GLY A C   1 
ATOM   3114 O  O   . GLY A 1 396 ? -2.085  -3.657  34.346  1.00 20.73  ? 396  GLY A O   1 
ATOM   3115 N  N   . ASP A 1 397 ? -0.888  -4.005  36.226  1.00 20.45  ? 397  ASP A N   1 
ATOM   3116 C  CA  . ASP A 1 397 ? -2.000  -3.588  37.077  1.00 20.81  ? 397  ASP A CA  1 
ATOM   3117 C  C   . ASP A 1 397 ? -2.316  -2.115  36.870  1.00 20.39  ? 397  ASP A C   1 
ATOM   3118 O  O   . ASP A 1 397 ? -3.482  -1.729  36.740  1.00 20.84  ? 397  ASP A O   1 
ATOM   3119 C  CB  . ASP A 1 397 ? -1.688  -3.848  38.559  1.00 21.47  ? 397  ASP A CB  1 
ATOM   3120 C  CG  . ASP A 1 397 ? -1.548  -5.326  38.892  1.00 24.92  ? 397  ASP A CG  1 
ATOM   3121 O  OD1 . ASP A 1 397 ? -1.985  -6.184  38.096  1.00 21.77  ? 397  ASP A OD1 1 
ATOM   3122 O  OD2 . ASP A 1 397 ? -0.991  -5.631  39.972  1.00 25.40  ? 397  ASP A OD2 1 
ATOM   3123 N  N   . HIS A 1 398 ? -1.285  -1.279  36.834  1.00 20.79  ? 398  HIS A N   1 
ATOM   3124 C  CA  . HIS A 1 398 ? -1.494  0.163   36.747  1.00 20.45  ? 398  HIS A CA  1 
ATOM   3125 C  C   . HIS A 1 398 ? -2.020  0.572   35.375  1.00 19.59  ? 398  HIS A C   1 
ATOM   3126 O  O   . HIS A 1 398 ? -2.910  1.423   35.273  1.00 19.54  ? 398  HIS A O   1 
ATOM   3127 C  CB  . HIS A 1 398 ? -0.186  0.888   37.035  1.00 22.52  ? 398  HIS A CB  1 
ATOM   3128 C  CG  . HIS A 1 398 ? -0.196  2.337   36.659  1.00 20.41  ? 398  HIS A CG  1 
ATOM   3129 N  ND1 . HIS A 1 398 ? -1.039  3.256   37.248  1.00 24.50  ? 398  HIS A ND1 1 
ATOM   3130 C  CD2 . HIS A 1 398 ? 0.536   3.025   35.751  1.00 23.87  ? 398  HIS A CD2 1 
ATOM   3131 C  CE1 . HIS A 1 398 ? -0.820  4.449   36.726  1.00 23.47  ? 398  HIS A CE1 1 
ATOM   3132 N  NE2 . HIS A 1 398 ? 0.125   4.335   35.810  1.00 24.47  ? 398  HIS A NE2 1 
ATOM   3133 N  N   . ASN A 1 399 ? -1.482  -0.015  34.316  1.00 18.66  ? 399  ASN A N   1 
ATOM   3134 C  CA  . ASN A 1 399 ? -1.808  0.457   32.971  1.00 19.80  ? 399  ASN A CA  1 
ATOM   3135 C  C   . ASN A 1 399 ? -2.977  -0.259  32.313  1.00 22.72  ? 399  ASN A C   1 
ATOM   3136 O  O   . ASN A 1 399 ? -3.592  0.316   31.399  1.00 23.75  ? 399  ASN A O   1 
ATOM   3137 C  CB  . ASN A 1 399 ? -0.575  0.344   32.063  1.00 20.85  ? 399  ASN A CB  1 
ATOM   3138 C  CG  . ASN A 1 399 ? 0.446   1.403   32.370  1.00 20.63  ? 399  ASN A CG  1 
ATOM   3139 O  OD1 . ASN A 1 399 ? 0.200   2.581   32.145  1.00 25.29  ? 399  ASN A OD1 1 
ATOM   3140 N  ND2 . ASN A 1 399 ? 1.588   1.000   32.925  1.00 20.37  ? 399  ASN A ND2 1 
ATOM   3141 N  N   . VAL A 1 400 ? -3.292  -1.493  32.713  1.00 20.02  ? 400  VAL A N   1 
ATOM   3142 C  CA  . VAL A 1 400 ? -4.291  -2.267  31.972  1.00 21.57  ? 400  VAL A CA  1 
ATOM   3143 C  C   . VAL A 1 400 ? -5.351  -2.838  32.911  1.00 23.98  ? 400  VAL A C   1 
ATOM   3144 O  O   . VAL A 1 400 ? -6.546  -2.528  32.786  1.00 22.45  ? 400  VAL A O   1 
ATOM   3145 C  CB  . VAL A 1 400 ? -3.638  -3.403  31.157  1.00 21.92  ? 400  VAL A CB  1 
ATOM   3146 C  CG1 . VAL A 1 400 ? -4.707  -4.257  30.495  1.00 23.39  ? 400  VAL A CG1 1 
ATOM   3147 C  CG2 . VAL A 1 400 ? -2.656  -2.842  30.072  1.00 21.89  ? 400  VAL A CG2 1 
ATOM   3148 N  N   . ILE A 1 401 ? -4.925  -3.686  33.849  1.00 21.87  ? 401  ILE A N   1 
ATOM   3149 C  CA  . ILE A 1 401 ? -5.882  -4.498  34.601  1.00 24.08  ? 401  ILE A CA  1 
ATOM   3150 C  C   . ILE A 1 401 ? -6.758  -3.622  35.494  1.00 22.75  ? 401  ILE A C   1 
ATOM   3151 O  O   . ILE A 1 401 ? -7.991  -3.701  35.444  1.00 23.45  ? 401  ILE A O   1 
ATOM   3152 C  CB  . ILE A 1 401 ? -5.144  -5.579  35.413  1.00 24.89  ? 401  ILE A CB  1 
ATOM   3153 C  CG1 . ILE A 1 401 ? -4.379  -6.511  34.466  1.00 25.49  ? 401  ILE A CG1 1 
ATOM   3154 C  CG2 . ILE A 1 401 ? -6.134  -6.354  36.310  1.00 26.03  ? 401  ILE A CG2 1 
ATOM   3155 C  CD1 . ILE A 1 401 ? -3.917  -7.817  35.112  1.00 24.70  ? 401  ILE A CD1 1 
ATOM   3156 N  N   . CYS A 1 402 ? -6.147  -2.791  36.333  1.00 24.08  ? 402  CYS A N   1 
ATOM   3157 C  CA  . CYS A 1 402 ? -6.983  -2.026  37.256  1.00 23.59  ? 402  CYS A CA  1 
ATOM   3158 C  C   . CYS A 1 402 ? -7.814  -0.942  36.558  1.00 25.48  ? 402  CYS A C   1 
ATOM   3159 O  O   . CYS A 1 402 ? -8.991  -0.775  36.910  1.00 23.02  ? 402  CYS A O   1 
ATOM   3160 C  CB  . CYS A 1 402 ? -6.126  -1.448  38.378  1.00 24.73  ? 402  CYS A CB  1 
ATOM   3161 S  SG  . CYS A 1 402 ? -5.397  -2.809  39.353  1.00 22.15  ? 402  CYS A SG  1 
ATOM   3162 N  N   . PRO A 1 403 ? -7.288  -0.206  35.560  1.00 24.79  ? 403  PRO A N   1 
ATOM   3163 C  CA  . PRO A 1 403 ? -8.185  0.690   34.803  1.00 21.38  ? 403  PRO A CA  1 
ATOM   3164 C  C   . PRO A 1 403 ? -9.364  -0.044  34.204  1.00 20.79  ? 403  PRO A C   1 
ATOM   3165 O  O   . PRO A 1 403 ? -10.495 0.459   34.251  1.00 23.99  ? 403  PRO A O   1 
ATOM   3166 C  CB  . PRO A 1 403 ? -7.279  1.271   33.698  1.00 23.47  ? 403  PRO A CB  1 
ATOM   3167 C  CG  . PRO A 1 403 ? -5.915  1.168   34.240  1.00 23.67  ? 403  PRO A CG  1 
ATOM   3168 C  CD  . PRO A 1 403 ? -5.885  -0.065  35.120  1.00 19.43  ? 403  PRO A CD  1 
ATOM   3169 N  N   . LEU A 1 404 ? -9.128  -1.230  33.637  1.00 20.42  ? 404  LEU A N   1 
ATOM   3170 C  CA  . LEU A 1 404 ? -10.227 -1.997  33.065  1.00 24.74  ? 404  LEU A CA  1 
ATOM   3171 C  C   . LEU A 1 404 ? -11.225 -2.412  34.143  1.00 23.96  ? 404  LEU A C   1 
ATOM   3172 O  O   . LEU A 1 404 ? -12.439 -2.402  33.908  1.00 21.30  ? 404  LEU A O   1 
ATOM   3173 C  CB  . LEU A 1 404 ? -9.695  -3.223  32.316  1.00 24.07  ? 404  LEU A CB  1 
ATOM   3174 C  CG  . LEU A 1 404 ? -10.781 -4.046  31.594  1.00 24.45  ? 404  LEU A CG  1 
ATOM   3175 C  CD1 . LEU A 1 404 ? -10.352 -4.438  30.169  1.00 22.42  ? 404  LEU A CD1 1 
ATOM   3176 C  CD2 . LEU A 1 404 ? -11.157 -5.297  32.401  1.00 21.16  ? 404  LEU A CD2 1 
ATOM   3177 N  N   . MET A 1 405 ? -10.739 -2.767  35.342  1.00 22.45  ? 405  MET A N   1 
ATOM   3178 C  CA  . MET A 1 405 ? -11.670 -3.162  36.398  1.00 22.90  ? 405  MET A CA  1 
ATOM   3179 C  C   . MET A 1 405 ? -12.478 -1.975  36.904  1.00 27.83  ? 405  MET A C   1 
ATOM   3180 O  O   . MET A 1 405 ? -13.636 -2.138  37.315  1.00 25.26  ? 405  MET A O   1 
ATOM   3181 C  CB  . MET A 1 405 ? -10.916 -3.825  37.560  1.00 23.19  ? 405  MET A CB  1 
ATOM   3182 C  CG  . MET A 1 405 ? -10.338 -5.195  37.227  1.00 20.74  ? 405  MET A CG  1 
ATOM   3183 S  SD  . MET A 1 405 ? -11.505 -6.338  36.447  1.00 26.56  ? 405  MET A SD  1 
ATOM   3184 C  CE  . MET A 1 405 ? -12.813 -6.410  37.688  1.00 25.25  ? 405  MET A CE  1 
ATOM   3185 N  N   . HIS A 1 406 ? -11.888 -0.781  36.906  1.00 22.15  ? 406  HIS A N   1 
ATOM   3186 C  CA  . HIS A 1 406 ? -12.663 0.408   37.233  1.00 25.72  ? 406  HIS A CA  1 
ATOM   3187 C  C   . HIS A 1 406 ? -13.762 0.624   36.200  1.00 24.95  ? 406  HIS A C   1 
ATOM   3188 O  O   . HIS A 1 406 ? -14.921 0.880   36.542  1.00 21.80  ? 406  HIS A O   1 
ATOM   3189 C  CB  . HIS A 1 406 ? -11.738 1.616   37.306  1.00 23.28  ? 406  HIS A CB  1 
ATOM   3190 C  CG  . HIS A 1 406 ? -12.435 2.899   37.629  1.00 28.55  ? 406  HIS A CG  1 
ATOM   3191 N  ND1 . HIS A 1 406 ? -12.899 3.200   38.892  1.00 29.88  ? 406  HIS A ND1 1 
ATOM   3192 C  CD2 . HIS A 1 406 ? -12.703 3.982   36.863  1.00 25.43  ? 406  HIS A CD2 1 
ATOM   3193 C  CE1 . HIS A 1 406 ? -13.440 4.405   38.884  1.00 31.05  ? 406  HIS A CE1 1 
ATOM   3194 N  NE2 . HIS A 1 406 ? -13.335 4.900   37.662  1.00 30.02  ? 406  HIS A NE2 1 
ATOM   3195 N  N   . PHE A 1 407 ? -13.407 0.503   34.921  1.00 22.68  ? 407  PHE A N   1 
ATOM   3196 C  CA  . PHE A 1 407 ? -14.396 0.618   33.856  1.00 23.88  ? 407  PHE A CA  1 
ATOM   3197 C  C   . PHE A 1 407 ? -15.468 -0.453  33.997  1.00 23.59  ? 407  PHE A C   1 
ATOM   3198 O  O   . PHE A 1 407 ? -16.664 -0.167  33.893  1.00 24.45  ? 407  PHE A O   1 
ATOM   3199 C  CB  . PHE A 1 407 ? -13.713 0.511   32.491  1.00 22.38  ? 407  PHE A CB  1 
ATOM   3200 C  CG  . PHE A 1 407 ? -14.683 0.544   31.322  1.00 22.13  ? 407  PHE A CG  1 
ATOM   3201 C  CD1 . PHE A 1 407 ? -15.258 1.738   30.921  1.00 23.80  ? 407  PHE A CD1 1 
ATOM   3202 C  CD2 . PHE A 1 407 ? -15.006 -0.615  30.637  1.00 21.78  ? 407  PHE A CD2 1 
ATOM   3203 C  CE1 . PHE A 1 407 ? -16.137 1.782   29.842  1.00 24.45  ? 407  PHE A CE1 1 
ATOM   3204 C  CE2 . PHE A 1 407 ? -15.890 -0.587  29.550  1.00 23.90  ? 407  PHE A CE2 1 
ATOM   3205 C  CZ  . PHE A 1 407 ? -16.460 0.613   29.165  1.00 22.61  ? 407  PHE A CZ  1 
ATOM   3206 N  N   . VAL A 1 408 ? -15.051 -1.703  34.214  1.00 23.14  ? 408  VAL A N   1 
ATOM   3207 C  CA  . VAL A 1 408 ? -16.004 -2.807  34.351  1.00 26.04  ? 408  VAL A CA  1 
ATOM   3208 C  C   . VAL A 1 408 ? -17.014 -2.491  35.448  1.00 29.57  ? 408  VAL A C   1 
ATOM   3209 O  O   . VAL A 1 408 ? -18.232 -2.652  35.285  1.00 22.56  ? 408  VAL A O   1 
ATOM   3210 C  CB  . VAL A 1 408 ? -15.254 -4.116  34.666  1.00 29.62  ? 408  VAL A CB  1 
ATOM   3211 C  CG1 . VAL A 1 408 ? -16.180 -5.096  35.318  1.00 34.79  ? 408  VAL A CG1 1 
ATOM   3212 C  CG2 . VAL A 1 408 ? -14.663 -4.731  33.431  1.00 29.25  ? 408  VAL A CG2 1 
ATOM   3213 N  N   . ASN A 1 409 ? -16.513 -2.032  36.593  1.00 23.64  ? 409  ASN A N   1 
ATOM   3214 C  CA  . ASN A 1 409 ? -17.398 -1.808  37.723  1.00 27.62  ? 409  ASN A CA  1 
ATOM   3215 C  C   . ASN A 1 409 ? -18.325 -0.621  37.467  1.00 31.51  ? 409  ASN A C   1 
ATOM   3216 O  O   . ASN A 1 409 ? -19.526 -0.694  37.749  1.00 30.16  ? 409  ASN A O   1 
ATOM   3217 C  CB  . ASN A 1 409 ? -16.556 -1.644  38.990  1.00 33.10  ? 409  ASN A CB  1 
ATOM   3218 C  CG  . ASN A 1 409 ? -16.214 -2.993  39.626  1.00 38.86  ? 409  ASN A CG  1 
ATOM   3219 O  OD1 . ASN A 1 409 ? -15.074 -3.468  39.554  1.00 39.87  ? 409  ASN A OD1 1 
ATOM   3220 N  ND2 . ASN A 1 409 ? -17.222 -3.637  40.211  1.00 35.10  ? 409  ASN A ND2 1 
ATOM   3221 N  N   . LYS A 1 410 ? -17.808 0.459   36.879  1.00 27.30  ? 410  LYS A N   1 
ATOM   3222 C  CA  . LYS A 1 410 ? -18.667 1.599   36.565  1.00 27.91  ? 410  LYS A CA  1 
ATOM   3223 C  C   . LYS A 1 410 ? -19.688 1.258   35.478  1.00 26.55  ? 410  LYS A C   1 
ATOM   3224 O  O   . LYS A 1 410 ? -20.870 1.620   35.593  1.00 26.80  ? 410  LYS A O   1 
ATOM   3225 C  CB  . LYS A 1 410 ? -17.817 2.791   36.138  1.00 27.26  ? 410  LYS A CB  1 
ATOM   3226 C  CG  . LYS A 1 410 ? -16.908 3.294   37.230  1.00 28.18  ? 410  LYS A CG  1 
ATOM   3227 C  CD  . LYS A 1 410 ? -17.690 4.117   38.241  1.00 33.44  ? 410  LYS A CD  1 
ATOM   3228 C  CE  . LYS A 1 410 ? -16.800 4.495   39.411  1.00 34.73  ? 410  LYS A CE  1 
ATOM   3229 N  NZ  . LYS A 1 410 ? -17.536 5.309   40.415  1.00 38.56  ? 410  LYS A NZ  1 
ATOM   3230 N  N   . TYR A 1 411 ? -19.259 0.560   34.420  1.00 24.29  ? 411  TYR A N   1 
ATOM   3231 C  CA  . TYR A 1 411 ? -20.171 0.274   33.310  1.00 24.17  ? 411  TYR A CA  1 
ATOM   3232 C  C   . TYR A 1 411 ? -21.319 -0.623  33.755  1.00 31.66  ? 411  TYR A C   1 
ATOM   3233 O  O   . TYR A 1 411 ? -22.478 -0.413  33.369  1.00 24.76  ? 411  TYR A O   1 
ATOM   3234 C  CB  . TYR A 1 411 ? -19.428 -0.385  32.143  1.00 26.68  ? 411  TYR A CB  1 
ATOM   3235 C  CG  . TYR A 1 411 ? -20.311 -0.465  30.918  1.00 22.11  ? 411  TYR A CG  1 
ATOM   3236 C  CD1 . TYR A 1 411 ? -20.402 0.607   30.038  1.00 24.51  ? 411  TYR A CD1 1 
ATOM   3237 C  CD2 . TYR A 1 411 ? -21.095 -1.592  30.670  1.00 22.94  ? 411  TYR A CD2 1 
ATOM   3238 C  CE1 . TYR A 1 411 ? -21.245 0.555   28.921  1.00 23.30  ? 411  TYR A CE1 1 
ATOM   3239 C  CE2 . TYR A 1 411 ? -21.937 -1.652  29.562  1.00 22.03  ? 411  TYR A CE2 1 
ATOM   3240 C  CZ  . TYR A 1 411 ? -22.007 -0.578  28.694  1.00 26.98  ? 411  TYR A CZ  1 
ATOM   3241 O  OH  . TYR A 1 411 ? -22.852 -0.635  27.597  1.00 24.95  ? 411  TYR A OH  1 
ATOM   3242 N  N   . THR A 1 412 ? -21.014 -1.621  34.580  1.00 29.39  ? 412  THR A N   1 
ATOM   3243 C  CA  . THR A 1 412 ? -21.990 -2.638  34.931  1.00 29.20  ? 412  THR A CA  1 
ATOM   3244 C  C   . THR A 1 412 ? -23.142 -2.066  35.752  1.00 27.92  ? 412  THR A C   1 
ATOM   3245 O  O   . THR A 1 412 ? -24.237 -2.649  35.763  1.00 28.94  ? 412  THR A O   1 
ATOM   3246 C  CB  . THR A 1 412 ? -21.242 -3.767  35.648  1.00 30.46  ? 412  THR A CB  1 
ATOM   3247 O  OG1 . THR A 1 412 ? -20.299 -4.336  34.728  1.00 29.44  ? 412  THR A OG1 1 
ATOM   3248 C  CG2 . THR A 1 412 ? -22.178 -4.870  36.144  1.00 33.61  ? 412  THR A CG2 1 
ATOM   3249 N  N   . LYS A 1 413 ? -22.949 -0.901  36.375  1.00 27.81  ? 413  LYS A N   1 
ATOM   3250 C  CA  . LYS A 1 413 ? -24.039 -0.279  37.118  1.00 30.66  ? 413  LYS A CA  1 
ATOM   3251 C  C   . LYS A 1 413 ? -25.190 0.135   36.203  1.00 34.81  ? 413  LYS A C   1 
ATOM   3252 O  O   . LYS A 1 413 ? -26.353 0.127   36.630  1.00 31.99  ? 413  LYS A O   1 
ATOM   3253 C  CB  . LYS A 1 413 ? -23.531 0.938   37.894  1.00 31.85  ? 413  LYS A CB  1 
ATOM   3254 C  CG  . LYS A 1 413 ? -24.655 1.682   38.595  1.00 43.84  ? 413  LYS A CG  1 
ATOM   3255 C  CD  . LYS A 1 413 ? -24.221 2.418   39.847  1.00 53.25  ? 413  LYS A CD  1 
ATOM   3256 C  CE  . LYS A 1 413 ? -25.311 3.397   40.273  1.00 52.61  ? 413  LYS A CE  1 
ATOM   3257 N  NZ  . LYS A 1 413 ? -24.748 4.714   40.667  1.00 48.65  ? 413  LYS A NZ  1 
ATOM   3258 N  N   . PHE A 1 414 ? -24.888 0.493   34.952  1.00 25.22  ? 414  PHE A N   1 
ATOM   3259 C  CA  . PHE A 1 414 ? -25.865 1.004   34.001  1.00 30.61  ? 414  PHE A CA  1 
ATOM   3260 C  C   . PHE A 1 414 ? -26.045 0.139   32.766  1.00 30.10  ? 414  PHE A C   1 
ATOM   3261 O  O   . PHE A 1 414 ? -27.080 0.259   32.105  1.00 28.43  ? 414  PHE A O   1 
ATOM   3262 C  CB  . PHE A 1 414 ? -25.478 2.413   33.524  1.00 29.62  ? 414  PHE A CB  1 
ATOM   3263 C  CG  . PHE A 1 414 ? -25.532 3.461   34.593  1.00 31.80  ? 414  PHE A CG  1 
ATOM   3264 C  CD1 . PHE A 1 414 ? -26.727 4.102   34.887  1.00 34.11  ? 414  PHE A CD1 1 
ATOM   3265 C  CD2 . PHE A 1 414 ? -24.389 3.823   35.295  1.00 27.84  ? 414  PHE A CD2 1 
ATOM   3266 C  CE1 . PHE A 1 414 ? -26.783 5.071   35.867  1.00 36.75  ? 414  PHE A CE1 1 
ATOM   3267 C  CE2 . PHE A 1 414 ? -24.439 4.789   36.271  1.00 35.33  ? 414  PHE A CE2 1 
ATOM   3268 C  CZ  . PHE A 1 414 ? -25.639 5.415   36.564  1.00 39.50  ? 414  PHE A CZ  1 
ATOM   3269 N  N   . GLY A 1 415 ? -25.081 -0.712  32.429  1.00 29.01  ? 415  GLY A N   1 
ATOM   3270 C  CA  . GLY A 1 415 ? -25.136 -1.485  31.208  1.00 27.10  ? 415  GLY A CA  1 
ATOM   3271 C  C   . GLY A 1 415 ? -26.152 -2.613  31.258  1.00 31.71  ? 415  GLY A C   1 
ATOM   3272 O  O   . GLY A 1 415 ? -26.877 -2.821  32.233  1.00 29.42  ? 415  GLY A O   1 
ATOM   3273 N  N   . ASN A 1 416 ? -26.192 -3.368  30.160  1.00 28.63  ? 416  ASN A N   1 
ATOM   3274 C  CA  . ASN A 1 416 ? -27.180 -4.425  29.970  1.00 28.97  ? 416  ASN A CA  1 
ATOM   3275 C  C   . ASN A 1 416 ? -26.535 -5.805  29.871  1.00 29.63  ? 416  ASN A C   1 
ATOM   3276 O  O   . ASN A 1 416 ? -27.126 -6.727  29.298  1.00 33.68  ? 416  ASN A O   1 
ATOM   3277 C  CB  . ASN A 1 416 ? -28.024 -4.121  28.728  1.00 30.00  ? 416  ASN A CB  1 
ATOM   3278 C  CG  . ASN A 1 416 ? -29.256 -5.010  28.614  1.00 34.55  ? 416  ASN A CG  1 
ATOM   3279 O  OD1 . ASN A 1 416 ? -29.480 -5.628  27.574  1.00 32.63  ? 416  ASN A OD1 1 
ATOM   3280 N  ND2 . ASN A 1 416 ? -30.053 -5.082  29.684  1.00 35.97  ? 416  ASN A ND2 1 
ATOM   3281 N  N   . GLY A 1 417 ? -25.334 -5.976  30.423  1.00 28.69  ? 417  GLY A N   1 
ATOM   3282 C  CA  . GLY A 1 417 ? -24.685 -7.273  30.376  1.00 26.05  ? 417  GLY A CA  1 
ATOM   3283 C  C   . GLY A 1 417 ? -23.176 -7.165  30.275  1.00 26.75  ? 417  GLY A C   1 
ATOM   3284 O  O   . GLY A 1 417 ? -22.672 -6.592  29.312  1.00 26.00  ? 417  GLY A O   1 
ATOM   3285 N  N   . THR A 1 418 ? -22.445 -7.695  31.254  1.00 24.15  ? 418  THR A N   1 
ATOM   3286 C  CA  . THR A 1 418 ? -20.986 -7.651  31.260  1.00 21.39  ? 418  THR A CA  1 
ATOM   3287 C  C   . THR A 1 418 ? -20.450 -9.069  31.390  1.00 27.67  ? 418  THR A C   1 
ATOM   3288 O  O   . THR A 1 418 ? -20.904 -9.832  32.251  1.00 27.93  ? 418  THR A O   1 
ATOM   3289 C  CB  . THR A 1 418 ? -20.457 -6.777  32.401  1.00 22.72  ? 418  THR A CB  1 
ATOM   3290 O  OG1 . THR A 1 418 ? -20.917 -5.432  32.225  1.00 27.30  ? 418  THR A OG1 1 
ATOM   3291 C  CG2 . THR A 1 418 ? -18.904 -6.798  32.456  1.00 21.87  ? 418  THR A CG2 1 
ATOM   3292 N  N   . TYR A 1 419 ? -19.506 -9.420  30.522  1.00 23.56  ? 419  TYR A N   1 
ATOM   3293 C  CA  . TYR A 1 419 ? -18.767 -10.676 30.586  1.00 26.45  ? 419  TYR A CA  1 
ATOM   3294 C  C   . TYR A 1 419 ? -17.278 -10.372 30.633  1.00 26.33  ? 419  TYR A C   1 
ATOM   3295 O  O   . TYR A 1 419 ? -16.752 -9.690  29.748  1.00 24.08  ? 419  TYR A O   1 
ATOM   3296 C  CB  . TYR A 1 419 ? -19.093 -11.559 29.384  1.00 26.35  ? 419  TYR A CB  1 
ATOM   3297 C  CG  . TYR A 1 419 ? -20.557 -11.944 29.351  1.00 26.10  ? 419  TYR A CG  1 
ATOM   3298 C  CD1 . TYR A 1 419 ? -21.010 -13.061 30.045  1.00 24.37  ? 419  TYR A CD1 1 
ATOM   3299 C  CD2 . TYR A 1 419 ? -21.485 -11.171 28.656  1.00 25.18  ? 419  TYR A CD2 1 
ATOM   3300 C  CE1 . TYR A 1 419 ? -22.353 -13.409 30.037  1.00 28.74  ? 419  TYR A CE1 1 
ATOM   3301 C  CE2 . TYR A 1 419 ? -22.839 -11.513 28.641  1.00 27.85  ? 419  TYR A CE2 1 
ATOM   3302 C  CZ  . TYR A 1 419 ? -23.256 -12.638 29.333  1.00 30.85  ? 419  TYR A CZ  1 
ATOM   3303 O  OH  . TYR A 1 419 ? -24.580 -12.996 29.340  1.00 28.88  ? 419  TYR A OH  1 
ATOM   3304 N  N   . LEU A 1 420 ? -16.602 -10.886 31.659  1.00 23.06  ? 420  LEU A N   1 
ATOM   3305 C  CA  . LEU A 1 420 ? -15.221 -10.537 31.967  1.00 24.70  ? 420  LEU A CA  1 
ATOM   3306 C  C   . LEU A 1 420 ? -14.359 -11.790 31.896  1.00 25.49  ? 420  LEU A C   1 
ATOM   3307 O  O   . LEU A 1 420 ? -14.760 -12.850 32.388  1.00 27.32  ? 420  LEU A O   1 
ATOM   3308 C  CB  . LEU A 1 420 ? -15.135 -9.899  33.371  1.00 25.26  ? 420  LEU A CB  1 
ATOM   3309 C  CG  . LEU A 1 420 ? -13.780 -9.464  33.927  1.00 26.17  ? 420  LEU A CG  1 
ATOM   3310 C  CD1 . LEU A 1 420 ? -13.109 -8.419  33.037  1.00 24.70  ? 420  LEU A CD1 1 
ATOM   3311 C  CD2 . LEU A 1 420 ? -13.949 -8.928  35.349  1.00 23.62  ? 420  LEU A CD2 1 
ATOM   3312 N  N   . TYR A 1 421 ? -13.175 -11.679 31.288  1.00 24.19  ? 421  TYR A N   1 
ATOM   3313 C  CA  . TYR A 1 421 ? -12.283 -12.821 31.158  1.00 24.99  ? 421  TYR A CA  1 
ATOM   3314 C  C   . TYR A 1 421 ? -10.874 -12.469 31.634  1.00 26.88  ? 421  TYR A C   1 
ATOM   3315 O  O   . TYR A 1 421 ? -10.473 -11.303 31.705  1.00 23.32  ? 421  TYR A O   1 
ATOM   3316 C  CB  . TYR A 1 421 ? -12.243 -13.357 29.704  1.00 23.13  ? 421  TYR A CB  1 
ATOM   3317 C  CG  . TYR A 1 421 ? -11.533 -12.444 28.727  1.00 24.24  ? 421  TYR A CG  1 
ATOM   3318 C  CD1 . TYR A 1 421 ? -10.142 -12.405 28.663  1.00 24.36  ? 421  TYR A CD1 1 
ATOM   3319 C  CD2 . TYR A 1 421 ? -12.254 -11.634 27.848  1.00 26.06  ? 421  TYR A CD2 1 
ATOM   3320 C  CE1 . TYR A 1 421 ? -9.482  -11.565 27.784  1.00 22.17  ? 421  TYR A CE1 1 
ATOM   3321 C  CE2 . TYR A 1 421 ? -11.594 -10.787 26.949  1.00 26.11  ? 421  TYR A CE2 1 
ATOM   3322 C  CZ  . TYR A 1 421 ? -10.207 -10.760 26.937  1.00 24.11  ? 421  TYR A CZ  1 
ATOM   3323 O  OH  . TYR A 1 421 ? -9.534  -9.936  26.064  1.00 24.90  ? 421  TYR A OH  1 
ATOM   3324 N  N   . PHE A 1 422 ? -10.121 -13.513 31.955  1.00 24.44  ? 422  PHE A N   1 
ATOM   3325 C  CA  . PHE A 1 422 ? -8.720  -13.403 32.352  1.00 26.52  ? 422  PHE A CA  1 
ATOM   3326 C  C   . PHE A 1 422 ? -7.971  -14.425 31.524  1.00 26.63  ? 422  PHE A C   1 
ATOM   3327 O  O   . PHE A 1 422 ? -8.101  -15.628 31.766  1.00 27.64  ? 422  PHE A O   1 
ATOM   3328 C  CB  . PHE A 1 422 ? -8.537  -13.663 33.851  1.00 24.84  ? 422  PHE A CB  1 
ATOM   3329 C  CG  . PHE A 1 422 ? -7.110  -13.536 34.332  1.00 22.14  ? 422  PHE A CG  1 
ATOM   3330 C  CD1 . PHE A 1 422 ? -6.527  -12.288 34.509  1.00 24.67  ? 422  PHE A CD1 1 
ATOM   3331 C  CD2 . PHE A 1 422 ? -6.368  -14.665 34.648  1.00 26.27  ? 422  PHE A CD2 1 
ATOM   3332 C  CE1 . PHE A 1 422 ? -5.211  -12.168 34.988  1.00 27.06  ? 422  PHE A CE1 1 
ATOM   3333 C  CE2 . PHE A 1 422 ? -5.055  -14.554 35.126  1.00 28.83  ? 422  PHE A CE2 1 
ATOM   3334 C  CZ  . PHE A 1 422 ? -4.480  -13.308 35.291  1.00 26.80  ? 422  PHE A CZ  1 
ATOM   3335 N  N   . PHE A 1 423 ? -7.216  -13.959 30.531  1.00 26.26  ? 423  PHE A N   1 
ATOM   3336 C  CA  . PHE A 1 423 ? -6.549  -14.856 29.600  1.00 25.05  ? 423  PHE A CA  1 
ATOM   3337 C  C   . PHE A 1 423 ? -5.157  -15.157 30.143  1.00 27.41  ? 423  PHE A C   1 
ATOM   3338 O  O   . PHE A 1 423 ? -4.326  -14.252 30.266  1.00 25.82  ? 423  PHE A O   1 
ATOM   3339 C  CB  . PHE A 1 423 ? -6.487  -14.230 28.201  1.00 22.52  ? 423  PHE A CB  1 
ATOM   3340 C  CG  . PHE A 1 423 ? -5.786  -15.080 27.185  1.00 25.51  ? 423  PHE A CG  1 
ATOM   3341 C  CD1 . PHE A 1 423 ? -6.482  -16.017 26.443  1.00 28.93  ? 423  PHE A CD1 1 
ATOM   3342 C  CD2 . PHE A 1 423 ? -4.423  -14.933 26.959  1.00 31.33  ? 423  PHE A CD2 1 
ATOM   3343 C  CE1 . PHE A 1 423 ? -5.835  -16.796 25.501  1.00 27.89  ? 423  PHE A CE1 1 
ATOM   3344 C  CE2 . PHE A 1 423 ? -3.769  -15.707 26.025  1.00 28.26  ? 423  PHE A CE2 1 
ATOM   3345 C  CZ  . PHE A 1 423 ? -4.479  -16.642 25.287  1.00 29.07  ? 423  PHE A CZ  1 
ATOM   3346 N  N   . ASN A 1 424 ? -4.898  -16.421 30.473  1.00 28.69  ? 424  ASN A N   1 
ATOM   3347 C  CA  . ASN A 1 424 ? -3.625  -16.758 31.107  1.00 29.12  ? 424  ASN A CA  1 
ATOM   3348 C  C   . ASN A 1 424 ? -3.015  -18.007 30.494  1.00 31.16  ? 424  ASN A C   1 
ATOM   3349 O  O   . ASN A 1 424 ? -2.358  -18.796 31.181  1.00 32.03  ? 424  ASN A O   1 
ATOM   3350 C  CB  . ASN A 1 424 ? -3.775  -16.916 32.625  1.00 27.72  ? 424  ASN A CB  1 
ATOM   3351 C  CG  . ASN A 1 424 ? -4.749  -18.020 33.024  1.00 28.39  ? 424  ASN A CG  1 
ATOM   3352 O  OD1 . ASN A 1 424 ? -5.501  -18.549 32.208  1.00 30.54  ? 424  ASN A OD1 1 
ATOM   3353 N  ND2 . ASN A 1 424 ? -4.754  -18.349 34.316  1.00 36.64  ? 424  ASN A ND2 1 
ATOM   3354 N  N   . HIS A 1 425 ? -3.178  -18.195 29.186  1.00 29.88  ? 425  HIS A N   1 
ATOM   3355 C  CA  . HIS A 1 425 ? -2.501  -19.285 28.494  1.00 29.87  ? 425  HIS A CA  1 
ATOM   3356 C  C   . HIS A 1 425 ? -1.274  -18.760 27.761  1.00 36.29  ? 425  HIS A C   1 
ATOM   3357 O  O   . HIS A 1 425 ? -1.383  -17.848 26.933  1.00 34.06  ? 425  HIS A O   1 
ATOM   3358 C  CB  . HIS A 1 425 ? -3.415  -19.995 27.502  1.00 33.67  ? 425  HIS A CB  1 
ATOM   3359 C  CG  . HIS A 1 425 ? -2.723  -21.096 26.770  1.00 34.95  ? 425  HIS A CG  1 
ATOM   3360 N  ND1 . HIS A 1 425 ? -2.406  -22.297 27.370  1.00 36.86  ? 425  HIS A ND1 1 
ATOM   3361 C  CD2 . HIS A 1 425 ? -2.219  -21.156 25.515  1.00 30.94  ? 425  HIS A CD2 1 
ATOM   3362 C  CE1 . HIS A 1 425 ? -1.766  -23.062 26.502  1.00 38.44  ? 425  HIS A CE1 1 
ATOM   3363 N  NE2 . HIS A 1 425 ? -1.643  -22.393 25.369  1.00 34.87  ? 425  HIS A NE2 1 
ATOM   3364 N  N   . ARG A 1 426 ? -0.117  -19.353 28.041  1.00 30.10  ? 426  ARG A N   1 
ATOM   3365 C  CA  . ARG A 1 426 ? 1.097   -19.061 27.290  1.00 32.90  ? 426  ARG A CA  1 
ATOM   3366 C  C   . ARG A 1 426 ? 1.210   -20.019 26.107  1.00 34.40  ? 426  ARG A C   1 
ATOM   3367 O  O   . ARG A 1 426 ? 1.194   -21.243 26.287  1.00 34.66  ? 426  ARG A O   1 
ATOM   3368 C  CB  . ARG A 1 426 ? 2.333   -19.172 28.176  1.00 37.69  ? 426  ARG A CB  1 
ATOM   3369 C  CG  . ARG A 1 426 ? 3.595   -18.841 27.414  1.00 35.79  ? 426  ARG A CG  1 
ATOM   3370 C  CD  . ARG A 1 426 ? 4.811   -19.052 28.257  1.00 36.98  ? 426  ARG A CD  1 
ATOM   3371 N  NE  . ARG A 1 426 ? 6.019   -19.059 27.443  1.00 37.40  ? 426  ARG A NE  1 
ATOM   3372 C  CZ  . ARG A 1 426 ? 6.768   -17.987 27.212  1.00 34.71  ? 426  ARG A CZ  1 
ATOM   3373 N  NH1 . ARG A 1 426 ? 6.429   -16.803 27.724  1.00 32.23  ? 426  ARG A NH1 1 
ATOM   3374 N  NH2 . ARG A 1 426 ? 7.860   -18.102 26.476  1.00 33.05  ? 426  ARG A NH2 1 
ATOM   3375 N  N   . ALA A 1 427 ? 1.336   -19.467 24.905  1.00 34.69  ? 427  ALA A N   1 
ATOM   3376 C  CA  . ALA A 1 427 ? 1.340   -20.298 23.708  1.00 37.47  ? 427  ALA A CA  1 
ATOM   3377 C  C   . ALA A 1 427 ? 2.548   -21.226 23.703  1.00 34.88  ? 427  ALA A C   1 
ATOM   3378 O  O   . ALA A 1 427 ? 3.654   -20.842 24.092  1.00 33.52  ? 427  ALA A O   1 
ATOM   3379 C  CB  . ALA A 1 427 ? 1.339   -19.430 22.448  1.00 34.24  ? 427  ALA A CB  1 
ATOM   3380 N  N   . SER A 1 428 ? 2.323   -22.462 23.255  1.00 35.15  ? 428  SER A N   1 
ATOM   3381 C  CA  . SER A 1 428 ? 3.389   -23.458 23.230  1.00 38.37  ? 428  SER A CA  1 
ATOM   3382 C  C   . SER A 1 428 ? 4.532   -23.055 22.305  1.00 38.76  ? 428  SER A C   1 
ATOM   3383 O  O   . SER A 1 428 ? 5.666   -23.499 22.499  1.00 35.84  ? 428  SER A O   1 
ATOM   3384 C  CB  . SER A 1 428 ? 2.816   -24.804 22.795  1.00 36.45  ? 428  SER A CB  1 
ATOM   3385 O  OG  . SER A 1 428 ? 2.245   -24.699 21.495  1.00 39.74  ? 428  SER A OG  1 
ATOM   3386 N  N   . ASN A 1 429 ? 4.257   -22.229 21.294  1.00 35.76  ? 429  ASN A N   1 
ATOM   3387 C  CA  . ASN A 1 429 ? 5.233   -21.859 20.276  1.00 33.16  ? 429  ASN A CA  1 
ATOM   3388 C  C   . ASN A 1 429 ? 5.713   -20.419 20.422  1.00 34.25  ? 429  ASN A C   1 
ATOM   3389 O  O   . ASN A 1 429 ? 6.239   -19.846 19.464  1.00 27.86  ? 429  ASN A O   1 
ATOM   3390 C  CB  . ASN A 1 429 ? 4.628   -22.061 18.886  1.00 34.13  ? 429  ASN A CB  1 
ATOM   3391 C  CG  . ASN A 1 429 ? 3.360   -21.235 18.680  1.00 39.18  ? 429  ASN A CG  1 
ATOM   3392 O  OD1 . ASN A 1 429 ? 2.996   -20.416 19.531  1.00 33.19  ? 429  ASN A OD1 1 
ATOM   3393 N  ND2 . ASN A 1 429 ? 2.680   -21.448 17.552  1.00 35.26  ? 429  ASN A ND2 1 
ATOM   3394 N  N   . LEU A 1 430 ? 5.498   -19.803 21.583  1.00 32.74  ? 430  LEU A N   1 
ATOM   3395 C  CA  . LEU A 1 430 ? 5.886   -18.412 21.759  1.00 32.53  ? 430  LEU A CA  1 
ATOM   3396 C  C   . LEU A 1 430 ? 7.388   -18.256 21.568  1.00 34.67  ? 430  LEU A C   1 
ATOM   3397 O  O   . LEU A 1 430 ? 8.177   -19.073 22.048  1.00 33.57  ? 430  LEU A O   1 
ATOM   3398 C  CB  . LEU A 1 430 ? 5.484   -17.916 23.153  1.00 32.79  ? 430  LEU A CB  1 
ATOM   3399 C  CG  . LEU A 1 430 ? 5.256   -16.412 23.291  1.00 31.86  ? 430  LEU A CG  1 
ATOM   3400 C  CD1 . LEU A 1 430 ? 3.918   -16.038 22.689  1.00 32.10  ? 430  LEU A CD1 1 
ATOM   3401 C  CD2 . LEU A 1 430 ? 5.326   -15.988 24.760  1.00 33.56  ? 430  LEU A CD2 1 
ATOM   3402 N  N   . VAL A 1 431 ? 7.781   -17.198 20.853  1.00 31.69  ? 431  VAL A N   1 
ATOM   3403 C  CA  . VAL A 1 431 ? 9.194   -16.969 20.564  1.00 29.87  ? 431  VAL A CA  1 
ATOM   3404 C  C   . VAL A 1 431 ? 9.863   -16.103 21.616  1.00 31.29  ? 431  VAL A C   1 
ATOM   3405 O  O   . VAL A 1 431 ? 11.099  -16.023 21.642  1.00 29.99  ? 431  VAL A O   1 
ATOM   3406 C  CB  . VAL A 1 431 ? 9.383   -16.328 19.173  1.00 34.33  ? 431  VAL A CB  1 
ATOM   3407 C  CG1 . VAL A 1 431 ? 8.811   -17.232 18.094  1.00 35.53  ? 431  VAL A CG1 1 
ATOM   3408 C  CG2 . VAL A 1 431 ? 8.731   -14.958 19.121  1.00 30.35  ? 431  VAL A CG2 1 
ATOM   3409 N  N   . TRP A 1 432 ? 9.089   -15.453 22.484  1.00 31.42  ? 432  TRP A N   1 
ATOM   3410 C  CA  . TRP A 1 432 ? 9.601   -14.631 23.566  1.00 30.36  ? 432  TRP A CA  1 
ATOM   3411 C  C   . TRP A 1 432 ? 9.950   -15.504 24.773  1.00 29.39  ? 432  TRP A C   1 
ATOM   3412 O  O   . TRP A 1 432 ? 9.414   -16.607 24.926  1.00 29.20  ? 432  TRP A O   1 
ATOM   3413 C  CB  . TRP A 1 432 ? 8.561   -13.566 23.932  1.00 28.17  ? 432  TRP A CB  1 
ATOM   3414 C  CG  . TRP A 1 432 ? 8.292   -12.583 22.797  1.00 27.50  ? 432  TRP A CG  1 
ATOM   3415 C  CD1 . TRP A 1 432 ? 7.206   -12.556 21.956  1.00 27.92  ? 432  TRP A CD1 1 
ATOM   3416 C  CD2 . TRP A 1 432 ? 9.137   -11.502 22.393  1.00 27.47  ? 432  TRP A CD2 1 
ATOM   3417 N  NE1 . TRP A 1 432 ? 7.325   -11.509 21.063  1.00 28.09  ? 432  TRP A NE1 1 
ATOM   3418 C  CE2 . TRP A 1 432 ? 8.507   -10.855 21.308  1.00 26.46  ? 432  TRP A CE2 1 
ATOM   3419 C  CE3 . TRP A 1 432 ? 10.371  -11.015 22.847  1.00 25.82  ? 432  TRP A CE3 1 
ATOM   3420 C  CZ2 . TRP A 1 432 ? 9.071   -9.743  20.675  1.00 24.32  ? 432  TRP A CZ2 1 
ATOM   3421 C  CZ3 . TRP A 1 432 ? 10.934  -9.912  22.214  1.00 25.71  ? 432  TRP A CZ3 1 
ATOM   3422 C  CH2 . TRP A 1 432 ? 10.280  -9.290  21.135  1.00 28.15  ? 432  TRP A CH2 1 
ATOM   3423 N  N   . PRO A 1 433 ? 10.862  -15.055 25.635  1.00 28.03  ? 433  PRO A N   1 
ATOM   3424 C  CA  . PRO A 1 433 ? 11.324  -15.912 26.736  1.00 29.24  ? 433  PRO A CA  1 
ATOM   3425 C  C   . PRO A 1 433 ? 10.250  -16.129 27.793  1.00 32.80  ? 433  PRO A C   1 
ATOM   3426 O  O   . PRO A 1 433 ? 9.260   -15.398 27.881  1.00 26.18  ? 433  PRO A O   1 
ATOM   3427 C  CB  . PRO A 1 433 ? 12.515  -15.141 27.311  1.00 31.11  ? 433  PRO A CB  1 
ATOM   3428 C  CG  . PRO A 1 433 ? 12.239  -13.715 26.957  1.00 30.68  ? 433  PRO A CG  1 
ATOM   3429 C  CD  . PRO A 1 433 ? 11.625  -13.795 25.580  1.00 29.46  ? 433  PRO A CD  1 
ATOM   3430 N  N   . GLU A 1 434 ? 10.487  -17.147 28.631  1.00 33.42  ? 434  GLU A N   1 
ATOM   3431 C  CA  . GLU A 1 434 ? 9.476   -17.575 29.601  1.00 35.37  ? 434  GLU A CA  1 
ATOM   3432 C  C   . GLU A 1 434 ? 9.148   -16.496 30.624  1.00 28.94  ? 434  GLU A C   1 
ATOM   3433 O  O   . GLU A 1 434 ? 8.006   -16.422 31.096  1.00 28.39  ? 434  GLU A O   1 
ATOM   3434 C  CB  . GLU A 1 434 ? 9.936   -18.850 30.313  1.00 40.09  ? 434  GLU A CB  1 
ATOM   3435 C  CG  . GLU A 1 434 ? 10.139  -20.020 29.364  1.00 43.45  ? 434  GLU A CG  1 
ATOM   3436 C  CD  . GLU A 1 434 ? 10.826  -21.208 30.008  1.00 62.72  ? 434  GLU A CD  1 
ATOM   3437 O  OE1 . GLU A 1 434 ? 10.129  -22.026 30.647  1.00 66.99  ? 434  GLU A OE1 1 
ATOM   3438 O  OE2 . GLU A 1 434 ? 12.066  -21.328 29.867  1.00 71.04  ? 434  GLU A OE2 1 
ATOM   3439 N  N   . TRP A 1 435 ? 10.118  -15.652 30.988  1.00 28.52  ? 435  TRP A N   1 
ATOM   3440 C  CA  . TRP A 1 435 ? 9.854   -14.677 32.045  1.00 28.60  ? 435  TRP A CA  1 
ATOM   3441 C  C   . TRP A 1 435 ? 8.743   -13.719 31.652  1.00 29.17  ? 435  TRP A C   1 
ATOM   3442 O  O   . TRP A 1 435 ? 8.047   -13.189 32.520  1.00 24.97  ? 435  TRP A O   1 
ATOM   3443 C  CB  . TRP A 1 435 ? 11.122  -13.902 32.415  1.00 26.69  ? 435  TRP A CB  1 
ATOM   3444 C  CG  . TRP A 1 435 ? 11.614  -12.899 31.414  1.00 26.35  ? 435  TRP A CG  1 
ATOM   3445 C  CD1 . TRP A 1 435 ? 12.624  -13.083 30.510  1.00 27.99  ? 435  TRP A CD1 1 
ATOM   3446 C  CD2 . TRP A 1 435 ? 11.167  -11.542 31.240  1.00 25.04  ? 435  TRP A CD2 1 
ATOM   3447 N  NE1 . TRP A 1 435 ? 12.821  -11.941 29.780  1.00 26.41  ? 435  TRP A NE1 1 
ATOM   3448 C  CE2 . TRP A 1 435 ? 11.940  -10.980 30.201  1.00 27.05  ? 435  TRP A CE2 1 
ATOM   3449 C  CE3 . TRP A 1 435 ? 10.175  -10.756 31.844  1.00 24.85  ? 435  TRP A CE3 1 
ATOM   3450 C  CZ2 . TRP A 1 435 ? 11.755  -9.667  29.753  1.00 26.94  ? 435  TRP A CZ2 1 
ATOM   3451 C  CZ3 . TRP A 1 435 ? 9.999   -9.449  31.402  1.00 25.29  ? 435  TRP A CZ3 1 
ATOM   3452 C  CH2 . TRP A 1 435 ? 10.778  -8.922  30.368  1.00 25.20  ? 435  TRP A CH2 1 
ATOM   3453 N  N   . MET A 1 436 ? 8.538   -13.512 30.352  1.00 24.59  ? 436  MET A N   1 
ATOM   3454 C  CA  . MET A 1 436 ? 7.508   -12.589 29.907  1.00 26.29  ? 436  MET A CA  1 
ATOM   3455 C  C   . MET A 1 436 ? 6.103   -13.164 30.044  1.00 24.32  ? 436  MET A C   1 
ATOM   3456 O  O   . MET A 1 436 ? 5.135   -12.402 29.978  1.00 28.65  ? 436  MET A O   1 
ATOM   3457 C  CB  . MET A 1 436 ? 7.796   -12.172 28.453  1.00 24.58  ? 436  MET A CB  1 
ATOM   3458 C  CG  . MET A 1 436 ? 9.147   -11.465 28.324  1.00 23.21  ? 436  MET A CG  1 
ATOM   3459 S  SD  . MET A 1 436 ? 9.484   -10.869 26.639  1.00 26.08  ? 436  MET A SD  1 
ATOM   3460 C  CE  . MET A 1 436 ? 8.290   -9.538  26.545  1.00 26.44  ? 436  MET A CE  1 
ATOM   3461 N  N   . GLY A 1 437 ? 5.967   -14.477 30.230  1.00 27.19  ? 437  GLY A N   1 
ATOM   3462 C  CA  . GLY A 1 437 ? 4.667   -15.039 30.588  1.00 30.00  ? 437  GLY A CA  1 
ATOM   3463 C  C   . GLY A 1 437 ? 3.632   -14.906 29.478  1.00 27.88  ? 437  GLY A C   1 
ATOM   3464 O  O   . GLY A 1 437 ? 3.905   -15.192 28.308  1.00 29.47  ? 437  GLY A O   1 
ATOM   3465 N  N   . VAL A 1 438 ? 2.423   -14.490 29.856  1.00 22.53  ? 438  VAL A N   1 
ATOM   3466 C  CA  . VAL A 1 438 ? 1.295   -14.359 28.926  1.00 25.16  ? 438  VAL A CA  1 
ATOM   3467 C  C   . VAL A 1 438 ? 1.265   -12.884 28.535  1.00 24.15  ? 438  VAL A C   1 
ATOM   3468 O  O   . VAL A 1 438 ? 0.696   -12.040 29.223  1.00 25.12  ? 438  VAL A O   1 
ATOM   3469 C  CB  . VAL A 1 438 ? -0.020  -14.828 29.549  1.00 27.81  ? 438  VAL A CB  1 
ATOM   3470 C  CG1 . VAL A 1 438 ? -1.160  -14.754 28.527  1.00 27.74  ? 438  VAL A CG1 1 
ATOM   3471 C  CG2 . VAL A 1 438 ? 0.134   -16.246 30.079  1.00 25.72  ? 438  VAL A CG2 1 
ATOM   3472 N  N   . ILE A 1 439 ? 1.880   -12.580 27.411  1.00 25.16  ? 439  ILE A N   1 
ATOM   3473 C  CA  . ILE A 1 439 ? 2.242   -11.216 27.042  1.00 23.40  ? 439  ILE A CA  1 
ATOM   3474 C  C   . ILE A 1 439 ? 1.025   -10.450 26.535  1.00 23.85  ? 439  ILE A C   1 
ATOM   3475 O  O   . ILE A 1 439 ? 0.107   -11.017 25.940  1.00 27.36  ? 439  ILE A O   1 
ATOM   3476 C  CB  . ILE A 1 439 ? 3.367   -11.282 25.985  1.00 26.21  ? 439  ILE A CB  1 
ATOM   3477 C  CG1 . ILE A 1 439 ? 4.626   -11.898 26.604  1.00 25.10  ? 439  ILE A CG1 1 
ATOM   3478 C  CG2 . ILE A 1 439 ? 3.695   -9.910  25.373  1.00 20.92  ? 439  ILE A CG2 1 
ATOM   3479 C  CD1 . ILE A 1 439 ? 5.662   -12.279 25.549  1.00 25.44  ? 439  ILE A CD1 1 
ATOM   3480 N  N   . HIS A 1 440 ? 1.016   -9.148  26.815  1.00 24.76  ? 440  HIS A N   1 
ATOM   3481 C  CA  . HIS A 1 440 ? 0.158   -8.172  26.159  1.00 22.93  ? 440  HIS A CA  1 
ATOM   3482 C  C   . HIS A 1 440 ? 0.029   -8.517  24.683  1.00 23.55  ? 440  HIS A C   1 
ATOM   3483 O  O   . HIS A 1 440 ? 1.026   -8.802  24.018  1.00 22.13  ? 440  HIS A O   1 
ATOM   3484 C  CB  . HIS A 1 440 ? 0.789   -6.784  26.338  1.00 23.82  ? 440  HIS A CB  1 
ATOM   3485 C  CG  . HIS A 1 440 ? -0.076  -5.626  25.935  1.00 25.08  ? 440  HIS A CG  1 
ATOM   3486 N  ND1 . HIS A 1 440 ? -1.300  -5.357  26.513  1.00 26.07  ? 440  HIS A ND1 1 
ATOM   3487 C  CD2 . HIS A 1 440 ? 0.144   -4.625  25.046  1.00 23.84  ? 440  HIS A CD2 1 
ATOM   3488 C  CE1 . HIS A 1 440 ? -1.804  -4.253  25.990  1.00 19.85  ? 440  HIS A CE1 1 
ATOM   3489 N  NE2 . HIS A 1 440 ? -0.941  -3.783  25.106  1.00 24.64  ? 440  HIS A NE2 1 
ATOM   3490 N  N   . GLY A 1 441 ? -1.210  -8.574  24.197  1.00 20.89  ? 441  GLY A N   1 
ATOM   3491 C  CA  . GLY A 1 441 ? -1.469  -8.783  22.786  1.00 25.14  ? 441  GLY A CA  1 
ATOM   3492 C  C   . GLY A 1 441 ? -1.429  -10.220 22.304  1.00 26.49  ? 441  GLY A C   1 
ATOM   3493 O  O   . GLY A 1 441 ? -1.814  -10.479 21.153  1.00 25.17  ? 441  GLY A O   1 
ATOM   3494 N  N   . TYR A 1 442 ? -0.976  -11.173 23.121  1.00 21.95  ? 442  TYR A N   1 
ATOM   3495 C  CA  . TYR A 1 442 ? -0.846  -12.530 22.616  1.00 22.03  ? 442  TYR A CA  1 
ATOM   3496 C  C   . TYR A 1 442 ? -2.109  -13.355 22.814  1.00 26.02  ? 442  TYR A C   1 
ATOM   3497 O  O   . TYR A 1 442 ? -2.114  -14.554 22.519  1.00 26.76  ? 442  TYR A O   1 
ATOM   3498 C  CB  . TYR A 1 442 ? 0.404   -13.188 23.204  1.00 25.67  ? 442  TYR A CB  1 
ATOM   3499 C  CG  . TYR A 1 442 ? 1.574   -12.755 22.360  1.00 27.33  ? 442  TYR A CG  1 
ATOM   3500 C  CD1 . TYR A 1 442 ? 2.216   -11.552 22.610  1.00 24.63  ? 442  TYR A CD1 1 
ATOM   3501 C  CD2 . TYR A 1 442 ? 1.953   -13.487 21.230  1.00 27.27  ? 442  TYR A CD2 1 
ATOM   3502 C  CE1 . TYR A 1 442 ? 3.268   -11.115 21.790  1.00 26.70  ? 442  TYR A CE1 1 
ATOM   3503 C  CE2 . TYR A 1 442 ? 3.002   -13.070 20.415  1.00 27.49  ? 442  TYR A CE2 1 
ATOM   3504 C  CZ  . TYR A 1 442 ? 3.646   -11.884 20.701  1.00 28.11  ? 442  TYR A CZ  1 
ATOM   3505 O  OH  . TYR A 1 442 ? 4.661   -11.463 19.886  1.00 26.64  ? 442  TYR A OH  1 
ATOM   3506 N  N   . GLU A 1 443 ? -3.202  -12.727 23.237  1.00 23.22  ? 443  GLU A N   1 
ATOM   3507 C  CA  . GLU A 1 443 ? -4.494  -13.363 23.040  1.00 24.87  ? 443  GLU A CA  1 
ATOM   3508 C  C   . GLU A 1 443 ? -5.025  -13.145 21.624  1.00 27.08  ? 443  GLU A C   1 
ATOM   3509 O  O   . GLU A 1 443 ? -5.883  -13.913 21.172  1.00 25.12  ? 443  GLU A O   1 
ATOM   3510 C  CB  . GLU A 1 443 ? -5.499  -12.842 24.068  1.00 23.32  ? 443  GLU A CB  1 
ATOM   3511 C  CG  . GLU A 1 443 ? -6.303  -11.629 23.603  1.00 23.32  ? 443  GLU A CG  1 
ATOM   3512 C  CD  . GLU A 1 443 ? -5.494  -10.338 23.515  1.00 25.98  ? 443  GLU A CD  1 
ATOM   3513 O  OE1 . GLU A 1 443 ? -4.279  -10.304 23.893  1.00 23.53  ? 443  GLU A OE1 1 
ATOM   3514 O  OE2 . GLU A 1 443 ? -6.092  -9.339  23.059  1.00 26.58  ? 443  GLU A OE2 1 
ATOM   3515 N  N   . ILE A 1 444 ? -4.520  -12.131 20.913  1.00 21.08  ? 444  ILE A N   1 
ATOM   3516 C  CA  . ILE A 1 444 ? -5.102  -11.780 19.613  1.00 24.95  ? 444  ILE A CA  1 
ATOM   3517 C  C   . ILE A 1 444 ? -5.063  -12.976 18.671  1.00 27.69  ? 444  ILE A C   1 
ATOM   3518 O  O   . ILE A 1 444 ? -6.051  -13.282 17.992  1.00 27.31  ? 444  ILE A O   1 
ATOM   3519 C  CB  . ILE A 1 444 ? -4.387  -10.566 18.990  1.00 24.37  ? 444  ILE A CB  1 
ATOM   3520 C  CG1 . ILE A 1 444 ? -4.564  -9.318  19.849  1.00 23.33  ? 444  ILE A CG1 1 
ATOM   3521 C  CG2 . ILE A 1 444 ? -4.940  -10.293 17.568  1.00 23.41  ? 444  ILE A CG2 1 
ATOM   3522 C  CD1 . ILE A 1 444 ? -3.612  -8.183  19.448  1.00 22.70  ? 444  ILE A CD1 1 
ATOM   3523 N  N   . GLU A 1 445 ? -3.920  -13.672 18.611  1.00 23.18  ? 445  GLU A N   1 
ATOM   3524 C  CA  . GLU A 1 445 ? -3.812  -14.789 17.674  1.00 26.64  ? 445  GLU A CA  1 
ATOM   3525 C  C   . GLU A 1 445 ? -4.855  -15.869 17.949  1.00 29.80  ? 445  GLU A C   1 
ATOM   3526 O  O   . GLU A 1 445 ? -5.278  -16.572 17.021  1.00 27.89  ? 445  GLU A O   1 
ATOM   3527 C  CB  . GLU A 1 445 ? -2.404  -15.382 17.701  1.00 26.52  ? 445  GLU A CB  1 
ATOM   3528 C  CG  . GLU A 1 445 ? -1.868  -15.672 19.101  1.00 30.23  ? 445  GLU A CG  1 
ATOM   3529 C  CD  . GLU A 1 445 ? -0.348  -15.690 19.143  1.00 30.53  ? 445  GLU A CD  1 
ATOM   3530 O  OE1 . GLU A 1 445 ? 0.279   -14.664 18.807  1.00 32.51  ? 445  GLU A OE1 1 
ATOM   3531 O  OE2 . GLU A 1 445 ? 0.219   -16.737 19.502  1.00 33.71  ? 445  GLU A OE2 1 
ATOM   3532 N  N   . PHE A 1 446 ? -5.300  -16.007 19.205  1.00 24.95  ? 446  PHE A N   1 
ATOM   3533 C  CA  . PHE A 1 446 ? -6.361  -16.961 19.499  1.00 24.78  ? 446  PHE A CA  1 
ATOM   3534 C  C   . PHE A 1 446 ? -7.721  -16.424 19.073  1.00 25.95  ? 446  PHE A C   1 
ATOM   3535 O  O   . PHE A 1 446 ? -8.570  -17.182 18.585  1.00 29.38  ? 446  PHE A O   1 
ATOM   3536 C  CB  . PHE A 1 446 ? -6.345  -17.308 20.999  1.00 25.06  ? 446  PHE A CB  1 
ATOM   3537 C  CG  . PHE A 1 446 ? -5.215  -18.215 21.376  1.00 28.18  ? 446  PHE A CG  1 
ATOM   3538 C  CD1 . PHE A 1 446 ? -3.955  -17.700 21.645  1.00 26.20  ? 446  PHE A CD1 1 
ATOM   3539 C  CD2 . PHE A 1 446 ? -5.388  -19.588 21.388  1.00 32.09  ? 446  PHE A CD2 1 
ATOM   3540 C  CE1 . PHE A 1 446 ? -2.907  -18.534 21.946  1.00 28.85  ? 446  PHE A CE1 1 
ATOM   3541 C  CE2 . PHE A 1 446 ? -4.330  -20.429 21.689  1.00 31.35  ? 446  PHE A CE2 1 
ATOM   3542 C  CZ  . PHE A 1 446 ? -3.094  -19.898 21.964  1.00 31.27  ? 446  PHE A CZ  1 
ATOM   3543 N  N   . VAL A 1 447 ? -7.940  -15.122 19.255  1.00 24.42  ? 447  VAL A N   1 
ATOM   3544 C  CA  . VAL A 1 447 ? -9.192  -14.496 18.835  1.00 22.27  ? 447  VAL A CA  1 
ATOM   3545 C  C   . VAL A 1 447 ? -9.365  -14.612 17.325  1.00 26.27  ? 447  VAL A C   1 
ATOM   3546 O  O   . VAL A 1 447 ? -10.483 -14.804 16.829  1.00 28.27  ? 447  VAL A O   1 
ATOM   3547 C  CB  . VAL A 1 447 ? -9.230  -13.028 19.305  1.00 25.76  ? 447  VAL A CB  1 
ATOM   3548 C  CG1 . VAL A 1 447 ? -10.351 -12.259 18.626  1.00 26.18  ? 447  VAL A CG1 1 
ATOM   3549 C  CG2 . VAL A 1 447 ? -9.373  -12.957 20.824  1.00 24.98  ? 447  VAL A CG2 1 
ATOM   3550 N  N   . PHE A 1 448 ? -8.267  -14.519 16.573  1.00 24.37  ? 448  PHE A N   1 
ATOM   3551 C  CA  . PHE A 1 448 ? -8.343  -14.542 15.114  1.00 28.76  ? 448  PHE A CA  1 
ATOM   3552 C  C   . PHE A 1 448 ? -8.129  -15.931 14.527  1.00 29.36  ? 448  PHE A C   1 
ATOM   3553 O  O   . PHE A 1 448 ? -8.131  -16.076 13.302  1.00 29.31  ? 448  PHE A O   1 
ATOM   3554 C  CB  . PHE A 1 448 ? -7.344  -13.541 14.512  1.00 27.71  ? 448  PHE A CB  1 
ATOM   3555 C  CG  . PHE A 1 448 ? -7.858  -12.126 14.521  1.00 30.22  ? 448  PHE A CG  1 
ATOM   3556 C  CD1 . PHE A 1 448 ? -7.740  -11.338 15.656  1.00 29.24  ? 448  PHE A CD1 1 
ATOM   3557 C  CD2 . PHE A 1 448 ? -8.505  -11.601 13.411  1.00 28.29  ? 448  PHE A CD2 1 
ATOM   3558 C  CE1 . PHE A 1 448 ? -8.239  -10.038 15.679  1.00 27.33  ? 448  PHE A CE1 1 
ATOM   3559 C  CE2 . PHE A 1 448 ? -9.002  -10.309 13.425  1.00 27.50  ? 448  PHE A CE2 1 
ATOM   3560 C  CZ  . PHE A 1 448 ? -8.876  -9.527  14.557  1.00 27.15  ? 448  PHE A CZ  1 
ATOM   3561 N  N   . GLY A 1 449 ? -7.978  -16.954 15.363  1.00 27.85  ? 449  GLY A N   1 
ATOM   3562 C  CA  . GLY A 1 449 ? -8.006  -18.317 14.880  1.00 32.22  ? 449  GLY A CA  1 
ATOM   3563 C  C   . GLY A 1 449 ? -6.717  -18.833 14.287  1.00 31.19  ? 449  GLY A C   1 
ATOM   3564 O  O   . GLY A 1 449 ? -6.739  -19.836 13.572  1.00 35.14  ? 449  GLY A O   1 
ATOM   3565 N  N   . LEU A 1 450 ? -5.589  -18.185 14.565  1.00 30.80  ? 450  LEU A N   1 
ATOM   3566 C  CA  . LEU A 1 450 ? -4.322  -18.672 14.035  1.00 27.47  ? 450  LEU A CA  1 
ATOM   3567 C  C   . LEU A 1 450 ? -3.941  -20.073 14.518  1.00 33.74  ? 450  LEU A C   1 
ATOM   3568 O  O   . LEU A 1 450 ? -3.269  -20.784 13.749  1.00 33.48  ? 450  LEU A O   1 
ATOM   3569 C  CB  . LEU A 1 450 ? -3.211  -17.660 14.352  1.00 28.58  ? 450  LEU A CB  1 
ATOM   3570 C  CG  . LEU A 1 450 ? -2.984  -16.625 13.239  1.00 38.05  ? 450  LEU A CG  1 
ATOM   3571 C  CD1 . LEU A 1 450 ? -4.201  -15.715 13.088  1.00 32.44  ? 450  LEU A CD1 1 
ATOM   3572 C  CD2 . LEU A 1 450 ? -1.727  -15.811 13.490  1.00 38.51  ? 450  LEU A CD2 1 
ATOM   3573 N  N   . PRO A 1 451 ? -4.303  -20.528 15.729  1.00 33.72  ? 451  PRO A N   1 
ATOM   3574 C  CA  . PRO A 1 451 ? -4.032  -21.935 16.079  1.00 33.22  ? 451  PRO A CA  1 
ATOM   3575 C  C   . PRO A 1 451 ? -4.696  -22.942 15.151  1.00 38.73  ? 451  PRO A C   1 
ATOM   3576 O  O   . PRO A 1 451 ? -4.249  -24.095 15.098  1.00 38.50  ? 451  PRO A O   1 
ATOM   3577 C  CB  . PRO A 1 451 ? -4.569  -22.049 17.517  1.00 36.81  ? 451  PRO A CB  1 
ATOM   3578 C  CG  . PRO A 1 451 ? -4.373  -20.693 18.075  1.00 33.35  ? 451  PRO A CG  1 
ATOM   3579 C  CD  . PRO A 1 451 ? -4.677  -19.750 16.926  1.00 33.35  ? 451  PRO A CD  1 
ATOM   3580 N  N   . LEU A 1 452 ? -5.736  -22.548 14.408  1.00 37.20  ? 452  LEU A N   1 
ATOM   3581 C  CA  . LEU A 1 452 ? -6.380  -23.446 13.453  1.00 39.10  ? 452  LEU A CA  1 
ATOM   3582 C  C   . LEU A 1 452 ? -5.506  -23.782 12.251  1.00 38.74  ? 452  LEU A C   1 
ATOM   3583 O  O   . LEU A 1 452 ? -5.897  -24.639 11.453  1.00 42.09  ? 452  LEU A O   1 
ATOM   3584 C  CB  . LEU A 1 452 ? -7.686  -22.838 12.942  1.00 40.34  ? 452  LEU A CB  1 
ATOM   3585 C  CG  . LEU A 1 452 ? -8.958  -23.148 13.720  1.00 38.33  ? 452  LEU A CG  1 
ATOM   3586 C  CD1 . LEU A 1 452 ? -8.906  -22.530 15.118  1.00 38.56  ? 452  LEU A CD1 1 
ATOM   3587 C  CD2 . LEU A 1 452 ? -10.169 -22.662 12.935  1.00 35.44  ? 452  LEU A CD2 1 
ATOM   3588 N  N   . VAL A 1 453 ? -4.350  -23.143 12.094  1.00 40.32  ? 453  VAL A N   1 
ATOM   3589 C  CA  . VAL A 1 453 ? -3.498  -23.332 10.923  1.00 38.34  ? 453  VAL A CA  1 
ATOM   3590 C  C   . VAL A 1 453 ? -2.405  -24.329 11.276  1.00 43.69  ? 453  VAL A C   1 
ATOM   3591 O  O   . VAL A 1 453 ? -1.558  -24.047 12.132  1.00 42.61  ? 453  VAL A O   1 
ATOM   3592 C  CB  . VAL A 1 453 ? -2.890  -22.004 10.448  1.00 41.77  ? 453  VAL A CB  1 
ATOM   3593 C  CG1 . VAL A 1 453 ? -1.952  -22.236 9.259   1.00 39.37  ? 453  VAL A CG1 1 
ATOM   3594 C  CG2 . VAL A 1 453 ? -3.990  -21.010 10.081  1.00 38.47  ? 453  VAL A CG2 1 
ATOM   3595 N  N   . LYS A 1 454 ? -2.414  -25.482 10.601  1.00 44.48  ? 454  LYS A N   1 
ATOM   3596 C  CA  . LYS A 1 454 ? -1.466  -26.555 10.895  1.00 48.13  ? 454  LYS A CA  1 
ATOM   3597 C  C   . LYS A 1 454 ? -0.028  -26.050 10.926  1.00 46.12  ? 454  LYS A C   1 
ATOM   3598 O  O   . LYS A 1 454 ? 0.716   -26.312 11.877  1.00 44.39  ? 454  LYS A O   1 
ATOM   3599 C  CB  . LYS A 1 454 ? -1.606  -27.676 9.859   1.00 52.91  ? 454  LYS A CB  1 
ATOM   3600 C  CG  . LYS A 1 454 ? -2.918  -28.443 9.923   1.00 60.90  ? 454  LYS A CG  1 
ATOM   3601 C  CD  . LYS A 1 454 ? -3.166  -29.033 11.309  1.00 59.25  ? 454  LYS A CD  1 
ATOM   3602 N  N   . GLU A 1 455 ? 0.377   -25.314 9.893   1.00 45.37  ? 455  GLU A N   1 
ATOM   3603 C  CA  . GLU A 1 455 ? 1.776   -24.944 9.728   1.00 48.57  ? 455  GLU A CA  1 
ATOM   3604 C  C   . GLU A 1 455 ? 2.284   -23.993 10.809  1.00 43.65  ? 455  GLU A C   1 
ATOM   3605 O  O   . GLU A 1 455 ? 3.495   -23.768 10.889  1.00 45.96  ? 455  GLU A O   1 
ATOM   3606 C  CB  . GLU A 1 455 ? 1.966   -24.336 8.340   1.00 50.90  ? 455  GLU A CB  1 
ATOM   3607 C  CG  . GLU A 1 455 ? 0.950   -24.848 7.328   1.00 60.46  ? 455  GLU A CG  1 
ATOM   3608 C  CD  . GLU A 1 455 ? 1.055   -24.155 5.984   1.00 73.65  ? 455  GLU A CD  1 
ATOM   3609 O  OE1 . GLU A 1 455 ? 0.545   -24.709 4.984   1.00 77.84  ? 455  GLU A OE1 1 
ATOM   3610 O  OE2 . GLU A 1 455 ? 1.649   -23.055 5.928   1.00 74.08  ? 455  GLU A OE2 1 
ATOM   3611 N  N   . LEU A 1 456 ? 1.408   -23.444 11.648  1.00 45.02  ? 456  LEU A N   1 
ATOM   3612 C  CA  . LEU A 1 456 ? 1.843   -22.553 12.715  1.00 40.40  ? 456  LEU A CA  1 
ATOM   3613 C  C   . LEU A 1 456 ? 2.185   -23.287 14.006  1.00 42.68  ? 456  LEU A C   1 
ATOM   3614 O  O   . LEU A 1 456 ? 2.661   -22.647 14.949  1.00 39.55  ? 456  LEU A O   1 
ATOM   3615 C  CB  . LEU A 1 456 ? 0.766   -21.497 12.987  1.00 40.60  ? 456  LEU A CB  1 
ATOM   3616 C  CG  . LEU A 1 456 ? 0.476   -20.587 11.792  1.00 39.88  ? 456  LEU A CG  1 
ATOM   3617 C  CD1 . LEU A 1 456 ? -0.410  -19.419 12.201  1.00 39.92  ? 456  LEU A CD1 1 
ATOM   3618 C  CD2 . LEU A 1 456 ? 1.787   -20.092 11.190  1.00 40.89  ? 456  LEU A CD2 1 
ATOM   3619 N  N   . ASN A 1 457 ? 1.932   -24.597 14.073  1.00 40.23  ? 457  ASN A N   1 
ATOM   3620 C  CA  . ASN A 1 457 ? 2.466   -25.470 15.126  1.00 41.72  ? 457  ASN A CA  1 
ATOM   3621 C  C   . ASN A 1 457 ? 1.938   -25.115 16.516  1.00 38.82  ? 457  ASN A C   1 
ATOM   3622 O  O   . ASN A 1 457 ? 2.686   -25.110 17.495  1.00 38.80  ? 457  ASN A O   1 
ATOM   3623 C  CB  . ASN A 1 457 ? 3.996   -25.467 15.119  1.00 39.37  ? 457  ASN A CB  1 
ATOM   3624 C  CG  . ASN A 1 457 ? 4.567   -25.861 13.774  1.00 53.71  ? 457  ASN A CG  1 
ATOM   3625 O  OD1 . ASN A 1 457 ? 3.890   -26.503 12.969  1.00 53.71  ? 457  ASN A OD1 1 
ATOM   3626 N  ND2 . ASN A 1 457 ? 5.817   -25.488 13.523  1.00 60.22  ? 457  ASN A ND2 1 
ATOM   3627 N  N   . TYR A 1 458 ? 0.644   -24.829 16.609  1.00 37.32  ? 458  TYR A N   1 
ATOM   3628 C  CA  . TYR A 1 458 ? -0.010  -24.834 17.909  1.00 39.65  ? 458  TYR A CA  1 
ATOM   3629 C  C   . TYR A 1 458 ? -0.448  -26.256 18.247  1.00 42.32  ? 458  TYR A C   1 
ATOM   3630 O  O   . TYR A 1 458 ? -0.625  -27.102 17.367  1.00 42.08  ? 458  TYR A O   1 
ATOM   3631 C  CB  . TYR A 1 458 ? -1.228  -23.908 17.923  1.00 36.30  ? 458  TYR A CB  1 
ATOM   3632 C  CG  . TYR A 1 458 ? -0.921  -22.433 17.781  1.00 37.18  ? 458  TYR A CG  1 
ATOM   3633 C  CD1 . TYR A 1 458 ? -0.746  -21.859 16.524  1.00 34.77  ? 458  TYR A CD1 1 
ATOM   3634 C  CD2 . TYR A 1 458 ? -0.824  -21.610 18.901  1.00 36.24  ? 458  TYR A CD2 1 
ATOM   3635 C  CE1 . TYR A 1 458 ? -0.488  -20.509 16.385  1.00 36.02  ? 458  TYR A CE1 1 
ATOM   3636 C  CE2 . TYR A 1 458 ? -0.554  -20.260 18.774  1.00 36.09  ? 458  TYR A CE2 1 
ATOM   3637 C  CZ  . TYR A 1 458 ? -0.389  -19.713 17.518  1.00 36.45  ? 458  TYR A CZ  1 
ATOM   3638 O  OH  . TYR A 1 458 ? -0.126  -18.368 17.389  1.00 35.84  ? 458  TYR A OH  1 
ATOM   3639 N  N   . THR A 1 459 ? -0.623  -26.518 19.537  1.00 38.97  ? 459  THR A N   1 
ATOM   3640 C  CA  . THR A 1 459 ? -1.122  -27.822 19.941  1.00 39.07  ? 459  THR A CA  1 
ATOM   3641 C  C   . THR A 1 459 ? -2.601  -27.958 19.607  1.00 39.27  ? 459  THR A C   1 
ATOM   3642 O  O   . THR A 1 459 ? -3.303  -26.976 19.350  1.00 41.03  ? 459  THR A O   1 
ATOM   3643 C  CB  . THR A 1 459 ? -0.935  -28.038 21.440  1.00 42.07  ? 459  THR A CB  1 
ATOM   3644 O  OG1 . THR A 1 459 ? -1.824  -27.164 22.148  1.00 37.97  ? 459  THR A OG1 1 
ATOM   3645 C  CG2 . THR A 1 459 ? 0.503   -27.761 21.844  1.00 36.55  ? 459  THR A CG2 1 
ATOM   3646 N  N   . ALA A 1 460 ? -3.081  -29.202 19.637  1.00 37.20  ? 460  ALA A N   1 
ATOM   3647 C  CA  . ALA A 1 460 ? -4.502  -29.432 19.417  1.00 41.39  ? 460  ALA A CA  1 
ATOM   3648 C  C   . ALA A 1 460 ? -5.336  -28.780 20.509  1.00 39.48  ? 460  ALA A C   1 
ATOM   3649 O  O   . ALA A 1 460 ? -6.453  -28.314 20.247  1.00 39.82  ? 460  ALA A O   1 
ATOM   3650 C  CB  . ALA A 1 460 ? -4.786  -30.932 19.340  1.00 45.94  ? 460  ALA A CB  1 
ATOM   3651 N  N   . GLU A 1 461 ? -4.805  -28.726 21.732  1.00 37.60  ? 461  GLU A N   1 
ATOM   3652 C  CA  . GLU A 1 461 ? -5.517  -28.070 22.822  1.00 41.71  ? 461  GLU A CA  1 
ATOM   3653 C  C   . GLU A 1 461 ? -5.627  -26.570 22.584  1.00 36.84  ? 461  GLU A C   1 
ATOM   3654 O  O   . GLU A 1 461 ? -6.630  -25.951 22.961  1.00 36.16  ? 461  GLU A O   1 
ATOM   3655 C  CB  . GLU A 1 461 ? -4.812  -28.358 24.151  1.00 41.53  ? 461  GLU A CB  1 
ATOM   3656 C  CG  . GLU A 1 461 ? -4.929  -29.808 24.640  1.00 47.66  ? 461  GLU A CG  1 
ATOM   3657 C  CD  . GLU A 1 461 ? -4.176  -30.808 23.768  0.24 43.77  ? 461  GLU A CD  1 
ATOM   3658 O  OE1 . GLU A 1 461 ? -3.182  -30.418 23.117  0.68 42.33  ? 461  GLU A OE1 1 
ATOM   3659 O  OE2 . GLU A 1 461 ? -4.580  -31.990 23.735  0.42 45.13  ? 461  GLU A OE2 1 
ATOM   3660 N  N   . GLU A 1 462 ? -4.613  -25.977 21.948  1.00 37.39  ? 462  GLU A N   1 
ATOM   3661 C  CA  . GLU A 1 462 ? -4.659  -24.554 21.639  1.00 38.39  ? 462  GLU A CA  1 
ATOM   3662 C  C   . GLU A 1 462 ? -5.599  -24.259 20.474  1.00 36.59  ? 462  GLU A C   1 
ATOM   3663 O  O   . GLU A 1 462 ? -6.247  -23.204 20.454  1.00 36.24  ? 462  GLU A O   1 
ATOM   3664 C  CB  . GLU A 1 462 ? -3.248  -24.046 21.353  1.00 36.11  ? 462  GLU A CB  1 
ATOM   3665 C  CG  . GLU A 1 462 ? -2.439  -23.858 22.621  1.00 36.03  ? 462  GLU A CG  1 
ATOM   3666 C  CD  . GLU A 1 462 ? -0.949  -23.732 22.386  1.00 34.35  ? 462  GLU A CD  1 
ATOM   3667 O  OE1 . GLU A 1 462 ? -0.443  -24.237 21.359  1.00 37.28  ? 462  GLU A OE1 1 
ATOM   3668 O  OE2 . GLU A 1 462 ? -0.276  -23.140 23.253  1.00 37.75  ? 462  GLU A OE2 1 
ATOM   3669 N  N   . GLU A 1 463 ? -5.709  -25.176 19.511  1.00 34.87  ? 463  GLU A N   1 
ATOM   3670 C  CA  . GLU A 1 463 ? -6.746  -25.023 18.497  1.00 35.68  ? 463  GLU A CA  1 
ATOM   3671 C  C   . GLU A 1 463 ? -8.126  -25.031 19.137  1.00 38.51  ? 463  GLU A C   1 
ATOM   3672 O  O   . GLU A 1 463 ? -8.971  -24.186 18.819  1.00 36.14  ? 463  GLU A O   1 
ATOM   3673 C  CB  . GLU A 1 463 ? -6.642  -26.118 17.435  1.00 36.27  ? 463  GLU A CB  1 
ATOM   3674 C  CG  . GLU A 1 463 ? -7.909  -26.197 16.592  1.00 41.26  ? 463  GLU A CG  1 
ATOM   3675 C  CD  . GLU A 1 463 ? -7.822  -27.164 15.424  1.00 43.84  ? 463  GLU A CD  1 
ATOM   3676 O  OE1 . GLU A 1 463 ? -6.716  -27.655 15.119  1.00 45.77  ? 463  GLU A OE1 1 
ATOM   3677 O  OE2 . GLU A 1 463 ? -8.877  -27.430 14.812  1.00 44.90  ? 463  GLU A OE2 1 
ATOM   3678 N  N   . ALA A 1 464 ? -8.369  -25.962 20.064  1.00 33.74  ? 464  ALA A N   1 
ATOM   3679 C  CA  . ALA A 1 464 ? -9.671  -26.002 20.722  1.00 33.39  ? 464  ALA A CA  1 
ATOM   3680 C  C   . ALA A 1 464 ? -9.938  -24.711 21.486  1.00 33.98  ? 464  ALA A C   1 
ATOM   3681 O  O   . ALA A 1 464 ? -11.055 -24.177 21.449  1.00 33.19  ? 464  ALA A O   1 
ATOM   3682 C  CB  . ALA A 1 464 ? -9.756  -27.212 21.654  1.00 36.88  ? 464  ALA A CB  1 
ATOM   3683 N  N   . LEU A 1 465 ? -8.923  -24.185 22.177  1.00 33.96  ? 465  LEU A N   1 
ATOM   3684 C  CA  . LEU A 1 465 ? -9.093  -22.928 22.900  1.00 32.81  ? 465  LEU A CA  1 
ATOM   3685 C  C   . LEU A 1 465 ? -9.436  -21.794 21.943  1.00 28.52  ? 465  LEU A C   1 
ATOM   3686 O  O   . LEU A 1 465 ? -10.364 -21.016 22.192  1.00 31.43  ? 465  LEU A O   1 
ATOM   3687 C  CB  . LEU A 1 465 ? -7.828  -22.598 23.690  1.00 33.60  ? 465  LEU A CB  1 
ATOM   3688 C  CG  . LEU A 1 465 ? -7.778  -21.232 24.384  1.00 30.27  ? 465  LEU A CG  1 
ATOM   3689 C  CD1 . LEU A 1 465 ? -8.991  -21.005 25.277  1.00 28.69  ? 465  LEU A CD1 1 
ATOM   3690 C  CD2 . LEU A 1 465 ? -6.483  -21.101 25.176  1.00 26.63  ? 465  LEU A CD2 1 
ATOM   3691 N  N   . SER A 1 466 ? -8.687  -21.680 20.846  1.00 32.08  ? 466  SER A N   1 
ATOM   3692 C  CA  . SER A 1 466 ? -9.002  -20.670 19.842  1.00 31.62  ? 466  SER A CA  1 
ATOM   3693 C  C   . SER A 1 466 ? -10.416 -20.843 19.297  1.00 33.38  ? 466  SER A C   1 
ATOM   3694 O  O   . SER A 1 466 ? -11.152 -19.861 19.144  1.00 32.81  ? 466  SER A O   1 
ATOM   3695 C  CB  . SER A 1 466 ? -7.994  -20.720 18.700  1.00 33.24  ? 466  SER A CB  1 
ATOM   3696 O  OG  . SER A 1 466 ? -8.339  -19.746 17.733  1.00 33.19  ? 466  SER A OG  1 
ATOM   3697 N  N   . ARG A 1 467 ? -10.815 -22.082 18.993  1.00 33.76  ? 467  ARG A N   1 
ATOM   3698 C  CA  . ARG A 1 467 ? -12.192 -22.308 18.566  1.00 33.42  ? 467  ARG A CA  1 
ATOM   3699 C  C   . ARG A 1 467 ? -13.176 -21.884 19.648  1.00 31.00  ? 467  ARG A C   1 
ATOM   3700 O  O   . ARG A 1 467 ? -14.216 -21.292 19.346  1.00 33.29  ? 467  ARG A O   1 
ATOM   3701 C  CB  . ARG A 1 467 ? -12.400 -23.772 18.182  1.00 35.63  ? 467  ARG A CB  1 
ATOM   3702 C  CG  . ARG A 1 467 ? -11.687 -24.168 16.892  1.00 34.36  ? 467  ARG A CG  1 
ATOM   3703 C  CD  . ARG A 1 467 ? -12.140 -25.526 16.413  1.00 37.04  ? 467  ARG A CD  1 
ATOM   3704 N  NE  . ARG A 1 467 ? -11.397 -25.942 15.231  1.00 38.16  ? 467  ARG A NE  1 
ATOM   3705 C  CZ  . ARG A 1 467 ? -11.729 -25.628 13.985  1.00 38.83  ? 467  ARG A CZ  1 
ATOM   3706 N  NH1 . ARG A 1 467 ? -12.806 -24.894 13.737  1.00 36.29  ? 467  ARG A NH1 1 
ATOM   3707 N  NH2 . ARG A 1 467 ? -10.975 -26.055 12.982  1.00 41.35  ? 467  ARG A NH2 1 
ATOM   3708 N  N   . ARG A 1 468 ? -12.864 -22.171 20.917  1.00 34.43  ? 468  ARG A N   1 
ATOM   3709 C  CA  A ARG A 1 468 ? -13.735 -21.733 22.004  0.59 34.19  ? 468  ARG A CA  1 
ATOM   3710 C  CA  B ARG A 1 468 ? -13.733 -21.733 22.006  0.41 34.19  ? 468  ARG A CA  1 
ATOM   3711 C  C   . ARG A 1 468 ? -13.829 -20.215 22.047  1.00 29.27  ? 468  ARG A C   1 
ATOM   3712 O  O   . ARG A 1 468 ? -14.922 -19.650 22.178  1.00 31.58  ? 468  ARG A O   1 
ATOM   3713 C  CB  A ARG A 1 468 ? -13.219 -22.263 23.344  0.59 36.66  ? 468  ARG A CB  1 
ATOM   3714 C  CB  B ARG A 1 468 ? -13.212 -22.263 23.343  0.41 36.64  ? 468  ARG A CB  1 
ATOM   3715 C  CG  A ARG A 1 468 ? -13.826 -23.575 23.807  0.59 39.96  ? 468  ARG A CG  1 
ATOM   3716 C  CG  B ARG A 1 468 ? -13.483 -23.733 23.607  0.41 39.02  ? 468  ARG A CG  1 
ATOM   3717 C  CD  A ARG A 1 468 ? -13.255 -23.987 25.172  0.59 38.10  ? 468  ARG A CD  1 
ATOM   3718 C  CD  B ARG A 1 468 ? -13.387 -24.049 25.105  0.41 38.10  ? 468  ARG A CD  1 
ATOM   3719 N  NE  A ARG A 1 468 ? -13.643 -23.061 26.233  0.59 38.13  ? 468  ARG A NE  1 
ATOM   3720 N  NE  B ARG A 1 468 ? -12.037 -23.860 25.635  0.41 37.03  ? 468  ARG A NE  1 
ATOM   3721 C  CZ  A ARG A 1 468 ? -12.827 -22.614 27.186  0.59 34.93  ? 468  ARG A CZ  1 
ATOM   3722 C  CZ  B ARG A 1 468 ? -11.071 -24.770 25.560  0.41 34.32  ? 468  ARG A CZ  1 
ATOM   3723 N  NH1 A ARG A 1 468 ? -11.557 -22.993 27.221  0.59 35.88  ? 468  ARG A NH1 1 
ATOM   3724 N  NH1 B ARG A 1 468 ? -11.301 -25.931 24.968  0.41 37.93  ? 468  ARG A NH1 1 
ATOM   3725 N  NH2 A ARG A 1 468 ? -13.284 -21.775 28.102  0.59 36.02  ? 468  ARG A NH2 1 
ATOM   3726 N  NH2 B ARG A 1 468 ? -9.877  -24.519 26.073  0.41 33.53  ? 468  ARG A NH2 1 
ATOM   3727 N  N   . ILE A 1 469 ? -12.683 -19.538 21.956  1.00 31.80  ? 469  ILE A N   1 
ATOM   3728 C  CA  . ILE A 1 469 ? -12.661 -18.084 22.068  1.00 28.88  ? 469  ILE A CA  1 
ATOM   3729 C  C   . ILE A 1 469 ? -13.405 -17.451 20.891  1.00 27.31  ? 469  ILE A C   1 
ATOM   3730 O  O   . ILE A 1 469 ? -14.242 -16.559 21.074  1.00 28.13  ? 469  ILE A O   1 
ATOM   3731 C  CB  . ILE A 1 469 ? -11.204 -17.588 22.179  1.00 29.03  ? 469  ILE A CB  1 
ATOM   3732 C  CG1 . ILE A 1 469 ? -10.695 -17.734 23.625  1.00 25.77  ? 469  ILE A CG1 1 
ATOM   3733 C  CG2 . ILE A 1 469 ? -11.065 -16.148 21.726  1.00 27.82  ? 469  ILE A CG2 1 
ATOM   3734 C  CD1 . ILE A 1 469 ? -9.183  -17.505 23.754  1.00 28.59  ? 469  ILE A CD1 1 
ATOM   3735 N  N   . MET A 1 470 ? -13.135 -17.925 19.672  1.00 29.02  ? 470  MET A N   1 
ATOM   3736 C  CA  . MET A 1 470 ? -13.837 -17.387 18.506  1.00 31.58  ? 470  MET A CA  1 
ATOM   3737 C  C   . MET A 1 470 ? -15.344 -17.553 18.645  1.00 26.20  ? 470  MET A C   1 
ATOM   3738 O  O   . MET A 1 470 ? -16.111 -16.647 18.297  1.00 31.07  ? 470  MET A O   1 
ATOM   3739 C  CB  . MET A 1 470 ? -13.350 -18.060 17.221  1.00 28.39  ? 470  MET A CB  1 
ATOM   3740 C  CG  . MET A 1 470 ? -11.940 -17.655 16.803  1.00 31.38  ? 470  MET A CG  1 
ATOM   3741 S  SD  . MET A 1 470 ? -11.572 -18.099 15.091  1.00 36.15  ? 470  MET A SD  1 
ATOM   3742 C  CE  . MET A 1 470 ? -11.462 -19.878 15.235  1.00 34.41  ? 470  MET A CE  1 
ATOM   3743 N  N   . HIS A 1 471 ? -15.788 -18.697 19.174  1.00 31.35  ? 471  HIS A N   1 
ATOM   3744 C  CA  . HIS A 1 471 ? -17.223 -18.916 19.337  1.00 32.81  ? 471  HIS A CA  1 
ATOM   3745 C  C   . HIS A 1 471 ? -17.802 -18.037 20.437  1.00 30.31  ? 471  HIS A C   1 
ATOM   3746 O  O   . HIS A 1 471 ? -18.904 -17.501 20.284  1.00 30.43  ? 471  HIS A O   1 
ATOM   3747 C  CB  . HIS A 1 471 ? -17.515 -20.387 19.616  1.00 32.87  ? 471  HIS A CB  1 
ATOM   3748 C  CG  . HIS A 1 471 ? -18.930 -20.775 19.324  1.00 35.11  ? 471  HIS A CG  1 
ATOM   3749 N  ND1 . HIS A 1 471 ? -19.456 -20.751 18.051  1.00 40.20  ? 471  HIS A ND1 1 
ATOM   3750 C  CD2 . HIS A 1 471 ? -19.934 -21.174 20.140  1.00 38.77  ? 471  HIS A CD2 1 
ATOM   3751 C  CE1 . HIS A 1 471 ? -20.723 -21.126 18.094  1.00 43.86  ? 471  HIS A CE1 1 
ATOM   3752 N  NE2 . HIS A 1 471 ? -21.036 -21.390 19.350  1.00 43.13  ? 471  HIS A NE2 1 
ATOM   3753 N  N   . TYR A 1 472 ? -17.092 -17.887 21.562  1.00 29.67  ? 472  TYR A N   1 
ATOM   3754 C  CA  . TYR A 1 472 ? -17.520 -16.914 22.563  1.00 28.79  ? 472  TYR A CA  1 
ATOM   3755 C  C   . TYR A 1 472 ? -17.673 -15.532 21.939  1.00 26.47  ? 472  TYR A C   1 
ATOM   3756 O  O   . TYR A 1 472 ? -18.684 -14.850 22.146  1.00 30.00  ? 472  TYR A O   1 
ATOM   3757 C  CB  . TYR A 1 472 ? -16.509 -16.829 23.710  1.00 27.38  ? 472  TYR A CB  1 
ATOM   3758 C  CG  . TYR A 1 472 ? -16.442 -17.999 24.664  1.00 31.90  ? 472  TYR A CG  1 
ATOM   3759 C  CD1 . TYR A 1 472 ? -17.574 -18.735 24.991  1.00 30.87  ? 472  TYR A CD1 1 
ATOM   3760 C  CD2 . TYR A 1 472 ? -15.236 -18.340 25.269  1.00 31.95  ? 472  TYR A CD2 1 
ATOM   3761 C  CE1 . TYR A 1 472 ? -17.502 -19.798 25.892  1.00 34.98  ? 472  TYR A CE1 1 
ATOM   3762 C  CE2 . TYR A 1 472 ? -15.151 -19.394 26.164  1.00 35.95  ? 472  TYR A CE2 1 
ATOM   3763 C  CZ  . TYR A 1 472 ? -16.282 -20.120 26.473  1.00 37.63  ? 472  TYR A CZ  1 
ATOM   3764 O  OH  . TYR A 1 472 ? -16.185 -21.167 27.368  1.00 41.52  ? 472  TYR A OH  1 
ATOM   3765 N  N   . TRP A 1 473 ? -16.639 -15.081 21.224  1.00 26.00  ? 473  TRP A N   1 
ATOM   3766 C  CA  . TRP A 1 473 ? -16.641 -13.735 20.658  1.00 28.04  ? 473  TRP A CA  1 
ATOM   3767 C  C   . TRP A 1 473 ? -17.791 -13.563 19.674  1.00 24.83  ? 473  TRP A C   1 
ATOM   3768 O  O   . TRP A 1 473 ? -18.539 -12.583 19.744  1.00 24.16  ? 473  TRP A O   1 
ATOM   3769 C  CB  . TRP A 1 473 ? -15.304 -13.458 19.960  1.00 25.60  ? 473  TRP A CB  1 
ATOM   3770 C  CG  . TRP A 1 473 ? -14.247 -12.718 20.778  1.00 27.24  ? 473  TRP A CG  1 
ATOM   3771 C  CD1 . TRP A 1 473 ? -13.521 -11.625 20.369  1.00 28.45  ? 473  TRP A CD1 1 
ATOM   3772 C  CD2 . TRP A 1 473 ? -13.768 -13.040 22.102  1.00 26.08  ? 473  TRP A CD2 1 
ATOM   3773 N  NE1 . TRP A 1 473 ? -12.635 -11.242 21.361  1.00 26.60  ? 473  TRP A NE1 1 
ATOM   3774 C  CE2 . TRP A 1 473 ? -12.769 -12.091 22.429  1.00 25.40  ? 473  TRP A CE2 1 
ATOM   3775 C  CE3 . TRP A 1 473 ? -14.089 -14.029 23.038  1.00 27.92  ? 473  TRP A CE3 1 
ATOM   3776 C  CZ2 . TRP A 1 473 ? -12.091 -12.105 23.657  1.00 27.98  ? 473  TRP A CZ2 1 
ATOM   3777 C  CZ3 . TRP A 1 473 ? -13.414 -14.045 24.258  1.00 25.46  ? 473  TRP A CZ3 1 
ATOM   3778 C  CH2 . TRP A 1 473 ? -12.421 -13.088 24.553  1.00 24.87  ? 473  TRP A CH2 1 
ATOM   3779 N  N   . ALA A 1 474 ? -17.942 -14.514 18.745  1.00 25.02  ? 474  ALA A N   1 
ATOM   3780 C  CA  . ALA A 1 474 ? -18.948 -14.369 17.693  1.00 28.57  ? 474  ALA A CA  1 
ATOM   3781 C  C   . ALA A 1 474 ? -20.358 -14.592 18.227  1.00 31.81  ? 474  ALA A C   1 
ATOM   3782 O  O   . ALA A 1 474 ? -21.304 -13.935 17.778  1.00 29.96  ? 474  ALA A O   1 
ATOM   3783 C  CB  . ALA A 1 474 ? -18.656 -15.333 16.549  1.00 27.50  ? 474  ALA A CB  1 
ATOM   3784 N  N   . THR A 1 475 ? -20.529 -15.521 19.173  1.00 28.97  ? 475  THR A N   1 
ATOM   3785 C  CA  . THR A 1 475 ? -21.856 -15.699 19.762  1.00 26.60  ? 475  THR A CA  1 
ATOM   3786 C  C   . THR A 1 475 ? -22.254 -14.471 20.565  1.00 29.22  ? 475  THR A C   1 
ATOM   3787 O  O   . THR A 1 475 ? -23.415 -14.043 20.529  1.00 30.66  ? 475  THR A O   1 
ATOM   3788 C  CB  . THR A 1 475 ? -21.890 -16.953 20.639  1.00 29.34  ? 475  THR A CB  1 
ATOM   3789 O  OG1 . THR A 1 475 ? -21.487 -18.085 19.857  1.00 30.56  ? 475  THR A OG1 1 
ATOM   3790 C  CG2 . THR A 1 475 ? -23.299 -17.194 21.198  1.00 31.95  ? 475  THR A CG2 1 
ATOM   3791 N  N   . PHE A 1 476 ? -21.303 -13.883 21.297  1.00 27.42  ? 476  PHE A N   1 
ATOM   3792 C  CA  . PHE A 1 476 ? -21.588 -12.616 21.963  1.00 26.42  ? 476  PHE A CA  1 
ATOM   3793 C  C   . PHE A 1 476 ? -21.966 -11.545 20.943  1.00 25.07  ? 476  PHE A C   1 
ATOM   3794 O  O   . PHE A 1 476 ? -22.943 -10.808 21.126  1.00 29.11  ? 476  PHE A O   1 
ATOM   3795 C  CB  . PHE A 1 476 ? -20.385 -12.168 22.796  1.00 26.64  ? 476  PHE A CB  1 
ATOM   3796 C  CG  . PHE A 1 476 ? -20.511 -10.767 23.307  1.00 24.73  ? 476  PHE A CG  1 
ATOM   3797 C  CD1 . PHE A 1 476 ? -21.225 -10.502 24.468  1.00 24.35  ? 476  PHE A CD1 1 
ATOM   3798 C  CD2 . PHE A 1 476 ? -19.933 -9.712  22.626  1.00 23.72  ? 476  PHE A CD2 1 
ATOM   3799 C  CE1 . PHE A 1 476 ? -21.362 -9.214  24.932  1.00 23.17  ? 476  PHE A CE1 1 
ATOM   3800 C  CE2 . PHE A 1 476 ? -20.063 -8.417  23.091  1.00 23.17  ? 476  PHE A CE2 1 
ATOM   3801 C  CZ  . PHE A 1 476 ? -20.777 -8.163  24.245  1.00 22.05  ? 476  PHE A CZ  1 
ATOM   3802 N  N   . ALA A 1 477 ? -21.204 -11.453 19.851  1.00 23.52  ? 477  ALA A N   1 
ATOM   3803 C  CA  . ALA A 1 477 ? -21.524 -10.475 18.818  1.00 23.16  ? 477  ALA A CA  1 
ATOM   3804 C  C   . ALA A 1 477 ? -22.939 -10.689 18.278  1.00 24.34  ? 477  ALA A C   1 
ATOM   3805 O  O   . ALA A 1 477 ? -23.701 -9.730  18.136  1.00 27.66  ? 477  ALA A O   1 
ATOM   3806 C  CB  . ALA A 1 477 ? -20.477 -10.535 17.702  1.00 24.23  ? 477  ALA A CB  1 
ATOM   3807 N  N   . LYS A 1 478 ? -23.327 -11.950 18.042  1.00 26.73  ? 478  LYS A N   1 
ATOM   3808 C  CA  . LYS A 1 478 ? -24.658 -12.259 17.501  1.00 30.85  ? 478  LYS A CA  1 
ATOM   3809 C  C   . LYS A 1 478 ? -25.786 -11.969 18.499  1.00 33.11  ? 478  LYS A C   1 
ATOM   3810 O  O   . LYS A 1 478 ? -26.860 -11.481 18.114  1.00 29.08  ? 478  LYS A O   1 
ATOM   3811 C  CB  . LYS A 1 478 ? -24.704 -13.729 17.077  1.00 31.94  ? 478  LYS A CB  1 
ATOM   3812 C  CG  . LYS A 1 478 ? -23.774 -14.092 15.917  1.00 39.94  ? 478  LYS A CG  1 
ATOM   3813 C  CD  . LYS A 1 478 ? -23.381 -15.578 15.906  1.00 44.01  ? 478  LYS A CD  1 
ATOM   3814 C  CE  . LYS A 1 478 ? -22.586 -15.946 14.646  1.00 44.04  ? 478  LYS A CE  1 
ATOM   3815 N  NZ  . LYS A 1 478 ? -21.595 -17.056 14.891  1.00 47.81  ? 478  LYS A NZ  1 
ATOM   3816 N  N   . THR A 1 479 ? -25.582 -12.279 19.784  1.00 26.86  ? 479  THR A N   1 
ATOM   3817 C  CA  . THR A 1 479 ? -26.682 -12.371 20.740  1.00 28.87  ? 479  THR A CA  1 
ATOM   3818 C  C   . THR A 1 479 ? -26.525 -11.519 21.989  1.00 31.95  ? 479  THR A C   1 
ATOM   3819 O  O   . THR A 1 479 ? -27.499 -11.379 22.742  1.00 28.08  ? 479  THR A O   1 
ATOM   3820 C  CB  . THR A 1 479 ? -26.864 -13.825 21.198  1.00 31.86  ? 479  THR A CB  1 
ATOM   3821 O  OG1 . THR A 1 479 ? -25.799 -14.161 22.099  1.00 29.55  ? 479  THR A OG1 1 
ATOM   3822 C  CG2 . THR A 1 479 ? -26.825 -14.774 20.002  1.00 30.57  ? 479  THR A CG2 1 
ATOM   3823 N  N   . GLY A 1 480 ? -25.341 -10.971 22.251  1.00 28.73  ? 480  GLY A N   1 
ATOM   3824 C  CA  . GLY A 1 480 ? -25.091 -10.290 23.503  1.00 25.03  ? 480  GLY A CA  1 
ATOM   3825 C  C   . GLY A 1 480 ? -24.717 -11.216 24.636  1.00 24.23  ? 480  GLY A C   1 
ATOM   3826 O  O   . GLY A 1 480 ? -24.643 -10.770 25.785  1.00 26.26  ? 480  GLY A O   1 
ATOM   3827 N  N   . ASN A 1 481 ? -24.468 -12.487 24.342  1.00 28.14  ? 481  ASN A N   1 
ATOM   3828 C  CA  . ASN A 1 481 ? -24.211 -13.514 25.338  1.00 31.34  ? 481  ASN A CA  1 
ATOM   3829 C  C   . ASN A 1 481 ? -23.224 -14.492 24.722  1.00 30.38  ? 481  ASN A C   1 
ATOM   3830 O  O   . ASN A 1 481 ? -23.524 -15.097 23.682  1.00 26.98  ? 481  ASN A O   1 
ATOM   3831 C  CB  . ASN A 1 481 ? -25.519 -14.207 25.752  1.00 30.66  ? 481  ASN A CB  1 
ATOM   3832 C  CG  . ASN A 1 481 ? -25.336 -15.204 26.900  1.00 32.50  ? 481  ASN A CG  1 
ATOM   3833 O  OD1 . ASN A 1 481 ? -24.258 -15.755 27.103  1.00 33.82  ? 481  ASN A OD1 1 
ATOM   3834 N  ND2 . ASN A 1 481 ? -26.412 -15.453 27.639  1.00 31.52  ? 481  ASN A ND2 1 
ATOM   3835 N  N   . PRO A 1 482 ? -22.035 -14.664 25.317  1.00 27.78  ? 482  PRO A N   1 
ATOM   3836 C  CA  . PRO A 1 482 ? -21.052 -15.587 24.733  1.00 27.28  ? 482  PRO A CA  1 
ATOM   3837 C  C   . PRO A 1 482 ? -21.475 -17.041 24.776  1.00 27.10  ? 482  PRO A C   1 
ATOM   3838 O  O   . PRO A 1 482 ? -20.859 -17.859 24.079  1.00 29.69  ? 482  PRO A O   1 
ATOM   3839 C  CB  . PRO A 1 482 ? -19.794 -15.355 25.590  1.00 24.17  ? 482  PRO A CB  1 
ATOM   3840 C  CG  . PRO A 1 482 ? -20.332 -14.899 26.913  1.00 27.94  ? 482  PRO A CG  1 
ATOM   3841 C  CD  . PRO A 1 482 ? -21.561 -14.078 26.584  1.00 28.30  ? 482  PRO A CD  1 
ATOM   3842 N  N   . ASN A 1 483 ? -22.481 -17.393 25.581  1.00 29.72  ? 483  ASN A N   1 
ATOM   3843 C  CA  . ASN A 1 483 ? -22.904 -18.777 25.749  1.00 32.74  ? 483  ASN A CA  1 
ATOM   3844 C  C   . ASN A 1 483 ? -23.986 -19.137 24.745  1.00 35.00  ? 483  ASN A C   1 
ATOM   3845 O  O   . ASN A 1 483 ? -24.908 -18.354 24.507  1.00 34.60  ? 483  ASN A O   1 
ATOM   3846 C  CB  . ASN A 1 483 ? -23.450 -19.016 27.159  1.00 35.54  ? 483  ASN A CB  1 
ATOM   3847 C  CG  . ASN A 1 483 ? -22.471 -18.621 28.232  1.00 32.32  ? 483  ASN A CG  1 
ATOM   3848 O  OD1 . ASN A 1 483 ? -21.446 -19.271 28.408  1.00 32.78  ? 483  ASN A OD1 1 
ATOM   3849 N  ND2 . ASN A 1 483 ? -22.781 -17.555 28.958  1.00 29.29  ? 483  ASN A ND2 1 
ATOM   3850 N  N   . GLU A 1 484 ? -23.878 -20.334 24.177  1.00 42.42  ? 484  GLU A N   1 
ATOM   3851 C  CA  . GLU A 1 484 ? -24.971 -20.878 23.384  1.00 49.35  ? 484  GLU A CA  1 
ATOM   3852 C  C   . GLU A 1 484 ? -26.032 -21.460 24.313  1.00 60.39  ? 484  GLU A C   1 
ATOM   3853 O  O   . GLU A 1 484 ? -25.697 -22.219 25.230  1.00 61.05  ? 484  GLU A O   1 
ATOM   3854 C  CB  . GLU A 1 484 ? -24.461 -21.947 22.422  1.00 53.40  ? 484  GLU A CB  1 
ATOM   3855 C  CG  . GLU A 1 484 ? -24.590 -21.551 20.961  1.00 52.63  ? 484  GLU A CG  1 
ATOM   3856 C  CD  . GLU A 1 484 ? -23.889 -22.511 20.020  1.00 57.11  ? 484  GLU A CD  1 
ATOM   3857 O  OE1 . GLU A 1 484 ? -23.283 -23.491 20.503  1.00 64.15  ? 484  GLU A OE1 1 
ATOM   3858 O  OE2 . GLU A 1 484 ? -23.953 -22.288 18.793  1.00 60.54  ? 484  GLU A OE2 1 
ATOM   3859 N  N   . PRO A 1 485 ? -27.302 -21.113 24.133  1.00 67.87  ? 485  PRO A N   1 
ATOM   3860 C  CA  . PRO A 1 485 ? -28.352 -21.713 24.961  1.00 72.70  ? 485  PRO A CA  1 
ATOM   3861 C  C   . PRO A 1 485 ? -28.536 -23.187 24.634  1.00 78.21  ? 485  PRO A C   1 
ATOM   3862 O  O   . PRO A 1 485 ? -28.189 -23.664 23.547  1.00 76.89  ? 485  PRO A O   1 
ATOM   3863 C  CB  . PRO A 1 485 ? -29.599 -20.900 24.602  1.00 75.20  ? 485  PRO A CB  1 
ATOM   3864 C  CG  . PRO A 1 485 ? -29.321 -20.390 23.224  1.00 65.40  ? 485  PRO A CG  1 
ATOM   3865 C  CD  . PRO A 1 485 ? -27.841 -20.134 23.173  1.00 64.90  ? 485  PRO A CD  1 
ATOM   3866 N  N   . HIS A 1 486 ? -29.094 -23.911 25.612  1.00 80.31  ? 486  HIS A N   1 
ATOM   3867 C  CA  . HIS A 1 486 ? -29.340 -25.345 25.496  1.00 85.72  ? 486  HIS A CA  1 
ATOM   3868 C  C   . HIS A 1 486 ? -28.071 -26.124 25.168  1.00 85.09  ? 486  HIS A C   1 
ATOM   3869 O  O   . HIS A 1 486 ? -28.137 -27.317 24.846  1.00 87.89  ? 486  HIS A O   1 
ATOM   3870 C  CB  . HIS A 1 486 ? -30.415 -25.627 24.445  1.00 89.77  ? 486  HIS A CB  1 
ATOM   3871 C  CG  . HIS A 1 486 ? -31.810 -25.604 24.991  1.00 95.62  ? 486  HIS A CG  1 
ATOM   3872 N  ND1 . HIS A 1 486 ? -32.909 -25.999 24.257  1.00 99.30  ? 486  HIS A ND1 1 
ATOM   3873 C  CD2 . HIS A 1 486 ? -32.284 -25.238 26.206  1.00 96.02  ? 486  HIS A CD2 1 
ATOM   3874 C  CE1 . HIS A 1 486 ? -33.999 -25.878 24.995  1.00 99.23  ? 486  HIS A CE1 1 
ATOM   3875 N  NE2 . HIS A 1 486 ? -33.647 -25.416 26.182  1.00 102.47 ? 486  HIS A NE2 1 
ATOM   3876 N  N   . SER A 1 487 ? -26.918 -25.465 25.254  1.00 79.24  ? 487  SER A N   1 
ATOM   3877 C  CA  . SER A 1 487 ? -25.660 -26.178 25.210  1.00 76.66  ? 487  SER A CA  1 
ATOM   3878 C  C   . SER A 1 487 ? -25.368 -26.768 26.586  1.00 74.76  ? 487  SER A C   1 
ATOM   3879 O  O   . SER A 1 487 ? -25.915 -26.336 27.603  1.00 76.08  ? 487  SER A O   1 
ATOM   3880 C  CB  . SER A 1 487 ? -24.530 -25.255 24.760  1.00 72.75  ? 487  SER A CB  1 
ATOM   3881 O  OG  . SER A 1 487 ? -23.276 -25.728 25.221  1.00 73.24  ? 487  SER A OG  1 
ATOM   3882 N  N   . GLN A 1 488 ? -24.502 -27.785 26.595  1.00 76.33  ? 488  GLN A N   1 
ATOM   3883 C  CA  . GLN A 1 488 ? -24.104 -28.509 27.797  1.00 79.30  ? 488  GLN A CA  1 
ATOM   3884 C  C   . GLN A 1 488 ? -22.711 -28.160 28.297  1.00 75.73  ? 488  GLN A C   1 
ATOM   3885 O  O   . GLN A 1 488 ? -22.322 -28.644 29.364  1.00 74.02  ? 488  GLN A O   1 
ATOM   3886 C  CB  . GLN A 1 488 ? -24.202 -30.010 27.574  1.00 80.96  ? 488  GLN A CB  1 
ATOM   3887 C  CG  . GLN A 1 488 ? -25.628 -30.520 27.471  1.00 82.01  ? 488  GLN A CG  1 
ATOM   3888 C  CD  . GLN A 1 488 ? -26.116 -30.655 26.042  1.00 84.57  ? 488  GLN A CD  1 
ATOM   3889 O  OE1 . GLN A 1 488 ? -25.536 -30.072 25.132  1.00 87.06  ? 488  GLN A OE1 1 
ATOM   3890 N  NE2 . GLN A 1 488 ? -27.238 -31.352 25.850  1.00 83.26  ? 488  GLN A NE2 1 
ATOM   3891 N  N   . GLU A 1 489 ? -21.955 -27.350 27.568  1.00 74.15  ? 489  GLU A N   1 
ATOM   3892 C  CA  . GLU A 1 489 ? -20.709 -26.847 28.114  1.00 69.53  ? 489  GLU A CA  1 
ATOM   3893 C  C   . GLU A 1 489 ? -20.990 -25.885 29.262  1.00 67.26  ? 489  GLU A C   1 
ATOM   3894 O  O   . GLU A 1 489 ? -22.102 -25.376 29.429  1.00 60.52  ? 489  GLU A O   1 
ATOM   3895 C  CB  . GLU A 1 489 ? -19.881 -26.148 27.034  1.00 69.34  ? 489  GLU A CB  1 
ATOM   3896 C  CG  . GLU A 1 489 ? -19.076 -27.092 26.161  1.00 74.46  ? 489  GLU A CG  1 
ATOM   3897 C  CD  . GLU A 1 489 ? -19.847 -27.583 24.951  1.00 81.05  ? 489  GLU A CD  1 
ATOM   3898 O  OE1 . GLU A 1 489 ? -19.739 -28.784 24.621  1.00 81.27  ? 489  GLU A OE1 1 
ATOM   3899 O  OE2 . GLU A 1 489 ? -20.563 -26.769 24.326  1.00 80.26  ? 489  GLU A OE2 1 
ATOM   3900 N  N   . SER A 1 490 ? -19.959 -25.652 30.069  1.00 66.28  ? 490  SER A N   1 
ATOM   3901 C  CA  . SER A 1 490 ? -20.103 -24.782 31.225  1.00 59.85  ? 490  SER A CA  1 
ATOM   3902 C  C   . SER A 1 490 ? -20.345 -23.339 30.786  1.00 52.04  ? 490  SER A C   1 
ATOM   3903 O  O   . SER A 1 490 ? -19.894 -22.899 29.724  1.00 53.28  ? 490  SER A O   1 
ATOM   3904 C  CB  . SER A 1 490 ? -18.863 -24.887 32.119  1.00 63.68  ? 490  SER A CB  1 
ATOM   3905 O  OG  . SER A 1 490 ? -17.693 -25.073 31.340  1.00 63.64  ? 490  SER A OG  1 
ATOM   3906 N  N   . LYS A 1 491 ? -21.092 -22.608 31.608  1.00 49.21  ? 491  LYS A N   1 
ATOM   3907 C  CA  . LYS A 1 491 ? -21.604 -21.290 31.254  1.00 44.78  ? 491  LYS A CA  1 
ATOM   3908 C  C   . LYS A 1 491 ? -20.694 -20.199 31.806  1.00 46.73  ? 491  LYS A C   1 
ATOM   3909 O  O   . LYS A 1 491 ? -20.325 -20.225 32.984  1.00 41.29  ? 491  LYS A O   1 
ATOM   3910 C  CB  . LYS A 1 491 ? -23.029 -21.103 31.786  1.00 46.00  ? 491  LYS A CB  1 
ATOM   3911 C  CG  . LYS A 1 491 ? -24.067 -22.073 31.212  1.00 53.73  ? 491  LYS A CG  1 
ATOM   3912 C  CD  . LYS A 1 491 ? -24.424 -21.739 29.764  1.00 57.66  ? 491  LYS A CD  1 
ATOM   3913 C  CE  . LYS A 1 491 ? -25.465 -22.704 29.185  1.00 62.05  ? 491  LYS A CE  1 
ATOM   3914 N  NZ  . LYS A 1 491 ? -24.887 -24.041 28.848  1.00 66.37  ? 491  LYS A NZ  1 
ATOM   3915 N  N   . TRP A 1 492 ? -20.343 -19.242 30.949  1.00 34.88  ? 492  TRP A N   1 
ATOM   3916 C  CA  . TRP A 1 492 ? -19.640 -18.020 31.313  1.00 29.53  ? 492  TRP A CA  1 
ATOM   3917 C  C   . TRP A 1 492 ? -20.630 -17.077 31.984  1.00 31.75  ? 492  TRP A C   1 
ATOM   3918 O  O   . TRP A 1 492 ? -21.532 -16.555 31.314  1.00 31.90  ? 492  TRP A O   1 
ATOM   3919 C  CB  . TRP A 1 492 ? -19.024 -17.392 30.053  1.00 31.62  ? 492  TRP A CB  1 
ATOM   3920 C  CG  . TRP A 1 492 ? -18.169 -16.154 30.235  1.00 29.87  ? 492  TRP A CG  1 
ATOM   3921 C  CD1 . TRP A 1 492 ? -18.072 -15.348 31.345  1.00 29.06  ? 492  TRP A CD1 1 
ATOM   3922 C  CD2 . TRP A 1 492 ? -17.280 -15.594 29.253  1.00 27.69  ? 492  TRP A CD2 1 
ATOM   3923 N  NE1 . TRP A 1 492 ? -17.177 -14.321 31.104  1.00 27.57  ? 492  TRP A NE1 1 
ATOM   3924 C  CE2 . TRP A 1 492 ? -16.680 -14.454 29.827  1.00 28.40  ? 492  TRP A CE2 1 
ATOM   3925 C  CE3 . TRP A 1 492 ? -16.943 -15.949 27.940  1.00 26.83  ? 492  TRP A CE3 1 
ATOM   3926 C  CZ2 . TRP A 1 492 ? -15.753 -13.662 29.126  1.00 27.67  ? 492  TRP A CZ2 1 
ATOM   3927 C  CZ3 . TRP A 1 492 ? -16.016 -15.167 27.245  1.00 26.60  ? 492  TRP A CZ3 1 
ATOM   3928 C  CH2 . TRP A 1 492 ? -15.439 -14.037 27.835  1.00 24.71  ? 492  TRP A CH2 1 
ATOM   3929 N  N   . PRO A 1 493 ? -20.513 -16.836 33.291  1.00 32.05  ? 493  PRO A N   1 
ATOM   3930 C  CA  . PRO A 1 493 ? -21.542 -16.067 33.988  1.00 29.92  ? 493  PRO A CA  1 
ATOM   3931 C  C   . PRO A 1 493 ? -21.400 -14.575 33.755  1.00 30.80  ? 493  PRO A C   1 
ATOM   3932 O  O   . PRO A 1 493 ? -20.298 -14.050 33.582  1.00 30.36  ? 493  PRO A O   1 
ATOM   3933 C  CB  . PRO A 1 493 ? -21.295 -16.407 35.467  1.00 34.40  ? 493  PRO A CB  1 
ATOM   3934 C  CG  . PRO A 1 493 ? -19.833 -16.653 35.535  1.00 32.04  ? 493  PRO A CG  1 
ATOM   3935 C  CD  . PRO A 1 493 ? -19.460 -17.307 34.211  1.00 31.40  ? 493  PRO A CD  1 
ATOM   3936 N  N   . LEU A 1 494 ? -22.546 -13.894 33.774  1.00 27.18  ? 494  LEU A N   1 
ATOM   3937 C  CA  . LEU A 1 494 ? -22.549 -12.437 33.811  1.00 30.66  ? 494  LEU A CA  1 
ATOM   3938 C  C   . LEU A 1 494 ? -21.715 -11.935 34.980  1.00 33.74  ? 494  LEU A C   1 
ATOM   3939 O  O   . LEU A 1 494 ? -21.810 -12.454 36.098  1.00 30.71  ? 494  LEU A O   1 
ATOM   3940 C  CB  . LEU A 1 494 ? -23.976 -11.909 33.944  1.00 31.08  ? 494  LEU A CB  1 
ATOM   3941 C  CG  . LEU A 1 494 ? -24.835 -11.826 32.682  1.00 29.86  ? 494  LEU A CG  1 
ATOM   3942 C  CD1 . LEU A 1 494 ? -26.309 -11.733 33.053  1.00 34.05  ? 494  LEU A CD1 1 
ATOM   3943 C  CD2 . LEU A 1 494 ? -24.418 -10.616 31.873  1.00 29.76  ? 494  LEU A CD2 1 
ATOM   3944 N  N   . PHE A 1 495 ? -20.887 -10.930 34.712  1.00 27.67  ? 495  PHE A N   1 
ATOM   3945 C  CA  . PHE A 1 495 ? -20.275 -10.154 35.779  1.00 29.07  ? 495  PHE A CA  1 
ATOM   3946 C  C   . PHE A 1 495 ? -21.337 -9.243  36.383  1.00 31.86  ? 495  PHE A C   1 
ATOM   3947 O  O   . PHE A 1 495 ? -21.965 -8.454  35.668  1.00 30.11  ? 495  PHE A O   1 
ATOM   3948 C  CB  . PHE A 1 495 ? -19.104 -9.340  35.227  1.00 25.93  ? 495  PHE A CB  1 
ATOM   3949 C  CG  . PHE A 1 495 ? -18.513 -8.380  36.209  1.00 26.75  ? 495  PHE A CG  1 
ATOM   3950 C  CD1 . PHE A 1 495 ? -19.090 -7.141  36.423  1.00 27.51  ? 495  PHE A CD1 1 
ATOM   3951 C  CD2 . PHE A 1 495 ? -17.357 -8.704  36.896  1.00 27.38  ? 495  PHE A CD2 1 
ATOM   3952 C  CE1 . PHE A 1 495 ? -18.556 -6.259  37.342  1.00 30.17  ? 495  PHE A CE1 1 
ATOM   3953 C  CE2 . PHE A 1 495 ? -16.802 -7.815  37.795  1.00 29.52  ? 495  PHE A CE2 1 
ATOM   3954 C  CZ  . PHE A 1 495 ? -17.412 -6.593  38.027  1.00 30.37  ? 495  PHE A CZ  1 
ATOM   3955 N  N   . THR A 1 496 ? -21.547 -9.342  37.692  1.00 28.63  ? 496  THR A N   1 
ATOM   3956 C  CA  . THR A 1 496 ? -22.513 -8.498  38.376  1.00 31.24  ? 496  THR A CA  1 
ATOM   3957 C  C   . THR A 1 496 ? -21.810 -7.647  39.421  1.00 29.36  ? 496  THR A C   1 
ATOM   3958 O  O   . THR A 1 496 ? -20.739 -8.007  39.922  1.00 33.11  ? 496  THR A O   1 
ATOM   3959 C  CB  . THR A 1 496 ? -23.610 -9.333  39.049  1.00 35.50  ? 496  THR A CB  1 
ATOM   3960 O  OG1 . THR A 1 496 ? -23.014 -10.168 40.046  1.00 31.15  ? 496  THR A OG1 1 
ATOM   3961 C  CG2 . THR A 1 496 ? -24.309 -10.206 38.022  1.00 34.95  ? 496  THR A CG2 1 
ATOM   3962 N  N   . THR A 1 497 ? -22.423 -6.506  39.740  1.00 33.23  ? 497  THR A N   1 
ATOM   3963 C  CA  . THR A 1 497 ? -21.879 -5.630  40.773  1.00 37.16  ? 497  THR A CA  1 
ATOM   3964 C  C   . THR A 1 497 ? -21.615 -6.387  42.066  1.00 33.10  ? 497  THR A C   1 
ATOM   3965 O  O   . THR A 1 497 ? -20.568 -6.208  42.699  1.00 34.20  ? 497  THR A O   1 
ATOM   3966 C  CB  . THR A 1 497 ? -22.842 -4.470  41.025  1.00 39.17  ? 497  THR A CB  1 
ATOM   3967 O  OG1 . THR A 1 497 ? -22.998 -3.715  39.815  1.00 36.25  ? 497  THR A OG1 1 
ATOM   3968 C  CG2 . THR A 1 497 ? -22.326 -3.571  42.128  1.00 36.47  ? 497  THR A CG2 1 
ATOM   3969 N  N   . LYS A 1 498 ? -22.536 -7.266  42.461  1.00 34.60  ? 498  LYS A N   1 
ATOM   3970 C  CA  . LYS A 1 498 ? -22.380 -7.933  43.749  1.00 35.49  ? 498  LYS A CA  1 
ATOM   3971 C  C   . LYS A 1 498 ? -21.350 -9.052  43.687  1.00 33.72  ? 498  LYS A C   1 
ATOM   3972 O  O   . LYS A 1 498 ? -20.423 -9.091  44.503  1.00 38.78  ? 498  LYS A O   1 
ATOM   3973 C  CB  . LYS A 1 498 ? -23.722 -8.483  44.241  1.00 36.28  ? 498  LYS A CB  1 
ATOM   3974 C  CG  . LYS A 1 498 ? -23.611 -9.184  45.602  1.00 45.69  ? 498  LYS A CG  1 
ATOM   3975 C  CD  . LYS A 1 498 ? -24.833 -10.035 45.913  1.00 52.26  ? 498  LYS A CD  1 
ATOM   3976 C  CE  . LYS A 1 498 ? -25.811 -9.294  46.807  1.00 58.40  ? 498  LYS A CE  1 
ATOM   3977 N  NZ  . LYS A 1 498 ? -25.257 -9.096  48.174  1.00 59.51  ? 498  LYS A NZ  1 
ATOM   3978 N  N   . GLU A 1 499 ? -21.486 -9.971  42.731  1.00 31.68  ? 499  GLU A N   1 
ATOM   3979 C  CA  . GLU A 1 499 ? -20.658 -11.172 42.738  1.00 34.09  ? 499  GLU A CA  1 
ATOM   3980 C  C   . GLU A 1 499 ? -19.389 -11.058 41.903  1.00 31.41  ? 499  GLU A C   1 
ATOM   3981 O  O   . GLU A 1 499 ? -18.450 -11.824 42.143  1.00 29.98  ? 499  GLU A O   1 
ATOM   3982 C  CB  . GLU A 1 499 ? -21.478 -12.368 42.263  1.00 35.63  ? 499  GLU A CB  1 
ATOM   3983 C  CG  . GLU A 1 499 ? -22.599 -12.717 43.233  1.00 44.38  ? 499  GLU A CG  1 
ATOM   3984 C  CD  . GLU A 1 499 ? -23.221 -14.078 42.941  1.00 56.43  ? 499  GLU A CD  1 
ATOM   3985 O  OE1 . GLU A 1 499 ? -23.602 -14.319 41.780  1.00 55.26  ? 499  GLU A OE1 1 
ATOM   3986 O  OE2 . GLU A 1 499 ? -23.315 -14.903 43.869  1.00 64.22  ? 499  GLU A OE2 1 
ATOM   3987 N  N   . GLN A 1 500 ? -19.351 -10.161 40.914  1.00 30.01  ? 500  GLN A N   1 
ATOM   3988 C  CA  . GLN A 1 500 ? -18.109 -9.809  40.203  1.00 28.93  ? 500  GLN A CA  1 
ATOM   3989 C  C   . GLN A 1 500 ? -17.388 -11.034 39.637  1.00 26.85  ? 500  GLN A C   1 
ATOM   3990 O  O   . GLN A 1 500 ? -16.159 -11.154 39.717  1.00 27.22  ? 500  GLN A O   1 
ATOM   3991 C  CB  . GLN A 1 500 ? -17.188 -9.005  41.123  1.00 28.32  ? 500  GLN A CB  1 
ATOM   3992 C  CG  . GLN A 1 500 ? -17.878 -7.786  41.704  1.00 32.35  ? 500  GLN A CG  1 
ATOM   3993 C  CD  . GLN A 1 500 ? -17.090 -7.148  42.821  1.00 39.40  ? 500  GLN A CD  1 
ATOM   3994 O  OE1 . GLN A 1 500 ? -15.879 -6.987  42.716  1.00 33.52  ? 500  GLN A OE1 1 
ATOM   3995 N  NE2 . GLN A 1 500 ? -17.773 -6.792  43.909  1.00 39.28  ? 500  GLN A NE2 1 
ATOM   3996 N  N   . LYS A 1 501 ? -18.152 -11.941 39.040  1.00 26.35  ? 501  LYS A N   1 
ATOM   3997 C  CA  . LYS A 1 501 ? -17.598 -13.163 38.476  1.00 28.86  ? 501  LYS A CA  1 
ATOM   3998 C  C   . LYS A 1 501 ? -16.890 -12.905 37.149  1.00 30.32  ? 501  LYS A C   1 
ATOM   3999 O  O   . LYS A 1 501 ? -17.291 -12.043 36.363  1.00 29.40  ? 501  LYS A O   1 
ATOM   4000 C  CB  . LYS A 1 501 ? -18.702 -14.197 38.271  1.00 27.48  ? 501  LYS A CB  1 
ATOM   4001 C  CG  . LYS A 1 501 ? -19.314 -14.662 39.600  1.00 33.36  ? 501  LYS A CG  1 
ATOM   4002 C  CD  . LYS A 1 501 ? -20.509 -15.571 39.366  1.00 36.20  ? 501  LYS A CD  1 
ATOM   4003 C  CE  . LYS A 1 501 ? -20.968 -16.245 40.664  1.00 38.59  ? 501  LYS A CE  1 
ATOM   4004 N  NZ  . LYS A 1 501 ? -22.160 -17.096 40.380  1.00 41.06  ? 501  LYS A NZ  1 
ATOM   4005 N  N   . PHE A 1 502 ? -15.817 -13.664 36.919  1.00 28.31  ? 502  PHE A N   1 
ATOM   4006 C  CA  . PHE A 1 502 ? -15.116 -13.713 35.645  1.00 27.88  ? 502  PHE A CA  1 
ATOM   4007 C  C   . PHE A 1 502 ? -14.657 -15.144 35.424  1.00 29.67  ? 502  PHE A C   1 
ATOM   4008 O  O   . PHE A 1 502 ? -14.744 -15.986 36.322  1.00 28.16  ? 502  PHE A O   1 
ATOM   4009 C  CB  . PHE A 1 502 ? -13.932 -12.734 35.601  1.00 25.96  ? 502  PHE A CB  1 
ATOM   4010 C  CG  . PHE A 1 502 ? -12.794 -13.087 36.537  1.00 26.57  ? 502  PHE A CG  1 
ATOM   4011 C  CD1 . PHE A 1 502 ? -12.835 -12.716 37.880  1.00 27.42  ? 502  PHE A CD1 1 
ATOM   4012 C  CD2 . PHE A 1 502 ? -11.679 -13.766 36.066  1.00 26.67  ? 502  PHE A CD2 1 
ATOM   4013 C  CE1 . PHE A 1 502 ? -11.779 -13.025 38.740  1.00 29.18  ? 502  PHE A CE1 1 
ATOM   4014 C  CE2 . PHE A 1 502 ? -10.612 -14.075 36.911  1.00 27.32  ? 502  PHE A CE2 1 
ATOM   4015 C  CZ  . PHE A 1 502 ? -10.663 -13.703 38.251  1.00 28.23  ? 502  PHE A CZ  1 
ATOM   4016 N  N   . ILE A 1 503 ? -14.170 -15.427 34.217  1.00 27.64  ? 503  ILE A N   1 
ATOM   4017 C  CA  . ILE A 1 503 ? -13.643 -16.749 33.906  1.00 26.54  ? 503  ILE A CA  1 
ATOM   4018 C  C   . ILE A 1 503 ? -12.191 -16.630 33.466  1.00 30.45  ? 503  ILE A C   1 
ATOM   4019 O  O   . ILE A 1 503 ? -11.765 -15.610 32.910  1.00 29.88  ? 503  ILE A O   1 
ATOM   4020 C  CB  . ILE A 1 503 ? -14.480 -17.480 32.827  1.00 32.02  ? 503  ILE A CB  1 
ATOM   4021 C  CG1 . ILE A 1 503 ? -14.353 -16.795 31.455  1.00 29.68  ? 503  ILE A CG1 1 
ATOM   4022 C  CG2 . ILE A 1 503 ? -15.941 -17.587 33.269  1.00 32.35  ? 503  ILE A CG2 1 
ATOM   4023 C  CD1 . ILE A 1 503 ? -14.788 -17.677 30.284  1.00 32.19  ? 503  ILE A CD1 1 
ATOM   4024 N  N   . ASP A 1 504 ? -11.424 -17.681 33.741  1.00 31.14  ? 504  ASP A N   1 
ATOM   4025 C  CA  . ASP A 1 504 ? -10.131 -17.858 33.100  1.00 30.51  ? 504  ASP A CA  1 
ATOM   4026 C  C   . ASP A 1 504 ? -10.351 -18.331 31.671  1.00 34.29  ? 504  ASP A C   1 
ATOM   4027 O  O   . ASP A 1 504 ? -11.250 -19.130 31.405  1.00 32.85  ? 504  ASP A O   1 
ATOM   4028 C  CB  . ASP A 1 504 ? -9.276  -18.890 33.837  1.00 32.38  ? 504  ASP A CB  1 
ATOM   4029 C  CG  . ASP A 1 504 ? -8.869  -18.442 35.235  1.00 39.20  ? 504  ASP A CG  1 
ATOM   4030 O  OD1 . ASP A 1 504 ? -8.894  -17.224 35.510  1.00 35.58  ? 504  ASP A OD1 1 
ATOM   4031 O  OD2 . ASP A 1 504 ? -8.520  -19.317 36.056  1.00 46.37  ? 504  ASP A OD2 1 
ATOM   4032 N  N   . LEU A 1 505 ? -9.526  -17.843 30.752  1.00 32.19  ? 505  LEU A N   1 
ATOM   4033 C  CA  . LEU A 1 505 ? -9.487  -18.373 29.395  1.00 31.84  ? 505  LEU A CA  1 
ATOM   4034 C  C   . LEU A 1 505 ? -8.147  -19.073 29.220  1.00 29.66  ? 505  LEU A C   1 
ATOM   4035 O  O   . LEU A 1 505 ? -7.104  -18.417 29.114  1.00 32.33  ? 505  LEU A O   1 
ATOM   4036 C  CB  . LEU A 1 505 ? -9.680  -17.278 28.347  1.00 34.24  ? 505  LEU A CB  1 
ATOM   4037 C  CG  . LEU A 1 505 ? -11.101 -16.750 28.134  1.00 37.30  ? 505  LEU A CG  1 
ATOM   4038 C  CD1 . LEU A 1 505 ? -11.100 -15.653 27.064  1.00 34.55  ? 505  LEU A CD1 1 
ATOM   4039 C  CD2 . LEU A 1 505 ? -12.067 -17.878 27.767  1.00 31.38  ? 505  LEU A CD2 1 
ATOM   4040 N  N   . ASN A 1 506 ? -8.174  -20.398 29.184  1.00 30.00  ? 506  ASN A N   1 
ATOM   4041 C  CA  . ASN A 1 506 ? -6.962  -21.177 28.968  1.00 32.35  ? 506  ASN A CA  1 
ATOM   4042 C  C   . ASN A 1 506 ? -7.381  -22.560 28.484  1.00 35.74  ? 506  ASN A C   1 
ATOM   4043 O  O   . ASN A 1 506 ? -8.559  -22.803 28.205  1.00 33.91  ? 506  ASN A O   1 
ATOM   4044 C  CB  . ASN A 1 506 ? -6.100  -21.228 30.237  1.00 31.04  ? 506  ASN A CB  1 
ATOM   4045 C  CG  . ASN A 1 506 ? -6.869  -21.732 31.444  1.00 38.77  ? 506  ASN A CG  1 
ATOM   4046 O  OD1 . ASN A 1 506 ? -7.608  -22.710 31.359  1.00 36.90  ? 506  ASN A OD1 1 
ATOM   4047 N  ND2 . ASN A 1 506 ? -6.689  -21.069 32.579  1.00 37.35  ? 506  ASN A ND2 1 
ATOM   4048 N  N   . THR A 1 507 ? -6.415  -23.475 28.388  1.00 38.15  ? 507  THR A N   1 
ATOM   4049 C  CA  . THR A 1 507 ? -6.679  -24.789 27.815  1.00 42.70  ? 507  THR A CA  1 
ATOM   4050 C  C   . THR A 1 507 ? -7.341  -25.750 28.791  1.00 44.53  ? 507  THR A C   1 
ATOM   4051 O  O   . THR A 1 507 ? -7.766  -26.830 28.372  1.00 46.21  ? 507  THR A O   1 
ATOM   4052 C  CB  . THR A 1 507 ? -5.380  -25.417 27.305  1.00 40.89  ? 507  THR A CB  1 
ATOM   4053 O  OG1 . THR A 1 507 ? -4.412  -25.429 28.364  1.00 41.00  ? 507  THR A OG1 1 
ATOM   4054 C  CG2 . THR A 1 507 ? -4.833  -24.631 26.115  1.00 37.63  ? 507  THR A CG2 1 
ATOM   4055 N  N   . GLU A 1 508 ? -7.429  -25.394 30.072  1.00 43.74  ? 508  GLU A N   1 
ATOM   4056 C  CA  . GLU A 1 508 ? -8.074  -26.224 31.074  1.00 49.28  ? 508  GLU A CA  1 
ATOM   4057 C  C   . GLU A 1 508 ? -9.567  -25.928 31.127  1.00 51.77  ? 508  GLU A C   1 
ATOM   4058 O  O   . GLU A 1 508 ? -10.021 -24.886 30.640  1.00 47.80  ? 508  GLU A O   1 
ATOM   4059 C  CB  . GLU A 1 508 ? -7.431  -25.984 32.442  1.00 50.02  ? 508  GLU A CB  1 
ATOM   4060 C  CG  . GLU A 1 508 ? -6.303  -26.958 32.751  1.00 56.47  ? 508  GLU A CG  1 
ATOM   4061 C  CD  . GLU A 1 508 ? -5.073  -26.280 33.325  1.00 70.47  ? 508  GLU A CD  1 
ATOM   4062 O  OE1 . GLU A 1 508 ? -3.959  -26.827 33.158  1.00 74.22  ? 508  GLU A OE1 1 
ATOM   4063 O  OE2 . GLU A 1 508 ? -5.219  -25.207 33.949  1.00 70.13  ? 508  GLU A OE2 1 
ATOM   4064 N  N   . PRO A 1 509 ? -10.364 -26.839 31.692  1.00 54.03  ? 509  PRO A N   1 
ATOM   4065 C  CA  . PRO A 1 509 ? -11.804 -26.577 31.822  1.00 52.58  ? 509  PRO A CA  1 
ATOM   4066 C  C   . PRO A 1 509 ? -12.073 -25.272 32.558  1.00 50.48  ? 509  PRO A C   1 
ATOM   4067 O  O   . PRO A 1 509 ? -11.345 -24.889 33.474  1.00 49.34  ? 509  PRO A O   1 
ATOM   4068 C  CB  . PRO A 1 509 ? -12.314 -27.786 32.612  1.00 52.63  ? 509  PRO A CB  1 
ATOM   4069 C  CG  . PRO A 1 509 ? -11.348 -28.873 32.271  1.00 60.31  ? 509  PRO A CG  1 
ATOM   4070 C  CD  . PRO A 1 509 ? -10.011 -28.201 32.135  1.00 55.79  ? 509  PRO A CD  1 
ATOM   4071 N  N   . MET A 1 510 ? -13.139 -24.598 32.136  1.00 51.33  ? 510  MET A N   1 
ATOM   4072 C  CA  . MET A 1 510 ? -13.428 -23.241 32.583  1.00 53.48  ? 510  MET A CA  1 
ATOM   4073 C  C   . MET A 1 510 ? -13.642 -23.185 34.091  1.00 52.35  ? 510  MET A C   1 
ATOM   4074 O  O   . MET A 1 510 ? -14.386 -23.989 34.658  1.00 55.72  ? 510  MET A O   1 
ATOM   4075 C  CB  . MET A 1 510 ? -14.665 -22.724 31.844  1.00 54.11  ? 510  MET A CB  1 
ATOM   4076 C  CG  . MET A 1 510 ? -15.100 -21.311 32.197  1.00 55.49  ? 510  MET A CG  1 
ATOM   4077 S  SD  . MET A 1 510 ? -16.841 -21.037 31.776  1.00 63.01  ? 510  MET A SD  1 
ATOM   4078 C  CE  . MET A 1 510 ? -17.614 -21.730 33.226  1.00 54.15  ? 510  MET A CE  1 
ATOM   4079 N  N   . LYS A 1 511 ? -12.980 -22.233 34.742  1.00 47.05  ? 511  LYS A N   1 
ATOM   4080 C  CA  . LYS A 1 511 ? -13.172 -21.979 36.162  1.00 45.36  ? 511  LYS A CA  1 
ATOM   4081 C  C   . LYS A 1 511 ? -13.716 -20.572 36.352  1.00 39.11  ? 511  LYS A C   1 
ATOM   4082 O  O   . LYS A 1 511 ? -13.255 -19.627 35.703  1.00 40.75  ? 511  LYS A O   1 
ATOM   4083 C  CB  . LYS A 1 511 ? -11.865 -22.136 36.954  1.00 43.83  ? 511  LYS A CB  1 
ATOM   4084 C  CG  . LYS A 1 511 ? -11.162 -23.467 36.761  1.00 48.39  ? 511  LYS A CG  1 
ATOM   4085 C  CD  . LYS A 1 511 ? -9.893  -23.540 37.607  1.00 51.18  ? 511  LYS A CD  1 
ATOM   4086 N  N   . VAL A 1 512 ? -14.694 -20.442 37.242  1.00 37.34  ? 512  VAL A N   1 
ATOM   4087 C  CA  . VAL A 1 512 ? -15.287 -19.157 37.587  1.00 33.31  ? 512  VAL A CA  1 
ATOM   4088 C  C   . VAL A 1 512 ? -14.589 -18.624 38.829  1.00 38.51  ? 512  VAL A C   1 
ATOM   4089 O  O   . VAL A 1 512 ? -14.439 -19.346 39.823  1.00 34.45  ? 512  VAL A O   1 
ATOM   4090 C  CB  . VAL A 1 512 ? -16.800 -19.296 37.833  1.00 37.18  ? 512  VAL A CB  1 
ATOM   4091 C  CG1 . VAL A 1 512 ? -17.360 -18.034 38.463  1.00 30.21  ? 512  VAL A CG1 1 
ATOM   4092 C  CG2 . VAL A 1 512 ? -17.531 -19.633 36.538  1.00 34.41  ? 512  VAL A CG2 1 
ATOM   4093 N  N   . HIS A 1 513 ? -14.172 -17.365 38.784  1.00 32.19  ? 513  HIS A N   1 
ATOM   4094 C  CA  . HIS A 1 513 ? -13.614 -16.687 39.948  1.00 32.45  ? 513  HIS A CA  1 
ATOM   4095 C  C   . HIS A 1 513 ? -14.382 -15.393 40.186  1.00 30.02  ? 513  HIS A C   1 
ATOM   4096 O  O   . HIS A 1 513 ? -15.260 -15.012 39.403  1.00 27.89  ? 513  HIS A O   1 
ATOM   4097 C  CB  . HIS A 1 513 ? -12.124 -16.379 39.776  1.00 33.31  ? 513  HIS A CB  1 
ATOM   4098 C  CG  . HIS A 1 513 ? -11.307 -17.525 39.271  1.00 36.48  ? 513  HIS A CG  1 
ATOM   4099 N  ND1 . HIS A 1 513 ? -10.874 -18.546 40.089  1.00 39.86  ? 513  HIS A ND1 1 
ATOM   4100 C  CD2 . HIS A 1 513 ? -10.803 -17.788 38.042  1.00 36.91  ? 513  HIS A CD2 1 
ATOM   4101 C  CE1 . HIS A 1 513 ? -10.157 -19.401 39.380  1.00 40.27  ? 513  HIS A CE1 1 
ATOM   4102 N  NE2 . HIS A 1 513 ? -10.094 -18.961 38.136  1.00 40.97  ? 513  HIS A NE2 1 
ATOM   4103 N  N   . GLN A 1 514 ? -14.014 -14.701 41.263  1.00 28.51  ? 514  GLN A N   1 
ATOM   4104 C  CA  . GLN A 1 514 ? -14.629 -13.434 41.629  1.00 29.82  ? 514  GLN A CA  1 
ATOM   4105 C  C   . GLN A 1 514 ? -13.544 -12.424 41.978  1.00 27.89  ? 514  GLN A C   1 
ATOM   4106 O  O   . GLN A 1 514 ? -12.474 -12.792 42.466  1.00 27.57  ? 514  GLN A O   1 
ATOM   4107 C  CB  . GLN A 1 514 ? -15.596 -13.610 42.826  1.00 29.78  ? 514  GLN A CB  1 
ATOM   4108 C  CG  . GLN A 1 514 ? -16.788 -14.522 42.513  1.00 35.50  ? 514  GLN A CG  1 
ATOM   4109 C  CD  . GLN A 1 514 ? -17.715 -14.735 43.707  1.00 41.36  ? 514  GLN A CD  1 
ATOM   4110 O  OE1 . GLN A 1 514 ? -17.932 -15.865 44.133  1.00 53.84  ? 514  GLN A OE1 1 
ATOM   4111 N  NE2 . GLN A 1 514 ? -18.271 -13.650 44.238  1.00 37.68  ? 514  GLN A NE2 1 
ATOM   4112 N  N   . ARG A 1 515 ? -13.839 -11.145 41.727  1.00 25.22  ? 515  ARG A N   1 
ATOM   4113 C  CA  . ARG A 1 515 ? -13.013 -10.011 42.153  1.00 25.12  ? 515  ARG A CA  1 
ATOM   4114 C  C   . ARG A 1 515 ? -11.598 -10.098 41.563  1.00 26.75  ? 515  ARG A C   1 
ATOM   4115 O  O   . ARG A 1 515 ? -10.601 -10.358 42.243  1.00 27.93  ? 515  ARG A O   1 
ATOM   4116 C  CB  . ARG A 1 515 ? -12.994 -9.907  43.689  1.00 21.69  ? 515  ARG A CB  1 
ATOM   4117 C  CG  . ARG A 1 515 ? -14.401 -9.865  44.298  1.00 25.99  ? 515  ARG A CG  1 
ATOM   4118 C  CD  . ARG A 1 515 ? -14.384 -9.494  45.795  1.00 28.43  ? 515  ARG A CD  1 
ATOM   4119 N  NE  . ARG A 1 515 ? -15.717 -9.113  46.277  1.00 30.57  ? 515  ARG A NE  1 
ATOM   4120 C  CZ  . ARG A 1 515 ? -15.952 -8.542  47.457  1.00 40.84  ? 515  ARG A CZ  1 
ATOM   4121 N  NH1 . ARG A 1 515 ? -14.945 -8.286  48.284  1.00 31.52  ? 515  ARG A NH1 1 
ATOM   4122 N  NH2 . ARG A 1 515 ? -17.196 -8.231  47.818  1.00 38.51  ? 515  ARG A NH2 1 
ATOM   4123 N  N   . LEU A 1 516 ? -11.535 -9.850  40.258  1.00 23.38  ? 516  LEU A N   1 
ATOM   4124 C  CA  . LEU A 1 516 ? -10.265 -9.915  39.533  1.00 20.96  ? 516  LEU A CA  1 
ATOM   4125 C  C   . LEU A 1 516 ? -9.269  -8.906  40.091  1.00 20.51  ? 516  LEU A C   1 
ATOM   4126 O  O   . LEU A 1 516 ? -9.556  -7.705  40.144  1.00 22.60  ? 516  LEU A O   1 
ATOM   4127 C  CB  . LEU A 1 516 ? -10.520 -9.664  38.037  1.00 22.48  ? 516  LEU A CB  1 
ATOM   4128 C  CG  . LEU A 1 516 ? -9.373  -9.672  37.013  1.00 25.01  ? 516  LEU A CG  1 
ATOM   4129 C  CD1 . LEU A 1 516 ? -8.328  -10.723 37.303  1.00 29.21  ? 516  LEU A CD1 1 
ATOM   4130 C  CD2 . LEU A 1 516 ? -9.982  -9.902  35.624  1.00 25.25  ? 516  LEU A CD2 1 
ATOM   4131 N  N   . ARG A 1 517 ? -8.124  -9.421  40.554  1.00 21.32  ? 517  ARG A N   1 
ATOM   4132 C  CA  . ARG A 1 517 ? -7.031  -8.661  41.176  1.00 25.29  ? 517  ARG A CA  1 
ATOM   4133 C  C   . ARG A 1 517 ? -7.535  -7.520  42.061  1.00 22.41  ? 517  ARG A C   1 
ATOM   4134 O  O   . ARG A 1 517 ? -7.034  -6.392  42.031  1.00 22.23  ? 517  ARG A O   1 
ATOM   4135 C  CB  . ARG A 1 517 ? -6.053  -8.168  40.111  1.00 31.88  ? 517  ARG A CB  1 
ATOM   4136 C  CG  . ARG A 1 517 ? -5.050  -9.274  39.780  1.00 35.44  ? 517  ARG A CG  1 
ATOM   4137 C  CD  . ARG A 1 517 ? -3.976  -8.863  38.815  1.00 39.73  ? 517  ARG A CD  1 
ATOM   4138 N  NE  . ARG A 1 517 ? -2.810  -8.291  39.473  1.00 39.39  ? 517  ARG A NE  1 
ATOM   4139 C  CZ  . ARG A 1 517 ? -1.962  -8.970  40.240  1.00 39.16  ? 517  ARG A CZ  1 
ATOM   4140 N  NH1 . ARG A 1 517 ? -2.154  -10.262 40.470  1.00 39.02  ? 517  ARG A NH1 1 
ATOM   4141 N  NH2 . ARG A 1 517 ? -0.912  -8.353  40.766  1.00 31.44  ? 517  ARG A NH2 1 
ATOM   4142 N  N   . VAL A 1 518 ? -8.498  -7.851  42.922  1.00 24.53  ? 518  VAL A N   1 
ATOM   4143 C  CA  . VAL A 1 518 ? -9.204  -6.813  43.667  1.00 22.28  ? 518  VAL A CA  1 
ATOM   4144 C  C   . VAL A 1 518 ? -8.270  -6.110  44.642  1.00 22.81  ? 518  VAL A C   1 
ATOM   4145 O  O   . VAL A 1 518 ? -8.387  -4.900  44.854  1.00 24.68  ? 518  VAL A O   1 
ATOM   4146 C  CB  . VAL A 1 518 ? -10.428 -7.403  44.391  1.00 24.66  ? 518  VAL A CB  1 
ATOM   4147 C  CG1 . VAL A 1 518 ? -10.008 -8.512  45.361  1.00 27.11  ? 518  VAL A CG1 1 
ATOM   4148 C  CG2 . VAL A 1 518 ? -11.193 -6.296  45.113  1.00 25.05  ? 518  VAL A CG2 1 
ATOM   4149 N  N   . GLN A 1 519 ? -7.343  -6.852  45.264  1.00 21.07  ? 519  GLN A N   1 
ATOM   4150 C  CA  . GLN A 1 519 ? -6.471  -6.248  46.269  1.00 24.75  ? 519  GLN A CA  1 
ATOM   4151 C  C   . GLN A 1 519 ? -5.589  -5.167  45.649  1.00 23.59  ? 519  GLN A C   1 
ATOM   4152 O  O   . GLN A 1 519 ? -5.539  -4.032  46.137  1.00 22.44  ? 519  GLN A O   1 
ATOM   4153 C  CB  . GLN A 1 519 ? -5.617  -7.324  46.937  1.00 26.68  ? 519  GLN A CB  1 
ATOM   4154 C  CG  . GLN A 1 519 ? -4.909  -6.839  48.181  1.00 24.71  ? 519  GLN A CG  1 
ATOM   4155 C  CD  . GLN A 1 519 ? -5.846  -6.711  49.382  1.00 25.63  ? 519  GLN A CD  1 
ATOM   4156 O  OE1 . GLN A 1 519 ? -6.866  -7.398  49.467  1.00 25.04  ? 519  GLN A OE1 1 
ATOM   4157 N  NE2 . GLN A 1 519 ? -5.504  -5.820  50.304  1.00 23.91  ? 519  GLN A NE2 1 
ATOM   4158 N  N   . MET A 1 520 ? -4.892  -5.496  44.562  1.00 22.82  ? 520  MET A N   1 
ATOM   4159 C  CA  . MET A 1 520 ? -4.065  -4.474  43.932  1.00 23.87  ? 520  MET A CA  1 
ATOM   4160 C  C   . MET A 1 520 ? -4.901  -3.364  43.309  1.00 20.46  ? 520  MET A C   1 
ATOM   4161 O  O   . MET A 1 520 ? -4.476  -2.200  43.282  1.00 22.81  ? 520  MET A O   1 
ATOM   4162 C  CB  . MET A 1 520 ? -3.139  -5.101  42.885  1.00 24.43  ? 520  MET A CB  1 
ATOM   4163 C  CG  . MET A 1 520 ? -2.169  -6.172  43.390  1.00 25.93  ? 520  MET A CG  1 
ATOM   4164 S  SD  . MET A 1 520 ? -1.138  -5.775  44.809  1.00 39.76  ? 520  MET A SD  1 
ATOM   4165 C  CE  . MET A 1 520 ? -1.067  -4.013  44.723  1.00 25.81  ? 520  MET A CE  1 
ATOM   4166 N  N   . CYS A 1 521 ? -6.094  -3.683  42.820  1.00 23.41  ? 521  CYS A N   1 
ATOM   4167 C  CA  . CYS A 1 521 ? -6.859  -2.624  42.181  1.00 26.02  ? 521  CYS A CA  1 
ATOM   4168 C  C   . CYS A 1 521 ? -7.508  -1.686  43.194  1.00 24.21  ? 521  CYS A C   1 
ATOM   4169 O  O   . CYS A 1 521 ? -7.717  -0.511  42.882  1.00 21.46  ? 521  CYS A O   1 
ATOM   4170 C  CB  . CYS A 1 521 ? -7.866  -3.235  41.211  1.00 25.54  ? 521  CYS A CB  1 
ATOM   4171 S  SG  . CYS A 1 521 ? -7.018  -3.998  39.774  1.00 27.63  ? 521  CYS A SG  1 
ATOM   4172 N  N   . VAL A 1 522 ? -7.774  -2.129  44.428  1.00 23.85  ? 522  VAL A N   1 
ATOM   4173 C  CA  . VAL A 1 522 ? -8.113  -1.140  45.445  1.00 23.46  ? 522  VAL A CA  1 
ATOM   4174 C  C   . VAL A 1 522 ? -6.972  -0.149  45.608  1.00 21.49  ? 522  VAL A C   1 
ATOM   4175 O  O   . VAL A 1 522 ? -7.191  1.061   45.736  1.00 23.64  ? 522  VAL A O   1 
ATOM   4176 C  CB  . VAL A 1 522 ? -8.462  -1.816  46.787  1.00 23.33  ? 522  VAL A CB  1 
ATOM   4177 C  CG1 . VAL A 1 522 ? -8.662  -0.751  47.848  1.00 26.83  ? 522  VAL A CG1 1 
ATOM   4178 C  CG2 . VAL A 1 522 ? -9.710  -2.643  46.638  1.00 30.01  ? 522  VAL A CG2 1 
ATOM   4179 N  N   . PHE A 1 523 ? -5.731  -0.646  45.607  1.00 22.43  ? 523  PHE A N   1 
ATOM   4180 C  CA  . PHE A 1 523 ? -4.575  0.244   45.682  1.00 21.13  ? 523  PHE A CA  1 
ATOM   4181 C  C   . PHE A 1 523 ? -4.521  1.196   44.485  1.00 24.31  ? 523  PHE A C   1 
ATOM   4182 O  O   . PHE A 1 523 ? -4.390  2.413   44.657  1.00 25.60  ? 523  PHE A O   1 
ATOM   4183 C  CB  . PHE A 1 523 ? -3.291  -0.579  45.770  1.00 23.19  ? 523  PHE A CB  1 
ATOM   4184 C  CG  . PHE A 1 523 ? -2.042  0.246   45.686  1.00 23.64  ? 523  PHE A CG  1 
ATOM   4185 C  CD1 . PHE A 1 523 ? -1.540  0.871   46.815  1.00 25.77  ? 523  PHE A CD1 1 
ATOM   4186 C  CD2 . PHE A 1 523 ? -1.381  0.413   44.474  1.00 23.56  ? 523  PHE A CD2 1 
ATOM   4187 C  CE1 . PHE A 1 523 ? -0.402  1.639   46.756  1.00 25.67  ? 523  PHE A CE1 1 
ATOM   4188 C  CE2 . PHE A 1 523 ? -0.229  1.180   44.403  1.00 26.91  ? 523  PHE A CE2 1 
ATOM   4189 C  CZ  . PHE A 1 523 ? 0.258   1.798   45.543  1.00 22.75  ? 523  PHE A CZ  1 
ATOM   4190 N  N   . TRP A 1 524 ? -4.617  0.665   43.260  1.00 22.59  ? 524  TRP A N   1 
ATOM   4191 C  CA  . TRP A 1 524 ? -4.461  1.537   42.091  1.00 22.75  ? 524  TRP A CA  1 
ATOM   4192 C  C   . TRP A 1 524 ? -5.670  2.440   41.867  1.00 25.90  ? 524  TRP A C   1 
ATOM   4193 O  O   . TRP A 1 524 ? -5.508  3.582   41.424  1.00 25.63  ? 524  TRP A O   1 
ATOM   4194 C  CB  . TRP A 1 524 ? -4.172  0.713   40.827  1.00 20.91  ? 524  TRP A CB  1 
ATOM   4195 C  CG  . TRP A 1 524 ? -2.801  0.070   40.851  1.00 22.87  ? 524  TRP A CG  1 
ATOM   4196 C  CD1 . TRP A 1 524 ? -2.522  -1.253  41.057  1.00 21.81  ? 524  TRP A CD1 1 
ATOM   4197 C  CD2 . TRP A 1 524 ? -1.532  0.723   40.680  1.00 21.73  ? 524  TRP A CD2 1 
ATOM   4198 N  NE1 . TRP A 1 524 ? -1.168  -1.460  41.031  1.00 22.07  ? 524  TRP A NE1 1 
ATOM   4199 C  CE2 . TRP A 1 524 ? -0.536  -0.266  40.797  1.00 19.93  ? 524  TRP A CE2 1 
ATOM   4200 C  CE3 . TRP A 1 524 ? -1.144  2.043   40.433  1.00 21.13  ? 524  TRP A CE3 1 
ATOM   4201 C  CZ2 . TRP A 1 524 ? 0.837   0.018   40.669  1.00 22.91  ? 524  TRP A CZ2 1 
ATOM   4202 C  CZ3 . TRP A 1 524 ? 0.228   2.331   40.324  1.00 20.32  ? 524  TRP A CZ3 1 
ATOM   4203 C  CH2 . TRP A 1 524 ? 1.195   1.320   40.443  1.00 22.81  ? 524  TRP A CH2 1 
ATOM   4204 N  N   . ASN A 1 525 ? -6.879  1.974   42.173  1.00 25.75  ? 525  ASN A N   1 
ATOM   4205 C  CA  . ASN A 1 525 ? -8.076  2.723   41.810  1.00 28.48  ? 525  ASN A CA  1 
ATOM   4206 C  C   . ASN A 1 525 ? -8.599  3.622   42.920  1.00 31.66  ? 525  ASN A C   1 
ATOM   4207 O  O   . ASN A 1 525 ? -9.299  4.591   42.626  1.00 33.78  ? 525  ASN A O   1 
ATOM   4208 C  CB  . ASN A 1 525 ? -9.180  1.762   41.364  1.00 28.61  ? 525  ASN A CB  1 
ATOM   4209 C  CG  . ASN A 1 525 ? -8.843  1.081   40.064  1.00 27.93  ? 525  ASN A CG  1 
ATOM   4210 O  OD1 . ASN A 1 525 ? -7.937  1.513   39.360  1.00 30.57  ? 525  ASN A OD1 1 
ATOM   4211 N  ND2 . ASN A 1 525 ? -9.565  0.018   39.733  1.00 25.62  ? 525  ASN A ND2 1 
ATOM   4212 N  N   . GLN A 1 526 ? -8.283  3.344   44.178  1.00 25.85  ? 526  GLN A N   1 
ATOM   4213 C  CA  . GLN A 1 526 ? -8.744  4.202   45.266  1.00 28.88  ? 526  GLN A CA  1 
ATOM   4214 C  C   . GLN A 1 526 ? -7.610  4.788   46.073  1.00 29.14  ? 526  GLN A C   1 
ATOM   4215 O  O   . GLN A 1 526 ? -7.520  6.014   46.183  1.00 32.35  ? 526  GLN A O   1 
ATOM   4216 C  CB  . GLN A 1 526 ? -9.733  3.444   46.155  1.00 32.57  ? 526  GLN A CB  1 
ATOM   4217 C  CG  . GLN A 1 526 ? -10.983 3.115   45.421  1.00 36.71  ? 526  GLN A CG  1 
ATOM   4218 C  CD  . GLN A 1 526 ? -11.430 1.694   45.625  1.00 46.91  ? 526  GLN A CD  1 
ATOM   4219 O  OE1 . GLN A 1 526 ? -11.887 1.310   46.706  1.00 55.25  ? 526  GLN A OE1 1 
ATOM   4220 N  NE2 . GLN A 1 526 ? -11.311 0.893   44.566  1.00 46.42  ? 526  GLN A NE2 1 
ATOM   4221 N  N   . PHE A 1 527 ? -6.721  3.977   46.635  1.00 26.26  ? 527  PHE A N   1 
ATOM   4222 C  CA  . PHE A 1 527 ? -5.796  4.539   47.610  1.00 27.34  ? 527  PHE A CA  1 
ATOM   4223 C  C   . PHE A 1 527 ? -4.746  5.433   46.955  1.00 26.93  ? 527  PHE A C   1 
ATOM   4224 O  O   . PHE A 1 527 ? -4.544  6.577   47.379  1.00 29.35  ? 527  PHE A O   1 
ATOM   4225 C  CB  . PHE A 1 527 ? -5.118  3.439   48.425  1.00 26.88  ? 527  PHE A CB  1 
ATOM   4226 C  CG  . PHE A 1 527 ? -4.087  3.959   49.361  1.00 28.73  ? 527  PHE A CG  1 
ATOM   4227 C  CD1 . PHE A 1 527 ? -4.466  4.609   50.523  1.00 27.53  ? 527  PHE A CD1 1 
ATOM   4228 C  CD2 . PHE A 1 527 ? -2.747  3.825   49.065  1.00 28.23  ? 527  PHE A CD2 1 
ATOM   4229 C  CE1 . PHE A 1 527 ? -3.525  5.101   51.383  1.00 27.19  ? 527  PHE A CE1 1 
ATOM   4230 C  CE2 . PHE A 1 527 ? -1.794  4.318   49.919  1.00 31.01  ? 527  PHE A CE2 1 
ATOM   4231 C  CZ  . PHE A 1 527 ? -2.182  4.954   51.091  1.00 29.51  ? 527  PHE A CZ  1 
ATOM   4232 N  N   . LEU A 1 528 ? -4.058  4.934   45.933  1.00 24.40  ? 528  LEU A N   1 
ATOM   4233 C  CA  . LEU A 1 528 ? -3.009  5.749   45.323  1.00 28.19  ? 528  LEU A CA  1 
ATOM   4234 C  C   . LEU A 1 528 ? -3.551  7.042   44.726  1.00 27.42  ? 528  LEU A C   1 
ATOM   4235 O  O   . LEU A 1 528 ? -2.930  8.094   44.955  1.00 30.89  ? 528  LEU A O   1 
ATOM   4236 C  CB  . LEU A 1 528 ? -2.232  4.950   44.265  1.00 27.43  ? 528  LEU A CB  1 
ATOM   4237 C  CG  . LEU A 1 528 ? -1.052  5.754   43.689  1.00 24.68  ? 528  LEU A CG  1 
ATOM   4238 C  CD1 . LEU A 1 528 ? 0.024   5.971   44.734  1.00 29.00  ? 528  LEU A CD1 1 
ATOM   4239 C  CD2 . LEU A 1 528 ? -0.455  5.095   42.449  1.00 28.61  ? 528  LEU A CD2 1 
ATOM   4240 N  N   . PRO A 1 529 ? -4.674  7.058   43.993  1.00 26.77  ? 529  PRO A N   1 
ATOM   4241 C  CA  . PRO A 1 529 ? -5.193  8.353   43.517  1.00 31.04  ? 529  PRO A CA  1 
ATOM   4242 C  C   . PRO A 1 529 ? -5.495  9.313   44.647  1.00 34.16  ? 529  PRO A C   1 
ATOM   4243 O  O   . PRO A 1 529 ? -5.213  10.513  44.535  1.00 35.52  ? 529  PRO A O   1 
ATOM   4244 C  CB  . PRO A 1 529 ? -6.464  7.963   42.753  1.00 34.09  ? 529  PRO A CB  1 
ATOM   4245 C  CG  . PRO A 1 529 ? -6.210  6.559   42.309  1.00 34.17  ? 529  PRO A CG  1 
ATOM   4246 C  CD  . PRO A 1 529 ? -5.476  5.938   43.467  1.00 29.49  ? 529  PRO A CD  1 
ATOM   4247 N  N   . LYS A 1 530 ? -6.043  8.805   45.753  1.00 32.37  ? 530  LYS A N   1 
ATOM   4248 C  CA  . LYS A 1 530 ? -6.288  9.660   46.904  1.00 34.49  ? 530  LYS A CA  1 
ATOM   4249 C  C   . LYS A 1 530 ? -4.980  10.188  47.483  1.00 31.49  ? 530  LYS A C   1 
ATOM   4250 O  O   . LYS A 1 530 ? -4.884  11.372  47.830  1.00 36.04  ? 530  LYS A O   1 
ATOM   4251 C  CB  . LYS A 1 530 ? -7.091  8.892   47.950  1.00 37.53  ? 530  LYS A CB  1 
ATOM   4252 C  CG  . LYS A 1 530 ? -7.598  9.743   49.087  1.00 39.53  ? 530  LYS A CG  1 
ATOM   4253 C  CD  . LYS A 1 530 ? -8.693  9.000   49.829  1.00 43.59  ? 530  LYS A CD  1 
ATOM   4254 C  CE  . LYS A 1 530 ? -9.153  9.748   51.073  1.00 47.22  ? 530  LYS A CE  1 
ATOM   4255 N  NZ  . LYS A 1 530 ? -10.418 9.146   51.585  1.00 46.37  ? 530  LYS A NZ  1 
ATOM   4256 N  N   . LEU A 1 531 ? -3.955  9.330   47.581  1.00 29.57  ? 531  LEU A N   1 
ATOM   4257 C  CA  . LEU A 1 531 ? -2.646  9.775   48.050  1.00 29.64  ? 531  LEU A CA  1 
ATOM   4258 C  C   . LEU A 1 531 ? -2.072  10.858  47.146  1.00 36.54  ? 531  LEU A C   1 
ATOM   4259 O  O   . LEU A 1 531 ? -1.556  11.873  47.626  1.00 38.11  ? 531  LEU A O   1 
ATOM   4260 C  CB  . LEU A 1 531 ? -1.679  8.592   48.125  1.00 30.60  ? 531  LEU A CB  1 
ATOM   4261 C  CG  . LEU A 1 531 ? -0.266  8.795   48.681  1.00 30.67  ? 531  LEU A CG  1 
ATOM   4262 C  CD1 . LEU A 1 531 ? 0.212   7.502   49.312  1.00 34.28  ? 531  LEU A CD1 1 
ATOM   4263 C  CD2 . LEU A 1 531 ? 0.748   9.264   47.630  1.00 29.82  ? 531  LEU A CD2 1 
ATOM   4264 N  N   . LEU A 1 532 ? -2.118  10.642  45.830  1.00 30.29  ? 532  LEU A N   1 
ATOM   4265 C  CA  . LEU A 1 532 ? -1.549  11.630  44.917  1.00 38.55  ? 532  LEU A CA  1 
ATOM   4266 C  C   . LEU A 1 532 ? -2.349  12.928  44.939  1.00 37.56  ? 532  LEU A C   1 
ATOM   4267 O  O   . LEU A 1 532 ? -1.772  14.019  44.877  1.00 40.90  ? 532  LEU A O   1 
ATOM   4268 C  CB  . LEU A 1 532 ? -1.474  11.061  43.500  1.00 33.90  ? 532  LEU A CB  1 
ATOM   4269 C  CG  . LEU A 1 532 ? -0.517  9.883   43.311  1.00 29.57  ? 532  LEU A CG  1 
ATOM   4270 C  CD1 . LEU A 1 532 ? -0.507  9.425   41.841  1.00 31.04  ? 532  LEU A CD1 1 
ATOM   4271 C  CD2 . LEU A 1 532 ? 0.893   10.234  43.786  1.00 30.31  ? 532  LEU A CD2 1 
ATOM   4272 N  N   . ASN A 1 533 ? -3.676  12.834  45.045  1.00 40.36  ? 533  ASN A N   1 
ATOM   4273 C  CA  . ASN A 1 533 ? -4.485  14.044  45.153  1.00 45.88  ? 533  ASN A CA  1 
ATOM   4274 C  C   . ASN A 1 533 ? -4.191  14.797  46.446  1.00 46.09  ? 533  ASN A C   1 
ATOM   4275 O  O   . ASN A 1 533 ? -4.167  16.034  46.460  1.00 50.55  ? 533  ASN A O   1 
ATOM   4276 C  CB  . ASN A 1 533 ? -5.969  13.699  45.060  1.00 45.37  ? 533  ASN A CB  1 
ATOM   4277 C  CG  . ASN A 1 533 ? -6.823  14.894  44.662  1.00 57.79  ? 533  ASN A CG  1 
ATOM   4278 O  OD1 . ASN A 1 533 ? -6.321  15.879  44.115  1.00 64.02  ? 533  ASN A OD1 1 
ATOM   4279 N  ND2 . ASN A 1 533 ? -8.121  14.807  44.925  1.00 61.55  ? 533  ASN A ND2 1 
ATOM   4280 N  N   . ALA A 1 534 ? -3.959  14.073  47.544  1.00 46.41  ? 534  ALA A N   1 
ATOM   4281 C  CA  . ALA A 1 534 ? -3.723  14.712  48.833  1.00 47.86  ? 534  ALA A CA  1 
ATOM   4282 C  C   . ALA A 1 534 ? -2.294  15.200  49.012  1.00 48.20  ? 534  ALA A C   1 
ATOM   4283 O  O   . ALA A 1 534 ? -2.045  16.014  49.909  1.00 55.12  ? 534  ALA A O   1 
ATOM   4284 C  CB  . ALA A 1 534 ? -4.070  13.752  49.977  1.00 47.40  ? 534  ALA A CB  1 
ATOM   4285 N  N   . THR A 1 535 ? -1.354  14.718  48.207  1.00 46.08  ? 535  THR A N   1 
ATOM   4286 C  CA  . THR A 1 535 ? 0.036   15.143  48.312  1.00 51.40  ? 535  THR A CA  1 
ATOM   4287 C  C   . THR A 1 535 ? 0.594   15.496  46.937  1.00 54.20  ? 535  THR A C   1 
ATOM   4288 O  O   . THR A 1 535 ? 1.783   15.785  46.798  1.00 62.43  ? 535  THR A O   1 
ATOM   4289 C  CB  . THR A 1 535 ? 0.922   14.052  48.956  1.00 48.33  ? 535  THR A CB  1 
ATOM   4290 O  OG1 . THR A 1 535 ? 0.717   12.803  48.287  1.00 48.57  ? 535  THR A OG1 1 
ATOM   4291 C  CG2 . THR A 1 535 ? 0.577   13.881  50.416  1.00 52.67  ? 535  THR A CG2 1 
ATOM   4292 N  N   . SER B 1 4   ? -19.699 -65.579 -36.624 1.00 49.07  ? 4    SER B N   1 
ATOM   4293 C  CA  . SER B 1 4   ? -21.053 -65.742 -36.103 1.00 49.08  ? 4    SER B CA  1 
ATOM   4294 C  C   . SER B 1 4   ? -21.024 -65.825 -34.582 1.00 46.23  ? 4    SER B C   1 
ATOM   4295 O  O   . SER B 1 4   ? -21.449 -64.898 -33.884 1.00 46.61  ? 4    SER B O   1 
ATOM   4296 C  CB  . SER B 1 4   ? -21.713 -66.991 -36.694 1.00 55.84  ? 4    SER B CB  1 
ATOM   4297 O  OG  . SER B 1 4   ? -22.963 -67.251 -36.078 1.00 55.23  ? 4    SER B OG  1 
ATOM   4298 N  N   . GLU B 1 5   ? -20.537 -66.956 -34.066 1.00 43.59  ? 5    GLU B N   1 
ATOM   4299 C  CA  . GLU B 1 5   ? -20.295 -67.055 -32.633 1.00 40.69  ? 5    GLU B CA  1 
ATOM   4300 C  C   . GLU B 1 5   ? -19.203 -66.082 -32.206 1.00 39.70  ? 5    GLU B C   1 
ATOM   4301 O  O   . GLU B 1 5   ? -19.249 -65.523 -31.101 1.00 42.03  ? 5    GLU B O   1 
ATOM   4302 C  CB  . GLU B 1 5   ? -19.916 -68.488 -32.263 1.00 43.74  ? 5    GLU B CB  1 
ATOM   4303 C  CG  . GLU B 1 5   ? -19.895 -68.739 -30.774 1.00 42.53  ? 5    GLU B CG  1 
ATOM   4304 C  CD  . GLU B 1 5   ? -19.640 -70.193 -30.426 1.00 45.65  ? 5    GLU B CD  1 
ATOM   4305 O  OE1 . GLU B 1 5   ? -19.357 -70.986 -31.348 1.00 47.39  ? 5    GLU B OE1 1 
ATOM   4306 O  OE2 . GLU B 1 5   ? -19.725 -70.541 -29.229 1.00 39.57  ? 5    GLU B OE2 1 
ATOM   4307 N  N   . LEU B 1 6   ? -18.224 -65.858 -33.077 1.00 29.70  ? 6    LEU B N   1 
ATOM   4308 C  CA  . LEU B 1 6   ? -17.096 -64.990 -32.789 1.00 35.75  ? 6    LEU B CA  1 
ATOM   4309 C  C   . LEU B 1 6   ? -17.295 -63.566 -33.277 1.00 35.49  ? 6    LEU B C   1 
ATOM   4310 O  O   . LEU B 1 6   ? -16.439 -62.716 -33.019 1.00 32.62  ? 6    LEU B O   1 
ATOM   4311 C  CB  . LEU B 1 6   ? -15.822 -65.561 -33.413 1.00 34.10  ? 6    LEU B CB  1 
ATOM   4312 C  CG  . LEU B 1 6   ? -15.403 -66.938 -32.904 1.00 39.26  ? 6    LEU B CG  1 
ATOM   4313 C  CD1 . LEU B 1 6   ? -14.284 -67.507 -33.749 1.00 38.38  ? 6    LEU B CD1 1 
ATOM   4314 C  CD2 . LEU B 1 6   ? -14.973 -66.830 -31.445 1.00 30.53  ? 6    LEU B CD2 1 
ATOM   4315 N  N   . LEU B 1 7   ? -18.380 -63.283 -33.985 1.00 34.97  ? 7    LEU B N   1 
ATOM   4316 C  CA  . LEU B 1 7   ? -18.624 -61.957 -34.543 1.00 35.25  ? 7    LEU B CA  1 
ATOM   4317 C  C   . LEU B 1 7   ? -19.767 -61.336 -33.758 1.00 33.94  ? 7    LEU B C   1 
ATOM   4318 O  O   . LEU B 1 7   ? -20.892 -61.844 -33.788 1.00 38.62  ? 7    LEU B O   1 
ATOM   4319 C  CB  . LEU B 1 7   ? -18.948 -62.037 -36.038 1.00 36.39  ? 7    LEU B CB  1 
ATOM   4320 C  CG  . LEU B 1 7   ? -19.233 -60.704 -36.741 1.00 36.35  ? 7    LEU B CG  1 
ATOM   4321 C  CD1 . LEU B 1 7   ? -18.103 -59.718 -36.510 1.00 35.85  ? 7    LEU B CD1 1 
ATOM   4322 C  CD2 . LEU B 1 7   ? -19.460 -60.915 -38.250 1.00 43.46  ? 7    LEU B CD2 1 
ATOM   4323 N  N   . VAL B 1 8   ? -19.477 -60.256 -33.036 1.00 26.80  ? 8    VAL B N   1 
ATOM   4324 C  CA  . VAL B 1 8   ? -20.442 -59.635 -32.145 1.00 29.24  ? 8    VAL B CA  1 
ATOM   4325 C  C   . VAL B 1 8   ? -20.516 -58.162 -32.492 1.00 27.60  ? 8    VAL B C   1 
ATOM   4326 O  O   . VAL B 1 8   ? -19.482 -57.496 -32.596 1.00 26.43  ? 8    VAL B O   1 
ATOM   4327 C  CB  . VAL B 1 8   ? -20.052 -59.820 -30.663 1.00 28.01  ? 8    VAL B CB  1 
ATOM   4328 C  CG1 . VAL B 1 8   ? -20.969 -59.008 -29.776 1.00 28.76  ? 8    VAL B CG1 1 
ATOM   4329 C  CG2 . VAL B 1 8   ? -20.094 -61.290 -30.279 1.00 30.88  ? 8    VAL B CG2 1 
ATOM   4330 N  N   . ASN B 1 9   ? -21.728 -57.653 -32.681 1.00 28.19  ? 9    ASN B N   1 
ATOM   4331 C  CA  A ASN B 1 9   ? -21.926 -56.227 -32.919 0.62 31.35  ? 9    ASN B CA  1 
ATOM   4332 C  CA  B ASN B 1 9   ? -21.944 -56.234 -32.928 0.38 31.34  ? 9    ASN B CA  1 
ATOM   4333 C  C   . ASN B 1 9   ? -22.214 -55.555 -31.588 1.00 29.82  ? 9    ASN B C   1 
ATOM   4334 O  O   . ASN B 1 9   ? -23.234 -55.830 -30.945 1.00 33.20  ? 9    ASN B O   1 
ATOM   4335 C  CB  A ASN B 1 9   ? -23.060 -55.944 -33.901 0.62 31.34  ? 9    ASN B CB  1 
ATOM   4336 C  CB  B ASN B 1 9   ? -23.104 -56.030 -33.902 0.38 31.34  ? 9    ASN B CB  1 
ATOM   4337 C  CG  A ASN B 1 9   ? -23.187 -54.453 -34.213 0.62 34.31  ? 9    ASN B CG  1 
ATOM   4338 C  CG  B ASN B 1 9   ? -22.842 -56.650 -35.274 0.38 32.29  ? 9    ASN B CG  1 
ATOM   4339 O  OD1 A ASN B 1 9   ? -22.206 -53.701 -34.126 0.62 26.91  ? 9    ASN B OD1 1 
ATOM   4340 O  OD1 B ASN B 1 9   ? -21.811 -57.286 -35.502 0.38 32.18  ? 9    ASN B OD1 1 
ATOM   4341 N  ND2 A ASN B 1 9   ? -24.401 -54.014 -34.554 0.62 38.13  ? 9    ASN B ND2 1 
ATOM   4342 N  ND2 B ASN B 1 9   ? -23.783 -56.462 -36.194 0.38 33.09  ? 9    ASN B ND2 1 
ATOM   4343 N  N   . THR B 1 10  ? -21.319 -54.677 -31.174 1.00 25.98  ? 10   THR B N   1 
ATOM   4344 C  CA  . THR B 1 10  ? -21.511 -53.939 -29.941 1.00 28.17  ? 10   THR B CA  1 
ATOM   4345 C  C   . THR B 1 10  ? -21.996 -52.534 -30.261 1.00 32.80  ? 10   THR B C   1 
ATOM   4346 O  O   . THR B 1 10  ? -22.000 -52.096 -31.415 1.00 31.41  ? 10   THR B O   1 
ATOM   4347 C  CB  . THR B 1 10  ? -20.210 -53.906 -29.127 1.00 29.47  ? 10   THR B CB  1 
ATOM   4348 O  OG1 . THR B 1 10  ? -19.328 -52.926 -29.681 1.00 25.77  ? 10   THR B OG1 1 
ATOM   4349 C  CG2 . THR B 1 10  ? -19.522 -55.258 -29.178 1.00 27.41  ? 10   THR B CG2 1 
ATOM   4350 N  N   . LYS B 1 11  ? -22.401 -51.822 -29.212 1.00 30.58  ? 11   LYS B N   1 
ATOM   4351 C  CA  . LYS B 1 11  ? -22.874 -50.455 -29.382 1.00 34.31  ? 11   LYS B CA  1 
ATOM   4352 C  C   . LYS B 1 11  ? -21.787 -49.517 -29.895 1.00 36.90  ? 11   LYS B C   1 
ATOM   4353 O  O   . LYS B 1 11  ? -22.109 -48.425 -30.376 1.00 37.84  ? 11   LYS B O   1 
ATOM   4354 C  CB  . LYS B 1 11  ? -23.450 -49.947 -28.066 1.00 32.21  ? 11   LYS B CB  1 
ATOM   4355 C  CG  . LYS B 1 11  ? -24.817 -50.570 -27.750 1.00 36.47  ? 11   LYS B CG  1 
ATOM   4356 C  CD  . LYS B 1 11  ? -25.279 -50.262 -26.335 1.00 33.97  ? 11   LYS B CD  1 
ATOM   4357 C  CE  . LYS B 1 11  ? -26.795 -50.331 -26.241 1.00 41.78  ? 11   LYS B CE  1 
ATOM   4358 N  NZ  . LYS B 1 11  ? -27.473 -49.112 -26.810 1.00 42.88  ? 11   LYS B NZ  1 
ATOM   4359 N  N   . SER B 1 12  ? -20.516 -49.911 -29.816 1.00 31.38  ? 12   SER B N   1 
ATOM   4360 C  CA  . SER B 1 12  ? -19.432 -49.111 -30.373 1.00 36.47  ? 12   SER B CA  1 
ATOM   4361 C  C   . SER B 1 12  ? -18.882 -49.667 -31.687 1.00 37.01  ? 12   SER B C   1 
ATOM   4362 O  O   . SER B 1 12  ? -17.953 -49.083 -32.252 1.00 38.00  ? 12   SER B O   1 
ATOM   4363 C  CB  . SER B 1 12  ? -18.291 -48.984 -29.360 1.00 37.11  ? 12   SER B CB  1 
ATOM   4364 O  OG  . SER B 1 12  ? -18.769 -48.897 -28.022 1.00 46.01  ? 12   SER B OG  1 
ATOM   4365 N  N   . GLY B 1 13  ? -19.411 -50.779 -32.184 1.00 31.12  ? 13   GLY B N   1 
ATOM   4366 C  CA  . GLY B 1 13  ? -18.948 -51.359 -33.428 1.00 31.27  ? 13   GLY B CA  1 
ATOM   4367 C  C   . GLY B 1 13  ? -18.747 -52.848 -33.304 1.00 30.10  ? 13   GLY B C   1 
ATOM   4368 O  O   . GLY B 1 13  ? -18.897 -53.441 -32.239 1.00 29.77  ? 13   GLY B O   1 
ATOM   4369 N  N   . LYS B 1 14  ? -18.392 -53.457 -34.428 1.00 28.14  ? 14   LYS B N   1 
ATOM   4370 C  CA  . LYS B 1 14  ? -18.252 -54.902 -34.505 1.00 27.67  ? 14   LYS B CA  1 
ATOM   4371 C  C   . LYS B 1 14  ? -16.885 -55.350 -34.000 1.00 30.35  ? 14   LYS B C   1 
ATOM   4372 O  O   . LYS B 1 14  ? -15.875 -54.660 -34.178 1.00 27.34  ? 14   LYS B O   1 
ATOM   4373 C  CB  . LYS B 1 14  ? -18.445 -55.387 -35.942 1.00 30.60  ? 14   LYS B CB  1 
ATOM   4374 C  CG  . LYS B 1 14  ? -19.758 -54.959 -36.583 1.00 31.89  ? 14   LYS B CG  1 
ATOM   4375 C  CD  . LYS B 1 14  ? -19.928 -55.641 -37.941 1.00 36.68  ? 14   LYS B CD  1 
ATOM   4376 C  CE  . LYS B 1 14  ? -21.209 -55.215 -38.640 1.00 37.71  ? 14   LYS B CE  1 
ATOM   4377 N  NZ  . LYS B 1 14  ? -21.071 -53.872 -39.280 1.00 47.15  ? 14   LYS B NZ  1 
ATOM   4378 N  N   . VAL B 1 15  ? -16.869 -56.533 -33.381 1.00 27.39  ? 15   VAL B N   1 
ATOM   4379 C  CA  A VAL B 1 15  ? -15.665 -57.158 -32.854 0.21 27.87  ? 15   VAL B CA  1 
ATOM   4380 C  CA  B VAL B 1 15  ? -15.642 -57.150 -32.895 0.79 27.88  ? 15   VAL B CA  1 
ATOM   4381 C  C   . VAL B 1 15  ? -15.632 -58.604 -33.334 1.00 26.31  ? 15   VAL B C   1 
ATOM   4382 O  O   . VAL B 1 15  ? -16.677 -59.254 -33.432 1.00 29.97  ? 15   VAL B O   1 
ATOM   4383 C  CB  A VAL B 1 15  ? -15.633 -57.073 -31.310 0.21 26.11  ? 15   VAL B CB  1 
ATOM   4384 C  CB  B VAL B 1 15  ? -15.475 -57.056 -31.353 0.79 25.93  ? 15   VAL B CB  1 
ATOM   4385 C  CG1 A VAL B 1 15  ? -14.984 -58.297 -30.698 0.21 27.05  ? 15   VAL B CG1 1 
ATOM   4386 C  CG1 B VAL B 1 15  ? -15.614 -55.620 -30.874 0.79 26.80  ? 15   VAL B CG1 1 
ATOM   4387 C  CG2 A VAL B 1 15  ? -14.923 -55.807 -30.861 0.21 26.95  ? 15   VAL B CG2 1 
ATOM   4388 C  CG2 B VAL B 1 15  ? -16.476 -57.958 -30.653 0.79 25.12  ? 15   VAL B CG2 1 
ATOM   4389 N  N   . MET B 1 16  ? -14.437 -59.107 -33.627 1.00 27.34  ? 16   MET B N   1 
ATOM   4390 C  CA  . MET B 1 16  ? -14.242 -60.492 -34.042 1.00 30.68  ? 16   MET B CA  1 
ATOM   4391 C  C   . MET B 1 16  ? -13.283 -61.163 -33.071 1.00 27.73  ? 16   MET B C   1 
ATOM   4392 O  O   . MET B 1 16  ? -12.096 -60.817 -33.024 1.00 29.01  ? 16   MET B O   1 
ATOM   4393 C  CB  . MET B 1 16  ? -13.707 -60.563 -35.472 1.00 28.94  ? 16   MET B CB  1 
ATOM   4394 C  CG  . MET B 1 16  ? -13.545 -61.965 -36.001 1.00 37.03  ? 16   MET B CG  1 
ATOM   4395 S  SD  . MET B 1 16  ? -15.139 -62.755 -36.291 1.00 53.26  ? 16   MET B SD  1 
ATOM   4396 C  CE  . MET B 1 16  ? -14.628 -64.452 -36.540 1.00 46.55  ? 16   MET B CE  1 
ATOM   4397 N  N   . GLY B 1 17  ? -13.801 -62.105 -32.284 1.00 31.71  ? 17   GLY B N   1 
ATOM   4398 C  CA  . GLY B 1 17  ? -12.995 -62.829 -31.330 1.00 29.64  ? 17   GLY B CA  1 
ATOM   4399 C  C   . GLY B 1 17  ? -12.281 -64.007 -31.962 1.00 38.38  ? 17   GLY B C   1 
ATOM   4400 O  O   . GLY B 1 17  ? -12.204 -64.159 -33.182 1.00 31.34  ? 17   GLY B O   1 
ATOM   4401 N  N   . THR B 1 18  ? -11.749 -64.864 -31.094 1.00 32.12  ? 18   THR B N   1 
ATOM   4402 C  CA  . THR B 1 18  ? -10.986 -66.026 -31.521 1.00 32.96  ? 18   THR B CA  1 
ATOM   4403 C  C   . THR B 1 18  ? -11.427 -67.234 -30.704 1.00 35.44  ? 18   THR B C   1 
ATOM   4404 O  O   . THR B 1 18  ? -11.894 -67.095 -29.570 1.00 35.75  ? 18   THR B O   1 
ATOM   4405 C  CB  . THR B 1 18  ? -9.470  -65.778 -31.377 1.00 31.94  ? 18   THR B CB  1 
ATOM   4406 O  OG1 . THR B 1 18  ? -8.748  -66.911 -31.868 1.00 37.77  ? 18   THR B OG1 1 
ATOM   4407 C  CG2 . THR B 1 18  ? -9.077  -65.533 -29.896 1.00 29.37  ? 18   THR B CG2 1 
ATOM   4408 N  N   . ARG B 1 19  ? -11.321 -68.416 -31.302 1.00 34.48  ? 19   ARG B N   1 
ATOM   4409 C  CA  A ARG B 1 19  ? -11.675 -69.660 -30.631 0.61 34.64  ? 19   ARG B CA  1 
ATOM   4410 C  CA  B ARG B 1 19  ? -11.673 -69.660 -30.631 0.39 34.68  ? 19   ARG B CA  1 
ATOM   4411 C  C   . ARG B 1 19  ? -10.427 -70.211 -29.955 1.00 37.48  ? 19   ARG B C   1 
ATOM   4412 O  O   . ARG B 1 19  ? -9.412  -70.449 -30.620 1.00 37.60  ? 19   ARG B O   1 
ATOM   4413 C  CB  A ARG B 1 19  ? -12.254 -70.674 -31.618 0.61 39.19  ? 19   ARG B CB  1 
ATOM   4414 C  CB  B ARG B 1 19  ? -12.240 -70.677 -31.617 0.39 39.16  ? 19   ARG B CB  1 
ATOM   4415 C  CG  A ARG B 1 19  ? -12.830 -71.942 -30.981 0.61 39.15  ? 19   ARG B CG  1 
ATOM   4416 C  CG  B ARG B 1 19  ? -12.681 -71.981 -30.974 0.39 39.09  ? 19   ARG B CG  1 
ATOM   4417 C  CD  A ARG B 1 19  ? -13.969 -72.537 -31.829 0.61 39.13  ? 19   ARG B CD  1 
ATOM   4418 C  CD  B ARG B 1 19  ? -12.547 -73.146 -31.939 0.39 40.53  ? 19   ARG B CD  1 
ATOM   4419 N  NE  A ARG B 1 19  ? -14.442 -73.826 -31.318 0.61 38.87  ? 19   ARG B NE  1 
ATOM   4420 N  NE  B ARG B 1 19  ? -13.503 -74.208 -31.640 0.39 41.22  ? 19   ARG B NE  1 
ATOM   4421 C  CZ  A ARG B 1 19  ? -15.442 -73.970 -30.452 0.61 42.41  ? 19   ARG B CZ  1 
ATOM   4422 C  CZ  B ARG B 1 19  ? -13.268 -75.501 -31.832 0.39 41.00  ? 19   ARG B CZ  1 
ATOM   4423 N  NH1 A ARG B 1 19  ? -16.083 -72.905 -29.989 0.61 39.37  ? 19   ARG B NH1 1 
ATOM   4424 N  NH1 B ARG B 1 19  ? -12.101 -75.900 -32.316 0.39 40.53  ? 19   ARG B NH1 1 
ATOM   4425 N  NH2 A ARG B 1 19  ? -15.799 -75.180 -30.040 0.61 42.57  ? 19   ARG B NH2 1 
ATOM   4426 N  NH2 B ARG B 1 19  ? -14.201 -76.395 -31.533 0.39 43.48  ? 19   ARG B NH2 1 
ATOM   4427 N  N   . VAL B 1 20  ? -10.498 -70.408 -28.640 1.00 37.03  ? 20   VAL B N   1 
ATOM   4428 C  CA  . VAL B 1 20  ? -9.306  -70.809 -27.899 1.00 35.19  ? 20   VAL B CA  1 
ATOM   4429 C  C   . VAL B 1 20  ? -9.480  -72.192 -27.281 1.00 34.94  ? 20   VAL B C   1 
ATOM   4430 O  O   . VAL B 1 20  ? -10.570 -72.541 -26.805 1.00 35.03  ? 20   VAL B O   1 
ATOM   4431 C  CB  . VAL B 1 20  ? -8.938  -69.762 -26.832 1.00 42.32  ? 20   VAL B CB  1 
ATOM   4432 C  CG1 . VAL B 1 20  ? -8.902  -68.371 -27.445 1.00 40.53  ? 20   VAL B CG1 1 
ATOM   4433 C  CG2 . VAL B 1 20  ? -9.907  -69.794 -25.680 1.00 35.93  ? 20   VAL B CG2 1 
ATOM   4434 N  N   . PRO B 1 21  ? -8.431  -73.008 -27.274 1.00 36.27  ? 21   PRO B N   1 
ATOM   4435 C  CA  . PRO B 1 21  ? -8.504  -74.284 -26.564 1.00 37.39  ? 21   PRO B CA  1 
ATOM   4436 C  C   . PRO B 1 21  ? -8.523  -74.039 -25.067 1.00 37.62  ? 21   PRO B C   1 
ATOM   4437 O  O   . PRO B 1 21  ? -7.857  -73.137 -24.557 1.00 36.07  ? 21   PRO B O   1 
ATOM   4438 C  CB  . PRO B 1 21  ? -7.219  -75.012 -26.985 1.00 40.15  ? 21   PRO B CB  1 
ATOM   4439 C  CG  . PRO B 1 21  ? -6.499  -74.083 -27.931 1.00 45.36  ? 21   PRO B CG  1 
ATOM   4440 C  CD  . PRO B 1 21  ? -7.075  -72.724 -27.761 1.00 38.30  ? 21   PRO B CD  1 
ATOM   4441 N  N   . VAL B 1 22  ? -9.307  -74.841 -24.364 1.00 37.62  ? 22   VAL B N   1 
ATOM   4442 C  CA  . VAL B 1 22  ? -9.288  -74.822 -22.909 1.00 40.07  ? 22   VAL B CA  1 
ATOM   4443 C  C   . VAL B 1 22  ? -9.482  -76.253 -22.453 1.00 41.05  ? 22   VAL B C   1 
ATOM   4444 O  O   . VAL B 1 22  ? -10.510 -76.869 -22.760 1.00 42.49  ? 22   VAL B O   1 
ATOM   4445 C  CB  . VAL B 1 22  ? -10.359 -73.895 -22.306 1.00 35.37  ? 22   VAL B CB  1 
ATOM   4446 C  CG1 . VAL B 1 22  ? -11.721 -74.118 -22.959 1.00 36.39  ? 22   VAL B CG1 1 
ATOM   4447 C  CG2 . VAL B 1 22  ? -10.415 -74.070 -20.777 1.00 31.25  ? 22   VAL B CG2 1 
ATOM   4448 N  N   . LEU B 1 23  ? -8.484  -76.791 -21.752 1.00 43.44  ? 23   LEU B N   1 
ATOM   4449 C  CA  . LEU B 1 23  ? -8.461  -78.196 -21.368 1.00 44.47  ? 23   LEU B CA  1 
ATOM   4450 C  C   . LEU B 1 23  ? -8.714  -79.046 -22.613 1.00 48.24  ? 23   LEU B C   1 
ATOM   4451 O  O   . LEU B 1 23  ? -7.971  -78.937 -23.595 1.00 52.92  ? 23   LEU B O   1 
ATOM   4452 C  CB  . LEU B 1 23  ? -9.466  -78.445 -20.236 1.00 43.47  ? 23   LEU B CB  1 
ATOM   4453 C  CG  . LEU B 1 23  ? -9.225  -77.465 -19.068 1.00 41.89  ? 23   LEU B CG  1 
ATOM   4454 C  CD1 . LEU B 1 23  ? -10.250 -77.589 -17.954 1.00 39.87  ? 23   LEU B CD1 1 
ATOM   4455 C  CD2 . LEU B 1 23  ? -7.825  -77.616 -18.494 1.00 39.44  ? 23   LEU B CD2 1 
ATOM   4456 N  N   . SER B 1 24  ? -9.762  -79.864 -22.622 1.00 49.04  ? 24   SER B N   1 
ATOM   4457 C  CA  . SER B 1 24  ? -10.045 -80.691 -23.788 1.00 48.18  ? 24   SER B CA  1 
ATOM   4458 C  C   . SER B 1 24  ? -11.195 -80.152 -24.632 1.00 46.23  ? 24   SER B C   1 
ATOM   4459 O  O   . SER B 1 24  ? -11.795 -80.906 -25.405 1.00 48.92  ? 24   SER B O   1 
ATOM   4460 C  CB  . SER B 1 24  ? -10.331 -82.129 -23.356 1.00 52.41  ? 24   SER B CB  1 
ATOM   4461 O  OG  . SER B 1 24  ? -9.130  -82.782 -22.977 1.00 54.64  ? 24   SER B OG  1 
ATOM   4462 N  N   . SER B 1 25  ? -11.506 -78.867 -24.512 1.00 43.43  ? 25   SER B N   1 
ATOM   4463 C  CA  . SER B 1 25  ? -12.642 -78.273 -25.209 1.00 40.77  ? 25   SER B CA  1 
ATOM   4464 C  C   . SER B 1 25  ? -12.199 -76.923 -25.768 1.00 37.18  ? 25   SER B C   1 
ATOM   4465 O  O   . SER B 1 25  ? -11.008 -76.666 -25.973 1.00 37.23  ? 25   SER B O   1 
ATOM   4466 C  CB  . SER B 1 25  ? -13.847 -78.172 -24.263 1.00 39.46  ? 25   SER B CB  1 
ATOM   4467 O  OG  . SER B 1 25  ? -14.996 -77.686 -24.934 1.00 46.39  ? 25   SER B OG  1 
ATOM   4468 N  N   . HIS B 1 26  ? -13.163 -76.040 -26.004 1.00 35.66  ? 26   HIS B N   1 
ATOM   4469 C  CA  . HIS B 1 26  ? -12.890 -74.737 -26.585 1.00 34.23  ? 26   HIS B CA  1 
ATOM   4470 C  C   . HIS B 1 26  ? -13.886 -73.728 -26.033 1.00 34.07  ? 26   HIS B C   1 
ATOM   4471 O  O   . HIS B 1 26  ? -15.007 -74.081 -25.658 1.00 35.68  ? 26   HIS B O   1 
ATOM   4472 C  CB  . HIS B 1 26  ? -12.981 -74.767 -28.127 1.00 36.69  ? 26   HIS B CB  1 
ATOM   4473 C  CG  . HIS B 1 26  ? -11.956 -75.646 -28.779 1.00 41.50  ? 26   HIS B CG  1 
ATOM   4474 N  ND1 . HIS B 1 26  ? -12.201 -76.963 -29.104 1.00 43.81  ? 26   HIS B ND1 1 
ATOM   4475 C  CD2 . HIS B 1 26  ? -10.678 -75.398 -29.156 1.00 41.62  ? 26   HIS B CD2 1 
ATOM   4476 C  CE1 . HIS B 1 26  ? -11.121 -77.488 -29.655 1.00 45.64  ? 26   HIS B CE1 1 
ATOM   4477 N  NE2 . HIS B 1 26  ? -10.182 -76.559 -29.700 1.00 45.59  ? 26   HIS B NE2 1 
ATOM   4478 N  N   . ILE B 1 27  ? -13.472 -72.462 -26.003 1.00 32.09  ? 27   ILE B N   1 
ATOM   4479 C  CA  . ILE B 1 27  ? -14.361 -71.347 -25.698 1.00 33.40  ? 27   ILE B CA  1 
ATOM   4480 C  C   . ILE B 1 27  ? -13.988 -70.174 -26.595 1.00 33.81  ? 27   ILE B C   1 
ATOM   4481 O  O   . ILE B 1 27  ? -12.973 -70.192 -27.290 1.00 37.04  ? 27   ILE B O   1 
ATOM   4482 C  CB  . ILE B 1 27  ? -14.302 -70.922 -24.213 1.00 30.25  ? 27   ILE B CB  1 
ATOM   4483 C  CG1 . ILE B 1 27  ? -12.884 -70.547 -23.825 1.00 32.51  ? 27   ILE B CG1 1 
ATOM   4484 C  CG2 . ILE B 1 27  ? -14.868 -72.014 -23.303 1.00 39.87  ? 27   ILE B CG2 1 
ATOM   4485 C  CD1 . ILE B 1 27  ? -12.825 -69.986 -22.430 1.00 40.35  ? 27   ILE B CD1 1 
ATOM   4486 N  N   . SER B 1 28  ? -14.829 -69.145 -26.573 1.00 33.27  ? 28   SER B N   1 
ATOM   4487 C  CA  . SER B 1 28  ? -14.612 -67.948 -27.372 1.00 30.44  ? 28   SER B CA  1 
ATOM   4488 C  C   . SER B 1 28  ? -13.901 -66.893 -26.536 1.00 33.85  ? 28   SER B C   1 
ATOM   4489 O  O   . SER B 1 28  ? -14.224 -66.699 -25.360 1.00 30.94  ? 28   SER B O   1 
ATOM   4490 C  CB  . SER B 1 28  ? -15.939 -67.389 -27.894 1.00 32.02  ? 28   SER B CB  1 
ATOM   4491 O  OG  . SER B 1 28  ? -16.738 -68.406 -28.474 1.00 33.67  ? 28   SER B OG  1 
ATOM   4492 N  N   . ALA B 1 29  ? -12.941 -66.202 -27.144 1.00 29.06  ? 29   ALA B N   1 
ATOM   4493 C  CA  . ALA B 1 29  ? -12.230 -65.136 -26.454 1.00 32.00  ? 29   ALA B CA  1 
ATOM   4494 C  C   . ALA B 1 29  ? -12.277 -63.872 -27.288 1.00 31.78  ? 29   ALA B C   1 
ATOM   4495 O  O   . ALA B 1 29  ? -12.004 -63.905 -28.492 1.00 29.18  ? 29   ALA B O   1 
ATOM   4496 C  CB  . ALA B 1 29  ? -10.773 -65.513 -26.167 1.00 29.79  ? 29   ALA B CB  1 
ATOM   4497 N  N   . PHE B 1 30  ? -12.599 -62.760 -26.649 1.00 28.74  ? 30   PHE B N   1 
ATOM   4498 C  CA  . PHE B 1 30  ? -12.581 -61.458 -27.305 1.00 31.50  ? 30   PHE B CA  1 
ATOM   4499 C  C   . PHE B 1 30  ? -11.539 -60.627 -26.566 1.00 29.01  ? 30   PHE B C   1 
ATOM   4500 O  O   . PHE B 1 30  ? -11.788 -60.143 -25.456 1.00 27.77  ? 30   PHE B O   1 
ATOM   4501 C  CB  . PHE B 1 30  ? -13.969 -60.823 -27.295 1.00 26.97  ? 30   PHE B CB  1 
ATOM   4502 C  CG  . PHE B 1 30  ? -15.029 -61.683 -27.920 1.00 28.81  ? 30   PHE B CG  1 
ATOM   4503 C  CD1 . PHE B 1 30  ? -15.640 -62.699 -27.199 1.00 28.20  ? 30   PHE B CD1 1 
ATOM   4504 C  CD2 . PHE B 1 30  ? -15.412 -61.483 -29.246 1.00 28.09  ? 30   PHE B CD2 1 
ATOM   4505 C  CE1 . PHE B 1 30  ? -16.622 -63.490 -27.769 1.00 32.65  ? 30   PHE B CE1 1 
ATOM   4506 C  CE2 . PHE B 1 30  ? -16.395 -62.282 -29.830 1.00 29.43  ? 30   PHE B CE2 1 
ATOM   4507 C  CZ  . PHE B 1 30  ? -17.000 -63.284 -29.088 1.00 31.51  ? 30   PHE B CZ  1 
ATOM   4508 N  N   . LEU B 1 31  ? -10.362 -60.481 -27.171 1.00 27.96  ? 31   LEU B N   1 
ATOM   4509 C  CA  . LEU B 1 31  ? -9.221  -59.882 -26.505 1.00 25.00  ? 31   LEU B CA  1 
ATOM   4510 C  C   . LEU B 1 31  ? -8.977  -58.468 -27.007 1.00 29.51  ? 31   LEU B C   1 
ATOM   4511 O  O   . LEU B 1 31  ? -9.031  -58.205 -28.215 1.00 30.14  ? 31   LEU B O   1 
ATOM   4512 C  CB  . LEU B 1 31  ? -7.972  -60.743 -26.702 1.00 27.16  ? 31   LEU B CB  1 
ATOM   4513 C  CG  . LEU B 1 31  ? -8.125  -62.206 -26.278 1.00 28.65  ? 31   LEU B CG  1 
ATOM   4514 C  CD1 . LEU B 1 31  ? -6.797  -62.922 -26.459 1.00 29.72  ? 31   LEU B CD1 1 
ATOM   4515 C  CD2 . LEU B 1 31  ? -8.611  -62.315 -24.812 1.00 30.14  ? 31   LEU B CD2 1 
ATOM   4516 N  N   . GLY B 1 32  ? -8.726  -57.562 -26.068 1.00 29.08  ? 32   GLY B N   1 
ATOM   4517 C  CA  . GLY B 1 32  ? -8.314  -56.208 -26.401 1.00 31.27  ? 32   GLY B CA  1 
ATOM   4518 C  C   . GLY B 1 32  ? -9.393  -55.332 -26.999 1.00 29.78  ? 32   GLY B C   1 
ATOM   4519 O  O   . GLY B 1 32  ? -9.108  -54.549 -27.913 1.00 27.45  ? 32   GLY B O   1 
ATOM   4520 N  N   . ILE B 1 33  ? -10.615 -55.426 -26.498 1.00 26.89  ? 33   ILE B N   1 
ATOM   4521 C  CA  . ILE B 1 33  ? -11.687 -54.539 -26.951 1.00 25.42  ? 33   ILE B CA  1 
ATOM   4522 C  C   . ILE B 1 33  ? -11.486 -53.168 -26.306 1.00 26.37  ? 33   ILE B C   1 
ATOM   4523 O  O   . ILE B 1 33  ? -11.324 -53.096 -25.077 1.00 25.31  ? 33   ILE B O   1 
ATOM   4524 C  CB  . ILE B 1 33  ? -13.051 -55.114 -26.589 1.00 26.06  ? 33   ILE B CB  1 
ATOM   4525 C  CG1 . ILE B 1 33  ? -13.290 -56.432 -27.327 1.00 29.30  ? 33   ILE B CG1 1 
ATOM   4526 C  CG2 . ILE B 1 33  ? -14.165 -54.102 -26.876 1.00 27.57  ? 33   ILE B CG2 1 
ATOM   4527 C  CD1 . ILE B 1 33  ? -14.435 -57.223 -26.739 1.00 30.38  ? 33   ILE B CD1 1 
ATOM   4528 N  N   . PRO B 1 34  ? -11.473 -52.084 -27.078 1.00 22.39  ? 34   PRO B N   1 
ATOM   4529 C  CA  . PRO B 1 34  ? -11.302 -50.759 -26.470 1.00 24.11  ? 34   PRO B CA  1 
ATOM   4530 C  C   . PRO B 1 34  ? -12.587 -50.309 -25.807 1.00 28.47  ? 34   PRO B C   1 
ATOM   4531 O  O   . PRO B 1 34  ? -13.685 -50.534 -26.321 1.00 27.73  ? 34   PRO B O   1 
ATOM   4532 C  CB  . PRO B 1 34  ? -10.948 -49.865 -27.666 1.00 27.46  ? 34   PRO B CB  1 
ATOM   4533 C  CG  . PRO B 1 34  ? -11.633 -50.540 -28.834 1.00 28.22  ? 34   PRO B CG  1 
ATOM   4534 C  CD  . PRO B 1 34  ? -11.547 -52.021 -28.555 1.00 25.59  ? 34   PRO B CD  1 
ATOM   4535 N  N   . PHE B 1 35  ? -12.456 -49.689 -24.633 1.00 25.12  ? 35   PHE B N   1 
ATOM   4536 C  CA  . PHE B 1 35  ? -13.624 -49.131 -23.977 1.00 24.39  ? 35   PHE B CA  1 
ATOM   4537 C  C   . PHE B 1 35  ? -13.493 -47.642 -23.722 1.00 27.52  ? 35   PHE B C   1 
ATOM   4538 O  O   . PHE B 1 35  ? -14.471 -47.012 -23.299 1.00 29.72  ? 35   PHE B O   1 
ATOM   4539 C  CB  . PHE B 1 35  ? -13.929 -49.883 -22.666 1.00 26.74  ? 35   PHE B CB  1 
ATOM   4540 C  CG  . PHE B 1 35  ? -12.849 -49.783 -21.617 1.00 25.84  ? 35   PHE B CG  1 
ATOM   4541 C  CD1 . PHE B 1 35  ? -12.802 -48.704 -20.751 1.00 25.46  ? 35   PHE B CD1 1 
ATOM   4542 C  CD2 . PHE B 1 35  ? -11.909 -50.794 -21.469 1.00 20.47  ? 35   PHE B CD2 1 
ATOM   4543 C  CE1 . PHE B 1 35  ? -11.819 -48.619 -19.761 1.00 25.13  ? 35   PHE B CE1 1 
ATOM   4544 C  CE2 . PHE B 1 35  ? -10.927 -50.708 -20.476 1.00 24.68  ? 35   PHE B CE2 1 
ATOM   4545 C  CZ  . PHE B 1 35  ? -10.888 -49.623 -19.635 1.00 25.67  ? 35   PHE B CZ  1 
ATOM   4546 N  N   . ALA B 1 36  ? -12.336 -47.062 -24.018 1.00 24.90  ? 36   ALA B N   1 
ATOM   4547 C  CA  . ALA B 1 36  ? -12.046 -45.659 -23.784 1.00 28.55  ? 36   ALA B CA  1 
ATOM   4548 C  C   . ALA B 1 36  ? -11.267 -45.122 -24.968 1.00 26.91  ? 36   ALA B C   1 
ATOM   4549 O  O   . ALA B 1 36  ? -10.579 -45.872 -25.661 1.00 29.41  ? 36   ALA B O   1 
ATOM   4550 C  CB  . ALA B 1 36  ? -11.195 -45.456 -22.528 1.00 30.73  ? 36   ALA B CB  1 
ATOM   4551 N  N   . GLU B 1 37  ? -11.351 -43.808 -25.170 1.00 33.58  ? 37   GLU B N   1 
ATOM   4552 C  CA  . GLU B 1 37  ? -10.394 -43.146 -26.052 1.00 34.30  ? 37   GLU B CA  1 
ATOM   4553 C  C   . GLU B 1 37  ? -8.995  -43.269 -25.453 1.00 34.48  ? 37   GLU B C   1 
ATOM   4554 O  O   . GLU B 1 37  ? -8.839  -43.201 -24.228 1.00 32.86  ? 37   GLU B O   1 
ATOM   4555 C  CB  . GLU B 1 37  ? -10.740 -41.668 -26.238 1.00 30.50  ? 37   GLU B CB  1 
ATOM   4556 C  CG  . GLU B 1 37  ? -11.951 -41.431 -27.136 1.00 37.63  ? 37   GLU B CG  1 
ATOM   4557 C  CD  . GLU B 1 37  ? -11.667 -41.794 -28.583 1.00 37.11  ? 37   GLU B CD  1 
ATOM   4558 O  OE1 . GLU B 1 37  ? -10.894 -41.058 -29.231 1.00 44.69  ? 37   GLU B OE1 1 
ATOM   4559 O  OE2 . GLU B 1 37  ? -12.195 -42.819 -29.065 1.00 36.38  ? 37   GLU B OE2 1 
ATOM   4560 N  N   . PRO B 1 38  ? -7.971  -43.473 -26.275 1.00 31.22  ? 38   PRO B N   1 
ATOM   4561 C  CA  . PRO B 1 38  ? -6.596  -43.509 -25.759 1.00 29.91  ? 38   PRO B CA  1 
ATOM   4562 C  C   . PRO B 1 38  ? -6.302  -42.277 -24.927 1.00 33.72  ? 38   PRO B C   1 
ATOM   4563 O  O   . PRO B 1 38  ? -6.478  -41.143 -25.399 1.00 34.52  ? 38   PRO B O   1 
ATOM   4564 C  CB  . PRO B 1 38  ? -5.741  -43.536 -27.035 1.00 32.62  ? 38   PRO B CB  1 
ATOM   4565 C  CG  . PRO B 1 38  ? -6.638  -44.158 -28.066 1.00 32.97  ? 38   PRO B CG  1 
ATOM   4566 C  CD  . PRO B 1 38  ? -8.025  -43.662 -27.739 1.00 34.29  ? 38   PRO B CD  1 
ATOM   4567 N  N   . PRO B 1 39  ? -5.886  -42.449 -23.673 1.00 29.96  ? 39   PRO B N   1 
ATOM   4568 C  CA  . PRO B 1 39  ? -5.619  -41.288 -22.807 1.00 28.80  ? 39   PRO B CA  1 
ATOM   4569 C  C   . PRO B 1 39  ? -4.215  -40.730 -23.019 1.00 36.04  ? 39   PRO B C   1 
ATOM   4570 O  O   . PRO B 1 39  ? -3.358  -40.767 -22.133 1.00 31.78  ? 39   PRO B O   1 
ATOM   4571 C  CB  . PRO B 1 39  ? -5.820  -41.877 -21.404 1.00 30.24  ? 39   PRO B CB  1 
ATOM   4572 C  CG  . PRO B 1 39  ? -5.381  -43.292 -21.543 1.00 29.12  ? 39   PRO B CG  1 
ATOM   4573 C  CD  . PRO B 1 39  ? -5.759  -43.725 -22.946 1.00 29.61  ? 39   PRO B CD  1 
ATOM   4574 N  N   . VAL B 1 40  ? -3.969  -40.207 -24.225 1.00 34.48  ? 40   VAL B N   1 
ATOM   4575 C  CA  . VAL B 1 40  ? -2.632  -39.804 -24.640 1.00 35.80  ? 40   VAL B CA  1 
ATOM   4576 C  C   . VAL B 1 40  ? -2.597  -38.304 -24.908 1.00 37.43  ? 40   VAL B C   1 
ATOM   4577 O  O   . VAL B 1 40  ? -3.627  -37.651 -25.097 1.00 35.40  ? 40   VAL B O   1 
ATOM   4578 C  CB  . VAL B 1 40  ? -2.162  -40.579 -25.885 1.00 35.42  ? 40   VAL B CB  1 
ATOM   4579 C  CG1 . VAL B 1 40  ? -2.107  -42.060 -25.583 1.00 33.46  ? 40   VAL B CG1 1 
ATOM   4580 C  CG2 . VAL B 1 40  ? -3.094  -40.304 -27.057 1.00 37.43  ? 40   VAL B CG2 1 
ATOM   4581 N  N   . GLY B 1 41  ? -1.382  -37.762 -24.917 1.00 36.23  ? 41   GLY B N   1 
ATOM   4582 C  CA  . GLY B 1 41  ? -1.208  -36.356 -25.246 1.00 38.51  ? 41   GLY B CA  1 
ATOM   4583 C  C   . GLY B 1 41  ? -1.842  -35.456 -24.207 1.00 37.83  ? 41   GLY B C   1 
ATOM   4584 O  O   . GLY B 1 41  ? -1.571  -35.563 -23.005 1.00 33.77  ? 41   GLY B O   1 
ATOM   4585 N  N   . ASN B 1 42  ? -2.696  -34.543 -24.669 1.00 39.56  ? 42   ASN B N   1 
ATOM   4586 C  CA  . ASN B 1 42  ? -3.362  -33.643 -23.732 1.00 39.22  ? 42   ASN B CA  1 
ATOM   4587 C  C   . ASN B 1 42  ? -4.443  -34.336 -22.914 1.00 36.20  ? 42   ASN B C   1 
ATOM   4588 O  O   . ASN B 1 42  ? -5.112  -33.671 -22.116 1.00 39.74  ? 42   ASN B O   1 
ATOM   4589 C  CB  . ASN B 1 42  ? -3.951  -32.442 -24.482 1.00 44.79  ? 42   ASN B CB  1 
ATOM   4590 C  CG  . ASN B 1 42  ? -5.161  -32.807 -25.334 1.00 52.43  ? 42   ASN B CG  1 
ATOM   4591 O  OD1 . ASN B 1 42  ? -5.288  -33.933 -25.819 1.00 51.93  ? 42   ASN B OD1 1 
ATOM   4592 N  ND2 . ASN B 1 42  ? -6.052  -31.841 -25.530 1.00 56.43  ? 42   ASN B ND2 1 
ATOM   4593 N  N   . MET B 1 43  ? -4.639  -35.641 -23.092 1.00 37.30  ? 43   MET B N   1 
ATOM   4594 C  CA  . MET B 1 43  ? -5.574  -36.407 -22.278 1.00 39.28  ? 43   MET B CA  1 
ATOM   4595 C  C   . MET B 1 43  ? -4.882  -37.207 -21.183 1.00 33.43  ? 43   MET B C   1 
ATOM   4596 O  O   . MET B 1 43  ? -5.551  -37.948 -20.457 1.00 32.98  ? 43   MET B O   1 
ATOM   4597 C  CB  . MET B 1 43  ? -6.394  -37.343 -23.164 1.00 36.77  ? 43   MET B CB  1 
ATOM   4598 C  CG  . MET B 1 43  ? -7.078  -36.622 -24.308 1.00 44.53  ? 43   MET B CG  1 
ATOM   4599 S  SD  . MET B 1 43  ? -8.532  -37.500 -24.862 1.00 53.69  ? 43   MET B SD  1 
ATOM   4600 C  CE  . MET B 1 43  ? -9.554  -37.296 -23.402 1.00 42.42  ? 43   MET B CE  1 
ATOM   4601 N  N   . ARG B 1 44  ? -3.563  -37.098 -21.062 1.00 37.34  ? 44   ARG B N   1 
ATOM   4602 C  CA  . ARG B 1 44  ? -2.874  -37.690 -19.924 1.00 30.69  ? 44   ARG B CA  1 
ATOM   4603 C  C   . ARG B 1 44  ? -3.335  -37.004 -18.645 1.00 34.75  ? 44   ARG B C   1 
ATOM   4604 O  O   . ARG B 1 44  ? -3.444  -35.775 -18.595 1.00 35.45  ? 44   ARG B O   1 
ATOM   4605 C  CB  . ARG B 1 44  ? -1.357  -37.563 -20.099 1.00 35.63  ? 44   ARG B CB  1 
ATOM   4606 C  CG  . ARG B 1 44  ? -0.534  -38.151 -18.953 1.00 28.77  ? 44   ARG B CG  1 
ATOM   4607 C  CD  . ARG B 1 44  ? 0.959   -37.814 -19.100 1.00 32.77  ? 44   ARG B CD  1 
ATOM   4608 N  NE  . ARG B 1 44  ? 1.622   -38.635 -20.116 1.00 31.24  ? 44   ARG B NE  1 
ATOM   4609 C  CZ  . ARG B 1 44  ? 2.886   -38.465 -20.493 1.00 32.50  ? 44   ARG B CZ  1 
ATOM   4610 N  NH1 . ARG B 1 44  ? 3.610   -37.503 -19.943 1.00 33.93  ? 44   ARG B NH1 1 
ATOM   4611 N  NH2 . ARG B 1 44  ? 3.428   -39.258 -21.411 1.00 29.04  ? 44   ARG B NH2 1 
ATOM   4612 N  N   . PHE B 1 45  ? -3.637  -37.805 -17.620 1.00 32.07  ? 45   PHE B N   1 
ATOM   4613 C  CA  . PHE B 1 45  ? -4.143  -37.408 -16.309 1.00 28.95  ? 45   PHE B CA  1 
ATOM   4614 C  C   . PHE B 1 45  ? -5.623  -37.044 -16.337 1.00 31.13  ? 45   PHE B C   1 
ATOM   4615 O  O   . PHE B 1 45  ? -6.207  -36.844 -15.278 1.00 33.29  ? 45   PHE B O   1 
ATOM   4616 C  CB  . PHE B 1 45  ? -3.365  -36.234 -15.689 1.00 33.49  ? 45   PHE B CB  1 
ATOM   4617 C  CG  . PHE B 1 45  ? -1.871  -36.401 -15.743 1.00 34.56  ? 45   PHE B CG  1 
ATOM   4618 C  CD1 . PHE B 1 45  ? -1.268  -37.533 -15.210 1.00 31.82  ? 45   PHE B CD1 1 
ATOM   4619 C  CD2 . PHE B 1 45  ? -1.070  -35.427 -16.324 1.00 35.04  ? 45   PHE B CD2 1 
ATOM   4620 C  CE1 . PHE B 1 45  ? 0.111   -37.685 -15.239 1.00 33.18  ? 45   PHE B CE1 1 
ATOM   4621 C  CE2 . PHE B 1 45  ? 0.306   -35.576 -16.364 1.00 35.09  ? 45   PHE B CE2 1 
ATOM   4622 C  CZ  . PHE B 1 45  ? 0.900   -36.707 -15.820 1.00 32.32  ? 45   PHE B CZ  1 
ATOM   4623 N  N   . ARG B 1 46  ? -6.249  -36.958 -17.498 1.00 33.34  ? 46   ARG B N   1 
ATOM   4624 C  CA  A ARG B 1 46  ? -7.635  -36.541 -17.635 0.52 34.55  ? 46   ARG B CA  1 
ATOM   4625 C  CA  B ARG B 1 46  ? -7.635  -36.534 -17.572 0.48 34.53  ? 46   ARG B CA  1 
ATOM   4626 C  C   . ARG B 1 46  ? -8.577  -37.720 -17.383 1.00 33.78  ? 46   ARG B C   1 
ATOM   4627 O  O   . ARG B 1 46  ? -8.193  -38.887 -17.505 1.00 32.86  ? 46   ARG B O   1 
ATOM   4628 C  CB  A ARG B 1 46  ? -7.859  -35.968 -19.043 0.52 37.21  ? 46   ARG B CB  1 
ATOM   4629 C  CB  B ARG B 1 46  ? -7.910  -35.846 -18.910 0.48 37.36  ? 46   ARG B CB  1 
ATOM   4630 C  CG  A ARG B 1 46  ? -8.986  -34.960 -19.162 0.52 43.16  ? 46   ARG B CG  1 
ATOM   4631 C  CG  B ARG B 1 46  ? -8.054  -34.342 -18.786 0.48 40.79  ? 46   ARG B CG  1 
ATOM   4632 C  CD  A ARG B 1 46  ? -9.029  -34.286 -20.534 0.52 44.32  ? 46   ARG B CD  1 
ATOM   4633 C  CD  B ARG B 1 46  ? -7.903  -33.647 -20.123 0.48 43.15  ? 46   ARG B CD  1 
ATOM   4634 N  NE  A ARG B 1 46  ? -7.985  -33.277 -20.716 0.52 44.75  ? 46   ARG B NE  1 
ATOM   4635 N  NE  B ARG B 1 46  ? -8.802  -34.169 -21.148 0.48 45.83  ? 46   ARG B NE  1 
ATOM   4636 C  CZ  A ARG B 1 46  ? -7.786  -32.601 -21.847 0.52 47.15  ? 46   ARG B CZ  1 
ATOM   4637 C  CZ  B ARG B 1 46  ? -10.099 -33.887 -21.229 0.48 47.90  ? 46   ARG B CZ  1 
ATOM   4638 N  NH1 A ARG B 1 46  ? -8.558  -32.826 -22.905 0.52 46.34  ? 46   ARG B NH1 1 
ATOM   4639 N  NH1 B ARG B 1 46  ? -10.668 -33.091 -20.330 0.48 48.21  ? 46   ARG B NH1 1 
ATOM   4640 N  NH2 A ARG B 1 46  ? -6.811  -31.703 -21.926 0.52 45.21  ? 46   ARG B NH2 1 
ATOM   4641 N  NH2 B ARG B 1 46  ? -10.831 -34.409 -22.207 0.48 45.17  ? 46   ARG B NH2 1 
ATOM   4642 N  N   . ARG B 1 47  ? -9.827  -37.402 -17.047 1.00 30.53  ? 47   ARG B N   1 
ATOM   4643 C  CA  . ARG B 1 47  ? -10.848 -38.435 -16.974 1.00 31.62  ? 47   ARG B CA  1 
ATOM   4644 C  C   . ARG B 1 47  ? -10.913 -39.169 -18.309 1.00 33.00  ? 47   ARG B C   1 
ATOM   4645 O  O   . ARG B 1 47  ? -10.664 -38.575 -19.364 1.00 33.31  ? 47   ARG B O   1 
ATOM   4646 C  CB  . ARG B 1 47  ? -12.217 -37.831 -16.661 1.00 33.86  ? 47   ARG B CB  1 
ATOM   4647 C  CG  . ARG B 1 47  ? -12.265 -37.076 -15.353 1.00 38.71  ? 47   ARG B CG  1 
ATOM   4648 C  CD  . ARG B 1 47  ? -13.680 -36.646 -14.987 1.00 43.06  ? 47   ARG B CD  1 
ATOM   4649 N  NE  . ARG B 1 47  ? -13.719 -36.114 -13.627 1.00 51.10  ? 47   ARG B NE  1 
ATOM   4650 C  CZ  . ARG B 1 47  ? -13.431 -34.855 -13.313 1.00 50.98  ? 47   ARG B CZ  1 
ATOM   4651 N  NH1 . ARG B 1 47  ? -13.097 -33.993 -14.268 1.00 47.62  ? 47   ARG B NH1 1 
ATOM   4652 N  NH2 . ARG B 1 47  ? -13.482 -34.457 -12.048 1.00 50.02  ? 47   ARG B NH2 1 
ATOM   4653 N  N   . PRO B 1 48  ? -11.244 -40.456 -18.304 1.00 29.80  ? 48   PRO B N   1 
ATOM   4654 C  CA  . PRO B 1 48  ? -11.419 -41.159 -19.575 1.00 29.95  ? 48   PRO B CA  1 
ATOM   4655 C  C   . PRO B 1 48  ? -12.631 -40.627 -20.323 1.00 31.75  ? 48   PRO B C   1 
ATOM   4656 O  O   . PRO B 1 48  ? -13.590 -40.127 -19.731 1.00 31.17  ? 48   PRO B O   1 
ATOM   4657 C  CB  . PRO B 1 48  ? -11.635 -42.612 -19.154 1.00 27.83  ? 48   PRO B CB  1 
ATOM   4658 C  CG  . PRO B 1 48  ? -12.336 -42.472 -17.780 1.00 26.31  ? 48   PRO B CG  1 
ATOM   4659 C  CD  . PRO B 1 48  ? -11.677 -41.269 -17.146 1.00 26.62  ? 48   PRO B CD  1 
ATOM   4660 N  N   . GLU B 1 49  ? -12.563 -40.723 -21.636 1.00 34.12  ? 49   GLU B N   1 
ATOM   4661 C  CA  . GLU B 1 49  ? -13.703 -40.471 -22.505 1.00 34.32  ? 49   GLU B CA  1 
ATOM   4662 C  C   . GLU B 1 49  ? -14.113 -41.770 -23.186 1.00 28.67  ? 49   GLU B C   1 
ATOM   4663 O  O   . GLU B 1 49  ? -13.251 -42.597 -23.496 1.00 33.14  ? 49   GLU B O   1 
ATOM   4664 C  CB  . GLU B 1 49  ? -13.376 -39.423 -23.577 1.00 36.29  ? 49   GLU B CB  1 
ATOM   4665 C  CG  . GLU B 1 49  ? -13.039 -38.047 -23.023 1.00 37.32  ? 49   GLU B CG  1 
ATOM   4666 C  CD  . GLU B 1 49  ? -14.240 -37.334 -22.447 1.00 43.16  ? 49   GLU B CD  1 
ATOM   4667 O  OE1 . GLU B 1 49  ? -15.379 -37.726 -22.771 1.00 49.42  ? 49   GLU B OE1 1 
ATOM   4668 O  OE2 . GLU B 1 49  ? -14.048 -36.372 -21.676 1.00 46.29  ? 49   GLU B OE2 1 
ATOM   4669 N  N   . PRO B 1 50  ? -15.409 -41.982 -23.430 1.00 33.53  ? 50   PRO B N   1 
ATOM   4670 C  CA  . PRO B 1 50  ? -15.843 -43.225 -24.082 1.00 30.77  ? 50   PRO B CA  1 
ATOM   4671 C  C   . PRO B 1 50  ? -15.159 -43.410 -25.427 1.00 32.38  ? 50   PRO B C   1 
ATOM   4672 O  O   . PRO B 1 50  ? -14.871 -42.445 -26.137 1.00 34.69  ? 50   PRO B O   1 
ATOM   4673 C  CB  . PRO B 1 50  ? -17.355 -43.032 -24.259 1.00 30.55  ? 50   PRO B CB  1 
ATOM   4674 C  CG  . PRO B 1 50  ? -17.735 -41.953 -23.308 1.00 35.19  ? 50   PRO B CG  1 
ATOM   4675 C  CD  . PRO B 1 50  ? -16.537 -41.072 -23.149 1.00 35.28  ? 50   PRO B CD  1 
ATOM   4676 N  N   . LYS B 1 51  ? -14.891 -44.668 -25.769 1.00 28.43  ? 51   LYS B N   1 
ATOM   4677 C  CA  . LYS B 1 51  ? -14.300 -44.971 -27.061 1.00 31.45  ? 51   LYS B CA  1 
ATOM   4678 C  C   . LYS B 1 51  ? -15.262 -44.583 -28.173 1.00 35.39  ? 51   LYS B C   1 
ATOM   4679 O  O   . LYS B 1 51  ? -16.438 -44.956 -28.146 1.00 35.13  ? 51   LYS B O   1 
ATOM   4680 C  CB  . LYS B 1 51  ? -13.967 -46.457 -27.160 1.00 32.88  ? 51   LYS B CB  1 
ATOM   4681 C  CG  . LYS B 1 51  ? -13.562 -46.907 -28.560 1.00 30.40  ? 51   LYS B CG  1 
ATOM   4682 C  CD  . LYS B 1 51  ? -12.170 -46.395 -28.903 1.00 33.84  ? 51   LYS B CD  1 
ATOM   4683 C  CE  . LYS B 1 51  ? -11.703 -46.894 -30.257 1.00 34.41  ? 51   LYS B CE  1 
ATOM   4684 N  NZ  . LYS B 1 51  ? -10.311 -46.454 -30.574 1.00 33.22  ? 51   LYS B NZ  1 
ATOM   4685 N  N   . LYS B 1 52  ? -14.766 -43.832 -29.151 1.00 34.28  ? 52   LYS B N   1 
ATOM   4686 C  CA  . LYS B 1 52  ? -15.624 -43.443 -30.260 1.00 34.11  ? 52   LYS B CA  1 
ATOM   4687 C  C   . LYS B 1 52  ? -15.920 -44.658 -31.135 1.00 31.62  ? 52   LYS B C   1 
ATOM   4688 O  O   . LYS B 1 52  ? -15.026 -45.472 -31.392 1.00 31.85  ? 52   LYS B O   1 
ATOM   4689 C  CB  . LYS B 1 52  ? -14.973 -42.330 -31.074 1.00 36.72  ? 52   LYS B CB  1 
ATOM   4690 C  CG  . LYS B 1 52  ? -15.521 -40.959 -30.701 1.00 43.62  ? 52   LYS B CG  1 
ATOM   4691 C  CD  . LYS B 1 52  ? -14.431 -39.973 -30.312 1.00 47.92  ? 52   LYS B CD  1 
ATOM   4692 C  CE  . LYS B 1 52  ? -13.619 -39.541 -31.512 1.00 49.03  ? 52   LYS B CE  1 
ATOM   4693 N  NZ  . LYS B 1 52  ? -12.560 -38.556 -31.148 1.00 54.56  ? 52   LYS B NZ  1 
ATOM   4694 N  N   . PRO B 1 53  ? -17.164 -44.818 -31.590 1.00 34.87  ? 53   PRO B N   1 
ATOM   4695 C  CA  . PRO B 1 53  ? -17.502 -45.980 -32.417 1.00 35.38  ? 53   PRO B CA  1 
ATOM   4696 C  C   . PRO B 1 53  ? -16.621 -46.057 -33.654 1.00 33.50  ? 53   PRO B C   1 
ATOM   4697 O  O   . PRO B 1 53  ? -16.207 -45.041 -34.213 1.00 35.76  ? 53   PRO B O   1 
ATOM   4698 C  CB  . PRO B 1 53  ? -18.969 -45.736 -32.791 1.00 35.86  ? 53   PRO B CB  1 
ATOM   4699 C  CG  . PRO B 1 53  ? -19.491 -44.877 -31.686 1.00 43.72  ? 53   PRO B CG  1 
ATOM   4700 C  CD  . PRO B 1 53  ? -18.341 -43.988 -31.290 1.00 39.89  ? 53   PRO B CD  1 
ATOM   4701 N  N   . TRP B 1 54  ? -16.327 -47.285 -34.068 1.00 33.22  ? 54   TRP B N   1 
ATOM   4702 C  CA  . TRP B 1 54  ? -15.475 -47.549 -35.216 1.00 37.11  ? 54   TRP B CA  1 
ATOM   4703 C  C   . TRP B 1 54  ? -16.273 -48.264 -36.301 1.00 37.69  ? 54   TRP B C   1 
ATOM   4704 O  O   . TRP B 1 54  ? -17.251 -48.969 -36.023 1.00 34.47  ? 54   TRP B O   1 
ATOM   4705 C  CB  . TRP B 1 54  ? -14.252 -48.393 -34.821 1.00 33.04  ? 54   TRP B CB  1 
ATOM   4706 C  CG  . TRP B 1 54  ? -14.620 -49.734 -34.250 1.00 38.04  ? 54   TRP B CG  1 
ATOM   4707 C  CD1 . TRP B 1 54  ? -14.793 -50.903 -34.937 1.00 35.50  ? 54   TRP B CD1 1 
ATOM   4708 C  CD2 . TRP B 1 54  ? -14.866 -50.040 -32.871 1.00 30.79  ? 54   TRP B CD2 1 
ATOM   4709 N  NE1 . TRP B 1 54  ? -15.136 -51.918 -34.072 1.00 30.72  ? 54   TRP B NE1 1 
ATOM   4710 C  CE2 . TRP B 1 54  ? -15.183 -51.415 -32.797 1.00 32.59  ? 54   TRP B CE2 1 
ATOM   4711 C  CE3 . TRP B 1 54  ? -14.847 -49.286 -31.694 1.00 34.11  ? 54   TRP B CE3 1 
ATOM   4712 C  CZ2 . TRP B 1 54  ? -15.486 -52.054 -31.586 1.00 31.17  ? 54   TRP B CZ2 1 
ATOM   4713 C  CZ3 . TRP B 1 54  ? -15.143 -49.926 -30.481 1.00 31.41  ? 54   TRP B CZ3 1 
ATOM   4714 C  CH2 . TRP B 1 54  ? -15.456 -51.293 -30.442 1.00 27.56  ? 54   TRP B CH2 1 
ATOM   4715 N  N   . SER B 1 55  ? -15.862 -48.056 -37.543 1.00 40.66  ? 55   SER B N   1 
ATOM   4716 C  CA  . SER B 1 55  ? -16.399 -48.835 -38.644 1.00 35.94  ? 55   SER B CA  1 
ATOM   4717 C  C   . SER B 1 55  ? -15.537 -50.073 -38.835 1.00 36.38  ? 55   SER B C   1 
ATOM   4718 O  O   . SER B 1 55  ? -14.417 -50.155 -38.333 1.00 37.51  ? 55   SER B O   1 
ATOM   4719 C  CB  . SER B 1 55  ? -16.428 -48.007 -39.924 1.00 42.78  ? 55   SER B CB  1 
ATOM   4720 O  OG  . SER B 1 55  ? -15.248 -47.238 -40.024 1.00 45.64  ? 55   SER B OG  1 
ATOM   4721 N  N   . GLY B 1 56  ? -16.061 -51.036 -39.576 1.00 36.77  ? 56   GLY B N   1 
ATOM   4722 C  CA  . GLY B 1 56  ? -15.320 -52.255 -39.786 1.00 34.91  ? 56   GLY B CA  1 
ATOM   4723 C  C   . GLY B 1 56  ? -15.401 -53.164 -38.574 1.00 35.24  ? 56   GLY B C   1 
ATOM   4724 O  O   . GLY B 1 56  ? -16.213 -52.979 -37.661 1.00 33.63  ? 56   GLY B O   1 
ATOM   4725 N  N   . VAL B 1 57  ? -14.530 -54.168 -38.578 1.00 33.12  ? 57   VAL B N   1 
ATOM   4726 C  CA  . VAL B 1 57  ? -14.520 -55.223 -37.571 1.00 34.75  ? 57   VAL B CA  1 
ATOM   4727 C  C   . VAL B 1 57  ? -13.246 -55.098 -36.746 1.00 34.75  ? 57   VAL B C   1 
ATOM   4728 O  O   . VAL B 1 57  ? -12.133 -55.226 -37.276 1.00 27.73  ? 57   VAL B O   1 
ATOM   4729 C  CB  . VAL B 1 57  ? -14.622 -56.612 -38.215 1.00 35.14  ? 57   VAL B CB  1 
ATOM   4730 C  CG1 . VAL B 1 57  ? -14.753 -57.669 -37.145 1.00 30.41  ? 57   VAL B CG1 1 
ATOM   4731 C  CG2 . VAL B 1 57  ? -15.801 -56.673 -39.184 1.00 35.06  ? 57   VAL B CG2 1 
ATOM   4732 N  N   . TRP B 1 58  ? -13.403 -54.871 -35.443 1.00 30.02  ? 58   TRP B N   1 
ATOM   4733 C  CA  . TRP B 1 58  ? -12.244 -54.833 -34.557 1.00 31.99  ? 58   TRP B CA  1 
ATOM   4734 C  C   . TRP B 1 58  ? -11.706 -56.249 -34.371 1.00 29.55  ? 58   TRP B C   1 
ATOM   4735 O  O   . TRP B 1 58  ? -12.448 -57.156 -33.982 1.00 31.11  ? 58   TRP B O   1 
ATOM   4736 C  CB  . TRP B 1 58  ? -12.617 -54.211 -33.212 1.00 29.34  ? 58   TRP B CB  1 
ATOM   4737 C  CG  . TRP B 1 58  ? -11.415 -53.855 -32.383 1.00 28.34  ? 58   TRP B CG  1 
ATOM   4738 C  CD1 . TRP B 1 58  ? -10.664 -54.704 -31.637 1.00 27.82  ? 58   TRP B CD1 1 
ATOM   4739 C  CD2 . TRP B 1 58  ? -10.829 -52.557 -32.234 1.00 27.57  ? 58   TRP B CD2 1 
ATOM   4740 N  NE1 . TRP B 1 58  ? -9.633  -54.019 -31.031 1.00 35.36  ? 58   TRP B NE1 1 
ATOM   4741 C  CE2 . TRP B 1 58  ? -9.712  -52.698 -31.386 1.00 31.77  ? 58   TRP B CE2 1 
ATOM   4742 C  CE3 . TRP B 1 58  ? -11.133 -51.291 -32.745 1.00 32.48  ? 58   TRP B CE3 1 
ATOM   4743 C  CZ2 . TRP B 1 58  ? -8.906  -51.621 -31.028 1.00 30.85  ? 58   TRP B CZ2 1 
ATOM   4744 C  CZ3 . TRP B 1 58  ? -10.324 -50.218 -32.388 1.00 32.55  ? 58   TRP B CZ3 1 
ATOM   4745 C  CH2 . TRP B 1 58  ? -9.228  -50.392 -31.535 1.00 33.68  ? 58   TRP B CH2 1 
ATOM   4746 N  N   . ASN B 1 59  ? -10.431 -56.452 -34.677 1.00 26.52  ? 59   ASN B N   1 
ATOM   4747 C  CA  . ASN B 1 59  ? -9.811  -57.762 -34.507 1.00 28.50  ? 59   ASN B CA  1 
ATOM   4748 C  C   . ASN B 1 59  ? -9.512  -57.949 -33.023 1.00 30.32  ? 59   ASN B C   1 
ATOM   4749 O  O   . ASN B 1 59  ? -8.568  -57.353 -32.498 1.00 33.36  ? 59   ASN B O   1 
ATOM   4750 C  CB  . ASN B 1 59  ? -8.536  -57.890 -35.336 1.00 33.11  ? 59   ASN B CB  1 
ATOM   4751 C  CG  . ASN B 1 59  ? -8.013  -59.317 -35.375 1.00 40.18  ? 59   ASN B CG  1 
ATOM   4752 O  OD1 . ASN B 1 59  ? -8.193  -60.076 -34.426 1.00 37.50  ? 59   ASN B OD1 1 
ATOM   4753 N  ND2 . ASN B 1 59  ? -7.369  -59.693 -36.475 1.00 39.38  ? 59   ASN B ND2 1 
ATOM   4754 N  N   . ALA B 1 60  ? -10.305 -58.776 -32.355 1.00 28.68  ? 60   ALA B N   1 
ATOM   4755 C  CA  . ALA B 1 60  ? -10.168 -59.026 -30.920 1.00 26.47  ? 60   ALA B CA  1 
ATOM   4756 C  C   . ALA B 1 60  ? -9.579  -60.409 -30.663 1.00 29.75  ? 60   ALA B C   1 
ATOM   4757 O  O   . ALA B 1 60  ? -10.031 -61.156 -29.793 1.00 27.57  ? 60   ALA B O   1 
ATOM   4758 C  CB  . ALA B 1 60  ? -11.513 -58.872 -30.216 1.00 25.36  ? 60   ALA B CB  1 
ATOM   4759 N  N   . SER B 1 61  ? -8.562  -60.772 -31.432 1.00 30.45  ? 61   SER B N   1 
ATOM   4760 C  CA  . SER B 1 61  ? -7.938  -62.076 -31.299 1.00 32.41  ? 61   SER B CA  1 
ATOM   4761 C  C   . SER B 1 61  ? -6.644  -62.012 -30.503 1.00 28.86  ? 61   SER B C   1 
ATOM   4762 O  O   . SER B 1 61  ? -6.021  -63.050 -30.271 1.00 31.59  ? 61   SER B O   1 
ATOM   4763 C  CB  . SER B 1 61  ? -7.660  -62.666 -32.684 1.00 36.73  ? 61   SER B CB  1 
ATOM   4764 O  OG  . SER B 1 61  ? -6.578  -61.974 -33.281 1.00 39.39  ? 61   SER B OG  1 
ATOM   4765 N  N   . THR B 1 62  ? -6.238  -60.820 -30.080 1.00 26.47  ? 62   THR B N   1 
ATOM   4766 C  CA  . THR B 1 62  ? -4.909  -60.569 -29.542 1.00 31.67  ? 62   THR B CA  1 
ATOM   4767 C  C   . THR B 1 62  ? -5.012  -59.714 -28.284 1.00 27.47  ? 62   THR B C   1 
ATOM   4768 O  O   . THR B 1 62  ? -5.828  -58.792 -28.221 1.00 27.39  ? 62   THR B O   1 
ATOM   4769 C  CB  . THR B 1 62  ? -4.059  -59.883 -30.632 1.00 32.28  ? 62   THR B CB  1 
ATOM   4770 O  OG1 . THR B 1 62  ? -3.547  -60.880 -31.523 1.00 42.08  ? 62   THR B OG1 1 
ATOM   4771 C  CG2 . THR B 1 62  ? -2.937  -59.077 -30.066 1.00 33.29  ? 62   THR B CG2 1 
ATOM   4772 N  N   . TYR B 1 63  ? -4.190  -60.023 -27.278 1.00 29.01  ? 63   TYR B N   1 
ATOM   4773 C  CA  . TYR B 1 63  ? -4.174  -59.215 -26.069 1.00 28.35  ? 63   TYR B CA  1 
ATOM   4774 C  C   . TYR B 1 63  ? -3.772  -57.776 -26.401 1.00 27.10  ? 63   TYR B C   1 
ATOM   4775 O  O   . TYR B 1 63  ? -2.970  -57.541 -27.306 1.00 31.97  ? 63   TYR B O   1 
ATOM   4776 C  CB  . TYR B 1 63  ? -3.185  -59.794 -25.053 1.00 27.86  ? 63   TYR B CB  1 
ATOM   4777 C  CG  . TYR B 1 63  ? -3.739  -60.824 -24.099 1.00 26.76  ? 63   TYR B CG  1 
ATOM   4778 C  CD1 . TYR B 1 63  ? -5.026  -60.715 -23.571 1.00 27.63  ? 63   TYR B CD1 1 
ATOM   4779 C  CD2 . TYR B 1 63  ? -2.958  -61.898 -23.702 1.00 34.15  ? 63   TYR B CD2 1 
ATOM   4780 C  CE1 . TYR B 1 63  ? -5.509  -61.662 -22.670 1.00 33.07  ? 63   TYR B CE1 1 
ATOM   4781 C  CE2 . TYR B 1 63  ? -3.429  -62.842 -22.807 1.00 34.92  ? 63   TYR B CE2 1 
ATOM   4782 C  CZ  . TYR B 1 63  ? -4.695  -62.724 -22.296 1.00 33.07  ? 63   TYR B CZ  1 
ATOM   4783 O  OH  . TYR B 1 63  ? -5.146  -63.677 -21.408 1.00 36.88  ? 63   TYR B OH  1 
ATOM   4784 N  N   . PRO B 1 64  ? -4.276  -56.796 -25.661 1.00 27.80  ? 64   PRO B N   1 
ATOM   4785 C  CA  . PRO B 1 64  ? -3.879  -55.401 -25.888 1.00 27.24  ? 64   PRO B CA  1 
ATOM   4786 C  C   . PRO B 1 64  ? -2.512  -55.099 -25.276 1.00 29.41  ? 64   PRO B C   1 
ATOM   4787 O  O   . PRO B 1 64  ? -1.892  -55.946 -24.638 1.00 27.22  ? 64   PRO B O   1 
ATOM   4788 C  CB  . PRO B 1 64  ? -4.976  -54.623 -25.178 1.00 24.55  ? 64   PRO B CB  1 
ATOM   4789 C  CG  . PRO B 1 64  ? -5.305  -55.517 -23.993 1.00 25.87  ? 64   PRO B CG  1 
ATOM   4790 C  CD  . PRO B 1 64  ? -5.228  -56.924 -24.542 1.00 27.49  ? 64   PRO B CD  1 
ATOM   4791 N  N   . ASN B 1 65  ? -2.052  -53.862 -25.486 1.00 25.36  ? 65   ASN B N   1 
ATOM   4792 C  CA  . ASN B 1 65  ? -0.926  -53.331 -24.725 1.00 25.89  ? 65   ASN B CA  1 
ATOM   4793 C  C   . ASN B 1 65  ? -1.263  -53.286 -23.238 1.00 24.65  ? 65   ASN B C   1 
ATOM   4794 O  O   . ASN B 1 65  ? -2.431  -53.217 -22.846 1.00 24.00  ? 65   ASN B O   1 
ATOM   4795 C  CB  . ASN B 1 65  ? -0.587  -51.907 -25.157 1.00 26.53  ? 65   ASN B CB  1 
ATOM   4796 C  CG  . ASN B 1 65  ? -0.242  -51.802 -26.616 1.00 35.92  ? 65   ASN B CG  1 
ATOM   4797 O  OD1 . ASN B 1 65  ? 0.608   -52.543 -27.116 1.00 32.63  ? 65   ASN B OD1 1 
ATOM   4798 N  ND2 . ASN B 1 65  ? -0.892  -50.868 -27.313 1.00 36.06  ? 65   ASN B ND2 1 
ATOM   4799 N  N   . ASN B 1 66  ? -0.219  -53.274 -22.411 1.00 24.98  ? 66   ASN B N   1 
ATOM   4800 C  CA  . ASN B 1 66  ? -0.351  -53.020 -20.979 1.00 27.16  ? 66   ASN B CA  1 
ATOM   4801 C  C   . ASN B 1 66  ? -0.080  -51.544 -20.699 1.00 26.94  ? 66   ASN B C   1 
ATOM   4802 O  O   . ASN B 1 66  ? 0.627   -50.877 -21.455 1.00 27.36  ? 66   ASN B O   1 
ATOM   4803 C  CB  . ASN B 1 66  ? 0.624   -53.881 -20.168 1.00 22.76  ? 66   ASN B CB  1 
ATOM   4804 C  CG  . ASN B 1 66  ? 0.501   -55.353 -20.464 1.00 24.00  ? 66   ASN B CG  1 
ATOM   4805 O  OD1 . ASN B 1 66  ? 1.501   -56.065 -20.547 1.00 25.33  ? 66   ASN B OD1 1 
ATOM   4806 N  ND2 . ASN B 1 66  ? -0.727  -55.830 -20.595 1.00 23.06  ? 66   ASN B ND2 1 
ATOM   4807 N  N   . CYS B 1 67  ? -0.636  -51.038 -19.595 1.00 22.60  ? 67   CYS B N   1 
ATOM   4808 C  CA  . CYS B 1 67  ? -0.423  -49.636 -19.259 1.00 22.37  ? 67   CYS B CA  1 
ATOM   4809 C  C   . CYS B 1 67  ? 1.025   -49.396 -18.819 1.00 25.42  ? 67   CYS B C   1 
ATOM   4810 O  O   . CYS B 1 67  ? 1.731   -50.311 -18.392 1.00 24.92  ? 67   CYS B O   1 
ATOM   4811 C  CB  . CYS B 1 67  ? -1.401  -49.184 -18.171 1.00 26.28  ? 67   CYS B CB  1 
ATOM   4812 S  SG  . CYS B 1 67  ? -3.145  -49.196 -18.705 1.00 26.14  ? 67   CYS B SG  1 
ATOM   4813 N  N   . GLN B 1 68  ? 1.467   -48.139 -18.942 1.00 22.74  ? 68   GLN B N   1 
ATOM   4814 C  CA  . GLN B 1 68  ? 2.828   -47.769 -18.564 1.00 24.94  ? 68   GLN B CA  1 
ATOM   4815 C  C   . GLN B 1 68  ? 3.023   -47.938 -17.062 1.00 23.11  ? 68   GLN B C   1 
ATOM   4816 O  O   . GLN B 1 68  ? 2.227   -47.436 -16.261 1.00 26.29  ? 68   GLN B O   1 
ATOM   4817 C  CB  . GLN B 1 68  ? 3.120   -46.324 -18.961 1.00 26.68  ? 68   GLN B CB  1 
ATOM   4818 C  CG  . GLN B 1 68  ? 3.240   -46.103 -20.485 1.00 28.21  ? 68   GLN B CG  1 
ATOM   4819 C  CD  . GLN B 1 68  ? 4.595   -46.536 -21.037 1.00 34.66  ? 68   GLN B CD  1 
ATOM   4820 O  OE1 . GLN B 1 68  ? 5.486   -46.955 -20.290 1.00 31.19  ? 68   GLN B OE1 1 
ATOM   4821 N  NE2 . GLN B 1 68  ? 4.752   -46.437 -22.351 1.00 33.45  ? 68   GLN B NE2 1 
ATOM   4822 N  N   . GLN B 1 69  ? 4.089   -48.631 -16.677 1.00 23.44  ? 69   GLN B N   1 
ATOM   4823 C  CA  . GLN B 1 69  ? 4.286   -48.911 -15.264 1.00 22.57  ? 69   GLN B CA  1 
ATOM   4824 C  C   . GLN B 1 69  ? 5.736   -49.263 -14.978 1.00 24.30  ? 69   GLN B C   1 
ATOM   4825 O  O   . GLN B 1 69  ? 6.486   -49.703 -15.854 1.00 26.85  ? 69   GLN B O   1 
ATOM   4826 C  CB  . GLN B 1 69  ? 3.395   -50.059 -14.798 1.00 23.74  ? 69   GLN B CB  1 
ATOM   4827 C  CG  . GLN B 1 69  ? 3.698   -51.351 -15.512 1.00 24.24  ? 69   GLN B CG  1 
ATOM   4828 C  CD  . GLN B 1 69  ? 2.582   -52.354 -15.375 1.00 25.79  ? 69   GLN B CD  1 
ATOM   4829 O  OE1 . GLN B 1 69  ? 2.620   -53.218 -14.492 1.00 26.42  ? 69   GLN B OE1 1 
ATOM   4830 N  NE2 . GLN B 1 69  ? 1.572   -52.246 -16.243 1.00 23.42  ? 69   GLN B NE2 1 
ATOM   4831 N  N   . TYR B 1 70  ? 6.095   -49.090 -13.713 1.00 23.67  ? 70   TYR B N   1 
ATOM   4832 C  CA  . TYR B 1 70  ? 7.334   -49.636 -13.176 1.00 27.57  ? 70   TYR B CA  1 
ATOM   4833 C  C   . TYR B 1 70  ? 7.419   -51.127 -13.476 1.00 28.90  ? 70   TYR B C   1 
ATOM   4834 O  O   . TYR B 1 70  ? 6.439   -51.859 -13.320 1.00 31.50  ? 70   TYR B O   1 
ATOM   4835 C  CB  . TYR B 1 70  ? 7.377   -49.385 -11.665 1.00 26.58  ? 70   TYR B CB  1 
ATOM   4836 C  CG  . TYR B 1 70  ? 8.555   -50.031 -10.969 1.00 27.89  ? 70   TYR B CG  1 
ATOM   4837 C  CD1 . TYR B 1 70  ? 9.770   -49.372 -10.872 1.00 29.10  ? 70   TYR B CD1 1 
ATOM   4838 C  CD2 . TYR B 1 70  ? 8.449   -51.302 -10.417 1.00 26.63  ? 70   TYR B CD2 1 
ATOM   4839 C  CE1 . TYR B 1 70  ? 10.854  -49.957 -10.242 1.00 32.39  ? 70   TYR B CE1 1 
ATOM   4840 C  CE2 . TYR B 1 70  ? 9.524   -51.899 -9.788  1.00 30.11  ? 70   TYR B CE2 1 
ATOM   4841 C  CZ  . TYR B 1 70  ? 10.725  -51.224 -9.707  1.00 33.43  ? 70   TYR B CZ  1 
ATOM   4842 O  OH  . TYR B 1 70  ? 11.802  -51.809 -9.073  1.00 37.54  ? 70   TYR B OH  1 
ATOM   4843 N  N   . VAL B 1 71  ? 8.587   -51.575 -13.928 1.00 23.59  ? 71   VAL B N   1 
ATOM   4844 C  CA  . VAL B 1 71  ? 8.837   -52.983 -14.223 1.00 24.26  ? 71   VAL B CA  1 
ATOM   4845 C  C   . VAL B 1 71  ? 9.867   -53.495 -13.217 1.00 30.08  ? 71   VAL B C   1 
ATOM   4846 O  O   . VAL B 1 71  ? 10.922  -52.875 -13.031 1.00 28.17  ? 71   VAL B O   1 
ATOM   4847 C  CB  . VAL B 1 71  ? 9.323   -53.182 -15.670 1.00 25.28  ? 71   VAL B CB  1 
ATOM   4848 C  CG1 . VAL B 1 71  ? 9.692   -54.636 -15.910 1.00 27.84  ? 71   VAL B CG1 1 
ATOM   4849 C  CG2 . VAL B 1 71  ? 8.257   -52.721 -16.697 1.00 26.43  ? 71   VAL B CG2 1 
ATOM   4850 N  N   . ASP B 1 72  ? 9.565   -54.626 -12.572 1.00 25.36  ? 72   ASP B N   1 
ATOM   4851 C  CA  . ASP B 1 72  ? 10.425  -55.184 -11.525 1.00 25.60  ? 72   ASP B CA  1 
ATOM   4852 C  C   . ASP B 1 72  ? 11.599  -55.948 -12.139 1.00 24.63  ? 72   ASP B C   1 
ATOM   4853 O  O   . ASP B 1 72  ? 11.402  -56.946 -12.841 1.00 27.31  ? 72   ASP B O   1 
ATOM   4854 C  CB  . ASP B 1 72  ? 9.589   -56.097 -10.628 1.00 28.73  ? 72   ASP B CB  1 
ATOM   4855 C  CG  . ASP B 1 72  ? 10.426  -56.951 -9.696  1.00 25.69  ? 72   ASP B CG  1 
ATOM   4856 O  OD1 . ASP B 1 72  ? 11.547  -56.535 -9.313  1.00 24.72  ? 72   ASP B OD1 1 
ATOM   4857 O  OD2 . ASP B 1 72  ? 9.927   -58.037 -9.329  1.00 26.17  ? 72   ASP B OD2 1 
ATOM   4858 N  N   . GLU B 1 73  ? 12.822  -55.486 -11.876 1.00 24.46  ? 73   GLU B N   1 
ATOM   4859 C  CA  A GLU B 1 73  ? 14.036  -56.128 -12.362 0.61 28.43  ? 73   GLU B CA  1 
ATOM   4860 C  CA  B GLU B 1 73  ? 14.013  -56.176 -12.367 0.39 28.43  ? 73   GLU B CA  1 
ATOM   4861 C  C   . GLU B 1 73  ? 14.874  -56.710 -11.227 1.00 28.58  ? 73   GLU B C   1 
ATOM   4862 O  O   . GLU B 1 73  ? 16.078  -56.941 -11.403 1.00 27.76  ? 73   GLU B O   1 
ATOM   4863 C  CB  A GLU B 1 73  ? 14.857  -55.131 -13.185 0.61 29.68  ? 73   GLU B CB  1 
ATOM   4864 C  CB  B GLU B 1 73  ? 14.829  -55.260 -13.280 0.39 29.80  ? 73   GLU B CB  1 
ATOM   4865 C  CG  A GLU B 1 73  ? 14.009  -54.350 -14.195 0.61 29.15  ? 73   GLU B CG  1 
ATOM   4866 C  CG  B GLU B 1 73  ? 14.241  -55.128 -14.685 0.39 29.41  ? 73   GLU B CG  1 
ATOM   4867 C  CD  A GLU B 1 73  ? 14.830  -53.649 -15.269 0.61 35.20  ? 73   GLU B CD  1 
ATOM   4868 C  CD  B GLU B 1 73  ? 14.124  -56.462 -15.409 0.39 33.37  ? 73   GLU B CD  1 
ATOM   4869 O  OE1 A GLU B 1 73  ? 15.267  -54.330 -16.216 0.61 40.21  ? 73   GLU B OE1 1 
ATOM   4870 O  OE1 B GLU B 1 73  ? 15.165  -57.013 -15.835 0.39 36.07  ? 73   GLU B OE1 1 
ATOM   4871 O  OE2 A GLU B 1 73  ? 15.009  -52.416 -15.185 0.61 31.27  ? 73   GLU B OE2 1 
ATOM   4872 O  OE2 B GLU B 1 73  ? 12.985  -56.955 -15.572 0.39 31.92  ? 73   GLU B OE2 1 
ATOM   4873 N  N   . GLN B 1 74  ? 14.270  -56.952 -10.065 1.00 24.49  ? 74   GLN B N   1 
ATOM   4874 C  CA  . GLN B 1 74  ? 15.045  -57.416 -8.924  1.00 23.23  ? 74   GLN B CA  1 
ATOM   4875 C  C   . GLN B 1 74  ? 15.637  -58.796 -9.163  1.00 28.74  ? 74   GLN B C   1 
ATOM   4876 O  O   . GLN B 1 74  ? 16.797  -59.051 -8.808  1.00 30.62  ? 74   GLN B O   1 
ATOM   4877 C  CB  . GLN B 1 74  ? 14.177  -57.425 -7.665  1.00 28.26  ? 74   GLN B CB  1 
ATOM   4878 C  CG  . GLN B 1 74  ? 14.985  -57.781 -6.433  1.00 30.06  ? 74   GLN B CG  1 
ATOM   4879 C  CD  . GLN B 1 74  ? 15.984  -56.696 -6.087  1.00 37.17  ? 74   GLN B CD  1 
ATOM   4880 O  OE1 . GLN B 1 74  ? 15.657  -55.511 -6.101  1.00 40.78  ? 74   GLN B OE1 1 
ATOM   4881 N  NE2 . GLN B 1 74  ? 17.219  -57.097 -5.778  1.00 35.35  ? 74   GLN B NE2 1 
ATOM   4882 N  N   . PHE B 1 75  ? 14.854  -59.706 -9.748  1.00 22.88  ? 75   PHE B N   1 
ATOM   4883 C  CA  . PHE B 1 75  ? 15.285  -61.069 -10.046 1.00 27.44  ? 75   PHE B CA  1 
ATOM   4884 C  C   . PHE B 1 75  ? 15.099  -61.313 -11.541 1.00 26.60  ? 75   PHE B C   1 
ATOM   4885 O  O   . PHE B 1 75  ? 14.152  -61.994 -11.963 1.00 26.21  ? 75   PHE B O   1 
ATOM   4886 C  CB  . PHE B 1 75  ? 14.522  -62.086 -9.203  1.00 27.68  ? 75   PHE B CB  1 
ATOM   4887 C  CG  . PHE B 1 75  ? 14.537  -61.778 -7.724  1.00 26.22  ? 75   PHE B CG  1 
ATOM   4888 C  CD1 . PHE B 1 75  ? 15.694  -61.943 -6.982  1.00 26.58  ? 75   PHE B CD1 1 
ATOM   4889 C  CD2 . PHE B 1 75  ? 13.394  -61.318 -7.083  1.00 26.62  ? 75   PHE B CD2 1 
ATOM   4890 C  CE1 . PHE B 1 75  ? 15.713  -61.668 -5.621  1.00 33.55  ? 75   PHE B CE1 1 
ATOM   4891 C  CE2 . PHE B 1 75  ? 13.401  -61.036 -5.722  1.00 28.24  ? 75   PHE B CE2 1 
ATOM   4892 C  CZ  . PHE B 1 75  ? 14.569  -61.209 -4.988  1.00 28.23  ? 75   PHE B CZ  1 
ATOM   4893 N  N   . PRO B 1 76  ? 16.000  -60.790 -12.369 1.00 30.01  ? 76   PRO B N   1 
ATOM   4894 C  CA  . PRO B 1 76  ? 15.818  -60.895 -13.825 1.00 28.98  ? 76   PRO B CA  1 
ATOM   4895 C  C   . PRO B 1 76  ? 15.679  -62.346 -14.262 1.00 27.36  ? 76   PRO B C   1 
ATOM   4896 O  O   . PRO B 1 76  ? 16.497  -63.196 -13.912 1.00 31.63  ? 76   PRO B O   1 
ATOM   4897 C  CB  . PRO B 1 76  ? 17.091  -60.253 -14.387 1.00 32.90  ? 76   PRO B CB  1 
ATOM   4898 C  CG  . PRO B 1 76  ? 17.608  -59.378 -13.290 1.00 32.14  ? 76   PRO B CG  1 
ATOM   4899 C  CD  . PRO B 1 76  ? 17.238  -60.081 -12.006 1.00 30.85  ? 76   PRO B CD  1 
ATOM   4900 N  N   . GLY B 1 77  ? 14.609  -62.632 -15.004 1.00 32.86  ? 77   GLY B N   1 
ATOM   4901 C  CA  . GLY B 1 77  ? 14.367  -63.966 -15.516 1.00 32.74  ? 77   GLY B CA  1 
ATOM   4902 C  C   . GLY B 1 77  ? 13.714  -64.934 -14.553 1.00 33.05  ? 77   GLY B C   1 
ATOM   4903 O  O   . GLY B 1 77  ? 13.347  -66.040 -14.971 1.00 29.92  ? 77   GLY B O   1 
ATOM   4904 N  N   . PHE B 1 78  ? 13.540  -64.562 -13.282 1.00 28.77  ? 78   PHE B N   1 
ATOM   4905 C  CA  . PHE B 1 78  ? 12.945  -65.453 -12.293 1.00 26.98  ? 78   PHE B CA  1 
ATOM   4906 C  C   . PHE B 1 78  ? 11.434  -65.494 -12.477 1.00 27.66  ? 78   PHE B C   1 
ATOM   4907 O  O   . PHE B 1 78  ? 10.778  -64.450 -12.456 1.00 28.24  ? 78   PHE B O   1 
ATOM   4908 C  CB  . PHE B 1 78  ? 13.301  -64.976 -10.886 1.00 29.58  ? 78   PHE B CB  1 
ATOM   4909 C  CG  . PHE B 1 78  ? 12.797  -65.873 -9.794  1.00 29.69  ? 78   PHE B CG  1 
ATOM   4910 C  CD1 . PHE B 1 78  ? 13.140  -67.215 -9.771  1.00 30.23  ? 78   PHE B CD1 1 
ATOM   4911 C  CD2 . PHE B 1 78  ? 11.972  -65.373 -8.793  1.00 26.90  ? 78   PHE B CD2 1 
ATOM   4912 C  CE1 . PHE B 1 78  ? 12.682  -68.051 -8.760  1.00 34.90  ? 78   PHE B CE1 1 
ATOM   4913 C  CE2 . PHE B 1 78  ? 11.506  -66.200 -7.782  1.00 28.52  ? 78   PHE B CE2 1 
ATOM   4914 C  CZ  . PHE B 1 78  ? 11.859  -67.543 -7.761  1.00 31.51  ? 78   PHE B CZ  1 
ATOM   4915 N  N   . SER B 1 79  ? 10.878  -66.695 -12.656 1.00 26.75  ? 79   SER B N   1 
ATOM   4916 C  CA  . SER B 1 79  ? 9.463   -66.794 -13.005 1.00 28.79  ? 79   SER B CA  1 
ATOM   4917 C  C   . SER B 1 79  ? 8.567   -66.205 -11.921 1.00 30.18  ? 79   SER B C   1 
ATOM   4918 O  O   . SER B 1 79  ? 7.529   -65.608 -12.235 1.00 25.38  ? 79   SER B O   1 
ATOM   4919 C  CB  . SER B 1 79  ? 9.081   -68.250 -13.260 1.00 30.24  ? 79   SER B CB  1 
ATOM   4920 O  OG  . SER B 1 79  ? 9.197   -69.009 -12.069 1.00 31.75  ? 79   SER B OG  1 
ATOM   4921 N  N   . GLY B 1 80  ? 8.958   -66.347 -10.650 1.00 28.73  ? 80   GLY B N   1 
ATOM   4922 C  CA  . GLY B 1 80  ? 8.102   -65.915 -9.555  1.00 29.96  ? 80   GLY B CA  1 
ATOM   4923 C  C   . GLY B 1 80  ? 7.857   -64.421 -9.520  1.00 27.32  ? 80   GLY B C   1 
ATOM   4924 O  O   . GLY B 1 80  ? 6.802   -63.976 -9.063  1.00 26.55  ? 80   GLY B O   1 
ATOM   4925 N  N   . SER B 1 81  ? 8.818   -63.627 -9.985  1.00 23.90  ? 81   SER B N   1 
ATOM   4926 C  CA  . SER B 1 81  ? 8.623   -62.186 -10.112 1.00 23.09  ? 81   SER B CA  1 
ATOM   4927 C  C   . SER B 1 81  ? 8.219   -61.778 -11.522 1.00 25.34  ? 81   SER B C   1 
ATOM   4928 O  O   . SER B 1 81  ? 7.380   -60.886 -11.684 1.00 22.80  ? 81   SER B O   1 
ATOM   4929 C  CB  . SER B 1 81  ? 9.894   -61.432 -9.716  1.00 24.78  ? 81   SER B CB  1 
ATOM   4930 O  OG  . SER B 1 81  ? 11.025  -61.903 -10.440 1.00 29.37  ? 81   SER B OG  1 
ATOM   4931 N  N   . GLU B 1 82  ? 8.798   -62.416 -12.546 1.00 24.33  ? 82   GLU B N   1 
ATOM   4932 C  CA  . GLU B 1 82  ? 8.459   -62.049 -13.923 1.00 25.98  ? 82   GLU B CA  1 
ATOM   4933 C  C   . GLU B 1 82  ? 6.990   -62.293 -14.239 1.00 27.67  ? 82   GLU B C   1 
ATOM   4934 O  O   . GLU B 1 82  ? 6.427   -61.615 -15.106 1.00 29.38  ? 82   GLU B O   1 
ATOM   4935 C  CB  . GLU B 1 82  ? 9.330   -62.816 -14.920 1.00 29.02  ? 82   GLU B CB  1 
ATOM   4936 C  CG  . GLU B 1 82  ? 10.820  -62.524 -14.829 1.00 31.45  ? 82   GLU B CG  1 
ATOM   4937 C  CD  . GLU B 1 82  ? 11.203  -61.166 -15.381 1.00 36.96  ? 82   GLU B CD  1 
ATOM   4938 O  OE1 . GLU B 1 82  ? 10.294  -60.387 -15.752 1.00 38.60  ? 82   GLU B OE1 1 
ATOM   4939 O  OE2 . GLU B 1 82  ? 12.421  -60.883 -15.438 1.00 34.41  ? 82   GLU B OE2 1 
ATOM   4940 N  N   . MET B 1 83  ? 6.349   -63.252 -13.561 1.00 26.49  ? 83   MET B N   1 
ATOM   4941 C  CA  . MET B 1 83  ? 4.951   -63.565 -13.858 1.00 25.24  ? 83   MET B CA  1 
ATOM   4942 C  C   . MET B 1 83  ? 4.019   -62.388 -13.587 1.00 27.05  ? 83   MET B C   1 
ATOM   4943 O  O   . MET B 1 83  ? 2.886   -62.391 -14.078 1.00 29.28  ? 83   MET B O   1 
ATOM   4944 C  CB  . MET B 1 83  ? 4.485   -64.778 -13.047 1.00 27.13  ? 83   MET B CB  1 
ATOM   4945 C  CG  . MET B 1 83  ? 4.396   -64.515 -11.551 1.00 28.23  ? 83   MET B CG  1 
ATOM   4946 S  SD  . MET B 1 83  ? 3.651   -65.870 -10.608 1.00 35.02  ? 83   MET B SD  1 
ATOM   4947 C  CE  . MET B 1 83  ? 1.900   -65.544 -10.762 1.00 28.96  ? 83   MET B CE  1 
ATOM   4948 N  N   . TRP B 1 84  ? 4.472   -61.376 -12.840 1.00 23.31  ? 84   TRP B N   1 
ATOM   4949 C  CA  . TRP B 1 84  ? 3.677   -60.189 -12.542 1.00 24.08  ? 84   TRP B CA  1 
ATOM   4950 C  C   . TRP B 1 84  ? 3.988   -59.005 -13.451 1.00 26.53  ? 84   TRP B C   1 
ATOM   4951 O  O   . TRP B 1 84  ? 3.213   -58.039 -13.475 1.00 21.98  ? 84   TRP B O   1 
ATOM   4952 C  CB  . TRP B 1 84  ? 3.891   -59.767 -11.080 1.00 21.61  ? 84   TRP B CB  1 
ATOM   4953 C  CG  . TRP B 1 84  ? 3.643   -60.869 -10.119 1.00 23.22  ? 84   TRP B CG  1 
ATOM   4954 C  CD1 . TRP B 1 84  ? 4.576   -61.638 -9.494  1.00 25.03  ? 84   TRP B CD1 1 
ATOM   4955 C  CD2 . TRP B 1 84  ? 2.364   -61.330 -9.658  1.00 27.10  ? 84   TRP B CD2 1 
ATOM   4956 N  NE1 . TRP B 1 84  ? 3.962   -62.554 -8.668  1.00 23.64  ? 84   TRP B NE1 1 
ATOM   4957 C  CE2 . TRP B 1 84  ? 2.602   -62.382 -8.750  1.00 22.53  ? 84   TRP B CE2 1 
ATOM   4958 C  CE3 . TRP B 1 84  ? 1.039   -60.956 -9.930  1.00 24.29  ? 84   TRP B CE3 1 
ATOM   4959 C  CZ2 . TRP B 1 84  ? 1.568   -63.066 -8.110  1.00 27.67  ? 84   TRP B CZ2 1 
ATOM   4960 C  CZ3 . TRP B 1 84  ? 0.008   -61.633 -9.287  1.00 23.99  ? 84   TRP B CZ3 1 
ATOM   4961 C  CH2 . TRP B 1 84  ? 0.280   -62.679 -8.392  1.00 27.48  ? 84   TRP B CH2 1 
ATOM   4962 N  N   . ASN B 1 85  ? 5.095   -59.049 -14.183 1.00 22.50  ? 85   ASN B N   1 
ATOM   4963 C  CA  . ASN B 1 85  ? 5.508   -57.947 -15.036 1.00 26.18  ? 85   ASN B CA  1 
ATOM   4964 C  C   . ASN B 1 85  ? 4.675   -57.921 -16.318 1.00 24.35  ? 85   ASN B C   1 
ATOM   4965 O  O   . ASN B 1 85  ? 4.136   -58.951 -16.739 1.00 22.38  ? 85   ASN B O   1 
ATOM   4966 C  CB  . ASN B 1 85  ? 6.990   -58.086 -15.396 1.00 23.33  ? 85   ASN B CB  1 
ATOM   4967 C  CG  . ASN B 1 85  ? 7.919   -57.560 -14.315 1.00 27.34  ? 85   ASN B CG  1 
ATOM   4968 O  OD1 . ASN B 1 85  ? 7.545   -56.700 -13.516 1.00 25.58  ? 85   ASN B OD1 1 
ATOM   4969 N  ND2 . ASN B 1 85  ? 9.154   -58.069 -14.301 1.00 25.22  ? 85   ASN B ND2 1 
ATOM   4970 N  N   . PRO B 1 86  ? 4.582   -56.766 -16.976 1.00 22.43  ? 86   PRO B N   1 
ATOM   4971 C  CA  . PRO B 1 86  ? 3.889   -56.718 -18.274 1.00 26.65  ? 86   PRO B CA  1 
ATOM   4972 C  C   . PRO B 1 86  ? 4.453   -57.757 -19.229 1.00 26.38  ? 86   PRO B C   1 
ATOM   4973 O  O   . PRO B 1 86  ? 5.668   -57.887 -19.373 1.00 26.74  ? 86   PRO B O   1 
ATOM   4974 C  CB  . PRO B 1 86  ? 4.165   -55.295 -18.777 1.00 29.34  ? 86   PRO B CB  1 
ATOM   4975 C  CG  . PRO B 1 86  ? 4.568   -54.517 -17.600 1.00 24.69  ? 86   PRO B CG  1 
ATOM   4976 C  CD  . PRO B 1 86  ? 5.229   -55.483 -16.653 1.00 23.14  ? 86   PRO B CD  1 
ATOM   4977 N  N   . ASN B 1 87  ? 3.563   -58.541 -19.846 1.00 27.46  ? 87   ASN B N   1 
ATOM   4978 C  CA  . ASN B 1 87  ? 3.954   -59.505 -20.866 1.00 26.13  ? 87   ASN B CA  1 
ATOM   4979 C  C   . ASN B 1 87  ? 3.600   -59.020 -22.260 1.00 29.82  ? 87   ASN B C   1 
ATOM   4980 O  O   . ASN B 1 87  ? 3.724   -59.776 -23.229 1.00 28.67  ? 87   ASN B O   1 
ATOM   4981 C  CB  . ASN B 1 87  ? 3.327   -60.878 -20.602 1.00 27.03  ? 87   ASN B CB  1 
ATOM   4982 C  CG  . ASN B 1 87  ? 1.800   -60.843 -20.522 1.00 27.42  ? 87   ASN B CG  1 
ATOM   4983 O  OD1 . ASN B 1 87  ? 1.186   -59.788 -20.387 1.00 28.94  ? 87   ASN B OD1 1 
ATOM   4984 N  ND2 . ASN B 1 87  ? 1.188   -62.013 -20.594 1.00 32.11  ? 87   ASN B ND2 1 
ATOM   4985 N  N   . ARG B 1 88  ? 3.165   -57.775 -22.368 1.00 28.64  ? 88   ARG B N   1 
ATOM   4986 C  CA  A ARG B 1 88  ? 2.892   -57.148 -23.648 0.59 32.42  ? 88   ARG B CA  1 
ATOM   4987 C  CA  B ARG B 1 88  ? 2.849   -57.121 -23.627 0.41 32.40  ? 88   ARG B CA  1 
ATOM   4988 C  C   . ARG B 1 88  ? 3.597   -55.797 -23.674 1.00 32.62  ? 88   ARG B C   1 
ATOM   4989 O  O   . ARG B 1 88  ? 4.143   -55.335 -22.670 1.00 29.13  ? 88   ARG B O   1 
ATOM   4990 C  CB  A ARG B 1 88  ? 1.376   -57.007 -23.887 0.59 29.24  ? 88   ARG B CB  1 
ATOM   4991 C  CB  B ARG B 1 88  ? 1.339   -56.882 -23.775 0.41 29.27  ? 88   ARG B CB  1 
ATOM   4992 C  CG  A ARG B 1 88  ? 0.649   -58.346 -24.122 0.59 30.06  ? 88   ARG B CG  1 
ATOM   4993 C  CG  B ARG B 1 88  ? 0.727   -57.490 -25.015 0.41 34.80  ? 88   ARG B CG  1 
ATOM   4994 C  CD  A ARG B 1 88  ? 1.243   -59.086 -25.323 0.59 36.97  ? 88   ARG B CD  1 
ATOM   4995 C  CD  B ARG B 1 88  ? 0.856   -58.996 -25.032 0.41 35.46  ? 88   ARG B CD  1 
ATOM   4996 N  NE  A ARG B 1 88  ? 0.545   -60.328 -25.659 0.59 36.40  ? 88   ARG B NE  1 
ATOM   4997 N  NE  B ARG B 1 88  ? 0.004   -59.577 -26.062 0.41 35.08  ? 88   ARG B NE  1 
ATOM   4998 C  CZ  A ARG B 1 88  ? 0.774   -61.503 -25.077 0.59 36.52  ? 88   ARG B CZ  1 
ATOM   4999 C  CZ  B ARG B 1 88  ? 0.270   -59.553 -27.365 0.41 36.15  ? 88   ARG B CZ  1 
ATOM   5000 N  NH1 A ARG B 1 88  ? 1.677   -61.608 -24.112 0.59 31.32  ? 88   ARG B NH1 1 
ATOM   5001 N  NH1 B ARG B 1 88  ? 1.378   -58.983 -27.817 0.41 40.84  ? 88   ARG B NH1 1 
ATOM   5002 N  NH2 A ARG B 1 88  ? 0.090   -62.576 -25.455 0.59 38.87  ? 88   ARG B NH2 1 
ATOM   5003 N  NH2 B ARG B 1 88  ? -0.579  -60.103 -28.218 0.41 31.50  ? 88   ARG B NH2 1 
ATOM   5004 N  N   . GLU B 1 89  ? 3.609   -55.175 -24.846 1.00 30.84  ? 89   GLU B N   1 
ATOM   5005 C  CA  . GLU B 1 89  ? 4.221   -53.862 -24.958 1.00 31.80  ? 89   GLU B CA  1 
ATOM   5006 C  C   . GLU B 1 89  ? 3.472   -52.862 -24.084 1.00 31.49  ? 89   GLU B C   1 
ATOM   5007 O  O   . GLU B 1 89  ? 2.240   -52.849 -24.043 1.00 28.92  ? 89   GLU B O   1 
ATOM   5008 C  CB  . GLU B 1 89  ? 4.220   -53.406 -26.421 1.00 34.32  ? 89   GLU B CB  1 
ATOM   5009 C  CG  . GLU B 1 89  ? 4.644   -51.964 -26.641 1.00 40.01  ? 89   GLU B CG  1 
ATOM   5010 C  CD  . GLU B 1 89  ? 4.821   -51.639 -28.129 1.00 50.10  ? 89   GLU B CD  1 
ATOM   5011 O  OE1 . GLU B 1 89  ? 3.904   -51.048 -28.740 1.00 50.63  ? 89   GLU B OE1 1 
ATOM   5012 O  OE2 . GLU B 1 89  ? 5.879   -51.998 -28.683 1.00 58.50  ? 89   GLU B OE2 1 
ATOM   5013 N  N   . MET B 1 90  ? 4.225   -52.015 -23.388 1.00 27.44  ? 90   MET B N   1 
ATOM   5014 C  CA  . MET B 1 90  ? 3.635   -50.960 -22.583 1.00 29.23  ? 90   MET B CA  1 
ATOM   5015 C  C   . MET B 1 90  ? 3.311   -49.744 -23.439 1.00 32.62  ? 90   MET B C   1 
ATOM   5016 O  O   . MET B 1 90  ? 4.104   -49.335 -24.293 1.00 29.07  ? 90   MET B O   1 
ATOM   5017 C  CB  . MET B 1 90  ? 4.576   -50.557 -21.450 1.00 29.01  ? 90   MET B CB  1 
ATOM   5018 C  CG  . MET B 1 90  ? 4.581   -51.521 -20.278 1.00 26.83  ? 90   MET B CG  1 
ATOM   5019 S  SD  . MET B 1 90  ? 5.497   -50.893 -18.856 1.00 26.57  ? 90   MET B SD  1 
ATOM   5020 C  CE  . MET B 1 90  ? 7.143   -50.603 -19.531 1.00 26.38  ? 90   MET B CE  1 
ATOM   5021 N  N   . SER B 1 91  ? 2.140   -49.158 -23.195 1.00 26.03  ? 91   SER B N   1 
ATOM   5022 C  CA  . SER B 1 91  ? 1.736   -47.959 -23.909 1.00 25.98  ? 91   SER B CA  1 
ATOM   5023 C  C   . SER B 1 91  ? 0.691   -47.229 -23.086 1.00 28.20  ? 91   SER B C   1 
ATOM   5024 O  O   . SER B 1 91  ? -0.070  -47.850 -22.335 1.00 29.53  ? 91   SER B O   1 
ATOM   5025 C  CB  . SER B 1 91  ? 1.193   -48.303 -25.305 1.00 30.21  ? 91   SER B CB  1 
ATOM   5026 O  OG  . SER B 1 91  ? 0.477   -47.214 -25.856 1.00 26.29  ? 91   SER B OG  1 
ATOM   5027 N  N   . GLU B 1 92  ? 0.674   -45.896 -23.207 1.00 28.97  ? 92   GLU B N   1 
ATOM   5028 C  CA  . GLU B 1 92  ? -0.437  -45.143 -22.632 1.00 27.69  ? 92   GLU B CA  1 
ATOM   5029 C  C   . GLU B 1 92  ? -1.751  -45.489 -23.316 1.00 29.95  ? 92   GLU B C   1 
ATOM   5030 O  O   . GLU B 1 92  ? -2.824  -45.315 -22.721 1.00 28.70  ? 92   GLU B O   1 
ATOM   5031 C  CB  . GLU B 1 92  ? -0.180  -43.639 -22.721 1.00 30.31  ? 92   GLU B CB  1 
ATOM   5032 C  CG  . GLU B 1 92  ? 0.885   -43.143 -21.744 1.00 31.59  ? 92   GLU B CG  1 
ATOM   5033 C  CD  . GLU B 1 92  ? 1.055   -41.638 -21.781 1.00 34.76  ? 92   GLU B CD  1 
ATOM   5034 O  OE1 . GLU B 1 92  ? 1.797   -41.133 -22.651 1.00 36.80  ? 92   GLU B OE1 1 
ATOM   5035 O  OE2 . GLU B 1 92  ? 0.454   -40.954 -20.930 1.00 34.40  ? 92   GLU B OE2 1 
ATOM   5036 N  N   . ASP B 1 93  ? -1.682  -45.989 -24.547 1.00 28.60  ? 93   ASP B N   1 
ATOM   5037 C  CA  . ASP B 1 93  ? -2.833  -46.531 -25.259 1.00 23.84  ? 93   ASP B CA  1 
ATOM   5038 C  C   . ASP B 1 93  ? -3.068  -47.938 -24.716 1.00 24.39  ? 93   ASP B C   1 
ATOM   5039 O  O   . ASP B 1 93  ? -2.622  -48.944 -25.269 1.00 26.12  ? 93   ASP B O   1 
ATOM   5040 C  CB  . ASP B 1 93  ? -2.577  -46.515 -26.771 1.00 26.63  ? 93   ASP B CB  1 
ATOM   5041 C  CG  . ASP B 1 93  ? -3.796  -46.953 -27.586 1.00 35.11  ? 93   ASP B CG  1 
ATOM   5042 O  OD1 . ASP B 1 93  ? -4.849  -47.243 -26.982 1.00 28.75  ? 93   ASP B OD1 1 
ATOM   5043 O  OD2 . ASP B 1 93  ? -3.714  -47.017 -28.837 1.00 30.76  ? 93   ASP B OD2 1 
ATOM   5044 N  N   . CYS B 1 94  ? -3.775  -48.010 -23.573 1.00 29.99  ? 94   CYS B N   1 
ATOM   5045 C  CA  . CYS B 1 94  ? -3.914  -49.292 -22.889 1.00 23.98  ? 94   CYS B CA  1 
ATOM   5046 C  C   . CYS B 1 94  ? -5.302  -49.565 -22.316 1.00 28.21  ? 94   CYS B C   1 
ATOM   5047 O  O   . CYS B 1 94  ? -5.447  -50.524 -21.544 1.00 25.13  ? 94   CYS B O   1 
ATOM   5048 C  CB  . CYS B 1 94  ? -2.900  -49.393 -21.741 1.00 21.99  ? 94   CYS B CB  1 
ATOM   5049 S  SG  . CYS B 1 94  ? -3.181  -48.134 -20.478 1.00 24.46  ? 94   CYS B SG  1 
ATOM   5050 N  N   . LEU B 1 95  ? -6.325  -48.778 -22.650 1.00 23.01  ? 95   LEU B N   1 
ATOM   5051 C  CA  . LEU B 1 95  ? -7.629  -48.946 -21.991 1.00 25.46  ? 95   LEU B CA  1 
ATOM   5052 C  C   . LEU B 1 95  ? -8.483  -49.904 -22.818 1.00 29.33  ? 95   LEU B C   1 
ATOM   5053 O  O   . LEU B 1 95  ? -9.259  -49.503 -23.690 1.00 27.76  ? 95   LEU B O   1 
ATOM   5054 C  CB  . LEU B 1 95  ? -8.296  -47.596 -21.765 1.00 28.11  ? 95   LEU B CB  1 
ATOM   5055 C  CG  . LEU B 1 95  ? -7.572  -46.745 -20.716 1.00 28.11  ? 95   LEU B CG  1 
ATOM   5056 C  CD1 . LEU B 1 95  ? -8.286  -45.435 -20.447 1.00 26.80  ? 95   LEU B CD1 1 
ATOM   5057 C  CD2 . LEU B 1 95  ? -7.400  -47.517 -19.404 1.00 27.78  ? 95   LEU B CD2 1 
ATOM   5058 N  N   . TYR B 1 96  ? -8.326  -51.198 -22.530 1.00 24.08  ? 96   TYR B N   1 
ATOM   5059 C  CA  . TYR B 1 96  ? -8.965  -52.286 -23.250 1.00 23.65  ? 96   TYR B CA  1 
ATOM   5060 C  C   . TYR B 1 96  ? -9.468  -53.316 -22.250 1.00 26.88  ? 96   TYR B C   1 
ATOM   5061 O  O   . TYR B 1 96  ? -9.018  -53.357 -21.101 1.00 24.59  ? 96   TYR B O   1 
ATOM   5062 C  CB  . TYR B 1 96  ? -8.002  -52.968 -24.242 1.00 27.58  ? 96   TYR B CB  1 
ATOM   5063 C  CG  . TYR B 1 96  ? -7.446  -52.004 -25.267 1.00 27.72  ? 96   TYR B CG  1 
ATOM   5064 C  CD1 . TYR B 1 96  ? -6.348  -51.202 -24.973 1.00 28.81  ? 96   TYR B CD1 1 
ATOM   5065 C  CD2 . TYR B 1 96  ? -8.049  -51.867 -26.512 1.00 30.04  ? 96   TYR B CD2 1 
ATOM   5066 C  CE1 . TYR B 1 96  ? -5.850  -50.301 -25.905 1.00 27.12  ? 96   TYR B CE1 1 
ATOM   5067 C  CE2 . TYR B 1 96  ? -7.567  -50.971 -27.448 1.00 28.50  ? 96   TYR B CE2 1 
ATOM   5068 C  CZ  . TYR B 1 96  ? -6.474  -50.187 -27.141 1.00 31.50  ? 96   TYR B CZ  1 
ATOM   5069 O  OH  . TYR B 1 96  ? -5.999  -49.291 -28.072 1.00 27.40  ? 96   TYR B OH  1 
ATOM   5070 N  N   . LEU B 1 97  ? -10.405 -54.157 -22.690 1.00 22.97  ? 97   LEU B N   1 
ATOM   5071 C  CA  . LEU B 1 97  ? -10.880 -55.248 -21.850 1.00 20.07  ? 97   LEU B CA  1 
ATOM   5072 C  C   . LEU B 1 97  ? -10.921 -56.537 -22.655 1.00 25.44  ? 97   LEU B C   1 
ATOM   5073 O  O   . LEU B 1 97  ? -10.909 -56.537 -23.894 1.00 24.89  ? 97   LEU B O   1 
ATOM   5074 C  CB  . LEU B 1 97  ? -12.251 -54.935 -21.220 1.00 20.03  ? 97   LEU B CB  1 
ATOM   5075 C  CG  . LEU B 1 97  ? -13.433 -54.517 -22.109 1.00 23.83  ? 97   LEU B CG  1 
ATOM   5076 C  CD1 . LEU B 1 97  ? -14.092 -55.732 -22.746 1.00 23.87  ? 97   LEU B CD1 1 
ATOM   5077 C  CD2 . LEU B 1 97  ? -14.444 -53.711 -21.293 1.00 21.56  ? 97   LEU B CD2 1 
ATOM   5078 N  N   . ASN B 1 98  ? -10.950 -57.648 -21.933 1.00 22.79  ? 98   ASN B N   1 
ATOM   5079 C  CA  . ASN B 1 98  ? -10.963 -58.971 -22.533 1.00 24.54  ? 98   ASN B CA  1 
ATOM   5080 C  C   . ASN B 1 98  ? -12.169 -59.735 -22.016 1.00 25.18  ? 98   ASN B C   1 
ATOM   5081 O  O   . ASN B 1 98  ? -12.583 -59.557 -20.864 1.00 24.52  ? 98   ASN B O   1 
ATOM   5082 C  CB  . ASN B 1 98  ? -9.686  -59.746 -22.207 1.00 24.58  ? 98   ASN B CB  1 
ATOM   5083 C  CG  . ASN B 1 98  ? -8.447  -58.886 -22.302 1.00 27.51  ? 98   ASN B CG  1 
ATOM   5084 O  OD1 . ASN B 1 98  ? -8.023  -58.512 -23.394 1.00 24.14  ? 98   ASN B OD1 1 
ATOM   5085 N  ND2 . ASN B 1 98  ? -7.860  -58.556 -21.149 1.00 25.80  ? 98   ASN B ND2 1 
ATOM   5086 N  N   . ILE B 1 99  ? -12.729 -60.595 -22.867 1.00 24.86  ? 99   ILE B N   1 
ATOM   5087 C  CA  . ILE B 1 99  ? -13.927 -61.360 -22.527 1.00 26.00  ? 99   ILE B CA  1 
ATOM   5088 C  C   . ILE B 1 99  ? -13.730 -62.814 -22.930 1.00 29.67  ? 99   ILE B C   1 
ATOM   5089 O  O   . ILE B 1 99  ? -13.363 -63.101 -24.076 1.00 27.01  ? 99   ILE B O   1 
ATOM   5090 C  CB  . ILE B 1 99  ? -15.191 -60.795 -23.202 1.00 24.09  ? 99   ILE B CB  1 
ATOM   5091 C  CG1 . ILE B 1 99  ? -15.240 -59.274 -23.085 1.00 23.56  ? 99   ILE B CG1 1 
ATOM   5092 C  CG2 . ILE B 1 99  ? -16.441 -61.424 -22.580 1.00 24.84  ? 99   ILE B CG2 1 
ATOM   5093 C  CD1 . ILE B 1 99  ? -16.513 -58.663 -23.672 1.00 23.49  ? 99   ILE B CD1 1 
ATOM   5094 N  N   . TRP B 1 100 ? -13.985 -63.725 -21.992 1.00 23.84  ? 100  TRP B N   1 
ATOM   5095 C  CA  . TRP B 1 100 ? -14.078 -65.149 -22.274 1.00 27.73  ? 100  TRP B CA  1 
ATOM   5096 C  C   . TRP B 1 100 ? -15.537 -65.567 -22.165 1.00 26.04  ? 100  TRP B C   1 
ATOM   5097 O  O   . TRP B 1 100 ? -16.208 -65.261 -21.168 1.00 24.48  ? 100  TRP B O   1 
ATOM   5098 C  CB  . TRP B 1 100 ? -13.205 -65.976 -21.331 1.00 25.25  ? 100  TRP B CB  1 
ATOM   5099 C  CG  . TRP B 1 100 ? -11.727 -65.828 -21.616 1.00 27.03  ? 100  TRP B CG  1 
ATOM   5100 C  CD1 . TRP B 1 100 ? -10.967 -66.621 -22.425 1.00 30.82  ? 100  TRP B CD1 1 
ATOM   5101 C  CD2 . TRP B 1 100 ? -10.842 -64.820 -21.100 1.00 28.22  ? 100  TRP B CD2 1 
ATOM   5102 N  NE1 . TRP B 1 100 ? -9.668  -66.174 -22.442 1.00 29.16  ? 100  TRP B NE1 1 
ATOM   5103 C  CE2 . TRP B 1 100 ? -9.565  -65.070 -21.637 1.00 28.25  ? 100  TRP B CE2 1 
ATOM   5104 C  CE3 . TRP B 1 100 ? -11.010 -63.732 -20.240 1.00 28.91  ? 100  TRP B CE3 1 
ATOM   5105 C  CZ2 . TRP B 1 100 ? -8.453  -64.274 -21.339 1.00 30.61  ? 100  TRP B CZ2 1 
ATOM   5106 C  CZ3 . TRP B 1 100 ? -9.900  -62.941 -19.936 1.00 28.50  ? 100  TRP B CZ3 1 
ATOM   5107 C  CH2 . TRP B 1 100 ? -8.639  -63.216 -20.487 1.00 27.80  ? 100  TRP B CH2 1 
ATOM   5108 N  N   . VAL B 1 101 ? -16.026 -66.233 -23.210 1.00 29.17  ? 101  VAL B N   1 
ATOM   5109 C  CA  . VAL B 1 101 ? -17.437 -66.582 -23.359 1.00 26.82  ? 101  VAL B CA  1 
ATOM   5110 C  C   . VAL B 1 101 ? -17.550 -68.085 -23.581 1.00 27.83  ? 101  VAL B C   1 
ATOM   5111 O  O   . VAL B 1 101 ? -16.937 -68.615 -24.522 1.00 30.44  ? 101  VAL B O   1 
ATOM   5112 C  CB  . VAL B 1 101 ? -18.084 -65.827 -24.534 1.00 28.65  ? 101  VAL B CB  1 
ATOM   5113 C  CG1 . VAL B 1 101 ? -19.580 -66.105 -24.576 1.00 31.87  ? 101  VAL B CG1 1 
ATOM   5114 C  CG2 . VAL B 1 101 ? -17.821 -64.343 -24.440 1.00 26.84  ? 101  VAL B CG2 1 
ATOM   5115 N  N   . PRO B 1 102 ? -18.318 -68.801 -22.762 1.00 28.79  ? 102  PRO B N   1 
ATOM   5116 C  CA  . PRO B 1 102 ? -18.521 -70.233 -23.008 1.00 28.72  ? 102  PRO B CA  1 
ATOM   5117 C  C   . PRO B 1 102 ? -19.045 -70.480 -24.418 1.00 32.80  ? 102  PRO B C   1 
ATOM   5118 O  O   . PRO B 1 102 ? -19.722 -69.638 -25.005 1.00 30.55  ? 102  PRO B O   1 
ATOM   5119 C  CB  . PRO B 1 102 ? -19.560 -70.632 -21.956 1.00 32.17  ? 102  PRO B CB  1 
ATOM   5120 C  CG  . PRO B 1 102 ? -19.426 -69.586 -20.876 1.00 31.80  ? 102  PRO B CG  1 
ATOM   5121 C  CD  . PRO B 1 102 ? -19.072 -68.320 -21.591 1.00 31.45  ? 102  PRO B CD  1 
ATOM   5122 N  N   . SER B 1 103 ? -18.708 -71.649 -24.959 1.00 34.54  ? 103  SER B N   1 
ATOM   5123 C  CA  . SER B 1 103 ? -19.139 -72.062 -26.290 1.00 35.50  ? 103  SER B CA  1 
ATOM   5124 C  C   . SER B 1 103 ? -19.914 -73.368 -26.178 1.00 37.81  ? 103  SER B C   1 
ATOM   5125 O  O   . SER B 1 103 ? -19.361 -74.365 -25.683 1.00 41.54  ? 103  SER B O   1 
ATOM   5126 C  CB  . SER B 1 103 ? -17.944 -72.234 -27.224 1.00 38.76  ? 103  SER B CB  1 
ATOM   5127 O  OG  . SER B 1 103 ? -18.378 -72.663 -28.505 1.00 41.71  ? 103  SER B OG  1 
ATOM   5128 N  N   . PRO B 1 104 ? -21.171 -73.438 -26.646 1.00 42.02  ? 104  PRO B N   1 
ATOM   5129 C  CA  . PRO B 1 104 ? -21.890 -72.372 -27.359 1.00 41.59  ? 104  PRO B CA  1 
ATOM   5130 C  C   . PRO B 1 104 ? -22.255 -71.188 -26.465 1.00 40.91  ? 104  PRO B C   1 
ATOM   5131 O  O   . PRO B 1 104 ? -22.313 -71.351 -25.250 1.00 38.71  ? 104  PRO B O   1 
ATOM   5132 C  CB  . PRO B 1 104 ? -23.152 -73.079 -27.864 1.00 42.63  ? 104  PRO B CB  1 
ATOM   5133 C  CG  . PRO B 1 104 ? -23.331 -74.235 -26.945 1.00 43.55  ? 104  PRO B CG  1 
ATOM   5134 C  CD  . PRO B 1 104 ? -21.962 -74.677 -26.560 1.00 40.42  ? 104  PRO B CD  1 
ATOM   5135 N  N   . ARG B 1 105 ? -22.488 -70.023 -27.063 1.00 37.25  ? 105  ARG B N   1 
ATOM   5136 C  CA  . ARG B 1 105 ? -22.740 -68.821 -26.282 1.00 36.30  ? 105  ARG B CA  1 
ATOM   5137 C  C   . ARG B 1 105 ? -23.992 -69.006 -25.428 1.00 40.79  ? 105  ARG B C   1 
ATOM   5138 O  O   . ARG B 1 105 ? -25.036 -69.427 -25.948 1.00 37.12  ? 105  ARG B O   1 
ATOM   5139 C  CB  . ARG B 1 105 ? -22.899 -67.610 -27.205 1.00 35.45  ? 105  ARG B CB  1 
ATOM   5140 C  CG  . ARG B 1 105 ? -23.044 -66.269 -26.481 1.00 34.99  ? 105  ARG B CG  1 
ATOM   5141 C  CD  . ARG B 1 105 ? -23.474 -65.167 -27.452 1.00 37.13  ? 105  ARG B CD  1 
ATOM   5142 N  NE  . ARG B 1 105 ? -22.539 -65.031 -28.567 1.00 35.49  ? 105  ARG B NE  1 
ATOM   5143 C  CZ  . ARG B 1 105 ? -22.721 -64.226 -29.610 1.00 38.35  ? 105  ARG B CZ  1 
ATOM   5144 N  NH1 . ARG B 1 105 ? -23.817 -63.484 -29.696 1.00 38.97  ? 105  ARG B NH1 1 
ATOM   5145 N  NH2 . ARG B 1 105 ? -21.812 -64.175 -30.579 1.00 36.87  ? 105  ARG B NH2 1 
ATOM   5146 N  N   . PRO B 1 106 ? -23.930 -68.735 -24.128 1.00 37.08  ? 106  PRO B N   1 
ATOM   5147 C  CA  . PRO B 1 106 ? -25.142 -68.803 -23.307 1.00 39.21  ? 106  PRO B CA  1 
ATOM   5148 C  C   . PRO B 1 106 ? -26.063 -67.634 -23.613 1.00 35.31  ? 106  PRO B C   1 
ATOM   5149 O  O   . PRO B 1 106 ? -25.700 -66.677 -24.299 1.00 35.21  ? 106  PRO B O   1 
ATOM   5150 C  CB  . PRO B 1 106 ? -24.608 -68.743 -21.872 1.00 40.91  ? 106  PRO B CB  1 
ATOM   5151 C  CG  . PRO B 1 106 ? -23.292 -68.062 -21.991 1.00 39.36  ? 106  PRO B CG  1 
ATOM   5152 C  CD  . PRO B 1 106 ? -22.726 -68.461 -23.320 1.00 35.49  ? 106  PRO B CD  1 
ATOM   5153 N  N   . LYS B 1 107 ? -27.276 -67.714 -23.068 1.00 38.91  ? 107  LYS B N   1 
ATOM   5154 C  CA  . LYS B 1 107 ? -28.301 -66.725 -23.387 1.00 41.18  ? 107  LYS B CA  1 
ATOM   5155 C  C   . LYS B 1 107 ? -28.168 -65.475 -22.528 1.00 42.61  ? 107  LYS B C   1 
ATOM   5156 O  O   . LYS B 1 107 ? -28.148 -64.351 -23.055 1.00 36.61  ? 107  LYS B O   1 
ATOM   5157 C  CB  . LYS B 1 107 ? -29.691 -67.342 -23.219 1.00 43.03  ? 107  LYS B CB  1 
ATOM   5158 C  CG  . LYS B 1 107 ? -30.183 -68.093 -24.441 1.00 46.44  ? 107  LYS B CG  1 
ATOM   5159 C  CD  . LYS B 1 107 ? -31.680 -68.320 -24.367 1.00 44.76  ? 107  LYS B CD  1 
ATOM   5160 C  CE  . LYS B 1 107 ? -32.299 -68.292 -25.749 1.00 52.07  ? 107  LYS B CE  1 
ATOM   5161 N  NZ  . LYS B 1 107 ? -32.742 -66.920 -26.116 1.00 51.94  ? 107  LYS B NZ  1 
ATOM   5162 N  N   . SER B 1 108 ? -28.089 -65.658 -21.202 1.00 34.13  ? 108  SER B N   1 
ATOM   5163 C  CA  . SER B 1 108 ? -28.019 -64.550 -20.261 1.00 36.64  ? 108  SER B CA  1 
ATOM   5164 C  C   . SER B 1 108 ? -27.399 -65.019 -18.947 1.00 36.22  ? 108  SER B C   1 
ATOM   5165 O  O   . SER B 1 108 ? -28.116 -65.199 -17.957 1.00 41.35  ? 108  SER B O   1 
ATOM   5166 C  CB  . SER B 1 108 ? -29.423 -63.982 -20.013 1.00 42.84  ? 108  SER B CB  1 
ATOM   5167 O  OG  . SER B 1 108 ? -29.395 -62.804 -19.216 1.00 50.60  ? 108  SER B OG  1 
ATOM   5168 N  N   . THR B 1 109 ? -26.083 -65.215 -18.927 1.00 33.08  ? 109  THR B N   1 
ATOM   5169 C  CA  . THR B 1 109 ? -25.435 -65.871 -17.805 1.00 36.03  ? 109  THR B CA  1 
ATOM   5170 C  C   . THR B 1 109 ? -24.682 -64.873 -16.926 1.00 31.70  ? 109  THR B C   1 
ATOM   5171 O  O   . THR B 1 109 ? -24.475 -63.706 -17.276 1.00 29.12  ? 109  THR B O   1 
ATOM   5172 C  CB  . THR B 1 109 ? -24.493 -66.971 -18.299 1.00 39.02  ? 109  THR B CB  1 
ATOM   5173 O  OG1 . THR B 1 109 ? -24.229 -67.878 -17.224 1.00 48.19  ? 109  THR B OG1 1 
ATOM   5174 C  CG2 . THR B 1 109 ? -23.176 -66.380 -18.764 1.00 33.38  ? 109  THR B CG2 1 
ATOM   5175 N  N   . THR B 1 110 ? -24.284 -65.367 -15.757 1.00 27.93  ? 110  THR B N   1 
ATOM   5176 C  CA  . THR B 1 110 ? -23.552 -64.574 -14.779 1.00 26.57  ? 110  THR B CA  1 
ATOM   5177 C  C   . THR B 1 110 ? -22.247 -64.043 -15.361 1.00 25.04  ? 110  THR B C   1 
ATOM   5178 O  O   . THR B 1 110 ? -21.548 -64.741 -16.098 1.00 26.60  ? 110  THR B O   1 
ATOM   5179 C  CB  . THR B 1 110 ? -23.281 -65.436 -13.550 1.00 29.46  ? 110  THR B CB  1 
ATOM   5180 O  OG1 . THR B 1 110 ? -24.528 -65.699 -12.903 1.00 31.15  ? 110  THR B OG1 1 
ATOM   5181 C  CG2 . THR B 1 110 ? -22.315 -64.757 -12.557 1.00 25.03  ? 110  THR B CG2 1 
ATOM   5182 N  N   . VAL B 1 111 ? -21.932 -62.795 -15.019 1.00 24.84  ? 111  VAL B N   1 
ATOM   5183 C  CA  . VAL B 1 111 ? -20.719 -62.113 -15.452 1.00 22.47  ? 111  VAL B CA  1 
ATOM   5184 C  C   . VAL B 1 111 ? -19.818 -61.864 -14.246 1.00 24.10  ? 111  VAL B C   1 
ATOM   5185 O  O   . VAL B 1 111 ? -20.282 -61.415 -13.187 1.00 23.47  ? 111  VAL B O   1 
ATOM   5186 C  CB  . VAL B 1 111 ? -21.059 -60.785 -16.152 1.00 24.20  ? 111  VAL B CB  1 
ATOM   5187 C  CG1 . VAL B 1 111 ? -19.775 -60.076 -16.627 1.00 23.57  ? 111  VAL B CG1 1 
ATOM   5188 C  CG2 . VAL B 1 111 ? -22.011 -61.051 -17.324 1.00 27.29  ? 111  VAL B CG2 1 
ATOM   5189 N  N   . MET B 1 112 ? -18.525 -62.127 -14.420 1.00 23.90  ? 112  MET B N   1 
ATOM   5190 C  CA  . MET B 1 112 ? -17.506 -61.765 -13.439 1.00 23.80  ? 112  MET B CA  1 
ATOM   5191 C  C   . MET B 1 112 ? -16.498 -60.853 -14.116 1.00 25.94  ? 112  MET B C   1 
ATOM   5192 O  O   . MET B 1 112 ? -15.983 -61.185 -15.188 1.00 28.17  ? 112  MET B O   1 
ATOM   5193 C  CB  . MET B 1 112 ? -16.810 -63.004 -12.866 1.00 25.86  ? 112  MET B CB  1 
ATOM   5194 C  CG  . MET B 1 112 ? -17.782 -63.955 -12.165 1.00 28.49  ? 112  MET B CG  1 
ATOM   5195 S  SD  . MET B 1 112 ? -17.045 -65.472 -11.512 1.00 26.76  ? 112  MET B SD  1 
ATOM   5196 C  CE  . MET B 1 112 ? -16.193 -64.817 -10.064 1.00 25.93  ? 112  MET B CE  1 
ATOM   5197 N  N   . VAL B 1 113 ? -16.229 -59.705 -13.506 1.00 26.44  ? 113  VAL B N   1 
ATOM   5198 C  CA  . VAL B 1 113 ? -15.284 -58.734 -14.048 1.00 22.34  ? 113  VAL B CA  1 
ATOM   5199 C  C   . VAL B 1 113 ? -14.095 -58.653 -13.099 1.00 21.88  ? 113  VAL B C   1 
ATOM   5200 O  O   . VAL B 1 113 ? -14.244 -58.209 -11.953 1.00 22.51  ? 113  VAL B O   1 
ATOM   5201 C  CB  . VAL B 1 113 ? -15.924 -57.353 -14.239 1.00 22.59  ? 113  VAL B CB  1 
ATOM   5202 C  CG1 . VAL B 1 113 ? -14.888 -56.392 -14.776 1.00 23.57  ? 113  VAL B CG1 1 
ATOM   5203 C  CG2 . VAL B 1 113 ? -17.136 -57.445 -15.190 1.00 22.51  ? 113  VAL B CG2 1 
ATOM   5204 N  N   . TRP B 1 114 ? -12.924 -59.057 -13.596 1.00 21.27  ? 114  TRP B N   1 
ATOM   5205 C  CA  . TRP B 1 114 ? -11.675 -59.046 -12.835 1.00 20.57  ? 114  TRP B CA  1 
ATOM   5206 C  C   . TRP B 1 114 ? -11.015 -57.672 -12.890 1.00 23.64  ? 114  TRP B C   1 
ATOM   5207 O  O   . TRP B 1 114 ? -10.852 -57.099 -13.975 1.00 21.70  ? 114  TRP B O   1 
ATOM   5208 C  CB  . TRP B 1 114 ? -10.716 -60.100 -13.400 1.00 22.34  ? 114  TRP B CB  1 
ATOM   5209 C  CG  . TRP B 1 114 ? -9.342  -60.121 -12.746 1.00 22.00  ? 114  TRP B CG  1 
ATOM   5210 C  CD1 . TRP B 1 114 ? -8.136  -59.800 -13.327 1.00 23.63  ? 114  TRP B CD1 1 
ATOM   5211 C  CD2 . TRP B 1 114 ? -9.050  -60.489 -11.398 1.00 21.95  ? 114  TRP B CD2 1 
ATOM   5212 N  NE1 . TRP B 1 114 ? -7.113  -59.945 -12.410 1.00 22.10  ? 114  TRP B NE1 1 
ATOM   5213 C  CE2 . TRP B 1 114 ? -7.651  -60.365 -11.219 1.00 24.40  ? 114  TRP B CE2 1 
ATOM   5214 C  CE3 . TRP B 1 114 ? -9.835  -60.912 -10.318 1.00 20.90  ? 114  TRP B CE3 1 
ATOM   5215 C  CZ2 . TRP B 1 114 ? -7.026  -60.658 -10.005 1.00 23.69  ? 114  TRP B CZ2 1 
ATOM   5216 C  CZ3 . TRP B 1 114 ? -9.214  -61.200 -9.120  1.00 21.52  ? 114  TRP B CZ3 1 
ATOM   5217 C  CH2 . TRP B 1 114 ? -7.822  -61.068 -8.968  1.00 22.71  ? 114  TRP B CH2 1 
ATOM   5218 N  N   . ILE B 1 115 ? -10.600 -57.163 -11.726 1.00 19.89  ? 115  ILE B N   1 
ATOM   5219 C  CA  . ILE B 1 115 ? -9.859  -55.911 -11.611 1.00 20.38  ? 115  ILE B CA  1 
ATOM   5220 C  C   . ILE B 1 115 ? -8.489  -56.243 -11.021 1.00 21.27  ? 115  ILE B C   1 
ATOM   5221 O  O   . ILE B 1 115 ? -8.393  -56.628 -9.846  1.00 19.81  ? 115  ILE B O   1 
ATOM   5222 C  CB  . ILE B 1 115 ? -10.599 -54.887 -10.743 1.00 21.07  ? 115  ILE B CB  1 
ATOM   5223 C  CG1 . ILE B 1 115 ? -12.021 -54.657 -11.279 1.00 20.95  ? 115  ILE B CG1 1 
ATOM   5224 C  CG2 . ILE B 1 115 ? -9.797  -53.571 -10.622 1.00 20.47  ? 115  ILE B CG2 1 
ATOM   5225 C  CD1 . ILE B 1 115 ? -12.774 -53.624 -10.510 1.00 21.77  ? 115  ILE B CD1 1 
ATOM   5226 N  N   . TYR B 1 116 ? -7.430  -56.091 -11.821 1.00 21.48  ? 116  TYR B N   1 
ATOM   5227 C  CA  . TYR B 1 116 ? -6.108  -56.489 -11.343 1.00 21.95  ? 116  TYR B CA  1 
ATOM   5228 C  C   . TYR B 1 116 ? -5.620  -55.564 -10.231 1.00 20.90  ? 116  TYR B C   1 
ATOM   5229 O  O   . TYR B 1 116 ? -5.998  -54.395 -10.144 1.00 20.76  ? 116  TYR B O   1 
ATOM   5230 C  CB  . TYR B 1 116 ? -5.078  -56.545 -12.499 1.00 23.32  ? 116  TYR B CB  1 
ATOM   5231 C  CG  . TYR B 1 116 ? -4.877  -55.277 -13.322 1.00 22.32  ? 116  TYR B CG  1 
ATOM   5232 C  CD1 . TYR B 1 116 ? -4.254  -54.155 -12.779 1.00 22.39  ? 116  TYR B CD1 1 
ATOM   5233 C  CD2 . TYR B 1 116 ? -5.279  -55.220 -14.658 1.00 19.28  ? 116  TYR B CD2 1 
ATOM   5234 C  CE1 . TYR B 1 116 ? -4.056  -53.000 -13.532 1.00 22.52  ? 116  TYR B CE1 1 
ATOM   5235 C  CE2 . TYR B 1 116 ? -5.088  -54.077 -15.417 1.00 20.15  ? 116  TYR B CE2 1 
ATOM   5236 C  CZ  . TYR B 1 116 ? -4.485  -52.969 -14.852 1.00 20.68  ? 116  TYR B CZ  1 
ATOM   5237 O  OH  . TYR B 1 116 ? -4.310  -51.828 -15.601 1.00 23.42  ? 116  TYR B OH  1 
ATOM   5238 N  N   . GLY B 1 117 ? -4.765  -56.111 -9.364  1.00 20.52  ? 117  GLY B N   1 
ATOM   5239 C  CA  . GLY B 1 117 ? -4.080  -55.334 -8.358  1.00 23.29  ? 117  GLY B CA  1 
ATOM   5240 C  C   . GLY B 1 117 ? -2.685  -54.943 -8.806  1.00 26.17  ? 117  GLY B C   1 
ATOM   5241 O  O   . GLY B 1 117 ? -2.323  -55.040 -9.982  1.00 25.45  ? 117  GLY B O   1 
ATOM   5242 N  N   . GLY B 1 118 ? -1.884  -54.499 -7.835  1.00 23.51  ? 118  GLY B N   1 
ATOM   5243 C  CA  . GLY B 1 118 ? -0.549  -54.013 -8.125  1.00 23.71  ? 118  GLY B CA  1 
ATOM   5244 C  C   . GLY B 1 118 ? -0.256  -52.675 -7.478  1.00 24.37  ? 118  GLY B C   1 
ATOM   5245 O  O   . GLY B 1 118 ? 0.455   -51.851 -8.058  1.00 23.41  ? 118  GLY B O   1 
ATOM   5246 N  N   . GLY B 1 119 ? -0.824  -52.429 -6.294  1.00 24.08  ? 119  GLY B N   1 
ATOM   5247 C  CA  . GLY B 1 119 ? -0.509  -51.222 -5.546  1.00 24.21  ? 119  GLY B CA  1 
ATOM   5248 C  C   . GLY B 1 119 ? -0.900  -49.924 -6.210  1.00 25.63  ? 119  GLY B C   1 
ATOM   5249 O  O   . GLY B 1 119 ? -0.395  -48.861 -5.826  1.00 22.62  ? 119  GLY B O   1 
ATOM   5250 N  N   . PHE B 1 120 ? -1.800  -49.974 -7.194  1.00 21.22  ? 120  PHE B N   1 
ATOM   5251 C  CA  . PHE B 1 120 ? -2.170  -48.844 -8.043  1.00 24.38  ? 120  PHE B CA  1 
ATOM   5252 C  C   . PHE B 1 120 ? -0.995  -48.297 -8.854  1.00 26.10  ? 120  PHE B C   1 
ATOM   5253 O  O   . PHE B 1 120 ? -1.149  -47.285 -9.547  1.00 24.97  ? 120  PHE B O   1 
ATOM   5254 C  CB  . PHE B 1 120 ? -2.814  -47.712 -7.233  1.00 22.60  ? 120  PHE B CB  1 
ATOM   5255 C  CG  . PHE B 1 120 ? -4.134  -48.088 -6.613  1.00 24.63  ? 120  PHE B CG  1 
ATOM   5256 C  CD1 . PHE B 1 120 ? -5.257  -48.264 -7.409  1.00 22.22  ? 120  PHE B CD1 1 
ATOM   5257 C  CD2 . PHE B 1 120 ? -4.248  -48.261 -5.240  1.00 22.61  ? 120  PHE B CD2 1 
ATOM   5258 C  CE1 . PHE B 1 120 ? -6.480  -48.611 -6.846  1.00 25.80  ? 120  PHE B CE1 1 
ATOM   5259 C  CE2 . PHE B 1 120 ? -5.480  -48.611 -4.653  1.00 24.75  ? 120  PHE B CE2 1 
ATOM   5260 C  CZ  . PHE B 1 120 ? -6.595  -48.780 -5.462  1.00 22.12  ? 120  PHE B CZ  1 
ATOM   5261 N  N   . TYR B 1 121 ? 0.180   -48.937 -8.795  1.00 24.68  ? 121  TYR B N   1 
ATOM   5262 C  CA  . TYR B 1 121 ? 1.317   -48.509 -9.602  1.00 23.15  ? 121  TYR B CA  1 
ATOM   5263 C  C   . TYR B 1 121 ? 1.668   -49.484 -10.717 1.00 24.12  ? 121  TYR B C   1 
ATOM   5264 O  O   . TYR B 1 121 ? 2.535   -49.167 -11.539 1.00 27.24  ? 121  TYR B O   1 
ATOM   5265 C  CB  . TYR B 1 121 ? 2.552   -48.282 -8.710  1.00 24.12  ? 121  TYR B CB  1 
ATOM   5266 C  CG  . TYR B 1 121 ? 3.212   -49.555 -8.230  1.00 23.73  ? 121  TYR B CG  1 
ATOM   5267 C  CD1 . TYR B 1 121 ? 4.169   -50.204 -9.001  1.00 25.55  ? 121  TYR B CD1 1 
ATOM   5268 C  CD2 . TYR B 1 121 ? 2.881   -50.105 -6.995  1.00 27.25  ? 121  TYR B CD2 1 
ATOM   5269 C  CE1 . TYR B 1 121 ? 4.766   -51.373 -8.565  1.00 28.87  ? 121  TYR B CE1 1 
ATOM   5270 C  CE2 . TYR B 1 121 ? 3.480   -51.271 -6.548  1.00 29.10  ? 121  TYR B CE2 1 
ATOM   5271 C  CZ  . TYR B 1 121 ? 4.421   -51.898 -7.335  1.00 31.99  ? 121  TYR B CZ  1 
ATOM   5272 O  OH  . TYR B 1 121 ? 5.014   -53.059 -6.890  1.00 28.71  ? 121  TYR B OH  1 
ATOM   5273 N  N   . SER B 1 122 ? 1.044   -50.657 -10.762 1.00 26.19  ? 122  SER B N   1 
ATOM   5274 C  CA  . SER B 1 122 ? 1.401   -51.692 -11.722 1.00 25.07  ? 122  SER B CA  1 
ATOM   5275 C  C   . SER B 1 122 ? 0.196   -52.601 -11.913 1.00 23.40  ? 122  SER B C   1 
ATOM   5276 O  O   . SER B 1 122 ? -0.821  -52.461 -11.233 1.00 23.21  ? 122  SER B O   1 
ATOM   5277 C  CB  . SER B 1 122 ? 2.617   -52.490 -11.250 1.00 27.51  ? 122  SER B CB  1 
ATOM   5278 O  OG  . SER B 1 122 ? 2.328   -53.177 -10.037 1.00 25.40  ? 122  SER B OG  1 
ATOM   5279 N  N   . GLY B 1 123 ? 0.326   -53.550 -12.834 1.00 23.31  ? 123  GLY B N   1 
ATOM   5280 C  CA  . GLY B 1 123 ? -0.726  -54.520 -13.085 1.00 20.30  ? 123  GLY B CA  1 
ATOM   5281 C  C   . GLY B 1 123 ? -1.060  -54.575 -14.563 1.00 21.10  ? 123  GLY B C   1 
ATOM   5282 O  O   . GLY B 1 123 ? -0.939  -53.586 -15.290 1.00 22.81  ? 123  GLY B O   1 
ATOM   5283 N  N   . SER B 1 124 ? -1.479  -55.753 -15.015 1.00 24.02  ? 124  SER B N   1 
ATOM   5284 C  CA  . SER B 1 124 ? -1.881  -55.977 -16.396 1.00 25.22  ? 124  SER B CA  1 
ATOM   5285 C  C   . SER B 1 124 ? -3.042  -56.959 -16.423 1.00 23.66  ? 124  SER B C   1 
ATOM   5286 O  O   . SER B 1 124 ? -3.105  -57.883 -15.614 1.00 24.06  ? 124  SER B O   1 
ATOM   5287 C  CB  . SER B 1 124 ? -0.723  -56.532 -17.247 1.00 23.89  ? 124  SER B CB  1 
ATOM   5288 O  OG  . SER B 1 124 ? 0.431   -55.706 -17.164 1.00 27.21  ? 124  SER B OG  1 
ATOM   5289 N  N   . SER B 1 125 ? -3.945  -56.780 -17.387 1.00 23.27  ? 125  SER B N   1 
ATOM   5290 C  CA  . SER B 1 125 ? -5.036  -57.737 -17.558 1.00 20.81  ? 125  SER B CA  1 
ATOM   5291 C  C   . SER B 1 125 ? -4.592  -59.016 -18.260 1.00 25.90  ? 125  SER B C   1 
ATOM   5292 O  O   . SER B 1 125 ? -5.356  -59.991 -18.293 1.00 27.52  ? 125  SER B O   1 
ATOM   5293 C  CB  . SER B 1 125 ? -6.166  -57.093 -18.361 1.00 21.42  ? 125  SER B CB  1 
ATOM   5294 O  OG  . SER B 1 125 ? -5.715  -56.873 -19.689 1.00 23.16  ? 125  SER B OG  1 
ATOM   5295 N  N   . THR B 1 126 ? -3.390  -59.025 -18.830 1.00 25.12  ? 126  THR B N   1 
ATOM   5296 C  CA  . THR B 1 126 ? -2.946  -60.051 -19.762 1.00 27.57  ? 126  THR B CA  1 
ATOM   5297 C  C   . THR B 1 126 ? -2.034  -61.094 -19.128 1.00 28.12  ? 126  THR B C   1 
ATOM   5298 O  O   . THR B 1 126 ? -1.521  -61.962 -19.838 1.00 26.57  ? 126  THR B O   1 
ATOM   5299 C  CB  . THR B 1 126 ? -2.210  -59.390 -20.927 1.00 26.28  ? 126  THR B CB  1 
ATOM   5300 O  OG1 . THR B 1 126 ? -1.099  -58.655 -20.405 1.00 22.51  ? 126  THR B OG1 1 
ATOM   5301 C  CG2 . THR B 1 126 ? -3.133  -58.424 -21.653 1.00 27.28  ? 126  THR B CG2 1 
ATOM   5302 N  N   . LEU B 1 127 ? -1.804  -61.020 -17.820 1.00 24.25  ? 127  LEU B N   1 
ATOM   5303 C  CA  . LEU B 1 127 ? -0.915  -61.973 -17.174 1.00 25.79  ? 127  LEU B CA  1 
ATOM   5304 C  C   . LEU B 1 127 ? -1.428  -63.389 -17.380 1.00 25.13  ? 127  LEU B C   1 
ATOM   5305 O  O   . LEU B 1 127 ? -2.635  -63.627 -17.442 1.00 26.19  ? 127  LEU B O   1 
ATOM   5306 C  CB  . LEU B 1 127 ? -0.808  -61.669 -15.675 1.00 23.12  ? 127  LEU B CB  1 
ATOM   5307 C  CG  . LEU B 1 127 ? -0.290  -60.278 -15.329 1.00 24.06  ? 127  LEU B CG  1 
ATOM   5308 C  CD1 . LEU B 1 127 ? -0.057  -60.160 -13.821 1.00 20.59  ? 127  LEU B CD1 1 
ATOM   5309 C  CD2 . LEU B 1 127 ? 0.996   -60.006 -16.094 1.00 25.20  ? 127  LEU B CD2 1 
ATOM   5310 N  N   . ASP B 1 128 ? -0.492  -64.336 -17.489 1.00 27.21  ? 128  ASP B N   1 
ATOM   5311 C  CA  . ASP B 1 128 ? -0.871  -65.742 -17.594 1.00 30.08  ? 128  ASP B CA  1 
ATOM   5312 C  C   . ASP B 1 128 ? -1.774  -66.160 -16.437 1.00 32.79  ? 128  ASP B C   1 
ATOM   5313 O  O   . ASP B 1 128 ? -2.728  -66.930 -16.623 1.00 30.26  ? 128  ASP B O   1 
ATOM   5314 C  CB  . ASP B 1 128 ? 0.381   -66.623 -17.626 1.00 34.69  ? 128  ASP B CB  1 
ATOM   5315 C  CG  . ASP B 1 128 ? 1.173   -66.471 -18.909 1.00 32.96  ? 128  ASP B CG  1 
ATOM   5316 O  OD1 . ASP B 1 128 ? 0.654   -65.871 -19.874 1.00 38.78  ? 128  ASP B OD1 1 
ATOM   5317 O  OD2 . ASP B 1 128 ? 2.319   -66.957 -18.949 1.00 40.55  ? 128  ASP B OD2 1 
ATOM   5318 N  N   . VAL B 1 129 ? -1.492  -65.656 -15.232 1.00 26.87  ? 129  VAL B N   1 
ATOM   5319 C  CA  . VAL B 1 129 ? -2.273  -66.030 -14.054 1.00 29.00  ? 129  VAL B CA  1 
ATOM   5320 C  C   . VAL B 1 129 ? -3.678  -65.429 -14.050 1.00 30.02  ? 129  VAL B C   1 
ATOM   5321 O  O   . VAL B 1 129 ? -4.537  -65.885 -13.286 1.00 30.68  ? 129  VAL B O   1 
ATOM   5322 C  CB  . VAL B 1 129 ? -1.474  -65.662 -12.782 1.00 31.87  ? 129  VAL B CB  1 
ATOM   5323 C  CG1 . VAL B 1 129 ? -1.350  -64.154 -12.617 1.00 26.50  ? 129  VAL B CG1 1 
ATOM   5324 C  CG2 . VAL B 1 129 ? -2.091  -66.305 -11.552 1.00 26.72  ? 129  VAL B CG2 1 
ATOM   5325 N  N   . TYR B 1 130 ? -3.961  -64.437 -14.898 1.00 25.31  ? 130  TYR B N   1 
ATOM   5326 C  CA  . TYR B 1 130 ? -5.319  -63.911 -15.021 1.00 23.65  ? 130  TYR B CA  1 
ATOM   5327 C  C   . TYR B 1 130 ? -6.045  -64.445 -16.259 1.00 25.50  ? 130  TYR B C   1 
ATOM   5328 O  O   . TYR B 1 130 ? -7.093  -63.906 -16.624 1.00 25.79  ? 130  TYR B O   1 
ATOM   5329 C  CB  . TYR B 1 130 ? -5.318  -62.376 -15.072 1.00 24.59  ? 130  TYR B CB  1 
ATOM   5330 C  CG  . TYR B 1 130 ? -4.609  -61.657 -13.934 1.00 27.06  ? 130  TYR B CG  1 
ATOM   5331 C  CD1 . TYR B 1 130 ? -4.477  -62.225 -12.669 1.00 25.46  ? 130  TYR B CD1 1 
ATOM   5332 C  CD2 . TYR B 1 130 ? -4.086  -60.389 -14.138 1.00 22.09  ? 130  TYR B CD2 1 
ATOM   5333 C  CE1 . TYR B 1 130 ? -3.814  -61.532 -11.636 1.00 25.49  ? 130  TYR B CE1 1 
ATOM   5334 C  CE2 . TYR B 1 130 ? -3.446  -59.700 -13.139 1.00 24.84  ? 130  TYR B CE2 1 
ATOM   5335 C  CZ  . TYR B 1 130 ? -3.310  -60.266 -11.887 1.00 23.64  ? 130  TYR B CZ  1 
ATOM   5336 O  OH  . TYR B 1 130 ? -2.650  -59.541 -10.930 1.00 23.58  ? 130  TYR B OH  1 
ATOM   5337 N  N   . ASN B 1 131 ? -5.515  -65.478 -16.907 1.00 26.45  ? 131  ASN B N   1 
ATOM   5338 C  CA  . ASN B 1 131 ? -6.180  -66.072 -18.064 1.00 28.76  ? 131  ASN B CA  1 
ATOM   5339 C  C   . ASN B 1 131 ? -7.571  -66.565 -17.682 1.00 30.49  ? 131  ASN B C   1 
ATOM   5340 O  O   . ASN B 1 131 ? -7.712  -67.493 -16.882 1.00 30.31  ? 131  ASN B O   1 
ATOM   5341 C  CB  . ASN B 1 131 ? -5.340  -67.220 -18.606 1.00 27.36  ? 131  ASN B CB  1 
ATOM   5342 C  CG  . ASN B 1 131 ? -5.829  -67.714 -19.959 1.00 35.71  ? 131  ASN B CG  1 
ATOM   5343 O  OD1 . ASN B 1 131 ? -6.957  -67.431 -20.372 1.00 30.97  ? 131  ASN B OD1 1 
ATOM   5344 N  ND2 . ASN B 1 131 ? -4.984  -68.469 -20.646 1.00 37.18  ? 131  ASN B ND2 1 
ATOM   5345 N  N   . GLY B 1 132 ? -8.599  -65.960 -18.280 1.00 26.78  ? 132  GLY B N   1 
ATOM   5346 C  CA  . GLY B 1 132 ? -9.962  -66.235 -17.868 1.00 28.25  ? 132  GLY B CA  1 
ATOM   5347 C  C   . GLY B 1 132 ? -10.563 -67.533 -18.362 1.00 28.64  ? 132  GLY B C   1 
ATOM   5348 O  O   . GLY B 1 132 ? -11.690 -67.856 -17.973 1.00 27.24  ? 132  GLY B O   1 
ATOM   5349 N  N   . LYS B 1 133 ? -9.850  -68.292 -19.200 1.00 27.52  ? 133  LYS B N   1 
ATOM   5350 C  CA  . LYS B 1 133 ? -10.513 -69.375 -19.924 1.00 28.68  ? 133  LYS B CA  1 
ATOM   5351 C  C   . LYS B 1 133 ? -10.897 -70.547 -19.022 1.00 31.16  ? 133  LYS B C   1 
ATOM   5352 O  O   . LYS B 1 133 ? -11.911 -71.209 -19.280 1.00 27.70  ? 133  LYS B O   1 
ATOM   5353 C  CB  . LYS B 1 133 ? -9.636  -69.853 -21.084 1.00 29.21  ? 133  LYS B CB  1 
ATOM   5354 C  CG  . LYS B 1 133 ? -8.397  -70.631 -20.722 1.00 32.42  ? 133  LYS B CG  1 
ATOM   5355 C  CD  . LYS B 1 133 ? -7.621  -70.966 -21.999 1.00 37.09  ? 133  LYS B CD  1 
ATOM   5356 C  CE  . LYS B 1 133 ? -6.479  -71.933 -21.735 1.00 35.95  ? 133  LYS B CE  1 
ATOM   5357 N  NZ  . LYS B 1 133 ? -5.669  -72.205 -22.969 1.00 37.47  ? 133  LYS B NZ  1 
ATOM   5358 N  N   . TYR B 1 134 ? -10.122 -70.821 -17.969 1.00 27.89  ? 134  TYR B N   1 
ATOM   5359 C  CA  . TYR B 1 134 ? -10.448 -71.948 -17.096 1.00 30.30  ? 134  TYR B CA  1 
ATOM   5360 C  C   . TYR B 1 134 ? -11.697 -71.669 -16.274 1.00 27.65  ? 134  TYR B C   1 
ATOM   5361 O  O   . TYR B 1 134 ? -12.555 -72.547 -16.120 1.00 27.87  ? 134  TYR B O   1 
ATOM   5362 C  CB  . TYR B 1 134 ? -9.262  -72.273 -16.187 1.00 29.33  ? 134  TYR B CB  1 
ATOM   5363 C  CG  . TYR B 1 134 ? -8.002  -72.464 -16.973 1.00 29.59  ? 134  TYR B CG  1 
ATOM   5364 C  CD1 . TYR B 1 134 ? -7.843  -73.566 -17.806 1.00 30.69  ? 134  TYR B CD1 1 
ATOM   5365 C  CD2 . TYR B 1 134 ? -6.981  -71.526 -16.921 1.00 30.10  ? 134  TYR B CD2 1 
ATOM   5366 C  CE1 . TYR B 1 134 ? -6.689  -73.737 -18.549 1.00 32.52  ? 134  TYR B CE1 1 
ATOM   5367 C  CE2 . TYR B 1 134 ? -5.829  -71.686 -17.672 1.00 33.56  ? 134  TYR B CE2 1 
ATOM   5368 C  CZ  . TYR B 1 134 ? -5.690  -72.792 -18.476 1.00 33.03  ? 134  TYR B CZ  1 
ATOM   5369 O  OH  . TYR B 1 134 ? -4.538  -72.951 -19.209 1.00 37.07  ? 134  TYR B OH  1 
ATOM   5370 N  N   . LEU B 1 135 ? -11.824 -70.453 -15.745 1.00 29.06  ? 135  LEU B N   1 
ATOM   5371 C  CA  . LEU B 1 135 ? -12.989 -70.117 -14.936 1.00 28.89  ? 135  LEU B CA  1 
ATOM   5372 C  C   . LEU B 1 135 ? -14.242 -70.022 -15.796 1.00 30.99  ? 135  LEU B C   1 
ATOM   5373 O  O   . LEU B 1 135 ? -15.297 -70.554 -15.432 1.00 28.78  ? 135  LEU B O   1 
ATOM   5374 C  CB  . LEU B 1 135 ? -12.722 -68.809 -14.188 1.00 31.87  ? 135  LEU B CB  1 
ATOM   5375 C  CG  . LEU B 1 135 ? -13.630 -68.282 -13.085 1.00 37.13  ? 135  LEU B CG  1 
ATOM   5376 C  CD1 . LEU B 1 135 ? -13.961 -69.369 -12.089 1.00 32.44  ? 135  LEU B CD1 1 
ATOM   5377 C  CD2 . LEU B 1 135 ? -12.939 -67.110 -12.396 1.00 28.69  ? 135  LEU B CD2 1 
ATOM   5378 N  N   . ALA B 1 136 ? -14.139 -69.378 -16.960 1.00 28.41  ? 136  ALA B N   1 
ATOM   5379 C  CA  . ALA B 1 136 ? -15.306 -69.241 -17.827 1.00 27.29  ? 136  ALA B CA  1 
ATOM   5380 C  C   . ALA B 1 136 ? -15.800 -70.600 -18.303 1.00 29.07  ? 136  ALA B C   1 
ATOM   5381 O  O   . ALA B 1 136 ? -17.006 -70.869 -18.292 1.00 32.93  ? 136  ALA B O   1 
ATOM   5382 C  CB  . ALA B 1 136 ? -14.973 -68.341 -19.020 1.00 27.03  ? 136  ALA B CB  1 
ATOM   5383 N  N   . TYR B 1 137 ? -14.879 -71.471 -18.715 1.00 31.16  ? 137  TYR B N   1 
ATOM   5384 C  CA  . TYR B 1 137 ? -15.255 -72.794 -19.198 1.00 28.55  ? 137  TYR B CA  1 
ATOM   5385 C  C   . TYR B 1 137 ? -15.808 -73.662 -18.073 1.00 35.76  ? 137  TYR B C   1 
ATOM   5386 O  O   . TYR B 1 137 ? -16.885 -74.255 -18.203 1.00 33.83  ? 137  TYR B O   1 
ATOM   5387 C  CB  . TYR B 1 137 ? -14.047 -73.470 -19.839 1.00 32.77  ? 137  TYR B CB  1 
ATOM   5388 C  CG  . TYR B 1 137 ? -14.267 -74.935 -20.119 1.00 38.42  ? 137  TYR B CG  1 
ATOM   5389 C  CD1 . TYR B 1 137 ? -15.028 -75.342 -21.206 1.00 39.52  ? 137  TYR B CD1 1 
ATOM   5390 C  CD2 . TYR B 1 137 ? -13.715 -75.913 -19.300 1.00 38.24  ? 137  TYR B CD2 1 
ATOM   5391 C  CE1 . TYR B 1 137 ? -15.238 -76.675 -21.469 1.00 40.26  ? 137  TYR B CE1 1 
ATOM   5392 C  CE2 . TYR B 1 137 ? -13.919 -77.253 -19.558 1.00 39.80  ? 137  TYR B CE2 1 
ATOM   5393 C  CZ  . TYR B 1 137 ? -14.682 -77.625 -20.645 1.00 41.66  ? 137  TYR B CZ  1 
ATOM   5394 O  OH  . TYR B 1 137 ? -14.895 -78.955 -20.905 1.00 42.83  ? 137  TYR B OH  1 
ATOM   5395 N  N   . THR B 1 138 ? -15.076 -73.755 -16.961 1.00 28.29  ? 138  THR B N   1 
ATOM   5396 C  CA  . THR B 1 138 ? -15.450 -74.686 -15.899 1.00 31.78  ? 138  THR B CA  1 
ATOM   5397 C  C   . THR B 1 138 ? -16.756 -74.284 -15.224 1.00 30.62  ? 138  THR B C   1 
ATOM   5398 O  O   . THR B 1 138 ? -17.576 -75.143 -14.887 1.00 34.43  ? 138  THR B O   1 
ATOM   5399 C  CB  . THR B 1 138 ? -14.322 -74.780 -14.868 1.00 27.36  ? 138  THR B CB  1 
ATOM   5400 O  OG1 . THR B 1 138 ? -13.126 -75.229 -15.516 1.00 31.50  ? 138  THR B OG1 1 
ATOM   5401 C  CG2 . THR B 1 138 ? -14.689 -75.757 -13.741 1.00 32.26  ? 138  THR B CG2 1 
ATOM   5402 N  N   . GLU B 1 139 ? -16.973 -72.993 -15.004 1.00 31.29  ? 139  GLU B N   1 
ATOM   5403 C  CA  . GLU B 1 139 ? -18.137 -72.541 -14.253 1.00 30.18  ? 139  GLU B CA  1 
ATOM   5404 C  C   . GLU B 1 139 ? -19.209 -71.905 -15.128 1.00 30.02  ? 139  GLU B C   1 
ATOM   5405 O  O   . GLU B 1 139 ? -20.255 -71.493 -14.605 1.00 30.03  ? 139  GLU B O   1 
ATOM   5406 C  CB  . GLU B 1 139 ? -17.703 -71.570 -13.150 1.00 28.58  ? 139  GLU B CB  1 
ATOM   5407 C  CG  . GLU B 1 139 ? -16.810 -72.222 -12.091 1.00 25.38  ? 139  GLU B CG  1 
ATOM   5408 C  CD  . GLU B 1 139 ? -17.549 -73.272 -11.278 1.00 31.41  ? 139  GLU B CD  1 
ATOM   5409 O  OE1 . GLU B 1 139 ? -18.733 -73.054 -10.954 1.00 29.86  ? 139  GLU B OE1 1 
ATOM   5410 O  OE2 . GLU B 1 139 ? -16.945 -74.318 -10.963 1.00 31.80  ? 139  GLU B OE2 1 
ATOM   5411 N  N   . GLU B 1 140 ? -18.990 -71.846 -16.443 1.00 34.53  ? 140  GLU B N   1 
ATOM   5412 C  CA  . GLU B 1 140 ? -19.976 -71.334 -17.392 1.00 35.54  ? 140  GLU B CA  1 
ATOM   5413 C  C   . GLU B 1 140 ? -20.403 -69.919 -17.022 1.00 33.47  ? 140  GLU B C   1 
ATOM   5414 O  O   . GLU B 1 140 ? -21.585 -69.621 -16.860 1.00 31.28  ? 140  GLU B O   1 
ATOM   5415 C  CB  . GLU B 1 140 ? -21.181 -72.269 -17.500 1.00 38.65  ? 140  GLU B CB  1 
ATOM   5416 C  CG  . GLU B 1 140 ? -20.799 -73.736 -17.483 1.00 45.96  ? 140  GLU B CG  1 
ATOM   5417 C  CD  . GLU B 1 140 ? -21.636 -74.558 -18.435 1.00 58.13  ? 140  GLU B CD  1 
ATOM   5418 O  OE1 . GLU B 1 140 ? -21.556 -75.807 -18.382 1.00 61.88  ? 140  GLU B OE1 1 
ATOM   5419 O  OE2 . GLU B 1 140 ? -22.354 -73.945 -19.256 1.00 60.04  ? 140  GLU B OE2 1 
ATOM   5420 N  N   . VAL B 1 141 ? -19.413 -69.045 -16.861 1.00 29.97  ? 141  VAL B N   1 
ATOM   5421 C  CA  . VAL B 1 141 ? -19.657 -67.626 -16.669 1.00 30.01  ? 141  VAL B CA  1 
ATOM   5422 C  C   . VAL B 1 141 ? -19.001 -66.892 -17.830 1.00 25.38  ? 141  VAL B C   1 
ATOM   5423 O  O   . VAL B 1 141 ? -18.105 -67.411 -18.500 1.00 26.16  ? 141  VAL B O   1 
ATOM   5424 C  CB  . VAL B 1 141 ? -19.123 -67.110 -15.311 1.00 26.47  ? 141  VAL B CB  1 
ATOM   5425 C  CG1 . VAL B 1 141 ? -19.821 -67.808 -14.154 1.00 29.30  ? 141  VAL B CG1 1 
ATOM   5426 C  CG2 . VAL B 1 141 ? -17.609 -67.289 -15.213 1.00 29.11  ? 141  VAL B CG2 1 
ATOM   5427 N  N   . VAL B 1 142 ? -19.467 -65.675 -18.066 1.00 24.85  ? 142  VAL B N   1 
ATOM   5428 C  CA  . VAL B 1 142 ? -18.772 -64.739 -18.940 1.00 26.88  ? 142  VAL B CA  1 
ATOM   5429 C  C   . VAL B 1 142 ? -17.766 -63.991 -18.074 1.00 24.62  ? 142  VAL B C   1 
ATOM   5430 O  O   . VAL B 1 142 ? -18.150 -63.325 -17.103 1.00 25.48  ? 142  VAL B O   1 
ATOM   5431 C  CB  . VAL B 1 142 ? -19.757 -63.777 -19.620 1.00 28.50  ? 142  VAL B CB  1 
ATOM   5432 C  CG1 . VAL B 1 142 ? -18.998 -62.668 -20.333 1.00 25.73  ? 142  VAL B CG1 1 
ATOM   5433 C  CG2 . VAL B 1 142 ? -20.652 -64.542 -20.601 1.00 30.46  ? 142  VAL B CG2 1 
ATOM   5434 N  N   . LEU B 1 143 ? -16.483 -64.126 -18.404 1.00 23.20  ? 143  LEU B N   1 
ATOM   5435 C  CA  . LEU B 1 143 ? -15.383 -63.587 -17.607 1.00 25.56  ? 143  LEU B CA  1 
ATOM   5436 C  C   . LEU B 1 143 ? -14.754 -62.418 -18.347 1.00 24.99  ? 143  LEU B C   1 
ATOM   5437 O  O   . LEU B 1 143 ? -14.230 -62.583 -19.455 1.00 27.49  ? 143  LEU B O   1 
ATOM   5438 C  CB  . LEU B 1 143 ? -14.330 -64.655 -17.329 1.00 28.39  ? 143  LEU B CB  1 
ATOM   5439 C  CG  . LEU B 1 143 ? -13.213 -64.302 -16.329 1.00 27.28  ? 143  LEU B CG  1 
ATOM   5440 C  CD1 . LEU B 1 143 ? -13.790 -63.647 -15.099 1.00 28.43  ? 143  LEU B CD1 1 
ATOM   5441 C  CD2 . LEU B 1 143 ? -12.581 -65.578 -15.926 1.00 33.25  ? 143  LEU B CD2 1 
ATOM   5442 N  N   . VAL B 1 144 ? -14.817 -61.245 -17.738 1.00 23.36  ? 144  VAL B N   1 
ATOM   5443 C  CA  . VAL B 1 144 ? -14.230 -60.028 -18.279 1.00 21.79  ? 144  VAL B CA  1 
ATOM   5444 C  C   . VAL B 1 144 ? -13.031 -59.664 -17.417 1.00 22.31  ? 144  VAL B C   1 
ATOM   5445 O  O   . VAL B 1 144 ? -13.112 -59.734 -16.187 1.00 25.03  ? 144  VAL B O   1 
ATOM   5446 C  CB  . VAL B 1 144 ? -15.252 -58.875 -18.277 1.00 23.79  ? 144  VAL B CB  1 
ATOM   5447 C  CG1 . VAL B 1 144 ? -14.614 -57.599 -18.786 1.00 23.16  ? 144  VAL B CG1 1 
ATOM   5448 C  CG2 . VAL B 1 144 ? -16.501 -59.252 -19.081 1.00 24.52  ? 144  VAL B CG2 1 
ATOM   5449 N  N   . SER B 1 145 ? -11.933 -59.256 -18.046 1.00 22.73  ? 145  SER B N   1 
ATOM   5450 C  CA  . SER B 1 145 ? -10.866 -58.573 -17.319 1.00 23.77  ? 145  SER B CA  1 
ATOM   5451 C  C   . SER B 1 145 ? -10.711 -57.181 -17.911 1.00 25.91  ? 145  SER B C   1 
ATOM   5452 O  O   . SER B 1 145 ? -10.581 -57.029 -19.132 1.00 24.01  ? 145  SER B O   1 
ATOM   5453 C  CB  . SER B 1 145 ? -9.535  -59.348 -17.356 1.00 24.57  ? 145  SER B CB  1 
ATOM   5454 O  OG  . SER B 1 145 ? -9.060  -59.616 -18.677 1.00 23.92  ? 145  SER B OG  1 
ATOM   5455 N  N   . LEU B 1 146 ? -10.772 -56.167 -17.057 1.00 22.21  ? 146  LEU B N   1 
ATOM   5456 C  CA  . LEU B 1 146 ? -10.634 -54.796 -17.513 1.00 23.36  ? 146  LEU B CA  1 
ATOM   5457 C  C   . LEU B 1 146 ? -9.195  -54.330 -17.298 1.00 26.52  ? 146  LEU B C   1 
ATOM   5458 O  O   . LEU B 1 146 ? -8.340  -55.068 -16.805 1.00 26.04  ? 146  LEU B O   1 
ATOM   5459 C  CB  . LEU B 1 146 ? -11.653 -53.895 -16.809 1.00 19.25  ? 146  LEU B CB  1 
ATOM   5460 C  CG  . LEU B 1 146 ? -11.705 -53.870 -15.270 1.00 20.54  ? 146  LEU B CG  1 
ATOM   5461 C  CD1 . LEU B 1 146 ? -10.568 -53.061 -14.649 1.00 22.41  ? 146  LEU B CD1 1 
ATOM   5462 C  CD2 . LEU B 1 146 ? -13.061 -53.319 -14.826 1.00 21.37  ? 146  LEU B CD2 1 
ATOM   5463 N  N   . SER B 1 147 ? -8.925  -53.084 -17.675 1.00 25.84  ? 147  SER B N   1 
ATOM   5464 C  CA  . SER B 1 147 ? -7.642  -52.469 -17.391 1.00 23.43  ? 147  SER B CA  1 
ATOM   5465 C  C   . SER B 1 147 ? -7.896  -51.052 -16.917 1.00 23.41  ? 147  SER B C   1 
ATOM   5466 O  O   . SER B 1 147 ? -9.000  -50.522 -17.047 1.00 24.90  ? 147  SER B O   1 
ATOM   5467 C  CB  . SER B 1 147 ? -6.716  -52.456 -18.617 1.00 22.77  ? 147  SER B CB  1 
ATOM   5468 O  OG  . SER B 1 147 ? -7.297  -51.698 -19.671 1.00 27.49  ? 147  SER B OG  1 
ATOM   5469 N  N   . TYR B 1 148 ? -6.869  -50.453 -16.328 1.00 23.14  ? 148  TYR B N   1 
ATOM   5470 C  CA  . TYR B 1 148 ? -6.989  -49.081 -15.868 1.00 22.46  ? 148  TYR B CA  1 
ATOM   5471 C  C   . TYR B 1 148 ? -5.593  -48.493 -15.724 1.00 24.34  ? 148  TYR B C   1 
ATOM   5472 O  O   . TYR B 1 148 ? -4.625  -49.213 -15.463 1.00 26.18  ? 148  TYR B O   1 
ATOM   5473 C  CB  . TYR B 1 148 ? -7.767  -48.984 -14.543 1.00 20.40  ? 148  TYR B CB  1 
ATOM   5474 C  CG  . TYR B 1 148 ? -7.140  -49.755 -13.392 1.00 23.66  ? 148  TYR B CG  1 
ATOM   5475 C  CD1 . TYR B 1 148 ? -7.377  -51.116 -13.233 1.00 23.58  ? 148  TYR B CD1 1 
ATOM   5476 C  CD2 . TYR B 1 148 ? -6.309  -49.124 -12.473 1.00 23.20  ? 148  TYR B CD2 1 
ATOM   5477 C  CE1 . TYR B 1 148 ? -6.814  -51.831 -12.165 1.00 22.19  ? 148  TYR B CE1 1 
ATOM   5478 C  CE2 . TYR B 1 148 ? -5.743  -49.829 -11.400 1.00 22.42  ? 148  TYR B CE2 1 
ATOM   5479 C  CZ  . TYR B 1 148 ? -5.994  -51.184 -11.272 1.00 21.44  ? 148  TYR B CZ  1 
ATOM   5480 O  OH  . TYR B 1 148 ? -5.445  -51.895 -10.226 1.00 22.12  ? 148  TYR B OH  1 
ATOM   5481 N  N   . ARG B 1 149 ? -5.510  -47.175 -15.907 1.00 24.88  ? 149  ARG B N   1 
ATOM   5482 C  CA  . ARG B 1 149 ? -4.250  -46.463 -15.772 1.00 22.69  ? 149  ARG B CA  1 
ATOM   5483 C  C   . ARG B 1 149 ? -3.736  -46.567 -14.341 1.00 24.35  ? 149  ARG B C   1 
ATOM   5484 O  O   . ARG B 1 149 ? -4.496  -46.403 -13.383 1.00 24.35  ? 149  ARG B O   1 
ATOM   5485 C  CB  . ARG B 1 149 ? -4.444  -44.999 -16.143 1.00 23.42  ? 149  ARG B CB  1 
ATOM   5486 C  CG  . ARG B 1 149 ? -4.573  -44.752 -17.657 1.00 26.61  ? 149  ARG B CG  1 
ATOM   5487 C  CD  . ARG B 1 149 ? -4.951  -43.302 -17.929 1.00 27.85  ? 149  ARG B CD  1 
ATOM   5488 N  NE  . ARG B 1 149 ? -6.381  -43.070 -17.754 1.00 23.53  ? 149  ARG B NE  1 
ATOM   5489 C  CZ  . ARG B 1 149 ? -6.956  -41.868 -17.791 1.00 29.10  ? 149  ARG B CZ  1 
ATOM   5490 N  NH1 . ARG B 1 149 ? -6.219  -40.783 -18.000 1.00 25.18  ? 149  ARG B NH1 1 
ATOM   5491 N  NH2 . ARG B 1 149 ? -8.275  -41.749 -17.629 1.00 26.76  ? 149  ARG B NH2 1 
ATOM   5492 N  N   . VAL B 1 150 ? -2.436  -46.820 -14.204 1.00 23.50  ? 150  VAL B N   1 
ATOM   5493 C  CA  . VAL B 1 150 ? -1.787  -46.952 -12.909 1.00 24.80  ? 150  VAL B CA  1 
ATOM   5494 C  C   . VAL B 1 150 ? -0.714  -45.875 -12.777 1.00 25.73  ? 150  VAL B C   1 
ATOM   5495 O  O   . VAL B 1 150 ? -0.413  -45.141 -13.719 1.00 25.74  ? 150  VAL B O   1 
ATOM   5496 C  CB  . VAL B 1 150 ? -1.186  -48.355 -12.693 1.00 22.07  ? 150  VAL B CB  1 
ATOM   5497 C  CG1 . VAL B 1 150 ? -2.307  -49.380 -12.565 1.00 24.22  ? 150  VAL B CG1 1 
ATOM   5498 C  CG2 . VAL B 1 150 ? -0.211  -48.719 -13.835 1.00 22.86  ? 150  VAL B CG2 1 
ATOM   5499 N  N   . GLY B 1 151 ? -0.133  -45.796 -11.583 1.00 24.95  ? 151  GLY B N   1 
ATOM   5500 C  CA  . GLY B 1 151 ? 0.890   -44.801 -11.325 1.00 28.23  ? 151  GLY B CA  1 
ATOM   5501 C  C   . GLY B 1 151 ? 0.360   -43.390 -11.513 1.00 27.45  ? 151  GLY B C   1 
ATOM   5502 O  O   . GLY B 1 151 ? -0.844  -43.123 -11.411 1.00 25.08  ? 151  GLY B O   1 
ATOM   5503 N  N   . ALA B 1 152 ? 1.284   -42.467 -11.804 1.00 27.47  ? 152  ALA B N   1 
ATOM   5504 C  CA  . ALA B 1 152 ? 0.904   -41.075 -12.016 1.00 28.29  ? 152  ALA B CA  1 
ATOM   5505 C  C   . ALA B 1 152 ? -0.133  -40.935 -13.122 1.00 24.79  ? 152  ALA B C   1 
ATOM   5506 O  O   . ALA B 1 152 ? -1.000  -40.063 -13.044 1.00 27.60  ? 152  ALA B O   1 
ATOM   5507 C  CB  . ALA B 1 152 ? 2.138   -40.234 -12.348 1.00 26.36  ? 152  ALA B CB  1 
ATOM   5508 N  N   . PHE B 1 153 ? -0.066  -41.789 -14.144 1.00 25.34  ? 153  PHE B N   1 
ATOM   5509 C  CA  . PHE B 1 153 ? -0.993  -41.686 -15.266 1.00 27.44  ? 153  PHE B CA  1 
ATOM   5510 C  C   . PHE B 1 153 ? -2.430  -41.924 -14.827 1.00 28.14  ? 153  PHE B C   1 
ATOM   5511 O  O   . PHE B 1 153 ? -3.364  -41.392 -15.438 1.00 26.41  ? 153  PHE B O   1 
ATOM   5512 C  CB  . PHE B 1 153 ? -0.599  -42.678 -16.359 1.00 27.61  ? 153  PHE B CB  1 
ATOM   5513 C  CG  . PHE B 1 153 ? 0.874   -42.659 -16.685 1.00 29.92  ? 153  PHE B CG  1 
ATOM   5514 C  CD1 . PHE B 1 153 ? 1.356   -41.870 -17.713 1.00 32.11  ? 153  PHE B CD1 1 
ATOM   5515 C  CD2 . PHE B 1 153 ? 1.775   -43.424 -15.959 1.00 27.90  ? 153  PHE B CD2 1 
ATOM   5516 C  CE1 . PHE B 1 153 ? 2.708   -41.847 -18.012 1.00 31.67  ? 153  PHE B CE1 1 
ATOM   5517 C  CE2 . PHE B 1 153 ? 3.135   -43.395 -16.250 1.00 28.53  ? 153  PHE B CE2 1 
ATOM   5518 C  CZ  . PHE B 1 153 ? 3.594   -42.609 -17.281 1.00 32.26  ? 153  PHE B CZ  1 
ATOM   5519 N  N   . GLY B 1 154 ? -2.631  -42.712 -13.778 1.00 24.06  ? 154  GLY B N   1 
ATOM   5520 C  CA  . GLY B 1 154 ? -3.986  -42.983 -13.350 1.00 25.07  ? 154  GLY B CA  1 
ATOM   5521 C  C   . GLY B 1 154 ? -4.378  -42.234 -12.099 1.00 26.95  ? 154  GLY B C   1 
ATOM   5522 O  O   . GLY B 1 154 ? -5.568  -42.113 -11.792 1.00 25.78  ? 154  GLY B O   1 
ATOM   5523 N  N   . PHE B 1 155 ? -3.400  -41.719 -11.356 1.00 26.48  ? 155  PHE B N   1 
ATOM   5524 C  CA  . PHE B 1 155 ? -3.736  -41.229 -10.026 1.00 27.11  ? 155  PHE B CA  1 
ATOM   5525 C  C   . PHE B 1 155 ? -3.000  -39.962 -9.616  1.00 27.03  ? 155  PHE B C   1 
ATOM   5526 O  O   . PHE B 1 155 ? -3.057  -39.595 -8.436  1.00 29.01  ? 155  PHE B O   1 
ATOM   5527 C  CB  . PHE B 1 155 ? -3.525  -42.358 -9.004  1.00 23.50  ? 155  PHE B CB  1 
ATOM   5528 C  CG  . PHE B 1 155 ? -4.472  -43.504 -9.221  1.00 22.90  ? 155  PHE B CG  1 
ATOM   5529 C  CD1 . PHE B 1 155 ? -5.797  -43.400 -8.829  1.00 24.66  ? 155  PHE B CD1 1 
ATOM   5530 C  CD2 . PHE B 1 155 ? -4.063  -44.647 -9.889  1.00 23.36  ? 155  PHE B CD2 1 
ATOM   5531 C  CE1 . PHE B 1 155 ? -6.701  -44.428 -9.078  1.00 23.75  ? 155  PHE B CE1 1 
ATOM   5532 C  CE2 . PHE B 1 155 ? -4.959  -45.683 -10.147 1.00 24.00  ? 155  PHE B CE2 1 
ATOM   5533 C  CZ  . PHE B 1 155 ? -6.282  -45.573 -9.739  1.00 24.62  ? 155  PHE B CZ  1 
ATOM   5534 N  N   . LEU B 1 156 ? -2.334  -39.268 -10.541 1.00 27.33  ? 156  LEU B N   1 
ATOM   5535 C  CA  . LEU B 1 156 ? -1.910  -37.901 -10.260 1.00 30.15  ? 156  LEU B CA  1 
ATOM   5536 C  C   . LEU B 1 156 ? -3.122  -37.073 -9.860  1.00 29.24  ? 156  LEU B C   1 
ATOM   5537 O  O   . LEU B 1 156 ? -4.159  -37.114 -10.522 1.00 31.75  ? 156  LEU B O   1 
ATOM   5538 C  CB  . LEU B 1 156 ? -1.234  -37.284 -11.482 1.00 34.50  ? 156  LEU B CB  1 
ATOM   5539 C  CG  . LEU B 1 156 ? -0.597  -35.925 -11.209 1.00 33.24  ? 156  LEU B CG  1 
ATOM   5540 C  CD1 . LEU B 1 156 ? 0.806   -36.122 -10.685 1.00 34.41  ? 156  LEU B CD1 1 
ATOM   5541 C  CD2 . LEU B 1 156 ? -0.584  -35.089 -12.487 1.00 38.51  ? 156  LEU B CD2 1 
ATOM   5542 N  N   . ALA B 1 157 ? -3.005  -36.341 -8.755  1.00 34.69  ? 157  ALA B N   1 
ATOM   5543 C  CA  . ALA B 1 157 ? -4.165  -35.672 -8.168  1.00 34.11  ? 157  ALA B CA  1 
ATOM   5544 C  C   . ALA B 1 157 ? -3.789  -34.249 -7.783  1.00 35.56  ? 157  ALA B C   1 
ATOM   5545 O  O   . ALA B 1 157 ? -3.028  -34.037 -6.834  1.00 35.38  ? 157  ALA B O   1 
ATOM   5546 C  CB  . ALA B 1 157 ? -4.691  -36.439 -6.949  1.00 31.02  ? 157  ALA B CB  1 
ATOM   5547 N  N   . LEU B 1 158 ? -4.338  -33.279 -8.507  1.00 34.58  ? 158  LEU B N   1 
ATOM   5548 C  CA  . LEU B 1 158 ? -4.208  -31.860 -8.190  1.00 37.60  ? 158  LEU B CA  1 
ATOM   5549 C  C   . LEU B 1 158 ? -5.622  -31.331 -7.994  1.00 38.25  ? 158  LEU B C   1 
ATOM   5550 O  O   . LEU B 1 158 ? -6.214  -30.760 -8.913  1.00 39.15  ? 158  LEU B O   1 
ATOM   5551 C  CB  . LEU B 1 158 ? -3.454  -31.116 -9.310  1.00 39.78  ? 158  LEU B CB  1 
ATOM   5552 C  CG  . LEU B 1 158 ? -1.962  -31.435 -9.387  1.00 37.00  ? 158  LEU B CG  1 
ATOM   5553 C  CD1 . LEU B 1 158 ? -1.362  -31.017 -10.730 1.00 35.85  ? 158  LEU B CD1 1 
ATOM   5554 C  CD2 . LEU B 1 158 ? -1.233  -30.767 -8.227  1.00 38.21  ? 158  LEU B CD2 1 
ATOM   5555 N  N   . HIS B 1 159 ? -6.169  -31.537 -6.793  1.00 37.32  ? 159  HIS B N   1 
ATOM   5556 C  CA  . HIS B 1 159 ? -7.584  -31.264 -6.559  1.00 38.11  ? 159  HIS B CA  1 
ATOM   5557 C  C   . HIS B 1 159 ? -7.922  -29.810 -6.852  1.00 36.85  ? 159  HIS B C   1 
ATOM   5558 O  O   . HIS B 1 159 ? -7.224  -28.894 -6.410  1.00 40.63  ? 159  HIS B O   1 
ATOM   5559 C  CB  . HIS B 1 159 ? -7.977  -31.598 -5.123  1.00 42.78  ? 159  HIS B CB  1 
ATOM   5560 C  CG  . HIS B 1 159 ? -9.452  -31.507 -4.885  1.00 42.64  ? 159  HIS B CG  1 
ATOM   5561 N  ND1 . HIS B 1 159 ? -10.004 -30.695 -3.918  1.00 43.84  ? 159  HIS B ND1 1 
ATOM   5562 C  CD2 . HIS B 1 159 ? -10.490 -32.119 -5.502  1.00 43.32  ? 159  HIS B CD2 1 
ATOM   5563 C  CE1 . HIS B 1 159 ? -11.319 -30.812 -3.948  1.00 45.78  ? 159  HIS B CE1 1 
ATOM   5564 N  NE2 . HIS B 1 159 ? -11.640 -31.669 -4.901  1.00 50.95  ? 159  HIS B NE2 1 
ATOM   5565 N  N   . GLY B 1 160 ? -9.017  -29.603 -7.575  1.00 40.95  ? 160  GLY B N   1 
ATOM   5566 C  CA  . GLY B 1 160 ? -9.367  -28.284 -8.063  1.00 43.37  ? 160  GLY B CA  1 
ATOM   5567 C  C   . GLY B 1 160 ? -9.157  -28.193 -9.560  1.00 42.44  ? 160  GLY B C   1 
ATOM   5568 O  O   . GLY B 1 160 ? -9.904  -27.516 -10.269 1.00 44.77  ? 160  GLY B O   1 
ATOM   5569 N  N   . SER B 1 161 ? -8.132  -28.880 -10.052 1.00 46.30  ? 161  SER B N   1 
ATOM   5570 C  CA  . SER B 1 161 ? -7.886  -28.961 -11.483 1.00 38.56  ? 161  SER B CA  1 
ATOM   5571 C  C   . SER B 1 161 ? -8.847  -29.954 -12.124 1.00 43.29  ? 161  SER B C   1 
ATOM   5572 O  O   . SER B 1 161 ? -9.161  -30.999 -11.545 1.00 43.78  ? 161  SER B O   1 
ATOM   5573 C  CB  . SER B 1 161 ? -6.436  -29.375 -11.742 1.00 41.82  ? 161  SER B CB  1 
ATOM   5574 O  OG  . SER B 1 161 ? -6.226  -29.749 -13.091 1.00 40.47  ? 161  SER B OG  1 
ATOM   5575 N  N   . GLN B 1 162 ? -9.334  -29.616 -13.316 1.00 42.46  ? 162  GLN B N   1 
ATOM   5576 C  CA  . GLN B 1 162 ? -10.101 -30.557 -14.117 1.00 39.72  ? 162  GLN B CA  1 
ATOM   5577 C  C   . GLN B 1 162 ? -9.231  -31.313 -15.108 1.00 41.50  ? 162  GLN B C   1 
ATOM   5578 O  O   . GLN B 1 162 ? -9.724  -32.232 -15.768 1.00 43.52  ? 162  GLN B O   1 
ATOM   5579 C  CB  . GLN B 1 162 ? -11.226 -29.837 -14.874 0.98 45.85  ? 162  GLN B CB  1 
ATOM   5580 C  CG  . GLN B 1 162 ? -12.269 -29.178 -13.980 1.00 47.16  ? 162  GLN B CG  1 
ATOM   5581 C  CD  . GLN B 1 162 ? -12.907 -30.155 -13.017 0.76 47.64  ? 162  GLN B CD  1 
ATOM   5582 O  OE1 . GLN B 1 162 ? -13.264 -31.269 -13.395 0.78 52.98  ? 162  GLN B OE1 1 
ATOM   5583 N  NE2 . GLN B 1 162 ? -13.046 -29.746 -11.762 1.00 48.18  ? 162  GLN B NE2 1 
ATOM   5584 N  N   . GLU B 1 163 ? -7.956  -30.945 -15.226 1.00 41.06  ? 163  GLU B N   1 
ATOM   5585 C  CA  . GLU B 1 163 ? -7.036  -31.613 -16.137 1.00 40.95  ? 163  GLU B CA  1 
ATOM   5586 C  C   . GLU B 1 163 ? -6.327  -32.788 -15.480 1.00 40.85  ? 163  GLU B C   1 
ATOM   5587 O  O   . GLU B 1 163 ? -5.957  -33.750 -16.165 1.00 37.49  ? 163  GLU B O   1 
ATOM   5588 C  CB  . GLU B 1 163 ? -5.993  -30.617 -16.653 1.00 43.12  ? 163  GLU B CB  1 
ATOM   5589 C  CG  . GLU B 1 163 ? -6.552  -29.498 -17.518 1.00 43.73  ? 163  GLU B CG  1 
ATOM   5590 C  CD  . GLU B 1 163 ? -7.140  -29.995 -18.817 0.97 47.03  ? 163  GLU B CD  1 
ATOM   5591 O  OE1 . GLU B 1 163 ? -6.602  -30.967 -19.390 1.00 47.12  ? 163  GLU B OE1 1 
ATOM   5592 O  OE2 . GLU B 1 163 ? -8.134  -29.402 -19.282 1.00 52.39  ? 163  GLU B OE2 1 
ATOM   5593 N  N   . ALA B 1 164 ? -6.113  -32.716 -14.170 1.00 39.68  ? 164  ALA B N   1 
ATOM   5594 C  CA  . ALA B 1 164 ? -5.532  -33.811 -13.396 1.00 37.84  ? 164  ALA B CA  1 
ATOM   5595 C  C   . ALA B 1 164 ? -6.266  -33.859 -12.066 1.00 35.82  ? 164  ALA B C   1 
ATOM   5596 O  O   . ALA B 1 164 ? -5.727  -33.484 -11.020 1.00 36.11  ? 164  ALA B O   1 
ATOM   5597 C  CB  . ALA B 1 164 ? -4.028  -33.613 -13.208 1.00 39.14  ? 164  ALA B CB  1 
ATOM   5598 N  N   . PRO B 1 165 ? -7.528  -34.302 -12.077 1.00 34.91  ? 165  PRO B N   1 
ATOM   5599 C  CA  . PRO B 1 165 ? -8.340  -34.230 -10.856 1.00 35.49  ? 165  PRO B CA  1 
ATOM   5600 C  C   . PRO B 1 165 ? -8.015  -35.309 -9.840  1.00 37.63  ? 165  PRO B C   1 
ATOM   5601 O  O   . PRO B 1 165 ? -8.317  -35.126 -8.654  1.00 37.48  ? 165  PRO B O   1 
ATOM   5602 C  CB  . PRO B 1 165 ? -9.774  -34.382 -11.382 1.00 39.16  ? 165  PRO B CB  1 
ATOM   5603 C  CG  . PRO B 1 165 ? -9.624  -35.225 -12.623 1.00 37.03  ? 165  PRO B CG  1 
ATOM   5604 C  CD  . PRO B 1 165 ? -8.250  -34.934 -13.198 1.00 35.61  ? 165  PRO B CD  1 
ATOM   5605 N  N   . GLY B 1 166 ? -7.393  -36.404 -10.255 1.00 35.27  ? 166  GLY B N   1 
ATOM   5606 C  CA  . GLY B 1 166 ? -7.233  -37.564 -9.408  1.00 30.88  ? 166  GLY B CA  1 
ATOM   5607 C  C   . GLY B 1 166 ? -8.273  -38.628 -9.720  1.00 30.69  ? 166  GLY B C   1 
ATOM   5608 O  O   . GLY B 1 166 ? -9.284  -38.384 -10.384 1.00 31.98  ? 166  GLY B O   1 
ATOM   5609 N  N   . ASN B 1 167 ? -7.990  -39.847 -9.271  1.00 30.38  ? 167  ASN B N   1 
ATOM   5610 C  CA  . ASN B 1 167 ? -8.906  -40.980 -9.364  1.00 26.25  ? 167  ASN B CA  1 
ATOM   5611 C  C   . ASN B 1 167 ? -9.236  -41.396 -10.792 1.00 26.39  ? 167  ASN B C   1 
ATOM   5612 O  O   . ASN B 1 167 ? -10.162 -42.188 -10.994 1.00 26.78  ? 167  ASN B O   1 
ATOM   5613 C  CB  . ASN B 1 167 ? -10.209 -40.695 -8.607  1.00 25.87  ? 167  ASN B CB  1 
ATOM   5614 C  CG  . ASN B 1 167 ? -9.981  -40.570 -7.132  1.00 27.63  ? 167  ASN B CG  1 
ATOM   5615 O  OD1 . ASN B 1 167 ? -9.043  -41.163 -6.604  1.00 27.69  ? 167  ASN B OD1 1 
ATOM   5616 N  ND2 . ASN B 1 167 ? -10.800 -39.769 -6.458  1.00 27.02  ? 167  ASN B ND2 1 
ATOM   5617 N  N   . VAL B 1 168 ? -8.497  -40.927 -11.803 1.00 27.00  ? 168  VAL B N   1 
ATOM   5618 C  CA  . VAL B 1 168 ? -8.944  -41.250 -13.156 1.00 26.82  ? 168  VAL B CA  1 
ATOM   5619 C  C   . VAL B 1 168 ? -8.761  -42.734 -13.469 1.00 23.59  ? 168  VAL B C   1 
ATOM   5620 O  O   . VAL B 1 168 ? -9.490  -43.274 -14.305 1.00 26.67  ? 168  VAL B O   1 
ATOM   5621 C  CB  . VAL B 1 168 ? -8.267  -40.354 -14.217 1.00 29.28  ? 168  VAL B CB  1 
ATOM   5622 C  CG1 . VAL B 1 168 ? -8.522  -38.890 -13.905 1.00 28.70  ? 168  VAL B CG1 1 
ATOM   5623 C  CG2 . VAL B 1 168 ? -6.763  -40.642 -14.338 1.00 28.51  ? 168  VAL B CG2 1 
ATOM   5624 N  N   . GLY B 1 169 ? -7.846  -43.431 -12.787 1.00 26.07  ? 169  GLY B N   1 
ATOM   5625 C  CA  . GLY B 1 169 ? -7.792  -44.881 -12.938 1.00 23.69  ? 169  GLY B CA  1 
ATOM   5626 C  C   . GLY B 1 169 ? -9.055  -45.569 -12.436 1.00 22.80  ? 169  GLY B C   1 
ATOM   5627 O  O   . GLY B 1 169 ? -9.477  -46.592 -12.978 1.00 21.08  ? 169  GLY B O   1 
ATOM   5628 N  N   . LEU B 1 170 ? -9.650  -45.046 -11.362 1.00 22.23  ? 170  LEU B N   1 
ATOM   5629 C  CA  . LEU B 1 170 ? -10.927 -45.597 -10.914 1.00 21.91  ? 170  LEU B CA  1 
ATOM   5630 C  C   . LEU B 1 170 ? -12.033 -45.308 -11.921 1.00 21.90  ? 170  LEU B C   1 
ATOM   5631 O  O   . LEU B 1 170 ? -12.922 -46.142 -12.114 1.00 24.98  ? 170  LEU B O   1 
ATOM   5632 C  CB  . LEU B 1 170 ? -11.302 -45.036 -9.546  1.00 22.77  ? 170  LEU B CB  1 
ATOM   5633 C  CG  . LEU B 1 170 ? -10.481 -45.583 -8.367  1.00 24.47  ? 170  LEU B CG  1 
ATOM   5634 C  CD1 . LEU B 1 170 ? -10.664 -44.726 -7.130  1.00 23.88  ? 170  LEU B CD1 1 
ATOM   5635 C  CD2 . LEU B 1 170 ? -10.855 -47.030 -8.063  1.00 21.06  ? 170  LEU B CD2 1 
ATOM   5636 N  N   . LEU B 1 171 ? -11.976 -44.148 -12.580 1.00 25.68  ? 171  LEU B N   1 
ATOM   5637 C  CA  . LEU B 1 171 ? -12.945 -43.825 -13.624 1.00 27.54  ? 171  LEU B CA  1 
ATOM   5638 C  C   . LEU B 1 171 ? -12.756 -44.704 -14.850 1.00 26.10  ? 171  LEU B C   1 
ATOM   5639 O  O   . LEU B 1 171 ? -13.736 -45.051 -15.523 1.00 25.20  ? 171  LEU B O   1 
ATOM   5640 C  CB  . LEU B 1 171 ? -12.838 -42.350 -13.990 1.00 27.23  ? 171  LEU B CB  1 
ATOM   5641 C  CG  . LEU B 1 171 ? -13.186 -41.444 -12.814 1.00 28.34  ? 171  LEU B CG  1 
ATOM   5642 C  CD1 . LEU B 1 171 ? -12.944 -39.979 -13.159 1.00 32.45  ? 171  LEU B CD1 1 
ATOM   5643 C  CD2 . LEU B 1 171 ? -14.644 -41.694 -12.386 1.00 28.25  ? 171  LEU B CD2 1 
ATOM   5644 N  N   . ASP B 1 172 ? -11.503 -45.058 -15.167 1.00 25.83  ? 172  ASP B N   1 
ATOM   5645 C  CA  . ASP B 1 172 ? -11.248 -46.065 -16.193 1.00 24.09  ? 172  ASP B CA  1 
ATOM   5646 C  C   . ASP B 1 172 ? -11.986 -47.354 -15.866 1.00 23.81  ? 172  ASP B C   1 
ATOM   5647 O  O   . ASP B 1 172 ? -12.670 -47.925 -16.721 1.00 24.08  ? 172  ASP B O   1 
ATOM   5648 C  CB  . ASP B 1 172 ? -9.743  -46.362 -16.316 1.00 27.54  ? 172  ASP B CB  1 
ATOM   5649 C  CG  . ASP B 1 172 ? -8.918  -45.163 -16.756 1.00 27.76  ? 172  ASP B CG  1 
ATOM   5650 O  OD1 . ASP B 1 172 ? -9.484  -44.169 -17.263 1.00 26.34  ? 172  ASP B OD1 1 
ATOM   5651 O  OD2 . ASP B 1 172 ? -7.676  -45.230 -16.591 1.00 24.20  ? 172  ASP B OD2 1 
ATOM   5652 N  N   . GLN B 1 173 ? -11.821 -47.851 -14.631 1.00 22.14  ? 173  GLN B N   1 
ATOM   5653 C  CA  . GLN B 1 173 ? -12.530 -49.057 -14.221 1.00 20.21  ? 173  GLN B CA  1 
ATOM   5654 C  C   . GLN B 1 173 ? -14.034 -48.870 -14.366 1.00 19.22  ? 173  GLN B C   1 
ATOM   5655 O  O   . GLN B 1 173 ? -14.733 -49.735 -14.907 1.00 21.32  ? 173  GLN B O   1 
ATOM   5656 C  CB  . GLN B 1 173 ? -12.184 -49.412 -12.768 1.00 20.13  ? 173  GLN B CB  1 
ATOM   5657 C  CG  . GLN B 1 173 ? -10.698 -49.648 -12.482 1.00 19.54  ? 173  GLN B CG  1 
ATOM   5658 C  CD  . GLN B 1 173 ? -10.490 -49.872 -10.998 1.00 22.81  ? 173  GLN B CD  1 
ATOM   5659 O  OE1 . GLN B 1 173 ? -11.463 -50.059 -10.266 1.00 22.55  ? 173  GLN B OE1 1 
ATOM   5660 N  NE2 . GLN B 1 173 ? -9.243  -49.846 -10.543 1.00 23.17  ? 173  GLN B NE2 1 
ATOM   5661 N  N   . ARG B 1 174 ? -14.545 -47.727 -13.903 1.00 21.26  ? 174  ARG B N   1 
ATOM   5662 C  CA  . ARG B 1 174 ? -15.976 -47.459 -14.007 1.00 22.90  ? 174  ARG B CA  1 
ATOM   5663 C  C   . ARG B 1 174 ? -16.429 -47.467 -15.459 1.00 25.31  ? 174  ARG B C   1 
ATOM   5664 O  O   . ARG B 1 174 ? -17.478 -48.033 -15.784 1.00 22.48  ? 174  ARG B O   1 
ATOM   5665 C  CB  . ARG B 1 174 ? -16.312 -46.121 -13.345 1.00 24.64  ? 174  ARG B CB  1 
ATOM   5666 C  CG  . ARG B 1 174 ? -17.785 -45.716 -13.464 1.00 29.71  ? 174  ARG B CG  1 
ATOM   5667 C  CD  . ARG B 1 174 ? -18.056 -44.343 -12.862 1.00 26.54  ? 174  ARG B CD  1 
ATOM   5668 N  NE  . ARG B 1 174 ? -17.981 -44.362 -11.400 1.00 26.95  ? 174  ARG B NE  1 
ATOM   5669 C  CZ  . ARG B 1 174 ? -17.928 -43.272 -10.640 1.00 28.84  ? 174  ARG B CZ  1 
ATOM   5670 N  NH1 . ARG B 1 174 ? -17.940 -42.065 -11.195 1.00 33.61  ? 174  ARG B NH1 1 
ATOM   5671 N  NH2 . ARG B 1 174 ? -17.864 -43.388 -9.328  1.00 27.52  ? 174  ARG B NH2 1 
ATOM   5672 N  N   . MET B 1 175 ? -15.640 -46.870 -16.356 1.00 23.33  ? 175  MET B N   1 
ATOM   5673 C  CA  . MET B 1 175 ? -16.067 -46.829 -17.750 1.00 23.88  ? 175  MET B CA  1 
ATOM   5674 C  C   . MET B 1 175 ? -16.094 -48.227 -18.351 1.00 26.47  ? 175  MET B C   1 
ATOM   5675 O  O   . MET B 1 175 ? -16.973 -48.543 -19.166 1.00 24.27  ? 175  MET B O   1 
ATOM   5676 C  CB  . MET B 1 175 ? -15.171 -45.903 -18.565 1.00 22.74  ? 175  MET B CB  1 
ATOM   5677 C  CG  . MET B 1 175 ? -15.897 -45.406 -19.824 1.00 37.25  ? 175  MET B CG  1 
ATOM   5678 S  SD  . MET B 1 175 ? -15.280 -43.808 -20.364 1.00 39.33  ? 175  MET B SD  1 
ATOM   5679 C  CE  . MET B 1 175 ? -13.904 -44.446 -21.121 1.00 29.18  ? 175  MET B CE  1 
ATOM   5680 N  N   . ALA B 1 176 ? -15.153 -49.086 -17.949 1.00 24.55  ? 176  ALA B N   1 
ATOM   5681 C  CA  . ALA B 1 176 ? -15.215 -50.478 -18.383 1.00 22.38  ? 176  ALA B CA  1 
ATOM   5682 C  C   . ALA B 1 176 ? -16.455 -51.168 -17.822 1.00 20.93  ? 176  ALA B C   1 
ATOM   5683 O  O   . ALA B 1 176 ? -17.097 -51.970 -18.515 1.00 21.57  ? 176  ALA B O   1 
ATOM   5684 C  CB  . ALA B 1 176 ? -13.945 -51.219 -17.970 1.00 25.17  ? 176  ALA B CB  1 
ATOM   5685 N  N   . LEU B 1 177 ? -16.800 -50.876 -16.559 1.00 22.16  ? 177  LEU B N   1 
ATOM   5686 C  CA  . LEU B 1 177 ? -18.045 -51.397 -15.998 1.00 24.82  ? 177  LEU B CA  1 
ATOM   5687 C  C   . LEU B 1 177 ? -19.257 -50.865 -16.757 1.00 24.21  ? 177  LEU B C   1 
ATOM   5688 O  O   . LEU B 1 177 ? -20.228 -51.595 -16.977 1.00 24.16  ? 177  LEU B O   1 
ATOM   5689 C  CB  . LEU B 1 177 ? -18.150 -51.050 -14.510 1.00 21.45  ? 177  LEU B CB  1 
ATOM   5690 C  CG  . LEU B 1 177 ? -17.049 -51.704 -13.670 1.00 23.96  ? 177  LEU B CG  1 
ATOM   5691 C  CD1 . LEU B 1 177 ? -17.197 -51.331 -12.203 1.00 27.33  ? 177  LEU B CD1 1 
ATOM   5692 C  CD2 . LEU B 1 177 ? -17.085 -53.214 -13.857 1.00 20.39  ? 177  LEU B CD2 1 
ATOM   5693 N  N   . GLN B 1 178 ? -19.236 -49.587 -17.133 1.00 26.84  ? 178  GLN B N   1 
ATOM   5694 C  CA  . GLN B 1 178 ? -20.326 -49.054 -17.945 1.00 27.31  ? 178  GLN B CA  1 
ATOM   5695 C  C   . GLN B 1 178 ? -20.397 -49.754 -19.298 1.00 26.50  ? 178  GLN B C   1 
ATOM   5696 O  O   . GLN B 1 178 ? -21.494 -50.022 -19.813 1.00 27.10  ? 178  GLN B O   1 
ATOM   5697 C  CB  . GLN B 1 178 ? -20.163 -47.549 -18.129 1.00 29.77  ? 178  GLN B CB  1 
ATOM   5698 C  CG  . GLN B 1 178 ? -21.302 -46.913 -18.939 1.00 29.78  ? 178  GLN B CG  1 
ATOM   5699 C  CD  . GLN B 1 178 ? -22.599 -46.859 -18.153 1.00 29.60  ? 178  GLN B CD  1 
ATOM   5700 O  OE1 . GLN B 1 178 ? -22.644 -46.298 -17.069 1.00 31.00  ? 178  GLN B OE1 1 
ATOM   5701 N  NE2 . GLN B 1 178 ? -23.659 -47.444 -18.705 1.00 27.19  ? 178  GLN B NE2 1 
ATOM   5702 N  N   . TRP B 1 179 ? -19.239 -50.048 -19.902 1.00 23.58  ? 179  TRP B N   1 
ATOM   5703 C  CA  . TRP B 1 179 ? -19.235 -50.768 -21.174 1.00 26.92  ? 179  TRP B CA  1 
ATOM   5704 C  C   . TRP B 1 179 ? -19.853 -52.154 -21.022 1.00 24.64  ? 179  TRP B C   1 
ATOM   5705 O  O   . TRP B 1 179 ? -20.661 -52.586 -21.859 1.00 24.09  ? 179  TRP B O   1 
ATOM   5706 C  CB  . TRP B 1 179 ? -17.801 -50.873 -21.712 1.00 26.94  ? 179  TRP B CB  1 
ATOM   5707 C  CG  . TRP B 1 179 ? -17.742 -51.336 -23.109 1.00 24.90  ? 179  TRP B CG  1 
ATOM   5708 C  CD1 . TRP B 1 179 ? -17.690 -50.554 -24.229 1.00 28.17  ? 179  TRP B CD1 1 
ATOM   5709 C  CD2 . TRP B 1 179 ? -17.738 -52.695 -23.568 1.00 22.14  ? 179  TRP B CD2 1 
ATOM   5710 N  NE1 . TRP B 1 179 ? -17.668 -51.342 -25.355 1.00 28.15  ? 179  TRP B NE1 1 
ATOM   5711 C  CE2 . TRP B 1 179 ? -17.695 -52.659 -24.978 1.00 25.54  ? 179  TRP B CE2 1 
ATOM   5712 C  CE3 . TRP B 1 179 ? -17.775 -53.934 -22.926 1.00 23.73  ? 179  TRP B CE3 1 
ATOM   5713 C  CZ2 . TRP B 1 179 ? -17.678 -53.818 -25.759 1.00 30.19  ? 179  TRP B CZ2 1 
ATOM   5714 C  CZ3 . TRP B 1 179 ? -17.760 -55.086 -23.704 1.00 27.62  ? 179  TRP B CZ3 1 
ATOM   5715 C  CH2 . TRP B 1 179 ? -17.708 -55.018 -25.101 1.00 26.78  ? 179  TRP B CH2 1 
ATOM   5716 N  N   . VAL B 1 180 ? -19.484 -52.864 -19.954 1.00 22.65  ? 180  VAL B N   1 
ATOM   5717 C  CA  . VAL B 1 180 ? -20.070 -54.169 -19.669 1.00 22.18  ? 180  VAL B CA  1 
ATOM   5718 C  C   . VAL B 1 180 ? -21.581 -54.041 -19.492 1.00 20.43  ? 180  VAL B C   1 
ATOM   5719 O  O   . VAL B 1 180 ? -22.351 -54.850 -20.016 1.00 25.76  ? 180  VAL B O   1 
ATOM   5720 C  CB  . VAL B 1 180 ? -19.402 -54.782 -18.417 1.00 25.21  ? 180  VAL B CB  1 
ATOM   5721 C  CG1 . VAL B 1 180 ? -20.213 -55.950 -17.906 1.00 22.29  ? 180  VAL B CG1 1 
ATOM   5722 C  CG2 . VAL B 1 180 ? -17.983 -55.251 -18.755 1.00 27.53  ? 180  VAL B CG2 1 
ATOM   5723 N  N   . HIS B 1 181 ? -22.019 -53.028 -18.740 1.00 20.35  ? 181  HIS B N   1 
ATOM   5724 C  CA  . HIS B 1 181 ? -23.444 -52.793 -18.535 1.00 22.00  ? 181  HIS B CA  1 
ATOM   5725 C  C   . HIS B 1 181 ? -24.174 -52.639 -19.863 1.00 27.43  ? 181  HIS B C   1 
ATOM   5726 O  O   . HIS B 1 181 ? -25.281 -53.160 -20.041 1.00 26.36  ? 181  HIS B O   1 
ATOM   5727 C  CB  . HIS B 1 181 ? -23.640 -51.543 -17.686 1.00 22.28  ? 181  HIS B CB  1 
ATOM   5728 C  CG  . HIS B 1 181 ? -25.072 -51.162 -17.497 1.00 26.92  ? 181  HIS B CG  1 
ATOM   5729 N  ND1 . HIS B 1 181 ? -25.872 -51.737 -16.535 1.00 24.24  ? 181  HIS B ND1 1 
ATOM   5730 C  CD2 . HIS B 1 181 ? -25.853 -50.273 -18.159 1.00 26.10  ? 181  HIS B CD2 1 
ATOM   5731 C  CE1 . HIS B 1 181 ? -27.081 -51.206 -16.599 1.00 26.52  ? 181  HIS B CE1 1 
ATOM   5732 N  NE2 . HIS B 1 181 ? -27.096 -50.314 -17.574 1.00 29.71  ? 181  HIS B NE2 1 
ATOM   5733 N  N   . ASP B 1 182 ? -23.563 -51.930 -20.806 1.00 25.53  ? 182  ASP B N   1 
ATOM   5734 C  CA  . ASP B 1 182 ? -24.212 -51.618 -22.079 1.00 25.91  ? 182  ASP B CA  1 
ATOM   5735 C  C   . ASP B 1 182 ? -24.079 -52.720 -23.116 1.00 28.78  ? 182  ASP B C   1 
ATOM   5736 O  O   . ASP B 1 182 ? -24.922 -52.802 -24.021 1.00 29.66  ? 182  ASP B O   1 
ATOM   5737 C  CB  . ASP B 1 182 ? -23.634 -50.330 -22.668 1.00 25.65  ? 182  ASP B CB  1 
ATOM   5738 C  CG  . ASP B 1 182 ? -23.955 -49.115 -21.830 1.00 31.46  ? 182  ASP B CG  1 
ATOM   5739 O  OD1 . ASP B 1 182 ? -24.999 -49.124 -21.139 1.00 31.75  ? 182  ASP B OD1 1 
ATOM   5740 O  OD2 . ASP B 1 182 ? -23.167 -48.143 -21.874 1.00 31.75  ? 182  ASP B OD2 1 
ATOM   5741 N  N   . ASN B 1 183 ? -23.058 -53.570 -23.011 1.00 23.63  ? 183  ASN B N   1 
ATOM   5742 C  CA  . ASN B 1 183 ? -22.676 -54.429 -24.119 1.00 22.79  ? 183  ASN B CA  1 
ATOM   5743 C  C   . ASN B 1 183 ? -22.595 -55.911 -23.802 1.00 23.96  ? 183  ASN B C   1 
ATOM   5744 O  O   . ASN B 1 183 ? -22.554 -56.708 -24.746 1.00 23.37  ? 183  ASN B O   1 
ATOM   5745 C  CB  . ASN B 1 183 ? -21.315 -53.987 -24.683 1.00 23.11  ? 183  ASN B CB  1 
ATOM   5746 C  CG  . ASN B 1 183 ? -21.391 -52.651 -25.390 1.00 27.00  ? 183  ASN B CG  1 
ATOM   5747 O  OD1 . ASN B 1 183 ? -21.922 -52.555 -26.507 1.00 26.61  ? 183  ASN B OD1 1 
ATOM   5748 N  ND2 . ASN B 1 183 ? -20.896 -51.603 -24.735 1.00 25.51  ? 183  ASN B ND2 1 
ATOM   5749 N  N   . ILE B 1 184 ? -22.531 -56.319 -22.530 1.00 25.86  ? 184  ILE B N   1 
ATOM   5750 C  CA  . ILE B 1 184 ? -22.241 -57.725 -22.263 1.00 24.53  ? 184  ILE B CA  1 
ATOM   5751 C  C   . ILE B 1 184 ? -23.397 -58.629 -22.680 1.00 23.47  ? 184  ILE B C   1 
ATOM   5752 O  O   . ILE B 1 184 ? -23.184 -59.818 -22.941 1.00 24.53  ? 184  ILE B O   1 
ATOM   5753 C  CB  . ILE B 1 184 ? -21.872 -57.928 -20.777 1.00 22.74  ? 184  ILE B CB  1 
ATOM   5754 C  CG1 . ILE B 1 184 ? -20.985 -59.166 -20.618 1.00 22.03  ? 184  ILE B CG1 1 
ATOM   5755 C  CG2 . ILE B 1 184 ? -23.119 -58.014 -19.914 1.00 22.97  ? 184  ILE B CG2 1 
ATOM   5756 C  CD1 . ILE B 1 184 ? -19.586 -59.020 -21.188 1.00 22.60  ? 184  ILE B CD1 1 
ATOM   5757 N  N   . GLN B 1 185 ? -24.620 -58.093 -22.772 1.00 27.20  ? 185  GLN B N   1 
ATOM   5758 C  CA  . GLN B 1 185 ? -25.741 -58.898 -23.250 1.00 29.87  ? 185  GLN B CA  1 
ATOM   5759 C  C   . GLN B 1 185 ? -25.482 -59.437 -24.653 1.00 30.80  ? 185  GLN B C   1 
ATOM   5760 O  O   . GLN B 1 185 ? -26.000 -60.499 -25.015 1.00 32.59  ? 185  GLN B O   1 
ATOM   5761 C  CB  . GLN B 1 185 ? -27.030 -58.072 -23.219 1.00 31.16  ? 185  GLN B CB  1 
ATOM   5762 C  CG  . GLN B 1 185 ? -27.052 -56.901 -24.210 1.00 30.54  ? 185  GLN B CG  1 
ATOM   5763 C  CD  . GLN B 1 185 ? -28.084 -55.837 -23.848 1.00 38.84  ? 185  GLN B CD  1 
ATOM   5764 O  OE1 . GLN B 1 185 ? -28.014 -55.207 -22.782 1.00 34.77  ? 185  GLN B OE1 1 
ATOM   5765 N  NE2 . GLN B 1 185 ? -29.065 -55.643 -24.735 1.00 37.00  ? 185  GLN B NE2 1 
ATOM   5766 N  N   . PHE B 1 186 ? -24.663 -58.742 -25.446 1.00 30.04  ? 186  PHE B N   1 
ATOM   5767 C  CA  . PHE B 1 186 ? -24.395 -59.197 -26.810 1.00 27.36  ? 186  PHE B CA  1 
ATOM   5768 C  C   . PHE B 1 186 ? -23.448 -60.381 -26.841 1.00 31.85  ? 186  PHE B C   1 
ATOM   5769 O  O   . PHE B 1 186 ? -23.306 -61.019 -27.890 1.00 30.05  ? 186  PHE B O   1 
ATOM   5770 C  CB  . PHE B 1 186 ? -23.832 -58.047 -27.647 1.00 27.01  ? 186  PHE B CB  1 
ATOM   5771 C  CG  . PHE B 1 186 ? -24.707 -56.832 -27.655 1.00 28.92  ? 186  PHE B CG  1 
ATOM   5772 C  CD1 . PHE B 1 186 ? -26.053 -56.933 -27.997 1.00 32.89  ? 186  PHE B CD1 1 
ATOM   5773 C  CD2 . PHE B 1 186 ? -24.202 -55.594 -27.313 1.00 25.94  ? 186  PHE B CD2 1 
ATOM   5774 C  CE1 . PHE B 1 186 ? -26.876 -55.815 -27.998 1.00 33.76  ? 186  PHE B CE1 1 
ATOM   5775 C  CE2 . PHE B 1 186 ? -25.015 -54.470 -27.305 1.00 29.34  ? 186  PHE B CE2 1 
ATOM   5776 C  CZ  . PHE B 1 186 ? -26.361 -54.580 -27.656 1.00 31.48  ? 186  PHE B CZ  1 
ATOM   5777 N  N   . PHE B 1 187 ? -22.809 -60.687 -25.711 1.00 31.88  ? 187  PHE B N   1 
ATOM   5778 C  CA  . PHE B 1 187 ? -21.920 -61.832 -25.569 1.00 33.71  ? 187  PHE B CA  1 
ATOM   5779 C  C   . PHE B 1 187 ? -22.540 -62.930 -24.718 1.00 34.36  ? 187  PHE B C   1 
ATOM   5780 O  O   . PHE B 1 187 ? -21.840 -63.876 -24.332 1.00 34.53  ? 187  PHE B O   1 
ATOM   5781 C  CB  . PHE B 1 187 ? -20.582 -61.400 -24.951 1.00 29.71  ? 187  PHE B CB  1 
ATOM   5782 C  CG  . PHE B 1 187 ? -19.863 -60.341 -25.736 1.00 26.79  ? 187  PHE B CG  1 
ATOM   5783 C  CD1 . PHE B 1 187 ? -20.227 -59.005 -25.619 1.00 27.31  ? 187  PHE B CD1 1 
ATOM   5784 C  CD2 . PHE B 1 187 ? -18.818 -60.679 -26.589 1.00 27.28  ? 187  PHE B CD2 1 
ATOM   5785 C  CE1 . PHE B 1 187 ? -19.559 -58.024 -26.350 1.00 24.79  ? 187  PHE B CE1 1 
ATOM   5786 C  CE2 . PHE B 1 187 ? -18.153 -59.712 -27.314 1.00 25.05  ? 187  PHE B CE2 1 
ATOM   5787 C  CZ  . PHE B 1 187 ? -18.522 -58.385 -27.192 1.00 27.43  ? 187  PHE B CZ  1 
ATOM   5788 N  N   . GLY B 1 188 ? -23.819 -62.812 -24.385 1.00 29.53  ? 188  GLY B N   1 
ATOM   5789 C  CA  . GLY B 1 188 ? -24.480 -63.821 -23.588 1.00 32.12  ? 188  GLY B CA  1 
ATOM   5790 C  C   . GLY B 1 188 ? -24.393 -63.617 -22.093 1.00 33.55  ? 188  GLY B C   1 
ATOM   5791 O  O   . GLY B 1 188 ? -24.681 -64.557 -21.338 1.00 33.18  ? 188  GLY B O   1 
ATOM   5792 N  N   . GLY B 1 189 ? -24.026 -62.424 -21.641 1.00 29.00  ? 189  GLY B N   1 
ATOM   5793 C  CA  . GLY B 1 189 ? -23.964 -62.119 -20.223 1.00 30.92  ? 189  GLY B CA  1 
ATOM   5794 C  C   . GLY B 1 189 ? -25.161 -61.306 -19.768 1.00 35.22  ? 189  GLY B C   1 
ATOM   5795 O  O   . GLY B 1 189 ? -25.736 -60.532 -20.533 1.00 30.41  ? 189  GLY B O   1 
ATOM   5796 N  N   . ASP B 1 190 ? -25.535 -61.498 -18.504 1.00 30.95  ? 190  ASP B N   1 
ATOM   5797 C  CA  . ASP B 1 190 ? -26.635 -60.761 -17.904 1.00 30.18  ? 190  ASP B CA  1 
ATOM   5798 C  C   . ASP B 1 190 ? -26.088 -59.504 -17.239 1.00 31.34  ? 190  ASP B C   1 
ATOM   5799 O  O   . ASP B 1 190 ? -25.444 -59.612 -16.184 1.00 28.16  ? 190  ASP B O   1 
ATOM   5800 C  CB  . ASP B 1 190 ? -27.364 -61.629 -16.883 1.00 31.69  ? 190  ASP B CB  1 
ATOM   5801 C  CG  . ASP B 1 190 ? -28.480 -60.892 -16.173 1.00 33.56  ? 190  ASP B CG  1 
ATOM   5802 O  OD1 . ASP B 1 190 ? -28.783 -59.733 -16.541 1.00 33.08  ? 190  ASP B OD1 1 
ATOM   5803 O  OD2 . ASP B 1 190 ? -29.060 -61.463 -15.224 1.00 35.42  ? 190  ASP B OD2 1 
ATOM   5804 N  N   . PRO B 1 191 ? -26.343 -58.311 -17.774 1.00 25.52  ? 191  PRO B N   1 
ATOM   5805 C  CA  . PRO B 1 191 ? -25.856 -57.087 -17.112 1.00 27.74  ? 191  PRO B CA  1 
ATOM   5806 C  C   . PRO B 1 191 ? -26.431 -56.856 -15.718 1.00 26.15  ? 191  PRO B C   1 
ATOM   5807 O  O   . PRO B 1 191 ? -25.912 -56.000 -14.989 1.00 24.57  ? 191  PRO B O   1 
ATOM   5808 C  CB  . PRO B 1 191 ? -26.287 -55.973 -18.071 1.00 28.56  ? 191  PRO B CB  1 
ATOM   5809 C  CG  . PRO B 1 191 ? -27.499 -56.580 -18.822 1.00 27.89  ? 191  PRO B CG  1 
ATOM   5810 C  CD  . PRO B 1 191 ? -27.099 -58.016 -19.009 1.00 31.00  ? 191  PRO B CD  1 
ATOM   5811 N  N   . LYS B 1 192 ? -27.496 -57.546 -15.338 1.00 28.04  ? 192  LYS B N   1 
ATOM   5812 C  CA  . LYS B 1 192 ? -28.036 -57.412 -13.990 1.00 25.18  ? 192  LYS B CA  1 
ATOM   5813 C  C   . LYS B 1 192 ? -27.388 -58.365 -12.992 1.00 25.50  ? 192  LYS B C   1 
ATOM   5814 O  O   . LYS B 1 192 ? -27.734 -58.324 -11.807 1.00 28.72  ? 192  LYS B O   1 
ATOM   5815 C  CB  . LYS B 1 192 ? -29.552 -57.634 -14.004 1.00 28.85  ? 192  LYS B CB  1 
ATOM   5816 C  CG  . LYS B 1 192 ? -30.295 -56.744 -14.988 1.00 31.67  ? 192  LYS B CG  1 
ATOM   5817 C  CD  . LYS B 1 192 ? -31.687 -57.310 -15.248 1.00 35.75  ? 192  LYS B CD  1 
ATOM   5818 C  CE  . LYS B 1 192 ? -32.743 -56.565 -14.446 1.00 33.37  ? 192  LYS B CE  1 
ATOM   5819 N  NZ  . LYS B 1 192 ? -32.550 -56.505 -12.958 1.00 41.01  ? 192  LYS B NZ  1 
ATOM   5820 N  N   . THR B 1 193 ? -26.465 -59.222 -13.434 1.00 26.16  ? 193  THR B N   1 
ATOM   5821 C  CA  . THR B 1 193 ? -25.805 -60.184 -12.552 1.00 29.89  ? 193  THR B CA  1 
ATOM   5822 C  C   . THR B 1 193 ? -24.287 -60.144 -12.806 1.00 23.35  ? 193  THR B C   1 
ATOM   5823 O  O   . THR B 1 193 ? -23.658 -61.132 -13.181 1.00 23.43  ? 193  THR B O   1 
ATOM   5824 C  CB  . THR B 1 193 ? -26.402 -61.585 -12.744 1.00 29.58  ? 193  THR B CB  1 
ATOM   5825 O  OG1 . THR B 1 193 ? -27.838 -61.495 -12.730 1.00 29.42  ? 193  THR B OG1 1 
ATOM   5826 C  CG2 . THR B 1 193 ? -25.971 -62.525 -11.606 1.00 29.65  ? 193  THR B CG2 1 
ATOM   5827 N  N   . VAL B 1 194 ? -23.702 -58.963 -12.618 1.00 22.07  ? 194  VAL B N   1 
ATOM   5828 C  CA  . VAL B 1 194 ? -22.260 -58.756 -12.768 1.00 21.35  ? 194  VAL B CA  1 
ATOM   5829 C  C   . VAL B 1 194 ? -21.619 -58.744 -11.382 1.00 21.74  ? 194  VAL B C   1 
ATOM   5830 O  O   . VAL B 1 194 ? -21.981 -57.928 -10.528 1.00 23.71  ? 194  VAL B O   1 
ATOM   5831 C  CB  . VAL B 1 194 ? -21.945 -57.446 -13.510 1.00 21.83  ? 194  VAL B CB  1 
ATOM   5832 C  CG1 . VAL B 1 194 ? -20.416 -57.240 -13.610 1.00 22.80  ? 194  VAL B CG1 1 
ATOM   5833 C  CG2 . VAL B 1 194 ? -22.590 -57.430 -14.909 1.00 22.51  ? 194  VAL B CG2 1 
ATOM   5834 N  N   . THR B 1 195 ? -20.651 -59.626 -11.165 1.00 22.74  ? 195  THR B N   1 
ATOM   5835 C  CA  . THR B 1 195 ? -19.806 -59.576 -9.977  1.00 21.96  ? 195  THR B CA  1 
ATOM   5836 C  C   . THR B 1 195 ? -18.474 -58.946 -10.349 1.00 22.64  ? 195  THR B C   1 
ATOM   5837 O  O   . THR B 1 195 ? -17.842 -59.364 -11.324 1.00 24.04  ? 195  THR B O   1 
ATOM   5838 C  CB  . THR B 1 195 ? -19.575 -60.973 -9.404  1.00 23.55  ? 195  THR B CB  1 
ATOM   5839 O  OG1 . THR B 1 195 ? -20.815 -61.497 -8.914  1.00 23.54  ? 195  THR B OG1 1 
ATOM   5840 C  CG2 . THR B 1 195 ? -18.555 -60.918 -8.237  1.00 22.85  ? 195  THR B CG2 1 
ATOM   5841 N  N   . ILE B 1 196 ? -18.073 -57.924 -9.615  1.00 22.11  ? 196  ILE B N   1 
ATOM   5842 C  CA  . ILE B 1 196 ? -16.714 -57.412 -9.741  1.00 22.20  ? 196  ILE B CA  1 
ATOM   5843 C  C   . ILE B 1 196 ? -15.850 -58.102 -8.691  1.00 23.59  ? 196  ILE B C   1 
ATOM   5844 O  O   . ILE B 1 196 ? -16.265 -58.268 -7.531  1.00 20.67  ? 196  ILE B O   1 
ATOM   5845 C  CB  . ILE B 1 196 ? -16.675 -55.875 -9.607  1.00 19.27  ? 196  ILE B CB  1 
ATOM   5846 C  CG1 . ILE B 1 196 ? -17.296 -55.401 -8.302  1.00 22.76  ? 196  ILE B CG1 1 
ATOM   5847 C  CG2 . ILE B 1 196 ? -17.414 -55.199 -10.789 1.00 21.37  ? 196  ILE B CG2 1 
ATOM   5848 C  CD1 . ILE B 1 196 ? -17.069 -53.936 -8.058  1.00 19.42  ? 196  ILE B CD1 1 
ATOM   5849 N  N   . PHE B 1 197 ? -14.662 -58.540 -9.096  1.00 21.55  ? 197  PHE B N   1 
ATOM   5850 C  CA  . PHE B 1 197 ? -13.727 -59.118 -8.143  1.00 19.33  ? 197  PHE B CA  1 
ATOM   5851 C  C   . PHE B 1 197 ? -12.309 -58.662 -8.466  1.00 21.26  ? 197  PHE B C   1 
ATOM   5852 O  O   . PHE B 1 197 ? -11.972 -58.362 -9.614  1.00 21.13  ? 197  PHE B O   1 
ATOM   5853 C  CB  . PHE B 1 197 ? -13.864 -60.663 -8.060  1.00 18.69  ? 197  PHE B CB  1 
ATOM   5854 C  CG  . PHE B 1 197 ? -13.411 -61.447 -9.284  1.00 20.12  ? 197  PHE B CG  1 
ATOM   5855 C  CD1 . PHE B 1 197 ? -13.879 -61.150 -10.556 1.00 22.97  ? 197  PHE B CD1 1 
ATOM   5856 C  CD2 . PHE B 1 197 ? -12.592 -62.563 -9.129  1.00 18.89  ? 197  PHE B CD2 1 
ATOM   5857 C  CE1 . PHE B 1 197 ? -13.487 -61.914 -11.658 1.00 24.43  ? 197  PHE B CE1 1 
ATOM   5858 C  CE2 . PHE B 1 197 ? -12.199 -63.323 -10.211 1.00 22.79  ? 197  PHE B CE2 1 
ATOM   5859 C  CZ  . PHE B 1 197 ? -12.648 -63.001 -11.489 1.00 22.31  ? 197  PHE B CZ  1 
ATOM   5860 N  N   . GLY B 1 198 ? -11.491 -58.549 -7.424  1.00 20.23  ? 198  GLY B N   1 
ATOM   5861 C  CA  . GLY B 1 198 ? -10.133 -58.073 -7.626  1.00 17.70  ? 198  GLY B CA  1 
ATOM   5862 C  C   . GLY B 1 198 ? -9.296  -58.391 -6.410  1.00 18.66  ? 198  GLY B C   1 
ATOM   5863 O  O   . GLY B 1 198 ? -9.820  -58.680 -5.330  1.00 19.90  ? 198  GLY B O   1 
ATOM   5864 N  N   . GLU B 1 199 ? -7.983  -58.343 -6.596  1.00 19.75  ? 199  GLU B N   1 
ATOM   5865 C  CA  . GLU B 1 199 ? -7.032  -58.675 -5.545  1.00 20.45  ? 199  GLU B CA  1 
ATOM   5866 C  C   . GLU B 1 199 ? -6.141  -57.468 -5.280  1.00 22.07  ? 199  GLU B C   1 
ATOM   5867 O  O   . GLU B 1 199 ? -5.855  -56.684 -6.191  1.00 22.09  ? 199  GLU B O   1 
ATOM   5868 C  CB  . GLU B 1 199 ? -6.185  -59.906 -5.953  1.00 21.68  ? 199  GLU B CB  1 
ATOM   5869 C  CG  . GLU B 1 199 ? -5.250  -60.445 -4.854  1.00 20.53  ? 199  GLU B CG  1 
ATOM   5870 C  CD  . GLU B 1 199 ? -3.873  -59.795 -4.875  1.00 25.29  ? 199  GLU B CD  1 
ATOM   5871 O  OE1 . GLU B 1 199 ? -3.564  -59.097 -5.861  1.00 21.74  ? 199  GLU B OE1 1 
ATOM   5872 O  OE2 . GLU B 1 199 ? -3.096  -59.958 -3.887  1.00 25.81  ? 199  GLU B OE2 1 
ATOM   5873 N  N   . SER B 1 200 ? -5.691  -57.313 -4.028  1.00 22.50  ? 200  SER B N   1 
ATOM   5874 C  CA  . SER B 1 200 ? -4.775  -56.230 -3.649  1.00 23.00  ? 200  SER B CA  1 
ATOM   5875 C  C   . SER B 1 200 ? -5.416  -54.902 -4.042  1.00 23.99  ? 200  SER B C   1 
ATOM   5876 O  O   . SER B 1 200 ? -6.557  -54.650 -3.618  1.00 21.24  ? 200  SER B O   1 
ATOM   5877 C  CB  . SER B 1 200 ? -3.403  -56.550 -4.265  1.00 29.58  ? 200  SER B CB  1 
ATOM   5878 O  OG  . SER B 1 200 ? -2.662  -55.399 -4.611  1.00 40.90  ? 200  SER B OG  1 
ATOM   5879 N  N   . ALA B 1 201 ? -4.759  -54.045 -4.836  1.00 22.93  ? 201  ALA B N   1 
ATOM   5880 C  CA  . ALA B 1 201 ? -5.378  -52.785 -5.252  1.00 22.65  ? 201  ALA B CA  1 
ATOM   5881 C  C   . ALA B 1 201 ? -6.684  -53.019 -5.998  1.00 21.92  ? 201  ALA B C   1 
ATOM   5882 O  O   . ALA B 1 201 ? -7.585  -52.170 -5.953  1.00 20.70  ? 201  ALA B O   1 
ATOM   5883 C  CB  . ALA B 1 201 ? -4.412  -51.982 -6.121  1.00 23.01  ? 201  ALA B CB  1 
ATOM   5884 N  N   . GLY B 1 202 ? -6.809  -54.160 -6.679  1.00 21.94  ? 202  GLY B N   1 
ATOM   5885 C  CA  . GLY B 1 202 ? -8.077  -54.504 -7.305  1.00 20.56  ? 202  GLY B CA  1 
ATOM   5886 C  C   . GLY B 1 202 ? -9.174  -54.768 -6.288  1.00 22.23  ? 202  GLY B C   1 
ATOM   5887 O  O   . GLY B 1 202 ? -10.339 -54.431 -6.518  1.00 22.45  ? 202  GLY B O   1 
ATOM   5888 N  N   . GLY B 1 203 ? -8.819  -55.382 -5.153  1.00 21.87  ? 203  GLY B N   1 
ATOM   5889 C  CA  . GLY B 1 203 ? -9.791  -55.588 -4.093  1.00 21.95  ? 203  GLY B CA  1 
ATOM   5890 C  C   . GLY B 1 203 ? -10.181 -54.292 -3.414  1.00 20.62  ? 203  GLY B C   1 
ATOM   5891 O  O   . GLY B 1 203 ? -11.357 -54.071 -3.104  1.00 22.81  ? 203  GLY B O   1 
ATOM   5892 N  N   . ALA B 1 204 ? -9.201  -53.426 -3.153  1.00 20.38  ? 204  ALA B N   1 
ATOM   5893 C  CA  . ALA B 1 204 ? -9.523  -52.083 -2.684  1.00 22.56  ? 204  ALA B CA  1 
ATOM   5894 C  C   . ALA B 1 204 ? -10.424 -51.360 -3.676  1.00 23.32  ? 204  ALA B C   1 
ATOM   5895 O  O   . ALA B 1 204 ? -11.388 -50.695 -3.271  1.00 23.90  ? 204  ALA B O   1 
ATOM   5896 C  CB  . ALA B 1 204 ? -8.248  -51.279 -2.453  1.00 23.03  ? 204  ALA B CB  1 
ATOM   5897 N  N   . SER B 1 205 ? -10.107 -51.462 -4.977  1.00 19.88  ? 205  SER B N   1 
ATOM   5898 C  CA  . SER B 1 205 ? -10.932 -50.836 -6.016  1.00 23.04  ? 205  SER B CA  1 
ATOM   5899 C  C   . SER B 1 205 ? -12.370 -51.334 -5.950  1.00 21.37  ? 205  SER B C   1 
ATOM   5900 O  O   . SER B 1 205 ? -13.318 -50.545 -6.046  1.00 23.40  ? 205  SER B O   1 
ATOM   5901 C  CB  . SER B 1 205 ? -10.355 -51.117 -7.407  1.00 20.95  ? 205  SER B CB  1 
ATOM   5902 O  OG  . SER B 1 205 ? -9.091  -50.500 -7.582  1.00 21.15  ? 205  SER B OG  1 
ATOM   5903 N  N   . VAL B 1 206 ? -12.551 -52.653 -5.827  1.00 22.52  ? 206  VAL B N   1 
ATOM   5904 C  CA  . VAL B 1 206 ? -13.897 -53.215 -5.710  1.00 21.90  ? 206  VAL B CA  1 
ATOM   5905 C  C   . VAL B 1 206 ? -14.642 -52.565 -4.549  1.00 24.55  ? 206  VAL B C   1 
ATOM   5906 O  O   . VAL B 1 206 ? -15.792 -52.130 -4.685  1.00 23.90  ? 206  VAL B O   1 
ATOM   5907 C  CB  . VAL B 1 206 ? -13.829 -54.743 -5.544  1.00 23.23  ? 206  VAL B CB  1 
ATOM   5908 C  CG1 . VAL B 1 206 ? -15.158 -55.280 -5.009  1.00 21.63  ? 206  VAL B CG1 1 
ATOM   5909 C  CG2 . VAL B 1 206 ? -13.476 -55.404 -6.861  1.00 18.35  ? 206  VAL B CG2 1 
ATOM   5910 N  N   . GLY B 1 207 ? -13.990 -52.475 -3.392  1.00 23.39  ? 207  GLY B N   1 
ATOM   5911 C  CA  . GLY B 1 207 ? -14.623 -51.821 -2.261  1.00 21.64  ? 207  GLY B CA  1 
ATOM   5912 C  C   . GLY B 1 207 ? -14.911 -50.360 -2.529  1.00 24.90  ? 207  GLY B C   1 
ATOM   5913 O  O   . GLY B 1 207 ? -15.914 -49.816 -2.046  1.00 25.57  ? 207  GLY B O   1 
ATOM   5914 N  N   . MET B 1 208 ? -14.061 -49.712 -3.325  1.00 22.58  ? 208  MET B N   1 
ATOM   5915 C  CA  . MET B 1 208 ? -14.254 -48.298 -3.617  1.00 20.41  ? 208  MET B CA  1 
ATOM   5916 C  C   . MET B 1 208 ? -15.455 -48.081 -4.527  1.00 22.24  ? 208  MET B C   1 
ATOM   5917 O  O   . MET B 1 208 ? -16.126 -47.052 -4.413  1.00 26.70  ? 208  MET B O   1 
ATOM   5918 C  CB  . MET B 1 208 ? -12.986 -47.714 -4.246  1.00 24.63  ? 208  MET B CB  1 
ATOM   5919 C  CG  . MET B 1 208 ? -11.852 -47.505 -3.241  1.00 23.10  ? 208  MET B CG  1 
ATOM   5920 S  SD  . MET B 1 208 ? -10.280 -47.105 -4.016  1.00 24.59  ? 208  MET B SD  1 
ATOM   5921 C  CE  . MET B 1 208 ? -9.233  -46.932 -2.564  1.00 23.86  ? 208  MET B CE  1 
ATOM   5922 N  N   . HIS B 1 209 ? -15.739 -49.031 -5.431  1.00 21.66  ? 209  HIS B N   1 
ATOM   5923 C  CA  . HIS B 1 209 ? -16.947 -48.937 -6.251  1.00 23.57  ? 209  HIS B CA  1 
ATOM   5924 C  C   . HIS B 1 209 ? -18.204 -49.220 -5.439  1.00 26.13  ? 209  HIS B C   1 
ATOM   5925 O  O   . HIS B 1 209 ? -19.275 -48.688 -5.754  1.00 25.89  ? 209  HIS B O   1 
ATOM   5926 C  CB  . HIS B 1 209 ? -16.875 -49.899 -7.433  1.00 23.85  ? 209  HIS B CB  1 
ATOM   5927 C  CG  . HIS B 1 209 ? -15.819 -49.540 -8.432  1.00 21.37  ? 209  HIS B CG  1 
ATOM   5928 N  ND1 . HIS B 1 209 ? -15.856 -48.372 -9.166  1.00 24.44  ? 209  HIS B ND1 1 
ATOM   5929 C  CD2 . HIS B 1 209 ? -14.682 -50.178 -8.798  1.00 21.49  ? 209  HIS B CD2 1 
ATOM   5930 C  CE1 . HIS B 1 209 ? -14.793 -48.313 -9.951  1.00 24.58  ? 209  HIS B CE1 1 
ATOM   5931 N  NE2 . HIS B 1 209 ? -14.067 -49.399 -9.752  1.00 23.14  ? 209  HIS B NE2 1 
ATOM   5932 N  N   . ILE B 1 210 ? -18.104 -50.091 -4.434  1.00 24.16  ? 210  ILE B N   1 
ATOM   5933 C  CA  . ILE B 1 210 ? -19.190 -50.257 -3.468  1.00 21.32  ? 210  ILE B CA  1 
ATOM   5934 C  C   . ILE B 1 210 ? -19.511 -48.923 -2.820  1.00 27.62  ? 210  ILE B C   1 
ATOM   5935 O  O   . ILE B 1 210 ? -20.681 -48.570 -2.621  1.00 31.03  ? 210  ILE B O   1 
ATOM   5936 C  CB  . ILE B 1 210 ? -18.797 -51.314 -2.418  1.00 21.32  ? 210  ILE B CB  1 
ATOM   5937 C  CG1 . ILE B 1 210 ? -18.838 -52.714 -3.027  1.00 24.50  ? 210  ILE B CG1 1 
ATOM   5938 C  CG2 . ILE B 1 210 ? -19.712 -51.243 -1.177  1.00 23.99  ? 210  ILE B CG2 1 
ATOM   5939 C  CD1 . ILE B 1 210 ? -18.277 -53.777 -2.073  1.00 25.51  ? 210  ILE B CD1 1 
ATOM   5940 N  N   . LEU B 1 211 ? -18.474 -48.161 -2.478  1.00 26.11  ? 211  LEU B N   1 
ATOM   5941 C  CA  . LEU B 1 211 ? -18.654 -46.902 -1.770  1.00 26.47  ? 211  LEU B CA  1 
ATOM   5942 C  C   . LEU B 1 211 ? -19.140 -45.786 -2.691  1.00 30.23  ? 211  LEU B C   1 
ATOM   5943 O  O   . LEU B 1 211 ? -20.049 -45.029 -2.327  1.00 33.27  ? 211  LEU B O   1 
ATOM   5944 C  CB  . LEU B 1 211 ? -17.342 -46.506 -1.090  1.00 25.48  ? 211  LEU B CB  1 
ATOM   5945 C  CG  . LEU B 1 211 ? -16.996 -47.298 0.183   1.00 29.45  ? 211  LEU B CG  1 
ATOM   5946 C  CD1 . LEU B 1 211 ? -15.532 -47.103 0.574   1.00 31.94  ? 211  LEU B CD1 1 
ATOM   5947 C  CD2 . LEU B 1 211 ? -17.894 -46.875 1.312   1.00 31.60  ? 211  LEU B CD2 1 
ATOM   5948 N  N   . SER B 1 212 ? -18.577 -45.683 -3.884  1.00 25.75  ? 212  SER B N   1 
ATOM   5949 C  CA  . SER B 1 212 ? -18.797 -44.503 -4.715  1.00 29.29  ? 212  SER B CA  1 
ATOM   5950 C  C   . SER B 1 212 ? -20.182 -44.528 -5.351  1.00 28.40  ? 212  SER B C   1 
ATOM   5951 O  O   . SER B 1 212 ? -20.497 -45.470 -6.090  1.00 27.59  ? 212  SER B O   1 
ATOM   5952 C  CB  . SER B 1 212 ? -17.749 -44.409 -5.806  1.00 27.74  ? 212  SER B CB  1 
ATOM   5953 O  OG  . SER B 1 212 ? -17.931 -43.215 -6.548  1.00 28.87  ? 212  SER B OG  1 
ATOM   5954 N  N   . PRO B 1 213 ? -21.015 -43.510 -5.127  1.00 32.07  ? 213  PRO B N   1 
ATOM   5955 C  CA  . PRO B 1 213 ? -22.374 -43.543 -5.706  1.00 32.23  ? 213  PRO B CA  1 
ATOM   5956 C  C   . PRO B 1 213 ? -22.382 -43.696 -7.217  1.00 31.11  ? 213  PRO B C   1 
ATOM   5957 O  O   . PRO B 1 213 ? -23.248 -44.388 -7.758  1.00 31.30  ? 213  PRO B O   1 
ATOM   5958 C  CB  . PRO B 1 213 ? -22.972 -42.204 -5.258  1.00 33.47  ? 213  PRO B CB  1 
ATOM   5959 C  CG  . PRO B 1 213 ? -22.231 -41.850 -4.015  1.00 30.34  ? 213  PRO B CG  1 
ATOM   5960 C  CD  . PRO B 1 213 ? -20.814 -42.354 -4.238  1.00 33.07  ? 213  PRO B CD  1 
ATOM   5961 N  N   . GLY B 1 214 ? -21.406 -43.108 -7.913  1.00 28.60  ? 214  GLY B N   1 
ATOM   5962 C  CA  . GLY B 1 214 ? -21.309 -43.209 -9.359  1.00 30.38  ? 214  GLY B CA  1 
ATOM   5963 C  C   . GLY B 1 214 ? -21.003 -44.594 -9.892  1.00 30.46  ? 214  GLY B C   1 
ATOM   5964 O  O   . GLY B 1 214 ? -21.150 -44.816 -11.100 1.00 28.13  ? 214  GLY B O   1 
ATOM   5965 N  N   . SER B 1 215 ? -20.606 -45.533 -9.033  1.00 28.21  ? 215  SER B N   1 
ATOM   5966 C  CA  . SER B 1 215 ? -20.297 -46.887 -9.467  1.00 27.38  ? 215  SER B CA  1 
ATOM   5967 C  C   . SER B 1 215 ? -21.341 -47.923 -9.080  1.00 26.05  ? 215  SER B C   1 
ATOM   5968 O  O   . SER B 1 215 ? -21.398 -48.983 -9.717  1.00 29.86  ? 215  SER B O   1 
ATOM   5969 C  CB  . SER B 1 215 ? -18.944 -47.325 -8.885  1.00 25.28  ? 215  SER B CB  1 
ATOM   5970 O  OG  . SER B 1 215 ? -17.901 -46.529 -9.421  1.00 29.66  ? 215  SER B OG  1 
ATOM   5971 N  N   . ARG B 1 216 ? -22.167 -47.636 -8.076  1.00 28.36  ? 216  ARG B N   1 
ATOM   5972 C  CA  . ARG B 1 216 ? -22.935 -48.681 -7.402  1.00 33.43  ? 216  ARG B CA  1 
ATOM   5973 C  C   . ARG B 1 216 ? -23.875 -49.406 -8.351  1.00 30.11  ? 216  ARG B C   1 
ATOM   5974 O  O   . ARG B 1 216 ? -24.064 -50.619 -8.231  1.00 30.98  ? 216  ARG B O   1 
ATOM   5975 C  CB  . ARG B 1 216 ? -23.727 -48.088 -6.239  1.00 29.81  ? 216  ARG B CB  1 
ATOM   5976 C  CG  . ARG B 1 216 ? -22.860 -47.513 -5.149  1.00 30.50  ? 216  ARG B CG  1 
ATOM   5977 C  CD  . ARG B 1 216 ? -23.721 -46.927 -4.042  1.00 31.61  ? 216  ARG B CD  1 
ATOM   5978 N  NE  . ARG B 1 216 ? -22.927 -46.139 -3.110  1.00 33.03  ? 216  ARG B NE  1 
ATOM   5979 C  CZ  . ARG B 1 216 ? -23.442 -45.287 -2.232  1.00 33.66  ? 216  ARG B CZ  1 
ATOM   5980 N  NH1 . ARG B 1 216 ? -24.761 -45.117 -2.167  1.00 35.52  ? 216  ARG B NH1 1 
ATOM   5981 N  NH2 . ARG B 1 216 ? -22.643 -44.595 -1.431  1.00 31.33  ? 216  ARG B NH2 1 
ATOM   5982 N  N   . ASP B 1 217 ? -24.465 -48.693 -9.304  1.00 27.65  ? 217  ASP B N   1 
ATOM   5983 C  CA  . ASP B 1 217 ? -25.468 -49.321 -10.147 1.00 29.84  ? 217  ASP B CA  1 
ATOM   5984 C  C   . ASP B 1 217 ? -24.875 -50.108 -11.311 1.00 31.14  ? 217  ASP B C   1 
ATOM   5985 O  O   . ASP B 1 217 ? -25.636 -50.639 -12.124 1.00 27.93  ? 217  ASP B O   1 
ATOM   5986 C  CB  . ASP B 1 217 ? -26.435 -48.249 -10.655 1.00 35.77  ? 217  ASP B CB  1 
ATOM   5987 C  CG  . ASP B 1 217 ? -27.169 -47.554 -9.516  1.00 36.19  ? 217  ASP B CG  1 
ATOM   5988 O  OD1 . ASP B 1 217 ? -27.605 -48.266 -8.593  1.00 34.64  ? 217  ASP B OD1 1 
ATOM   5989 O  OD2 . ASP B 1 217 ? -27.302 -46.309 -9.528  1.00 40.04  ? 217  ASP B OD2 1 
ATOM   5990 N  N   . LEU B 1 218 ? -23.552 -50.216 -11.410 1.00 27.26  ? 218  LEU B N   1 
ATOM   5991 C  CA  . LEU B 1 218 ? -22.909 -50.891 -12.532 1.00 29.89  ? 218  LEU B CA  1 
ATOM   5992 C  C   . LEU B 1 218 ? -22.462 -52.310 -12.202 1.00 28.96  ? 218  LEU B C   1 
ATOM   5993 O  O   . LEU B 1 218 ? -21.682 -52.891 -12.961 1.00 30.61  ? 218  LEU B O   1 
ATOM   5994 C  CB  . LEU B 1 218 ? -21.716 -50.070 -13.015 1.00 28.86  ? 218  LEU B CB  1 
ATOM   5995 C  CG  . LEU B 1 218 ? -22.080 -48.703 -13.592 1.00 28.45  ? 218  LEU B CG  1 
ATOM   5996 C  CD1 . LEU B 1 218 ? -20.815 -47.938 -13.939 1.00 26.49  ? 218  LEU B CD1 1 
ATOM   5997 C  CD2 . LEU B 1 218 ? -22.971 -48.874 -14.819 1.00 30.14  ? 218  LEU B CD2 1 
ATOM   5998 N  N   . PHE B 1 219 ? -22.912 -52.871 -11.080 1.00 25.38  ? 219  PHE B N   1 
ATOM   5999 C  CA  . PHE B 1 219 ? -22.593 -54.252 -10.741 1.00 25.98  ? 219  PHE B CA  1 
ATOM   6000 C  C   . PHE B 1 219 ? -23.571 -54.709 -9.667  1.00 22.98  ? 219  PHE B C   1 
ATOM   6001 O  O   . PHE B 1 219 ? -24.252 -53.900 -9.038  1.00 23.16  ? 219  PHE B O   1 
ATOM   6002 C  CB  . PHE B 1 219 ? -21.124 -54.420 -10.272 1.00 24.32  ? 219  PHE B CB  1 
ATOM   6003 C  CG  . PHE B 1 219 ? -20.797 -53.669 -9.018  1.00 23.13  ? 219  PHE B CG  1 
ATOM   6004 C  CD1 . PHE B 1 219 ? -20.498 -52.318 -9.069  1.00 21.43  ? 219  PHE B CD1 1 
ATOM   6005 C  CD2 . PHE B 1 219 ? -20.783 -54.312 -7.777  1.00 22.47  ? 219  PHE B CD2 1 
ATOM   6006 C  CE1 . PHE B 1 219 ? -20.203 -51.616 -7.915  1.00 24.08  ? 219  PHE B CE1 1 
ATOM   6007 C  CE2 . PHE B 1 219 ? -20.495 -53.612 -6.616  1.00 20.64  ? 219  PHE B CE2 1 
ATOM   6008 C  CZ  . PHE B 1 219 ? -20.206 -52.264 -6.679  1.00 22.00  ? 219  PHE B CZ  1 
ATOM   6009 N  N   . ARG B 1 220 ? -23.656 -56.026 -9.499  1.00 22.11  ? 220  ARG B N   1 
ATOM   6010 C  CA  . ARG B 1 220 ? -24.621 -56.657 -8.608  1.00 21.66  ? 220  ARG B CA  1 
ATOM   6011 C  C   . ARG B 1 220 ? -24.025 -56.989 -7.242  1.00 21.81  ? 220  ARG B C   1 
ATOM   6012 O  O   . ARG B 1 220 ? -24.645 -56.708 -6.206  1.00 23.39  ? 220  ARG B O   1 
ATOM   6013 C  CB  . ARG B 1 220 ? -25.156 -57.932 -9.268  1.00 22.73  ? 220  ARG B CB  1 
ATOM   6014 C  CG  . ARG B 1 220 ? -26.125 -58.730 -8.415  1.00 26.45  ? 220  ARG B CG  1 
ATOM   6015 C  CD  . ARG B 1 220 ? -27.423 -57.985 -8.198  1.00 29.61  ? 220  ARG B CD  1 
ATOM   6016 N  NE  . ARG B 1 220 ? -28.414 -58.852 -7.572  1.00 36.67  ? 220  ARG B NE  1 
ATOM   6017 C  CZ  . ARG B 1 220 ? -29.208 -59.682 -8.244  1.00 37.35  ? 220  ARG B CZ  1 
ATOM   6018 N  NH1 . ARG B 1 220 ? -29.138 -59.755 -9.575  1.00 32.79  ? 220  ARG B NH1 1 
ATOM   6019 N  NH2 . ARG B 1 220 ? -30.075 -60.438 -7.583  1.00 37.08  ? 220  ARG B NH2 1 
ATOM   6020 N  N   . ARG B 1 221 ? -22.826 -57.576 -7.221  1.00 22.01  ? 221  ARG B N   1 
ATOM   6021 C  CA  . ARG B 1 221 ? -22.183 -57.982 -5.978  1.00 21.23  ? 221  ARG B CA  1 
ATOM   6022 C  C   . ARG B 1 221 ? -20.673 -57.985 -6.182  1.00 23.73  ? 221  ARG B C   1 
ATOM   6023 O  O   . ARG B 1 221 ? -20.171 -57.699 -7.273  1.00 20.31  ? 221  ARG B O   1 
ATOM   6024 C  CB  . ARG B 1 221 ? -22.705 -59.344 -5.504  1.00 24.29  ? 221  ARG B CB  1 
ATOM   6025 C  CG  . ARG B 1 221 ? -22.746 -60.405 -6.562  1.00 23.04  ? 221  ARG B CG  1 
ATOM   6026 C  CD  . ARG B 1 221 ? -23.466 -61.673 -6.069  1.00 27.81  ? 221  ARG B CD  1 
ATOM   6027 N  NE  . ARG B 1 221 ? -24.853 -61.438 -5.656  1.00 26.12  ? 221  ARG B NE  1 
ATOM   6028 C  CZ  . ARG B 1 221 ? -25.924 -61.796 -6.368  1.00 29.52  ? 221  ARG B CZ  1 
ATOM   6029 N  NH1 . ARG B 1 221 ? -25.779 -62.395 -7.545  1.00 27.30  ? 221  ARG B NH1 1 
ATOM   6030 N  NH2 . ARG B 1 221 ? -27.145 -61.545 -5.902  1.00 27.90  ? 221  ARG B NH2 1 
ATOM   6031 N  N   . ALA B 1 222 ? -19.937 -58.314 -5.117  1.00 22.07  ? 222  ALA B N   1 
ATOM   6032 C  CA  . ALA B 1 222 ? -18.518 -57.985 -5.104  1.00 18.70  ? 222  ALA B CA  1 
ATOM   6033 C  C   . ALA B 1 222 ? -17.694 -59.006 -4.328  1.00 25.86  ? 222  ALA B C   1 
ATOM   6034 O  O   . ALA B 1 222 ? -18.124 -59.484 -3.270  1.00 21.98  ? 222  ALA B O   1 
ATOM   6035 C  CB  . ALA B 1 222 ? -18.307 -56.601 -4.485  1.00 20.07  ? 222  ALA B CB  1 
ATOM   6036 N  N   . ILE B 1 223 ? -16.483 -59.280 -4.835  1.00 22.82  ? 223  ILE B N   1 
ATOM   6037 C  CA  . ILE B 1 223 ? -15.496 -60.138 -4.183  1.00 21.31  ? 223  ILE B CA  1 
ATOM   6038 C  C   . ILE B 1 223 ? -14.206 -59.344 -3.987  1.00 21.17  ? 223  ILE B C   1 
ATOM   6039 O  O   . ILE B 1 223 ? -13.696 -58.734 -4.938  1.00 21.89  ? 223  ILE B O   1 
ATOM   6040 C  CB  . ILE B 1 223 ? -15.217 -61.408 -5.007  1.00 22.42  ? 223  ILE B CB  1 
ATOM   6041 C  CG1 . ILE B 1 223 ? -16.493 -62.243 -5.193  1.00 21.75  ? 223  ILE B CG1 1 
ATOM   6042 C  CG2 . ILE B 1 223 ? -14.040 -62.212 -4.401  1.00 22.29  ? 223  ILE B CG2 1 
ATOM   6043 C  CD1 . ILE B 1 223 ? -16.275 -63.466 -6.058  1.00 20.44  ? 223  ILE B CD1 1 
ATOM   6044 N  N   . LEU B 1 224 ? -13.666 -59.366 -2.767  1.00 22.04  ? 224  LEU B N   1 
ATOM   6045 C  CA  . LEU B 1 224 ? -12.448 -58.627 -2.437  1.00 21.72  ? 224  LEU B CA  1 
ATOM   6046 C  C   . LEU B 1 224 ? -11.389 -59.589 -1.910  1.00 24.65  ? 224  LEU B C   1 
ATOM   6047 O  O   . LEU B 1 224 ? -11.603 -60.247 -0.891  1.00 21.05  ? 224  LEU B O   1 
ATOM   6048 C  CB  . LEU B 1 224 ? -12.730 -57.536 -1.398  1.00 24.70  ? 224  LEU B CB  1 
ATOM   6049 C  CG  . LEU B 1 224 ? -13.759 -56.447 -1.733  1.00 22.17  ? 224  LEU B CG  1 
ATOM   6050 C  CD1 . LEU B 1 224 ? -15.210 -56.898 -1.478  1.00 20.78  ? 224  LEU B CD1 1 
ATOM   6051 C  CD2 . LEU B 1 224 ? -13.477 -55.202 -0.950  1.00 23.23  ? 224  LEU B CD2 1 
ATOM   6052 N  N   . GLN B 1 225 ? -10.222 -59.619 -2.557  1.00 21.93  ? 225  GLN B N   1 
ATOM   6053 C  CA  . GLN B 1 225 ? -9.147  -60.545 -2.201  1.00 21.54  ? 225  GLN B CA  1 
ATOM   6054 C  C   . GLN B 1 225 ? -7.949  -59.741 -1.703  1.00 21.93  ? 225  GLN B C   1 
ATOM   6055 O  O   . GLN B 1 225 ? -7.300  -59.038 -2.483  1.00 20.96  ? 225  GLN B O   1 
ATOM   6056 C  CB  . GLN B 1 225 ? -8.759  -61.432 -3.397  1.00 20.03  ? 225  GLN B CB  1 
ATOM   6057 C  CG  . GLN B 1 225 ? -9.916  -62.310 -3.902  1.00 20.93  ? 225  GLN B CG  1 
ATOM   6058 C  CD  . GLN B 1 225 ? -9.694  -62.901 -5.292  1.00 24.75  ? 225  GLN B CD  1 
ATOM   6059 O  OE1 . GLN B 1 225 ? -10.658 -63.167 -6.022  1.00 21.03  ? 225  GLN B OE1 1 
ATOM   6060 N  NE2 . GLN B 1 225 ? -8.422  -63.117 -5.664  1.00 23.26  ? 225  GLN B NE2 1 
ATOM   6061 N  N   . SER B 1 226 ? -7.650  -59.841 -0.403  1.00 20.17  ? 226  SER B N   1 
ATOM   6062 C  CA  . SER B 1 226 ? -6.447  -59.223 0.155   1.00 20.55  ? 226  SER B CA  1 
ATOM   6063 C  C   . SER B 1 226 ? -6.380  -57.734 -0.157  1.00 21.86  ? 226  SER B C   1 
ATOM   6064 O  O   . SER B 1 226 ? -5.330  -57.206 -0.524  1.00 22.52  ? 226  SER B O   1 
ATOM   6065 C  CB  . SER B 1 226 ? -5.172  -59.907 -0.353  1.00 19.85  ? 226  SER B CB  1 
ATOM   6066 O  OG  . SER B 1 226 ? -5.168  -61.284 -0.030  1.00 22.67  ? 226  SER B OG  1 
ATOM   6067 N  N   . GLY B 1 227 ? -7.510  -57.057 -0.032  1.00 21.45  ? 227  GLY B N   1 
ATOM   6068 C  CA  . GLY B 1 227 ? -7.533  -55.626 -0.243  1.00 22.83  ? 227  GLY B CA  1 
ATOM   6069 C  C   . GLY B 1 227 ? -8.893  -55.073 0.137   1.00 22.98  ? 227  GLY B C   1 
ATOM   6070 O  O   . GLY B 1 227 ? -9.908  -55.762 0.013   1.00 24.12  ? 227  GLY B O   1 
ATOM   6071 N  N   . SER B 1 228 ? -8.931  -53.844 0.624   1.00 21.39  ? 228  SER B N   1 
ATOM   6072 C  CA  . SER B 1 228 ? -10.187 -53.219 1.013   1.00 22.16  ? 228  SER B CA  1 
ATOM   6073 C  C   . SER B 1 228 ? -9.977  -51.714 0.901   1.00 22.42  ? 228  SER B C   1 
ATOM   6074 O  O   . SER B 1 228 ? -8.835  -51.251 0.885   1.00 22.18  ? 228  SER B O   1 
ATOM   6075 C  CB  . SER B 1 228 ? -10.617 -53.633 2.432   1.00 28.23  ? 228  SER B CB  1 
ATOM   6076 O  OG  . SER B 1 228 ? -9.635  -53.273 3.375   1.00 33.38  ? 228  SER B OG  1 
ATOM   6077 N  N   . PRO B 1 229 ? -11.067 -50.949 0.764   1.00 23.93  ? 229  PRO B N   1 
ATOM   6078 C  CA  . PRO B 1 229 ? -10.898 -49.535 0.379   1.00 23.88  ? 229  PRO B CA  1 
ATOM   6079 C  C   . PRO B 1 229 ? -10.243 -48.689 1.442   1.00 25.38  ? 229  PRO B C   1 
ATOM   6080 O  O   . PRO B 1 229 ? -9.652  -47.657 1.099   1.00 24.50  ? 229  PRO B O   1 
ATOM   6081 C  CB  . PRO B 1 229 ? -12.339 -49.071 0.099   1.00 25.02  ? 229  PRO B CB  1 
ATOM   6082 C  CG  . PRO B 1 229 ? -13.194 -50.006 0.863   1.00 26.48  ? 229  PRO B CG  1 
ATOM   6083 C  CD  . PRO B 1 229 ? -12.487 -51.323 0.877   1.00 25.09  ? 229  PRO B CD  1 
ATOM   6084 N  N   . ASN B 1 230 ? -10.320 -49.101 2.712   1.00 22.74  ? 230  ASN B N   1 
ATOM   6085 C  CA  . ASN B 1 230 ? -9.766  -48.389 3.851   1.00 26.16  ? 230  ASN B CA  1 
ATOM   6086 C  C   . ASN B 1 230 ? -8.315  -48.758 4.158   1.00 25.17  ? 230  ASN B C   1 
ATOM   6087 O  O   . ASN B 1 230 ? -7.795  -48.324 5.193   1.00 24.02  ? 230  ASN B O   1 
ATOM   6088 C  CB  . ASN B 1 230 ? -10.625 -48.674 5.091   1.00 24.77  ? 230  ASN B CB  1 
ATOM   6089 C  CG  . ASN B 1 230 ? -10.782 -50.161 5.344   1.00 25.01  ? 230  ASN B CG  1 
ATOM   6090 O  OD1 . ASN B 1 230 ? -11.124 -50.922 4.439   1.00 27.65  ? 230  ASN B OD1 1 
ATOM   6091 N  ND2 . ASN B 1 230 ? -10.521 -50.587 6.570   1.00 24.09  ? 230  ASN B ND2 1 
ATOM   6092 N  N   . CYS B 1 231 ? -7.660  -49.561 3.315   1.00 23.12  ? 231  CYS B N   1 
ATOM   6093 C  CA  . CYS B 1 231 ? -6.274  -49.943 3.578   1.00 25.78  ? 231  CYS B CA  1 
ATOM   6094 C  C   . CYS B 1 231 ? -5.381  -48.703 3.645   1.00 24.59  ? 231  CYS B C   1 
ATOM   6095 O  O   . CYS B 1 231 ? -5.596  -47.745 2.893   1.00 24.16  ? 231  CYS B O   1 
ATOM   6096 C  CB  . CYS B 1 231 ? -5.760  -50.896 2.497   1.00 21.06  ? 231  CYS B CB  1 
ATOM   6097 S  SG  . CYS B 1 231 ? -6.414  -52.562 2.550   1.00 25.36  ? 231  CYS B SG  1 
ATOM   6098 N  N   . PRO B 1 232 ? -4.377  -48.680 4.531   1.00 22.97  ? 232  PRO B N   1 
ATOM   6099 C  CA  . PRO B 1 232 ? -3.595  -47.446 4.720   1.00 23.87  ? 232  PRO B CA  1 
ATOM   6100 C  C   . PRO B 1 232 ? -2.831  -47.032 3.479   1.00 25.10  ? 232  PRO B C   1 
ATOM   6101 O  O   . PRO B 1 232 ? -2.531  -45.843 3.324   1.00 27.39  ? 232  PRO B O   1 
ATOM   6102 C  CB  . PRO B 1 232 ? -2.644  -47.797 5.882   1.00 26.72  ? 232  PRO B CB  1 
ATOM   6103 C  CG  . PRO B 1 232 ? -2.504  -49.275 5.822   1.00 24.02  ? 232  PRO B CG  1 
ATOM   6104 C  CD  . PRO B 1 232 ? -3.864  -49.790 5.352   1.00 24.54  ? 232  PRO B CD  1 
ATOM   6105 N  N   . TRP B 1 233 ? -2.538  -47.971 2.582   1.00 24.30  ? 233  TRP B N   1 
ATOM   6106 C  CA  . TRP B 1 233 ? -1.841  -47.692 1.336   1.00 25.01  ? 233  TRP B CA  1 
ATOM   6107 C  C   . TRP B 1 233 ? -2.773  -47.315 0.196   1.00 26.09  ? 233  TRP B C   1 
ATOM   6108 O  O   . TRP B 1 233 ? -2.287  -46.903 -0.861  1.00 24.66  ? 233  TRP B O   1 
ATOM   6109 C  CB  . TRP B 1 233 ? -1.025  -48.916 0.899   1.00 22.45  ? 233  TRP B CB  1 
ATOM   6110 C  CG  . TRP B 1 233 ? -1.825  -50.190 0.956   1.00 21.95  ? 233  TRP B CG  1 
ATOM   6111 C  CD1 . TRP B 1 233 ? -1.899  -51.056 2.010   1.00 23.45  ? 233  TRP B CD1 1 
ATOM   6112 C  CD2 . TRP B 1 233 ? -2.679  -50.737 -0.072  1.00 22.55  ? 233  TRP B CD2 1 
ATOM   6113 N  NE1 . TRP B 1 233 ? -2.734  -52.103 1.706   1.00 21.36  ? 233  TRP B NE1 1 
ATOM   6114 C  CE2 . TRP B 1 233 ? -3.217  -51.938 0.432   1.00 22.85  ? 233  TRP B CE2 1 
ATOM   6115 C  CE3 . TRP B 1 233 ? -3.032  -50.329 -1.369  1.00 23.53  ? 233  TRP B CE3 1 
ATOM   6116 C  CZ2 . TRP B 1 233 ? -4.092  -52.734 -0.303  1.00 21.13  ? 233  TRP B CZ2 1 
ATOM   6117 C  CZ3 . TRP B 1 233 ? -3.901  -51.124 -2.105  1.00 24.30  ? 233  TRP B CZ3 1 
ATOM   6118 C  CH2 . TRP B 1 233 ? -4.415  -52.317 -1.577  1.00 21.91  ? 233  TRP B CH2 1 
ATOM   6119 N  N   . ALA B 1 234 ? -4.089  -47.458 0.364   1.00 23.48  ? 234  ALA B N   1 
ATOM   6120 C  CA  . ALA B 1 234 ? -4.968  -47.412 -0.798  1.00 24.62  ? 234  ALA B CA  1 
ATOM   6121 C  C   . ALA B 1 234 ? -5.536  -46.026 -1.092  1.00 23.54  ? 234  ALA B C   1 
ATOM   6122 O  O   . ALA B 1 234 ? -6.196  -45.858 -2.120  1.00 25.23  ? 234  ALA B O   1 
ATOM   6123 C  CB  . ALA B 1 234 ? -6.114  -48.422 -0.633  1.00 21.78  ? 234  ALA B CB  1 
ATOM   6124 N  N   . SER B 1 235 ? -5.303  -45.030 -0.240  1.00 25.62  ? 235  SER B N   1 
ATOM   6125 C  CA  . SER B 1 235 ? -5.772  -43.689 -0.563  1.00 23.84  ? 235  SER B CA  1 
ATOM   6126 C  C   . SER B 1 235 ? -4.918  -42.660 0.154   1.00 27.18  ? 235  SER B C   1 
ATOM   6127 O  O   . SER B 1 235 ? -4.237  -42.967 1.131   1.00 27.85  ? 235  SER B O   1 
ATOM   6128 C  CB  . SER B 1 235 ? -7.252  -43.492 -0.209  1.00 25.47  ? 235  SER B CB  1 
ATOM   6129 O  OG  . SER B 1 235 ? -7.498  -43.661 1.172   1.00 28.32  ? 235  SER B OG  1 
ATOM   6130 N  N   . VAL B 1 236 ? -4.973  -41.427 -0.350  1.00 25.25  ? 236  VAL B N   1 
ATOM   6131 C  CA  . VAL B 1 236 ? -4.339  -40.279 0.284   1.00 28.85  ? 236  VAL B CA  1 
ATOM   6132 C  C   . VAL B 1 236 ? -5.336  -39.129 0.307   1.00 30.99  ? 236  VAL B C   1 
ATOM   6133 O  O   . VAL B 1 236 ? -6.349  -39.140 -0.392  1.00 30.67  ? 236  VAL B O   1 
ATOM   6134 C  CB  . VAL B 1 236 ? -3.039  -39.851 -0.430  1.00 28.22  ? 236  VAL B CB  1 
ATOM   6135 C  CG1 . VAL B 1 236 ? -1.979  -40.936 -0.311  1.00 30.87  ? 236  VAL B CG1 1 
ATOM   6136 C  CG2 . VAL B 1 236 ? -3.316  -39.500 -1.884  1.00 29.36  ? 236  VAL B CG2 1 
ATOM   6137 N  N   . SER B 1 237 ? -5.035  -38.128 1.135   1.00 31.47  ? 237  SER B N   1 
ATOM   6138 C  CA  . SER B 1 237 ? -5.832  -36.911 1.177   1.00 34.45  ? 237  SER B CA  1 
ATOM   6139 C  C   . SER B 1 237 ? -5.523  -36.032 -0.031  1.00 36.15  ? 237  SER B C   1 
ATOM   6140 O  O   . SER B 1 237 ? -4.495  -36.191 -0.699  1.00 33.21  ? 237  SER B O   1 
ATOM   6141 C  CB  . SER B 1 237 ? -5.542  -36.119 2.444   1.00 36.16  ? 237  SER B CB  1 
ATOM   6142 O  OG  . SER B 1 237 ? -4.223  -35.592 2.369   1.00 37.09  ? 237  SER B OG  1 
ATOM   6143 N  N   . VAL B 1 238 ? -6.417  -35.070 -0.285  1.00 35.68  ? 238  VAL B N   1 
ATOM   6144 C  CA  . VAL B 1 238 ? -6.198  -34.132 -1.383  1.00 38.99  ? 238  VAL B CA  1 
ATOM   6145 C  C   . VAL B 1 238 ? -4.899  -33.365 -1.169  1.00 37.95  ? 238  VAL B C   1 
ATOM   6146 O  O   . VAL B 1 238 ? -4.128  -33.145 -2.112  1.00 38.91  ? 238  VAL B O   1 
ATOM   6147 C  CB  . VAL B 1 238 ? -7.407  -33.184 -1.545  1.00 39.20  ? 238  VAL B CB  1 
ATOM   6148 C  CG1 . VAL B 1 238 ? -8.621  -33.941 -2.063  1.00 41.08  ? 238  VAL B CG1 1 
ATOM   6149 C  CG2 . VAL B 1 238 ? -7.733  -32.488 -0.238  1.00 38.56  ? 238  VAL B CG2 1 
ATOM   6150 N  N   . ALA B 1 239 ? -4.620  -32.974 0.079   1.00 36.56  ? 239  ALA B N   1 
ATOM   6151 C  CA  . ALA B 1 239 ? -3.377  -32.267 0.373   1.00 35.70  ? 239  ALA B CA  1 
ATOM   6152 C  C   . ALA B 1 239 ? -2.160  -33.127 0.047   1.00 39.17  ? 239  ALA B C   1 
ATOM   6153 O  O   . ALA B 1 239 ? -1.208  -32.657 -0.586  1.00 36.89  ? 239  ALA B O   1 
ATOM   6154 C  CB  . ALA B 1 239 ? -3.349  -31.836 1.838   1.00 38.60  ? 239  ALA B CB  1 
ATOM   6155 N  N   . GLU B 1 240 ? -2.168  -34.391 0.483   1.00 32.91  ? 240  GLU B N   1 
ATOM   6156 C  CA  . GLU B 1 240 ? -1.019  -35.255 0.236   1.00 36.34  ? 240  GLU B CA  1 
ATOM   6157 C  C   . GLU B 1 240 ? -0.898  -35.604 -1.245  1.00 35.53  ? 240  GLU B C   1 
ATOM   6158 O  O   . GLU B 1 240 ? 0.214   -35.688 -1.779  1.00 34.25  ? 240  GLU B O   1 
ATOM   6159 C  CB  . GLU B 1 240 ? -1.115  -36.516 1.105   1.00 33.93  ? 240  GLU B CB  1 
ATOM   6160 C  CG  . GLU B 1 240 ? -0.010  -37.580 0.879   1.00 33.52  ? 240  GLU B CG  1 
ATOM   6161 C  CD  . GLU B 1 240 ? 1.402   -37.103 1.207   1.00 36.11  ? 240  GLU B CD  1 
ATOM   6162 O  OE1 . GLU B 1 240 ? 1.575   -35.948 1.647   1.00 36.35  ? 240  GLU B OE1 1 
ATOM   6163 O  OE2 . GLU B 1 240 ? 2.353   -37.897 1.022   1.00 36.56  ? 240  GLU B OE2 1 
ATOM   6164 N  N   . GLY B 1 241 ? -2.026  -35.799 -1.931  1.00 35.69  ? 241  GLY B N   1 
ATOM   6165 C  CA  . GLY B 1 241 ? -1.963  -36.013 -3.366  1.00 33.80  ? 241  GLY B CA  1 
ATOM   6166 C  C   . GLY B 1 241 ? -1.368  -34.825 -4.096  1.00 35.01  ? 241  GLY B C   1 
ATOM   6167 O  O   . GLY B 1 241 ? -0.511  -34.984 -4.969  1.00 34.76  ? 241  GLY B O   1 
ATOM   6168 N  N   . ARG B 1 242 ? -1.800  -33.615 -3.733  1.00 35.82  ? 242  ARG B N   1 
ATOM   6169 C  CA  . ARG B 1 242 ? -1.220  -32.408 -4.312  1.00 37.94  ? 242  ARG B CA  1 
ATOM   6170 C  C   . ARG B 1 242 ? 0.278   -32.325 -4.040  1.00 39.70  ? 242  ARG B C   1 
ATOM   6171 O  O   . ARG B 1 242 ? 1.064   -32.030 -4.949  1.00 38.18  ? 242  ARG B O   1 
ATOM   6172 C  CB  . ARG B 1 242 ? -1.931  -31.172 -3.761  1.00 39.19  ? 242  ARG B CB  1 
ATOM   6173 C  CG  . ARG B 1 242 ? -1.262  -29.854 -4.130  1.00 46.03  ? 242  ARG B CG  1 
ATOM   6174 C  CD  . ARG B 1 242 ? -2.187  -28.658 -3.900  1.00 42.77  ? 242  ARG B CD  1 
ATOM   6175 N  NE  . ARG B 1 242 ? -3.342  -28.681 -4.792  1.00 41.33  ? 242  ARG B NE  1 
ATOM   6176 C  CZ  . ARG B 1 242 ? -3.323  -28.262 -6.052  1.00 41.54  ? 242  ARG B CZ  1 
ATOM   6177 N  NH1 . ARG B 1 242 ? -2.204  -27.784 -6.578  1.00 45.10  ? 242  ARG B NH1 1 
ATOM   6178 N  NH2 . ARG B 1 242 ? -4.423  -28.327 -6.789  1.00 42.88  ? 242  ARG B NH2 1 
ATOM   6179 N  N   . ARG B 1 243 ? 0.692   -32.590 -2.794  1.00 35.78  ? 243  ARG B N   1 
ATOM   6180 C  CA  . ARG B 1 243 ? 2.111   -32.535 -2.452  1.00 37.52  ? 243  ARG B CA  1 
ATOM   6181 C  C   . ARG B 1 243 ? 2.920   -33.510 -3.295  1.00 38.81  ? 243  ARG B C   1 
ATOM   6182 O  O   . ARG B 1 243 ? 3.994   -33.162 -3.798  1.00 37.33  ? 243  ARG B O   1 
ATOM   6183 C  CB  . ARG B 1 243 ? 2.315   -32.824 -0.962  1.00 38.52  ? 243  ARG B CB  1 
ATOM   6184 C  CG  . ARG B 1 243 ? 3.762   -32.655 -0.493  1.00 41.15  ? 243  ARG B CG  1 
ATOM   6185 C  CD  . ARG B 1 243 ? 4.040   -33.318 0.865   1.00 41.48  ? 243  ARG B CD  1 
ATOM   6186 N  NE  . ARG B 1 243 ? 4.015   -34.782 0.811   1.00 43.55  ? 243  ARG B NE  1 
ATOM   6187 C  CZ  . ARG B 1 243 ? 4.975   -35.536 0.279   1.00 42.69  ? 243  ARG B CZ  1 
ATOM   6188 N  NH1 . ARG B 1 243 ? 6.052   -34.976 -0.261  1.00 39.93  ? 243  ARG B NH1 1 
ATOM   6189 N  NH2 . ARG B 1 243 ? 4.855   -36.857 0.282   1.00 36.35  ? 243  ARG B NH2 1 
ATOM   6190 N  N   . ARG B 1 244 ? 2.422   -34.738 -3.461  1.00 34.36  ? 244  ARG B N   1 
ATOM   6191 C  CA  . ARG B 1 244 ? 3.168   -35.718 -4.242  1.00 36.16  ? 244  ARG B CA  1 
ATOM   6192 C  C   . ARG B 1 244 ? 3.230   -35.332 -5.711  1.00 36.61  ? 244  ARG B C   1 
ATOM   6193 O  O   . ARG B 1 244 ? 4.244   -35.591 -6.372  1.00 33.88  ? 244  ARG B O   1 
ATOM   6194 C  CB  . ARG B 1 244 ? 2.555   -37.108 -4.071  1.00 32.32  ? 244  ARG B CB  1 
ATOM   6195 C  CG  . ARG B 1 244 ? 2.706   -37.652 -2.649  1.00 34.70  ? 244  ARG B CG  1 
ATOM   6196 C  CD  . ARG B 1 244 ? 2.127   -39.047 -2.517  1.00 31.41  ? 244  ARG B CD  1 
ATOM   6197 N  NE  . ARG B 1 244 ? 2.148   -39.506 -1.128  1.00 31.00  ? 244  ARG B NE  1 
ATOM   6198 C  CZ  . ARG B 1 244 ? 1.824   -40.737 -0.750  1.00 27.98  ? 244  ARG B CZ  1 
ATOM   6199 N  NH1 . ARG B 1 244 ? 1.467   -41.637 -1.664  1.00 26.93  ? 244  ARG B NH1 1 
ATOM   6200 N  NH2 . ARG B 1 244 ? 1.866   -41.071 0.538   1.00 27.33  ? 244  ARG B NH2 1 
ATOM   6201 N  N   . ALA B 1 245 ? 2.170   -34.706 -6.233  1.00 36.50  ? 245  ALA B N   1 
ATOM   6202 C  CA  . ALA B 1 245 ? 2.188   -34.257 -7.622  1.00 35.23  ? 245  ALA B CA  1 
ATOM   6203 C  C   . ALA B 1 245 ? 3.193   -33.128 -7.817  1.00 38.06  ? 245  ALA B C   1 
ATOM   6204 O  O   . ALA B 1 245 ? 3.967   -33.129 -8.781  1.00 35.02  ? 245  ALA B O   1 
ATOM   6205 C  CB  . ALA B 1 245 ? 0.789   -33.810 -8.052  1.00 32.27  ? 245  ALA B CB  1 
ATOM   6206 N  N   . VAL B 1 246 ? 3.185   -32.147 -6.916  1.00 39.80  ? 246  VAL B N   1 
ATOM   6207 C  CA  . VAL B 1 246 ? 4.144   -31.050 -7.007  1.00 40.54  ? 246  VAL B CA  1 
ATOM   6208 C  C   . VAL B 1 246 ? 5.569   -31.578 -6.888  1.00 41.61  ? 246  VAL B C   1 
ATOM   6209 O  O   . VAL B 1 246 ? 6.474   -31.138 -7.609  1.00 38.03  ? 246  VAL B O   1 
ATOM   6210 C  CB  . VAL B 1 246 ? 3.830   -29.989 -5.934  1.00 42.09  ? 246  VAL B CB  1 
ATOM   6211 C  CG1 . VAL B 1 246 ? 4.951   -28.968 -5.841  1.00 42.15  ? 246  VAL B CG1 1 
ATOM   6212 C  CG2 . VAL B 1 246 ? 2.500   -29.311 -6.244  1.00 37.77  ? 246  VAL B CG2 1 
ATOM   6213 N  N   . GLU B 1 247 ? 5.787   -32.546 -5.994  1.00 38.18  ? 247  GLU B N   1 
ATOM   6214 C  CA  . GLU B 1 247 ? 7.116   -33.128 -5.833  1.00 37.29  ? 247  GLU B CA  1 
ATOM   6215 C  C   . GLU B 1 247 ? 7.539   -33.920 -7.066  1.00 40.63  ? 247  GLU B C   1 
ATOM   6216 O  O   . GLU B 1 247 ? 8.738   -34.010 -7.368  1.00 35.40  ? 247  GLU B O   1 
ATOM   6217 C  CB  . GLU B 1 247 ? 7.140   -34.010 -4.585  1.00 40.15  ? 247  GLU B CB  1 
ATOM   6218 C  CG  . GLU B 1 247 ? 8.516   -34.514 -4.175  1.00 43.82  ? 247  GLU B CG  1 
ATOM   6219 C  CD  . GLU B 1 247 ? 9.468   -33.392 -3.770  1.00 50.65  ? 247  GLU B CD  1 
ATOM   6220 O  OE1 . GLU B 1 247 ? 8.990   -32.301 -3.391  1.00 53.06  ? 247  GLU B OE1 1 
ATOM   6221 O  OE2 . GLU B 1 247 ? 10.698  -33.607 -3.826  1.00 54.45  ? 247  GLU B OE2 1 
ATOM   6222 N  N   . LEU B 1 248 ? 6.581   -34.505 -7.786  1.00 33.87  ? 248  LEU B N   1 
ATOM   6223 C  CA  . LEU B 1 248 ? 6.913   -35.154 -9.048  1.00 36.11  ? 248  LEU B CA  1 
ATOM   6224 C  C   . LEU B 1 248 ? 7.423   -34.133 -10.058 1.00 37.81  ? 248  LEU B C   1 
ATOM   6225 O  O   . LEU B 1 248 ? 8.374   -34.403 -10.803 1.00 38.93  ? 248  LEU B O   1 
ATOM   6226 C  CB  . LEU B 1 248 ? 5.690   -35.895 -9.596  1.00 32.74  ? 248  LEU B CB  1 
ATOM   6227 C  CG  . LEU B 1 248 ? 5.939   -36.856 -10.761 1.00 35.72  ? 248  LEU B CG  1 
ATOM   6228 C  CD1 . LEU B 1 248 ? 6.672   -38.102 -10.282 1.00 33.03  ? 248  LEU B CD1 1 
ATOM   6229 C  CD2 . LEU B 1 248 ? 4.633   -37.229 -11.464 1.00 31.09  ? 248  LEU B CD2 1 
ATOM   6230 N  N   . GLY B 1 249 ? 6.803   -32.951 -10.091 1.00 34.25  ? 249  GLY B N   1 
ATOM   6231 C  CA  . GLY B 1 249 ? 7.292   -31.892 -10.955 1.00 41.26  ? 249  GLY B CA  1 
ATOM   6232 C  C   . GLY B 1 249 ? 8.649   -31.367 -10.527 1.00 40.98  ? 249  GLY B C   1 
ATOM   6233 O  O   . GLY B 1 249 ? 9.498   -31.064 -11.370 1.00 42.57  ? 249  GLY B O   1 
ATOM   6234 N  N   . ARG B 1 250 ? 8.873   -31.255 -9.216  1.00 38.02  ? 250  ARG B N   1 
ATOM   6235 C  CA  . ARG B 1 250 ? 10.173  -30.811 -8.716  1.00 41.16  ? 250  ARG B CA  1 
ATOM   6236 C  C   . ARG B 1 250 ? 11.280  -31.774 -9.130  1.00 46.09  ? 250  ARG B C   1 
ATOM   6237 O  O   . ARG B 1 250 ? 12.366  -31.345 -9.539  1.00 45.59  ? 250  ARG B O   1 
ATOM   6238 C  CB  . ARG B 1 250 ? 10.124  -30.667 -7.192  1.00 41.45  ? 250  ARG B CB  1 
ATOM   6239 C  CG  . ARG B 1 250 ? 11.369  -30.060 -6.558  1.00 44.01  ? 250  ARG B CG  1 
ATOM   6240 C  CD  . ARG B 1 250 ? 11.127  -29.715 -5.098  1.00 47.91  ? 250  ARG B CD  1 
ATOM   6241 N  NE  . ARG B 1 250 ? 10.150  -28.634 -4.955  1.00 53.84  ? 250  ARG B NE  1 
ATOM   6242 C  CZ  . ARG B 1 250 ? 9.001   -28.733 -4.290  1.00 51.89  ? 250  ARG B CZ  1 
ATOM   6243 N  NH1 . ARG B 1 250 ? 8.665   -29.867 -3.687  1.00 51.39  ? 250  ARG B NH1 1 
ATOM   6244 N  NH2 . ARG B 1 250 ? 8.183   -27.692 -4.222  1.00 51.85  ? 250  ARG B NH2 1 
ATOM   6245 N  N   . ASN B 1 251 ? 11.018  -33.081 -9.046  1.00 39.07  ? 251  ASN B N   1 
ATOM   6246 C  CA  . ASN B 1 251 ? 11.980  -34.077 -9.506  1.00 42.10  ? 251  ASN B CA  1 
ATOM   6247 C  C   . ASN B 1 251 ? 12.271  -33.987 -10.997 1.00 44.76  ? 251  ASN B C   1 
ATOM   6248 O  O   . ASN B 1 251 ? 13.250  -34.588 -11.452 1.00 44.40  ? 251  ASN B O   1 
ATOM   6249 C  CB  . ASN B 1 251 ? 11.479  -35.487 -9.201  1.00 41.18  ? 251  ASN B CB  1 
ATOM   6250 C  CG  . ASN B 1 251 ? 11.842  -35.948 -7.814  1.00 40.93  ? 251  ASN B CG  1 
ATOM   6251 O  OD1 . ASN B 1 251 ? 12.787  -36.717 -7.635  1.00 42.19  ? 251  ASN B OD1 1 
ATOM   6252 N  ND2 . ASN B 1 251 ? 11.090  -35.485 -6.817  1.00 39.75  ? 251  ASN B ND2 1 
ATOM   6253 N  N   . LEU B 1 252 ? 11.452  -33.277 -11.771 1.00 42.53  ? 252  LEU B N   1 
ATOM   6254 C  CA  . LEU B 1 252 ? 11.623  -33.220 -13.218 1.00 46.46  ? 252  LEU B CA  1 
ATOM   6255 C  C   . LEU B 1 252 ? 11.848  -31.798 -13.723 1.00 48.77  ? 252  LEU B C   1 
ATOM   6256 O  O   . LEU B 1 252 ? 11.612  -31.523 -14.904 1.00 50.71  ? 252  LEU B O   1 
ATOM   6257 C  CB  . LEU B 1 252 ? 10.417  -33.848 -13.921 1.00 44.39  ? 252  LEU B CB  1 
ATOM   6258 C  CG  . LEU B 1 252 ? 10.184  -35.329 -13.629 1.00 37.72  ? 252  LEU B CG  1 
ATOM   6259 C  CD1 . LEU B 1 252 ? 8.753   -35.712 -13.960 1.00 37.27  ? 252  LEU B CD1 1 
ATOM   6260 C  CD2 . LEU B 1 252 ? 11.172  -36.209 -14.382 1.00 40.29  ? 252  LEU B CD2 1 
ATOM   6261 N  N   . ASN B 1 253 ? 12.297  -30.891 -12.850 1.00 47.98  ? 253  ASN B N   1 
ATOM   6262 C  CA  . ASN B 1 253 ? 12.604  -29.508 -13.225 1.00 51.00  ? 253  ASN B CA  1 
ATOM   6263 C  C   . ASN B 1 253 ? 11.394  -28.811 -13.839 1.00 50.81  ? 253  ASN B C   1 
ATOM   6264 O  O   . ASN B 1 253 ? 11.516  -28.068 -14.811 1.00 49.40  ? 253  ASN B O   1 
ATOM   6265 C  CB  . ASN B 1 253 ? 13.799  -29.440 -14.183 1.00 53.73  ? 253  ASN B CB  1 
ATOM   6266 C  CG  . ASN B 1 253 ? 15.038  -30.097 -13.616 1.00 54.26  ? 253  ASN B CG  1 
ATOM   6267 O  OD1 . ASN B 1 253 ? 15.310  -30.007 -12.418 1.00 62.21  ? 253  ASN B OD1 1 
ATOM   6268 N  ND2 . ASN B 1 253 ? 15.798  -30.770 -14.476 1.00 62.65  ? 253  ASN B ND2 1 
ATOM   6269 N  N   . CYS B 1 254 ? 10.216  -29.044 -13.268 1.00 49.42  ? 254  CYS B N   1 
ATOM   6270 C  CA  . CYS B 1 254 ? 8.989   -28.479 -13.810 1.00 48.68  ? 254  CYS B CA  1 
ATOM   6271 C  C   . CYS B 1 254 ? 8.700   -27.114 -13.200 1.00 46.67  ? 254  CYS B C   1 
ATOM   6272 O  O   . CYS B 1 254 ? 9.030   -26.848 -12.041 1.00 46.18  ? 254  CYS B O   1 
ATOM   6273 C  CB  . CYS B 1 254 ? 7.801   -29.414 -13.562 1.00 46.31  ? 254  CYS B CB  1 
ATOM   6274 S  SG  . CYS B 1 254 ? 7.655   -30.790 -14.727 1.00 46.17  ? 254  CYS B SG  1 
ATOM   6275 N  N   . ASN B 1 255 ? 8.106   -26.246 -14.009 1.00 48.69  ? 255  ASN B N   1 
ATOM   6276 C  CA  . ASN B 1 255 ? 7.482   -25.029 -13.514 1.00 49.33  ? 255  ASN B CA  1 
ATOM   6277 C  C   . ASN B 1 255 ? 6.398   -25.397 -12.505 1.00 52.09  ? 255  ASN B C   1 
ATOM   6278 O  O   . ASN B 1 255 ? 5.441   -26.103 -12.843 1.00 50.52  ? 255  ASN B O   1 
ATOM   6279 C  CB  . ASN B 1 255 ? 6.891   -24.263 -14.701 1.00 53.82  ? 255  ASN B CB  1 
ATOM   6280 C  CG  . ASN B 1 255 ? 6.485   -22.841 -14.360 1.00 57.82  ? 255  ASN B CG  1 
ATOM   6281 O  OD1 . ASN B 1 255 ? 5.971   -22.564 -13.276 1.00 57.30  ? 255  ASN B OD1 1 
ATOM   6282 N  ND2 . ASN B 1 255 ? 6.684   -21.935 -15.311 1.00 55.58  ? 255  ASN B ND2 1 
ATOM   6283 N  N   . LEU B 1 256 ? 6.543   -24.930 -11.263 1.00 49.94  ? 256  LEU B N   1 
ATOM   6284 C  CA  . LEU B 1 256 ? 5.600   -25.270 -10.203 1.00 49.57  ? 256  LEU B CA  1 
ATOM   6285 C  C   . LEU B 1 256 ? 4.698   -24.101 -9.818  1.00 52.38  ? 256  LEU B C   1 
ATOM   6286 O  O   . LEU B 1 256 ? 4.089   -24.123 -8.744  1.00 58.69  ? 256  LEU B O   1 
ATOM   6287 C  CB  . LEU B 1 256 ? 6.340   -25.779 -8.966  1.00 48.18  ? 256  LEU B CB  1 
ATOM   6288 C  CG  . LEU B 1 256 ? 7.382   -26.885 -9.128  1.00 45.92  ? 256  LEU B CG  1 
ATOM   6289 C  CD1 . LEU B 1 256 ? 7.885   -27.329 -7.766  1.00 43.19  ? 256  LEU B CD1 1 
ATOM   6290 C  CD2 . LEU B 1 256 ? 6.802   -28.061 -9.896  1.00 46.62  ? 256  LEU B CD2 1 
ATOM   6291 N  N   . ASN B 1 257 ? 4.583   -23.088 -10.678 1.00 56.11  ? 257  ASN B N   1 
ATOM   6292 C  CA  . ASN B 1 257 ? 3.844   -21.887 -10.298 1.00 55.01  ? 257  ASN B CA  1 
ATOM   6293 C  C   . ASN B 1 257 ? 2.347   -22.149 -10.223 1.00 54.60  ? 257  ASN B C   1 
ATOM   6294 O  O   . ASN B 1 257 ? 1.654   -21.575 -9.375  1.00 56.80  ? 257  ASN B O   1 
ATOM   6295 C  CB  . ASN B 1 257 ? 4.134   -20.754 -11.280 1.00 59.38  ? 257  ASN B CB  1 
ATOM   6296 C  CG  . ASN B 1 257 ? 5.573   -20.284 -11.224 1.00 66.39  ? 257  ASN B CG  1 
ATOM   6297 O  OD1 . ASN B 1 257 ? 6.264   -20.469 -10.217 1.00 60.22  ? 257  ASN B OD1 1 
ATOM   6298 N  ND2 . ASN B 1 257 ? 6.034   -19.665 -12.309 1.00 71.32  ? 257  ASN B ND2 1 
ATOM   6299 N  N   . SER B 1 258 ? 1.826   -23.005 -11.101 1.00 52.61  ? 258  SER B N   1 
ATOM   6300 C  CA  . SER B 1 258 ? 0.393   -23.254 -11.153 1.00 53.68  ? 258  SER B CA  1 
ATOM   6301 C  C   . SER B 1 258 ? 0.144   -24.693 -11.576 1.00 51.86  ? 258  SER B C   1 
ATOM   6302 O  O   . SER B 1 258 ? 1.018   -25.355 -12.147 1.00 47.92  ? 258  SER B O   1 
ATOM   6303 C  CB  . SER B 1 258 ? -0.313  -22.292 -12.120 1.00 52.93  ? 258  SER B CB  1 
ATOM   6304 O  OG  . SER B 1 258 ? 0.149   -22.482 -13.448 1.00 48.69  ? 258  SER B OG  1 
ATOM   6305 N  N   . ASP B 1 259 ? -1.074  -25.166 -11.288 1.00 47.26  ? 259  ASP B N   1 
ATOM   6306 C  CA  . ASP B 1 259 ? -1.492  -26.482 -11.759 1.00 46.35  ? 259  ASP B CA  1 
ATOM   6307 C  C   . ASP B 1 259 ? -1.343  -26.591 -13.276 1.00 47.51  ? 259  ASP B C   1 
ATOM   6308 O  O   . ASP B 1 259 ? -0.791  -27.573 -13.788 1.00 43.89  ? 259  ASP B O   1 
ATOM   6309 C  CB  . ASP B 1 259 ? -2.940  -26.759 -11.335 1.00 43.44  ? 259  ASP B CB  1 
ATOM   6310 C  CG  . ASP B 1 259 ? -3.107  -26.886 -9.820  1.00 47.88  ? 259  ASP B CG  1 
ATOM   6311 O  OD1 . ASP B 1 259 ? -2.090  -26.933 -9.092  1.00 48.09  ? 259  ASP B OD1 1 
ATOM   6312 O  OD2 . ASP B 1 259 ? -4.266  -26.944 -9.350  1.00 46.63  ? 259  ASP B OD2 1 
ATOM   6313 N  N   . GLU B 1 260 ? -1.813  -25.577 -14.012 1.00 48.08  ? 260  GLU B N   1 
ATOM   6314 C  CA  . GLU B 1 260 ? -1.744  -25.619 -15.472 1.00 47.69  ? 260  GLU B CA  1 
ATOM   6315 C  C   . GLU B 1 260 ? -0.307  -25.771 -15.959 1.00 47.75  ? 260  GLU B C   1 
ATOM   6316 O  O   . GLU B 1 260 ? -0.023  -26.580 -16.850 1.00 44.99  ? 260  GLU B O   1 
ATOM   6317 C  CB  . GLU B 1 260 ? -2.381  -24.361 -16.067 1.00 54.57  ? 260  GLU B CB  1 
ATOM   6318 C  CG  . GLU B 1 260 ? -1.940  -24.056 -17.493 1.00 55.18  ? 260  GLU B CG  1 
ATOM   6319 C  CD  . GLU B 1 260 ? -2.947  -23.213 -18.251 0.40 55.81  ? 260  GLU B CD  1 
ATOM   6320 O  OE1 . GLU B 1 260 ? -3.426  -23.662 -19.316 0.77 60.25  ? 260  GLU B OE1 1 
ATOM   6321 O  OE2 . GLU B 1 260 ? -3.256  -22.096 -17.782 0.73 55.14  ? 260  GLU B OE2 1 
ATOM   6322 N  N   . GLU B 1 261 ? 0.622   -25.006 -15.380 1.00 49.95  ? 261  GLU B N   1 
ATOM   6323 C  CA  . GLU B 1 261 ? 2.008   -25.087 -15.831 1.00 51.83  ? 261  GLU B CA  1 
ATOM   6324 C  C   . GLU B 1 261 ? 2.652   -26.402 -15.410 1.00 50.63  ? 261  GLU B C   1 
ATOM   6325 O  O   . GLU B 1 261 ? 3.381   -27.022 -16.196 1.00 49.41  ? 261  GLU B O   1 
ATOM   6326 C  CB  . GLU B 1 261 ? 2.806   -23.900 -15.299 1.00 55.07  ? 261  GLU B CB  1 
ATOM   6327 C  CG  . GLU B 1 261 ? 2.427   -22.576 -15.930 1.00 55.80  ? 261  GLU B CG  1 
ATOM   6328 C  CD  . GLU B 1 261 ? 2.964   -21.397 -15.152 1.00 64.97  ? 261  GLU B CD  1 
ATOM   6329 O  OE1 . GLU B 1 261 ? 2.485   -21.164 -14.019 1.00 64.15  ? 261  GLU B OE1 1 
ATOM   6330 O  OE2 . GLU B 1 261 ? 3.863   -20.703 -15.672 1.00 68.36  ? 261  GLU B OE2 1 
ATOM   6331 N  N   . LEU B 1 262 ? 2.396   -26.838 -14.172 1.00 46.60  ? 262  LEU B N   1 
ATOM   6332 C  CA  . LEU B 1 262 ? 2.899   -28.130 -13.713 1.00 44.44  ? 262  LEU B CA  1 
ATOM   6333 C  C   . LEU B 1 262 ? 2.377   -29.261 -14.591 1.00 42.59  ? 262  LEU B C   1 
ATOM   6334 O  O   . LEU B 1 262 ? 3.153   -30.091 -15.085 1.00 42.56  ? 262  LEU B O   1 
ATOM   6335 C  CB  . LEU B 1 262 ? 2.505   -28.355 -12.252 1.00 40.48  ? 262  LEU B CB  1 
ATOM   6336 C  CG  . LEU B 1 262 ? 2.752   -29.758 -11.701 1.00 38.17  ? 262  LEU B CG  1 
ATOM   6337 C  CD1 . LEU B 1 262 ? 4.217   -30.110 -11.811 1.00 37.90  ? 262  LEU B CD1 1 
ATOM   6338 C  CD2 . LEU B 1 262 ? 2.277   -29.876 -10.254 1.00 37.88  ? 262  LEU B CD2 1 
ATOM   6339 N  N   . ILE B 1 263 ? 1.058   -29.303 -14.798 1.00 40.33  ? 263  ILE B N   1 
ATOM   6340 C  CA  . ILE B 1 263 ? 0.458   -30.332 -15.643 1.00 41.91  ? 263  ILE B CA  1 
ATOM   6341 C  C   . ILE B 1 263 ? 1.045   -30.283 -17.047 1.00 41.51  ? 263  ILE B C   1 
ATOM   6342 O  O   . ILE B 1 263 ? 1.398   -31.318 -17.626 1.00 40.53  ? 263  ILE B O   1 
ATOM   6343 C  CB  . ILE B 1 263 ? -1.074  -30.177 -15.667 1.00 40.16  ? 263  ILE B CB  1 
ATOM   6344 C  CG1 . ILE B 1 263 ? -1.657  -30.500 -14.286 1.00 38.01  ? 263  ILE B CG1 1 
ATOM   6345 C  CG2 . ILE B 1 263 ? -1.687  -31.059 -16.739 1.00 37.61  ? 263  ILE B CG2 1 
ATOM   6346 C  CD1 . ILE B 1 263 ? -3.115  -30.107 -14.131 1.00 40.06  ? 263  ILE B CD1 1 
ATOM   6347 N  N   . HIS B 1 264 ? 1.154   -29.078 -17.622 1.00 44.06  ? 264  HIS B N   1 
ATOM   6348 C  CA  . HIS B 1 264 ? 1.678   -28.959 -18.982 1.00 46.86  ? 264  HIS B CA  1 
ATOM   6349 C  C   . HIS B 1 264 ? 3.096   -29.507 -19.075 1.00 43.73  ? 264  HIS B C   1 
ATOM   6350 O  O   . HIS B 1 264 ? 3.438   -30.204 -20.039 1.00 42.53  ? 264  HIS B O   1 
ATOM   6351 C  CB  . HIS B 1 264 ? 1.633   -27.504 -19.450 1.00 49.02  ? 264  HIS B CB  1 
ATOM   6352 C  CG  . HIS B 1 264 ? 2.104   -27.312 -20.860 1.00 53.28  ? 264  HIS B CG  1 
ATOM   6353 N  ND1 . HIS B 1 264 ? 3.417   -27.033 -21.176 1.00 51.99  ? 264  HIS B ND1 1 
ATOM   6354 C  CD2 . HIS B 1 264 ? 1.439   -27.373 -22.038 1.00 53.29  ? 264  HIS B CD2 1 
ATOM   6355 C  CE1 . HIS B 1 264 ? 3.538   -26.924 -22.487 1.00 52.98  ? 264  HIS B CE1 1 
ATOM   6356 N  NE2 . HIS B 1 264 ? 2.354   -27.127 -23.034 1.00 56.89  ? 264  HIS B NE2 1 
ATOM   6357 N  N   . CYS B 1 265 ? 3.929   -29.211 -18.072 1.00 43.08  ? 265  CYS B N   1 
ATOM   6358 C  CA  . CYS B 1 265 ? 5.271   -29.783 -18.011 1.00 43.04  ? 265  CYS B CA  1 
ATOM   6359 C  C   . CYS B 1 265 ? 5.223   -31.305 -17.955 1.00 43.45  ? 265  CYS B C   1 
ATOM   6360 O  O   . CYS B 1 265 ? 5.928   -31.989 -18.707 1.00 41.87  ? 265  CYS B O   1 
ATOM   6361 C  CB  . CYS B 1 265 ? 6.017   -29.235 -16.793 1.00 46.03  ? 265  CYS B CB  1 
ATOM   6362 S  SG  . CYS B 1 265 ? 7.668   -29.932 -16.579 1.00 52.97  ? 265  CYS B SG  1 
ATOM   6363 N  N   . LEU B 1 266 ? 4.392   -31.854 -17.062 1.00 42.46  ? 266  LEU B N   1 
ATOM   6364 C  CA  . LEU B 1 266 ? 4.329   -33.302 -16.898 1.00 37.52  ? 266  LEU B CA  1 
ATOM   6365 C  C   . LEU B 1 266 ? 3.782   -33.991 -18.142 1.00 37.61  ? 266  LEU B C   1 
ATOM   6366 O  O   . LEU B 1 266 ? 4.204   -35.108 -18.460 1.00 37.75  ? 266  LEU B O   1 
ATOM   6367 C  CB  . LEU B 1 266 ? 3.484   -33.647 -15.671 1.00 38.79  ? 266  LEU B CB  1 
ATOM   6368 C  CG  . LEU B 1 266 ? 4.129   -33.223 -14.348 1.00 37.20  ? 266  LEU B CG  1 
ATOM   6369 C  CD1 . LEU B 1 266 ? 3.189   -33.438 -13.163 1.00 37.07  ? 266  LEU B CD1 1 
ATOM   6370 C  CD2 . LEU B 1 266 ? 5.445   -33.967 -14.152 1.00 34.82  ? 266  LEU B CD2 1 
ATOM   6371 N  N   . ARG B 1 267 ? 2.866   -33.342 -18.869 1.00 37.64  ? 267  ARG B N   1 
ATOM   6372 C  CA  . ARG B 1 267 ? 2.327   -33.933 -20.093 1.00 35.47  ? 267  ARG B CA  1 
ATOM   6373 C  C   . ARG B 1 267 ? 3.348   -34.008 -21.220 1.00 39.61  ? 267  ARG B C   1 
ATOM   6374 O  O   . ARG B 1 267 ? 3.161   -34.794 -22.157 1.00 40.09  ? 267  ARG B O   1 
ATOM   6375 C  CB  . ARG B 1 267 ? 1.108   -33.147 -20.571 1.00 37.09  ? 267  ARG B CB  1 
ATOM   6376 C  CG  . ARG B 1 267 ? -0.135  -33.494 -19.808 1.00 37.88  ? 267  ARG B CG  1 
ATOM   6377 C  CD  . ARG B 1 267 ? -1.346  -32.732 -20.288 1.00 39.43  ? 267  ARG B CD  1 
ATOM   6378 N  NE  . ARG B 1 267 ? -2.517  -33.163 -19.543 1.00 40.07  ? 267  ARG B NE  1 
ATOM   6379 C  CZ  . ARG B 1 267 ? -3.636  -32.461 -19.434 1.00 41.21  ? 267  ARG B CZ  1 
ATOM   6380 N  NH1 . ARG B 1 267 ? -3.736  -31.280 -20.033 1.00 39.65  ? 267  ARG B NH1 1 
ATOM   6381 N  NH2 . ARG B 1 267 ? -4.649  -32.941 -18.721 1.00 40.30  ? 267  ARG B NH2 1 
ATOM   6382 N  N   . GLU B 1 268 ? 4.411   -33.211 -21.163 1.00 39.08  ? 268  GLU B N   1 
ATOM   6383 C  CA  . GLU B 1 268 ? 5.411   -33.231 -22.218 1.00 43.08  ? 268  GLU B CA  1 
ATOM   6384 C  C   . GLU B 1 268 ? 6.517   -34.245 -21.972 1.00 42.99  ? 268  GLU B C   1 
ATOM   6385 O  O   . GLU B 1 268 ? 7.351   -34.451 -22.858 1.00 41.93  ? 268  GLU B O   1 
ATOM   6386 C  CB  . GLU B 1 268 ? 6.015   -31.835 -22.394 1.00 46.04  ? 268  GLU B CB  1 
ATOM   6387 C  CG  . GLU B 1 268 ? 4.976   -30.783 -22.766 1.00 52.39  ? 268  GLU B CG  1 
ATOM   6388 C  CD  . GLU B 1 268 ? 5.363   -29.995 -23.999 1.00 60.49  ? 268  GLU B CD  1 
ATOM   6389 O  OE1 . GLU B 1 268 ? 6.560   -29.674 -24.143 1.00 71.74  ? 268  GLU B OE1 1 
ATOM   6390 O  OE2 . GLU B 1 268 ? 4.473   -29.700 -24.826 1.00 64.02  ? 268  GLU B OE2 1 
ATOM   6391 N  N   . LYS B 1 269 ? 6.536   -34.890 -20.810 1.00 43.03  ? 269  LYS B N   1 
ATOM   6392 C  CA  . LYS B 1 269 ? 7.547   -35.895 -20.524 1.00 38.52  ? 269  LYS B CA  1 
ATOM   6393 C  C   . LYS B 1 269 ? 7.166   -37.240 -21.133 1.00 39.32  ? 269  LYS B C   1 
ATOM   6394 O  O   . LYS B 1 269 ? 5.986   -37.599 -21.215 1.00 38.46  ? 269  LYS B O   1 
ATOM   6395 C  CB  . LYS B 1 269 ? 7.732   -36.054 -19.016 1.00 38.71  ? 269  LYS B CB  1 
ATOM   6396 C  CG  . LYS B 1 269 ? 8.013   -34.754 -18.277 1.00 41.31  ? 269  LYS B CG  1 
ATOM   6397 C  CD  . LYS B 1 269 ? 9.420   -34.244 -18.569 1.00 42.31  ? 269  LYS B CD  1 
ATOM   6398 C  CE  . LYS B 1 269 ? 9.645   -32.871 -17.960 1.00 46.42  ? 269  LYS B CE  1 
ATOM   6399 N  NZ  . LYS B 1 269 ? 11.018  -32.364 -18.246 1.00 58.44  ? 269  LYS B NZ  1 
ATOM   6400 N  N   . LYS B 1 270 ? 8.186   -37.982 -21.566 1.00 40.81  ? 270  LYS B N   1 
ATOM   6401 C  CA  . LYS B 1 270 ? 8.003   -39.378 -21.928 1.00 35.40  ? 270  LYS B CA  1 
ATOM   6402 C  C   . LYS B 1 270 ? 7.486   -40.147 -20.708 1.00 38.80  ? 270  LYS B C   1 
ATOM   6403 O  O   . LYS B 1 270 ? 7.793   -39.786 -19.571 1.00 34.37  ? 270  LYS B O   1 
ATOM   6404 C  CB  . LYS B 1 270 ? 9.320   -39.984 -22.400 1.00 41.46  ? 270  LYS B CB  1 
ATOM   6405 C  CG  . LYS B 1 270 ? 9.764   -39.533 -23.792 1.00 44.94  ? 270  LYS B CG  1 
ATOM   6406 C  CD  . LYS B 1 270 ? 11.267  -39.296 -23.821 1.00 55.09  ? 270  LYS B CD  1 
ATOM   6407 C  CE  . LYS B 1 270 ? 12.052  -40.599 -23.965 1.00 66.23  ? 270  LYS B CE  1 
ATOM   6408 N  NZ  . LYS B 1 270 ? 13.513  -40.412 -23.689 1.00 60.79  ? 270  LYS B NZ  1 
ATOM   6409 N  N   . PRO B 1 271 ? 6.690   -41.201 -20.919 1.00 39.65  ? 271  PRO B N   1 
ATOM   6410 C  CA  . PRO B 1 271 ? 6.145   -41.942 -19.765 1.00 34.64  ? 271  PRO B CA  1 
ATOM   6411 C  C   . PRO B 1 271 ? 7.218   -42.448 -18.819 1.00 32.78  ? 271  PRO B C   1 
ATOM   6412 O  O   . PRO B 1 271 ? 7.071   -42.335 -17.597 1.00 32.40  ? 271  PRO B O   1 
ATOM   6413 C  CB  . PRO B 1 271 ? 5.388   -43.101 -20.426 1.00 34.73  ? 271  PRO B CB  1 
ATOM   6414 C  CG  . PRO B 1 271 ? 5.073   -42.620 -21.808 1.00 35.31  ? 271  PRO B CG  1 
ATOM   6415 C  CD  . PRO B 1 271 ? 6.239   -41.759 -22.206 1.00 37.95  ? 271  PRO B CD  1 
ATOM   6416 N  N   . GLN B 1 272 ? 8.312   -42.988 -19.361 1.00 33.66  ? 272  GLN B N   1 
ATOM   6417 C  CA  . GLN B 1 272 ? 9.350   -43.569 -18.520 1.00 35.97  ? 272  GLN B CA  1 
ATOM   6418 C  C   . GLN B 1 272 ? 10.012  -42.519 -17.634 1.00 38.39  ? 272  GLN B C   1 
ATOM   6419 O  O   . GLN B 1 272 ? 10.499  -42.845 -16.543 1.00 35.68  ? 272  GLN B O   1 
ATOM   6420 C  CB  . GLN B 1 272 ? 10.390  -44.279 -19.392 1.00 35.18  ? 272  GLN B CB  1 
ATOM   6421 C  CG  . GLN B 1 272 ? 11.221  -45.300 -18.624 1.00 44.60  ? 272  GLN B CG  1 
ATOM   6422 C  CD  . GLN B 1 272 ? 10.352  -46.268 -17.830 1.00 44.10  ? 272  GLN B CD  1 
ATOM   6423 O  OE1 . GLN B 1 272 ? 9.394   -46.838 -18.360 1.00 44.42  ? 272  GLN B OE1 1 
ATOM   6424 N  NE2 . GLN B 1 272 ? 10.681  -46.453 -16.556 1.00 41.53  ? 272  GLN B NE2 1 
ATOM   6425 N  N   . GLU B 1 273 ? 10.027  -41.255 -18.071 1.00 37.63  ? 273  GLU B N   1 
ATOM   6426 C  CA  . GLU B 1 273 ? 10.598  -40.204 -17.233 1.00 36.94  ? 273  GLU B CA  1 
ATOM   6427 C  C   . GLU B 1 273 ? 9.802   -40.031 -15.949 1.00 34.69  ? 273  GLU B C   1 
ATOM   6428 O  O   . GLU B 1 273 ? 10.376  -39.760 -14.888 1.00 32.35  ? 273  GLU B O   1 
ATOM   6429 C  CB  . GLU B 1 273 ? 10.637  -38.880 -17.984 1.00 37.37  ? 273  GLU B CB  1 
ATOM   6430 C  CG  . GLU B 1 273 ? 11.610  -38.818 -19.130 1.00 41.69  ? 273  GLU B CG  1 
ATOM   6431 C  CD  . GLU B 1 273 ? 11.598  -37.448 -19.761 1.00 42.87  ? 273  GLU B CD  1 
ATOM   6432 O  OE1 . GLU B 1 273 ? 10.853  -37.260 -20.742 1.00 45.82  ? 273  GLU B OE1 1 
ATOM   6433 O  OE2 . GLU B 1 273 ? 12.309  -36.555 -19.252 1.00 47.80  ? 273  GLU B OE2 1 
ATOM   6434 N  N   . LEU B 1 274 ? 8.472   -40.136 -16.036 1.00 29.77  ? 274  LEU B N   1 
ATOM   6435 C  CA  . LEU B 1 274 ? 7.653   -40.076 -14.830 1.00 30.90  ? 274  LEU B CA  1 
ATOM   6436 C  C   . LEU B 1 274 ? 7.913   -41.284 -13.943 1.00 28.42  ? 274  LEU B C   1 
ATOM   6437 O  O   . LEU B 1 274 ? 8.095   -41.149 -12.726 1.00 29.39  ? 274  LEU B O   1 
ATOM   6438 C  CB  . LEU B 1 274 ? 6.170   -39.990 -15.194 1.00 30.72  ? 274  LEU B CB  1 
ATOM   6439 C  CG  . LEU B 1 274 ? 5.700   -38.881 -16.145 1.00 35.11  ? 274  LEU B CG  1 
ATOM   6440 C  CD1 . LEU B 1 274 ? 4.176   -38.820 -16.145 1.00 34.93  ? 274  LEU B CD1 1 
ATOM   6441 C  CD2 . LEU B 1 274 ? 6.267   -37.542 -15.748 1.00 33.32  ? 274  LEU B CD2 1 
ATOM   6442 N  N   . ILE B 1 275 ? 7.938   -42.477 -14.543 1.00 29.93  ? 275  ILE B N   1 
ATOM   6443 C  CA  . ILE B 1 275 ? 8.111   -43.710 -13.779 1.00 29.33  ? 275  ILE B CA  1 
ATOM   6444 C  C   . ILE B 1 275 ? 9.456   -43.719 -13.064 1.00 32.26  ? 275  ILE B C   1 
ATOM   6445 O  O   . ILE B 1 275 ? 9.571   -44.200 -11.928 1.00 34.13  ? 275  ILE B O   1 
ATOM   6446 C  CB  . ILE B 1 275 ? 7.956   -44.923 -14.714 1.00 31.85  ? 275  ILE B CB  1 
ATOM   6447 C  CG1 . ILE B 1 275 ? 6.535   -44.975 -15.293 1.00 31.07  ? 275  ILE B CG1 1 
ATOM   6448 C  CG2 . ILE B 1 275 ? 8.319   -46.213 -14.001 1.00 30.45  ? 275  ILE B CG2 1 
ATOM   6449 C  CD1 . ILE B 1 275 ? 6.378   -46.003 -16.390 1.00 30.78  ? 275  ILE B CD1 1 
ATOM   6450 N  N   . ASP B 1 276 ? 10.492  -43.172 -13.707 1.00 32.03  ? 276  ASP B N   1 
ATOM   6451 C  CA  . ASP B 1 276 ? 11.832  -43.208 -13.134 1.00 32.97  ? 276  ASP B CA  1 
ATOM   6452 C  C   . ASP B 1 276 ? 11.942  -42.441 -11.825 1.00 31.40  ? 276  ASP B C   1 
ATOM   6453 O  O   . ASP B 1 276 ? 12.842  -42.739 -11.029 1.00 36.19  ? 276  ASP B O   1 
ATOM   6454 C  CB  . ASP B 1 276 ? 12.858  -42.655 -14.135 1.00 35.23  ? 276  ASP B CB  1 
ATOM   6455 C  CG  . ASP B 1 276 ? 13.276  -43.680 -15.167 1.00 41.33  ? 276  ASP B CG  1 
ATOM   6456 O  OD1 . ASP B 1 276 ? 13.005  -44.878 -14.951 1.00 43.76  ? 276  ASP B OD1 1 
ATOM   6457 O  OD2 . ASP B 1 276 ? 13.886  -43.294 -16.188 1.00 39.55  ? 276  ASP B OD2 1 
ATOM   6458 N  N   . VAL B 1 277 ? 11.066  -41.466 -11.571 1.00 29.65  ? 277  VAL B N   1 
ATOM   6459 C  CA  . VAL B 1 277 ? 11.109  -40.699 -10.327 1.00 29.53  ? 277  VAL B CA  1 
ATOM   6460 C  C   . VAL B 1 277 ? 9.882   -40.952 -9.455  1.00 32.45  ? 277  VAL B C   1 
ATOM   6461 O  O   . VAL B 1 277 ? 9.714   -40.292 -8.421  1.00 33.11  ? 277  VAL B O   1 
ATOM   6462 C  CB  . VAL B 1 277 ? 11.274  -39.194 -10.595 1.00 32.88  ? 277  VAL B CB  1 
ATOM   6463 C  CG1 . VAL B 1 277 ? 12.654  -38.899 -11.245 1.00 33.28  ? 277  VAL B CG1 1 
ATOM   6464 C  CG2 . VAL B 1 277 ? 10.124  -38.681 -11.457 1.00 29.42  ? 277  VAL B CG2 1 
ATOM   6465 N  N   . GLU B 1 278 ? 9.037   -41.913 -9.840  1.00 28.95  ? 278  GLU B N   1 
ATOM   6466 C  CA  . GLU B 1 278 ? 7.755   -42.138 -9.174  1.00 29.86  ? 278  GLU B CA  1 
ATOM   6467 C  C   . GLU B 1 278 ? 7.931   -42.362 -7.676  1.00 29.34  ? 278  GLU B C   1 
ATOM   6468 O  O   . GLU B 1 278 ? 7.239   -41.746 -6.856  1.00 32.37  ? 278  GLU B O   1 
ATOM   6469 C  CB  . GLU B 1 278 ? 7.054   -43.334 -9.829  1.00 30.38  ? 278  GLU B CB  1 
ATOM   6470 C  CG  . GLU B 1 278 ? 5.776   -43.777 -9.133  1.00 33.06  ? 278  GLU B CG  1 
ATOM   6471 C  CD  . GLU B 1 278 ? 5.170   -45.037 -9.746  1.00 34.10  ? 278  GLU B CD  1 
ATOM   6472 O  OE1 . GLU B 1 278 ? 5.376   -45.296 -10.948 1.00 32.01  ? 278  GLU B OE1 1 
ATOM   6473 O  OE2 . GLU B 1 278 ? 4.465   -45.769 -9.023  1.00 37.74  ? 278  GLU B OE2 1 
ATOM   6474 N  N   . TRP B 1 279 ? 8.862   -43.236 -7.299  1.00 32.35  ? 279  TRP B N   1 
ATOM   6475 C  CA  . TRP B 1 279 ? 9.053   -43.565 -5.891  1.00 33.04  ? 279  TRP B CA  1 
ATOM   6476 C  C   . TRP B 1 279 ? 9.684   -42.437 -5.085  1.00 35.46  ? 279  TRP B C   1 
ATOM   6477 O  O   . TRP B 1 279 ? 9.667   -42.506 -3.852  1.00 35.88  ? 279  TRP B O   1 
ATOM   6478 C  CB  . TRP B 1 279 ? 9.902   -44.831 -5.773  1.00 35.62  ? 279  TRP B CB  1 
ATOM   6479 C  CG  . TRP B 1 279 ? 9.301   -45.978 -6.515  1.00 36.41  ? 279  TRP B CG  1 
ATOM   6480 C  CD1 . TRP B 1 279 ? 9.611   -46.398 -7.789  1.00 33.88  ? 279  TRP B CD1 1 
ATOM   6481 C  CD2 . TRP B 1 279 ? 8.252   -46.841 -6.053  1.00 32.96  ? 279  TRP B CD2 1 
ATOM   6482 N  NE1 . TRP B 1 279 ? 8.832   -47.479 -8.128  1.00 38.08  ? 279  TRP B NE1 1 
ATOM   6483 C  CE2 . TRP B 1 279 ? 7.990   -47.769 -7.082  1.00 35.84  ? 279  TRP B CE2 1 
ATOM   6484 C  CE3 . TRP B 1 279 ? 7.516   -46.923 -4.864  1.00 32.57  ? 279  TRP B CE3 1 
ATOM   6485 C  CZ2 . TRP B 1 279 ? 7.021   -48.764 -6.958  1.00 33.19  ? 279  TRP B CZ2 1 
ATOM   6486 C  CZ3 . TRP B 1 279 ? 6.556   -47.916 -4.742  1.00 31.22  ? 279  TRP B CZ3 1 
ATOM   6487 C  CH2 . TRP B 1 279 ? 6.322   -48.825 -5.780  1.00 27.83  ? 279  TRP B CH2 1 
ATOM   6488 N  N   . ASN B 1 280 ? 10.229  -41.407 -5.737  1.00 34.21  ? 280  ASN B N   1 
ATOM   6489 C  CA  . ASN B 1 280 ? 10.886  -40.317 -5.017  1.00 35.53  ? 280  ASN B CA  1 
ATOM   6490 C  C   . ASN B 1 280 ? 9.907   -39.436 -4.253  1.00 36.96  ? 280  ASN B C   1 
ATOM   6491 O  O   . ASN B 1 280 ? 10.335  -38.670 -3.384  1.00 40.91  ? 280  ASN B O   1 
ATOM   6492 C  CB  . ASN B 1 280 ? 11.677  -39.431 -5.986  1.00 34.20  ? 280  ASN B CB  1 
ATOM   6493 C  CG  . ASN B 1 280 ? 12.877  -40.143 -6.604  1.00 36.81  ? 280  ASN B CG  1 
ATOM   6494 O  OD1 . ASN B 1 280 ? 13.151  -41.310 -6.319  1.00 37.40  ? 280  ASN B OD1 1 
ATOM   6495 N  ND2 . ASN B 1 280 ? 13.594  -39.433 -7.468  1.00 38.66  ? 280  ASN B ND2 1 
ATOM   6496 N  N   . VAL B 1 281 ? 8.607   -39.500 -4.561  1.00 36.65  ? 281  VAL B N   1 
ATOM   6497 C  CA  . VAL B 1 281 ? 7.659   -38.573 -3.948  1.00 33.08  ? 281  VAL B CA  1 
ATOM   6498 C  C   . VAL B 1 281 ? 7.044   -39.110 -2.667  1.00 37.55  ? 281  VAL B C   1 
ATOM   6499 O  O   . VAL B 1 281 ? 6.271   -38.391 -2.019  1.00 37.19  ? 281  VAL B O   1 
ATOM   6500 C  CB  . VAL B 1 281 ? 6.535   -38.176 -4.930  1.00 37.02  ? 281  VAL B CB  1 
ATOM   6501 C  CG1 . VAL B 1 281 ? 7.122   -37.800 -6.280  1.00 35.52  ? 281  VAL B CG1 1 
ATOM   6502 C  CG2 . VAL B 1 281 ? 5.508   -39.298 -5.075  1.00 34.74  ? 281  VAL B CG2 1 
ATOM   6503 N  N   . LEU B 1 282 ? 7.363   -40.338 -2.272  1.00 34.00  ? 282  LEU B N   1 
ATOM   6504 C  CA  . LEU B 1 282 ? 6.818   -40.866 -1.028  1.00 34.09  ? 282  LEU B CA  1 
ATOM   6505 C  C   . LEU B 1 282 ? 7.357   -40.059 0.152   1.00 36.16  ? 282  LEU B C   1 
ATOM   6506 O  O   . LEU B 1 282 ? 8.500   -39.586 0.113   1.00 37.71  ? 282  LEU B O   1 
ATOM   6507 C  CB  . LEU B 1 282 ? 7.176   -42.343 -0.858  1.00 31.24  ? 282  LEU B CB  1 
ATOM   6508 C  CG  . LEU B 1 282 ? 6.389   -43.344 -1.712  1.00 30.82  ? 282  LEU B CG  1 
ATOM   6509 C  CD1 . LEU B 1 282 ? 6.976   -44.738 -1.531  1.00 32.11  ? 282  LEU B CD1 1 
ATOM   6510 C  CD2 . LEU B 1 282 ? 4.909   -43.323 -1.348  1.00 27.96  ? 282  LEU B CD2 1 
ATOM   6511 N  N   . PRO B 1 283 ? 6.562   -39.862 1.203   1.00 38.29  ? 283  PRO B N   1 
ATOM   6512 C  CA  . PRO B 1 283 ? 7.039   -39.022 2.311   1.00 37.69  ? 283  PRO B CA  1 
ATOM   6513 C  C   . PRO B 1 283 ? 8.061   -39.713 3.196   1.00 40.41  ? 283  PRO B C   1 
ATOM   6514 O  O   . PRO B 1 283 ? 8.862   -39.025 3.842   1.00 45.66  ? 283  PRO B O   1 
ATOM   6515 C  CB  . PRO B 1 283 ? 5.749   -38.687 3.077   1.00 38.01  ? 283  PRO B CB  1 
ATOM   6516 C  CG  . PRO B 1 283 ? 4.819   -39.823 2.771   1.00 35.54  ? 283  PRO B CG  1 
ATOM   6517 C  CD  . PRO B 1 283 ? 5.140   -40.226 1.344   1.00 33.69  ? 283  PRO B CD  1 
ATOM   6518 N  N   . PHE B 1 284 ? 8.068   -41.041 3.256   1.00 36.06  ? 284  PHE B N   1 
ATOM   6519 C  CA  . PHE B 1 284 ? 8.951   -41.743 4.174   1.00 38.00  ? 284  PHE B CA  1 
ATOM   6520 C  C   . PHE B 1 284 ? 9.535   -42.966 3.495   1.00 39.45  ? 284  PHE B C   1 
ATOM   6521 O  O   . PHE B 1 284 ? 8.930   -43.543 2.587   1.00 35.56  ? 284  PHE B O   1 
ATOM   6522 C  CB  . PHE B 1 284 ? 8.234   -42.216 5.460   1.00 39.54  ? 284  PHE B CB  1 
ATOM   6523 C  CG  . PHE B 1 284 ? 7.260   -41.225 6.035   1.00 44.52  ? 284  PHE B CG  1 
ATOM   6524 C  CD1 . PHE B 1 284 ? 7.703   -40.130 6.765   1.00 50.50  ? 284  PHE B CD1 1 
ATOM   6525 C  CD2 . PHE B 1 284 ? 5.896   -41.409 5.872   1.00 46.66  ? 284  PHE B CD2 1 
ATOM   6526 C  CE1 . PHE B 1 284 ? 6.799   -39.227 7.305   1.00 46.99  ? 284  PHE B CE1 1 
ATOM   6527 C  CE2 . PHE B 1 284 ? 4.989   -40.512 6.407   1.00 47.83  ? 284  PHE B CE2 1 
ATOM   6528 C  CZ  . PHE B 1 284 ? 5.442   -39.420 7.125   1.00 49.30  ? 284  PHE B CZ  1 
ATOM   6529 N  N   . ASP B 1 285 ? 10.717  -43.366 3.956   1.00 37.76  ? 285  ASP B N   1 
ATOM   6530 C  CA  . ASP B 1 285 ? 11.195  -44.711 3.670   1.00 42.16  ? 285  ASP B CA  1 
ATOM   6531 C  C   . ASP B 1 285 ? 10.174  -45.705 4.207   1.00 39.01  ? 285  ASP B C   1 
ATOM   6532 O  O   . ASP B 1 285 ? 9.787   -45.637 5.377   1.00 33.54  ? 285  ASP B O   1 
ATOM   6533 C  CB  . ASP B 1 285 ? 12.564  -44.933 4.313   1.00 42.31  ? 285  ASP B CB  1 
ATOM   6534 C  CG  . ASP B 1 285 ? 13.703  -44.557 3.394   1.00 57.82  ? 285  ASP B CG  1 
ATOM   6535 O  OD1 . ASP B 1 285 ? 14.737  -45.263 3.406   1.00 64.67  ? 285  ASP B OD1 1 
ATOM   6536 O  OD2 . ASP B 1 285 ? 13.554  -43.565 2.640   1.00 61.79  ? 285  ASP B OD2 1 
ATOM   6537 N  N   . SER B 1 286 ? 9.709   -46.611 3.351   1.00 34.41  ? 286  SER B N   1 
ATOM   6538 C  CA  . SER B 1 286 ? 8.570   -47.431 3.740   1.00 34.68  ? 286  SER B CA  1 
ATOM   6539 C  C   . SER B 1 286 ? 8.499   -48.664 2.859   1.00 34.14  ? 286  SER B C   1 
ATOM   6540 O  O   . SER B 1 286 ? 9.134   -48.742 1.806   1.00 33.56  ? 286  SER B O   1 
ATOM   6541 C  CB  . SER B 1 286 ? 7.270   -46.634 3.643   1.00 31.54  ? 286  SER B CB  1 
ATOM   6542 O  OG  . SER B 1 286 ? 7.175   -46.058 2.350   1.00 34.61  ? 286  SER B OG  1 
ATOM   6543 N  N   . ILE B 1 287 ? 7.712   -49.634 3.316   1.00 25.91  ? 287  ILE B N   1 
ATOM   6544 C  CA  . ILE B 1 287 ? 7.278   -50.746 2.491   1.00 29.28  ? 287  ILE B CA  1 
ATOM   6545 C  C   . ILE B 1 287 ? 5.757   -50.741 2.507   1.00 24.43  ? 287  ILE B C   1 
ATOM   6546 O  O   . ILE B 1 287 ? 5.125   -50.207 3.423   1.00 25.43  ? 287  ILE B O   1 
ATOM   6547 C  CB  . ILE B 1 287 ? 7.831   -52.093 2.973   1.00 26.63  ? 287  ILE B CB  1 
ATOM   6548 C  CG1 . ILE B 1 287 ? 7.398   -52.356 4.412   1.00 25.56  ? 287  ILE B CG1 1 
ATOM   6549 C  CG2 . ILE B 1 287 ? 9.372   -52.117 2.870   1.00 29.73  ? 287  ILE B CG2 1 
ATOM   6550 C  CD1 . ILE B 1 287 ? 7.781   -53.737 4.877   1.00 27.95  ? 287  ILE B CD1 1 
ATOM   6551 N  N   . PHE B 1 288 ? 5.172   -51.328 1.469   1.00 24.32  ? 288  PHE B N   1 
ATOM   6552 C  CA  . PHE B 1 288 ? 3.713   -51.349 1.311   1.00 23.85  ? 288  PHE B CA  1 
ATOM   6553 C  C   . PHE B 1 288 ? 3.138   -49.927 1.298   1.00 23.31  ? 288  PHE B C   1 
ATOM   6554 O  O   . PHE B 1 288 ? 2.066   -49.663 1.851   1.00 25.66  ? 288  PHE B O   1 
ATOM   6555 C  CB  . PHE B 1 288 ? 3.050   -52.208 2.397   1.00 22.65  ? 288  PHE B CB  1 
ATOM   6556 C  CG  . PHE B 1 288 ? 1.914   -53.057 1.898   1.00 24.69  ? 288  PHE B CG  1 
ATOM   6557 C  CD1 . PHE B 1 288 ? 1.764   -54.362 2.340   1.00 22.74  ? 288  PHE B CD1 1 
ATOM   6558 C  CD2 . PHE B 1 288 ? 0.986   -52.549 0.986   1.00 23.64  ? 288  PHE B CD2 1 
ATOM   6559 C  CE1 . PHE B 1 288 ? 0.710   -55.147 1.894   1.00 21.65  ? 288  PHE B CE1 1 
ATOM   6560 C  CE2 . PHE B 1 288 ? -0.071  -53.335 0.528   1.00 24.17  ? 288  PHE B CE2 1 
ATOM   6561 C  CZ  . PHE B 1 288 ? -0.205  -54.635 0.980   1.00 20.12  ? 288  PHE B CZ  1 
ATOM   6562 N  N   . ARG B 1 289 ? 3.861   -49.000 0.660   1.00 23.04  ? 289  ARG B N   1 
ATOM   6563 C  CA  . ARG B 1 289 ? 3.348   -47.668 0.359   1.00 25.14  ? 289  ARG B CA  1 
ATOM   6564 C  C   . ARG B 1 289 ? 3.639   -47.335 -1.100  1.00 26.32  ? 289  ARG B C   1 
ATOM   6565 O  O   . ARG B 1 289 ? 4.716   -47.650 -1.613  1.00 24.44  ? 289  ARG B O   1 
ATOM   6566 C  CB  . ARG B 1 289 ? 3.956   -46.594 1.265   1.00 24.90  ? 289  ARG B CB  1 
ATOM   6567 C  CG  . ARG B 1 289 ? 3.572   -46.717 2.755   1.00 22.12  ? 289  ARG B CG  1 
ATOM   6568 C  CD  . ARG B 1 289 ? 2.090   -46.443 2.969   1.00 23.22  ? 289  ARG B CD  1 
ATOM   6569 N  NE  . ARG B 1 289 ? 1.744   -46.416 4.393   1.00 24.30  ? 289  ARG B NE  1 
ATOM   6570 C  CZ  . ARG B 1 289 ? 1.403   -47.488 5.099   1.00 27.23  ? 289  ARG B CZ  1 
ATOM   6571 N  NH1 . ARG B 1 289 ? 1.354   -48.680 4.513   1.00 25.71  ? 289  ARG B NH1 1 
ATOM   6572 N  NH2 . ARG B 1 289 ? 1.103   -47.368 6.387   1.00 28.01  ? 289  ARG B NH2 1 
ATOM   6573 N  N   . PHE B 1 290 ? 2.681   -46.680 -1.754  1.00 22.83  ? 290  PHE B N   1 
ATOM   6574 C  CA  . PHE B 1 290 ? 2.746   -46.420 -3.189  1.00 25.08  ? 290  PHE B CA  1 
ATOM   6575 C  C   . PHE B 1 290 ? 2.402   -44.961 -3.453  1.00 23.85  ? 290  PHE B C   1 
ATOM   6576 O  O   . PHE B 1 290 ? 1.610   -44.351 -2.730  1.00 26.80  ? 290  PHE B O   1 
ATOM   6577 C  CB  . PHE B 1 290 ? 1.815   -47.373 -3.951  1.00 24.63  ? 290  PHE B CB  1 
ATOM   6578 C  CG  . PHE B 1 290 ? 1.799   -48.768 -3.379  1.00 24.71  ? 290  PHE B CG  1 
ATOM   6579 C  CD1 . PHE B 1 290 ? 2.929   -49.578 -3.469  1.00 26.74  ? 290  PHE B CD1 1 
ATOM   6580 C  CD2 . PHE B 1 290 ? 0.683   -49.250 -2.710  1.00 25.95  ? 290  PHE B CD2 1 
ATOM   6581 C  CE1 . PHE B 1 290 ? 2.938   -50.853 -2.937  1.00 24.91  ? 290  PHE B CE1 1 
ATOM   6582 C  CE2 . PHE B 1 290 ? 0.676   -50.526 -2.179  1.00 25.07  ? 290  PHE B CE2 1 
ATOM   6583 C  CZ  . PHE B 1 290 ? 1.804   -51.333 -2.288  1.00 24.62  ? 290  PHE B CZ  1 
ATOM   6584 N  N   . SER B 1 291 ? 3.038   -44.392 -4.479  1.00 23.70  ? 291  SER B N   1 
ATOM   6585 C  CA  . SER B 1 291 ? 3.041   -42.941 -4.633  1.00 23.73  ? 291  SER B CA  1 
ATOM   6586 C  C   . SER B 1 291 ? 1.687   -42.405 -5.087  1.00 24.82  ? 291  SER B C   1 
ATOM   6587 O  O   . SER B 1 291 ? 1.157   -41.461 -4.495  1.00 28.44  ? 291  SER B O   1 
ATOM   6588 C  CB  . SER B 1 291 ? 4.131   -42.522 -5.618  1.00 28.16  ? 291  SER B CB  1 
ATOM   6589 O  OG  . SER B 1 291 ? 5.407   -42.801 -5.087  1.00 31.07  ? 291  SER B OG  1 
ATOM   6590 N  N   . PHE B 1 292 ? 1.144   -42.936 -6.170  1.00 26.95  ? 292  PHE B N   1 
ATOM   6591 C  CA  . PHE B 1 292 ? -0.039  -42.348 -6.791  1.00 24.12  ? 292  PHE B CA  1 
ATOM   6592 C  C   . PHE B 1 292 ? -1.200  -43.323 -6.643  1.00 22.26  ? 292  PHE B C   1 
ATOM   6593 O  O   . PHE B 1 292 ? -1.246  -44.366 -7.308  1.00 24.19  ? 292  PHE B O   1 
ATOM   6594 C  CB  . PHE B 1 292 ? 0.264   -41.964 -8.237  1.00 25.59  ? 292  PHE B CB  1 
ATOM   6595 C  CG  . PHE B 1 292 ? 1.337   -40.923 -8.327  1.00 25.34  ? 292  PHE B CG  1 
ATOM   6596 C  CD1 . PHE B 1 292 ? 1.066   -39.611 -7.977  1.00 29.47  ? 292  PHE B CD1 1 
ATOM   6597 C  CD2 . PHE B 1 292 ? 2.639   -41.270 -8.659  1.00 28.88  ? 292  PHE B CD2 1 
ATOM   6598 C  CE1 . PHE B 1 292 ? 2.061   -38.646 -7.993  1.00 29.77  ? 292  PHE B CE1 1 
ATOM   6599 C  CE2 . PHE B 1 292 ? 3.645   -40.312 -8.678  1.00 29.77  ? 292  PHE B CE2 1 
ATOM   6600 C  CZ  . PHE B 1 292 ? 3.355   -38.999 -8.349  1.00 31.58  ? 292  PHE B CZ  1 
ATOM   6601 N  N   . VAL B 1 293 ? -2.111  -42.988 -5.736  1.00 25.61  ? 293  VAL B N   1 
ATOM   6602 C  CA  . VAL B 1 293 ? -3.216  -43.856 -5.339  1.00 26.44  ? 293  VAL B CA  1 
ATOM   6603 C  C   . VAL B 1 293 ? -4.497  -43.024 -5.328  1.00 27.98  ? 293  VAL B C   1 
ATOM   6604 O  O   . VAL B 1 293 ? -4.429  -41.789 -5.453  1.00 24.64  ? 293  VAL B O   1 
ATOM   6605 C  CB  . VAL B 1 293 ? -2.945  -44.499 -3.965  1.00 22.87  ? 293  VAL B CB  1 
ATOM   6606 C  CG1 . VAL B 1 293 ? -1.678  -45.373 -4.012  1.00 23.97  ? 293  VAL B CG1 1 
ATOM   6607 C  CG2 . VAL B 1 293 ? -2.873  -43.431 -2.869  1.00 24.49  ? 293  VAL B CG2 1 
ATOM   6608 N  N   . PRO B 1 294 ? -5.674  -43.647 -5.190  1.00 26.54  ? 294  PRO B N   1 
ATOM   6609 C  CA  . PRO B 1 294 ? -6.921  -42.875 -5.084  1.00 26.64  ? 294  PRO B CA  1 
ATOM   6610 C  C   . PRO B 1 294 ? -6.841  -41.768 -4.038  1.00 29.45  ? 294  PRO B C   1 
ATOM   6611 O  O   . PRO B 1 294 ? -6.146  -41.883 -3.028  1.00 26.49  ? 294  PRO B O   1 
ATOM   6612 C  CB  . PRO B 1 294 ? -7.953  -43.936 -4.690  1.00 25.82  ? 294  PRO B CB  1 
ATOM   6613 C  CG  . PRO B 1 294 ? -7.471  -45.166 -5.361  1.00 25.45  ? 294  PRO B CG  1 
ATOM   6614 C  CD  . PRO B 1 294 ? -5.943  -45.092 -5.315  1.00 24.94  ? 294  PRO B CD  1 
ATOM   6615 N  N   . VAL B 1 295 ? -7.561  -40.680 -4.297  1.00 29.49  ? 295  VAL B N   1 
ATOM   6616 C  CA  . VAL B 1 295 ? -7.590  -39.525 -3.409  1.00 26.83  ? 295  VAL B CA  1 
ATOM   6617 C  C   . VAL B 1 295 ? -9.012  -39.321 -2.889  1.00 29.88  ? 295  VAL B C   1 
ATOM   6618 O  O   . VAL B 1 295 ? -9.986  -39.483 -3.631  1.00 30.28  ? 295  VAL B O   1 
ATOM   6619 C  CB  . VAL B 1 295 ? -7.063  -38.261 -4.121  1.00 29.37  ? 295  VAL B CB  1 
ATOM   6620 C  CG1 . VAL B 1 295 ? -7.850  -37.982 -5.413  1.00 28.30  ? 295  VAL B CG1 1 
ATOM   6621 C  CG2 . VAL B 1 295 ? -7.100  -37.075 -3.191  1.00 36.70  ? 295  VAL B CG2 1 
ATOM   6622 N  N   . ILE B 1 296 ? -9.128  -38.991 -1.600  1.00 30.89  ? 296  ILE B N   1 
ATOM   6623 C  CA  . ILE B 1 296 ? -10.422 -38.691 -0.986  1.00 31.14  ? 296  ILE B CA  1 
ATOM   6624 C  C   . ILE B 1 296 ? -10.821 -37.279 -1.385  1.00 35.80  ? 296  ILE B C   1 
ATOM   6625 O  O   . ILE B 1 296 ? -10.431 -36.305 -0.729  1.00 36.97  ? 296  ILE B O   1 
ATOM   6626 C  CB  . ILE B 1 296 ? -10.379 -38.839 0.544   1.00 32.45  ? 296  ILE B CB  1 
ATOM   6627 C  CG1 . ILE B 1 296 ? -9.709  -40.165 0.921   1.00 32.05  ? 296  ILE B CG1 1 
ATOM   6628 C  CG2 . ILE B 1 296 ? -11.797 -38.735 1.114   1.00 32.53  ? 296  ILE B CG2 1 
ATOM   6629 C  CD1 . ILE B 1 296 ? -10.433 -41.396 0.353   1.00 30.21  ? 296  ILE B CD1 1 
ATOM   6630 N  N   . ASP B 1 297 ? -11.622 -37.172 -2.446  1.00 36.14  ? 297  ASP B N   1 
ATOM   6631 C  CA  . ASP B 1 297 ? -11.771 -35.946 -3.218  1.00 40.61  ? 297  ASP B CA  1 
ATOM   6632 C  C   . ASP B 1 297 ? -13.081 -35.207 -2.977  1.00 46.03  ? 297  ASP B C   1 
ATOM   6633 O  O   . ASP B 1 297 ? -13.204 -34.056 -3.407  1.00 47.70  ? 297  ASP B O   1 
ATOM   6634 C  CB  . ASP B 1 297 ? -11.667 -36.264 -4.715  1.00 37.31  ? 297  ASP B CB  1 
ATOM   6635 C  CG  . ASP B 1 297 ? -12.692 -37.295 -5.160  1.00 40.60  ? 297  ASP B CG  1 
ATOM   6636 O  OD1 . ASP B 1 297 ? -13.372 -37.883 -4.285  1.00 36.32  ? 297  ASP B OD1 1 
ATOM   6637 O  OD2 . ASP B 1 297 ? -12.827 -37.524 -6.384  1.00 40.99  ? 297  ASP B OD2 1 
ATOM   6638 N  N   . GLY B 1 298 ? -14.067 -35.833 -2.344  1.00 41.50  ? 298  GLY B N   1 
ATOM   6639 C  CA  . GLY B 1 298 ? -15.367 -35.212 -2.240  1.00 44.92  ? 298  GLY B CA  1 
ATOM   6640 C  C   . GLY B 1 298 ? -16.273 -35.420 -3.433  1.00 43.19  ? 298  GLY B C   1 
ATOM   6641 O  O   . GLY B 1 298 ? -17.378 -34.863 -3.454  1.00 45.92  ? 298  GLY B O   1 
ATOM   6642 N  N   . GLU B 1 299 ? -15.847 -36.199 -4.427  1.00 43.85  ? 299  GLU B N   1 
ATOM   6643 C  CA  . GLU B 1 299 ? -16.657 -36.453 -5.613  1.00 42.79  ? 299  GLU B CA  1 
ATOM   6644 C  C   . GLU B 1 299 ? -16.799 -37.952 -5.859  1.00 43.87  ? 299  GLU B C   1 
ATOM   6645 O  O   . GLU B 1 299 ? -17.887 -38.510 -5.674  1.00 45.59  ? 299  GLU B O   1 
ATOM   6646 C  CB  . GLU B 1 299 ? -16.052 -35.740 -6.826  1.00 43.28  ? 299  GLU B CB  1 
ATOM   6647 C  CG  . GLU B 1 299 ? -15.314 -34.461 -6.445  1.00 50.99  ? 299  GLU B CG  1 
ATOM   6648 C  CD  . GLU B 1 299 ? -14.928 -33.610 -7.642  1.00 65.67  ? 299  GLU B CD  1 
ATOM   6649 O  OE1 . GLU B 1 299 ? -14.343 -32.526 -7.423  1.00 67.46  ? 299  GLU B OE1 1 
ATOM   6650 O  OE2 . GLU B 1 299 ? -15.214 -34.018 -8.792  1.00 65.74  ? 299  GLU B OE2 1 
ATOM   6651 N  N   . PHE B 1 300 ? -15.716 -38.625 -6.264  1.00 36.87  ? 300  PHE B N   1 
ATOM   6652 C  CA  . PHE B 1 300 ? -15.754 -40.083 -6.314  1.00 33.27  ? 300  PHE B CA  1 
ATOM   6653 C  C   . PHE B 1 300 ? -16.038 -40.655 -4.930  1.00 35.55  ? 300  PHE B C   1 
ATOM   6654 O  O   . PHE B 1 300 ? -16.779 -41.634 -4.791  1.00 36.34  ? 300  PHE B O   1 
ATOM   6655 C  CB  . PHE B 1 300 ? -14.440 -40.637 -6.877  1.00 33.84  ? 300  PHE B CB  1 
ATOM   6656 C  CG  . PHE B 1 300 ? -14.501 -42.100 -7.237  1.00 31.05  ? 300  PHE B CG  1 
ATOM   6657 C  CD1 . PHE B 1 300 ? -14.377 -43.080 -6.257  1.00 29.59  ? 300  PHE B CD1 1 
ATOM   6658 C  CD2 . PHE B 1 300 ? -14.677 -42.495 -8.552  1.00 28.42  ? 300  PHE B CD2 1 
ATOM   6659 C  CE1 . PHE B 1 300 ? -14.439 -44.418 -6.595  1.00 26.66  ? 300  PHE B CE1 1 
ATOM   6660 C  CE2 . PHE B 1 300 ? -14.737 -43.830 -8.895  1.00 28.12  ? 300  PHE B CE2 1 
ATOM   6661 C  CZ  . PHE B 1 300 ? -14.627 -44.791 -7.921  1.00 24.03  ? 300  PHE B CZ  1 
ATOM   6662 N  N   . PHE B 1 301 ? -15.466 -40.050 -3.895  1.00 36.88  ? 301  PHE B N   1 
ATOM   6663 C  CA  . PHE B 1 301 ? -15.818 -40.368 -2.519  1.00 37.41  ? 301  PHE B CA  1 
ATOM   6664 C  C   . PHE B 1 301 ? -16.451 -39.137 -1.893  1.00 39.06  ? 301  PHE B C   1 
ATOM   6665 O  O   . PHE B 1 301 ? -15.735 -38.172 -1.588  1.00 40.74  ? 301  PHE B O   1 
ATOM   6666 C  CB  . PHE B 1 301 ? -14.591 -40.802 -1.714  1.00 34.94  ? 301  PHE B CB  1 
ATOM   6667 C  CG  . PHE B 1 301 ? -13.825 -41.928 -2.339  1.00 36.23  ? 301  PHE B CG  1 
ATOM   6668 C  CD1 . PHE B 1 301 ? -14.307 -43.228 -2.274  1.00 32.72  ? 301  PHE B CD1 1 
ATOM   6669 C  CD2 . PHE B 1 301 ? -12.618 -41.693 -2.977  1.00 30.71  ? 301  PHE B CD2 1 
ATOM   6670 C  CE1 . PHE B 1 301 ? -13.602 -44.267 -2.842  1.00 29.05  ? 301  PHE B CE1 1 
ATOM   6671 C  CE2 . PHE B 1 301 ? -11.907 -42.731 -3.548  1.00 33.25  ? 301  PHE B CE2 1 
ATOM   6672 C  CZ  . PHE B 1 301 ? -12.395 -44.018 -3.484  1.00 28.40  ? 301  PHE B CZ  1 
ATOM   6673 N  N   . PRO B 1 302 ? -17.769 -39.121 -1.677  1.00 39.35  ? 302  PRO B N   1 
ATOM   6674 C  CA  . PRO B 1 302 ? -18.412 -37.894 -1.173  1.00 39.39  ? 302  PRO B CA  1 
ATOM   6675 C  C   . PRO B 1 302 ? -17.873 -37.418 0.164   1.00 40.50  ? 302  PRO B C   1 
ATOM   6676 O  O   . PRO B 1 302 ? -17.759 -36.205 0.376   1.00 39.44  ? 302  PRO B O   1 
ATOM   6677 C  CB  . PRO B 1 302 ? -19.897 -38.281 -1.088  1.00 42.31  ? 302  PRO B CB  1 
ATOM   6678 C  CG  . PRO B 1 302 ? -19.950 -39.770 -1.275  1.00 44.42  ? 302  PRO B CG  1 
ATOM   6679 C  CD  . PRO B 1 302 ? -18.746 -40.148 -2.068  1.00 40.14  ? 302  PRO B CD  1 
ATOM   6680 N  N   . THR B 1 303 ? -17.542 -38.327 1.079   1.00 36.64  ? 303  THR B N   1 
ATOM   6681 C  CA  . THR B 1 303 ? -16.945 -37.956 2.354   1.00 37.45  ? 303  THR B CA  1 
ATOM   6682 C  C   . THR B 1 303 ? -15.851 -38.967 2.680   1.00 37.52  ? 303  THR B C   1 
ATOM   6683 O  O   . THR B 1 303 ? -15.511 -39.826 1.861   1.00 33.97  ? 303  THR B O   1 
ATOM   6684 C  CB  . THR B 1 303 ? -17.999 -37.887 3.467   1.00 37.05  ? 303  THR B CB  1 
ATOM   6685 O  OG1 . THR B 1 303 ? -18.588 -39.180 3.648   1.00 37.54  ? 303  THR B OG1 1 
ATOM   6686 C  CG2 . THR B 1 303 ? -19.083 -36.882 3.129   1.00 37.95  ? 303  THR B CG2 1 
ATOM   6687 N  N   . SER B 1 304 ? -15.301 -38.861 3.890   1.00 34.91  ? 304  SER B N   1 
ATOM   6688 C  CA  . SER B 1 304 ? -14.278 -39.794 4.337   1.00 34.06  ? 304  SER B CA  1 
ATOM   6689 C  C   . SER B 1 304 ? -14.786 -41.231 4.247   1.00 31.83  ? 304  SER B C   1 
ATOM   6690 O  O   . SER B 1 304 ? -15.979 -41.504 4.400   1.00 31.99  ? 304  SER B O   1 
ATOM   6691 C  CB  . SER B 1 304 ? -13.855 -39.470 5.773   1.00 33.09  ? 304  SER B CB  1 
ATOM   6692 O  OG  . SER B 1 304 ? -14.878 -39.792 6.712   1.00 32.69  ? 304  SER B OG  1 
ATOM   6693 N  N   . LEU B 1 305 ? -13.863 -42.158 3.976   1.00 31.29  ? 305  LEU B N   1 
ATOM   6694 C  CA  . LEU B 1 305 ? -14.250 -43.564 3.903   1.00 28.95  ? 305  LEU B CA  1 
ATOM   6695 C  C   . LEU B 1 305 ? -14.865 -44.025 5.217   1.00 28.04  ? 305  LEU B C   1 
ATOM   6696 O  O   . LEU B 1 305 ? -15.851 -44.768 5.222   1.00 29.72  ? 305  LEU B O   1 
ATOM   6697 C  CB  . LEU B 1 305 ? -13.041 -44.432 3.545   1.00 31.77  ? 305  LEU B CB  1 
ATOM   6698 C  CG  . LEU B 1 305 ? -12.329 -44.069 2.237   1.00 27.70  ? 305  LEU B CG  1 
ATOM   6699 C  CD1 . LEU B 1 305 ? -11.149 -44.997 1.983   1.00 29.37  ? 305  LEU B CD1 1 
ATOM   6700 C  CD2 . LEU B 1 305 ? -13.305 -44.107 1.080   1.00 31.38  ? 305  LEU B CD2 1 
ATOM   6701 N  N   . GLU B 1 306 ? -14.313 -43.575 6.340   1.00 29.37  ? 306  GLU B N   1 
ATOM   6702 C  CA  . GLU B 1 306 ? -14.834 -44.018 7.629   1.00 28.93  ? 306  GLU B CA  1 
ATOM   6703 C  C   . GLU B 1 306 ? -16.248 -43.498 7.880   1.00 33.60  ? 306  GLU B C   1 
ATOM   6704 O  O   . GLU B 1 306 ? -17.114 -44.248 8.351   1.00 34.92  ? 306  GLU B O   1 
ATOM   6705 C  CB  . GLU B 1 306 ? -13.889 -43.595 8.752   1.00 35.72  ? 306  GLU B CB  1 
ATOM   6706 C  CG  . GLU B 1 306 ? -14.337 -44.064 10.136  1.00 32.43  ? 306  GLU B CG  1 
ATOM   6707 C  CD  . GLU B 1 306 ? -14.231 -45.572 10.303  1.00 39.92  ? 306  GLU B CD  1 
ATOM   6708 O  OE1 . GLU B 1 306 ? -13.735 -46.252 9.379   1.00 36.74  ? 306  GLU B OE1 1 
ATOM   6709 O  OE2 . GLU B 1 306 ? -14.632 -46.081 11.369  1.00 40.33  ? 306  GLU B OE2 1 
ATOM   6710 N  N   . SER B 1 307 ? -16.511 -42.224 7.575   1.00 34.59  ? 307  SER B N   1 
ATOM   6711 C  CA  . SER B 1 307 ? -17.870 -41.707 7.745   1.00 35.05  ? 307  SER B CA  1 
ATOM   6712 C  C   . SER B 1 307 ? -18.864 -42.454 6.857   1.00 34.03  ? 307  SER B C   1 
ATOM   6713 O  O   . SER B 1 307 ? -19.978 -42.775 7.293   1.00 32.42  ? 307  SER B O   1 
ATOM   6714 C  CB  . SER B 1 307 ? -17.916 -40.206 7.455   1.00 36.51  ? 307  SER B CB  1 
ATOM   6715 O  OG  . SER B 1 307 ? -17.540 -39.930 6.115   1.00 39.14  ? 307  SER B OG  1 
ATOM   6716 N  N   . MET B 1 308 ? -18.478 -42.752 5.612   1.00 31.24  ? 308  MET B N   1 
ATOM   6717 C  CA  . MET B 1 308 ? -19.361 -43.512 4.729   1.00 29.38  ? 308  MET B CA  1 
ATOM   6718 C  C   . MET B 1 308 ? -19.630 -44.907 5.281   1.00 31.07  ? 308  MET B C   1 
ATOM   6719 O  O   . MET B 1 308 ? -20.769 -45.390 5.246   1.00 30.07  ? 308  MET B O   1 
ATOM   6720 C  CB  . MET B 1 308 ? -18.762 -43.610 3.322   1.00 29.26  ? 308  MET B CB  1 
ATOM   6721 C  CG  . MET B 1 308 ? -18.555 -42.281 2.623   1.00 32.11  ? 308  MET B CG  1 
ATOM   6722 S  SD  . MET B 1 308 ? -17.873 -42.489 0.955   1.00 35.68  ? 308  MET B SD  1 
ATOM   6723 C  CE  . MET B 1 308 ? -19.249 -43.292 0.156   1.00 32.20  ? 308  MET B CE  1 
ATOM   6724 N  N   . LEU B 1 309 ? -18.588 -45.580 5.775   1.00 26.85  ? 309  LEU B N   1 
ATOM   6725 C  CA  . LEU B 1 309 ? -18.776 -46.891 6.387   1.00 29.85  ? 309  LEU B CA  1 
ATOM   6726 C  C   . LEU B 1 309 ? -19.695 -46.794 7.599   1.00 31.05  ? 309  LEU B C   1 
ATOM   6727 O  O   . LEU B 1 309 ? -20.586 -47.634 7.782   1.00 31.67  ? 309  LEU B O   1 
ATOM   6728 C  CB  . LEU B 1 309 ? -17.420 -47.490 6.786   1.00 24.50  ? 309  LEU B CB  1 
ATOM   6729 C  CG  . LEU B 1 309 ? -16.461 -47.921 5.657   1.00 31.88  ? 309  LEU B CG  1 
ATOM   6730 C  CD1 . LEU B 1 309 ? -15.150 -48.501 6.216   1.00 29.66  ? 309  LEU B CD1 1 
ATOM   6731 C  CD2 . LEU B 1 309 ? -17.133 -48.918 4.724   1.00 29.78  ? 309  LEU B CD2 1 
ATOM   6732 N  N   . ASN B 1 310 ? -19.502 -45.764 8.427   1.00 31.00  ? 310  ASN B N   1 
ATOM   6733 C  CA  . ASN B 1 310 ? -20.297 -45.631 9.647   1.00 33.98  ? 310  ASN B CA  1 
ATOM   6734 C  C   . ASN B 1 310 ? -21.757 -45.361 9.337   1.00 34.29  ? 310  ASN B C   1 
ATOM   6735 O  O   . ASN B 1 310 ? -22.646 -45.894 10.011  1.00 38.29  ? 310  ASN B O   1 
ATOM   6736 C  CB  . ASN B 1 310 ? -19.745 -44.512 10.528  1.00 34.94  ? 310  ASN B CB  1 
ATOM   6737 C  CG  . ASN B 1 310 ? -18.557 -44.949 11.322  1.00 42.08  ? 310  ASN B CG  1 
ATOM   6738 O  OD1 . ASN B 1 310 ? -18.370 -46.142 11.545  1.00 44.62  ? 310  ASN B OD1 1 
ATOM   6739 N  ND2 . ASN B 1 310 ? -17.739 -43.993 11.762  1.00 41.89  ? 310  ASN B ND2 1 
ATOM   6740 N  N   . SER B 1 311 ? -22.028 -44.524 8.338   1.00 36.82  ? 311  SER B N   1 
ATOM   6741 C  CA  . SER B 1 311 ? -23.398 -44.128 8.044   1.00 37.81  ? 311  SER B CA  1 
ATOM   6742 C  C   . SER B 1 311 ? -24.141 -45.128 7.166   1.00 37.06  ? 311  SER B C   1 
ATOM   6743 O  O   . SER B 1 311 ? -25.346 -44.962 6.955   1.00 35.84  ? 311  SER B O   1 
ATOM   6744 C  CB  . SER B 1 311 ? -23.404 -42.756 7.371   1.00 38.53  ? 311  SER B CB  1 
ATOM   6745 O  OG  . SER B 1 311 ? -22.859 -42.838 6.070   1.00 40.60  ? 311  SER B OG  1 
ATOM   6746 N  N   . GLY B 1 312 ? -23.471 -46.160 6.666   1.00 34.54  ? 312  GLY B N   1 
ATOM   6747 C  CA  . GLY B 1 312 ? -24.111 -47.031 5.706   1.00 33.03  ? 312  GLY B CA  1 
ATOM   6748 C  C   . GLY B 1 312 ? -24.231 -46.433 4.323   1.00 33.00  ? 312  GLY B C   1 
ATOM   6749 O  O   . GLY B 1 312 ? -25.061 -46.890 3.528   1.00 33.77  ? 312  GLY B O   1 
ATOM   6750 N  N   . ASN B 1 313 ? -23.427 -45.409 4.014   1.00 32.35  ? 313  ASN B N   1 
ATOM   6751 C  CA  . ASN B 1 313 ? -23.451 -44.756 2.705   1.00 36.11  ? 313  ASN B CA  1 
ATOM   6752 C  C   . ASN B 1 313 ? -22.626 -45.577 1.715   1.00 31.78  ? 313  ASN B C   1 
ATOM   6753 O  O   . ASN B 1 313 ? -21.514 -45.219 1.330   1.00 33.07  ? 313  ASN B O   1 
ATOM   6754 C  CB  . ASN B 1 313 ? -22.929 -43.326 2.796   1.00 32.48  ? 313  ASN B CB  1 
ATOM   6755 C  CG  . ASN B 1 313 ? -23.132 -42.558 1.502   1.00 36.52  ? 313  ASN B CG  1 
ATOM   6756 O  OD1 . ASN B 1 313 ? -23.842 -43.019 0.611   1.00 36.90  ? 313  ASN B OD1 1 
ATOM   6757 N  ND2 . ASN B 1 313 ? -22.510 -41.388 1.389   1.00 37.82  ? 313  ASN B ND2 1 
ATOM   6758 N  N   . PHE B 1 314 ? -23.191 -46.711 1.315   1.00 32.45  ? 314  PHE B N   1 
ATOM   6759 C  CA  . PHE B 1 314 ? -22.547 -47.574 0.332   1.00 29.69  ? 314  PHE B CA  1 
ATOM   6760 C  C   . PHE B 1 314 ? -23.596 -48.514 -0.226  1.00 32.45  ? 314  PHE B C   1 
ATOM   6761 O  O   . PHE B 1 314 ? -24.709 -48.606 0.295   1.00 26.39  ? 314  PHE B O   1 
ATOM   6762 C  CB  . PHE B 1 314 ? -21.371 -48.364 0.936   1.00 26.18  ? 314  PHE B CB  1 
ATOM   6763 C  CG  . PHE B 1 314 ? -21.681 -49.016 2.272   1.00 29.80  ? 314  PHE B CG  1 
ATOM   6764 C  CD1 . PHE B 1 314 ? -22.377 -50.217 2.335   1.00 27.09  ? 314  PHE B CD1 1 
ATOM   6765 C  CD2 . PHE B 1 314 ? -21.240 -48.439 3.450   1.00 28.14  ? 314  PHE B CD2 1 
ATOM   6766 C  CE1 . PHE B 1 314 ? -22.644 -50.823 3.559   1.00 25.66  ? 314  PHE B CE1 1 
ATOM   6767 C  CE2 . PHE B 1 314 ? -21.503 -49.037 4.691   1.00 30.36  ? 314  PHE B CE2 1 
ATOM   6768 C  CZ  . PHE B 1 314 ? -22.196 -50.227 4.740   1.00 26.87  ? 314  PHE B CZ  1 
ATOM   6769 N  N   . LYS B 1 315 ? -23.224 -49.205 -1.304  1.00 26.29  ? 315  LYS B N   1 
ATOM   6770 C  CA  . LYS B 1 315 ? -24.095 -50.186 -1.933  1.00 27.46  ? 315  LYS B CA  1 
ATOM   6771 C  C   . LYS B 1 315 ? -24.342 -51.354 -0.989  1.00 26.29  ? 315  LYS B C   1 
ATOM   6772 O  O   . LYS B 1 315 ? -23.400 -51.952 -0.453  1.00 24.04  ? 315  LYS B O   1 
ATOM   6773 C  CB  . LYS B 1 315 ? -23.471 -50.690 -3.235  1.00 24.30  ? 315  LYS B CB  1 
ATOM   6774 C  CG  . LYS B 1 315 ? -24.318 -51.702 -3.996  1.00 24.25  ? 315  LYS B CG  1 
ATOM   6775 C  CD  . LYS B 1 315 ? -23.535 -52.323 -5.147  1.00 25.64  ? 315  LYS B CD  1 
ATOM   6776 C  CE  . LYS B 1 315 ? -24.404 -53.285 -5.948  1.00 25.48  ? 315  LYS B CE  1 
ATOM   6777 N  NZ  . LYS B 1 315 ? -25.432 -52.516 -6.701  1.00 25.33  ? 315  LYS B NZ  1 
ATOM   6778 N  N   . LYS B 1 316 ? -25.613 -51.682 -0.786  1.00 25.72  ? 316  LYS B N   1 
ATOM   6779 C  CA  . LYS B 1 316 ? -26.003 -52.769 0.100   1.00 26.94  ? 316  LYS B CA  1 
ATOM   6780 C  C   . LYS B 1 316 ? -26.288 -54.000 -0.744  1.00 25.54  ? 316  LYS B C   1 
ATOM   6781 O  O   . LYS B 1 316 ? -27.291 -54.055 -1.469  1.00 29.36  ? 316  LYS B O   1 
ATOM   6782 C  CB  . LYS B 1 316 ? -27.204 -52.371 0.952   1.00 27.68  ? 316  LYS B CB  1 
ATOM   6783 C  CG  . LYS B 1 316 ? -26.792 -51.536 2.150   1.00 30.09  ? 316  LYS B CG  1 
ATOM   6784 C  CD  . LYS B 1 316 ? -26.973 -50.049 1.901   1.00 37.68  ? 316  LYS B CD  1 
ATOM   6785 C  CE  . LYS B 1 316 ? -27.208 -49.301 3.208   1.00 40.10  ? 316  LYS B CE  1 
ATOM   6786 N  NZ  . LYS B 1 316 ? -27.390 -47.836 2.977   1.00 47.57  ? 316  LYS B NZ  1 
ATOM   6787 N  N   . THR B 1 317 ? -25.394 -54.977 -0.663  1.00 22.85  ? 317  THR B N   1 
ATOM   6788 C  CA  . THR B 1 317 ? -25.516 -56.201 -1.434  1.00 21.97  ? 317  THR B CA  1 
ATOM   6789 C  C   . THR B 1 317 ? -24.773 -57.301 -0.676  1.00 25.78  ? 317  THR B C   1 
ATOM   6790 O  O   . THR B 1 317 ? -24.527 -57.181 0.531   1.00 26.53  ? 317  THR B O   1 
ATOM   6791 C  CB  . THR B 1 317 ? -25.017 -55.964 -2.879  1.00 23.28  ? 317  THR B CB  1 
ATOM   6792 O  OG1 . THR B 1 317 ? -25.212 -57.150 -3.660  1.00 25.13  ? 317  THR B OG1 1 
ATOM   6793 C  CG2 . THR B 1 317 ? -23.523 -55.579 -2.897  1.00 25.15  ? 317  THR B CG2 1 
ATOM   6794 N  N   . GLN B 1 318 ? -24.425 -58.379 -1.375  1.00 24.26  ? 318  GLN B N   1 
ATOM   6795 C  CA  . GLN B 1 318 ? -23.627 -59.456 -0.806  1.00 24.37  ? 318  GLN B CA  1 
ATOM   6796 C  C   . GLN B 1 318 ? -22.160 -59.240 -1.147  1.00 26.24  ? 318  GLN B C   1 
ATOM   6797 O  O   . GLN B 1 318 ? -21.828 -58.732 -2.221  1.00 24.65  ? 318  GLN B O   1 
ATOM   6798 C  CB  . GLN B 1 318 ? -24.071 -60.827 -1.331  1.00 21.37  ? 318  GLN B CB  1 
ATOM   6799 C  CG  . GLN B 1 318 ? -25.576 -61.133 -1.106  1.00 24.01  ? 318  GLN B CG  1 
ATOM   6800 C  CD  . GLN B 1 318 ? -26.440 -60.534 -2.201  1.00 27.50  ? 318  GLN B CD  1 
ATOM   6801 O  OE1 . GLN B 1 318 ? -26.035 -60.492 -3.360  1.00 27.80  ? 318  GLN B OE1 1 
ATOM   6802 N  NE2 . GLN B 1 318 ? -27.627 -60.060 -1.838  1.00 30.71  ? 318  GLN B NE2 1 
ATOM   6803 N  N   . ILE B 1 319 ? -21.275 -59.649 -0.234  1.00 22.33  ? 319  ILE B N   1 
ATOM   6804 C  CA  . ILE B 1 319 ? -19.842 -59.620 -0.509  1.00 19.11  ? 319  ILE B CA  1 
ATOM   6805 C  C   . ILE B 1 319 ? -19.207 -60.915 -0.029  1.00 24.76  ? 319  ILE B C   1 
ATOM   6806 O  O   . ILE B 1 319 ? -19.661 -61.543 0.936   1.00 22.62  ? 319  ILE B O   1 
ATOM   6807 C  CB  . ILE B 1 319 ? -19.143 -58.403 0.128   1.00 22.80  ? 319  ILE B CB  1 
ATOM   6808 C  CG1 . ILE B 1 319 ? -19.257 -58.440 1.655   1.00 23.18  ? 319  ILE B CG1 1 
ATOM   6809 C  CG2 . ILE B 1 319 ? -19.714 -57.106 -0.418  1.00 22.74  ? 319  ILE B CG2 1 
ATOM   6810 C  CD1 . ILE B 1 319 ? -18.404 -57.373 2.326   1.00 24.49  ? 319  ILE B CD1 1 
ATOM   6811 N  N   . LEU B 1 320 ? -18.148 -61.313 -0.727  1.00 24.30  ? 320  LEU B N   1 
ATOM   6812 C  CA  . LEU B 1 320 ? -17.301 -62.435 -0.349  1.00 22.85  ? 320  LEU B CA  1 
ATOM   6813 C  C   . LEU B 1 320 ? -15.874 -61.914 -0.371  1.00 24.26  ? 320  LEU B C   1 
ATOM   6814 O  O   . LEU B 1 320 ? -15.474 -61.257 -1.339  1.00 21.62  ? 320  LEU B O   1 
ATOM   6815 C  CB  . LEU B 1 320 ? -17.494 -63.615 -1.320  1.00 21.86  ? 320  LEU B CB  1 
ATOM   6816 C  CG  . LEU B 1 320 ? -16.740 -64.936 -1.129  1.00 22.68  ? 320  LEU B CG  1 
ATOM   6817 C  CD1 . LEU B 1 320 ? -17.548 -66.078 -1.730  1.00 23.81  ? 320  LEU B CD1 1 
ATOM   6818 C  CD2 . LEU B 1 320 ? -15.342 -64.900 -1.772  1.00 21.75  ? 320  LEU B CD2 1 
ATOM   6819 N  N   . LEU B 1 321 ? -15.114 -62.159 0.695   1.00 21.30  ? 321  LEU B N   1 
ATOM   6820 C  CA  . LEU B 1 321 ? -13.810 -61.519 0.773   1.00 20.97  ? 321  LEU B CA  1 
ATOM   6821 C  C   . LEU B 1 321 ? -12.933 -62.283 1.754   1.00 22.25  ? 321  LEU B C   1 
ATOM   6822 O  O   . LEU B 1 321 ? -13.413 -63.095 2.550   1.00 20.27  ? 321  LEU B O   1 
ATOM   6823 C  CB  . LEU B 1 321 ? -13.945 -60.043 1.171   1.00 21.61  ? 321  LEU B CB  1 
ATOM   6824 C  CG  . LEU B 1 321 ? -14.289 -59.662 2.622   1.00 22.88  ? 321  LEU B CG  1 
ATOM   6825 C  CD1 . LEU B 1 321 ? -14.170 -58.165 2.762   1.00 19.88  ? 321  LEU B CD1 1 
ATOM   6826 C  CD2 . LEU B 1 321 ? -15.698 -60.109 3.034   1.00 23.66  ? 321  LEU B CD2 1 
ATOM   6827 N  N   . GLY B 1 322 ? -11.635 -62.015 1.690   1.00 23.06  ? 322  GLY B N   1 
ATOM   6828 C  CA  . GLY B 1 322 ? -10.728 -62.709 2.581   1.00 18.17  ? 322  GLY B CA  1 
ATOM   6829 C  C   . GLY B 1 322 ? -9.291  -62.290 2.370   1.00 21.34  ? 322  GLY B C   1 
ATOM   6830 O  O   . GLY B 1 322 ? -8.991  -61.349 1.628   1.00 19.17  ? 322  GLY B O   1 
ATOM   6831 N  N   . VAL B 1 323 ? -8.402  -63.004 3.062   1.00 20.95  ? 323  VAL B N   1 
ATOM   6832 C  CA  . VAL B 1 323 ? -6.981  -62.676 3.137   1.00 20.48  ? 323  VAL B CA  1 
ATOM   6833 C  C   . VAL B 1 323 ? -6.175  -63.965 3.067   1.00 21.07  ? 323  VAL B C   1 
ATOM   6834 O  O   . VAL B 1 323 ? -6.713  -65.070 3.197   1.00 21.20  ? 323  VAL B O   1 
ATOM   6835 C  CB  . VAL B 1 323 ? -6.626  -61.901 4.433   1.00 20.75  ? 323  VAL B CB  1 
ATOM   6836 C  CG1 . VAL B 1 323 ? -7.486  -60.645 4.560   1.00 21.59  ? 323  VAL B CG1 1 
ATOM   6837 C  CG2 . VAL B 1 323 ? -6.789  -62.809 5.675   1.00 21.07  ? 323  VAL B CG2 1 
ATOM   6838 N  N   . ASN B 1 324 ? -4.858  -63.803 2.885   1.00 20.86  ? 324  ASN B N   1 
ATOM   6839 C  CA  . ASN B 1 324 ? -3.904  -64.899 2.856   1.00 19.49  ? 324  ASN B CA  1 
ATOM   6840 C  C   . ASN B 1 324 ? -3.110  -64.901 4.154   1.00 21.83  ? 324  ASN B C   1 
ATOM   6841 O  O   . ASN B 1 324 ? -2.979  -63.876 4.821   1.00 22.41  ? 324  ASN B O   1 
ATOM   6842 C  CB  . ASN B 1 324 ? -2.931  -64.776 1.673   1.00 19.62  ? 324  ASN B CB  1 
ATOM   6843 C  CG  . ASN B 1 324 ? -3.624  -64.950 0.333   1.00 21.62  ? 324  ASN B CG  1 
ATOM   6844 O  OD1 . ASN B 1 324 ? -4.833  -65.193 0.279   1.00 21.12  ? 324  ASN B OD1 1 
ATOM   6845 N  ND2 . ASN B 1 324 ? -2.864  -64.813 -0.759  1.00 22.28  ? 324  ASN B ND2 1 
ATOM   6846 N  N   . LYS B 1 325 ? -2.539  -66.056 4.484   1.00 21.95  ? 325  LYS B N   1 
ATOM   6847 C  CA  . LYS B 1 325 ? -1.916  -66.172 5.800   1.00 21.28  ? 325  LYS B CA  1 
ATOM   6848 C  C   . LYS B 1 325 ? -0.685  -65.280 5.933   1.00 25.56  ? 325  LYS B C   1 
ATOM   6849 O  O   . LYS B 1 325 ? -0.448  -64.717 7.006   1.00 25.38  ? 325  LYS B O   1 
ATOM   6850 C  CB  . LYS B 1 325 ? -1.543  -67.621 6.095   1.00 24.40  ? 325  LYS B CB  1 
ATOM   6851 C  CG  . LYS B 1 325 ? -0.838  -67.787 7.463   1.00 27.97  ? 325  LYS B CG  1 
ATOM   6852 C  CD  . LYS B 1 325 ? -0.176  -69.142 7.621   1.00 33.59  ? 325  LYS B CD  1 
ATOM   6853 C  CE  . LYS B 1 325 ? 0.611   -69.208 8.957   1.00 40.32  ? 325  LYS B CE  1 
ATOM   6854 N  NZ  . LYS B 1 325 ? 1.545   -68.033 9.164   1.00 34.67  ? 325  LYS B NZ  1 
ATOM   6855 N  N   . ASP B 1 326 ? 0.098   -65.100 4.867   1.00 25.82  ? 326  ASP B N   1 
ATOM   6856 C  CA  . ASP B 1 326 ? 1.380   -64.401 5.008   1.00 24.74  ? 326  ASP B CA  1 
ATOM   6857 C  C   . ASP B 1 326 ? 1.466   -63.228 4.036   1.00 25.39  ? 326  ASP B C   1 
ATOM   6858 O  O   . ASP B 1 326 ? 2.358   -63.157 3.190   1.00 23.58  ? 326  ASP B O   1 
ATOM   6859 C  CB  . ASP B 1 326 ? 2.547   -65.363 4.820   1.00 21.06  ? 326  ASP B CB  1 
ATOM   6860 C  CG  . ASP B 1 326 ? 2.511   -66.497 5.808   1.00 28.83  ? 326  ASP B CG  1 
ATOM   6861 O  OD1 . ASP B 1 326 ? 2.705   -66.217 7.011   1.00 27.18  ? 326  ASP B OD1 1 
ATOM   6862 O  OD2 . ASP B 1 326 ? 2.258   -67.654 5.393   1.00 22.44  ? 326  ASP B OD2 1 
ATOM   6863 N  N   . GLU B 1 327 ? 0.547   -62.270 4.206   1.00 26.92  ? 327  GLU B N   1 
ATOM   6864 C  CA  . GLU B 1 327 ? 0.453   -61.148 3.275   1.00 26.25  ? 327  GLU B CA  1 
ATOM   6865 C  C   . GLU B 1 327 ? 1.731   -60.315 3.250   1.00 23.85  ? 327  GLU B C   1 
ATOM   6866 O  O   . GLU B 1 327 ? 2.041   -59.683 2.235   1.00 24.63  ? 327  GLU B O   1 
ATOM   6867 C  CB  . GLU B 1 327 ? -0.741  -60.263 3.646   1.00 24.18  ? 327  GLU B CB  1 
ATOM   6868 C  CG  . GLU B 1 327 ? -2.097  -60.956 3.609   1.00 23.10  ? 327  GLU B CG  1 
ATOM   6869 C  CD  . GLU B 1 327 ? -2.714  -61.005 2.216   1.00 24.31  ? 327  GLU B CD  1 
ATOM   6870 O  OE1 . GLU B 1 327 ? -2.003  -60.734 1.227   1.00 24.46  ? 327  GLU B OE1 1 
ATOM   6871 O  OE2 . GLU B 1 327 ? -3.921  -61.314 2.122   1.00 21.18  ? 327  GLU B OE2 1 
ATOM   6872 N  N   . GLY B 1 328 ? 2.493   -60.307 4.343   1.00 22.32  ? 328  GLY B N   1 
ATOM   6873 C  CA  . GLY B 1 328 ? 3.593   -59.367 4.439   1.00 22.95  ? 328  GLY B CA  1 
ATOM   6874 C  C   . GLY B 1 328 ? 4.897   -59.786 3.781   1.00 20.66  ? 328  GLY B C   1 
ATOM   6875 O  O   . GLY B 1 328 ? 5.754   -58.928 3.560   1.00 20.98  ? 328  GLY B O   1 
ATOM   6876 N  N   . SER B 1 329 ? 5.081   -61.075 3.480   1.00 22.51  ? 329  SER B N   1 
ATOM   6877 C  CA  . SER B 1 329 ? 6.430   -61.565 3.168   1.00 24.51  ? 329  SER B CA  1 
ATOM   6878 C  C   . SER B 1 329 ? 6.986   -60.966 1.873   1.00 22.54  ? 329  SER B C   1 
ATOM   6879 O  O   . SER B 1 329 ? 8.178   -60.653 1.789   1.00 23.10  ? 329  SER B O   1 
ATOM   6880 C  CB  . SER B 1 329 ? 6.441   -63.090 3.088   1.00 24.70  ? 329  SER B CB  1 
ATOM   6881 O  OG  . SER B 1 329 ? 5.453   -63.604 2.213   1.00 22.64  ? 329  SER B OG  1 
ATOM   6882 N  N   . PHE B 1 330 ? 6.143   -60.806 0.854   1.00 21.38  ? 330  PHE B N   1 
ATOM   6883 C  CA  . PHE B 1 330 ? 6.578   -60.202 -0.405  1.00 22.50  ? 330  PHE B CA  1 
ATOM   6884 C  C   . PHE B 1 330 ? 7.210   -58.831 -0.172  1.00 20.69  ? 330  PHE B C   1 
ATOM   6885 O  O   . PHE B 1 330 ? 8.309   -58.545 -0.668  1.00 21.89  ? 330  PHE B O   1 
ATOM   6886 C  CB  . PHE B 1 330 ? 5.357   -60.146 -1.342  1.00 23.96  ? 330  PHE B CB  1 
ATOM   6887 C  CG  . PHE B 1 330 ? 5.425   -59.125 -2.439  1.00 22.43  ? 330  PHE B CG  1 
ATOM   6888 C  CD1 . PHE B 1 330 ? 6.581   -58.899 -3.175  1.00 29.17  ? 330  PHE B CD1 1 
ATOM   6889 C  CD2 . PHE B 1 330 ? 4.276   -58.408 -2.764  1.00 27.65  ? 330  PHE B CD2 1 
ATOM   6890 C  CE1 . PHE B 1 330 ? 6.597   -57.953 -4.220  1.00 25.62  ? 330  PHE B CE1 1 
ATOM   6891 C  CE2 . PHE B 1 330 ? 4.286   -57.476 -3.779  1.00 28.80  ? 330  PHE B CE2 1 
ATOM   6892 C  CZ  . PHE B 1 330 ? 5.449   -57.248 -4.518  1.00 26.57  ? 330  PHE B CZ  1 
ATOM   6893 N  N   . PHE B 1 331 ? 6.552   -57.990 0.627   1.00 19.06  ? 331  PHE B N   1 
ATOM   6894 C  CA  . PHE B 1 331 ? 7.025   -56.627 0.845   1.00 20.43  ? 331  PHE B CA  1 
ATOM   6895 C  C   . PHE B 1 331 ? 8.282   -56.594 1.699   1.00 21.66  ? 331  PHE B C   1 
ATOM   6896 O  O   . PHE B 1 331 ? 9.127   -55.710 1.522   1.00 24.23  ? 331  PHE B O   1 
ATOM   6897 C  CB  . PHE B 1 331 ? 5.905   -55.802 1.481   1.00 21.45  ? 331  PHE B CB  1 
ATOM   6898 C  CG  . PHE B 1 331 ? 4.651   -55.842 0.670   1.00 23.90  ? 331  PHE B CG  1 
ATOM   6899 C  CD1 . PHE B 1 331 ? 4.455   -54.929 -0.353  1.00 25.44  ? 331  PHE B CD1 1 
ATOM   6900 C  CD2 . PHE B 1 331 ? 3.720   -56.855 0.857   1.00 22.71  ? 331  PHE B CD2 1 
ATOM   6901 C  CE1 . PHE B 1 331 ? 3.315   -54.998 -1.148  1.00 26.10  ? 331  PHE B CE1 1 
ATOM   6902 C  CE2 . PHE B 1 331 ? 2.584   -56.930 0.054   1.00 24.97  ? 331  PHE B CE2 1 
ATOM   6903 C  CZ  . PHE B 1 331 ? 2.379   -55.995 -0.935  1.00 25.12  ? 331  PHE B CZ  1 
ATOM   6904 N  N   . LEU B 1 332 ? 8.420   -57.540 2.624   1.00 21.84  ? 332  LEU B N   1 
ATOM   6905 C  CA  . LEU B 1 332 ? 9.644   -57.613 3.417   1.00 20.66  ? 332  LEU B CA  1 
ATOM   6906 C  C   . LEU B 1 332 ? 10.817  -58.081 2.561   1.00 21.59  ? 332  LEU B C   1 
ATOM   6907 O  O   . LEU B 1 332 ? 11.921  -57.520 2.639   1.00 23.01  ? 332  LEU B O   1 
ATOM   6908 C  CB  . LEU B 1 332 ? 9.424   -58.545 4.605   1.00 22.96  ? 332  LEU B CB  1 
ATOM   6909 C  CG  . LEU B 1 332 ? 8.451   -57.977 5.638   1.00 21.67  ? 332  LEU B CG  1 
ATOM   6910 C  CD1 . LEU B 1 332 ? 8.073   -59.034 6.679   1.00 23.44  ? 332  LEU B CD1 1 
ATOM   6911 C  CD2 . LEU B 1 332 ? 9.047   -56.749 6.308   1.00 21.64  ? 332  LEU B CD2 1 
ATOM   6912 N  N   . LEU B 1 333 ? 10.595  -59.105 1.740   1.00 19.31  ? 333  LEU B N   1 
ATOM   6913 C  CA  . LEU B 1 333 ? 11.661  -59.585 0.857   1.00 23.35  ? 333  LEU B CA  1 
ATOM   6914 C  C   . LEU B 1 333 ? 12.229  -58.451 0.020   1.00 26.84  ? 333  LEU B C   1 
ATOM   6915 O  O   . LEU B 1 333 ? 13.452  -58.332 -0.145  1.00 23.54  ? 333  LEU B O   1 
ATOM   6916 C  CB  . LEU B 1 333 ? 11.138  -60.699 -0.045  1.00 25.06  ? 333  LEU B CB  1 
ATOM   6917 C  CG  . LEU B 1 333 ? 12.007  -60.999 -1.276  1.00 23.90  ? 333  LEU B CG  1 
ATOM   6918 C  CD1 . LEU B 1 333 ? 13.359  -61.554 -0.828  1.00 26.17  ? 333  LEU B CD1 1 
ATOM   6919 C  CD2 . LEU B 1 333 ? 11.306  -61.967 -2.191  1.00 25.35  ? 333  LEU B CD2 1 
ATOM   6920 N  N   . TYR B 1 334 ? 11.358  -57.580 -0.481  1.00 23.03  ? 334  TYR B N   1 
ATOM   6921 C  CA  . TYR B 1 334 ? 11.777  -56.562 -1.429  1.00 24.01  ? 334  TYR B CA  1 
ATOM   6922 C  C   . TYR B 1 334 ? 12.265  -55.288 -0.754  1.00 30.97  ? 334  TYR B C   1 
ATOM   6923 O  O   . TYR B 1 334 ? 13.033  -54.537 -1.367  1.00 28.29  ? 334  TYR B O   1 
ATOM   6924 C  CB  . TYR B 1 334 ? 10.623  -56.228 -2.386  1.00 23.42  ? 334  TYR B CB  1 
ATOM   6925 C  CG  . TYR B 1 334 ? 10.531  -57.100 -3.618  1.00 27.87  ? 334  TYR B CG  1 
ATOM   6926 C  CD1 . TYR B 1 334 ? 10.119  -58.430 -3.533  1.00 22.97  ? 334  TYR B CD1 1 
ATOM   6927 C  CD2 . TYR B 1 334 ? 10.849  -56.588 -4.879  1.00 26.71  ? 334  TYR B CD2 1 
ATOM   6928 C  CE1 . TYR B 1 334 ? 10.021  -59.221 -4.674  1.00 24.31  ? 334  TYR B CE1 1 
ATOM   6929 C  CE2 . TYR B 1 334 ? 10.747  -57.361 -6.008  1.00 26.35  ? 334  TYR B CE2 1 
ATOM   6930 C  CZ  . TYR B 1 334 ? 10.347  -58.674 -5.906  1.00 23.27  ? 334  TYR B CZ  1 
ATOM   6931 O  OH  . TYR B 1 334 ? 10.252  -59.445 -7.042  1.00 23.08  ? 334  TYR B OH  1 
ATOM   6932 N  N   . GLY B 1 335 ? 11.876  -55.033 0.498   1.00 24.39  ? 335  GLY B N   1 
ATOM   6933 C  CA  . GLY B 1 335 ? 12.154  -53.725 1.057   1.00 23.26  ? 335  GLY B CA  1 
ATOM   6934 C  C   . GLY B 1 335 ? 12.747  -53.661 2.455   1.00 28.92  ? 335  GLY B C   1 
ATOM   6935 O  O   . GLY B 1 335 ? 13.046  -52.563 2.924   1.00 31.56  ? 335  GLY B O   1 
ATOM   6936 N  N   . ALA B 1 336 ? 12.921  -54.797 3.135   1.00 24.80  ? 336  ALA B N   1 
ATOM   6937 C  CA  . ALA B 1 336 ? 13.345  -54.733 4.538   1.00 25.39  ? 336  ALA B CA  1 
ATOM   6938 C  C   . ALA B 1 336 ? 14.670  -55.456 4.763   1.00 26.07  ? 336  ALA B C   1 
ATOM   6939 O  O   . ALA B 1 336 ? 14.921  -56.504 4.157   1.00 26.10  ? 336  ALA B O   1 
ATOM   6940 C  CB  . ALA B 1 336 ? 12.272  -55.335 5.476   1.00 22.32  ? 336  ALA B CB  1 
ATOM   6941 N  N   . PRO B 1 337 ? 15.520  -54.937 5.647   1.00 25.77  ? 337  PRO B N   1 
ATOM   6942 C  CA  . PRO B 1 337 ? 16.856  -55.529 5.829   1.00 23.03  ? 337  PRO B CA  1 
ATOM   6943 C  C   . PRO B 1 337 ? 16.793  -56.915 6.462   1.00 26.04  ? 337  PRO B C   1 
ATOM   6944 O  O   . PRO B 1 337 ? 15.985  -57.183 7.359   1.00 26.08  ? 337  PRO B O   1 
ATOM   6945 C  CB  . PRO B 1 337 ? 17.565  -54.526 6.747   1.00 29.48  ? 337  PRO B CB  1 
ATOM   6946 C  CG  . PRO B 1 337 ? 16.435  -53.827 7.503   1.00 25.63  ? 337  PRO B CG  1 
ATOM   6947 C  CD  . PRO B 1 337 ? 15.307  -53.741 6.486   1.00 25.58  ? 337  PRO B CD  1 
ATOM   6948 N  N   . GLY B 1 338 ? 17.653  -57.806 5.969   1.00 25.32  ? 338  GLY B N   1 
ATOM   6949 C  CA  . GLY B 1 338 ? 17.780  -59.151 6.489   1.00 22.78  ? 338  GLY B CA  1 
ATOM   6950 C  C   . GLY B 1 338 ? 17.003  -60.213 5.745   1.00 28.58  ? 338  GLY B C   1 
ATOM   6951 O  O   . GLY B 1 338 ? 17.190  -61.407 6.028   1.00 23.23  ? 338  GLY B O   1 
ATOM   6952 N  N   . PHE B 1 339 ? 16.128  -59.820 4.821   1.00 24.67  ? 339  PHE B N   1 
ATOM   6953 C  CA  . PHE B 1 339 ? 15.312  -60.755 4.066   1.00 26.94  ? 339  PHE B CA  1 
ATOM   6954 C  C   . PHE B 1 339 ? 15.981  -61.068 2.738   1.00 24.23  ? 339  PHE B C   1 
ATOM   6955 O  O   . PHE B 1 339 ? 16.544  -60.185 2.092   1.00 25.80  ? 339  PHE B O   1 
ATOM   6956 C  CB  . PHE B 1 339 ? 13.914  -60.185 3.821   1.00 21.37  ? 339  PHE B CB  1 
ATOM   6957 C  CG  . PHE B 1 339 ? 13.125  -60.015 5.085   1.00 22.63  ? 339  PHE B CG  1 
ATOM   6958 C  CD1 . PHE B 1 339 ? 13.243  -58.860 5.837   1.00 22.46  ? 339  PHE B CD1 1 
ATOM   6959 C  CD2 . PHE B 1 339 ? 12.324  -61.038 5.553   1.00 22.23  ? 339  PHE B CD2 1 
ATOM   6960 C  CE1 . PHE B 1 339 ? 12.530  -58.717 7.032   1.00 23.28  ? 339  PHE B CE1 1 
ATOM   6961 C  CE2 . PHE B 1 339 ? 11.604  -60.893 6.744   1.00 22.68  ? 339  PHE B CE2 1 
ATOM   6962 C  CZ  . PHE B 1 339 ? 11.718  -59.737 7.471   1.00 23.24  ? 339  PHE B CZ  1 
ATOM   6963 N  N   . SER B 1 340 ? 15.898  -62.328 2.333   1.00 26.47  ? 340  SER B N   1 
ATOM   6964 C  CA  . SER B 1 340 ? 16.519  -62.765 1.099   1.00 27.90  ? 340  SER B CA  1 
ATOM   6965 C  C   . SER B 1 340 ? 15.706  -63.902 0.515   1.00 27.50  ? 340  SER B C   1 
ATOM   6966 O  O   . SER B 1 340 ? 15.102  -64.698 1.241   1.00 27.70  ? 340  SER B O   1 
ATOM   6967 C  CB  . SER B 1 340 ? 17.970  -63.221 1.324   1.00 28.40  ? 340  SER B CB  1 
ATOM   6968 O  OG  . SER B 1 340 ? 18.414  -63.973 0.209   1.00 37.10  ? 340  SER B OG  1 
ATOM   6969 N  N   . LYS B 1 341 ? 15.706  -63.962 -0.818  1.00 26.08  ? 341  LYS B N   1 
ATOM   6970 C  CA  . LYS B 1 341 ? 15.043  -65.037 -1.536  1.00 28.10  ? 341  LYS B CA  1 
ATOM   6971 C  C   . LYS B 1 341 ? 15.767  -66.362 -1.339  1.00 28.53  ? 341  LYS B C   1 
ATOM   6972 O  O   . LYS B 1 341 ? 15.149  -67.429 -1.441  1.00 32.71  ? 341  LYS B O   1 
ATOM   6973 C  CB  . LYS B 1 341 ? 14.975  -64.661 -3.028  1.00 31.35  ? 341  LYS B CB  1 
ATOM   6974 C  CG  . LYS B 1 341 ? 14.604  -65.765 -3.974  1.00 35.81  ? 341  LYS B CG  1 
ATOM   6975 C  CD  . LYS B 1 341 ? 14.451  -65.224 -5.406  1.00 33.73  ? 341  LYS B CD  1 
ATOM   6976 C  CE  . LYS B 1 341 ? 15.623  -65.670 -6.246  1.00 34.36  ? 341  LYS B CE  1 
ATOM   6977 N  NZ  . LYS B 1 341 ? 15.622  -67.154 -6.342  1.00 40.14  ? 341  LYS B NZ  1 
ATOM   6978 N  N   . ASP B 1 342 ? 17.067  -66.316 -1.033  1.00 29.89  ? 342  ASP B N   1 
ATOM   6979 C  CA  . ASP B 1 342 ? 17.920  -67.500 -1.024  1.00 32.84  ? 342  ASP B CA  1 
ATOM   6980 C  C   . ASP B 1 342 ? 18.361  -67.910 0.373   1.00 33.24  ? 342  ASP B C   1 
ATOM   6981 O  O   . ASP B 1 342 ? 19.358  -68.624 0.517   1.00 31.28  ? 342  ASP B O   1 
ATOM   6982 C  CB  . ASP B 1 342 ? 19.144  -67.264 -1.906  1.00 34.84  ? 342  ASP B CB  1 
ATOM   6983 C  CG  . ASP B 1 342 ? 18.767  -66.821 -3.287  1.00 39.07  ? 342  ASP B CG  1 
ATOM   6984 O  OD1 . ASP B 1 342 ? 17.808  -67.407 -3.841  1.00 38.75  ? 342  ASP B OD1 1 
ATOM   6985 O  OD2 . ASP B 1 342 ? 19.414  -65.884 -3.809  1.00 43.72  ? 342  ASP B OD2 1 
ATOM   6986 N  N   . SER B 1 343 ? 17.646  -67.476 1.404   1.00 30.47  ? 343  SER B N   1 
ATOM   6987 C  CA  . SER B 1 343 ? 17.994  -67.842 2.765   1.00 29.46  ? 343  SER B CA  1 
ATOM   6988 C  C   . SER B 1 343 ? 16.719  -67.853 3.592   1.00 32.17  ? 343  SER B C   1 
ATOM   6989 O  O   . SER B 1 343 ? 15.660  -67.402 3.148   1.00 31.11  ? 343  SER B O   1 
ATOM   6990 C  CB  . SER B 1 343 ? 19.028  -66.883 3.362   1.00 29.60  ? 343  SER B CB  1 
ATOM   6991 O  OG  . SER B 1 343 ? 18.396  -65.892 4.155   1.00 36.36  ? 343  SER B OG  1 
ATOM   6992 N  N   . GLU B 1 344 ? 16.834  -68.391 4.804   1.00 28.83  ? 344  GLU B N   1 
ATOM   6993 C  CA  . GLU B 1 344 ? 15.707  -68.459 5.723   1.00 31.39  ? 344  GLU B CA  1 
ATOM   6994 C  C   . GLU B 1 344 ? 15.352  -67.106 6.312   1.00 29.58  ? 344  GLU B C   1 
ATOM   6995 O  O   . GLU B 1 344 ? 14.305  -66.994 6.966   1.00 28.95  ? 344  GLU B O   1 
ATOM   6996 C  CB  . GLU B 1 344 ? 16.027  -69.435 6.852   1.00 35.19  ? 344  GLU B CB  1 
ATOM   6997 C  CG  . GLU B 1 344 ? 15.894  -70.879 6.448   1.00 42.19  ? 344  GLU B CG  1 
ATOM   6998 C  CD  . GLU B 1 344 ? 16.130  -71.818 7.610   1.00 57.50  ? 344  GLU B CD  1 
ATOM   6999 O  OE1 . GLU B 1 344 ? 16.236  -73.040 7.368   1.00 61.55  ? 344  GLU B OE1 1 
ATOM   7000 O  OE2 . GLU B 1 344 ? 16.213  -71.335 8.759   1.00 59.22  ? 344  GLU B OE2 1 
ATOM   7001 N  N   . SER B 1 345 ? 16.205  -66.098 6.115   1.00 25.35  ? 345  SER B N   1 
ATOM   7002 C  CA  . SER B 1 345 ? 15.911  -64.717 6.486   1.00 28.42  ? 345  SER B CA  1 
ATOM   7003 C  C   . SER B 1 345 ? 15.587  -64.605 7.974   1.00 28.07  ? 345  SER B C   1 
ATOM   7004 O  O   . SER B 1 345 ? 14.623  -63.951 8.381   1.00 24.68  ? 345  SER B O   1 
ATOM   7005 C  CB  . SER B 1 345 ? 14.772  -64.148 5.628   1.00 28.02  ? 345  SER B CB  1 
ATOM   7006 O  OG  . SER B 1 345 ? 15.154  -64.110 4.257   1.00 29.64  ? 345  SER B OG  1 
ATOM   7007 N  N   . LYS B 1 346 ? 16.400  -65.255 8.797   1.00 26.42  ? 346  LYS B N   1 
ATOM   7008 C  CA  . LYS B 1 346 ? 16.304  -64.993 10.227  1.00 27.60  ? 346  LYS B CA  1 
ATOM   7009 C  C   . LYS B 1 346 ? 16.714  -63.549 10.488  1.00 29.58  ? 346  LYS B C   1 
ATOM   7010 O  O   . LYS B 1 346 ? 17.710  -63.059 9.951   1.00 32.33  ? 346  LYS B O   1 
ATOM   7011 C  CB  . LYS B 1 346 ? 17.175  -65.966 11.018  1.00 31.11  ? 346  LYS B CB  1 
ATOM   7012 C  CG  . LYS B 1 346 ? 16.685  -67.404 10.912  1.00 35.15  ? 346  LYS B CG  1 
ATOM   7013 C  CD  . LYS B 1 346 ? 17.684  -68.392 11.494  1.00 43.70  ? 346  LYS B CD  1 
ATOM   7014 C  CE  . LYS B 1 346 ? 17.188  -69.820 11.352  1.00 50.18  ? 346  LYS B CE  1 
ATOM   7015 N  NZ  . LYS B 1 346 ? 18.299  -70.808 11.428  1.00 60.40  ? 346  LYS B NZ  1 
ATOM   7016 N  N   . ILE B 1 347 ? 15.913  -62.858 11.280  1.00 27.04  ? 347  ILE B N   1 
ATOM   7017 C  CA  . ILE B 1 347 ? 15.991  -61.413 11.430  1.00 29.03  ? 347  ILE B CA  1 
ATOM   7018 C  C   . ILE B 1 347 ? 16.580  -61.112 12.804  1.00 25.22  ? 347  ILE B C   1 
ATOM   7019 O  O   . ILE B 1 347 ? 16.069  -61.591 13.822  1.00 27.31  ? 347  ILE B O   1 
ATOM   7020 C  CB  . ILE B 1 347 ? 14.601  -60.777 11.256  1.00 25.61  ? 347  ILE B CB  1 
ATOM   7021 C  CG1 . ILE B 1 347 ? 14.140  -60.981 9.810   1.00 25.93  ? 347  ILE B CG1 1 
ATOM   7022 C  CG2 . ILE B 1 347 ? 14.639  -59.305 11.543  1.00 25.04  ? 347  ILE B CG2 1 
ATOM   7023 C  CD1 . ILE B 1 347 ? 15.125  -60.375 8.797   1.00 24.72  ? 347  ILE B CD1 1 
ATOM   7024 N  N   . SER B 1 348 ? 17.657  -60.333 12.828  1.00 26.55  ? 348  SER B N   1 
ATOM   7025 C  CA  . SER B 1 348 ? 18.209  -59.852 14.087  1.00 29.48  ? 348  SER B CA  1 
ATOM   7026 C  C   . SER B 1 348 ? 17.254  -58.858 14.732  1.00 26.77  ? 348  SER B C   1 
ATOM   7027 O  O   . SER B 1 348 ? 16.376  -58.284 14.081  1.00 28.53  ? 348  SER B O   1 
ATOM   7028 C  CB  . SER B 1 348 ? 19.556  -59.171 13.860  1.00 30.52  ? 348  SER B CB  1 
ATOM   7029 O  OG  . SER B 1 348 ? 19.358  -57.914 13.213  1.00 28.95  ? 348  SER B OG  1 
ATOM   7030 N  N   . ARG B 1 349 ? 17.458  -58.641 16.036  1.00 26.16  ? 349  ARG B N   1 
ATOM   7031 C  CA  . ARG B 1 349 ? 16.708  -57.621 16.755  1.00 28.64  ? 349  ARG B CA  1 
ATOM   7032 C  C   . ARG B 1 349 ? 16.865  -56.256 16.097  1.00 26.73  ? 349  ARG B C   1 
ATOM   7033 O  O   . ARG B 1 349 ? 15.896  -55.501 15.962  1.00 27.24  ? 349  ARG B O   1 
ATOM   7034 C  CB  . ARG B 1 349 ? 17.184  -57.577 18.208  1.00 31.18  ? 349  ARG B CB  1 
ATOM   7035 C  CG  . ARG B 1 349 ? 16.276  -56.833 19.115  1.00 34.40  ? 349  ARG B CG  1 
ATOM   7036 C  CD  . ARG B 1 349 ? 15.084  -57.678 19.446  1.00 37.49  ? 349  ARG B CD  1 
ATOM   7037 N  NE  . ARG B 1 349 ? 13.956  -56.818 19.720  1.00 43.65  ? 349  ARG B NE  1 
ATOM   7038 C  CZ  . ARG B 1 349 ? 12.700  -57.123 19.438  1.00 36.35  ? 349  ARG B CZ  1 
ATOM   7039 N  NH1 . ARG B 1 349 ? 12.401  -58.295 18.889  1.00 31.73  ? 349  ARG B NH1 1 
ATOM   7040 N  NH2 . ARG B 1 349 ? 11.747  -56.252 19.728  1.00 35.14  ? 349  ARG B NH2 1 
ATOM   7041 N  N   . GLU B 1 350 ? 18.083  -55.925 15.683  1.00 23.94  ? 350  GLU B N   1 
ATOM   7042 C  CA  . GLU B 1 350 ? 18.337  -54.651 15.019  1.00 26.24  ? 350  GLU B CA  1 
ATOM   7043 C  C   . GLU B 1 350 ? 17.532  -54.531 13.723  1.00 27.99  ? 350  GLU B C   1 
ATOM   7044 O  O   . GLU B 1 350 ? 16.870  -53.515 13.477  1.00 26.11  ? 350  GLU B O   1 
ATOM   7045 C  CB  . GLU B 1 350 ? 19.838  -54.534 14.748  1.00 29.00  ? 350  GLU B CB  1 
ATOM   7046 C  CG  . GLU B 1 350 ? 20.297  -53.216 14.194  0.98 33.75  ? 350  GLU B CG  1 
ATOM   7047 C  CD  . GLU B 1 350 ? 21.780  -53.238 13.861  0.97 37.54  ? 350  GLU B CD  1 
ATOM   7048 O  OE1 . GLU B 1 350 ? 22.600  -53.393 14.790  0.86 46.64  ? 350  GLU B OE1 1 
ATOM   7049 O  OE2 . GLU B 1 350 ? 22.120  -53.127 12.674  0.74 37.65  ? 350  GLU B OE2 1 
ATOM   7050 N  N   . ASP B 1 351 ? 17.567  -55.568 12.888  1.00 25.58  ? 351  ASP B N   1 
ATOM   7051 C  CA  . ASP B 1 351 ? 16.789  -55.545 11.648  1.00 24.91  ? 351  ASP B CA  1 
ATOM   7052 C  C   . ASP B 1 351 ? 15.286  -55.599 11.916  1.00 25.90  ? 351  ASP B C   1 
ATOM   7053 O  O   . ASP B 1 351 ? 14.498  -55.057 11.129  1.00 24.91  ? 351  ASP B O   1 
ATOM   7054 C  CB  . ASP B 1 351 ? 17.207  -56.705 10.747  1.00 27.35  ? 351  ASP B CB  1 
ATOM   7055 C  CG  . ASP B 1 351 ? 18.538  -56.456 10.060  1.00 29.95  ? 351  ASP B CG  1 
ATOM   7056 O  OD1 . ASP B 1 351 ? 19.071  -55.331 10.194  1.00 27.95  ? 351  ASP B OD1 1 
ATOM   7057 O  OD2 . ASP B 1 351 ? 19.034  -57.386 9.382   1.00 26.74  ? 351  ASP B OD2 1 
ATOM   7058 N  N   . PHE B 1 352 ? 14.869  -56.255 13.005  1.00 27.96  ? 352  PHE B N   1 
ATOM   7059 C  CA  . PHE B 1 352 ? 13.462  -56.219 13.389  1.00 25.28  ? 352  PHE B CA  1 
ATOM   7060 C  C   . PHE B 1 352 ? 13.007  -54.788 13.641  1.00 25.51  ? 352  PHE B C   1 
ATOM   7061 O  O   . PHE B 1 352 ? 11.985  -54.342 13.104  1.00 27.09  ? 352  PHE B O   1 
ATOM   7062 C  CB  . PHE B 1 352 ? 13.229  -57.083 14.630  1.00 24.97  ? 352  PHE B CB  1 
ATOM   7063 C  CG  . PHE B 1 352 ? 11.799  -57.093 15.098  1.00 25.55  ? 352  PHE B CG  1 
ATOM   7064 C  CD1 . PHE B 1 352 ? 10.870  -57.922 14.492  1.00 24.23  ? 352  PHE B CD1 1 
ATOM   7065 C  CD2 . PHE B 1 352 ? 11.388  -56.271 16.144  1.00 24.77  ? 352  PHE B CD2 1 
ATOM   7066 C  CE1 . PHE B 1 352 ? 9.550   -57.945 14.918  1.00 25.82  ? 352  PHE B CE1 1 
ATOM   7067 C  CE2 . PHE B 1 352 ? 10.059  -56.286 16.580  1.00 26.56  ? 352  PHE B CE2 1 
ATOM   7068 C  CZ  . PHE B 1 352 ? 9.144   -57.122 15.967  1.00 24.27  ? 352  PHE B CZ  1 
ATOM   7069 N  N   . MET B 1 353 ? 13.752  -54.052 14.471  1.00 25.05  ? 353  MET B N   1 
ATOM   7070 C  CA  . MET B 1 353 ? 13.358  -52.679 14.766  1.00 28.34  ? 353  MET B CA  1 
ATOM   7071 C  C   . MET B 1 353 ? 13.368  -51.818 13.505  1.00 26.31  ? 353  MET B C   1 
ATOM   7072 O  O   . MET B 1 353 ? 12.505  -50.949 13.335  1.00 27.42  ? 353  MET B O   1 
ATOM   7073 C  CB  . MET B 1 353 ? 14.264  -52.089 15.845  1.00 29.54  ? 353  MET B CB  1 
ATOM   7074 C  CG  . MET B 1 353 ? 13.868  -52.520 17.279  1.00 41.11  ? 353  MET B CG  1 
ATOM   7075 S  SD  . MET B 1 353 ? 15.246  -52.332 18.427  1.00 61.02  ? 353  MET B SD  1 
ATOM   7076 C  CE  . MET B 1 353 ? 15.257  -50.552 18.652  1.00 54.86  ? 353  MET B CE  1 
ATOM   7077 N  N   . SER B 1 354 ? 14.337  -52.044 12.608  1.00 23.83  ? 354  SER B N   1 
ATOM   7078 C  CA  . SER B 1 354 ? 14.347  -51.327 11.337  1.00 27.09  ? 354  SER B CA  1 
ATOM   7079 C  C   . SER B 1 354 ? 13.107  -51.654 10.516  1.00 23.28  ? 354  SER B C   1 
ATOM   7080 O  O   . SER B 1 354 ? 12.491  -50.760 9.927   1.00 26.50  ? 354  SER B O   1 
ATOM   7081 C  CB  . SER B 1 354 ? 15.613  -51.666 10.546  1.00 22.64  ? 354  SER B CB  1 
ATOM   7082 O  OG  . SER B 1 354 ? 16.759  -51.136 11.190  1.00 27.16  ? 354  SER B OG  1 
ATOM   7083 N  N   . GLY B 1 355 ? 12.727  -52.934 10.465  1.00 25.55  ? 355  GLY B N   1 
ATOM   7084 C  CA  . GLY B 1 355 ? 11.540  -53.315 9.723   1.00 24.75  ? 355  GLY B CA  1 
ATOM   7085 C  C   . GLY B 1 355 ? 10.265  -52.724 10.290  1.00 27.77  ? 355  GLY B C   1 
ATOM   7086 O  O   . GLY B 1 355 ? 9.342   -52.394 9.537   1.00 25.67  ? 355  GLY B O   1 
ATOM   7087 N  N   . VAL B 1 356 ? 10.190  -52.579 11.612  1.00 25.35  ? 356  VAL B N   1 
ATOM   7088 C  CA  . VAL B 1 356 ? 8.984   -52.018 12.211  1.00 27.07  ? 356  VAL B CA  1 
ATOM   7089 C  C   . VAL B 1 356 ? 8.786   -50.591 11.729  1.00 26.60  ? 356  VAL B C   1 
ATOM   7090 O  O   . VAL B 1 356 ? 7.675   -50.191 11.352  1.00 27.07  ? 356  VAL B O   1 
ATOM   7091 C  CB  . VAL B 1 356 ? 9.052   -52.089 13.750  1.00 24.14  ? 356  VAL B CB  1 
ATOM   7092 C  CG1 . VAL B 1 356 ? 7.894   -51.304 14.352  1.00 27.60  ? 356  VAL B CG1 1 
ATOM   7093 C  CG2 . VAL B 1 356 ? 9.005   -53.540 14.236  1.00 24.57  ? 356  VAL B CG2 1 
ATOM   7094 N  N   . LYS B 1 357 ? 9.866   -49.808 11.712  1.00 25.99  ? 357  LYS B N   1 
ATOM   7095 C  CA  . LYS B 1 357 ? 9.763   -48.413 11.297  1.00 28.21  ? 357  LYS B CA  1 
ATOM   7096 C  C   . LYS B 1 357 ? 9.412   -48.306 9.812   1.00 25.15  ? 357  LYS B C   1 
ATOM   7097 O  O   . LYS B 1 357 ? 8.656   -47.417 9.409   1.00 28.81  ? 357  LYS B O   1 
ATOM   7098 C  CB  . LYS B 1 357 ? 11.072  -47.683 11.601  1.00 32.56  ? 357  LYS B CB  1 
ATOM   7099 C  CG  . LYS B 1 357 ? 11.023  -46.182 11.339  1.00 36.74  ? 357  LYS B CG  1 
ATOM   7100 C  CD  . LYS B 1 357 ? 12.243  -45.467 11.909  1.00 44.25  ? 357  LYS B CD  1 
ATOM   7101 C  CE  . LYS B 1 357 ? 12.160  -43.967 11.656  1.00 43.05  ? 357  LYS B CE  1 
ATOM   7102 N  NZ  . LYS B 1 357 ? 10.839  -43.409 12.093  1.00 46.11  ? 357  LYS B NZ  1 
ATOM   7103 N  N   . LEU B 1 358 ? 9.948   -49.207 8.987   1.00 26.22  ? 358  LEU B N   1 
ATOM   7104 C  CA  . LEU B 1 358 ? 9.577   -49.227 7.571   1.00 24.04  ? 358  LEU B CA  1 
ATOM   7105 C  C   . LEU B 1 358 ? 8.122   -49.637 7.377   1.00 29.84  ? 358  LEU B C   1 
ATOM   7106 O  O   . LEU B 1 358 ? 7.468   -49.174 6.436   1.00 31.18  ? 358  LEU B O   1 
ATOM   7107 C  CB  . LEU B 1 358 ? 10.477  -50.187 6.801   1.00 26.72  ? 358  LEU B CB  1 
ATOM   7108 C  CG  . LEU B 1 358 ? 11.946  -49.799 6.626   1.00 30.05  ? 358  LEU B CG  1 
ATOM   7109 C  CD1 . LEU B 1 358 ? 12.734  -50.993 6.124   1.00 30.31  ? 358  LEU B CD1 1 
ATOM   7110 C  CD2 . LEU B 1 358 ? 12.080  -48.631 5.664   1.00 34.87  ? 358  LEU B CD2 1 
ATOM   7111 N  N   . SER B 1 359 ? 7.610   -50.516 8.241   1.00 26.44  ? 359  SER B N   1 
ATOM   7112 C  CA  . SER B 1 359 ? 6.258   -51.031 8.086   1.00 27.71  ? 359  SER B CA  1 
ATOM   7113 C  C   . SER B 1 359 ? 5.207   -50.046 8.568   1.00 28.71  ? 359  SER B C   1 
ATOM   7114 O  O   . SER B 1 359 ? 4.096   -50.016 8.019   1.00 26.27  ? 359  SER B O   1 
ATOM   7115 C  CB  . SER B 1 359 ? 6.118   -52.356 8.831   1.00 26.70  ? 359  SER B CB  1 
ATOM   7116 O  OG  . SER B 1 359 ? 7.036   -53.313 8.320   1.00 29.27  ? 359  SER B OG  1 
ATOM   7117 N  N   . VAL B 1 360 ? 5.523   -49.245 9.581   1.00 25.93  ? 360  VAL B N   1 
ATOM   7118 C  CA  . VAL B 1 360 ? 4.576   -48.262 10.096  1.00 29.78  ? 360  VAL B CA  1 
ATOM   7119 C  C   . VAL B 1 360 ? 5.235   -46.895 9.969   1.00 33.33  ? 360  VAL B C   1 
ATOM   7120 O  O   . VAL B 1 360 ? 5.576   -46.269 10.989  1.00 30.91  ? 360  VAL B O   1 
ATOM   7121 C  CB  . VAL B 1 360 ? 4.169   -48.576 11.547  1.00 30.04  ? 360  VAL B CB  1 
ATOM   7122 C  CG1 . VAL B 1 360 ? 2.853   -47.882 11.892  1.00 28.41  ? 360  VAL B CG1 1 
ATOM   7123 C  CG2 . VAL B 1 360 ? 4.044   -50.079 11.740  1.00 27.60  ? 360  VAL B CG2 1 
ATOM   7124 N  N   . PRO B 1 361 ? 5.425   -46.392 8.744   1.00 32.08  ? 361  PRO B N   1 
ATOM   7125 C  CA  . PRO B 1 361 ? 6.257   -45.193 8.567   1.00 32.16  ? 361  PRO B CA  1 
ATOM   7126 C  C   . PRO B 1 361 ? 5.643   -43.942 9.157   1.00 34.79  ? 361  PRO B C   1 
ATOM   7127 O  O   . PRO B 1 361 ? 6.379   -43.007 9.492   1.00 38.87  ? 361  PRO B O   1 
ATOM   7128 C  CB  . PRO B 1 361 ? 6.393   -45.081 7.041   1.00 31.91  ? 361  PRO B CB  1 
ATOM   7129 C  CG  . PRO B 1 361 ? 5.141   -45.748 6.509   1.00 34.29  ? 361  PRO B CG  1 
ATOM   7130 C  CD  . PRO B 1 361 ? 4.849   -46.873 7.472   1.00 32.33  ? 361  PRO B CD  1 
ATOM   7131 N  N   . HIS B 1 362 ? 4.327   -43.902 9.318   1.00 30.84  ? 362  HIS B N   1 
ATOM   7132 C  CA  . HIS B 1 362 ? 3.641   -42.722 9.822   1.00 36.24  ? 362  HIS B CA  1 
ATOM   7133 C  C   . HIS B 1 362 ? 3.626   -42.629 11.346  1.00 41.53  ? 362  HIS B C   1 
ATOM   7134 O  O   . HIS B 1 362 ? 3.140   -41.626 11.881  1.00 45.69  ? 362  HIS B O   1 
ATOM   7135 C  CB  . HIS B 1 362 ? 2.201   -42.711 9.304   1.00 42.49  ? 362  HIS B CB  1 
ATOM   7136 C  CG  . HIS B 1 362 ? 1.437   -43.957 9.634   1.00 43.66  ? 362  HIS B CG  1 
ATOM   7137 N  ND1 . HIS B 1 362 ? 1.634   -45.150 8.969   1.00 37.47  ? 362  HIS B ND1 1 
ATOM   7138 C  CD2 . HIS B 1 362 ? 0.488   -44.199 10.571  1.00 41.30  ? 362  HIS B CD2 1 
ATOM   7139 C  CE1 . HIS B 1 362 ? 0.835   -46.072 9.480   1.00 37.36  ? 362  HIS B CE1 1 
ATOM   7140 N  NE2 . HIS B 1 362 ? 0.126   -45.519 10.451  1.00 39.42  ? 362  HIS B NE2 1 
ATOM   7141 N  N   . ALA B 1 363 ? 4.132   -43.629 12.059  1.00 36.18  ? 363  ALA B N   1 
ATOM   7142 C  CA  . ALA B 1 363 ? 3.981   -43.681 13.509  1.00 35.77  ? 363  ALA B CA  1 
ATOM   7143 C  C   . ALA B 1 363 ? 5.090   -42.910 14.216  1.00 38.28  ? 363  ALA B C   1 
ATOM   7144 O  O   . ALA B 1 363 ? 6.248   -42.934 13.792  1.00 38.34  ? 363  ALA B O   1 
ATOM   7145 C  CB  . ALA B 1 363 ? 3.977   -45.134 13.986  1.00 28.53  ? 363  ALA B CB  1 
ATOM   7146 N  N   . ASN B 1 364 ? 4.730   -42.234 15.308  1.00 38.03  ? 364  ASN B N   1 
ATOM   7147 C  CA  . ASN B 1 364 ? 5.727   -41.630 16.181  1.00 37.47  ? 364  ASN B CA  1 
ATOM   7148 C  C   . ASN B 1 364 ? 6.453   -42.716 16.982  1.00 34.58  ? 364  ASN B C   1 
ATOM   7149 O  O   . ASN B 1 364 ? 6.131   -43.906 16.909  1.00 33.19  ? 364  ASN B O   1 
ATOM   7150 C  CB  . ASN B 1 364 ? 5.076   -40.614 17.117  1.00 42.86  ? 364  ASN B CB  1 
ATOM   7151 C  CG  . ASN B 1 364 ? 3.896   -41.194 17.885  1.00 38.69  ? 364  ASN B CG  1 
ATOM   7152 O  OD1 . ASN B 1 364 ? 3.815   -42.401 18.119  1.00 33.52  ? 364  ASN B OD1 1 
ATOM   7153 N  ND2 . ASN B 1 364 ? 2.960   -40.333 18.259  1.00 42.15  ? 364  ASN B ND2 1 
ATOM   7154 N  N   . ASP B 1 365 ? 7.436   -42.294 17.779  1.00 36.92  ? 365  ASP B N   1 
ATOM   7155 C  CA  . ASP B 1 365 ? 8.231   -43.260 18.532  1.00 39.40  ? 365  ASP B CA  1 
ATOM   7156 C  C   . ASP B 1 365 ? 7.372   -44.048 19.511  1.00 33.49  ? 365  ASP B C   1 
ATOM   7157 O  O   . ASP B 1 365 ? 7.585   -45.251 19.703  1.00 30.59  ? 365  ASP B O   1 
ATOM   7158 C  CB  . ASP B 1 365 ? 9.370   -42.553 19.266  1.00 43.14  ? 365  ASP B CB  1 
ATOM   7159 C  CG  . ASP B 1 365 ? 10.525  -42.204 18.342  1.00 57.06  ? 365  ASP B CG  1 
ATOM   7160 O  OD1 . ASP B 1 365 ? 11.087  -41.101 18.489  1.00 62.80  ? 365  ASP B OD1 1 
ATOM   7161 O  OD2 . ASP B 1 365 ? 10.865  -43.027 17.461  1.00 64.02  ? 365  ASP B OD2 1 
ATOM   7162 N  N   . LEU B 1 366 ? 6.405   -43.387 20.149  1.00 31.57  ? 366  LEU B N   1 
ATOM   7163 C  CA  . LEU B 1 366 ? 5.501   -44.099 21.050  1.00 33.21  ? 366  LEU B CA  1 
ATOM   7164 C  C   . LEU B 1 366 ? 4.704   -45.154 20.296  1.00 31.02  ? 366  LEU B C   1 
ATOM   7165 O  O   . LEU B 1 366 ? 4.507   -46.271 20.791  1.00 27.63  ? 366  LEU B O   1 
ATOM   7166 C  CB  . LEU B 1 366 ? 4.560   -43.112 21.740  1.00 33.40  ? 366  LEU B CB  1 
ATOM   7167 C  CG  . LEU B 1 366 ? 3.638   -43.738 22.779  1.00 32.11  ? 366  LEU B CG  1 
ATOM   7168 C  CD1 . LEU B 1 366 ? 4.443   -44.249 23.963  1.00 35.06  ? 366  LEU B CD1 1 
ATOM   7169 C  CD2 . LEU B 1 366 ? 2.575   -42.739 23.215  1.00 35.57  ? 366  LEU B CD2 1 
ATOM   7170 N  N   . GLY B 1 367 ? 4.259   -44.827 19.084  1.00 30.52  ? 367  GLY B N   1 
ATOM   7171 C  CA  . GLY B 1 367 ? 3.557   -45.810 18.277  1.00 31.31  ? 367  GLY B CA  1 
ATOM   7172 C  C   . GLY B 1 367 ? 4.455   -46.963 17.876  1.00 30.02  ? 367  GLY B C   1 
ATOM   7173 O  O   . GLY B 1 367 ? 4.027   -48.122 17.875  1.00 27.02  ? 367  GLY B O   1 
ATOM   7174 N  N   . LEU B 1 368 ? 5.717   -46.665 17.541  1.00 29.44  ? 368  LEU B N   1 
ATOM   7175 C  CA  . LEU B 1 368 ? 6.658   -47.727 17.203  1.00 29.14  ? 368  LEU B CA  1 
ATOM   7176 C  C   . LEU B 1 368 ? 6.890   -48.647 18.394  1.00 27.08  ? 368  LEU B C   1 
ATOM   7177 O  O   . LEU B 1 368 ? 6.937   -49.877 18.238  1.00 24.65  ? 368  LEU B O   1 
ATOM   7178 C  CB  . LEU B 1 368 ? 7.977   -47.124 16.715  1.00 32.79  ? 368  LEU B CB  1 
ATOM   7179 C  CG  . LEU B 1 368 ? 7.990   -46.359 15.380  1.00 32.01  ? 368  LEU B CG  1 
ATOM   7180 C  CD1 . LEU B 1 368 ? 9.354   -45.728 15.160  1.00 38.16  ? 368  LEU B CD1 1 
ATOM   7181 C  CD2 . LEU B 1 368 ? 7.625   -47.246 14.191  1.00 34.63  ? 368  LEU B CD2 1 
ATOM   7182 N  N   . ASP B 1 369 ? 7.036   -48.068 19.594  1.00 28.27  ? 369  ASP B N   1 
ATOM   7183 C  CA  . ASP B 1 369 ? 7.144   -48.877 20.809  1.00 28.81  ? 369  ASP B CA  1 
ATOM   7184 C  C   . ASP B 1 369 ? 5.932   -49.786 20.990  1.00 26.65  ? 369  ASP B C   1 
ATOM   7185 O  O   . ASP B 1 369 ? 6.076   -50.958 21.370  1.00 27.05  ? 369  ASP B O   1 
ATOM   7186 C  CB  . ASP B 1 369 ? 7.294   -47.978 22.042  1.00 28.87  ? 369  ASP B CB  1 
ATOM   7187 C  CG  . ASP B 1 369 ? 8.617   -47.239 22.083  1.00 35.95  ? 369  ASP B CG  1 
ATOM   7188 O  OD1 . ASP B 1 369 ? 9.539   -47.572 21.300  1.00 36.49  ? 369  ASP B OD1 1 
ATOM   7189 O  OD2 . ASP B 1 369 ? 8.738   -46.318 22.916  1.00 39.23  ? 369  ASP B OD2 1 
ATOM   7190 N  N   . ALA B 1 370 ? 4.728   -49.261 20.744  1.00 24.14  ? 370  ALA B N   1 
ATOM   7191 C  CA  . ALA B 1 370 ? 3.521   -50.068 20.911  1.00 24.39  ? 370  ALA B CA  1 
ATOM   7192 C  C   . ALA B 1 370 ? 3.527   -51.260 19.958  1.00 26.44  ? 370  ALA B C   1 
ATOM   7193 O  O   . ALA B 1 370 ? 3.249   -52.398 20.363  1.00 25.30  ? 370  ALA B O   1 
ATOM   7194 C  CB  . ALA B 1 370 ? 2.275   -49.202 20.699  1.00 22.54  ? 370  ALA B CB  1 
ATOM   7195 N  N   . VAL B 1 371 ? 3.869   -51.016 18.685  1.00 24.89  ? 371  VAL B N   1 
ATOM   7196 C  CA  . VAL B 1 371 ? 3.936   -52.102 17.706  1.00 26.23  ? 371  VAL B CA  1 
ATOM   7197 C  C   . VAL B 1 371 ? 4.963   -53.133 18.141  1.00 22.68  ? 371  VAL B C   1 
ATOM   7198 O  O   . VAL B 1 371 ? 4.707   -54.344 18.123  1.00 23.31  ? 371  VAL B O   1 
ATOM   7199 C  CB  . VAL B 1 371 ? 4.264   -51.553 16.302  1.00 25.12  ? 371  VAL B CB  1 
ATOM   7200 C  CG1 . VAL B 1 371 ? 4.359   -52.698 15.299  1.00 22.82  ? 371  VAL B CG1 1 
ATOM   7201 C  CG2 . VAL B 1 371 ? 3.216   -50.540 15.860  1.00 23.17  ? 371  VAL B CG2 1 
ATOM   7202 N  N   . THR B 1 372 ? 6.143   -52.662 18.538  1.00 21.57  ? 372  THR B N   1 
ATOM   7203 C  CA  . THR B 1 372 ? 7.210   -53.563 18.947  1.00 27.58  ? 372  THR B CA  1 
ATOM   7204 C  C   . THR B 1 372 ? 6.774   -54.437 20.110  1.00 23.27  ? 372  THR B C   1 
ATOM   7205 O  O   . THR B 1 372 ? 6.920   -55.667 20.070  1.00 24.69  ? 372  THR B O   1 
ATOM   7206 C  CB  . THR B 1 372 ? 8.456   -52.752 19.312  1.00 26.57  ? 372  THR B CB  1 
ATOM   7207 O  OG1 . THR B 1 372 ? 8.955   -52.106 18.129  1.00 27.15  ? 372  THR B OG1 1 
ATOM   7208 C  CG2 . THR B 1 372 ? 9.524   -53.664 19.888  1.00 26.33  ? 372  THR B CG2 1 
ATOM   7209 N  N   . LEU B 1 373 ? 6.228   -53.816 21.160  1.00 23.88  ? 373  LEU B N   1 
ATOM   7210 C  CA  . LEU B 1 373 ? 5.838   -54.574 22.341  1.00 27.27  ? 373  LEU B CA  1 
ATOM   7211 C  C   . LEU B 1 373 ? 4.773   -55.599 21.990  1.00 23.43  ? 373  LEU B C   1 
ATOM   7212 O  O   . LEU B 1 373 ? 4.778   -56.725 22.496  1.00 26.86  ? 373  LEU B O   1 
ATOM   7213 C  CB  . LEU B 1 373 ? 5.324   -53.625 23.427  1.00 22.50  ? 373  LEU B CB  1 
ATOM   7214 C  CG  . LEU B 1 373 ? 4.818   -54.308 24.698  1.00 26.76  ? 373  LEU B CG  1 
ATOM   7215 C  CD1 . LEU B 1 373 ? 5.913   -55.181 25.295  1.00 24.65  ? 373  LEU B CD1 1 
ATOM   7216 C  CD2 . LEU B 1 373 ? 4.346   -53.254 25.701  1.00 27.98  ? 373  LEU B CD2 1 
ATOM   7217 N  N   . GLN B 1 374 ? 3.858   -55.225 21.111  1.00 25.02  ? 374  GLN B N   1 
ATOM   7218 C  CA  . GLN B 1 374 ? 2.762   -56.115 20.776  1.00 23.96  ? 374  GLN B CA  1 
ATOM   7219 C  C   . GLN B 1 374 ? 3.241   -57.341 20.004  1.00 25.70  ? 374  GLN B C   1 
ATOM   7220 O  O   . GLN B 1 374 ? 2.628   -58.413 20.103  1.00 27.71  ? 374  GLN B O   1 
ATOM   7221 C  CB  . GLN B 1 374 ? 1.727   -55.325 19.987  1.00 29.71  ? 374  GLN B CB  1 
ATOM   7222 C  CG  . GLN B 1 374 ? 0.499   -56.079 19.732  1.00 31.54  ? 374  GLN B CG  1 
ATOM   7223 C  CD  . GLN B 1 374 ? -0.520  -56.005 20.851  1.00 33.83  ? 374  GLN B CD  1 
ATOM   7224 O  OE1 . GLN B 1 374 ? -0.328  -55.317 21.854  1.00 35.33  ? 374  GLN B OE1 1 
ATOM   7225 N  NE2 . GLN B 1 374 ? -1.612  -56.727 20.682  1.00 31.38  ? 374  GLN B NE2 1 
ATOM   7226 N  N   . TYR B 1 375 ? 4.344   -57.227 19.258  1.00 21.23  ? 375  TYR B N   1 
ATOM   7227 C  CA  . TYR B 1 375 ? 4.802   -58.324 18.416  1.00 23.48  ? 375  TYR B CA  1 
ATOM   7228 C  C   . TYR B 1 375 ? 6.124   -58.932 18.868  1.00 26.38  ? 375  TYR B C   1 
ATOM   7229 O  O   . TYR B 1 375 ? 6.722   -59.713 18.117  1.00 26.31  ? 375  TYR B O   1 
ATOM   7230 C  CB  . TYR B 1 375 ? 4.919   -57.854 16.961  1.00 23.68  ? 375  TYR B CB  1 
ATOM   7231 C  CG  . TYR B 1 375 ? 3.580   -57.734 16.264  1.00 21.33  ? 375  TYR B CG  1 
ATOM   7232 C  CD1 . TYR B 1 375 ? 2.866   -56.543 16.291  1.00 21.51  ? 375  TYR B CD1 1 
ATOM   7233 C  CD2 . TYR B 1 375 ? 3.037   -58.815 15.575  1.00 24.32  ? 375  TYR B CD2 1 
ATOM   7234 C  CE1 . TYR B 1 375 ? 1.638   -56.429 15.635  1.00 24.90  ? 375  TYR B CE1 1 
ATOM   7235 C  CE2 . TYR B 1 375 ? 1.810   -58.715 14.922  1.00 24.94  ? 375  TYR B CE2 1 
ATOM   7236 C  CZ  . TYR B 1 375 ? 1.117   -57.525 14.961  1.00 22.51  ? 375  TYR B CZ  1 
ATOM   7237 O  OH  . TYR B 1 375 ? -0.105  -57.433 14.329  1.00 26.22  ? 375  TYR B OH  1 
ATOM   7238 N  N   . THR B 1 376 ? 6.605   -58.604 20.067  1.00 23.63  ? 376  THR B N   1 
ATOM   7239 C  CA  . THR B 1 376 ? 7.884   -59.116 20.544  1.00 21.88  ? 376  THR B CA  1 
ATOM   7240 C  C   . THR B 1 376 ? 7.660   -60.071 21.703  1.00 28.04  ? 376  THR B C   1 
ATOM   7241 O  O   . THR B 1 376 ? 6.959   -59.738 22.671  1.00 25.02  ? 376  THR B O   1 
ATOM   7242 C  CB  . THR B 1 376 ? 8.813   -57.985 20.987  1.00 28.26  ? 376  THR B CB  1 
ATOM   7243 O  OG1 . THR B 1 376 ? 9.142   -57.166 19.865  1.00 24.76  ? 376  THR B OG1 1 
ATOM   7244 C  CG2 . THR B 1 376 ? 10.090  -58.536 21.624  1.00 28.81  ? 376  THR B CG2 1 
ATOM   7245 N  N   . ASP B 1 377 ? 8.255   -61.253 21.600  1.00 24.93  ? 377  ASP B N   1 
ATOM   7246 C  CA  . ASP B 1 377 ? 8.328   -62.200 22.707  1.00 24.75  ? 377  ASP B CA  1 
ATOM   7247 C  C   . ASP B 1 377 ? 9.563   -61.850 23.530  1.00 25.46  ? 377  ASP B C   1 
ATOM   7248 O  O   . ASP B 1 377 ? 10.692  -62.197 23.164  1.00 24.01  ? 377  ASP B O   1 
ATOM   7249 C  CB  . ASP B 1 377 ? 8.377   -63.627 22.177  1.00 29.79  ? 377  ASP B CB  1 
ATOM   7250 C  CG  . ASP B 1 377 ? 8.470   -64.659 23.281  1.00 32.28  ? 377  ASP B CG  1 
ATOM   7251 O  OD1 . ASP B 1 377 ? 8.470   -64.277 24.474  1.00 29.81  ? 377  ASP B OD1 1 
ATOM   7252 O  OD2 . ASP B 1 377 ? 8.523   -65.861 22.946  1.00 30.42  ? 377  ASP B OD2 1 
ATOM   7253 N  N   . TRP B 1 378 ? 9.354   -61.158 24.650  1.00 24.44  ? 378  TRP B N   1 
ATOM   7254 C  CA  . TRP B 1 378 ? 10.486  -60.719 25.462  1.00 27.29  ? 378  TRP B CA  1 
ATOM   7255 C  C   . TRP B 1 378 ? 11.117  -61.835 26.286  1.00 26.66  ? 378  TRP B C   1 
ATOM   7256 O  O   . TRP B 1 378 ? 12.145  -61.593 26.932  1.00 27.94  ? 378  TRP B O   1 
ATOM   7257 C  CB  . TRP B 1 378 ? 10.057  -59.544 26.351  1.00 24.24  ? 378  TRP B CB  1 
ATOM   7258 C  CG  . TRP B 1 378 ? 10.111  -58.260 25.561  1.00 26.29  ? 378  TRP B CG  1 
ATOM   7259 C  CD1 . TRP B 1 378 ? 9.057   -57.483 25.182  1.00 29.33  ? 378  TRP B CD1 1 
ATOM   7260 C  CD2 . TRP B 1 378 ? 11.286  -57.638 25.021  1.00 29.68  ? 378  TRP B CD2 1 
ATOM   7261 N  NE1 . TRP B 1 378 ? 9.504   -56.406 24.450  1.00 29.68  ? 378  TRP B NE1 1 
ATOM   7262 C  CE2 . TRP B 1 378 ? 10.869  -56.477 24.343  1.00 34.71  ? 378  TRP B CE2 1 
ATOM   7263 C  CE3 . TRP B 1 378 ? 12.654  -57.944 25.063  1.00 38.69  ? 378  TRP B CE3 1 
ATOM   7264 C  CZ2 . TRP B 1 378 ? 11.766  -55.623 23.699  1.00 38.57  ? 378  TRP B CZ2 1 
ATOM   7265 C  CZ3 . TRP B 1 378 ? 13.552  -57.087 24.428  1.00 37.13  ? 378  TRP B CZ3 1 
ATOM   7266 C  CH2 . TRP B 1 378 ? 13.102  -55.942 23.754  1.00 40.00  ? 378  TRP B CH2 1 
ATOM   7267 N  N   . MET B 1 379 ? 10.559  -63.048 26.276  1.00 26.23  ? 379  MET B N   1 
ATOM   7268 C  CA  . MET B 1 379 ? 11.317  -64.192 26.774  1.00 27.70  ? 379  MET B CA  1 
ATOM   7269 C  C   . MET B 1 379 ? 12.347  -64.697 25.766  1.00 30.12  ? 379  MET B C   1 
ATOM   7270 O  O   . MET B 1 379 ? 13.179  -65.543 26.119  1.00 31.82  ? 379  MET B O   1 
ATOM   7271 C  CB  . MET B 1 379 ? 10.381  -65.350 27.129  1.00 24.45  ? 379  MET B CB  1 
ATOM   7272 C  CG  . MET B 1 379 ? 9.502   -65.095 28.355  1.00 35.99  ? 379  MET B CG  1 
ATOM   7273 S  SD  . MET B 1 379 ? 8.156   -66.276 28.460  1.00 49.86  ? 379  MET B SD  1 
ATOM   7274 C  CE  . MET B 1 379 ? 9.012   -67.671 29.171  1.00 40.05  ? 379  MET B CE  1 
ATOM   7275 N  N   . ASP B 1 380 ? 12.313  -64.203 24.530  1.00 28.27  ? 380  ASP B N   1 
ATOM   7276 C  CA  . ASP B 1 380 ? 13.046  -64.831 23.442  1.00 28.80  ? 380  ASP B CA  1 
ATOM   7277 C  C   . ASP B 1 380 ? 13.283  -63.819 22.326  1.00 29.01  ? 380  ASP B C   1 
ATOM   7278 O  O   . ASP B 1 380 ? 13.025  -64.107 21.154  1.00 32.09  ? 380  ASP B O   1 
ATOM   7279 C  CB  . ASP B 1 380 ? 12.254  -66.044 22.931  1.00 31.08  ? 380  ASP B CB  1 
ATOM   7280 C  CG  . ASP B 1 380 ? 13.103  -67.013 22.122  1.00 31.28  ? 380  ASP B CG  1 
ATOM   7281 O  OD1 . ASP B 1 380 ? 14.348  -66.900 22.149  1.00 29.19  ? 380  ASP B OD1 1 
ATOM   7282 O  OD2 . ASP B 1 380 ? 12.505  -67.888 21.456  1.00 32.96  ? 380  ASP B OD2 1 
ATOM   7283 N  N   . ASP B 1 381 ? 13.772  -62.629 22.675  1.00 26.14  ? 381  ASP B N   1 
ATOM   7284 C  CA  . ASP B 1 381 ? 13.739  -61.524 21.730  1.00 30.03  ? 381  ASP B CA  1 
ATOM   7285 C  C   . ASP B 1 381 ? 14.795  -61.627 20.643  1.00 30.30  ? 381  ASP B C   1 
ATOM   7286 O  O   . ASP B 1 381 ? 14.718  -60.866 19.674  1.00 30.53  ? 381  ASP B O   1 
ATOM   7287 C  CB  . ASP B 1 381 ? 13.914  -60.203 22.457  1.00 28.78  ? 381  ASP B CB  1 
ATOM   7288 C  CG  . ASP B 1 381 ? 15.027  -60.252 23.465  1.00 34.78  ? 381  ASP B CG  1 
ATOM   7289 O  OD1 . ASP B 1 381 ? 14.971  -61.115 24.365  1.00 32.83  ? 381  ASP B OD1 1 
ATOM   7290 O  OD2 . ASP B 1 381 ? 15.951  -59.430 23.352  1.00 35.42  ? 381  ASP B OD2 1 
ATOM   7291 N  N   . ASN B 1 382 ? 15.770  -62.519 20.779  1.00 28.05  ? 382  ASN B N   1 
ATOM   7292 C  CA  . ASN B 1 382 ? 16.794  -62.684 19.751  1.00 32.93  ? 382  ASN B CA  1 
ATOM   7293 C  C   . ASN B 1 382 ? 16.512  -63.871 18.843  1.00 31.22  ? 382  ASN B C   1 
ATOM   7294 O  O   . ASN B 1 382 ? 17.380  -64.267 18.059  1.00 36.93  ? 382  ASN B O   1 
ATOM   7295 C  CB  . ASN B 1 382 ? 18.170  -62.815 20.399  1.00 35.19  ? 382  ASN B CB  1 
ATOM   7296 C  CG  . ASN B 1 382 ? 18.649  -61.508 20.974  1.00 39.48  ? 382  ASN B CG  1 
ATOM   7297 O  OD1 . ASN B 1 382 ? 18.642  -60.480 20.296  1.00 37.94  ? 382  ASN B OD1 1 
ATOM   7298 N  ND2 . ASN B 1 382 ? 19.042  -61.528 22.243  1.00 40.14  ? 382  ASN B ND2 1 
ATOM   7299 N  N   . ASN B 1 383 ? 15.318  -64.450 18.934  1.00 28.82  ? 383  ASN B N   1 
ATOM   7300 C  CA  . ASN B 1 383 ? 14.936  -65.565 18.082  1.00 30.17  ? 383  ASN B CA  1 
ATOM   7301 C  C   . ASN B 1 383 ? 14.705  -65.024 16.675  1.00 29.63  ? 383  ASN B C   1 
ATOM   7302 O  O   . ASN B 1 383 ? 13.734  -64.303 16.433  1.00 26.63  ? 383  ASN B O   1 
ATOM   7303 C  CB  . ASN B 1 383 ? 13.689  -66.242 18.646  1.00 28.84  ? 383  ASN B CB  1 
ATOM   7304 C  CG  . ASN B 1 383 ? 13.335  -67.524 17.916  1.00 32.87  ? 383  ASN B CG  1 
ATOM   7305 O  OD1 . ASN B 1 383 ? 13.433  -67.599 16.691  1.00 32.92  ? 383  ASN B OD1 1 
ATOM   7306 N  ND2 . ASN B 1 383 ? 12.894  -68.529 18.659  1.00 31.55  ? 383  ASN B ND2 1 
ATOM   7307 N  N   . GLY B 1 384 ? 15.618  -65.330 15.752  1.00 28.92  ? 384  GLY B N   1 
ATOM   7308 C  CA  . GLY B 1 384 ? 15.518  -64.759 14.415  1.00 27.97  ? 384  GLY B CA  1 
ATOM   7309 C  C   . GLY B 1 384 ? 14.300  -65.226 13.645  1.00 27.12  ? 384  GLY B C   1 
ATOM   7310 O  O   . GLY B 1 384 ? 13.809  -64.521 12.754  1.00 25.48  ? 384  GLY B O   1 
ATOM   7311 N  N   . ILE B 1 385 ? 13.809  -66.423 13.949  1.00 23.74  ? 385  ILE B N   1 
ATOM   7312 C  CA  . ILE B 1 385 ? 12.614  -66.919 13.285  1.00 24.18  ? 385  ILE B CA  1 
ATOM   7313 C  C   . ILE B 1 385 ? 11.386  -66.186 13.811  1.00 29.51  ? 385  ILE B C   1 
ATOM   7314 O  O   . ILE B 1 385 ? 10.538  -65.724 13.038  1.00 25.56  ? 385  ILE B O   1 
ATOM   7315 C  CB  . ILE B 1 385 ? 12.512  -68.444 13.465  1.00 28.92  ? 385  ILE B CB  1 
ATOM   7316 C  CG1 . ILE B 1 385 ? 13.621  -69.128 12.654  1.00 33.21  ? 385  ILE B CG1 1 
ATOM   7317 C  CG2 . ILE B 1 385 ? 11.139  -68.961 13.055  1.00 30.22  ? 385  ILE B CG2 1 
ATOM   7318 C  CD1 . ILE B 1 385 ? 13.578  -70.635 12.726  1.00 40.13  ? 385  ILE B CD1 1 
ATOM   7319 N  N   . LYS B 1 386 ? 11.296  -66.025 15.133  1.00 25.00  ? 386  LYS B N   1 
ATOM   7320 C  CA  . LYS B 1 386 ? 10.186  -65.264 15.698  1.00 25.33  ? 386  LYS B CA  1 
ATOM   7321 C  C   . LYS B 1 386 ? 10.215  -63.815 15.230  1.00 23.33  ? 386  LYS B C   1 
ATOM   7322 O  O   . LYS B 1 386 ? 9.165   -63.219 14.959  1.00 24.09  ? 386  LYS B O   1 
ATOM   7323 C  CB  . LYS B 1 386 ? 10.228  -65.329 17.223  1.00 28.01  ? 386  LYS B CB  1 
ATOM   7324 C  CG  . LYS B 1 386 ? 9.763   -66.656 17.787  1.00 27.17  ? 386  LYS B CG  1 
ATOM   7325 C  CD  . LYS B 1 386 ? 10.061  -66.724 19.279  1.00 27.23  ? 386  LYS B CD  1 
ATOM   7326 C  CE  . LYS B 1 386 ? 9.406   -67.925 19.913  1.00 31.88  ? 386  LYS B CE  1 
ATOM   7327 N  NZ  . LYS B 1 386 ? 9.626   -67.893 21.400  1.00 34.08  ? 386  LYS B NZ  1 
ATOM   7328 N  N   . ASN B 1 387 ? 11.407  -63.229 15.132  1.00 22.41  ? 387  ASN B N   1 
ATOM   7329 C  CA  . ASN B 1 387 ? 11.499  -61.850 14.673  1.00 22.62  ? 387  ASN B CA  1 
ATOM   7330 C  C   . ASN B 1 387 ? 11.064  -61.740 13.223  1.00 23.39  ? 387  ASN B C   1 
ATOM   7331 O  O   . ASN B 1 387 ? 10.355  -60.797 12.845  1.00 23.65  ? 387  ASN B O   1 
ATOM   7332 C  CB  . ASN B 1 387 ? 12.924  -61.339 14.827  1.00 23.48  ? 387  ASN B CB  1 
ATOM   7333 C  CG  . ASN B 1 387 ? 13.290  -61.082 16.277  1.00 25.26  ? 387  ASN B CG  1 
ATOM   7334 O  OD1 . ASN B 1 387 ? 12.413  -60.934 17.125  1.00 27.96  ? 387  ASN B OD1 1 
ATOM   7335 N  ND2 . ASN B 1 387 ? 14.588  -61.022 16.562  1.00 28.86  ? 387  ASN B ND2 1 
ATOM   7336 N  N   . ARG B 1 388 ? 11.482  -62.705 12.408  1.00 23.40  ? 388  ARG B N   1 
ATOM   7337 C  CA  . ARG B 1 388 ? 11.086  -62.739 11.004  1.00 21.43  ? 388  ARG B CA  1 
ATOM   7338 C  C   . ARG B 1 388 ? 9.572   -62.836 10.870  1.00 24.28  ? 388  ARG B C   1 
ATOM   7339 O  O   . ARG B 1 388 ? 8.938   -62.037 10.169  1.00 23.19  ? 388  ARG B O   1 
ATOM   7340 C  CB  . ARG B 1 388 ? 11.757  -63.925 10.320  1.00 22.47  ? 388  ARG B CB  1 
ATOM   7341 C  CG  . ARG B 1 388 ? 11.493  -63.986 8.801   1.00 23.37  ? 388  ARG B CG  1 
ATOM   7342 C  CD  . ARG B 1 388 ? 11.768  -65.378 8.266   1.00 24.34  ? 388  ARG B CD  1 
ATOM   7343 N  NE  . ARG B 1 388 ? 10.862  -66.377 8.830   1.00 26.00  ? 388  ARG B NE  1 
ATOM   7344 C  CZ  . ARG B 1 388 ? 11.173  -67.662 8.969   1.00 27.57  ? 388  ARG B CZ  1 
ATOM   7345 N  NH1 . ARG B 1 388 ? 12.371  -68.092 8.588   1.00 26.65  ? 388  ARG B NH1 1 
ATOM   7346 N  NH2 . ARG B 1 388 ? 10.298  -68.519 9.485   1.00 27.13  ? 388  ARG B NH2 1 
ATOM   7347 N  N   . ASP B 1 389 ? 8.977   -63.836 11.527  1.00 25.25  ? 389  ASP B N   1 
ATOM   7348 C  CA  . ASP B 1 389 ? 7.540   -64.050 11.404  1.00 26.65  ? 389  ASP B CA  1 
ATOM   7349 C  C   . ASP B 1 389 ? 6.746   -62.934 12.083  1.00 28.15  ? 389  ASP B C   1 
ATOM   7350 O  O   . ASP B 1 389 ? 5.629   -62.617 11.651  1.00 23.15  ? 389  ASP B O   1 
ATOM   7351 C  CB  . ASP B 1 389 ? 7.165   -65.414 11.989  1.00 27.50  ? 389  ASP B CB  1 
ATOM   7352 C  CG  . ASP B 1 389 ? 7.748   -66.584 11.197  1.00 30.93  ? 389  ASP B CG  1 
ATOM   7353 O  OD1 . ASP B 1 389 ? 8.170   -66.404 10.022  1.00 28.69  ? 389  ASP B OD1 1 
ATOM   7354 O  OD2 . ASP B 1 389 ? 7.766   -67.704 11.758  1.00 35.16  ? 389  ASP B OD2 1 
ATOM   7355 N  N   . GLY B 1 390 ? 7.306   -62.324 13.134  1.00 24.78  ? 390  GLY B N   1 
ATOM   7356 C  CA  . GLY B 1 390 ? 6.644   -61.180 13.747  1.00 25.40  ? 390  GLY B CA  1 
ATOM   7357 C  C   . GLY B 1 390 ? 6.530   -60.009 12.789  1.00 27.72  ? 390  GLY B C   1 
ATOM   7358 O  O   . GLY B 1 390 ? 5.475   -59.381 12.672  1.00 23.24  ? 390  GLY B O   1 
ATOM   7359 N  N   . LEU B 1 391 ? 7.621   -59.707 12.080  1.00 23.84  ? 391  LEU B N   1 
ATOM   7360 C  CA  . LEU B 1 391 ? 7.576   -58.677 11.050  1.00 24.90  ? 391  LEU B CA  1 
ATOM   7361 C  C   . LEU B 1 391 ? 6.579   -59.036 9.957   1.00 21.92  ? 391  LEU B C   1 
ATOM   7362 O  O   . LEU B 1 391 ? 5.823   -58.178 9.489   1.00 23.06  ? 391  LEU B O   1 
ATOM   7363 C  CB  . LEU B 1 391 ? 8.970   -58.497 10.450  1.00 28.72  ? 391  LEU B CB  1 
ATOM   7364 C  CG  . LEU B 1 391 ? 9.503   -57.090 10.234  1.00 34.08  ? 391  LEU B CG  1 
ATOM   7365 C  CD1 . LEU B 1 391 ? 9.230   -56.275 11.446  1.00 27.78  ? 391  LEU B CD1 1 
ATOM   7366 C  CD2 . LEU B 1 391 ? 11.017  -57.145 9.969   1.00 29.26  ? 391  LEU B CD2 1 
ATOM   7367 N  N   . ASP B 1 392 ? 6.586   -60.298 9.517   1.00 23.57  ? 392  ASP B N   1 
ATOM   7368 C  CA  . ASP B 1 392 ? 5.621   -60.754 8.522   1.00 24.14  ? 392  ASP B CA  1 
ATOM   7369 C  C   . ASP B 1 392 ? 4.202   -60.445 8.977   1.00 24.24  ? 392  ASP B C   1 
ATOM   7370 O  O   . ASP B 1 392 ? 3.397   -59.879 8.231   1.00 23.47  ? 392  ASP B O   1 
ATOM   7371 C  CB  . ASP B 1 392 ? 5.806   -62.256 8.283   1.00 22.74  ? 392  ASP B CB  1 
ATOM   7372 C  CG  . ASP B 1 392 ? 5.317   -62.705 6.909   1.00 32.91  ? 392  ASP B CG  1 
ATOM   7373 O  OD1 . ASP B 1 392 ? 4.568   -61.941 6.266   1.00 29.89  ? 392  ASP B OD1 1 
ATOM   7374 O  OD2 . ASP B 1 392 ? 5.675   -63.829 6.483   1.00 30.58  ? 392  ASP B OD2 1 
ATOM   7375 N  N   . ASP B 1 393 ? 3.891   -60.778 10.228  1.00 24.44  ? 393  ASP B N   1 
ATOM   7376 C  CA  . ASP B 1 393 ? 2.565   -60.502 10.759  1.00 26.88  ? 393  ASP B CA  1 
ATOM   7377 C  C   . ASP B 1 393 ? 2.290   -59.006 10.844  1.00 26.04  ? 393  ASP B C   1 
ATOM   7378 O  O   . ASP B 1 393 ? 1.177   -58.567 10.537  1.00 22.55  ? 393  ASP B O   1 
ATOM   7379 C  CB  . ASP B 1 393 ? 2.408   -61.159 12.132  1.00 24.06  ? 393  ASP B CB  1 
ATOM   7380 C  CG  . ASP B 1 393 ? 2.313   -62.665 12.032  1.00 33.87  ? 393  ASP B CG  1 
ATOM   7381 O  OD1 . ASP B 1 393 ? 1.876   -63.155 10.968  1.00 33.96  ? 393  ASP B OD1 1 
ATOM   7382 O  OD2 . ASP B 1 393 ? 2.685   -63.365 12.991  1.00 32.09  ? 393  ASP B OD2 1 
ATOM   7383 N  N   . ILE B 1 394 ? 3.277   -58.207 11.269  1.00 22.30  ? 394  ILE B N   1 
ATOM   7384 C  CA  . ILE B 1 394 ? 3.066   -56.760 11.345  1.00 20.13  ? 394  ILE B CA  1 
ATOM   7385 C  C   . ILE B 1 394 ? 2.638   -56.217 9.989   1.00 23.71  ? 394  ILE B C   1 
ATOM   7386 O  O   . ILE B 1 394 ? 1.643   -55.483 9.867   1.00 22.28  ? 394  ILE B O   1 
ATOM   7387 C  CB  . ILE B 1 394 ? 4.334   -56.048 11.846  1.00 24.45  ? 394  ILE B CB  1 
ATOM   7388 C  CG1 . ILE B 1 394 ? 4.535   -56.286 13.349  1.00 22.42  ? 394  ILE B CG1 1 
ATOM   7389 C  CG2 . ILE B 1 394 ? 4.240   -54.547 11.577  1.00 21.56  ? 394  ILE B CG2 1 
ATOM   7390 C  CD1 . ILE B 1 394 ? 5.892   -55.781 13.861  1.00 22.02  ? 394  ILE B CD1 1 
ATOM   7391 N  N   . VAL B 1 395 ? 3.386   -56.571 8.949   1.00 20.87  ? 395  VAL B N   1 
ATOM   7392 C  CA  . VAL B 1 395 ? 3.105   -56.028 7.619   1.00 20.05  ? 395  VAL B CA  1 
ATOM   7393 C  C   . VAL B 1 395 ? 1.730   -56.468 7.136   1.00 20.07  ? 395  VAL B C   1 
ATOM   7394 O  O   . VAL B 1 395 ? 0.932   -55.650 6.664   1.00 22.49  ? 395  VAL B O   1 
ATOM   7395 C  CB  . VAL B 1 395 ? 4.206   -56.437 6.632   1.00 19.05  ? 395  VAL B CB  1 
ATOM   7396 C  CG1 . VAL B 1 395 ? 3.865   -55.929 5.248   1.00 21.08  ? 395  VAL B CG1 1 
ATOM   7397 C  CG2 . VAL B 1 395 ? 5.526   -55.837 7.075   1.00 19.30  ? 395  VAL B CG2 1 
ATOM   7398 N  N   . GLY B 1 396 ? 1.431   -57.764 7.245   1.00 20.45  ? 396  GLY B N   1 
ATOM   7399 C  CA  . GLY B 1 396 ? 0.147   -58.258 6.767   1.00 20.46  ? 396  GLY B CA  1 
ATOM   7400 C  C   . GLY B 1 396 ? -1.023  -57.758 7.596   1.00 19.10  ? 396  GLY B C   1 
ATOM   7401 O  O   . GLY B 1 396 ? -2.086  -57.434 7.055   1.00 20.76  ? 396  GLY B O   1 
ATOM   7402 N  N   . ASP B 1 397 ? -0.849  -57.682 8.927   1.00 22.62  ? 397  ASP B N   1 
ATOM   7403 C  CA  . ASP B 1 397 ? -1.954  -57.253 9.784   1.00 20.76  ? 397  ASP B CA  1 
ATOM   7404 C  C   . ASP B 1 397 ? -2.284  -55.789 9.555   1.00 19.04  ? 397  ASP B C   1 
ATOM   7405 O  O   . ASP B 1 397 ? -3.453  -55.423 9.418   1.00 21.07  ? 397  ASP B O   1 
ATOM   7406 C  CB  . ASP B 1 397 ? -1.625  -57.471 11.266  1.00 20.01  ? 397  ASP B CB  1 
ATOM   7407 C  CG  . ASP B 1 397 ? -1.563  -58.936 11.654  1.00 24.62  ? 397  ASP B CG  1 
ATOM   7408 O  OD1 . ASP B 1 397 ? -2.023  -59.800 10.887  1.00 21.30  ? 397  ASP B OD1 1 
ATOM   7409 O  OD2 . ASP B 1 397 ? -1.046  -59.221 12.752  1.00 24.17  ? 397  ASP B OD2 1 
ATOM   7410 N  N   . HIS B 1 398 ? -1.263  -54.935 9.538   1.00 17.88  ? 398  HIS B N   1 
ATOM   7411 C  CA  . HIS B 1 398 ? -1.482  -53.498 9.389   1.00 22.20  ? 398  HIS B CA  1 
ATOM   7412 C  C   . HIS B 1 398 ? -1.997  -53.140 7.999   1.00 22.80  ? 398  HIS B C   1 
ATOM   7413 O  O   . HIS B 1 398 ? -2.865  -52.271 7.858   1.00 20.87  ? 398  HIS B O   1 
ATOM   7414 C  CB  . HIS B 1 398 ? -0.182  -52.753 9.679   1.00 23.36  ? 398  HIS B CB  1 
ATOM   7415 C  CG  . HIS B 1 398 ? -0.182  -51.317 9.250   1.00 22.57  ? 398  HIS B CG  1 
ATOM   7416 N  ND1 . HIS B 1 398 ? -1.025  -50.369 9.796   1.00 26.32  ? 398  HIS B ND1 1 
ATOM   7417 C  CD2 . HIS B 1 398 ? 0.579   -50.662 8.341   1.00 25.60  ? 398  HIS B CD2 1 
ATOM   7418 C  CE1 . HIS B 1 398 ? -0.797  -49.198 9.226   1.00 23.76  ? 398  HIS B CE1 1 
ATOM   7419 N  NE2 . HIS B 1 398 ? 0.179   -49.346 8.348   1.00 28.11  ? 398  HIS B NE2 1 
ATOM   7420 N  N   . ASN B 1 399 ? -1.461  -53.771 6.956   1.00 22.46  ? 399  ASN B N   1 
ATOM   7421 C  CA  . ASN B 1 399 ? -1.786  -53.312 5.607   1.00 20.91  ? 399  ASN B CA  1 
ATOM   7422 C  C   . ASN B 1 399 ? -2.953  -54.047 4.969   1.00 21.91  ? 399  ASN B C   1 
ATOM   7423 O  O   . ASN B 1 399 ? -3.622  -53.478 4.096   1.00 22.69  ? 399  ASN B O   1 
ATOM   7424 C  CB  . ASN B 1 399 ? -0.558  -53.423 4.692   1.00 23.90  ? 399  ASN B CB  1 
ATOM   7425 C  CG  . ASN B 1 399 ? 0.502   -52.391 5.027   1.00 22.62  ? 399  ASN B CG  1 
ATOM   7426 O  OD1 . ASN B 1 399 ? 0.326   -51.203 4.768   1.00 26.90  ? 399  ASN B OD1 1 
ATOM   7427 N  ND2 . ASN B 1 399 ? 1.607   -52.839 5.601   1.00 21.20  ? 399  ASN B ND2 1 
ATOM   7428 N  N   . VAL B 1 400 ? -3.214  -55.293 5.354   1.00 22.25  ? 400  VAL B N   1 
ATOM   7429 C  CA  . VAL B 1 400 ? -4.252  -56.057 4.670   1.00 21.23  ? 400  VAL B CA  1 
ATOM   7430 C  C   . VAL B 1 400 ? -5.314  -56.566 5.641   1.00 23.27  ? 400  VAL B C   1 
ATOM   7431 O  O   . VAL B 1 400 ? -6.499  -56.225 5.517   1.00 20.26  ? 400  VAL B O   1 
ATOM   7432 C  CB  . VAL B 1 400 ? -3.635  -57.225 3.872   1.00 21.47  ? 400  VAL B CB  1 
ATOM   7433 C  CG1 . VAL B 1 400 ? -4.724  -58.052 3.230   1.00 24.52  ? 400  VAL B CG1 1 
ATOM   7434 C  CG2 . VAL B 1 400 ? -2.663  -56.701 2.810   1.00 21.66  ? 400  VAL B CG2 1 
ATOM   7435 N  N   . ILE B 1 401 ? -4.907  -57.396 6.605   1.00 22.09  ? 401  ILE B N   1 
ATOM   7436 C  CA  . ILE B 1 401 ? -5.886  -58.181 7.352   1.00 22.61  ? 401  ILE B CA  1 
ATOM   7437 C  C   . ILE B 1 401 ? -6.756  -57.281 8.217   1.00 21.11  ? 401  ILE B C   1 
ATOM   7438 O  O   . ILE B 1 401 ? -7.987  -57.367 8.173   1.00 22.70  ? 401  ILE B O   1 
ATOM   7439 C  CB  . ILE B 1 401 ? -5.196  -59.268 8.195   1.00 24.98  ? 401  ILE B CB  1 
ATOM   7440 C  CG1 . ILE B 1 401 ? -4.459  -60.254 7.279   1.00 23.17  ? 401  ILE B CG1 1 
ATOM   7441 C  CG2 . ILE B 1 401 ? -6.252  -59.988 9.063   1.00 23.48  ? 401  ILE B CG2 1 
ATOM   7442 C  CD1 . ILE B 1 401 ? -4.031  -61.553 7.974   1.00 25.03  ? 401  ILE B CD1 1 
ATOM   7443 N  N   . CYS B 1 402 ? -6.143  -56.407 9.019   1.00 23.37  ? 402  CYS B N   1 
ATOM   7444 C  CA  . CYS B 1 402 ? -6.974  -55.638 9.944   1.00 22.80  ? 402  CYS B CA  1 
ATOM   7445 C  C   . CYS B 1 402 ? -7.761  -54.524 9.248   1.00 23.37  ? 402  CYS B C   1 
ATOM   7446 O  O   . CYS B 1 402 ? -8.888  -54.242 9.667   1.00 21.14  ? 402  CYS B O   1 
ATOM   7447 C  CB  . CYS B 1 402 ? -6.125  -55.085 11.090  1.00 24.98  ? 402  CYS B CB  1 
ATOM   7448 S  SG  . CYS B 1 402 ? -5.419  -56.452 12.066  1.00 22.83  ? 402  CYS B SG  1 
ATOM   7449 N  N   . PRO B 1 403 ? -7.233  -53.856 8.206   1.00 23.54  ? 403  PRO B N   1 
ATOM   7450 C  CA  . PRO B 1 403 ? -8.119  -52.973 7.430   1.00 22.51  ? 403  PRO B CA  1 
ATOM   7451 C  C   . PRO B 1 403 ? -9.309  -53.714 6.866   1.00 23.57  ? 403  PRO B C   1 
ATOM   7452 O  O   . PRO B 1 403 ? -10.430 -53.188 6.886   1.00 25.14  ? 403  PRO B O   1 
ATOM   7453 C  CB  . PRO B 1 403 ? -7.202  -52.434 6.321   1.00 22.30  ? 403  PRO B CB  1 
ATOM   7454 C  CG  . PRO B 1 403 ? -5.848  -52.457 6.931   1.00 22.76  ? 403  PRO B CG  1 
ATOM   7455 C  CD  . PRO B 1 403 ? -5.819  -53.693 7.799   1.00 21.67  ? 403  PRO B CD  1 
ATOM   7456 N  N   . LEU B 1 404 ? -9.094  -54.938 6.371   1.00 21.47  ? 404  LEU B N   1 
ATOM   7457 C  CA  . LEU B 1 404 ? -10.197 -55.696 5.794   1.00 22.57  ? 404  LEU B CA  1 
ATOM   7458 C  C   . LEU B 1 404 ? -11.175 -56.141 6.873   1.00 25.60  ? 404  LEU B C   1 
ATOM   7459 O  O   . LEU B 1 404 ? -12.388 -56.177 6.640   1.00 21.14  ? 404  LEU B O   1 
ATOM   7460 C  CB  . LEU B 1 404 ? -9.671  -56.903 5.009   1.00 23.17  ? 404  LEU B CB  1 
ATOM   7461 C  CG  . LEU B 1 404 ? -10.757 -57.752 4.319   1.00 23.74  ? 404  LEU B CG  1 
ATOM   7462 C  CD1 . LEU B 1 404 ? -10.368 -58.197 2.897   1.00 25.32  ? 404  LEU B CD1 1 
ATOM   7463 C  CD2 . LEU B 1 404 ? -11.106 -58.971 5.187   1.00 22.07  ? 404  LEU B CD2 1 
ATOM   7464 N  N   . MET B 1 405 ? -10.678 -56.463 8.071   1.00 21.65  ? 405  MET B N   1 
ATOM   7465 C  CA  . MET B 1 405 ? -11.601 -56.855 9.135   1.00 23.12  ? 405  MET B CA  1 
ATOM   7466 C  C   . MET B 1 405 ? -12.420 -55.667 9.618   1.00 25.56  ? 405  MET B C   1 
ATOM   7467 O  O   . MET B 1 405 ? -13.578 -55.834 10.030  1.00 22.67  ? 405  MET B O   1 
ATOM   7468 C  CB  . MET B 1 405 ? -10.841 -57.493 10.307  1.00 22.22  ? 405  MET B CB  1 
ATOM   7469 C  CG  . MET B 1 405 ? -10.238 -58.851 9.987   1.00 23.78  ? 405  MET B CG  1 
ATOM   7470 S  SD  . MET B 1 405 ? -11.419 -59.971 9.206   1.00 23.81  ? 405  MET B SD  1 
ATOM   7471 C  CE  . MET B 1 405 ? -12.740 -59.968 10.431  1.00 21.79  ? 405  MET B CE  1 
ATOM   7472 N  N   . HIS B 1 406 ? -11.844 -54.466 9.574   1.00 23.15  ? 406  HIS B N   1 
ATOM   7473 C  CA  . HIS B 1 406 ? -12.615 -53.270 9.883   1.00 25.30  ? 406  HIS B CA  1 
ATOM   7474 C  C   . HIS B 1 406 ? -13.722 -53.073 8.857   1.00 26.79  ? 406  HIS B C   1 
ATOM   7475 O  O   . HIS B 1 406 ? -14.883 -52.829 9.207   1.00 23.66  ? 406  HIS B O   1 
ATOM   7476 C  CB  . HIS B 1 406 ? -11.695 -52.056 9.916   1.00 25.48  ? 406  HIS B CB  1 
ATOM   7477 C  CG  . HIS B 1 406 ? -12.391 -50.778 10.266  1.00 28.12  ? 406  HIS B CG  1 
ATOM   7478 N  ND1 . HIS B 1 406 ? -12.870 -50.508 11.532  1.00 32.39  ? 406  HIS B ND1 1 
ATOM   7479 C  CD2 . HIS B 1 406 ? -12.674 -49.686 9.516   1.00 26.91  ? 406  HIS B CD2 1 
ATOM   7480 C  CE1 . HIS B 1 406 ? -13.420 -49.306 11.543  1.00 32.97  ? 406  HIS B CE1 1 
ATOM   7481 N  NE2 . HIS B 1 406 ? -13.308 -48.784 10.333  1.00 27.88  ? 406  HIS B NE2 1 
ATOM   7482 N  N   . PHE B 1 407 ? -13.367 -53.174 7.574   1.00 23.00  ? 407  PHE B N   1 
ATOM   7483 C  CA  . PHE B 1 407 ? -14.359 -53.073 6.508   1.00 21.79  ? 407  PHE B CA  1 
ATOM   7484 C  C   . PHE B 1 407 ? -15.436 -54.140 6.659   1.00 22.16  ? 407  PHE B C   1 
ATOM   7485 O  O   . PHE B 1 407 ? -16.634 -53.856 6.543   1.00 22.79  ? 407  PHE B O   1 
ATOM   7486 C  CB  . PHE B 1 407 ? -13.659 -53.191 5.148   1.00 20.07  ? 407  PHE B CB  1 
ATOM   7487 C  CG  . PHE B 1 407 ? -14.620 -53.167 3.966   1.00 22.56  ? 407  PHE B CG  1 
ATOM   7488 C  CD1 . PHE B 1 407 ? -15.137 -51.973 3.505   1.00 25.37  ? 407  PHE B CD1 1 
ATOM   7489 C  CD2 . PHE B 1 407 ? -14.998 -54.341 3.336   1.00 19.40  ? 407  PHE B CD2 1 
ATOM   7490 C  CE1 . PHE B 1 407 ? -16.025 -51.947 2.423   1.00 22.57  ? 407  PHE B CE1 1 
ATOM   7491 C  CE2 . PHE B 1 407 ? -15.893 -54.328 2.259   1.00 22.35  ? 407  PHE B CE2 1 
ATOM   7492 C  CZ  . PHE B 1 407 ? -16.406 -53.128 1.810   1.00 25.73  ? 407  PHE B CZ  1 
ATOM   7493 N  N   . VAL B 1 408 ? -15.023 -55.383 6.906   1.00 22.46  ? 408  VAL B N   1 
ATOM   7494 C  CA  . VAL B 1 408 ? -15.967 -56.492 7.045   1.00 21.88  ? 408  VAL B CA  1 
ATOM   7495 C  C   . VAL B 1 408 ? -16.986 -56.191 8.143   1.00 26.07  ? 408  VAL B C   1 
ATOM   7496 O  O   . VAL B 1 408 ? -18.203 -56.364 7.972   1.00 22.41  ? 408  VAL B O   1 
ATOM   7497 C  CB  . VAL B 1 408 ? -15.192 -57.790 7.347   1.00 28.08  ? 408  VAL B CB  1 
ATOM   7498 C  CG1 . VAL B 1 408 ? -16.036 -58.758 8.137   1.00 35.58  ? 408  VAL B CG1 1 
ATOM   7499 C  CG2 . VAL B 1 408 ? -14.732 -58.439 6.088   1.00 31.10  ? 408  VAL B CG2 1 
ATOM   7500 N  N   . ASN B 1 409 ? -16.496 -55.730 9.289   1.00 26.55  ? 409  ASN B N   1 
ATOM   7501 C  CA  A ASN B 1 409 ? -17.396 -55.493 10.406  0.73 26.72  ? 409  ASN B CA  1 
ATOM   7502 C  CA  B ASN B 1 409 ? -17.363 -55.457 10.434  0.27 26.75  ? 409  ASN B CA  1 
ATOM   7503 C  C   . ASN B 1 409 ? -18.318 -54.308 10.135  1.00 27.89  ? 409  ASN B C   1 
ATOM   7504 O  O   . ASN B 1 409 ? -19.525 -54.396 10.392  1.00 29.73  ? 409  ASN B O   1 
ATOM   7505 C  CB  A ASN B 1 409 ? -16.578 -55.326 11.681  0.73 28.67  ? 409  ASN B CB  1 
ATOM   7506 C  CB  B ASN B 1 409 ? -16.497 -55.156 11.664  0.27 28.58  ? 409  ASN B CB  1 
ATOM   7507 C  CG  A ASN B 1 409 ? -16.161 -56.671 12.262  0.73 27.38  ? 409  ASN B CG  1 
ATOM   7508 C  CG  B ASN B 1 409 ? -17.064 -54.045 12.541  0.27 31.03  ? 409  ASN B CG  1 
ATOM   7509 O  OD1 A ASN B 1 409 ? -15.005 -57.074 12.163  0.73 32.15  ? 409  ASN B OD1 1 
ATOM   7510 O  OD1 B ASN B 1 409 ? -18.108 -54.199 13.174  0.27 28.43  ? 409  ASN B OD1 1 
ATOM   7511 N  ND2 A ASN B 1 409 ? -17.116 -57.381 12.849  0.73 28.28  ? 409  ASN B ND2 1 
ATOM   7512 N  ND2 B ASN B 1 409 ? -16.365 -52.916 12.580  0.27 31.24  ? 409  ASN B ND2 1 
ATOM   7513 N  N   . LYS B 1 410 ? -17.794 -53.216 9.571   1.00 25.67  ? 410  LYS B N   1 
ATOM   7514 C  CA  . LYS B 1 410 ? -18.659 -52.087 9.248   1.00 26.94  ? 410  LYS B CA  1 
ATOM   7515 C  C   . LYS B 1 410 ? -19.665 -52.458 8.167   1.00 27.45  ? 410  LYS B C   1 
ATOM   7516 O  O   . LYS B 1 410 ? -20.858 -52.146 8.291   1.00 26.57  ? 410  LYS B O   1 
ATOM   7517 C  CB  . LYS B 1 410 ? -17.834 -50.880 8.809   1.00 27.25  ? 410  LYS B CB  1 
ATOM   7518 C  CG  . LYS B 1 410 ? -16.934 -50.314 9.893   1.00 31.67  ? 410  LYS B CG  1 
ATOM   7519 C  CD  . LYS B 1 410 ? -17.736 -49.566 10.964  1.00 29.32  ? 410  LYS B CD  1 
ATOM   7520 C  CE  . LYS B 1 410 ? -16.801 -48.891 11.941  1.00 35.93  ? 410  LYS B CE  1 
ATOM   7521 N  NZ  . LYS B 1 410 ? -17.535 -48.181 13.026  1.00 35.05  ? 410  LYS B NZ  1 
ATOM   7522 N  N   . TYR B 1 411 ? -19.208 -53.142 7.111   1.00 22.24  ? 411  TYR B N   1 
ATOM   7523 C  CA  . TYR B 1 411 ? -20.099 -53.462 5.996   1.00 21.97  ? 411  TYR B CA  1 
ATOM   7524 C  C   . TYR B 1 411 ? -21.260 -54.335 6.452   1.00 27.18  ? 411  TYR B C   1 
ATOM   7525 O  O   . TYR B 1 411 ? -22.421 -54.073 6.108   1.00 25.49  ? 411  TYR B O   1 
ATOM   7526 C  CB  . TYR B 1 411 ? -19.336 -54.158 4.866   1.00 22.50  ? 411  TYR B CB  1 
ATOM   7527 C  CG  . TYR B 1 411 ? -20.206 -54.255 3.629   1.00 21.25  ? 411  TYR B CG  1 
ATOM   7528 C  CD1 . TYR B 1 411 ? -20.279 -53.199 2.737   1.00 21.55  ? 411  TYR B CD1 1 
ATOM   7529 C  CD2 . TYR B 1 411 ? -21.005 -55.368 3.403   1.00 19.55  ? 411  TYR B CD2 1 
ATOM   7530 C  CE1 . TYR B 1 411 ? -21.118 -53.259 1.626   1.00 21.18  ? 411  TYR B CE1 1 
ATOM   7531 C  CE2 . TYR B 1 411 ? -21.840 -55.438 2.305   1.00 25.37  ? 411  TYR B CE2 1 
ATOM   7532 C  CZ  . TYR B 1 411 ? -21.884 -54.382 1.414   1.00 22.95  ? 411  TYR B CZ  1 
ATOM   7533 O  OH  . TYR B 1 411 ? -22.721 -54.458 0.319   1.00 26.89  ? 411  TYR B OH  1 
ATOM   7534 N  N   . THR B 1 412 ? -20.964 -55.362 7.249   1.00 24.25  ? 412  THR B N   1 
ATOM   7535 C  CA  . THR B 1 412 ? -21.955 -56.366 7.602   1.00 24.97  ? 412  THR B CA  1 
ATOM   7536 C  C   . THR B 1 412 ? -23.118 -55.771 8.394   1.00 24.95  ? 412  THR B C   1 
ATOM   7537 O  O   . THR B 1 412 ? -24.214 -56.339 8.382   1.00 27.73  ? 412  THR B O   1 
ATOM   7538 C  CB  . THR B 1 412 ? -21.233 -57.490 8.360   1.00 26.17  ? 412  THR B CB  1 
ATOM   7539 O  OG1 . THR B 1 412 ? -20.309 -58.140 7.467   1.00 23.41  ? 412  THR B OG1 1 
ATOM   7540 C  CG2 . THR B 1 412 ? -22.200 -58.531 8.920   1.00 26.40  ? 412  THR B CG2 1 
ATOM   7541 N  N   . LYS B 1 413 ? -22.923 -54.611 9.025   1.00 25.55  ? 413  LYS B N   1 
ATOM   7542 C  CA  . LYS B 1 413 ? -24.005 -53.968 9.768   1.00 29.44  ? 413  LYS B CA  1 
ATOM   7543 C  C   . LYS B 1 413 ? -25.142 -53.540 8.845   1.00 32.50  ? 413  LYS B C   1 
ATOM   7544 O  O   . LYS B 1 413 ? -26.295 -53.446 9.282   1.00 30.03  ? 413  LYS B O   1 
ATOM   7545 C  CB  . LYS B 1 413 ? -23.459 -52.762 10.543  1.00 28.94  ? 413  LYS B CB  1 
ATOM   7546 C  CG  . LYS B 1 413 ? -24.533 -51.880 11.168  1.00 40.39  ? 413  LYS B CG  1 
ATOM   7547 C  CD  . LYS B 1 413 ? -23.988 -50.933 12.234  1.00 49.27  ? 413  LYS B CD  1 
ATOM   7548 C  CE  . LYS B 1 413 ? -25.057 -49.926 12.651  1.00 47.11  ? 413  LYS B CE  1 
ATOM   7549 N  NZ  . LYS B 1 413 ? -26.282 -50.615 13.155  1.00 55.15  ? 413  LYS B NZ  1 
ATOM   7550 N  N   . PHE B 1 414 ? -24.841 -53.296 7.569   1.00 27.79  ? 414  PHE B N   1 
ATOM   7551 C  CA  . PHE B 1 414 ? -25.819 -52.808 6.607   1.00 30.23  ? 414  PHE B CA  1 
ATOM   7552 C  C   . PHE B 1 414 ? -26.009 -53.716 5.404   1.00 31.54  ? 414  PHE B C   1 
ATOM   7553 O  O   . PHE B 1 414 ? -27.072 -53.655 4.773   1.00 27.81  ? 414  PHE B O   1 
ATOM   7554 C  CB  . PHE B 1 414 ? -25.421 -51.415 6.090   1.00 30.30  ? 414  PHE B CB  1 
ATOM   7555 C  CG  . PHE B 1 414 ? -25.501 -50.330 7.125   1.00 34.69  ? 414  PHE B CG  1 
ATOM   7556 C  CD1 . PHE B 1 414 ? -26.709 -49.702 7.402   1.00 37.03  ? 414  PHE B CD1 1 
ATOM   7557 C  CD2 . PHE B 1 414 ? -24.365 -49.932 7.825   1.00 32.68  ? 414  PHE B CD2 1 
ATOM   7558 C  CE1 . PHE B 1 414 ? -26.778 -48.699 8.344   1.00 37.61  ? 414  PHE B CE1 1 
ATOM   7559 C  CE2 . PHE B 1 414 ? -24.428 -48.931 8.763   1.00 32.71  ? 414  PHE B CE2 1 
ATOM   7560 C  CZ  . PHE B 1 414 ? -25.637 -48.313 9.031   1.00 36.33  ? 414  PHE B CZ  1 
ATOM   7561 N  N   . GLY B 1 415 ? -25.027 -54.550 5.074   1.00 27.56  ? 415  GLY B N   1 
ATOM   7562 C  CA  . GLY B 1 415 ? -25.068 -55.353 3.872   1.00 25.33  ? 415  GLY B CA  1 
ATOM   7563 C  C   . GLY B 1 415 ? -26.115 -56.449 3.917   1.00 30.34  ? 415  GLY B C   1 
ATOM   7564 O  O   . GLY B 1 415 ? -26.866 -56.616 4.882   1.00 29.33  ? 415  GLY B O   1 
ATOM   7565 N  N   . ASN B 1 416 ? -26.151 -57.225 2.832   1.00 25.00  ? 416  ASN B N   1 
ATOM   7566 C  CA  . ASN B 1 416 ? -27.137 -58.285 2.638   1.00 26.57  ? 416  ASN B CA  1 
ATOM   7567 C  C   . ASN B 1 416 ? -26.505 -59.676 2.622   1.00 29.16  ? 416  ASN B C   1 
ATOM   7568 O  O   . ASN B 1 416 ? -27.111 -60.631 2.124   1.00 28.64  ? 416  ASN B O   1 
ATOM   7569 C  CB  . ASN B 1 416 ? -27.923 -58.035 1.345   1.00 28.97  ? 416  ASN B CB  1 
ATOM   7570 C  CG  . ASN B 1 416 ? -29.152 -58.927 1.221   1.00 30.37  ? 416  ASN B CG  1 
ATOM   7571 O  OD1 . ASN B 1 416 ? -29.336 -59.598 0.200   1.00 28.92  ? 416  ASN B OD1 1 
ATOM   7572 N  ND2 . ASN B 1 416 ? -29.977 -58.968 2.272   1.00 31.27  ? 416  ASN B ND2 1 
ATOM   7573 N  N   . GLY B 1 417 ? -25.297 -59.821 3.162   1.00 25.44  ? 417  GLY B N   1 
ATOM   7574 C  CA  . GLY B 1 417 ? -24.698 -61.139 3.213   1.00 24.54  ? 417  GLY B CA  1 
ATOM   7575 C  C   . GLY B 1 417 ? -23.195 -61.083 3.038   1.00 24.81  ? 417  GLY B C   1 
ATOM   7576 O  O   . GLY B 1 417 ? -22.719 -60.636 1.997   1.00 22.77  ? 417  GLY B O   1 
ATOM   7577 N  N   . THR B 1 418 ? -22.440 -61.516 4.045   1.00 24.40  ? 418  THR B N   1 
ATOM   7578 C  CA  . THR B 1 418 ? -20.979 -61.468 4.021   1.00 24.05  ? 418  THR B CA  1 
ATOM   7579 C  C   . THR B 1 418 ? -20.409 -62.871 4.180   1.00 22.51  ? 418  THR B C   1 
ATOM   7580 O  O   . THR B 1 418 ? -20.826 -63.622 5.072   1.00 23.89  ? 418  THR B O   1 
ATOM   7581 C  CB  . THR B 1 418 ? -20.437 -60.572 5.139   1.00 23.36  ? 418  THR B CB  1 
ATOM   7582 O  OG1 . THR B 1 418 ? -20.921 -59.235 4.975   1.00 24.06  ? 418  THR B OG1 1 
ATOM   7583 C  CG2 . THR B 1 418 ? -18.888 -60.562 5.155   1.00 22.05  ? 418  THR B CG2 1 
ATOM   7584 N  N   . TYR B 1 419 ? -19.438 -63.212 3.334   1.00 23.15  ? 419  TYR B N   1 
ATOM   7585 C  CA  . TYR B 1 419 ? -18.719 -64.476 3.419   1.00 22.22  ? 419  TYR B CA  1 
ATOM   7586 C  C   . TYR B 1 419 ? -17.226 -64.180 3.468   1.00 24.04  ? 419  TYR B C   1 
ATOM   7587 O  O   . TYR B 1 419 ? -16.695 -63.514 2.577   1.00 23.47  ? 419  TYR B O   1 
ATOM   7588 C  CB  . TYR B 1 419 ? -19.058 -65.378 2.233   1.00 23.26  ? 419  TYR B CB  1 
ATOM   7589 C  CG  . TYR B 1 419 ? -20.529 -65.752 2.204   1.00 23.25  ? 419  TYR B CG  1 
ATOM   7590 C  CD1 . TYR B 1 419 ? -20.997 -66.849 2.917   1.00 24.22  ? 419  TYR B CD1 1 
ATOM   7591 C  CD2 . TYR B 1 419 ? -21.442 -65.000 1.473   1.00 21.97  ? 419  TYR B CD2 1 
ATOM   7592 C  CE1 . TYR B 1 419 ? -22.344 -67.190 2.903   1.00 24.89  ? 419  TYR B CE1 1 
ATOM   7593 C  CE2 . TYR B 1 419 ? -22.794 -65.331 1.455   1.00 24.31  ? 419  TYR B CE2 1 
ATOM   7594 C  CZ  . TYR B 1 419 ? -23.234 -66.428 2.167   1.00 25.76  ? 419  TYR B CZ  1 
ATOM   7595 O  OH  . TYR B 1 419 ? -24.575 -66.756 2.156   1.00 24.67  ? 419  TYR B OH  1 
ATOM   7596 N  N   . LEU B 1 420 ? -16.554 -64.689 4.498   1.00 22.62  ? 420  LEU B N   1 
ATOM   7597 C  CA  . LEU B 1 420 ? -15.176 -64.331 4.816   1.00 19.18  ? 420  LEU B CA  1 
ATOM   7598 C  C   . LEU B 1 420 ? -14.310 -65.587 4.803   1.00 22.92  ? 420  LEU B C   1 
ATOM   7599 O  O   . LEU B 1 420 ? -14.709 -66.619 5.359   1.00 22.24  ? 420  LEU B O   1 
ATOM   7600 C  CB  . LEU B 1 420 ? -15.116 -63.647 6.204   1.00 22.04  ? 420  LEU B CB  1 
ATOM   7601 C  CG  . LEU B 1 420 ? -13.741 -63.208 6.739   1.00 20.12  ? 420  LEU B CG  1 
ATOM   7602 C  CD1 . LEU B 1 420 ? -13.098 -62.159 5.818   1.00 19.51  ? 420  LEU B CD1 1 
ATOM   7603 C  CD2 . LEU B 1 420 ? -13.820 -62.696 8.188   1.00 21.91  ? 420  LEU B CD2 1 
ATOM   7604 N  N   . TYR B 1 421 ? -13.126 -65.505 4.179   1.00 22.18  ? 421  TYR B N   1 
ATOM   7605 C  CA  . TYR B 1 421 ? -12.229 -66.650 4.078   1.00 21.72  ? 421  TYR B CA  1 
ATOM   7606 C  C   . TYR B 1 421 ? -10.829 -66.273 4.548   1.00 21.68  ? 421  TYR B C   1 
ATOM   7607 O  O   . TYR B 1 421 ? -10.442 -65.099 4.573   1.00 21.79  ? 421  TYR B O   1 
ATOM   7608 C  CB  . TYR B 1 421 ? -12.143 -67.214 2.635   1.00 22.53  ? 421  TYR B CB  1 
ATOM   7609 C  CG  . TYR B 1 421 ? -11.422 -66.311 1.654   1.00 20.05  ? 421  TYR B CG  1 
ATOM   7610 C  CD1 . TYR B 1 421 ? -10.028 -66.272 1.589   1.00 22.63  ? 421  TYR B CD1 1 
ATOM   7611 C  CD2 . TYR B 1 421 ? -12.136 -65.501 0.784   1.00 23.08  ? 421  TYR B CD2 1 
ATOM   7612 C  CE1 . TYR B 1 421 ? -9.368  -65.433 0.682   1.00 22.30  ? 421  TYR B CE1 1 
ATOM   7613 C  CE2 . TYR B 1 421 ? -11.487 -64.665 -0.124  1.00 23.16  ? 421  TYR B CE2 1 
ATOM   7614 C  CZ  . TYR B 1 421 ? -10.106 -64.633 -0.165  1.00 22.47  ? 421  TYR B CZ  1 
ATOM   7615 O  OH  . TYR B 1 421 ? -9.468  -63.795 -1.062  1.00 20.03  ? 421  TYR B OH  1 
ATOM   7616 N  N   . PHE B 1 422 ? -10.068 -67.307 4.900   1.00 23.51  ? 422  PHE B N   1 
ATOM   7617 C  CA  . PHE B 1 422 ? -8.660  -67.205 5.284   1.00 23.16  ? 422  PHE B CA  1 
ATOM   7618 C  C   . PHE B 1 422 ? -7.925  -68.239 4.437   1.00 21.41  ? 422  PHE B C   1 
ATOM   7619 O  O   . PHE B 1 422 ? -8.010  -69.437 4.713   1.00 25.15  ? 422  PHE B O   1 
ATOM   7620 C  CB  . PHE B 1 422 ? -8.483  -67.470 6.785   1.00 19.15  ? 422  PHE B CB  1 
ATOM   7621 C  CG  . PHE B 1 422 ? -7.077  -67.266 7.294   1.00 21.26  ? 422  PHE B CG  1 
ATOM   7622 C  CD1 . PHE B 1 422 ? -6.532  -65.994 7.396   1.00 22.93  ? 422  PHE B CD1 1 
ATOM   7623 C  CD2 . PHE B 1 422 ? -6.315  -68.348 7.700   1.00 24.98  ? 422  PHE B CD2 1 
ATOM   7624 C  CE1 . PHE B 1 422 ? -5.228  -65.808 7.878   1.00 25.66  ? 422  PHE B CE1 1 
ATOM   7625 C  CE2 . PHE B 1 422 ? -5.014  -68.169 8.199   1.00 26.39  ? 422  PHE B CE2 1 
ATOM   7626 C  CZ  . PHE B 1 422 ? -4.477  -66.897 8.284   1.00 25.44  ? 422  PHE B CZ  1 
ATOM   7627 N  N   . PHE B 1 423 ? -7.230  -67.796 3.386   1.00 21.71  ? 423  PHE B N   1 
ATOM   7628 C  CA  . PHE B 1 423 ? -6.534  -68.713 2.485   1.00 24.02  ? 423  PHE B CA  1 
ATOM   7629 C  C   . PHE B 1 423 ? -5.150  -68.989 3.065   1.00 21.93  ? 423  PHE B C   1 
ATOM   7630 O  O   . PHE B 1 423 ? -4.354  -68.062 3.240   1.00 22.06  ? 423  PHE B O   1 
ATOM   7631 C  CB  . PHE B 1 423 ? -6.442  -68.119 1.075   1.00 23.79  ? 423  PHE B CB  1 
ATOM   7632 C  CG  . PHE B 1 423 ? -5.729  -68.999 0.076   1.00 24.31  ? 423  PHE B CG  1 
ATOM   7633 C  CD1 . PHE B 1 423 ? -6.426  -69.942 -0.670  1.00 24.95  ? 423  PHE B CD1 1 
ATOM   7634 C  CD2 . PHE B 1 423 ? -4.360  -68.870 -0.125  1.00 24.95  ? 423  PHE B CD2 1 
ATOM   7635 C  CE1 . PHE B 1 423 ? -5.765  -70.750 -1.605  1.00 22.82  ? 423  PHE B CE1 1 
ATOM   7636 C  CE2 . PHE B 1 423 ? -3.690  -69.671 -1.052  1.00 24.03  ? 423  PHE B CE2 1 
ATOM   7637 C  CZ  . PHE B 1 423 ? -4.397  -70.615 -1.789  1.00 24.74  ? 423  PHE B CZ  1 
ATOM   7638 N  N   . ASN B 1 424 ? -4.873  -70.250 3.408   1.00 24.69  ? 424  ASN B N   1 
ATOM   7639 C  CA  . ASN B 1 424 ? -3.596  -70.554 4.049   1.00 24.30  ? 424  ASN B CA  1 
ATOM   7640 C  C   . ASN B 1 424 ? -2.969  -71.820 3.478   1.00 24.28  ? 424  ASN B C   1 
ATOM   7641 O  O   . ASN B 1 424 ? -2.274  -72.559 4.183   1.00 26.91  ? 424  ASN B O   1 
ATOM   7642 C  CB  . ASN B 1 424 ? -3.744  -70.652 5.576   1.00 25.43  ? 424  ASN B CB  1 
ATOM   7643 C  CG  . ASN B 1 424 ? -4.658  -71.780 6.022   1.00 25.94  ? 424  ASN B CG  1 
ATOM   7644 O  OD1 . ASN B 1 424 ? -5.385  -72.374 5.232   1.00 25.25  ? 424  ASN B OD1 1 
ATOM   7645 N  ND2 . ASN B 1 424 ? -4.638  -72.065 7.331   1.00 29.26  ? 424  ASN B ND2 1 
ATOM   7646 N  N   . HIS B 1 425 ? -3.142  -72.063 2.182   1.00 24.88  ? 425  HIS B N   1 
ATOM   7647 C  CA  . HIS B 1 425 ? -2.488  -73.188 1.531   1.00 25.82  ? 425  HIS B CA  1 
ATOM   7648 C  C   . HIS B 1 425 ? -1.249  -72.711 0.780   1.00 30.87  ? 425  HIS B C   1 
ATOM   7649 O  O   . HIS B 1 425 ? -1.340  -71.833 -0.086  1.00 27.50  ? 425  HIS B O   1 
ATOM   7650 C  CB  . HIS B 1 425 ? -3.423  -73.906 0.566   1.00 27.86  ? 425  HIS B CB  1 
ATOM   7651 C  CG  . HIS B 1 425 ? -2.747  -75.000 -0.191  1.00 26.92  ? 425  HIS B CG  1 
ATOM   7652 N  ND1 . HIS B 1 425 ? -2.472  -76.228 0.371   1.00 32.09  ? 425  HIS B ND1 1 
ATOM   7653 C  CD2 . HIS B 1 425 ? -2.255  -75.044 -1.452  1.00 27.45  ? 425  HIS B CD2 1 
ATOM   7654 C  CE1 . HIS B 1 425 ? -1.851  -76.986 -0.516  1.00 33.22  ? 425  HIS B CE1 1 
ATOM   7655 N  NE2 . HIS B 1 425 ? -1.705  -76.290 -1.629  1.00 31.22  ? 425  HIS B NE2 1 
ATOM   7656 N  N   . ARG B 1 426 ? -0.101  -73.308 1.089   1.00 26.86  ? 426  ARG B N   1 
ATOM   7657 C  CA  . ARG B 1 426 ? 1.125   -73.039 0.347   1.00 25.21  ? 426  ARG B CA  1 
ATOM   7658 C  C   . ARG B 1 426 ? 1.216   -74.005 -0.834  1.00 27.84  ? 426  ARG B C   1 
ATOM   7659 O  O   . ARG B 1 426 ? 1.183   -75.226 -0.642  1.00 29.43  ? 426  ARG B O   1 
ATOM   7660 C  CB  . ARG B 1 426 ? 2.360   -73.174 1.233   1.00 29.11  ? 426  ARG B CB  1 
ATOM   7661 C  CG  . ARG B 1 426 ? 3.631   -72.918 0.434   1.00 31.50  ? 426  ARG B CG  1 
ATOM   7662 C  CD  . ARG B 1 426 ? 4.859   -72.963 1.272   1.00 38.00  ? 426  ARG B CD  1 
ATOM   7663 N  NE  . ARG B 1 426 ? 6.065   -72.990 0.453   1.00 34.14  ? 426  ARG B NE  1 
ATOM   7664 C  CZ  . ARG B 1 426 ? 6.819   -71.927 0.195   1.00 33.36  ? 426  ARG B CZ  1 
ATOM   7665 N  NH1 . ARG B 1 426 ? 6.485   -70.729 0.671   1.00 29.36  ? 426  ARG B NH1 1 
ATOM   7666 N  NH2 . ARG B 1 426 ? 7.914   -72.062 -0.539  1.00 33.02  ? 426  ARG B NH2 1 
ATOM   7667 N  N   . ALA B 1 427 ? 1.324   -73.461 -2.049  1.00 25.76  ? 427  ALA B N   1 
ATOM   7668 C  CA  . ALA B 1 427 ? 1.330   -74.302 -3.243  1.00 29.94  ? 427  ALA B CA  1 
ATOM   7669 C  C   . ALA B 1 427 ? 2.522   -75.252 -3.234  1.00 26.36  ? 427  ALA B C   1 
ATOM   7670 O  O   . ALA B 1 427 ? 3.637   -74.869 -2.887  1.00 30.47  ? 427  ALA B O   1 
ATOM   7671 C  CB  . ALA B 1 427 ? 1.370   -73.442 -4.513  1.00 28.84  ? 427  ALA B CB  1 
ATOM   7672 N  N   . SER B 1 428 ? 2.281   -76.493 -3.661  1.00 32.75  ? 428  SER B N   1 
ATOM   7673 C  CA  . SER B 1 428 ? 3.338   -77.502 -3.687  1.00 32.39  ? 428  SER B CA  1 
ATOM   7674 C  C   . SER B 1 428 ? 4.480   -77.118 -4.619  1.00 35.99  ? 428  SER B C   1 
ATOM   7675 O  O   . SER B 1 428 ? 5.612   -77.570 -4.428  1.00 34.57  ? 428  SER B O   1 
ATOM   7676 C  CB  . SER B 1 428 ? 2.761   -78.843 -4.132  1.00 37.49  ? 428  SER B CB  1 
ATOM   7677 O  OG  . SER B 1 428 ? 2.249   -78.738 -5.456  1.00 37.40  ? 428  SER B OG  1 
ATOM   7678 N  N   . ASN B 1 429 ? 4.204   -76.308 -5.642  1.00 32.42  ? 429  ASN B N   1 
ATOM   7679 C  CA  . ASN B 1 429 ? 5.188   -75.966 -6.662  1.00 31.30  ? 429  ASN B CA  1 
ATOM   7680 C  C   . ASN B 1 429 ? 5.669   -74.527 -6.546  1.00 31.01  ? 429  ASN B C   1 
ATOM   7681 O  O   . ASN B 1 429 ? 6.129   -73.948 -7.535  1.00 25.95  ? 429  ASN B O   1 
ATOM   7682 C  CB  . ASN B 1 429 ? 4.602   -76.208 -8.054  1.00 35.68  ? 429  ASN B CB  1 
ATOM   7683 C  CG  . ASN B 1 429 ? 3.316   -75.425 -8.291  1.00 32.99  ? 429  ASN B CG  1 
ATOM   7684 O  OD1 . ASN B 1 429 ? 2.921   -74.588 -7.478  1.00 31.24  ? 429  ASN B OD1 1 
ATOM   7685 N  ND2 . ASN B 1 429 ? 2.663   -75.693 -9.409  1.00 30.74  ? 429  ASN B ND2 1 
ATOM   7686 N  N   . LEU B 1 430 ? 5.550   -73.926 -5.368  1.00 28.19  ? 430  LEU B N   1 
ATOM   7687 C  CA  . LEU B 1 430 ? 5.939   -72.534 -5.210  1.00 28.37  ? 430  LEU B CA  1 
ATOM   7688 C  C   . LEU B 1 430 ? 7.430   -72.363 -5.461  1.00 28.61  ? 430  LEU B C   1 
ATOM   7689 O  O   . LEU B 1 430 ? 8.252   -73.162 -5.000  1.00 28.22  ? 430  LEU B O   1 
ATOM   7690 C  CB  . LEU B 1 430 ? 5.592   -72.038 -3.802  1.00 28.90  ? 430  LEU B CB  1 
ATOM   7691 C  CG  . LEU B 1 430 ? 5.290   -70.541 -3.711  1.00 32.32  ? 430  LEU B CG  1 
ATOM   7692 C  CD1 . LEU B 1 430 ? 3.900   -70.253 -4.232  1.00 26.56  ? 430  LEU B CD1 1 
ATOM   7693 C  CD2 . LEU B 1 430 ? 5.447   -70.028 -2.265  1.00 31.94  ? 430  LEU B CD2 1 
ATOM   7694 N  N   . VAL B 1 431 ? 7.777   -71.300 -6.196  1.00 24.65  ? 431  VAL B N   1 
ATOM   7695 C  CA  . VAL B 1 431 ? 9.175   -71.030 -6.521  1.00 25.93  ? 431  VAL B CA  1 
ATOM   7696 C  C   . VAL B 1 431 ? 9.834   -70.132 -5.495  1.00 30.75  ? 431  VAL B C   1 
ATOM   7697 O  O   . VAL B 1 431 ? 11.065  -69.987 -5.516  1.00 28.84  ? 431  VAL B O   1 
ATOM   7698 C  CB  . VAL B 1 431 ? 9.325   -70.392 -7.918  1.00 29.07  ? 431  VAL B CB  1 
ATOM   7699 C  CG1 . VAL B 1 431 ? 8.764   -71.325 -8.977  1.00 32.11  ? 431  VAL B CG1 1 
ATOM   7700 C  CG2 . VAL B 1 431 ? 8.638   -69.047 -7.971  1.00 26.77  ? 431  VAL B CG2 1 
ATOM   7701 N  N   . TRP B 1 432 ? 9.062   -69.536 -4.593  1.00 27.28  ? 432  TRP B N   1 
ATOM   7702 C  CA  . TRP B 1 432 ? 9.572   -68.671 -3.547  1.00 30.21  ? 432  TRP B CA  1 
ATOM   7703 C  C   . TRP B 1 432 ? 9.930   -69.490 -2.309  1.00 27.34  ? 432  TRP B C   1 
ATOM   7704 O  O   . TRP B 1 432 ? 9.408   -70.591 -2.105  1.00 26.74  ? 432  TRP B O   1 
ATOM   7705 C  CB  . TRP B 1 432 ? 8.530   -67.603 -3.214  1.00 25.70  ? 432  TRP B CB  1 
ATOM   7706 C  CG  . TRP B 1 432 ? 8.266   -66.630 -4.343  1.00 26.67  ? 432  TRP B CG  1 
ATOM   7707 C  CD1 . TRP B 1 432 ? 7.173   -66.601 -5.167  1.00 25.79  ? 432  TRP B CD1 1 
ATOM   7708 C  CD2 . TRP B 1 432 ? 9.107   -65.543 -4.755  1.00 23.43  ? 432  TRP B CD2 1 
ATOM   7709 N  NE1 . TRP B 1 432 ? 7.284   -65.562 -6.067  1.00 26.24  ? 432  TRP B NE1 1 
ATOM   7710 C  CE2 . TRP B 1 432 ? 8.466   -64.904 -5.838  1.00 25.24  ? 432  TRP B CE2 1 
ATOM   7711 C  CE3 . TRP B 1 432 ? 10.345  -65.056 -4.321  1.00 22.79  ? 432  TRP B CE3 1 
ATOM   7712 C  CZ2 . TRP B 1 432 ? 9.016   -63.794 -6.484  1.00 24.10  ? 432  TRP B CZ2 1 
ATOM   7713 C  CZ3 . TRP B 1 432 ? 10.893  -63.952 -4.965  1.00 26.06  ? 432  TRP B CZ3 1 
ATOM   7714 C  CH2 . TRP B 1 432 ? 10.222  -63.332 -6.039  1.00 23.42  ? 432  TRP B CH2 1 
ATOM   7715 N  N   . PRO B 1 433 ? 10.831  -68.990 -1.468  1.00 24.94  ? 433  PRO B N   1 
ATOM   7716 C  CA  . PRO B 1 433 ? 11.320  -69.792 -0.337  1.00 29.46  ? 433  PRO B CA  1 
ATOM   7717 C  C   . PRO B 1 433 ? 10.245  -70.015 0.722   1.00 31.26  ? 433  PRO B C   1 
ATOM   7718 O  O   . PRO B 1 433 ? 9.221   -69.330 0.781   1.00 27.10  ? 433  PRO B O   1 
ATOM   7719 C  CB  . PRO B 1 433 ? 12.479  -68.957 0.206   1.00 29.99  ? 433  PRO B CB  1 
ATOM   7720 C  CG  . PRO B 1 433 ? 12.123  -67.569 -0.157  1.00 30.13  ? 433  PRO B CG  1 
ATOM   7721 C  CD  . PRO B 1 433 ? 11.505  -67.686 -1.537  1.00 28.92  ? 433  PRO B CD  1 
ATOM   7722 N  N   . GLU B 1 434 ? 10.513  -70.992 1.596   1.00 28.07  ? 434  GLU B N   1 
ATOM   7723 C  CA  . GLU B 1 434 ? 9.481   -71.447 2.526   1.00 32.12  ? 434  GLU B CA  1 
ATOM   7724 C  C   . GLU B 1 434 ? 9.138   -70.404 3.580   1.00 28.07  ? 434  GLU B C   1 
ATOM   7725 O  O   . GLU B 1 434 ? 8.003   -70.386 4.069   1.00 27.98  ? 434  GLU B O   1 
ATOM   7726 C  CB  . GLU B 1 434 ? 9.911   -72.742 3.213   1.00 36.96  ? 434  GLU B CB  1 
ATOM   7727 C  CG  . GLU B 1 434 ? 10.473  -73.776 2.265   1.00 43.68  ? 434  GLU B CG  1 
ATOM   7728 C  CD  . GLU B 1 434 ? 10.968  -75.017 2.979   1.00 61.76  ? 434  GLU B CD  1 
ATOM   7729 O  OE1 . GLU B 1 434 ? 12.059  -75.517 2.615   1.00 68.05  ? 434  GLU B OE1 1 
ATOM   7730 O  OE2 . GLU B 1 434 ? 10.264  -75.491 3.897   1.00 65.34  ? 434  GLU B OE2 1 
ATOM   7731 N  N   . TRP B 1 435 ? 10.088  -69.539 3.953   1.00 28.96  ? 435  TRP B N   1 
ATOM   7732 C  CA  . TRP B 1 435 ? 9.800   -68.570 5.008   1.00 28.06  ? 435  TRP B CA  1 
ATOM   7733 C  C   . TRP B 1 435 ? 8.685   -67.615 4.600   1.00 28.27  ? 435  TRP B C   1 
ATOM   7734 O  O   . TRP B 1 435 ? 7.977   -67.080 5.464   1.00 25.69  ? 435  TRP B O   1 
ATOM   7735 C  CB  . TRP B 1 435 ? 11.061  -67.790 5.397   1.00 24.96  ? 435  TRP B CB  1 
ATOM   7736 C  CG  . TRP B 1 435 ? 11.590  -66.806 4.368   1.00 25.45  ? 435  TRP B CG  1 
ATOM   7737 C  CD1 . TRP B 1 435 ? 12.612  -67.020 3.482   1.00 27.69  ? 435  TRP B CD1 1 
ATOM   7738 C  CD2 . TRP B 1 435 ? 11.149  -65.453 4.144   1.00 26.60  ? 435  TRP B CD2 1 
ATOM   7739 N  NE1 . TRP B 1 435 ? 12.831  -65.898 2.729   1.00 24.43  ? 435  TRP B NE1 1 
ATOM   7740 C  CE2 . TRP B 1 435 ? 11.942  -64.925 3.103   1.00 25.49  ? 435  TRP B CE2 1 
ATOM   7741 C  CE3 . TRP B 1 435 ? 10.148  -64.647 4.710   1.00 23.59  ? 435  TRP B CE3 1 
ATOM   7742 C  CZ2 . TRP B 1 435 ? 11.779  -63.626 2.621   1.00 24.39  ? 435  TRP B CZ2 1 
ATOM   7743 C  CZ3 . TRP B 1 435 ? 9.988   -63.356 4.237   1.00 22.06  ? 435  TRP B CZ3 1 
ATOM   7744 C  CH2 . TRP B 1 435 ? 10.798  -62.858 3.195   1.00 28.52  ? 435  TRP B CH2 1 
ATOM   7745 N  N   . MET B 1 436 ? 8.500   -67.405 3.297   1.00 23.13  ? 436  MET B N   1 
ATOM   7746 C  CA  . MET B 1 436 ? 7.473   -66.485 2.829   1.00 24.64  ? 436  MET B CA  1 
ATOM   7747 C  C   . MET B 1 436 ? 6.066   -67.049 2.972   1.00 23.55  ? 436  MET B C   1 
ATOM   7748 O  O   . MET B 1 436 ? 5.107   -66.275 2.912   1.00 24.65  ? 436  MET B O   1 
ATOM   7749 C  CB  . MET B 1 436 ? 7.744   -66.095 1.363   1.00 23.78  ? 436  MET B CB  1 
ATOM   7750 C  CG  . MET B 1 436 ? 9.079   -65.386 1.190   1.00 22.28  ? 436  MET B CG  1 
ATOM   7751 S  SD  . MET B 1 436 ? 9.446   -64.856 -0.509  1.00 23.02  ? 436  MET B SD  1 
ATOM   7752 C  CE  . MET B 1 436 ? 8.327   -63.466 -0.656  1.00 23.50  ? 436  MET B CE  1 
ATOM   7753 N  N   . GLY B 1 437 ? 5.917   -68.365 3.134   1.00 22.79  ? 437  GLY B N   1 
ATOM   7754 C  CA  . GLY B 1 437 ? 4.628   -68.909 3.558   1.00 25.00  ? 437  GLY B CA  1 
ATOM   7755 C  C   . GLY B 1 437 ? 3.586   -68.843 2.448   1.00 27.70  ? 437  GLY B C   1 
ATOM   7756 O  O   . GLY B 1 437 ? 3.839   -69.222 1.298   1.00 25.09  ? 437  GLY B O   1 
ATOM   7757 N  N   . VAL B 1 438 ? 2.401   -68.356 2.798   1.00 23.60  ? 438  VAL B N   1 
ATOM   7758 C  CA  . VAL B 1 438 ? 1.282   -68.233 1.869   1.00 28.72  ? 438  VAL B CA  1 
ATOM   7759 C  C   . VAL B 1 438 ? 1.259   -66.777 1.425   1.00 22.75  ? 438  VAL B C   1 
ATOM   7760 O  O   . VAL B 1 438 ? 0.719   -65.910 2.116   1.00 22.29  ? 438  VAL B O   1 
ATOM   7761 C  CB  . VAL B 1 438 ? -0.039  -68.657 2.515   1.00 24.64  ? 438  VAL B CB  1 
ATOM   7762 C  CG1 . VAL B 1 438 ? -1.178  -68.562 1.487   1.00 22.88  ? 438  VAL B CG1 1 
ATOM   7763 C  CG2 . VAL B 1 438 ? 0.080   -70.064 3.056   1.00 25.31  ? 438  VAL B CG2 1 
ATOM   7764 N  N   . ILE B 1 439 ? 1.850   -66.514 0.271   1.00 21.52  ? 439  ILE B N   1 
ATOM   7765 C  CA  . ILE B 1 439 ? 2.223   -65.168 -0.137  1.00 21.90  ? 439  ILE B CA  1 
ATOM   7766 C  C   . ILE B 1 439 ? 1.008   -64.396 -0.646  1.00 20.76  ? 439  ILE B C   1 
ATOM   7767 O  O   . ILE B 1 439 ? 0.075   -64.962 -1.218  1.00 23.90  ? 439  ILE B O   1 
ATOM   7768 C  CB  . ILE B 1 439 ? 3.331   -65.267 -1.212  1.00 21.79  ? 439  ILE B CB  1 
ATOM   7769 C  CG1 . ILE B 1 439 ? 4.573   -65.965 -0.619  1.00 20.26  ? 439  ILE B CG1 1 
ATOM   7770 C  CG2 . ILE B 1 439 ? 3.695   -63.893 -1.768  1.00 21.64  ? 439  ILE B CG2 1 
ATOM   7771 C  CD1 . ILE B 1 439 ? 5.632   -66.288 -1.668  1.00 26.25  ? 439  ILE B CD1 1 
ATOM   7772 N  N   . HIS B 1 440 ? 1.017   -63.087 -0.399  1.00 23.37  ? 440  HIS B N   1 
ATOM   7773 C  CA  . HIS B 1 440 ? 0.146   -62.126 -1.071  1.00 21.42  ? 440  HIS B CA  1 
ATOM   7774 C  C   . HIS B 1 440 ? -0.015  -62.506 -2.538  1.00 25.12  ? 440  HIS B C   1 
ATOM   7775 O  O   . HIS B 1 440 ? 0.958   -62.849 -3.206  1.00 23.96  ? 440  HIS B O   1 
ATOM   7776 C  CB  . HIS B 1 440 ? 0.788   -60.741 -0.931  1.00 20.89  ? 440  HIS B CB  1 
ATOM   7777 C  CG  . HIS B 1 440 ? -0.058  -59.583 -1.371  1.00 23.00  ? 440  HIS B CG  1 
ATOM   7778 N  ND1 . HIS B 1 440 ? -1.286  -59.286 -0.816  1.00 24.59  ? 440  HIS B ND1 1 
ATOM   7779 C  CD2 . HIS B 1 440 ? 0.197   -58.593 -2.263  1.00 23.48  ? 440  HIS B CD2 1 
ATOM   7780 C  CE1 . HIS B 1 440 ? -1.764  -58.182 -1.365  1.00 21.28  ? 440  HIS B CE1 1 
ATOM   7781 N  NE2 . HIS B 1 440 ? -0.873  -57.734 -2.237  1.00 23.80  ? 440  HIS B NE2 1 
ATOM   7782 N  N   . GLY B 1 441 ? -1.255  -62.518 -3.018  1.00 21.54  ? 441  GLY B N   1 
ATOM   7783 C  CA  . GLY B 1 441 ? -1.506  -62.798 -4.422  1.00 24.97  ? 441  GLY B CA  1 
ATOM   7784 C  C   . GLY B 1 441 ? -1.431  -64.255 -4.845  1.00 26.46  ? 441  GLY B C   1 
ATOM   7785 O  O   . GLY B 1 441 ? -1.791  -64.571 -5.987  1.00 23.21  ? 441  GLY B O   1 
ATOM   7786 N  N   . TYR B 1 442 ? -0.997  -65.172 -3.984  1.00 22.46  ? 442  TYR B N   1 
ATOM   7787 C  CA  . TYR B 1 442 ? -0.828  -66.535 -4.471  1.00 19.95  ? 442  TYR B CA  1 
ATOM   7788 C  C   . TYR B 1 442 ? -2.086  -67.384 -4.298  1.00 25.18  ? 442  TYR B C   1 
ATOM   7789 O  O   . TYR B 1 442 ? -2.061  -68.585 -4.579  1.00 27.12  ? 442  TYR B O   1 
ATOM   7790 C  CB  . TYR B 1 442 ? 0.431   -67.162 -3.847  1.00 23.18  ? 442  TYR B CB  1 
ATOM   7791 C  CG  . TYR B 1 442 ? 1.598   -66.755 -4.720  1.00 24.29  ? 442  TYR B CG  1 
ATOM   7792 C  CD1 . TYR B 1 442 ? 2.192   -65.511 -4.577  1.00 21.90  ? 442  TYR B CD1 1 
ATOM   7793 C  CD2 . TYR B 1 442 ? 2.003   -67.553 -5.785  1.00 25.13  ? 442  TYR B CD2 1 
ATOM   7794 C  CE1 . TYR B 1 442 ? 3.215   -65.101 -5.430  1.00 23.68  ? 442  TYR B CE1 1 
ATOM   7795 C  CE2 . TYR B 1 442 ? 3.019   -67.158 -6.635  1.00 25.43  ? 442  TYR B CE2 1 
ATOM   7796 C  CZ  . TYR B 1 442 ? 3.615   -65.934 -6.455  1.00 24.71  ? 442  TYR B CZ  1 
ATOM   7797 O  OH  . TYR B 1 442 ? 4.609   -65.529 -7.309  1.00 23.46  ? 442  TYR B OH  1 
ATOM   7798 N  N   . GLU B 1 443 ? -3.204  -66.769 -3.903  1.00 23.16  ? 443  GLU B N   1 
ATOM   7799 C  CA  . GLU B 1 443 ? -4.503  -67.403 -4.077  1.00 22.25  ? 443  GLU B CA  1 
ATOM   7800 C  C   . GLU B 1 443 ? -5.055  -67.188 -5.484  1.00 23.93  ? 443  GLU B C   1 
ATOM   7801 O  O   . GLU B 1 443 ? -5.961  -67.920 -5.909  1.00 21.90  ? 443  GLU B O   1 
ATOM   7802 C  CB  . GLU B 1 443 ? -5.480  -66.873 -3.020  1.00 24.79  ? 443  GLU B CB  1 
ATOM   7803 C  CG  . GLU B 1 443 ? -6.306  -65.673 -3.463  1.00 23.69  ? 443  GLU B CG  1 
ATOM   7804 C  CD  . GLU B 1 443 ? -5.485  -64.394 -3.638  1.00 24.63  ? 443  GLU B CD  1 
ATOM   7805 O  OE1 . GLU B 1 443 ? -4.273  -64.363 -3.287  1.00 23.98  ? 443  GLU B OE1 1 
ATOM   7806 O  OE2 . GLU B 1 443 ? -6.069  -63.404 -4.140  1.00 23.96  ? 443  GLU B OE2 1 
ATOM   7807 N  N   . ILE B 1 444 ? -4.518  -66.214 -6.220  1.00 19.41  ? 444  ILE B N   1 
ATOM   7808 C  CA  . ILE B 1 444 ? -5.087  -65.887 -7.534  1.00 21.43  ? 444  ILE B CA  1 
ATOM   7809 C  C   . ILE B 1 444 ? -5.034  -67.090 -8.467  1.00 22.92  ? 444  ILE B C   1 
ATOM   7810 O  O   . ILE B 1 444 ? -6.004  -67.382 -9.172  1.00 22.95  ? 444  ILE B O   1 
ATOM   7811 C  CB  . ILE B 1 444 ? -4.374  -64.674 -8.153  1.00 21.93  ? 444  ILE B CB  1 
ATOM   7812 C  CG1 . ILE B 1 444 ? -4.587  -63.434 -7.289  1.00 20.58  ? 444  ILE B CG1 1 
ATOM   7813 C  CG2 . ILE B 1 444 ? -4.903  -64.425 -9.596  1.00 22.65  ? 444  ILE B CG2 1 
ATOM   7814 C  CD1 . ILE B 1 444 ? -3.652  -62.287 -7.646  1.00 20.31  ? 444  ILE B CD1 1 
ATOM   7815 N  N   . GLU B 1 445 ? -3.903  -67.805 -8.494  1.00 24.66  ? 445  GLU B N   1 
ATOM   7816 C  CA  . GLU B 1 445 ? -3.789  -68.945 -9.402  1.00 23.97  ? 445  GLU B CA  1 
ATOM   7817 C  C   . GLU B 1 445 ? -4.808  -70.035 -9.079  1.00 26.41  ? 445  GLU B C   1 
ATOM   7818 O  O   . GLU B 1 445 ? -5.188  -70.810 -9.965  1.00 25.39  ? 445  GLU B O   1 
ATOM   7819 C  CB  . GLU B 1 445 ? -2.371  -69.515 -9.368  1.00 22.17  ? 445  GLU B CB  1 
ATOM   7820 C  CG  . GLU B 1 445 ? -1.871  -69.861 -7.958  1.00 27.69  ? 445  GLU B CG  1 
ATOM   7821 C  CD  . GLU B 1 445 ? -0.353  -69.889 -7.883  1.00 27.71  ? 445  GLU B CD  1 
ATOM   7822 O  OE1 . GLU B 1 445 ? 0.293   -68.874 -8.231  1.00 27.08  ? 445  GLU B OE1 1 
ATOM   7823 O  OE2 . GLU B 1 445 ? 0.191   -70.937 -7.485  1.00 29.93  ? 445  GLU B OE2 1 
ATOM   7824 N  N   . PHE B 1 446 ? -5.268  -70.117 -7.826  1.00 22.62  ? 446  PHE B N   1 
ATOM   7825 C  CA  . PHE B 1 446 ? -6.340  -71.063 -7.527  1.00 23.11  ? 446  PHE B CA  1 
ATOM   7826 C  C   . PHE B 1 446 ? -7.698  -70.536 -7.978  1.00 23.60  ? 446  PHE B C   1 
ATOM   7827 O  O   . PHE B 1 446 ? -8.544  -71.308 -8.450  1.00 24.91  ? 446  PHE B O   1 
ATOM   7828 C  CB  . PHE B 1 446 ? -6.350  -71.388 -6.027  1.00 22.30  ? 446  PHE B CB  1 
ATOM   7829 C  CG  . PHE B 1 446 ? -5.255  -72.333 -5.627  1.00 25.16  ? 446  PHE B CG  1 
ATOM   7830 C  CD1 . PHE B 1 446 ? -3.962  -71.862 -5.394  1.00 24.18  ? 446  PHE B CD1 1 
ATOM   7831 C  CD2 . PHE B 1 446 ? -5.496  -73.698 -5.540  1.00 25.04  ? 446  PHE B CD2 1 
ATOM   7832 C  CE1 . PHE B 1 446 ? -2.933  -72.729 -5.058  1.00 25.57  ? 446  PHE B CE1 1 
ATOM   7833 C  CE2 . PHE B 1 446 ? -4.470  -74.576 -5.195  1.00 25.67  ? 446  PHE B CE2 1 
ATOM   7834 C  CZ  . PHE B 1 446 ? -3.182  -74.085 -4.962  1.00 25.98  ? 446  PHE B CZ  1 
ATOM   7835 N  N   . VAL B 1 447 ? -7.924  -69.229 -7.842  1.00 21.73  ? 447  VAL B N   1 
ATOM   7836 C  CA  . VAL B 1 447 ? -9.187  -68.637 -8.281  1.00 21.55  ? 447  VAL B CA  1 
ATOM   7837 C  C   . VAL B 1 447 ? -9.350  -68.782 -9.795  1.00 24.25  ? 447  VAL B C   1 
ATOM   7838 O  O   . VAL B 1 447 ? -10.465 -68.983 -10.293 1.00 24.15  ? 447  VAL B O   1 
ATOM   7839 C  CB  . VAL B 1 447 ? -9.254  -67.161 -7.838  1.00 23.45  ? 447  VAL B CB  1 
ATOM   7840 C  CG1 . VAL B 1 447 ? -10.417 -66.427 -8.514  1.00 25.81  ? 447  VAL B CG1 1 
ATOM   7841 C  CG2 . VAL B 1 447 ? -9.332  -67.050 -6.305  1.00 23.22  ? 447  VAL B CG2 1 
ATOM   7842 N  N   . PHE B 1 448 ? -8.247  -68.685 -10.552 1.00 22.45  ? 448  PHE B N   1 
ATOM   7843 C  CA  . PHE B 1 448 ? -8.307  -68.743 -12.014 1.00 24.84  ? 448  PHE B CA  1 
ATOM   7844 C  C   . PHE B 1 448 ? -8.064  -70.142 -12.562 1.00 26.54  ? 448  PHE B C   1 
ATOM   7845 O  O   . PHE B 1 448 ? -7.991  -70.316 -13.784 1.00 26.05  ? 448  PHE B O   1 
ATOM   7846 C  CB  . PHE B 1 448 ? -7.327  -67.744 -12.636 1.00 24.10  ? 448  PHE B CB  1 
ATOM   7847 C  CG  . PHE B 1 448 ? -7.863  -66.348 -12.674 1.00 25.08  ? 448  PHE B CG  1 
ATOM   7848 C  CD1 . PHE B 1 448 ? -7.798  -65.541 -11.552 1.00 23.91  ? 448  PHE B CD1 1 
ATOM   7849 C  CD2 . PHE B 1 448 ? -8.472  -65.853 -13.822 1.00 25.17  ? 448  PHE B CD2 1 
ATOM   7850 C  CE1 . PHE B 1 448 ? -8.317  -64.256 -11.565 1.00 23.51  ? 448  PHE B CE1 1 
ATOM   7851 C  CE2 . PHE B 1 448 ? -8.997  -64.570 -13.846 1.00 25.23  ? 448  PHE B CE2 1 
ATOM   7852 C  CZ  . PHE B 1 448 ? -8.921  -63.768 -12.733 1.00 25.18  ? 448  PHE B CZ  1 
ATOM   7853 N  N   . GLY B 1 449 ? -7.957  -71.145 -11.690 1.00 25.77  ? 449  GLY B N   1 
ATOM   7854 C  CA  . GLY B 1 449 ? -7.995  -72.524 -12.121 1.00 27.86  ? 449  GLY B CA  1 
ATOM   7855 C  C   . GLY B 1 449 ? -6.716  -73.066 -12.710 1.00 28.17  ? 449  GLY B C   1 
ATOM   7856 O  O   . GLY B 1 449 ? -6.750  -74.127 -13.340 1.00 32.13  ? 449  GLY B O   1 
ATOM   7857 N  N   . LEU B 1 450 ? -5.592  -72.384 -12.521 1.00 23.56  ? 450  LEU B N   1 
ATOM   7858 C  CA  . LEU B 1 450 ? -4.320  -72.906 -13.011 1.00 23.11  ? 450  LEU B CA  1 
ATOM   7859 C  C   . LEU B 1 450 ? -4.010  -74.322 -12.537 1.00 30.34  ? 450  LEU B C   1 
ATOM   7860 O  O   . LEU B 1 450 ? -3.442  -75.088 -13.331 1.00 30.72  ? 450  LEU B O   1 
ATOM   7861 C  CB  . LEU B 1 450 ? -3.187  -71.943 -12.630 1.00 25.81  ? 450  LEU B CB  1 
ATOM   7862 C  CG  . LEU B 1 450 ? -2.929  -70.830 -13.658 1.00 35.10  ? 450  LEU B CG  1 
ATOM   7863 C  CD1 . LEU B 1 450 ? -4.129  -69.897 -13.787 1.00 30.25  ? 450  LEU B CD1 1 
ATOM   7864 C  CD2 . LEU B 1 450 ? -1.676  -70.054 -13.300 1.00 37.29  ? 450  LEU B CD2 1 
ATOM   7865 N  N   . PRO B 1 451 ? -4.336  -74.744 -11.305 1.00 28.28  ? 451  PRO B N   1 
ATOM   7866 C  CA  . PRO B 1 451 ? -4.060  -76.139 -10.925 1.00 29.85  ? 451  PRO B CA  1 
ATOM   7867 C  C   . PRO B 1 451 ? -4.753  -77.172 -11.802 1.00 32.61  ? 451  PRO B C   1 
ATOM   7868 O  O   . PRO B 1 451 ? -4.386  -78.351 -11.737 1.00 33.78  ? 451  PRO B O   1 
ATOM   7869 C  CB  . PRO B 1 451 ? -4.557  -76.215 -9.468  1.00 30.07  ? 451  PRO B CB  1 
ATOM   7870 C  CG  . PRO B 1 451 ? -4.394  -74.824 -8.955  1.00 26.95  ? 451  PRO B CG  1 
ATOM   7871 C  CD  . PRO B 1 451 ? -4.777  -73.951 -10.140 1.00 28.49  ? 451  PRO B CD  1 
ATOM   7872 N  N   . LEU B 1 452 ? -5.729  -76.778 -12.622 1.00 30.80  ? 452  LEU B N   1 
ATOM   7873 C  CA  . LEU B 1 452 ? -6.361  -77.714 -13.541 1.00 34.51  ? 452  LEU B CA  1 
ATOM   7874 C  C   . LEU B 1 452 ? -5.474  -78.054 -14.733 1.00 32.74  ? 452  LEU B C   1 
ATOM   7875 O  O   . LEU B 1 452 ? -5.780  -79.003 -15.465 1.00 32.31  ? 452  LEU B O   1 
ATOM   7876 C  CB  . LEU B 1 452 ? -7.698  -77.147 -14.037 1.00 33.14  ? 452  LEU B CB  1 
ATOM   7877 C  CG  . LEU B 1 452 ? -8.924  -77.209 -13.120 1.00 35.09  ? 452  LEU B CG  1 
ATOM   7878 C  CD1 . LEU B 1 452 ? -8.706  -76.543 -11.753 1.00 29.11  ? 452  LEU B CD1 1 
ATOM   7879 C  CD2 . LEU B 1 452 ? -10.144 -76.611 -13.822 1.00 33.54  ? 452  LEU B CD2 1 
ATOM   7880 N  N   . VAL B 1 453 ? -4.383  -77.320 -14.931 1.00 32.39  ? 453  VAL B N   1 
ATOM   7881 C  CA  . VAL B 1 453 ? -3.473  -77.541 -16.051 1.00 30.53  ? 453  VAL B CA  1 
ATOM   7882 C  C   . VAL B 1 453 ? -2.395  -78.519 -15.591 1.00 37.03  ? 453  VAL B C   1 
ATOM   7883 O  O   . VAL B 1 453 ? -1.489  -78.145 -14.841 1.00 36.36  ? 453  VAL B O   1 
ATOM   7884 C  CB  . VAL B 1 453 ? -2.860  -76.222 -16.537 1.00 33.20  ? 453  VAL B CB  1 
ATOM   7885 C  CG1 . VAL B 1 453 ? -1.990  -76.443 -17.795 1.00 35.97  ? 453  VAL B CG1 1 
ATOM   7886 C  CG2 . VAL B 1 453 ? -3.945  -75.207 -16.803 1.00 31.44  ? 453  VAL B CG2 1 
ATOM   7887 N  N   . LYS B 1 454 ? -2.483  -79.767 -16.067 1.00 36.48  ? 454  LYS B N   1 
ATOM   7888 C  CA  . LYS B 1 454 ? -1.601  -80.836 -15.597 1.00 40.90  ? 454  LYS B CA  1 
ATOM   7889 C  C   . LYS B 1 454 ? -0.130  -80.472 -15.741 1.00 39.55  ? 454  LYS B C   1 
ATOM   7890 O  O   . LYS B 1 454 ? 0.691   -80.826 -14.886 1.00 42.53  ? 454  LYS B O   1 
ATOM   7891 C  CB  . LYS B 1 454 ? -1.901  -82.129 -16.361 1.00 49.98  ? 454  LYS B CB  1 
ATOM   7892 C  CG  . LYS B 1 454 ? -3.178  -82.846 -15.922 1.00 54.31  ? 454  LYS B CG  1 
ATOM   7893 C  CD  . LYS B 1 454 ? -2.977  -83.609 -14.620 1.00 54.40  ? 454  LYS B CD  1 
ATOM   7894 N  N   . GLU B 1 455 ? 0.222   -79.754 -16.809 1.00 37.50  ? 455  GLU B N   1 
ATOM   7895 C  CA  . GLU B 1 455 ? 1.616   -79.419 -17.066 1.00 39.72  ? 455  GLU B CA  1 
ATOM   7896 C  C   . GLU B 1 455 ? 2.212   -78.509 -15.999 1.00 40.70  ? 455  GLU B C   1 
ATOM   7897 O  O   . GLU B 1 455 ? 3.438   -78.461 -15.865 1.00 36.83  ? 455  GLU B O   1 
ATOM   7898 C  CB  . GLU B 1 455 ? 1.745   -78.762 -18.445 1.00 46.22  ? 455  GLU B CB  1 
ATOM   7899 C  CG  . GLU B 1 455 ? 1.036   -79.524 -19.548 1.00 51.19  ? 455  GLU B CG  1 
ATOM   7900 C  CD  . GLU B 1 455 ? -0.431  -79.158 -19.662 1.00 51.39  ? 455  GLU B CD  1 
ATOM   7901 O  OE1 . GLU B 1 455 ? -0.758  -78.236 -20.442 1.00 62.16  ? 455  GLU B OE1 1 
ATOM   7902 O  OE2 . GLU B 1 455 ? -1.258  -79.783 -18.964 1.00 52.21  ? 455  GLU B OE2 1 
ATOM   7903 N  N   . LEU B 1 456 ? 1.382   -77.796 -15.230 1.00 38.43  ? 456  LEU B N   1 
ATOM   7904 C  CA  . LEU B 1 456 ? 1.896   -76.897 -14.199 1.00 34.55  ? 456  LEU B CA  1 
ATOM   7905 C  C   . LEU B 1 456 ? 2.284   -77.621 -12.912 1.00 36.10  ? 456  LEU B C   1 
ATOM   7906 O  O   . LEU B 1 456 ? 2.866   -76.991 -12.022 1.00 38.16  ? 456  LEU B O   1 
ATOM   7907 C  CB  . LEU B 1 456 ? 0.866   -75.800 -13.903 1.00 35.13  ? 456  LEU B CB  1 
ATOM   7908 C  CG  . LEU B 1 456 ? 0.579   -74.845 -15.071 1.00 35.93  ? 456  LEU B CG  1 
ATOM   7909 C  CD1 . LEU B 1 456 ? -0.434  -73.760 -14.704 1.00 33.70  ? 456  LEU B CD1 1 
ATOM   7910 C  CD2 . LEU B 1 456 ? 1.868   -74.221 -15.624 1.00 35.50  ? 456  LEU B CD2 1 
ATOM   7911 N  N   . ASN B 1 457 ? 1.977   -78.916 -12.793 1.00 33.52  ? 457  ASN B N   1 
ATOM   7912 C  CA  . ASN B 1 457 ? 2.497   -79.779 -11.727 1.00 36.17  ? 457  ASN B CA  1 
ATOM   7913 C  C   . ASN B 1 457 ? 1.946   -79.409 -10.348 1.00 35.85  ? 457  ASN B C   1 
ATOM   7914 O  O   . ASN B 1 457 ? 2.661   -79.482 -9.346  1.00 38.96  ? 457  ASN B O   1 
ATOM   7915 C  CB  . ASN B 1 457 ? 4.028   -79.772 -11.692 1.00 45.16  ? 457  ASN B CB  1 
ATOM   7916 C  CG  . ASN B 1 457 ? 4.641   -80.620 -12.783 1.00 50.27  ? 457  ASN B CG  1 
ATOM   7917 O  OD1 . ASN B 1 457 ? 3.940   -81.189 -13.612 1.00 49.70  ? 457  ASN B OD1 1 
ATOM   7918 N  ND2 . ASN B 1 457 ? 5.963   -80.698 -12.792 1.00 59.90  ? 457  ASN B ND2 1 
ATOM   7919 N  N   . TYR B 1 458 ? 0.683   -79.007 -10.287 1.00 33.07  ? 458  TYR B N   1 
ATOM   7920 C  CA  . TYR B 1 458 ? 0.016   -78.981 -8.993  1.00 30.73  ? 458  TYR B CA  1 
ATOM   7921 C  C   . TYR B 1 458 ? -0.404  -80.395 -8.606  1.00 34.42  ? 458  TYR B C   1 
ATOM   7922 O  O   . TYR B 1 458 ? -0.528  -81.282 -9.453  1.00 31.92  ? 458  TYR B O   1 
ATOM   7923 C  CB  . TYR B 1 458 ? -1.212  -78.070 -9.021  1.00 30.84  ? 458  TYR B CB  1 
ATOM   7924 C  CG  . TYR B 1 458 ? -0.908  -76.595 -9.158  1.00 32.85  ? 458  TYR B CG  1 
ATOM   7925 C  CD1 . TYR B 1 458 ? -0.778  -76.009 -10.411 1.00 30.49  ? 458  TYR B CD1 1 
ATOM   7926 C  CD2 . TYR B 1 458 ? -0.766  -75.784 -8.032  1.00 31.84  ? 458  TYR B CD2 1 
ATOM   7927 C  CE1 . TYR B 1 458 ? -0.518  -74.661 -10.547 1.00 29.55  ? 458  TYR B CE1 1 
ATOM   7928 C  CE2 . TYR B 1 458 ? -0.492  -74.431 -8.158  1.00 30.76  ? 458  TYR B CE2 1 
ATOM   7929 C  CZ  . TYR B 1 458 ? -0.379  -73.875 -9.424  1.00 33.35  ? 458  TYR B CZ  1 
ATOM   7930 O  OH  . TYR B 1 458 ? -0.113  -72.534 -9.572  1.00 31.58  ? 458  TYR B OH  1 
ATOM   7931 N  N   . THR B 1 459 ? -0.635  -80.604 -7.308  1.00 33.04  ? 459  THR B N   1 
ATOM   7932 C  CA  . THR B 1 459 ? -1.118  -81.902 -6.855  1.00 31.76  ? 459  THR B CA  1 
ATOM   7933 C  C   . THR B 1 459 ? -2.595  -82.068 -7.193  1.00 32.44  ? 459  THR B C   1 
ATOM   7934 O  O   . THR B 1 459 ? -3.297  -81.109 -7.525  1.00 36.56  ? 459  THR B O   1 
ATOM   7935 C  CB  . THR B 1 459 ? -0.941  -82.069 -5.345  1.00 31.92  ? 459  THR B CB  1 
ATOM   7936 O  OG1 . THR B 1 459 ? -1.799  -81.146 -4.671  1.00 31.61  ? 459  THR B OG1 1 
ATOM   7937 C  CG2 . THR B 1 459 ? 0.501   -81.833 -4.926  1.00 32.67  ? 459  THR B CG2 1 
ATOM   7938 N  N   . ALA B 1 460 ? -3.076  -83.309 -7.083  1.00 33.11  ? 460  ALA B N   1 
ATOM   7939 C  CA  . ALA B 1 460 ? -4.503  -83.555 -7.261  1.00 35.79  ? 460  ALA B CA  1 
ATOM   7940 C  C   . ALA B 1 460 ? -5.313  -82.831 -6.197  1.00 32.18  ? 460  ALA B C   1 
ATOM   7941 O  O   . ALA B 1 460 ? -6.423  -82.355 -6.457  1.00 35.48  ? 460  ALA B O   1 
ATOM   7942 C  CB  . ALA B 1 460 ? -4.788  -85.058 -7.224  1.00 40.37  ? 460  ALA B CB  1 
ATOM   7943 N  N   . GLU B 1 461 ? -4.779  -82.737 -4.985  1.00 34.52  ? 461  GLU B N   1 
ATOM   7944 C  CA  . GLU B 1 461 ? -5.497  -82.028 -3.936  1.00 35.19  ? 461  GLU B CA  1 
ATOM   7945 C  C   . GLU B 1 461 ? -5.611  -80.547 -4.252  1.00 29.36  ? 461  GLU B C   1 
ATOM   7946 O  O   . GLU B 1 461 ? -6.627  -79.925 -3.924  1.00 31.68  ? 461  GLU B O   1 
ATOM   7947 C  CB  . GLU B 1 461 ? -4.808  -82.253 -2.586  1.00 38.76  ? 461  GLU B CB  1 
ATOM   7948 C  CG  . GLU B 1 461 ? -4.757  -83.745 -2.145  1.00 43.64  ? 461  GLU B CG  1 
ATOM   7949 C  CD  . GLU B 1 461 ? -3.902  -84.628 -3.061  0.15 42.74  ? 461  GLU B CD  1 
ATOM   7950 O  OE1 . GLU B 1 461 ? -4.396  -85.657 -3.574  0.40 49.54  ? 461  GLU B OE1 1 
ATOM   7951 O  OE2 . GLU B 1 461 ? -2.740  -84.276 -3.304  0.77 43.33  ? 461  GLU B OE2 1 
ATOM   7952 N  N   . GLU B 1 462 ? -4.592  -79.982 -4.905  1.00 29.77  ? 462  GLU B N   1 
ATOM   7953 C  CA  . GLU B 1 462 ? -4.639  -78.581 -5.286  1.00 30.57  ? 462  GLU B CA  1 
ATOM   7954 C  C   . GLU B 1 462 ? -5.609  -78.356 -6.442  1.00 30.36  ? 462  GLU B C   1 
ATOM   7955 O  O   . GLU B 1 462 ? -6.280  -77.318 -6.505  1.00 27.66  ? 462  GLU B O   1 
ATOM   7956 C  CB  . GLU B 1 462 ? -3.227  -78.115 -5.621  1.00 26.98  ? 462  GLU B CB  1 
ATOM   7957 C  CG  . GLU B 1 462 ? -2.366  -78.029 -4.346  1.00 28.28  ? 462  GLU B CG  1 
ATOM   7958 C  CD  . GLU B 1 462 ? -0.896  -77.781 -4.601  1.00 32.18  ? 462  GLU B CD  1 
ATOM   7959 O  OE1 . GLU B 1 462 ? -0.352  -78.275 -5.615  1.00 32.75  ? 462  GLU B OE1 1 
ATOM   7960 O  OE2 . GLU B 1 462 ? -0.276  -77.098 -3.765  1.00 31.24  ? 462  GLU B OE2 1 
ATOM   7961 N  N   . GLU B 1 463 ? -5.702  -79.310 -7.372  1.00 28.86  ? 463  GLU B N   1 
ATOM   7962 C  CA  . GLU B 1 463 ? -6.751  -79.199 -8.382  1.00 32.77  ? 463  GLU B CA  1 
ATOM   7963 C  C   . GLU B 1 463 ? -8.127  -79.218 -7.730  1.00 30.30  ? 463  GLU B C   1 
ATOM   7964 O  O   . GLU B 1 463 ? -9.022  -78.447 -8.109  1.00 29.08  ? 463  GLU B O   1 
ATOM   7965 C  CB  . GLU B 1 463 ? -6.645  -80.315 -9.423  1.00 31.78  ? 463  GLU B CB  1 
ATOM   7966 C  CG  . GLU B 1 463 ? -7.819  -80.288 -10.394 1.00 33.15  ? 463  GLU B CG  1 
ATOM   7967 C  CD  . GLU B 1 463 ? -7.786  -81.391 -11.440 1.00 40.27  ? 463  GLU B CD  1 
ATOM   7968 O  OE1 . GLU B 1 463 ? -6.739  -82.061 -11.583 1.00 39.64  ? 463  GLU B OE1 1 
ATOM   7969 O  OE2 . GLU B 1 463 ? -8.820  -81.577 -12.119 1.00 39.92  ? 463  GLU B OE2 1 
ATOM   7970 N  N   . ALA B 1 464 ? -8.315  -80.077 -6.726  1.00 32.41  ? 464  ALA B N   1 
ATOM   7971 C  CA  . ALA B 1 464 ? -9.607  -80.111 -6.051  1.00 29.27  ? 464  ALA B CA  1 
ATOM   7972 C  C   . ALA B 1 464 ? -9.884  -78.788 -5.348  1.00 31.47  ? 464  ALA B C   1 
ATOM   7973 O  O   . ALA B 1 464 ? -11.002 -78.256 -5.420  1.00 30.93  ? 464  ALA B O   1 
ATOM   7974 C  CB  . ALA B 1 464 ? -9.666  -81.279 -5.064  1.00 36.19  ? 464  ALA B CB  1 
ATOM   7975 N  N   . LEU B 1 465 ? -8.869  -78.231 -4.683  1.00 30.29  ? 465  LEU B N   1 
ATOM   7976 C  CA  . LEU B 1 465 ? -9.032  -76.940 -4.022  1.00 29.95  ? 465  LEU B CA  1 
ATOM   7977 C  C   . LEU B 1 465 ? -9.364  -75.843 -5.031  1.00 26.66  ? 465  LEU B C   1 
ATOM   7978 O  O   . LEU B 1 465 ? -10.238 -75.008 -4.780  1.00 25.17  ? 465  LEU B O   1 
ATOM   7979 C  CB  . LEU B 1 465 ? -7.762  -76.590 -3.243  1.00 28.16  ? 465  LEU B CB  1 
ATOM   7980 C  CG  . LEU B 1 465 ? -7.696  -75.224 -2.567  1.00 24.24  ? 465  LEU B CG  1 
ATOM   7981 C  CD1 . LEU B 1 465 ? -8.878  -75.017 -1.628  1.00 26.58  ? 465  LEU B CD1 1 
ATOM   7982 C  CD2 . LEU B 1 465 ? -6.365  -75.081 -1.820  1.00 23.48  ? 465  LEU B CD2 1 
ATOM   7983 N  N   . SER B 1 466 ? -8.658  -75.812 -6.164  1.00 26.26  ? 466  SER B N   1 
ATOM   7984 C  CA  . SER B 1 466 ? -8.959  -74.807 -7.179  1.00 26.18  ? 466  SER B CA  1 
ATOM   7985 C  C   . SER B 1 466 ? -10.400 -74.927 -7.659  1.00 28.20  ? 466  SER B C   1 
ATOM   7986 O  O   . SER B 1 466 ? -11.124 -73.927 -7.749  1.00 26.64  ? 466  SER B O   1 
ATOM   7987 C  CB  . SER B 1 466 ? -7.998  -74.932 -8.360  1.00 27.33  ? 466  SER B CB  1 
ATOM   7988 O  OG  . SER B 1 466 ? -8.327  -73.948 -9.319  1.00 26.50  ? 466  SER B OG  1 
ATOM   7989 N  N   . ARG B 1 467 ? -10.841 -76.154 -7.960  1.00 29.12  ? 467  ARG B N   1 
ATOM   7990 C  CA  . ARG B 1 467 ? -12.218 -76.347 -8.416  1.00 29.97  ? 467  ARG B CA  1 
ATOM   7991 C  C   . ARG B 1 467 ? -13.224 -75.921 -7.350  1.00 29.65  ? 467  ARG B C   1 
ATOM   7992 O  O   . ARG B 1 467 ? -14.262 -75.325 -7.673  1.00 27.61  ? 467  ARG B O   1 
ATOM   7993 C  CB  . ARG B 1 467 ? -12.443 -77.805 -8.827  1.00 29.05  ? 467  ARG B CB  1 
ATOM   7994 C  CG  . ARG B 1 467 ? -11.675 -78.223 -10.086 1.00 31.47  ? 467  ARG B CG  1 
ATOM   7995 C  CD  . ARG B 1 467 ? -11.987 -79.671 -10.481 1.00 30.48  ? 467  ARG B CD  1 
ATOM   7996 N  NE  . ARG B 1 467 ? -11.308 -80.060 -11.714 1.00 32.39  ? 467  ARG B NE  1 
ATOM   7997 C  CZ  . ARG B 1 467 ? -11.760 -79.781 -12.936 1.00 34.50  ? 467  ARG B CZ  1 
ATOM   7998 N  NH1 . ARG B 1 467 ? -12.891 -79.108 -13.094 1.00 31.04  ? 467  ARG B NH1 1 
ATOM   7999 N  NH2 . ARG B 1 467 ? -11.076 -80.173 -14.003 1.00 39.48  ? 467  ARG B NH2 1 
ATOM   8000 N  N   . ARG B 1 468 ? -12.934 -76.214 -6.075  1.00 28.46  ? 468  ARG B N   1 
ATOM   8001 C  CA  A ARG B 1 468 ? -13.798 -75.759 -4.988  0.59 28.95  ? 468  ARG B CA  1 
ATOM   8002 C  CA  B ARG B 1 468 ? -13.795 -75.760 -4.984  0.41 28.98  ? 468  ARG B CA  1 
ATOM   8003 C  C   . ARG B 1 468 ? -13.894 -74.239 -4.960  1.00 26.83  ? 468  ARG B C   1 
ATOM   8004 O  O   . ARG B 1 468 ? -14.983 -73.675 -4.796  1.00 25.58  ? 468  ARG B O   1 
ATOM   8005 C  CB  A ARG B 1 468 ? -13.270 -76.256 -3.639  0.59 30.86  ? 468  ARG B CB  1 
ATOM   8006 C  CB  B ARG B 1 468 ? -13.263 -76.255 -3.633  0.41 30.87  ? 468  ARG B CB  1 
ATOM   8007 C  CG  A ARG B 1 468 ? -13.771 -77.610 -3.166  0.59 36.36  ? 468  ARG B CG  1 
ATOM   8008 C  CG  B ARG B 1 468 ? -13.490 -77.728 -3.303  0.41 35.70  ? 468  ARG B CG  1 
ATOM   8009 C  CD  A ARG B 1 468 ? -13.220 -77.928 -1.755  0.59 35.00  ? 468  ARG B CD  1 
ATOM   8010 C  CD  B ARG B 1 468 ? -13.388 -77.993 -1.775  0.41 35.01  ? 468  ARG B CD  1 
ATOM   8011 N  NE  A ARG B 1 468 ? -13.637 -76.924 -0.783  0.59 32.37  ? 468  ARG B NE  1 
ATOM   8012 N  NE  B ARG B 1 468 ? -12.066 -77.679 -1.230  0.41 32.25  ? 468  ARG B NE  1 
ATOM   8013 C  CZ  A ARG B 1 468 ? -12.868 -76.415 0.174   0.59 31.24  ? 468  ARG B CZ  1 
ATOM   8014 C  CZ  B ARG B 1 468 ? -11.011 -78.488 -1.312  0.41 29.12  ? 468  ARG B CZ  1 
ATOM   8015 N  NH1 A ARG B 1 468 ? -11.609 -76.806 0.318   0.59 33.14  ? 468  ARG B NH1 1 
ATOM   8016 N  NH1 B ARG B 1 468 ? -11.116 -79.655 -1.920  0.41 30.86  ? 468  ARG B NH1 1 
ATOM   8017 N  NH2 A ARG B 1 468 ? -13.375 -75.509 0.999   0.59 33.84  ? 468  ARG B NH2 1 
ATOM   8018 N  NH2 B ARG B 1 468 ? -9.849  -78.126 -0.800  0.41 31.63  ? 468  ARG B NH2 1 
ATOM   8019 N  N   . ILE B 1 469 ? -12.750 -73.563 -5.079  1.00 25.70  ? 469  ILE B N   1 
ATOM   8020 C  CA  . ILE B 1 469 ? -12.707 -72.108 -4.971  1.00 25.18  ? 469  ILE B CA  1 
ATOM   8021 C  C   . ILE B 1 469 ? -13.415 -71.466 -6.157  1.00 23.89  ? 469  ILE B C   1 
ATOM   8022 O  O   . ILE B 1 469 ? -14.198 -70.525 -5.996  1.00 21.97  ? 469  ILE B O   1 
ATOM   8023 C  CB  . ILE B 1 469 ? -11.246 -71.630 -4.851  1.00 24.04  ? 469  ILE B CB  1 
ATOM   8024 C  CG1 . ILE B 1 469 ? -10.707 -71.913 -3.436  1.00 23.89  ? 469  ILE B CG1 1 
ATOM   8025 C  CG2 . ILE B 1 469 ? -11.123 -70.154 -5.183  1.00 21.18  ? 469  ILE B CG2 1 
ATOM   8026 C  CD1 . ILE B 1 469 ? -9.218  -71.593 -3.243  1.00 24.00  ? 469  ILE B CD1 1 
ATOM   8027 N  N   . MET B 1 470 ? -13.130 -71.951 -7.370  1.00 24.04  ? 470  MET B N   1 
ATOM   8028 C  CA  . MET B 1 470 ? -13.830 -71.444 -8.545  1.00 26.38  ? 470  MET B CA  1 
ATOM   8029 C  C   . MET B 1 470 ? -15.339 -71.606 -8.402  1.00 26.11  ? 470  MET B C   1 
ATOM   8030 O  O   . MET B 1 470 ? -16.106 -70.703 -8.765  1.00 28.13  ? 470  MET B O   1 
ATOM   8031 C  CB  . MET B 1 470 ? -13.327 -72.162 -9.800  1.00 25.75  ? 470  MET B CB  1 
ATOM   8032 C  CG  . MET B 1 470 ? -11.932 -71.764 -10.206 1.00 24.50  ? 470  MET B CG  1 
ATOM   8033 S  SD  . MET B 1 470 ? -11.579 -72.252 -11.927 1.00 31.51  ? 470  MET B SD  1 
ATOM   8034 C  CE  . MET B 1 470 ? -11.421 -74.014 -11.689 1.00 25.53  ? 470  MET B CE  1 
ATOM   8035 N  N   . HIS B 1 471 ? -15.786 -72.742 -7.861  1.00 27.01  ? 471  HIS B N   1 
ATOM   8036 C  CA  . HIS B 1 471 ? -17.226 -72.955 -7.725  1.00 28.58  ? 471  HIS B CA  1 
ATOM   8037 C  C   . HIS B 1 471 ? -17.827 -72.061 -6.645  1.00 28.79  ? 471  HIS B C   1 
ATOM   8038 O  O   . HIS B 1 471 ? -18.930 -71.537 -6.826  1.00 26.76  ? 471  HIS B O   1 
ATOM   8039 C  CB  . HIS B 1 471 ? -17.531 -74.427 -7.451  1.00 31.16  ? 471  HIS B CB  1 
ATOM   8040 C  CG  . HIS B 1 471 ? -18.962 -74.791 -7.688  1.00 34.60  ? 471  HIS B CG  1 
ATOM   8041 N  ND1 . HIS B 1 471 ? -19.588 -74.583 -8.897  1.00 34.60  ? 471  HIS B ND1 1 
ATOM   8042 C  CD2 . HIS B 1 471 ? -19.905 -75.293 -6.856  1.00 38.08  ? 471  HIS B CD2 1 
ATOM   8043 C  CE1 . HIS B 1 471 ? -20.848 -74.971 -8.809  1.00 38.69  ? 471  HIS B CE1 1 
ATOM   8044 N  NE2 . HIS B 1 471 ? -21.067 -75.400 -7.580  1.00 40.63  ? 471  HIS B NE2 1 
ATOM   8045 N  N   . TYR B 1 472 ? -17.130 -71.874 -5.512  1.00 25.02  ? 472  TYR B N   1 
ATOM   8046 C  CA  . TYR B 1 472 ? -17.579 -70.886 -4.529  1.00 23.73  ? 472  TYR B CA  1 
ATOM   8047 C  C   . TYR B 1 472 ? -17.714 -69.510 -5.168  1.00 23.35  ? 472  TYR B C   1 
ATOM   8048 O  O   . TYR B 1 472 ? -18.720 -68.820 -4.977  1.00 24.27  ? 472  TYR B O   1 
ATOM   8049 C  CB  . TYR B 1 472 ? -16.596 -70.767 -3.360  1.00 25.63  ? 472  TYR B CB  1 
ATOM   8050 C  CG  . TYR B 1 472 ? -16.509 -71.908 -2.374  1.00 26.15  ? 472  TYR B CG  1 
ATOM   8051 C  CD1 . TYR B 1 472 ? -17.627 -72.659 -2.020  1.00 29.43  ? 472  TYR B CD1 1 
ATOM   8052 C  CD2 . TYR B 1 472 ? -15.293 -72.214 -1.774  1.00 28.86  ? 472  TYR B CD2 1 
ATOM   8053 C  CE1 . TYR B 1 472 ? -17.524 -73.700 -1.093  1.00 28.58  ? 472  TYR B CE1 1 
ATOM   8054 C  CE2 . TYR B 1 472 ? -15.179 -73.243 -0.857  1.00 27.76  ? 472  TYR B CE2 1 
ATOM   8055 C  CZ  . TYR B 1 472 ? -16.292 -73.985 -0.523  1.00 30.61  ? 472  TYR B CZ  1 
ATOM   8056 O  OH  . TYR B 1 472 ? -16.155 -75.007 0.397   1.00 34.98  ? 472  TYR B OH  1 
ATOM   8057 N  N   . TRP B 1 473 ? -16.656 -69.060 -5.852  1.00 23.85  ? 473  TRP B N   1 
ATOM   8058 C  CA  . TRP B 1 473 ? -16.647 -67.728 -6.443  1.00 24.07  ? 473  TRP B CA  1 
ATOM   8059 C  C   . TRP B 1 473 ? -17.783 -67.578 -7.449  1.00 25.81  ? 473  TRP B C   1 
ATOM   8060 O  O   . TRP B 1 473 ? -18.515 -66.585 -7.434  1.00 24.37  ? 473  TRP B O   1 
ATOM   8061 C  CB  . TRP B 1 473 ? -15.302 -67.475 -7.131  1.00 20.69  ? 473  TRP B CB  1 
ATOM   8062 C  CG  . TRP B 1 473 ? -14.232 -66.753 -6.328  1.00 23.91  ? 473  TRP B CG  1 
ATOM   8063 C  CD1 . TRP B 1 473 ? -13.487 -65.684 -6.752  1.00 24.45  ? 473  TRP B CD1 1 
ATOM   8064 C  CD2 . TRP B 1 473 ? -13.748 -67.075 -5.009  1.00 21.60  ? 473  TRP B CD2 1 
ATOM   8065 N  NE1 . TRP B 1 473 ? -12.597 -65.302 -5.772  1.00 21.98  ? 473  TRP B NE1 1 
ATOM   8066 C  CE2 . TRP B 1 473 ? -12.728 -66.143 -4.699  1.00 23.28  ? 473  TRP B CE2 1 
ATOM   8067 C  CE3 . TRP B 1 473 ? -14.089 -68.039 -4.056  1.00 24.92  ? 473  TRP B CE3 1 
ATOM   8068 C  CZ2 . TRP B 1 473 ? -12.043 -66.152 -3.471  1.00 24.37  ? 473  TRP B CZ2 1 
ATOM   8069 C  CZ3 . TRP B 1 473 ? -13.407 -68.044 -2.829  1.00 22.58  ? 473  TRP B CZ3 1 
ATOM   8070 C  CH2 . TRP B 1 473 ? -12.392 -67.109 -2.559  1.00 24.49  ? 473  TRP B CH2 1 
ATOM   8071 N  N   . ALA B 1 474 ? -17.945 -68.566 -8.333  1.00 23.75  ? 474  ALA B N   1 
ATOM   8072 C  CA  . ALA B 1 474 ? -18.945 -68.454 -9.390  1.00 25.50  ? 474  ALA B CA  1 
ATOM   8073 C  C   . ALA B 1 474 ? -20.355 -68.666 -8.857  1.00 27.96  ? 474  ALA B C   1 
ATOM   8074 O  O   . ALA B 1 474 ? -21.299 -68.017 -9.323  1.00 27.73  ? 474  ALA B O   1 
ATOM   8075 C  CB  . ALA B 1 474 ? -18.647 -69.452 -10.507 1.00 24.16  ? 474  ALA B CB  1 
ATOM   8076 N  N   . THR B 1 475 ? -20.528 -69.587 -7.904  1.00 25.78  ? 475  THR B N   1 
ATOM   8077 C  CA  . THR B 1 475 ? -21.845 -69.756 -7.291  1.00 27.81  ? 475  THR B CA  1 
ATOM   8078 C  C   . THR B 1 475 ? -22.244 -68.508 -6.517  1.00 27.37  ? 475  THR B C   1 
ATOM   8079 O  O   . THR B 1 475 ? -23.402 -68.074 -6.572  1.00 27.56  ? 475  THR B O   1 
ATOM   8080 C  CB  . THR B 1 475 ? -21.860 -70.982 -6.379  1.00 27.72  ? 475  THR B CB  1 
ATOM   8081 O  OG1 . THR B 1 475 ? -21.530 -72.145 -7.149  1.00 27.02  ? 475  THR B OG1 1 
ATOM   8082 C  CG2 . THR B 1 475 ? -23.232 -71.168 -5.733  1.00 30.01  ? 475  THR B CG2 1 
ATOM   8083 N  N   . PHE B 1 476 ? -21.297 -67.908 -5.794  1.00 25.22  ? 476  PHE B N   1 
ATOM   8084 C  CA  . PHE B 1 476 ? -21.576 -66.625 -5.167  1.00 25.04  ? 476  PHE B CA  1 
ATOM   8085 C  C   . PHE B 1 476 ? -21.935 -65.582 -6.218  1.00 24.87  ? 476  PHE B C   1 
ATOM   8086 O  O   . PHE B 1 476 ? -22.900 -64.829 -6.058  1.00 27.27  ? 476  PHE B O   1 
ATOM   8087 C  CB  . PHE B 1 476 ? -20.379 -66.153 -4.338  1.00 22.44  ? 476  PHE B CB  1 
ATOM   8088 C  CG  . PHE B 1 476 ? -20.525 -64.750 -3.840  1.00 20.85  ? 476  PHE B CG  1 
ATOM   8089 C  CD1 . PHE B 1 476 ? -21.261 -64.481 -2.696  1.00 21.81  ? 476  PHE B CD1 1 
ATOM   8090 C  CD2 . PHE B 1 476 ? -19.964 -63.694 -4.538  1.00 21.52  ? 476  PHE B CD2 1 
ATOM   8091 C  CE1 . PHE B 1 476 ? -21.422 -63.178 -2.244  1.00 22.32  ? 476  PHE B CE1 1 
ATOM   8092 C  CE2 . PHE B 1 476 ? -20.117 -62.397 -4.101  1.00 22.56  ? 476  PHE B CE2 1 
ATOM   8093 C  CZ  . PHE B 1 476 ? -20.850 -62.134 -2.947  1.00 21.25  ? 476  PHE B CZ  1 
ATOM   8094 N  N   . ALA B 1 477 ? -21.148 -65.509 -7.296  1.00 22.36  ? 477  ALA B N   1 
ATOM   8095 C  CA  . ALA B 1 477 ? -21.454 -64.559 -8.362  1.00 24.60  ? 477  ALA B CA  1 
ATOM   8096 C  C   . ALA B 1 477 ? -22.880 -64.746 -8.873  1.00 25.00  ? 477  ALA B C   1 
ATOM   8097 O  O   . ALA B 1 477 ? -23.594 -63.766 -9.096  1.00 24.08  ? 477  ALA B O   1 
ATOM   8098 C  CB  . ALA B 1 477 ? -20.445 -64.703 -9.508  1.00 25.80  ? 477  ALA B CB  1 
ATOM   8099 N  N   . LYS B 1 478 ? -23.320 -65.998 -9.030  1.00 25.29  ? 478  LYS B N   1 
ATOM   8100 C  CA  . LYS B 1 478 ? -24.643 -66.255 -9.600  1.00 29.16  ? 478  LYS B CA  1 
ATOM   8101 C  C   . LYS B 1 478 ? -25.774 -65.981 -8.614  1.00 31.86  ? 478  LYS B C   1 
ATOM   8102 O  O   . LYS B 1 478 ? -26.855 -65.552 -9.027  1.00 26.18  ? 478  LYS B O   1 
ATOM   8103 C  CB  . LYS B 1 478 ? -24.736 -67.705 -10.087 1.00 33.13  ? 478  LYS B CB  1 
ATOM   8104 C  CG  . LYS B 1 478 ? -23.831 -68.025 -11.275 1.00 39.74  ? 478  LYS B CG  1 
ATOM   8105 C  CD  . LYS B 1 478 ? -23.257 -69.435 -11.273 1.00 43.08  ? 478  LYS B CD  1 
ATOM   8106 C  CE  . LYS B 1 478 ? -22.781 -69.798 -12.677 1.00 48.66  ? 478  LYS B CE  1 
ATOM   8107 N  NZ  . LYS B 1 478 ? -22.370 -71.226 -12.778 1.00 51.15  ? 478  LYS B NZ  1 
ATOM   8108 N  N   . THR B 1 479 ? -25.554 -66.212 -7.316  1.00 25.69  ? 479  THR B N   1 
ATOM   8109 C  CA  . THR B 1 479 ? -26.652 -66.276 -6.364  1.00 25.75  ? 479  THR B CA  1 
ATOM   8110 C  C   . THR B 1 479 ? -26.488 -65.395 -5.135  1.00 31.84  ? 479  THR B C   1 
ATOM   8111 O  O   . THR B 1 479 ? -27.473 -65.190 -4.416  1.00 27.65  ? 479  THR B O   1 
ATOM   8112 C  CB  . THR B 1 479 ? -26.862 -67.727 -5.895  1.00 29.77  ? 479  THR B CB  1 
ATOM   8113 O  OG1 . THR B 1 479 ? -25.742 -68.147 -5.099  1.00 29.20  ? 479  THR B OG1 1 
ATOM   8114 C  CG2 . THR B 1 479 ? -27.013 -68.673 -7.088  1.00 33.76  ? 479  THR B CG2 1 
ATOM   8115 N  N   . GLY B 1 480 ? -25.298 -64.862 -4.869  1.00 24.01  ? 480  GLY B N   1 
ATOM   8116 C  CA  . GLY B 1 480 ? -25.076 -64.164 -3.623  1.00 24.39  ? 480  GLY B CA  1 
ATOM   8117 C  C   . GLY B 1 480 ? -24.721 -65.080 -2.479  1.00 23.52  ? 480  GLY B C   1 
ATOM   8118 O  O   . GLY B 1 480 ? -24.676 -64.626 -1.333  1.00 26.54  ? 480  GLY B O   1 
ATOM   8119 N  N   . ASN B 1 481 ? -24.468 -66.354 -2.763  1.00 25.11  ? 481  ASN B N   1 
ATOM   8120 C  CA  . ASN B 1 481 ? -24.175 -67.388 -1.779  1.00 26.69  ? 481  ASN B CA  1 
ATOM   8121 C  C   . ASN B 1 481 ? -23.193 -68.373 -2.401  1.00 27.22  ? 481  ASN B C   1 
ATOM   8122 O  O   . ASN B 1 481 ? -23.497 -68.963 -3.452  1.00 26.43  ? 481  ASN B O   1 
ATOM   8123 C  CB  . ASN B 1 481 ? -25.479 -68.084 -1.360  1.00 26.21  ? 481  ASN B CB  1 
ATOM   8124 C  CG  . ASN B 1 481 ? -25.300 -69.052 -0.191  1.00 30.77  ? 481  ASN B CG  1 
ATOM   8125 O  OD1 . ASN B 1 481 ? -24.235 -69.641 0.005   1.00 28.32  ? 481  ASN B OD1 1 
ATOM   8126 N  ND2 . ASN B 1 481 ? -26.367 -69.231 0.577   1.00 29.29  ? 481  ASN B ND2 1 
ATOM   8127 N  N   . PRO B 1 482 ? -22.005 -68.566 -1.808  1.00 23.49  ? 482  PRO B N   1 
ATOM   8128 C  CA  . PRO B 1 482 ? -21.040 -69.511 -2.390  1.00 24.19  ? 482  PRO B CA  1 
ATOM   8129 C  C   . PRO B 1 482 ? -21.488 -70.950 -2.298  1.00 26.56  ? 482  PRO B C   1 
ATOM   8130 O  O   . PRO B 1 482 ? -20.930 -71.802 -3.000  1.00 28.08  ? 482  PRO B O   1 
ATOM   8131 C  CB  . PRO B 1 482 ? -19.770 -69.287 -1.549  1.00 23.26  ? 482  PRO B CB  1 
ATOM   8132 C  CG  . PRO B 1 482 ? -20.299 -68.838 -0.214  1.00 25.84  ? 482  PRO B CG  1 
ATOM   8133 C  CD  . PRO B 1 482 ? -21.529 -68.014 -0.521  1.00 24.85  ? 482  PRO B CD  1 
ATOM   8134 N  N   . ASN B 1 483 ? -22.452 -71.249 -1.438  1.00 26.59  ? 483  ASN B N   1 
ATOM   8135 C  CA  . ASN B 1 483 ? -22.914 -72.607 -1.215  1.00 28.47  ? 483  ASN B CA  1 
ATOM   8136 C  C   . ASN B 1 483 ? -24.014 -72.953 -2.201  1.00 34.58  ? 483  ASN B C   1 
ATOM   8137 O  O   . ASN B 1 483 ? -24.896 -72.136 -2.471  1.00 31.55  ? 483  ASN B O   1 
ATOM   8138 C  CB  . ASN B 1 483 ? -23.465 -72.767 0.201   1.00 27.10  ? 483  ASN B CB  1 
ATOM   8139 C  CG  . ASN B 1 483 ? -22.460 -72.383 1.260   1.00 28.04  ? 483  ASN B CG  1 
ATOM   8140 O  OD1 . ASN B 1 483 ? -21.473 -73.080 1.464   1.00 32.51  ? 483  ASN B OD1 1 
ATOM   8141 N  ND2 . ASN B 1 483 ? -22.714 -71.280 1.944   1.00 25.29  ? 483  ASN B ND2 1 
ATOM   8142 N  N   . GLU B 1 484 ? -23.973 -74.172 -2.709  1.00 38.41  ? 484  GLU B N   1 
ATOM   8143 C  CA  . GLU B 1 484 ? -25.115 -74.714 -3.424  1.00 49.90  ? 484  GLU B CA  1 
ATOM   8144 C  C   . GLU B 1 484 ? -26.089 -75.318 -2.421  1.00 56.31  ? 484  GLU B C   1 
ATOM   8145 O  O   . GLU B 1 484 ? -25.722 -76.257 -1.709  1.00 56.73  ? 484  GLU B O   1 
ATOM   8146 C  CB  . GLU B 1 484 ? -24.674 -75.768 -4.424  1.00 51.86  ? 484  GLU B CB  1 
ATOM   8147 C  CG  . GLU B 1 484 ? -24.772 -75.308 -5.861  1.00 52.12  ? 484  GLU B CG  1 
ATOM   8148 C  CD  . GLU B 1 484 ? -24.347 -76.372 -6.840  1.00 56.80  ? 484  GLU B CD  1 
ATOM   8149 O  OE1 . GLU B 1 484 ? -23.164 -76.776 -6.812  1.00 50.63  ? 484  GLU B OE1 1 
ATOM   8150 O  OE2 . GLU B 1 484 ? -25.198 -76.803 -7.646  1.00 65.22  ? 484  GLU B OE2 1 
ATOM   8151 N  N   . PRO B 1 485 ? -27.315 -74.812 -2.315  1.00 63.45  ? 485  PRO B N   1 
ATOM   8152 C  CA  . PRO B 1 485 ? -28.319 -75.486 -1.483  1.00 69.38  ? 485  PRO B CA  1 
ATOM   8153 C  C   . PRO B 1 485 ? -28.613 -76.877 -2.026  1.00 74.35  ? 485  PRO B C   1 
ATOM   8154 O  O   . PRO B 1 485 ? -28.219 -77.243 -3.137  1.00 78.21  ? 485  PRO B O   1 
ATOM   8155 C  CB  . PRO B 1 485 ? -29.537 -74.563 -1.584  1.00 74.63  ? 485  PRO B CB  1 
ATOM   8156 C  CG  . PRO B 1 485 ? -29.363 -73.880 -2.917  1.00 71.94  ? 485  PRO B CG  1 
ATOM   8157 C  CD  . PRO B 1 485 ? -27.882 -73.679 -3.070  1.00 61.72  ? 485  PRO B CD  1 
ATOM   8158 N  N   . HIS B 1 486 ? -29.319 -77.664 -1.212  1.00 78.02  ? 486  HIS B N   1 
ATOM   8159 C  CA  . HIS B 1 486 ? -29.635 -79.067 -1.489  1.00 80.13  ? 486  HIS B CA  1 
ATOM   8160 C  C   . HIS B 1 486 ? -28.387 -79.947 -1.546  1.00 76.35  ? 486  HIS B C   1 
ATOM   8161 O  O   . HIS B 1 486 ? -28.501 -81.171 -1.671  1.00 79.87  ? 486  HIS B O   1 
ATOM   8162 C  CB  . HIS B 1 486 ? -30.419 -79.251 -2.802  1.00 84.73  ? 486  HIS B CB  1 
ATOM   8163 C  CG  . HIS B 1 486 ? -31.259 -78.074 -3.200  1.00 88.46  ? 486  HIS B CG  1 
ATOM   8164 N  ND1 . HIS B 1 486 ? -32.178 -77.486 -2.357  1.00 87.39  ? 486  HIS B ND1 1 
ATOM   8165 C  CD2 . HIS B 1 486 ? -31.329 -77.391 -4.369  1.00 90.06  ? 486  HIS B CD2 1 
ATOM   8166 C  CE1 . HIS B 1 486 ? -32.772 -76.486 -2.986  1.00 87.52  ? 486  HIS B CE1 1 
ATOM   8167 N  NE2 . HIS B 1 486 ? -32.275 -76.407 -4.207  1.00 88.61  ? 486  HIS B NE2 1 
ATOM   8168 N  N   . SER B 1 487 ? -27.200 -79.356 -1.459  1.00 70.01  ? 487  SER B N   1 
ATOM   8169 C  CA  . SER B 1 487 ? -25.968 -80.122 -1.575  1.00 68.14  ? 487  SER B CA  1 
ATOM   8170 C  C   . SER B 1 487 ? -25.545 -80.675 -0.220  1.00 67.66  ? 487  SER B C   1 
ATOM   8171 O  O   . SER B 1 487 ? -25.950 -80.185 0.838   1.00 64.14  ? 487  SER B O   1 
ATOM   8172 C  CB  . SER B 1 487 ? -24.843 -79.266 -2.151  1.00 66.37  ? 487  SER B CB  1 
ATOM   8173 O  OG  . SER B 1 487 ? -24.100 -78.661 -1.107  1.00 61.46  ? 487  SER B OG  1 
ATOM   8174 N  N   . GLN B 1 488 ? -24.711 -81.711 -0.267  1.00 65.90  ? 488  GLN B N   1 
ATOM   8175 C  CA  . GLN B 1 488 ? -24.182 -82.336 0.936   1.00 67.01  ? 488  GLN B CA  1 
ATOM   8176 C  C   . GLN B 1 488 ? -22.755 -81.908 1.241   1.00 62.52  ? 488  GLN B C   1 
ATOM   8177 O  O   . GLN B 1 488 ? -22.111 -82.513 2.102   1.00 61.88  ? 488  GLN B O   1 
ATOM   8178 C  CB  . GLN B 1 488 ? -24.250 -83.859 0.821   1.00 74.58  ? 488  GLN B CB  1 
ATOM   8179 C  CG  . GLN B 1 488 ? -25.606 -84.390 0.408   1.00 75.02  ? 488  GLN B CG  1 
ATOM   8180 C  CD  . GLN B 1 488 ? -25.515 -85.270 -0.818  1.00 81.75  ? 488  GLN B CD  1 
ATOM   8181 O  OE1 . GLN B 1 488 ? -24.959 -86.368 -0.769  1.00 81.55  ? 488  GLN B OE1 1 
ATOM   8182 N  NE2 . GLN B 1 488 ? -26.046 -84.785 -1.934  1.00 83.59  ? 488  GLN B NE2 1 
ATOM   8183 N  N   . GLU B 1 489 ? -22.241 -80.900 0.543   1.00 61.37  ? 489  GLU B N   1 
ATOM   8184 C  CA  . GLU B 1 489 ? -20.947 -80.340 0.899   1.00 54.99  ? 489  GLU B CA  1 
ATOM   8185 C  C   . GLU B 1 489 ? -21.079 -79.532 2.180   1.00 49.34  ? 489  GLU B C   1 
ATOM   8186 O  O   . GLU B 1 489 ? -22.142 -78.988 2.484   1.00 47.05  ? 489  GLU B O   1 
ATOM   8187 C  CB  . GLU B 1 489 ? -20.410 -79.443 -0.219  1.00 54.47  ? 489  GLU B CB  1 
ATOM   8188 C  CG  . GLU B 1 489 ? -20.428 -80.038 -1.624  1.00 58.94  ? 489  GLU B CG  1 
ATOM   8189 C  CD  . GLU B 1 489 ? -20.156 -81.528 -1.640  1.00 66.35  ? 489  GLU B CD  1 
ATOM   8190 O  OE1 . GLU B 1 489 ? -21.124 -82.311 -1.770  1.00 70.82  ? 489  GLU B OE1 1 
ATOM   8191 O  OE2 . GLU B 1 489 ? -18.974 -81.914 -1.511  1.00 67.61  ? 489  GLU B OE2 1 
ATOM   8192 N  N   . SER B 1 490 ? -19.987 -79.454 2.938   1.00 48.53  ? 490  SER B N   1 
ATOM   8193 C  CA  . SER B 1 490 ? -19.994 -78.591 4.110   1.00 45.35  ? 490  SER B CA  1 
ATOM   8194 C  C   . SER B 1 490 ? -20.258 -77.155 3.678   1.00 36.52  ? 490  SER B C   1 
ATOM   8195 O  O   . SER B 1 490 ? -19.862 -76.732 2.587   1.00 39.36  ? 490  SER B O   1 
ATOM   8196 C  CB  . SER B 1 490 ? -18.675 -78.702 4.876   1.00 45.59  ? 490  SER B CB  1 
ATOM   8197 O  OG  . SER B 1 490 ? -17.596 -78.906 3.994   1.00 47.28  ? 490  SER B OG  1 
ATOM   8198 N  N   . LYS B 1 491 ? -20.968 -76.420 4.521   1.00 35.91  ? 491  LYS B N   1 
ATOM   8199 C  CA  . LYS B 1 491 ? -21.483 -75.107 4.168   1.00 34.12  ? 491  LYS B CA  1 
ATOM   8200 C  C   . LYS B 1 491 ? -20.598 -74.014 4.750   1.00 38.19  ? 491  LYS B C   1 
ATOM   8201 O  O   . LYS B 1 491 ? -20.263 -74.038 5.944   1.00 30.77  ? 491  LYS B O   1 
ATOM   8202 C  CB  . LYS B 1 491 ? -22.921 -74.941 4.666   1.00 37.58  ? 491  LYS B CB  1 
ATOM   8203 C  CG  . LYS B 1 491 ? -23.890 -75.970 4.097   1.00 38.00  ? 491  LYS B CG  1 
ATOM   8204 C  CD  . LYS B 1 491 ? -24.241 -75.645 2.651   1.00 42.78  ? 491  LYS B CD  1 
ATOM   8205 C  CE  . LYS B 1 491 ? -25.397 -76.507 2.134   1.00 49.44  ? 491  LYS B CE  1 
ATOM   8206 N  NZ  . LYS B 1 491 ? -25.065 -77.963 2.116   1.00 49.12  ? 491  LYS B NZ  1 
ATOM   8207 N  N   . TRP B 1 492 ? -20.230 -73.068 3.902   1.00 30.32  ? 492  TRP B N   1 
ATOM   8208 C  CA  . TRP B 1 492 ? -19.534 -71.850 4.282   1.00 27.50  ? 492  TRP B CA  1 
ATOM   8209 C  C   . TRP B 1 492 ? -20.537 -70.908 4.938   1.00 27.75  ? 492  TRP B C   1 
ATOM   8210 O  O   . TRP B 1 492 ? -21.464 -70.443 4.260   1.00 27.23  ? 492  TRP B O   1 
ATOM   8211 C  CB  . TRP B 1 492 ? -18.899 -71.238 3.018   1.00 23.78  ? 492  TRP B CB  1 
ATOM   8212 C  CG  . TRP B 1 492 ? -18.058 -69.995 3.191   1.00 24.70  ? 492  TRP B CG  1 
ATOM   8213 C  CD1 . TRP B 1 492 ? -17.964 -69.186 4.294   1.00 25.02  ? 492  TRP B CD1 1 
ATOM   8214 C  CD2 . TRP B 1 492 ? -17.196 -69.424 2.200   1.00 23.05  ? 492  TRP B CD2 1 
ATOM   8215 N  NE1 . TRP B 1 492 ? -17.099 -68.142 4.043   1.00 21.34  ? 492  TRP B NE1 1 
ATOM   8216 C  CE2 . TRP B 1 492 ? -16.613 -68.270 2.762   1.00 23.46  ? 492  TRP B CE2 1 
ATOM   8217 C  CE3 . TRP B 1 492 ? -16.873 -69.774 0.882   1.00 22.77  ? 492  TRP B CE3 1 
ATOM   8218 C  CZ2 . TRP B 1 492 ? -15.714 -67.468 2.053   1.00 22.49  ? 492  TRP B CZ2 1 
ATOM   8219 C  CZ3 . TRP B 1 492 ? -15.966 -68.984 0.180   1.00 24.44  ? 492  TRP B CZ3 1 
ATOM   8220 C  CH2 . TRP B 1 492 ? -15.400 -67.844 0.762   1.00 24.00  ? 492  TRP B CH2 1 
ATOM   8221 N  N   . PRO B 1 493 ? -20.418 -70.623 6.233   1.00 27.09  ? 493  PRO B N   1 
ATOM   8222 C  CA  . PRO B 1 493 ? -21.452 -69.845 6.917   1.00 27.68  ? 493  PRO B CA  1 
ATOM   8223 C  C   . PRO B 1 493 ? -21.316 -68.352 6.680   1.00 24.85  ? 493  PRO B C   1 
ATOM   8224 O  O   . PRO B 1 493 ? -20.219 -67.816 6.507   1.00 24.79  ? 493  PRO B O   1 
ATOM   8225 C  CB  . PRO B 1 493 ? -21.218 -70.184 8.398   1.00 26.65  ? 493  PRO B CB  1 
ATOM   8226 C  CG  . PRO B 1 493 ? -19.751 -70.441 8.477   1.00 29.06  ? 493  PRO B CG  1 
ATOM   8227 C  CD  . PRO B 1 493 ? -19.409 -71.150 7.172   1.00 25.61  ? 493  PRO B CD  1 
ATOM   8228 N  N   . LEU B 1 494 ? -22.470 -67.684 6.680   1.00 25.96  ? 494  LEU B N   1 
ATOM   8229 C  CA  . LEU B 1 494 ? -22.498 -66.227 6.714   1.00 26.03  ? 494  LEU B CA  1 
ATOM   8230 C  C   . LEU B 1 494 ? -21.661 -65.701 7.871   1.00 30.27  ? 494  LEU B C   1 
ATOM   8231 O  O   . LEU B 1 494 ? -21.727 -66.224 8.991   1.00 26.08  ? 494  LEU B O   1 
ATOM   8232 C  CB  . LEU B 1 494 ? -23.935 -65.720 6.872   1.00 23.79  ? 494  LEU B CB  1 
ATOM   8233 C  CG  . LEU B 1 494 ? -24.834 -65.620 5.636   1.00 25.68  ? 494  LEU B CG  1 
ATOM   8234 C  CD1 . LEU B 1 494 ? -26.294 -65.381 6.047   1.00 27.47  ? 494  LEU B CD1 1 
ATOM   8235 C  CD2 . LEU B 1 494 ? -24.358 -64.517 4.711   1.00 24.72  ? 494  LEU B CD2 1 
ATOM   8236 N  N   . PHE B 1 495 ? -20.877 -64.659 7.589   1.00 24.47  ? 495  PHE B N   1 
ATOM   8237 C  CA  . PHE B 1 495 ? -20.266 -63.835 8.624   1.00 25.53  ? 495  PHE B CA  1 
ATOM   8238 C  C   . PHE B 1 495 ? -21.336 -62.911 9.193   1.00 30.02  ? 495  PHE B C   1 
ATOM   8239 O  O   . PHE B 1 495 ? -21.965 -62.152 8.446   1.00 26.04  ? 495  PHE B O   1 
ATOM   8240 C  CB  . PHE B 1 495 ? -19.102 -63.021 8.047   1.00 22.49  ? 495  PHE B CB  1 
ATOM   8241 C  CG  . PHE B 1 495 ? -18.493 -62.042 9.029   1.00 24.30  ? 495  PHE B CG  1 
ATOM   8242 C  CD1 . PHE B 1 495 ? -19.087 -60.817 9.272   1.00 23.46  ? 495  PHE B CD1 1 
ATOM   8243 C  CD2 . PHE B 1 495 ? -17.308 -62.347 9.692   1.00 21.54  ? 495  PHE B CD2 1 
ATOM   8244 C  CE1 . PHE B 1 495 ? -18.543 -59.927 10.180  1.00 28.54  ? 495  PHE B CE1 1 
ATOM   8245 C  CE2 . PHE B 1 495 ? -16.741 -61.453 10.575  1.00 26.18  ? 495  PHE B CE2 1 
ATOM   8246 C  CZ  . PHE B 1 495 ? -17.364 -60.239 10.828  1.00 26.28  ? 495  PHE B CZ  1 
ATOM   8247 N  N   . THR B 1 496 ? -21.542 -62.963 10.505  1.00 28.40  ? 496  THR B N   1 
ATOM   8248 C  CA  . THR B 1 496 ? -22.516 -62.109 11.165  1.00 26.92  ? 496  THR B CA  1 
ATOM   8249 C  C   . THR B 1 496 ? -21.821 -61.208 12.176  1.00 27.69  ? 496  THR B C   1 
ATOM   8250 O  O   . THR B 1 496 ? -20.744 -61.527 12.684  1.00 27.61  ? 496  THR B O   1 
ATOM   8251 C  CB  . THR B 1 496 ? -23.593 -62.935 11.877  1.00 34.47  ? 496  THR B CB  1 
ATOM   8252 O  OG1 . THR B 1 496 ? -22.983 -63.706 12.923  1.00 27.39  ? 496  THR B OG1 1 
ATOM   8253 C  CG2 . THR B 1 496 ? -24.297 -63.867 10.884  1.00 30.83  ? 496  THR B CG2 1 
ATOM   8254 N  N   . THR B 1 497 ? -22.456 -60.073 12.472  1.00 28.78  ? 497  THR B N   1 
ATOM   8255 C  CA  . THR B 1 497 ? -21.898 -59.163 13.470  1.00 35.27  ? 497  THR B CA  1 
ATOM   8256 C  C   . THR B 1 497 ? -21.627 -59.881 14.789  1.00 32.17  ? 497  THR B C   1 
ATOM   8257 O  O   . THR B 1 497 ? -20.609 -59.632 15.446  1.00 32.18  ? 497  THR B O   1 
ATOM   8258 C  CB  . THR B 1 497 ? -22.841 -57.978 13.692  1.00 33.78  ? 497  THR B CB  1 
ATOM   8259 O  OG1 . THR B 1 497 ? -22.998 -57.254 12.462  1.00 36.06  ? 497  THR B OG1 1 
ATOM   8260 C  CG2 . THR B 1 497 ? -22.297 -57.049 14.771  1.00 36.35  ? 497  THR B CG2 1 
ATOM   8261 N  N   . LYS B 1 498 ? -22.503 -60.812 15.171  1.00 34.38  ? 498  LYS B N   1 
ATOM   8262 C  CA  . LYS B 1 498 ? -22.361 -61.440 16.482  1.00 32.24  ? 498  LYS B CA  1 
ATOM   8263 C  C   . LYS B 1 498 ? -21.342 -62.572 16.462  1.00 31.78  ? 498  LYS B C   1 
ATOM   8264 O  O   . LYS B 1 498 ? -20.416 -62.592 17.282  1.00 34.55  ? 498  LYS B O   1 
ATOM   8265 C  CB  . LYS B 1 498 ? -23.716 -61.957 16.972  1.00 33.30  ? 498  LYS B CB  1 
ATOM   8266 C  CG  . LYS B 1 498 ? -23.638 -62.621 18.340  1.00 39.82  ? 498  LYS B CG  1 
ATOM   8267 C  CD  . LYS B 1 498 ? -25.027 -62.902 18.899  1.00 44.95  ? 498  LYS B CD  1 
ATOM   8268 C  CE  . LYS B 1 498 ? -24.951 -63.722 20.181  1.00 51.93  ? 498  LYS B CE  1 
ATOM   8269 N  NZ  . LYS B 1 498 ? -26.310 -64.074 20.694  1.00 58.79  ? 498  LYS B NZ  1 
ATOM   8270 N  N   . GLU B 1 499 ? -21.476 -63.512 15.523  1.00 26.91  ? 499  GLU B N   1 
ATOM   8271 C  CA  . GLU B 1 499 ? -20.648 -64.712 15.562  1.00 28.91  ? 499  GLU B CA  1 
ATOM   8272 C  C   . GLU B 1 499 ? -19.356 -64.602 14.756  1.00 27.33  ? 499  GLU B C   1 
ATOM   8273 O  O   . GLU B 1 499 ? -18.384 -65.302 15.076  1.00 25.65  ? 499  GLU B O   1 
ATOM   8274 C  CB  . GLU B 1 499 ? -21.456 -65.918 15.094  1.00 29.80  ? 499  GLU B CB  1 
ATOM   8275 C  CG  . GLU B 1 499 ? -22.714 -66.108 15.942  1.00 39.33  ? 499  GLU B CG  1 
ATOM   8276 C  CD  . GLU B 1 499 ? -23.284 -67.505 15.835  1.00 47.91  ? 499  GLU B CD  1 
ATOM   8277 O  OE1 . GLU B 1 499 ? -23.882 -67.834 14.786  1.00 47.95  ? 499  GLU B OE1 1 
ATOM   8278 O  OE2 . GLU B 1 499 ? -23.126 -68.282 16.801  1.00 54.69  ? 499  GLU B OE2 1 
ATOM   8279 N  N   . GLN B 1 500 ? -19.324 -63.755 13.727  1.00 26.08  ? 500  GLN B N   1 
ATOM   8280 C  CA  . GLN B 1 500 ? -18.079 -63.395 13.030  1.00 25.02  ? 500  GLN B CA  1 
ATOM   8281 C  C   . GLN B 1 500 ? -17.340 -64.611 12.469  1.00 23.94  ? 500  GLN B C   1 
ATOM   8282 O  O   . GLN B 1 500 ? -16.107 -64.688 12.501  1.00 25.65  ? 500  GLN B O   1 
ATOM   8283 C  CB  . GLN B 1 500 ? -17.175 -62.580 13.963  1.00 29.19  ? 500  GLN B CB  1 
ATOM   8284 C  CG  . GLN B 1 500 ? -17.813 -61.261 14.373  1.00 26.79  ? 500  GLN B CG  1 
ATOM   8285 C  CD  . GLN B 1 500 ? -17.057 -60.560 15.474  1.00 35.82  ? 500  GLN B CD  1 
ATOM   8286 O  OE1 . GLN B 1 500 ? -15.851 -60.367 15.378  1.00 32.95  ? 500  GLN B OE1 1 
ATOM   8287 N  NE2 . GLN B 1 500 ? -17.764 -60.179 16.534  1.00 38.41  ? 500  GLN B NE2 1 
ATOM   8288 N  N   . LYS B 1 501 ? -18.092 -65.556 11.921  1.00 22.20  ? 501  LYS B N   1 
ATOM   8289 C  CA  . LYS B 1 501 ? -17.512 -66.789 11.414  1.00 22.22  ? 501  LYS B CA  1 
ATOM   8290 C  C   . LYS B 1 501 ? -16.813 -66.579 10.077  1.00 25.25  ? 501  LYS B C   1 
ATOM   8291 O  O   . LYS B 1 501 ? -17.226 -65.757 9.255   1.00 23.86  ? 501  LYS B O   1 
ATOM   8292 C  CB  . LYS B 1 501 ? -18.584 -67.857 11.239  1.00 25.31  ? 501  LYS B CB  1 
ATOM   8293 C  CG  . LYS B 1 501 ? -19.237 -68.269 12.548  1.00 24.62  ? 501  LYS B CG  1 
ATOM   8294 C  CD  . LYS B 1 501 ? -20.406 -69.204 12.290  1.00 29.69  ? 501  LYS B CD  1 
ATOM   8295 C  CE  . LYS B 1 501 ? -20.924 -69.797 13.590  1.00 35.55  ? 501  LYS B CE  1 
ATOM   8296 N  NZ  . LYS B 1 501 ? -21.949 -70.825 13.288  1.00 39.03  ? 501  LYS B NZ  1 
ATOM   8297 N  N   . PHE B 1 502 ? -15.758 -67.362 9.867   1.00 22.76  ? 502  PHE B N   1 
ATOM   8298 C  CA  . PHE B 1 502 ? -15.069 -67.449 8.590   1.00 22.27  ? 502  PHE B CA  1 
ATOM   8299 C  C   . PHE B 1 502 ? -14.593 -68.883 8.428   1.00 24.99  ? 502  PHE B C   1 
ATOM   8300 O  O   . PHE B 1 502 ? -14.642 -69.679 9.372   1.00 26.53  ? 502  PHE B O   1 
ATOM   8301 C  CB  . PHE B 1 502 ? -13.915 -66.451 8.509   1.00 21.82  ? 502  PHE B CB  1 
ATOM   8302 C  CG  . PHE B 1 502 ? -12.754 -66.760 9.438   1.00 25.46  ? 502  PHE B CG  1 
ATOM   8303 C  CD1 . PHE B 1 502 ? -12.786 -66.355 10.767  1.00 22.80  ? 502  PHE B CD1 1 
ATOM   8304 C  CD2 . PHE B 1 502 ? -11.621 -67.422 8.970   1.00 23.87  ? 502  PHE B CD2 1 
ATOM   8305 C  CE1 . PHE B 1 502 ? -11.715 -66.623 11.630  1.00 26.07  ? 502  PHE B CE1 1 
ATOM   8306 C  CE2 . PHE B 1 502 ? -10.540 -67.692 9.818   1.00 23.52  ? 502  PHE B CE2 1 
ATOM   8307 C  CZ  . PHE B 1 502 ? -10.581 -67.285 11.144  1.00 26.66  ? 502  PHE B CZ  1 
ATOM   8308 N  N   . ILE B 1 503 ? -14.139 -69.215 7.219   1.00 23.34  ? 503  ILE B N   1 
ATOM   8309 C  CA  . ILE B 1 503 ? -13.552 -70.522 6.952   1.00 25.34  ? 503  ILE B CA  1 
ATOM   8310 C  C   . ILE B 1 503 ? -12.106 -70.370 6.495   1.00 26.34  ? 503  ILE B C   1 
ATOM   8311 O  O   . ILE B 1 503 ? -11.710 -69.351 5.917   1.00 24.90  ? 503  ILE B O   1 
ATOM   8312 C  CB  . ILE B 1 503 ? -14.351 -71.318 5.899   1.00 25.20  ? 503  ILE B CB  1 
ATOM   8313 C  CG1 . ILE B 1 503 ? -14.233 -70.662 4.516   1.00 26.45  ? 503  ILE B CG1 1 
ATOM   8314 C  CG2 . ILE B 1 503 ? -15.792 -71.477 6.338   1.00 27.30  ? 503  ILE B CG2 1 
ATOM   8315 C  CD1 . ILE B 1 503 ? -14.593 -71.601 3.371   1.00 27.93  ? 503  ILE B CD1 1 
ATOM   8316 N  N   . ASP B 1 504 ? -11.314 -71.405 6.768   1.00 26.16  ? 504  ASP B N   1 
ATOM   8317 C  CA  . ASP B 1 504 ? -10.038 -71.586 6.092   1.00 29.22  ? 504  ASP B CA  1 
ATOM   8318 C  C   . ASP B 1 504 ? -10.297 -72.099 4.682   1.00 31.08  ? 504  ASP B C   1 
ATOM   8319 O  O   . ASP B 1 504 ? -11.191 -72.919 4.463   1.00 30.33  ? 504  ASP B O   1 
ATOM   8320 C  CB  . ASP B 1 504 ? -9.157  -72.596 6.835   1.00 28.30  ? 504  ASP B CB  1 
ATOM   8321 C  CG  . ASP B 1 504 ? -8.785  -72.151 8.235   1.00 31.56  ? 504  ASP B CG  1 
ATOM   8322 O  OD1 . ASP B 1 504 ? -8.757  -70.930 8.505   1.00 29.58  ? 504  ASP B OD1 1 
ATOM   8323 O  OD2 . ASP B 1 504 ? -8.495  -73.038 9.069   1.00 35.22  ? 504  ASP B OD2 1 
ATOM   8324 N  N   . LEU B 1 505 ? -9.510  -71.626 3.723   1.00 29.04  ? 505  LEU B N   1 
ATOM   8325 C  CA  . LEU B 1 505 ? -9.485  -72.221 2.392   1.00 26.28  ? 505  LEU B CA  1 
ATOM   8326 C  C   . LEU B 1 505 ? -8.163  -72.951 2.252   1.00 25.11  ? 505  LEU B C   1 
ATOM   8327 O  O   . LEU B 1 505 ? -7.106  -72.312 2.180   1.00 25.82  ? 505  LEU B O   1 
ATOM   8328 C  CB  . LEU B 1 505 ? -9.640  -71.175 1.288   1.00 30.94  ? 505  LEU B CB  1 
ATOM   8329 C  CG  . LEU B 1 505 ? -11.046 -70.637 1.036   1.00 32.83  ? 505  LEU B CG  1 
ATOM   8330 C  CD1 . LEU B 1 505 ? -10.986 -69.507 0.014   1.00 29.13  ? 505  LEU B CD1 1 
ATOM   8331 C  CD2 . LEU B 1 505 ? -11.990 -71.754 0.600   1.00 27.60  ? 505  LEU B CD2 1 
ATOM   8332 N  N   . ASN B 1 506 ? -8.218  -74.278 2.200   1.00 25.16  ? 506  ASN B N   1 
ATOM   8333 C  CA  . ASN B 1 506 ? -7.019  -75.087 1.987   1.00 28.29  ? 506  ASN B CA  1 
ATOM   8334 C  C   . ASN B 1 506 ? -7.467  -76.473 1.538   1.00 26.80  ? 506  ASN B C   1 
ATOM   8335 O  O   . ASN B 1 506 ? -8.649  -76.698 1.260   1.00 28.85  ? 506  ASN B O   1 
ATOM   8336 C  CB  . ASN B 1 506 ? -6.143  -75.138 3.246   1.00 29.47  ? 506  ASN B CB  1 
ATOM   8337 C  CG  . ASN B 1 506 ? -6.885  -75.668 4.443   1.00 26.28  ? 506  ASN B CG  1 
ATOM   8338 O  OD1 . ASN B 1 506 ? -7.677  -76.598 4.326   1.00 28.86  ? 506  ASN B OD1 1 
ATOM   8339 N  ND2 . ASN B 1 506 ? -6.625  -75.087 5.607   1.00 28.38  ? 506  ASN B ND2 1 
ATOM   8340 N  N   . THR B 1 507 ? -6.531  -77.419 1.508   1.00 28.81  ? 507  THR B N   1 
ATOM   8341 C  CA  . THR B 1 507 ? -6.827  -78.747 0.990   1.00 30.56  ? 507  THR B CA  1 
ATOM   8342 C  C   . THR B 1 507 ? -7.455  -79.675 2.020   1.00 31.56  ? 507  THR B C   1 
ATOM   8343 O  O   . THR B 1 507 ? -7.850  -80.788 1.660   1.00 33.78  ? 507  THR B O   1 
ATOM   8344 C  CB  . THR B 1 507 ? -5.555  -79.394 0.439   1.00 32.16  ? 507  THR B CB  1 
ATOM   8345 O  OG1 . THR B 1 507 ? -4.538  -79.387 1.447   1.00 30.61  ? 507  THR B OG1 1 
ATOM   8346 C  CG2 . THR B 1 507 ? -5.055  -78.636 -0.801  1.00 32.21  ? 507  THR B CG2 1 
ATOM   8347 N  N   . GLU B 1 508 ? -7.560  -79.255 3.275   1.00 31.74  ? 508  GLU B N   1 
ATOM   8348 C  CA  . GLU B 1 508 ? -8.186  -80.053 4.317   1.00 30.87  ? 508  GLU B CA  1 
ATOM   8349 C  C   . GLU B 1 508 ? -9.696  -79.834 4.330   1.00 34.49  ? 508  GLU B C   1 
ATOM   8350 O  O   . GLU B 1 508 ? -10.195 -78.839 3.794   1.00 32.23  ? 508  GLU B O   1 
ATOM   8351 C  CB  . GLU B 1 508 ? -7.589  -79.692 5.681   1.00 28.12  ? 508  GLU B CB  1 
ATOM   8352 C  CG  . GLU B 1 508 ? -6.149  -80.135 5.843   1.00 30.22  ? 508  GLU B CG  1 
ATOM   8353 C  CD  . GLU B 1 508 ? -5.502  -79.561 7.091   1.00 39.19  ? 508  GLU B CD  1 
ATOM   8354 O  OE1 . GLU B 1 508 ? -6.024  -78.558 7.630   1.00 36.97  ? 508  GLU B OE1 1 
ATOM   8355 O  OE2 . GLU B 1 508 ? -4.477  -80.114 7.534   1.00 43.66  ? 508  GLU B OE2 1 
ATOM   8356 N  N   . PRO B 1 509 ? -10.452 -80.753 4.930   1.00 33.32  ? 509  PRO B N   1 
ATOM   8357 C  CA  . PRO B 1 509 ? -11.880 -80.499 5.161   1.00 34.66  ? 509  PRO B CA  1 
ATOM   8358 C  C   . PRO B 1 509 ? -12.099 -79.160 5.848   1.00 37.24  ? 509  PRO B C   1 
ATOM   8359 O  O   . PRO B 1 509 ? -11.277 -78.703 6.647   1.00 33.04  ? 509  PRO B O   1 
ATOM   8360 C  CB  . PRO B 1 509 ? -12.307 -81.662 6.063   1.00 32.99  ? 509  PRO B CB  1 
ATOM   8361 C  CG  . PRO B 1 509 ? -11.360 -82.759 5.725   1.00 38.14  ? 509  PRO B CG  1 
ATOM   8362 C  CD  . PRO B 1 509 ? -10.047 -82.099 5.380   1.00 35.49  ? 509  PRO B CD  1 
ATOM   8363 N  N   . MET B 1 510 ? -13.236 -78.545 5.537   1.00 35.94  ? 510  MET B N   1 
ATOM   8364 C  CA  . MET B 1 510 ? -13.522 -77.191 5.987   1.00 35.55  ? 510  MET B CA  1 
ATOM   8365 C  C   . MET B 1 510 ? -13.498 -77.081 7.507   1.00 35.55  ? 510  MET B C   1 
ATOM   8366 O  O   . MET B 1 510 ? -14.011 -77.949 8.218   1.00 35.82  ? 510  MET B O   1 
ATOM   8367 C  CB  . MET B 1 510 ? -14.886 -76.754 5.461   1.00 36.70  ? 510  MET B CB  1 
ATOM   8368 C  CG  . MET B 1 510 ? -15.396 -75.454 6.045   1.00 38.09  ? 510  MET B CG  1 
ATOM   8369 S  SD  . MET B 1 510 ? -17.025 -75.046 5.384   1.00 38.92  ? 510  MET B SD  1 
ATOM   8370 C  CE  . MET B 1 510 ? -16.713 -75.182 3.626   1.00 35.14  ? 510  MET B CE  1 
ATOM   8371 N  N   . LYS B 1 511 ? -12.880 -76.007 8.003   1.00 30.54  ? 511  LYS B N   1 
ATOM   8372 C  CA  . LYS B 1 511 ? -12.995 -75.601 9.396   1.00 34.16  ? 511  LYS B CA  1 
ATOM   8373 C  C   . LYS B 1 511 ? -13.625 -74.222 9.441   1.00 29.21  ? 511  LYS B C   1 
ATOM   8374 O  O   . LYS B 1 511 ? -13.290 -73.347 8.636   1.00 31.66  ? 511  LYS B O   1 
ATOM   8375 C  CB  . LYS B 1 511 ? -11.635 -75.560 10.121  1.00 33.41  ? 511  LYS B CB  1 
ATOM   8376 C  CG  . LYS B 1 511 ? -10.897 -76.879 10.176  1.00 39.31  ? 511  LYS B CG  1 
ATOM   8377 C  CD  . LYS B 1 511 ? -9.597  -76.761 10.980  1.00 43.96  ? 511  LYS B CD  1 
ATOM   8378 N  N   . VAL B 1 512 ? -14.542 -74.040 10.372  1.00 26.51  ? 512  VAL B N   1 
ATOM   8379 C  CA  . VAL B 1 512 ? -15.132 -72.745 10.666  1.00 27.00  ? 512  VAL B CA  1 
ATOM   8380 C  C   . VAL B 1 512 ? -14.442 -72.191 11.902  1.00 31.31  ? 512  VAL B C   1 
ATOM   8381 O  O   . VAL B 1 512 ? -14.232 -72.916 12.884  1.00 31.54  ? 512  VAL B O   1 
ATOM   8382 C  CB  . VAL B 1 512 ? -16.651 -72.861 10.888  1.00 32.34  ? 512  VAL B CB  1 
ATOM   8383 C  CG1 . VAL B 1 512 ? -17.223 -71.552 11.423  1.00 26.58  ? 512  VAL B CG1 1 
ATOM   8384 C  CG2 . VAL B 1 512 ? -17.352 -73.287 9.594   1.00 27.57  ? 512  VAL B CG2 1 
ATOM   8385 N  N   . HIS B 1 513 ? -14.082 -70.916 11.854  1.00 27.42  ? 513  HIS B N   1 
ATOM   8386 C  CA  . HIS B 1 513 ? -13.503 -70.206 12.981  1.00 28.46  ? 513  HIS B CA  1 
ATOM   8387 C  C   . HIS B 1 513 ? -14.299 -68.929 13.202  1.00 29.18  ? 513  HIS B C   1 
ATOM   8388 O  O   . HIS B 1 513 ? -15.162 -68.564 12.400  1.00 26.95  ? 513  HIS B O   1 
ATOM   8389 C  CB  . HIS B 1 513 ? -12.030 -69.851 12.751  1.00 29.71  ? 513  HIS B CB  1 
ATOM   8390 C  CG  . HIS B 1 513 ? -11.179 -70.993 12.291  1.00 32.96  ? 513  HIS B CG  1 
ATOM   8391 N  ND1 . HIS B 1 513 ? -10.781 -72.011 13.132  1.00 30.74  ? 513  HIS B ND1 1 
ATOM   8392 C  CD2 . HIS B 1 513 ? -10.600 -71.245 11.092  1.00 30.80  ? 513  HIS B CD2 1 
ATOM   8393 C  CE1 . HIS B 1 513 ? -10.016 -72.855 12.460  1.00 33.13  ? 513  HIS B CE1 1 
ATOM   8394 N  NE2 . HIS B 1 513 ? -9.887  -72.411 11.221  1.00 32.78  ? 513  HIS B NE2 1 
ATOM   8395 N  N   . GLN B 1 514 ? -13.984 -68.233 14.288  1.00 27.97  ? 514  GLN B N   1 
ATOM   8396 C  CA  . GLN B 1 514 ? -14.585 -66.940 14.577  1.00 25.60  ? 514  GLN B CA  1 
ATOM   8397 C  C   . GLN B 1 514 ? -13.503 -65.919 14.906  1.00 25.04  ? 514  GLN B C   1 
ATOM   8398 O  O   . GLN B 1 514 ? -12.436 -66.263 15.429  1.00 25.64  ? 514  GLN B O   1 
ATOM   8399 C  CB  . GLN B 1 514 ? -15.585 -67.039 15.749  1.00 26.88  ? 514  GLN B CB  1 
ATOM   8400 C  CG  . GLN B 1 514 ? -16.771 -67.931 15.460  1.00 29.83  ? 514  GLN B CG  1 
ATOM   8401 C  CD  . GLN B 1 514 ? -17.702 -68.067 16.660  1.00 36.77  ? 514  GLN B CD  1 
ATOM   8402 O  OE1 . GLN B 1 514 ? -18.077 -69.173 17.037  1.00 49.23  ? 514  GLN B OE1 1 
ATOM   8403 N  NE2 . GLN B 1 514 ? -18.070 -66.940 17.263  1.00 30.92  ? 514  GLN B NE2 1 
ATOM   8404 N  N   . ARG B 1 515 ? -13.809 -64.652 14.608  1.00 22.09  ? 515  ARG B N   1 
ATOM   8405 C  CA  . ARG B 1 515 ? -12.992 -63.499 14.984  1.00 21.44  ? 515  ARG B CA  1 
ATOM   8406 C  C   . ARG B 1 515 ? -11.566 -63.626 14.433  1.00 25.21  ? 515  ARG B C   1 
ATOM   8407 O  O   . ARG B 1 515 ? -10.581 -63.796 15.159  1.00 22.21  ? 515  ARG B O   1 
ATOM   8408 C  CB  . ARG B 1 515 ? -12.995 -63.313 16.512  1.00 23.06  ? 515  ARG B CB  1 
ATOM   8409 C  CG  . ARG B 1 515 ? -14.398 -63.118 17.071  1.00 25.13  ? 515  ARG B CG  1 
ATOM   8410 C  CD  . ARG B 1 515 ? -14.381 -62.757 18.556  1.00 29.75  ? 515  ARG B CD  1 
ATOM   8411 N  NE  . ARG B 1 515 ? -15.722 -62.430 19.037  1.00 29.56  ? 515  ARG B NE  1 
ATOM   8412 C  CZ  . ARG B 1 515 ? -15.970 -61.922 20.240  1.00 40.75  ? 515  ARG B CZ  1 
ATOM   8413 N  NH1 . ARG B 1 515 ? -14.961 -61.684 21.073  1.00 33.33  ? 515  ARG B NH1 1 
ATOM   8414 N  NH2 . ARG B 1 515 ? -17.217 -61.648 20.611  1.00 35.63  ? 515  ARG B NH2 1 
ATOM   8415 N  N   . LEU B 1 516 ? -11.484 -63.518 13.111  1.00 22.16  ? 516  LEU B N   1 
ATOM   8416 C  CA  . LEU B 1 516 ? -10.200 -63.567 12.414  1.00 18.13  ? 516  LEU B CA  1 
ATOM   8417 C  C   . LEU B 1 516 ? -9.215  -62.541 12.967  1.00 20.99  ? 516  LEU B C   1 
ATOM   8418 O  O   . LEU B 1 516 ? -9.452  -61.331 12.895  1.00 20.87  ? 516  LEU B O   1 
ATOM   8419 C  CB  . LEU B 1 516 ? -10.447 -63.346 10.908  1.00 19.03  ? 516  LEU B CB  1 
ATOM   8420 C  CG  . LEU B 1 516 ? -9.289  -63.300 9.901   1.00 25.71  ? 516  LEU B CG  1 
ATOM   8421 C  CD1 . LEU B 1 516 ? -8.250  -64.334 10.176  1.00 28.78  ? 516  LEU B CD1 1 
ATOM   8422 C  CD2 . LEU B 1 516 ? -9.870  -63.513 8.487   1.00 22.31  ? 516  LEU B CD2 1 
ATOM   8423 N  N   . ARG B 1 517 ? -8.122  -63.043 13.554  1.00 20.91  ? 517  ARG B N   1 
ATOM   8424 C  CA  . ARG B 1 517 ? -7.021  -62.229 14.100  1.00 24.66  ? 517  ARG B CA  1 
ATOM   8425 C  C   . ARG B 1 517 ? -7.531  -61.050 14.938  1.00 22.83  ? 517  ARG B C   1 
ATOM   8426 O  O   . ARG B 1 517 ? -7.040  -59.919 14.859  1.00 23.32  ? 517  ARG B O   1 
ATOM   8427 C  CB  . ARG B 1 517 ? -6.080  -61.780 12.979  1.00 29.00  ? 517  ARG B CB  1 
ATOM   8428 C  CG  . ARG B 1 517 ? -5.127  -62.929 12.607  1.00 31.53  ? 517  ARG B CG  1 
ATOM   8429 C  CD  . ARG B 1 517 ? -4.056  -62.579 11.597  1.00 34.17  ? 517  ARG B CD  1 
ATOM   8430 N  NE  . ARG B 1 517 ? -2.884  -61.970 12.217  1.00 35.26  ? 517  ARG B NE  1 
ATOM   8431 C  CZ  . ARG B 1 517 ? -2.059  -62.582 13.065  1.00 38.20  ? 517  ARG B CZ  1 
ATOM   8432 N  NH1 . ARG B 1 517 ? -2.267  -63.847 13.421  1.00 36.63  ? 517  ARG B NH1 1 
ATOM   8433 N  NH2 . ARG B 1 517 ? -1.010  -61.921 13.551  1.00 27.31  ? 517  ARG B NH2 1 
ATOM   8434 N  N   . VAL B 1 518 ? -8.501  -61.347 15.804  1.00 24.56  ? 518  VAL B N   1 
ATOM   8435 C  CA  . VAL B 1 518 ? -9.194  -60.284 16.526  1.00 22.64  ? 518  VAL B CA  1 
ATOM   8436 C  C   . VAL B 1 518 ? -8.240  -59.560 17.464  1.00 19.54  ? 518  VAL B C   1 
ATOM   8437 O  O   . VAL B 1 518 ? -8.324  -58.334 17.632  1.00 23.29  ? 518  VAL B O   1 
ATOM   8438 C  CB  . VAL B 1 518 ? -10.411 -60.859 17.275  1.00 23.04  ? 518  VAL B CB  1 
ATOM   8439 C  CG1 . VAL B 1 518 ? -9.970  -61.920 18.291  1.00 26.36  ? 518  VAL B CG1 1 
ATOM   8440 C  CG2 . VAL B 1 518 ? -11.222 -59.730 17.945  1.00 24.72  ? 518  VAL B CG2 1 
ATOM   8441 N  N   . GLN B 1 519 ? -7.314  -60.293 18.086  1.00 21.61  ? 519  GLN B N   1 
ATOM   8442 C  CA  . GLN B 1 519 ? -6.438  -59.668 19.078  1.00 22.39  ? 519  GLN B CA  1 
ATOM   8443 C  C   . GLN B 1 519 ? -5.561  -58.608 18.432  1.00 21.32  ? 519  GLN B C   1 
ATOM   8444 O  O   . GLN B 1 519 ? -5.532  -57.454 18.872  1.00 22.91  ? 519  GLN B O   1 
ATOM   8445 C  CB  . GLN B 1 519 ? -5.578  -60.716 19.785  1.00 21.72  ? 519  GLN B CB  1 
ATOM   8446 C  CG  . GLN B 1 519 ? -4.847  -60.152 21.008  1.00 23.76  ? 519  GLN B CG  1 
ATOM   8447 C  CD  . GLN B 1 519 ? -5.767  -60.026 22.207  1.00 27.77  ? 519  GLN B CD  1 
ATOM   8448 O  OE1 . GLN B 1 519 ? -6.740  -60.773 22.332  1.00 28.28  ? 519  GLN B OE1 1 
ATOM   8449 N  NE2 . GLN B 1 519 ? -5.470  -59.076 23.092  1.00 26.06  ? 519  GLN B NE2 1 
ATOM   8450 N  N   . MET B 1 520 ? -4.866  -58.967 17.354  1.00 23.50  ? 520  MET B N   1 
ATOM   8451 C  CA  . MET B 1 520 ? -4.046  -57.965 16.692  1.00 22.76  ? 520  MET B CA  1 
ATOM   8452 C  C   . MET B 1 520 ? -4.884  -56.862 16.065  1.00 22.16  ? 520  MET B C   1 
ATOM   8453 O  O   . MET B 1 520 ? -4.449  -55.703 16.023  1.00 22.75  ? 520  MET B O   1 
ATOM   8454 C  CB  . MET B 1 520 ? -3.141  -58.611 15.633  1.00 21.90  ? 520  MET B CB  1 
ATOM   8455 C  CG  . MET B 1 520 ? -2.074  -59.565 16.202  1.00 27.41  ? 520  MET B CG  1 
ATOM   8456 S  SD  . MET B 1 520 ? -1.020  -58.944 17.544  1.00 33.60  ? 520  MET B SD  1 
ATOM   8457 C  CE  . MET B 1 520 ? -1.050  -57.200 17.303  1.00 32.72  ? 520  MET B CE  1 
ATOM   8458 N  N   . CYS B 1 521 ? -6.082  -57.183 15.588  1.00 21.24  ? 521  CYS B N   1 
ATOM   8459 C  CA  . CYS B 1 521 ? -6.834  -56.150 14.893  1.00 24.83  ? 521  CYS B CA  1 
ATOM   8460 C  C   . CYS B 1 521 ? -7.469  -55.158 15.859  1.00 23.82  ? 521  CYS B C   1 
ATOM   8461 O  O   . CYS B 1 521 ? -7.633  -53.988 15.502  1.00 23.11  ? 521  CYS B O   1 
ATOM   8462 C  CB  . CYS B 1 521 ? -7.862  -56.793 13.957  1.00 25.16  ? 521  CYS B CB  1 
ATOM   8463 S  SG  . CYS B 1 521 ? -7.018  -57.622 12.545  1.00 25.81  ? 521  CYS B SG  1 
ATOM   8464 N  N   . VAL B 1 522 ? -7.754  -55.555 17.106  1.00 23.66  ? 522  VAL B N   1 
ATOM   8465 C  CA  . VAL B 1 522 ? -8.104  -54.534 18.089  1.00 21.67  ? 522  VAL B CA  1 
ATOM   8466 C  C   . VAL B 1 522 ? -6.949  -53.560 18.254  1.00 21.32  ? 522  VAL B C   1 
ATOM   8467 O  O   . VAL B 1 522 ? -7.153  -52.344 18.353  1.00 24.06  ? 522  VAL B O   1 
ATOM   8468 C  CB  . VAL B 1 522 ? -8.509  -55.175 19.434  1.00 28.26  ? 522  VAL B CB  1 
ATOM   8469 C  CG1 . VAL B 1 522 ? -8.688  -54.095 20.495  1.00 24.77  ? 522  VAL B CG1 1 
ATOM   8470 C  CG2 . VAL B 1 522 ? -9.803  -55.973 19.258  1.00 29.03  ? 522  VAL B CG2 1 
ATOM   8471 N  N   . PHE B 1 523 ? -5.709  -54.076 18.267  1.00 22.61  ? 523  PHE B N   1 
ATOM   8472 C  CA  . PHE B 1 523 ? -4.539  -53.201 18.343  1.00 22.62  ? 523  PHE B CA  1 
ATOM   8473 C  C   . PHE B 1 523 ? -4.479  -52.254 17.152  1.00 22.37  ? 523  PHE B C   1 
ATOM   8474 O  O   . PHE B 1 523 ? -4.342  -51.036 17.323  1.00 23.26  ? 523  PHE B O   1 
ATOM   8475 C  CB  . PHE B 1 523 ? -3.250  -54.030 18.431  1.00 20.91  ? 523  PHE B CB  1 
ATOM   8476 C  CG  . PHE B 1 523 ? -1.980  -53.202 18.363  1.00 25.42  ? 523  PHE B CG  1 
ATOM   8477 C  CD1 . PHE B 1 523 ? -1.466  -52.603 19.497  1.00 26.17  ? 523  PHE B CD1 1 
ATOM   8478 C  CD2 . PHE B 1 523 ? -1.313  -53.022 17.156  1.00 25.70  ? 523  PHE B CD2 1 
ATOM   8479 C  CE1 . PHE B 1 523 ? -0.307  -51.842 19.450  1.00 24.66  ? 523  PHE B CE1 1 
ATOM   8480 C  CE2 . PHE B 1 523 ? -0.151  -52.258 17.089  1.00 27.69  ? 523  PHE B CE2 1 
ATOM   8481 C  CZ  . PHE B 1 523 ? 0.362   -51.672 18.238  1.00 25.53  ? 523  PHE B CZ  1 
ATOM   8482 N  N   . TRP B 1 524 ? -4.587  -52.797 15.929  1.00 21.92  ? 524  TRP B N   1 
ATOM   8483 C  CA  . TRP B 1 524 ? -4.411  -51.972 14.739  1.00 25.27  ? 524  TRP B CA  1 
ATOM   8484 C  C   . TRP B 1 524 ? -5.604  -51.051 14.503  1.00 27.33  ? 524  TRP B C   1 
ATOM   8485 O  O   . TRP B 1 524 ? -5.428  -49.916 14.047  1.00 25.05  ? 524  TRP B O   1 
ATOM   8486 C  CB  . TRP B 1 524 ? -4.155  -52.857 13.508  1.00 21.19  ? 524  TRP B CB  1 
ATOM   8487 C  CG  . TRP B 1 524 ? -2.797  -53.501 13.548  1.00 20.93  ? 524  TRP B CG  1 
ATOM   8488 C  CD1 . TRP B 1 524 ? -2.519  -54.815 13.791  1.00 21.02  ? 524  TRP B CD1 1 
ATOM   8489 C  CD2 . TRP B 1 524 ? -1.533  -52.853 13.344  1.00 21.95  ? 524  TRP B CD2 1 
ATOM   8490 N  NE1 . TRP B 1 524 ? -1.156  -55.023 13.749  1.00 20.19  ? 524  TRP B NE1 1 
ATOM   8491 C  CE2 . TRP B 1 524 ? -0.534  -53.833 13.471  1.00 20.93  ? 524  TRP B CE2 1 
ATOM   8492 C  CE3 . TRP B 1 524 ? -1.152  -51.538 13.051  1.00 22.92  ? 524  TRP B CE3 1 
ATOM   8493 C  CZ2 . TRP B 1 524 ? 0.826   -53.539 13.336  1.00 17.82  ? 524  TRP B CZ2 1 
ATOM   8494 C  CZ3 . TRP B 1 524 ? 0.194   -51.250 12.918  1.00 21.80  ? 524  TRP B CZ3 1 
ATOM   8495 C  CH2 . TRP B 1 524 ? 1.165   -52.243 13.066  1.00 20.02  ? 524  TRP B CH2 1 
ATOM   8496 N  N   . ASN B 1 525 ? -6.822  -51.506 14.808  1.00 24.64  ? 525  ASN B N   1 
ATOM   8497 C  CA  . ASN B 1 525 ? -8.018  -50.755 14.436  1.00 26.51  ? 525  ASN B CA  1 
ATOM   8498 C  C   . ASN B 1 525 ? -8.547  -49.853 15.536  1.00 33.58  ? 525  ASN B C   1 
ATOM   8499 O  O   . ASN B 1 525 ? -9.184  -48.840 15.234  1.00 31.00  ? 525  ASN B O   1 
ATOM   8500 C  CB  . ASN B 1 525 ? -9.136  -51.705 14.001  1.00 27.12  ? 525  ASN B CB  1 
ATOM   8501 C  CG  . ASN B 1 525 ? -8.803  -52.415 12.719  1.00 27.12  ? 525  ASN B CG  1 
ATOM   8502 O  OD1 . ASN B 1 525 ? -7.938  -51.971 11.978  1.00 29.86  ? 525  ASN B OD1 1 
ATOM   8503 N  ND2 . ASN B 1 525 ? -9.485  -53.511 12.444  1.00 23.42  ? 525  ASN B ND2 1 
ATOM   8504 N  N   . GLN B 1 526 ? -8.305  -50.183 16.802  1.00 29.25  ? 526  GLN B N   1 
ATOM   8505 C  CA  . GLN B 1 526 ? -8.791  -49.362 17.902  1.00 29.23  ? 526  GLN B CA  1 
ATOM   8506 C  C   . GLN B 1 526 ? -7.649  -48.684 18.650  1.00 32.32  ? 526  GLN B C   1 
ATOM   8507 O  O   . GLN B 1 526 ? -7.600  -47.454 18.728  1.00 32.13  ? 526  GLN B O   1 
ATOM   8508 C  CB  . GLN B 1 526 ? -9.647  -50.218 18.846  1.00 31.60  ? 526  GLN B CB  1 
ATOM   8509 C  CG  . GLN B 1 526 ? -11.122 -50.251 18.462  1.00 37.08  ? 526  GLN B CG  1 
ATOM   8510 C  CD  . GLN B 1 526 ? -11.388 -51.055 17.205  1.00 49.42  ? 526  GLN B CD  1 
ATOM   8511 O  OE1 . GLN B 1 526 ? -10.977 -52.212 17.101  1.00 47.15  ? 526  GLN B OE1 1 
ATOM   8512 N  NE2 . GLN B 1 526 ? -12.077 -50.445 16.234  1.00 44.68  ? 526  GLN B NE2 1 
ATOM   8513 N  N   . PHE B 1 527 ? -6.686  -49.443 19.169  1.00 27.52  ? 527  PHE B N   1 
ATOM   8514 C  CA  . PHE B 1 527 ? -5.741  -48.850 20.112  1.00 27.33  ? 527  PHE B CA  1 
ATOM   8515 C  C   . PHE B 1 527 ? -4.720  -47.952 19.417  1.00 26.75  ? 527  PHE B C   1 
ATOM   8516 O  O   . PHE B 1 527 ? -4.542  -46.790 19.794  1.00 27.39  ? 527  PHE B O   1 
ATOM   8517 C  CB  . PHE B 1 527 ? -5.027  -49.934 20.914  1.00 28.77  ? 527  PHE B CB  1 
ATOM   8518 C  CG  . PHE B 1 527 ? -4.023  -49.382 21.876  1.00 29.98  ? 527  PHE B CG  1 
ATOM   8519 C  CD1 . PHE B 1 527 ? -4.443  -48.707 23.012  1.00 31.16  ? 527  PHE B CD1 1 
ATOM   8520 C  CD2 . PHE B 1 527 ? -2.668  -49.508 21.634  1.00 28.21  ? 527  PHE B CD2 1 
ATOM   8521 C  CE1 . PHE B 1 527 ? -3.529  -48.183 23.894  1.00 25.89  ? 527  PHE B CE1 1 
ATOM   8522 C  CE2 . PHE B 1 527 ? -1.739  -48.987 22.515  1.00 29.06  ? 527  PHE B CE2 1 
ATOM   8523 C  CZ  . PHE B 1 527 ? -2.169  -48.325 23.647  1.00 28.86  ? 527  PHE B CZ  1 
ATOM   8524 N  N   . LEU B 1 528 ? -4.000  -48.481 18.428  1.00 26.57  ? 528  LEU B N   1 
ATOM   8525 C  CA  . LEU B 1 528 ? -2.934  -47.680 17.821  1.00 25.84  ? 528  LEU B CA  1 
ATOM   8526 C  C   . LEU B 1 528 ? -3.441  -46.368 17.232  1.00 29.12  ? 528  LEU B C   1 
ATOM   8527 O  O   . LEU B 1 528 ? -2.794  -45.329 17.459  1.00 29.68  ? 528  LEU B O   1 
ATOM   8528 C  CB  . LEU B 1 528 ? -2.183  -48.495 16.760  1.00 28.81  ? 528  LEU B CB  1 
ATOM   8529 C  CG  . LEU B 1 528 ? -0.951  -47.775 16.170  1.00 29.37  ? 528  LEU B CG  1 
ATOM   8530 C  CD1 . LEU B 1 528 ? 0.132   -47.555 17.207  1.00 28.41  ? 528  LEU B CD1 1 
ATOM   8531 C  CD2 . LEU B 1 528 ? -0.392  -48.525 14.958  1.00 27.82  ? 528  LEU B CD2 1 
ATOM   8532 N  N   . PRO B 1 529 ? -4.551  -46.326 16.471  1.00 30.85  ? 529  PRO B N   1 
ATOM   8533 C  CA  . PRO B 1 529 ? -5.012  -45.023 15.957  1.00 33.67  ? 529  PRO B CA  1 
ATOM   8534 C  C   . PRO B 1 529 ? -5.256  -44.030 17.067  1.00 33.77  ? 529  PRO B C   1 
ATOM   8535 O  O   . PRO B 1 529 ? -4.948  -42.838 16.932  1.00 35.03  ? 529  PRO B O   1 
ATOM   8536 C  CB  . PRO B 1 529 ? -6.306  -45.374 15.211  1.00 35.88  ? 529  PRO B CB  1 
ATOM   8537 C  CG  . PRO B 1 529 ? -6.135  -46.801 14.822  1.00 34.96  ? 529  PRO B CG  1 
ATOM   8538 C  CD  . PRO B 1 529 ? -5.399  -47.429 15.976  1.00 31.66  ? 529  PRO B CD  1 
ATOM   8539 N  N   . LYS B 1 530 ? -5.764  -44.521 18.196  1.00 33.26  ? 530  LYS B N   1 
ATOM   8540 C  CA  . LYS B 1 530 ? -6.009  -43.654 19.336  1.00 35.30  ? 530  LYS B CA  1 
ATOM   8541 C  C   . LYS B 1 530 ? -4.702  -43.161 19.948  1.00 36.69  ? 530  LYS B C   1 
ATOM   8542 O  O   . LYS B 1 530 ? -4.589  -41.989 20.323  1.00 38.43  ? 530  LYS B O   1 
ATOM   8543 C  CB  . LYS B 1 530 ? -6.860  -44.403 20.356  1.00 35.94  ? 530  LYS B CB  1 
ATOM   8544 C  CG  . LYS B 1 530 ? -7.360  -43.544 21.453  1.00 44.48  ? 530  LYS B CG  1 
ATOM   8545 C  CD  . LYS B 1 530 ? -8.430  -44.257 22.215  1.00 45.78  ? 530  LYS B CD  1 
ATOM   8546 C  CE  . LYS B 1 530 ? -8.819  -43.414 23.414  1.00 53.33  ? 530  LYS B CE  1 
ATOM   8547 N  NZ  . LYS B 1 530 ? -10.095 -43.863 24.010  1.00 51.78  ? 530  LYS B NZ  1 
ATOM   8548 N  N   . LEU B 1 531 ? -3.694  -44.031 20.037  1.00 33.45  ? 531  LEU B N   1 
ATOM   8549 C  CA  . LEU B 1 531 ? -2.380  -43.596 20.498  1.00 35.42  ? 531  LEU B CA  1 
ATOM   8550 C  C   . LEU B 1 531 ? -1.800  -42.533 19.569  1.00 40.55  ? 531  LEU B C   1 
ATOM   8551 O  O   . LEU B 1 531 ? -1.236  -41.532 20.026  1.00 37.76  ? 531  LEU B O   1 
ATOM   8552 C  CB  . LEU B 1 531 ? -1.445  -44.806 20.594  1.00 32.54  ? 531  LEU B CB  1 
ATOM   8553 C  CG  . LEU B 1 531 ? -0.010  -44.659 21.117  1.00 34.43  ? 531  LEU B CG  1 
ATOM   8554 C  CD1 . LEU B 1 531 ? 0.499   -46.003 21.601  1.00 32.30  ? 531  LEU B CD1 1 
ATOM   8555 C  CD2 . LEU B 1 531 ? 0.934   -44.111 20.060  1.00 36.98  ? 531  LEU B CD2 1 
ATOM   8556 N  N   . LEU B 1 532 ? -1.914  -42.744 18.259  1.00 34.35  ? 532  LEU B N   1 
ATOM   8557 C  CA  . LEU B 1 532 ? -1.327  -41.800 17.312  1.00 38.64  ? 532  LEU B CA  1 
ATOM   8558 C  C   . LEU B 1 532 ? -2.076  -40.473 17.285  1.00 41.18  ? 532  LEU B C   1 
ATOM   8559 O  O   . LEU B 1 532 ? -1.472  -39.429 17.012  1.00 47.10  ? 532  LEU B O   1 
ATOM   8560 C  CB  . LEU B 1 532 ? -1.297  -42.418 15.918  1.00 33.40  ? 532  LEU B CB  1 
ATOM   8561 C  CG  . LEU B 1 532 ? -0.418  -43.656 15.738  1.00 33.59  ? 532  LEU B CG  1 
ATOM   8562 C  CD1 . LEU B 1 532 ? -0.419  -44.092 14.275  1.00 37.07  ? 532  LEU B CD1 1 
ATOM   8563 C  CD2 . LEU B 1 532 ? 1.007   -43.378 16.226  1.00 39.23  ? 532  LEU B CD2 1 
ATOM   8564 N  N   . ASN B 1 533 ? -3.383  -40.491 17.554  1.00 44.82  ? 533  ASN B N   1 
ATOM   8565 C  CA  . ASN B 1 533 ? -4.148  -39.249 17.611  1.00 48.92  ? 533  ASN B CA  1 
ATOM   8566 C  C   . ASN B 1 533 ? -3.829  -38.461 18.877  1.00 50.66  ? 533  ASN B C   1 
ATOM   8567 O  O   . ASN B 1 533 ? -3.811  -37.225 18.860  1.00 54.98  ? 533  ASN B O   1 
ATOM   8568 C  CB  . ASN B 1 533 ? -5.644  -39.551 17.530  1.00 45.79  ? 533  ASN B CB  1 
ATOM   8569 C  CG  . ASN B 1 533 ? -6.467  -38.321 17.212  1.00 59.87  ? 533  ASN B CG  1 
ATOM   8570 O  OD1 . ASN B 1 533 ? -5.952  -37.348 16.660  1.00 62.58  ? 533  ASN B OD1 1 
ATOM   8571 N  ND2 . ASN B 1 533 ? -7.753  -38.355 17.557  1.00 63.44  ? 533  ASN B ND2 1 
ATOM   8572 N  N   . ALA B 1 534 ? -3.589  -39.156 19.989  1.00 49.75  ? 534  ALA B N   1 
ATOM   8573 C  CA  . ALA B 1 534 ? -3.221  -38.463 21.220  1.00 52.92  ? 534  ALA B CA  1 
ATOM   8574 C  C   . ALA B 1 534 ? -1.890  -37.747 21.064  1.00 54.21  ? 534  ALA B C   1 
ATOM   8575 O  O   . ALA B 1 534 ? -1.731  -36.604 21.510  1.00 56.10  ? 534  ALA B O   1 
ATOM   8576 C  CB  . ALA B 1 534 ? -3.154  -39.455 22.380  1.00 48.42  ? 534  ALA B CB  1 
ATOM   8577 N  N   . THR B 1 535 ? -0.931  -38.402 20.423  1.00 61.65  ? 535  THR B N   1 
ATOM   8578 C  CA  . THR B 1 535 ? 0.431   -37.904 20.308  1.00 64.06  ? 535  THR B CA  1 
ATOM   8579 C  C   . THR B 1 535 ? 0.737   -37.462 18.877  1.00 64.17  ? 535  THR B C   1 
ATOM   8580 O  O   . THR B 1 535 ? 1.901   -37.307 18.498  1.00 74.74  ? 535  THR B O   1 
ATOM   8581 C  CB  . THR B 1 535 ? 1.451   -38.984 20.749  1.00 61.03  ? 535  THR B CB  1 
ATOM   8582 O  OG1 . THR B 1 535 ? 0.997   -40.280 20.329  1.00 49.44  ? 535  THR B OG1 1 
ATOM   8583 C  CG2 . THR B 1 535 ? 1.627   -38.979 22.255  1.00 55.53  ? 535  THR B CG2 1 
HETATM 8584 C  C1  . NAG C 2 .   ? -6.291  -5.900  -9.233  1.00 51.26  ? 601  NAG A C1  1 
HETATM 8585 C  C2  . NAG C 2 .   ? -6.293  -6.338  -10.688 1.00 56.91  ? 601  NAG A C2  1 
HETATM 8586 C  C3  . NAG C 2 .   ? -5.682  -7.723  -10.802 1.00 60.58  ? 601  NAG A C3  1 
HETATM 8587 C  C4  . NAG C 2 .   ? -4.261  -7.694  -10.255 1.00 58.79  ? 601  NAG A C4  1 
HETATM 8588 C  C5  . NAG C 2 .   ? -4.241  -7.141  -8.825  1.00 60.04  ? 601  NAG A C5  1 
HETATM 8589 C  C6  . NAG C 2 .   ? -2.834  -6.888  -8.326  1.00 60.63  ? 601  NAG A C6  1 
HETATM 8590 C  C7  . NAG C 2 .   ? -7.934  -5.611  -12.361 1.00 61.80  ? 601  NAG A C7  1 
HETATM 8591 C  C8  . NAG C 2 .   ? -6.809  -4.844  -12.988 1.00 61.15  ? 601  NAG A C8  1 
HETATM 8592 N  N2  . NAG C 2 .   ? -7.629  -6.310  -11.261 1.00 54.30  ? 601  NAG A N2  1 
HETATM 8593 O  O3  . NAG C 2 .   ? -5.687  -8.140  -12.163 1.00 68.37  ? 601  NAG A O3  1 
HETATM 8594 O  O4  . NAG C 2 .   ? -3.700  -9.002  -10.272 1.00 66.86  ? 601  NAG A O4  1 
HETATM 8595 O  O5  . NAG C 2 .   ? -4.940  -5.884  -8.737  1.00 48.31  ? 601  NAG A O5  1 
HETATM 8596 O  O6  . NAG C 2 .   ? -2.647  -5.536  -7.931  1.00 61.81  ? 601  NAG A O6  1 
HETATM 8597 O  O7  . NAG C 2 .   ? -9.067  -5.601  -12.830 1.00 63.61  ? 601  NAG A O7  1 
HETATM 8598 C  C1  . NAG D 2 .   ? -31.125 -6.122  29.607  1.00 43.62  ? 602  NAG A C1  1 
HETATM 8599 C  C2  . NAG D 2 .   ? -31.312 -6.761  30.988  1.00 44.55  ? 602  NAG A C2  1 
HETATM 8600 C  C3  . NAG D 2 .   ? -32.666 -7.469  31.075  1.00 49.53  ? 602  NAG A C3  1 
HETATM 8601 C  C4  . NAG D 2 .   ? -33.788 -6.522  30.671  1.00 52.61  ? 602  NAG A C4  1 
HETATM 8602 C  C5  . NAG D 2 .   ? -33.495 -5.942  29.291  1.00 53.23  ? 602  NAG A C5  1 
HETATM 8603 C  C6  . NAG D 2 .   ? -34.522 -4.931  28.832  1.00 53.26  ? 602  NAG A C6  1 
HETATM 8604 C  C7  . NAG D 2 .   ? -29.178 -7.362  32.022  1.00 42.66  ? 602  NAG A C7  1 
HETATM 8605 C  C8  . NAG D 2 .   ? -28.152 -8.434  32.221  1.00 41.42  ? 602  NAG A C8  1 
HETATM 8606 N  N2  . NAG D 2 .   ? -30.231 -7.691  31.271  1.00 44.67  ? 602  NAG A N2  1 
HETATM 8607 O  O3  . NAG D 2 .   ? -32.883 -7.924  32.406  1.00 49.84  ? 602  NAG A O3  1 
HETATM 8608 O  O4  . NAG D 2 .   ? -35.031 -7.215  30.657  1.00 60.66  ? 602  NAG A O4  1 
HETATM 8609 O  O5  . NAG D 2 .   ? -32.230 -5.266  29.319  1.00 45.69  ? 602  NAG A O5  1 
HETATM 8610 O  O6  . NAG D 2 .   ? -34.748 -3.927  29.814  1.00 51.10  ? 602  NAG A O6  1 
HETATM 8611 O  O7  . NAG D 2 .   ? -29.066 -6.252  32.528  1.00 38.58  ? 602  NAG A O7  1 
HETATM 8612 C  C1  . NAG E 2 .   ? 6.263   -26.191 12.314  1.00 62.28  ? 603  NAG A C1  1 
HETATM 8613 C  C2  . NAG E 2 .   ? 7.589   -25.445 12.062  1.00 65.97  ? 603  NAG A C2  1 
HETATM 8614 C  C3  . NAG E 2 .   ? 8.316   -25.997 10.823  1.00 66.53  ? 603  NAG A C3  1 
HETATM 8615 C  C4  . NAG E 2 .   ? 8.338   -27.521 10.795  1.00 67.66  ? 603  NAG A C4  1 
HETATM 8616 C  C5  . NAG E 2 .   ? 6.935   -28.058 11.036  1.00 71.37  ? 603  NAG A C5  1 
HETATM 8617 C  C6  . NAG E 2 .   ? 6.841   -29.569 11.036  1.00 64.84  ? 603  NAG A C6  1 
HETATM 8618 C  C7  . NAG E 2 .   ? 7.822   -23.068 12.678  1.00 68.25  ? 603  NAG A C7  1 
HETATM 8619 C  C8  . NAG E 2 .   ? 7.426   -21.663 12.332  1.00 70.63  ? 603  NAG A C8  1 
HETATM 8620 N  N2  . NAG E 2 .   ? 7.325   -24.025 11.889  1.00 68.13  ? 603  NAG A N2  1 
HETATM 8621 O  O3  . NAG E 2 .   ? 9.649   -25.498 10.823  1.00 64.24  ? 603  NAG A O3  1 
HETATM 8622 O  O4  . NAG E 2 .   ? 8.802   -27.974 9.527   1.00 69.14  ? 603  NAG A O4  1 
HETATM 8623 O  O5  . NAG E 2 .   ? 6.488   -27.595 12.315  1.00 69.32  ? 603  NAG A O5  1 
HETATM 8624 O  O6  . NAG E 2 .   ? 7.487   -30.154 12.158  1.00 68.93  ? 603  NAG A O6  1 
HETATM 8625 O  O7  . NAG E 2 .   ? 8.557   -23.323 13.628  1.00 70.49  ? 603  NAG A O7  1 
HETATM 8626 C  CAA . E1N F 3 .   ? 6.413   -5.623  20.312  1.00 26.02  ? 604  E1N A CAA 1 
HETATM 8627 C  CAB . E1N F 3 .   ? 5.032   -5.450  20.419  1.00 27.25  ? 604  E1N A CAB 1 
HETATM 8628 C  CAC . E1N F 3 .   ? 4.315   -6.217  21.324  1.00 26.89  ? 604  E1N A CAC 1 
HETATM 8629 C  CAD . E1N F 3 .   ? 4.954   -7.160  22.125  1.00 25.98  ? 604  E1N A CAD 1 
HETATM 8630 C  CAE . E1N F 3 .   ? 6.327   -7.334  22.028  1.00 28.68  ? 604  E1N A CAE 1 
HETATM 8631 C  CAF . E1N F 3 .   ? 7.073   -6.561  21.124  1.00 27.47  ? 604  E1N A CAF 1 
HETATM 8632 C  CAG . E1N F 3 .   ? 2.279   -5.198  20.725  1.00 26.85  ? 604  E1N A CAG 1 
HETATM 8633 C  CAH . E1N F 3 .   ? 2.924   -4.394  19.788  1.00 26.77  ? 604  E1N A CAH 1 
HETATM 8634 C  CAI . E1N F 3 .   ? 4.311   -4.531  19.650  1.00 27.82  ? 604  E1N A CAI 1 
HETATM 8635 C  CAJ . E1N F 3 .   ? 2.217   -3.437  19.051  1.00 30.50  ? 604  E1N A CAJ 1 
HETATM 8636 C  CAK . E1N F 3 .   ? 0.730   -3.727  18.987  1.00 24.36  ? 604  E1N A CAK 1 
HETATM 8637 C  CAL . E1N F 3 .   ? 0.215   -3.946  20.420  1.00 25.60  ? 604  E1N A CAL 1 
HETATM 8638 C  CAM . E1N F 3 .   ? 0.883   -5.190  20.961  1.00 26.93  ? 604  E1N A CAM 1 
HETATM 8639 C  CAN . E1N F 3 .   ? 2.276   -6.902  22.377  1.00 28.77  ? 604  E1N A CAN 1 
HETATM 8640 C  CAR . E1N F 3 .   ? 2.371   -2.086  19.811  1.00 24.51  ? 604  E1N A CAR 1 
HETATM 8641 C  CAS . E1N F 3 .   ? 0.489   -2.861  21.242  1.00 25.17  ? 604  E1N A CAS 1 
HETATM 8642 C  CAT . E1N F 3 .   ? 1.542   -1.991  20.982  1.00 27.83  ? 604  E1N A CAT 1 
HETATM 8643 C  CAU . E1N F 3 .   ? 1.629   -0.928  21.882  1.00 26.13  ? 604  E1N A CAU 1 
HETATM 8644 C  CAV . E1N F 3 .   ? 3.058   -0.567  22.207  1.00 35.42  ? 604  E1N A CAV 1 
HETATM 8645 N  NAO . E1N F 3 .   ? 4.977   -3.763  18.772  1.00 24.02  ? 604  E1N A NAO 1 
HETATM 8646 N  NAQ . E1N F 3 .   ? 2.989   -6.079  21.422  1.00 25.58  ? 604  E1N A NAQ 1 
HETATM 8647 CL CLA . E1N F 3 .   ? 7.094   -8.507  23.097  1.00 29.45  ? 604  E1N A CLA 1 
HETATM 8648 CL CL  . CL  G 4 .   ? 5.740   -14.991 34.983  1.00 59.86  ? 605  CL  A CL  1 
HETATM 8649 CL CL  . CL  H 4 .   ? -25.509 -6.086  38.141  1.00 54.76  ? 606  CL  A CL  1 
HETATM 8650 CL CL  . CL  I 4 .   ? -10.939 3.515   -9.260  1.00 57.96  ? 607  CL  A CL  1 
HETATM 8651 C  C1  . PEG J 5 .   ? -12.914 18.533  31.099  1.00 44.32  ? 608  PEG A C1  1 
HETATM 8652 O  O1  . PEG J 5 .   ? -12.292 18.625  32.356  1.00 51.58  ? 608  PEG A O1  1 
HETATM 8653 C  C2  . PEG J 5 .   ? -12.580 19.764  30.256  1.00 48.67  ? 608  PEG A C2  1 
HETATM 8654 O  O2  . PEG J 5 .   ? -13.384 19.816  29.106  1.00 53.49  ? 608  PEG A O2  1 
HETATM 8655 C  C3  . PEG J 5 .   ? -12.688 20.027  27.905  1.00 49.40  ? 608  PEG A C3  1 
HETATM 8656 C  C4  . PEG J 5 .   ? -12.566 21.519  27.576  1.00 49.94  ? 608  PEG A C4  1 
HETATM 8657 O  O4  . PEG J 5 .   ? -11.463 22.086  28.235  1.00 50.82  ? 608  PEG A O4  1 
HETATM 8658 C  C1  . PEG K 5 .   ? -12.559 0.870   40.973  1.00 33.20  ? 609  PEG A C1  1 
HETATM 8659 O  O1  . PEG K 5 .   ? -13.768 1.562   40.893  1.00 41.17  ? 609  PEG A O1  1 
HETATM 8660 C  C2  . PEG K 5 .   ? -12.791 -0.628  40.791  1.00 37.12  ? 609  PEG A C2  1 
HETATM 8661 O  O2  . PEG K 5 .   ? -11.987 -1.312  41.712  1.00 46.52  ? 609  PEG A O2  1 
HETATM 8662 C  C3  . PEG K 5 .   ? -11.081 -2.203  41.142  1.00 41.00  ? 609  PEG A C3  1 
HETATM 8663 C  C4  . PEG K 5 .   ? -11.581 -3.639  41.176  1.00 29.05  ? 609  PEG A C4  1 
HETATM 8664 O  O4  . PEG K 5 .   ? -12.982 -3.649  41.194  1.00 55.69  ? 609  PEG A O4  1 
HETATM 8665 C  C1  . NAG L 2 .   ? -6.860  -61.038 -36.594 1.00 43.55  ? 601  NAG B C1  1 
HETATM 8666 C  C2  . NAG L 2 .   ? -6.748  -61.491 -38.056 1.00 48.88  ? 601  NAG B C2  1 
HETATM 8667 C  C3  . NAG L 2 .   ? -6.241  -62.931 -38.127 1.00 52.68  ? 601  NAG B C3  1 
HETATM 8668 C  C4  . NAG L 2 .   ? -4.953  -63.085 -37.328 1.00 50.33  ? 601  NAG B C4  1 
HETATM 8669 C  C5  . NAG L 2 .   ? -5.144  -62.559 -35.907 1.00 48.82  ? 601  NAG B C5  1 
HETATM 8670 C  C6  . NAG L 2 .   ? -3.877  -62.581 -35.080 1.00 49.21  ? 601  NAG B C6  1 
HETATM 8671 C  C7  . NAG L 2 .   ? -8.184  -60.619 -39.846 1.00 54.00  ? 601  NAG B C7  1 
HETATM 8672 C  C8  . NAG L 2 .   ? -9.566  -60.594 -40.423 1.00 52.89  ? 601  NAG B C8  1 
HETATM 8673 N  N2  . NAG L 2 .   ? -8.021  -61.360 -38.745 1.00 48.53  ? 601  NAG B N2  1 
HETATM 8674 O  O3  . NAG L 2 .   ? -6.009  -63.286 -39.486 1.00 56.73  ? 601  NAG B O3  1 
HETATM 8675 O  O4  . NAG L 2 .   ? -4.573  -64.456 -37.278 1.00 53.48  ? 601  NAG B O4  1 
HETATM 8676 O  O5  . NAG L 2 .   ? -5.596  -61.197 -35.943 1.00 42.93  ? 601  NAG B O5  1 
HETATM 8677 O  O6  . NAG L 2 .   ? -2.770  -62.006 -35.764 1.00 52.49  ? 601  NAG B O6  1 
HETATM 8678 O  O7  . NAG L 2 .   ? -7.257  -59.995 -40.351 1.00 58.28  ? 601  NAG B O7  1 
HETATM 8679 C  C1  . NAG M 2 .   ? -31.091 -59.940 2.251   1.00 37.71  ? 602  NAG B C1  1 
HETATM 8680 C  C2  . NAG M 2 .   ? -31.349 -60.527 3.642   1.00 37.00  ? 602  NAG B C2  1 
HETATM 8681 C  C3  . NAG M 2 .   ? -32.714 -61.227 3.703   1.00 40.70  ? 602  NAG B C3  1 
HETATM 8682 C  C4  . NAG M 2 .   ? -33.818 -60.339 3.146   1.00 45.00  ? 602  NAG B C4  1 
HETATM 8683 C  C5  . NAG M 2 .   ? -33.425 -59.875 1.752   1.00 47.40  ? 602  NAG B C5  1 
HETATM 8684 C  C6  . NAG M 2 .   ? -34.450 -58.975 1.096   1.00 46.19  ? 602  NAG B C6  1 
HETATM 8685 C  C7  . NAG M 2 .   ? -29.254 -61.138 4.774   1.00 34.01  ? 602  NAG B C7  1 
HETATM 8686 C  C8  . NAG M 2 .   ? -28.258 -62.227 5.016   1.00 35.47  ? 602  NAG B C8  1 
HETATM 8687 N  N2  . NAG M 2 .   ? -30.290 -61.460 3.994   1.00 39.29  ? 602  NAG B N2  1 
HETATM 8688 O  O3  . NAG M 2 .   ? -32.998 -61.551 5.058   1.00 43.51  ? 602  NAG B O3  1 
HETATM 8689 O  O4  . NAG M 2 .   ? -35.046 -61.056 3.081   1.00 51.29  ? 602  NAG B O4  1 
HETATM 8690 O  O5  . NAG M 2 .   ? -32.205 -59.131 1.851   1.00 40.58  ? 602  NAG B O5  1 
HETATM 8691 O  O6  . NAG M 2 .   ? -34.777 -57.858 1.912   1.00 47.98  ? 602  NAG B O6  1 
HETATM 8692 O  O7  . NAG M 2 .   ? -29.130 -60.020 5.267   1.00 35.94  ? 602  NAG B O7  1 
HETATM 8693 C  C1  . NAG N 2 .   ? 6.529   -81.676 -13.698 1.00 66.50  ? 603  NAG B C1  1 
HETATM 8694 C  C2  . NAG N 2 .   ? 7.663   -80.906 -14.372 1.00 65.90  ? 603  NAG B C2  1 
HETATM 8695 C  C3  . NAG N 2 .   ? 8.412   -81.816 -15.340 1.00 70.67  ? 603  NAG B C3  1 
HETATM 8696 C  C4  . NAG N 2 .   ? 8.868   -83.087 -14.635 1.00 70.17  ? 603  NAG B C4  1 
HETATM 8697 C  C5  . NAG N 2 .   ? 7.695   -83.762 -13.928 1.00 68.25  ? 603  NAG B C5  1 
HETATM 8698 C  C6  . NAG N 2 .   ? 8.117   -84.944 -13.083 1.00 71.52  ? 603  NAG B C6  1 
HETATM 8699 C  C7  . NAG N 2 .   ? 7.644   -78.504 -14.889 1.00 67.24  ? 603  NAG B C7  1 
HETATM 8700 C  C8  . NAG N 2 .   ? 6.980   -77.415 -15.675 1.00 68.57  ? 603  NAG B C8  1 
HETATM 8701 N  N2  . NAG N 2 .   ? 7.152   -79.735 -15.063 1.00 66.86  ? 603  NAG B N2  1 
HETATM 8702 O  O3  . NAG N 2 .   ? 9.535   -81.121 -15.869 1.00 72.67  ? 603  NAG B O3  1 
HETATM 8703 O  O4  . NAG N 2 .   ? 9.428   -83.996 -15.577 1.00 72.62  ? 603  NAG B O4  1 
HETATM 8704 O  O5  . NAG N 2 .   ? 7.054   -82.831 -13.042 1.00 68.15  ? 603  NAG B O5  1 
HETATM 8705 O  O6  . NAG N 2 .   ? 8.605   -84.532 -11.813 1.00 71.68  ? 603  NAG B O6  1 
HETATM 8706 O  O7  . NAG N 2 .   ? 8.582   -78.281 -14.132 1.00 70.71  ? 603  NAG B O7  1 
HETATM 8707 C  CAA . E1N O 3 .   ? 6.424   -59.657 -6.926  1.00 24.92  ? 604  E1N B CAA 1 
HETATM 8708 C  CAB . E1N O 3 .   ? 5.033   -59.505 -6.835  1.00 24.65  ? 604  E1N B CAB 1 
HETATM 8709 C  CAC . E1N O 3 .   ? 4.313   -60.275 -5.936  1.00 26.33  ? 604  E1N B CAC 1 
HETATM 8710 C  CAD . E1N O 3 .   ? 4.961   -61.202 -5.125  1.00 23.52  ? 604  E1N B CAD 1 
HETATM 8711 C  CAE . E1N O 3 .   ? 6.340   -61.357 -5.202  1.00 27.07  ? 604  E1N B CAE 1 
HETATM 8712 C  CAF . E1N O 3 .   ? 7.076   -60.585 -6.112  1.00 25.24  ? 604  E1N B CAF 1 
HETATM 8713 C  CAG . E1N O 3 .   ? 2.269   -59.275 -6.568  1.00 25.61  ? 604  E1N B CAG 1 
HETATM 8714 C  CAH . E1N O 3 .   ? 2.921   -58.478 -7.505  1.00 27.36  ? 604  E1N B CAH 1 
HETATM 8715 C  CAI . E1N O 3 .   ? 4.309   -58.607 -7.621  1.00 26.59  ? 604  E1N B CAI 1 
HETATM 8716 C  CAJ . E1N O 3 .   ? 2.229   -57.532 -8.273  1.00 28.79  ? 604  E1N B CAJ 1 
HETATM 8717 C  CAK . E1N O 3 .   ? 0.749   -57.811 -8.348  1.00 22.96  ? 604  E1N B CAK 1 
HETATM 8718 C  CAL . E1N O 3 .   ? 0.228   -57.999 -6.915  1.00 28.20  ? 604  E1N B CAL 1 
HETATM 8719 C  CAM . E1N O 3 .   ? 0.868   -59.257 -6.364  1.00 26.56  ? 604  E1N B CAM 1 
HETATM 8720 C  CAN . E1N O 3 .   ? 2.268   -60.974 -4.883  1.00 27.73  ? 604  E1N B CAN 1 
HETATM 8721 C  CAR . E1N O 3 .   ? 2.389   -56.163 -7.550  1.00 24.69  ? 604  E1N B CAR 1 
HETATM 8722 C  CAS . E1N O 3 .   ? 0.516   -56.907 -6.098  1.00 26.83  ? 604  E1N B CAS 1 
HETATM 8723 C  CAT . E1N O 3 .   ? 1.584   -56.054 -6.367  1.00 29.14  ? 604  E1N B CAT 1 
HETATM 8724 C  CAU . E1N O 3 .   ? 1.701   -54.977 -5.500  1.00 24.52  ? 604  E1N B CAU 1 
HETATM 8725 C  CAV . E1N O 3 .   ? 3.130   -54.693 -5.097  1.00 36.31  ? 604  E1N B CAV 1 
HETATM 8726 N  NAO . E1N O 3 .   ? 4.969   -57.840 -8.496  1.00 23.25  ? 604  E1N B NAO 1 
HETATM 8727 N  NAQ . E1N O 3 .   ? 2.976   -60.148 -5.847  1.00 25.13  ? 604  E1N B NAQ 1 
HETATM 8728 CL CLA . E1N O 3 .   ? 7.123   -62.518 -4.082  1.00 26.02  ? 604  E1N B CLA 1 
HETATM 8729 CL CL  . CL  P 4 .   ? 6.011   -69.114 7.742   1.00 57.60  ? 605  CL  B CL  1 
HETATM 8730 C  C1  . PEG Q 5 .   ? -12.736 -56.720 14.285  1.00 48.21  ? 606  PEG B C1  1 
HETATM 8731 O  O1  . PEG Q 5 .   ? -11.786 -55.788 13.822  1.00 39.00  ? 606  PEG B O1  1 
HETATM 8732 C  C2  . PEG Q 5 .   ? -13.358 -56.261 15.612  1.00 41.91  ? 606  PEG B C2  1 
HETATM 8733 O  O2  . PEG Q 5 .   ? -14.382 -57.126 16.055  1.00 55.16  ? 606  PEG B O2  1 
HETATM 8734 C  C3  . PEG Q 5 .   ? -14.464 -57.293 17.444  1.00 46.11  ? 606  PEG B C3  1 
HETATM 8735 C  C4  . PEG Q 5 .   ? -15.621 -56.459 17.995  1.00 55.73  ? 606  PEG B C4  1 
HETATM 8736 O  O4  . PEG Q 5 .   ? -16.721 -57.284 18.276  1.00 46.57  ? 606  PEG B O4  1 
HETATM 8737 O  O   . HOH R 6 .   ? -11.184 -0.959  44.087  1.00 43.97  ? 701  HOH A O   1 
HETATM 8738 O  O   . HOH R 6 .   ? 10.760  -5.408  45.229  1.00 43.84  ? 702  HOH A O   1 
HETATM 8739 O  O   . HOH R 6 .   ? -28.235 -8.430  3.689   1.00 57.61  ? 703  HOH A O   1 
HETATM 8740 O  O   . HOH R 6 .   ? -24.059 -14.758 39.876  1.00 54.66  ? 704  HOH A O   1 
HETATM 8741 O  O   . HOH R 6 .   ? -15.754 1.700   41.164  1.00 58.26  ? 705  HOH A O   1 
HETATM 8742 O  O   . HOH R 6 .   ? 15.141  -14.580 20.845  1.00 44.97  ? 706  HOH A O   1 
HETATM 8743 O  O   . HOH R 6 .   ? -29.722 -4.395  33.271  1.00 52.76  ? 707  HOH A O   1 
HETATM 8744 O  O   . HOH R 6 .   ? 5.072   35.221  14.205  1.00 52.79  ? 708  HOH A O   1 
HETATM 8745 O  O   . HOH R 6 .   ? 18.843  -9.550  23.267  1.00 47.38  ? 709  HOH A O   1 
HETATM 8746 O  O   . HOH R 6 .   ? 0.594   -7.370  -2.130  1.00 51.44  ? 710  HOH A O   1 
HETATM 8747 O  O   . HOH R 6 .   ? -2.046  0.761   23.538  1.00 31.11  ? 711  HOH A O   1 
HETATM 8748 O  O   . HOH R 6 .   ? -11.070 10.936  -3.448  1.00 43.61  ? 712  HOH A O   1 
HETATM 8749 O  O   . HOH R 6 .   ? 13.699  -0.206  21.265  1.00 39.08  ? 713  HOH A O   1 
HETATM 8750 O  O   . HOH R 6 .   ? -15.704 8.648   40.693  1.00 41.04  ? 714  HOH A O   1 
HETATM 8751 O  O   . HOH R 6 .   ? 9.074   5.546   10.614  1.00 35.93  ? 715  HOH A O   1 
HETATM 8752 O  O   . HOH R 6 .   ? -27.579 1.848   4.162   1.00 36.34  ? 716  HOH A O   1 
HETATM 8753 O  O   . HOH R 6 .   ? -30.329 -9.783  30.129  1.00 53.64  ? 717  HOH A O   1 
HETATM 8754 O  O   . HOH R 6 .   ? -15.846 14.047  0.696   1.00 44.41  ? 718  HOH A O   1 
HETATM 8755 O  O   . HOH R 6 .   ? 20.883  2.547   38.861  1.00 42.86  ? 719  HOH A O   1 
HETATM 8756 O  O   . HOH R 6 .   ? -18.058 -22.683 27.623  1.00 46.81  ? 720  HOH A O   1 
HETATM 8757 O  O   . HOH R 6 .   ? 2.296   9.350   19.390  1.00 25.59  ? 721  HOH A O   1 
HETATM 8758 O  O   . HOH R 6 .   ? -18.317 4.011   -13.296 1.00 48.54  ? 722  HOH A O   1 
HETATM 8759 O  O   . HOH R 6 .   ? -10.516 20.010  19.736  1.00 37.86  ? 723  HOH A O   1 
HETATM 8760 O  O   . HOH R 6 .   ? 2.106   23.777  4.996   1.00 41.37  ? 724  HOH A O   1 
HETATM 8761 O  O   . HOH R 6 .   ? -8.444  -21.640 35.161  1.00 47.73  ? 725  HOH A O   1 
HETATM 8762 O  O   . HOH R 6 .   ? -28.304 -13.758 7.272   1.00 47.62  ? 726  HOH A O   1 
HETATM 8763 O  O   . HOH R 6 .   ? 2.969   -8.917  42.443  1.00 49.12  ? 727  HOH A O   1 
HETATM 8764 O  O   . HOH R 6 .   ? 2.830   -10.214 35.251  1.00 36.37  ? 728  HOH A O   1 
HETATM 8765 O  O   . HOH R 6 .   ? -18.053 -12.772 -8.360  1.00 48.12  ? 729  HOH A O   1 
HETATM 8766 O  O   . HOH R 6 .   ? -22.823 -7.461  16.773  1.00 30.29  ? 730  HOH A O   1 
HETATM 8767 O  O   . HOH R 6 .   ? -1.055  -10.164 6.262   1.00 37.95  ? 731  HOH A O   1 
HETATM 8768 O  O   . HOH R 6 .   ? -20.663 -3.052  39.115  1.00 36.14  ? 732  HOH A O   1 
HETATM 8769 O  O   . HOH R 6 .   ? -29.388 -8.215  16.413  1.00 36.95  ? 733  HOH A O   1 
HETATM 8770 O  O   . HOH R 6 .   ? -13.282 -26.818 23.656  1.00 54.52  ? 734  HOH A O   1 
HETATM 8771 O  O   . HOH R 6 .   ? -20.071 -20.091 23.159  1.00 36.13  ? 735  HOH A O   1 
HETATM 8772 O  O   . HOH R 6 .   ? 13.591  17.513  10.570  1.00 35.82  ? 736  HOH A O   1 
HETATM 8773 O  O   . HOH R 6 .   ? -21.161 0.317   12.071  1.00 28.33  ? 737  HOH A O   1 
HETATM 8774 O  O   . HOH R 6 .   ? 4.438   6.895   15.353  1.00 20.45  ? 738  HOH A O   1 
HETATM 8775 O  O   . HOH R 6 .   ? -10.287 -2.106  -10.895 1.00 46.14  ? 739  HOH A O   1 
HETATM 8776 O  O   . HOH R 6 .   ? 4.342   -7.194  10.198  1.00 28.09  ? 740  HOH A O   1 
HETATM 8777 O  O   . HOH R 6 .   ? -23.616 8.637   5.783   1.00 41.07  ? 741  HOH A O   1 
HETATM 8778 O  O   . HOH R 6 .   ? 1.929   9.542   33.286  1.00 42.72  ? 742  HOH A O   1 
HETATM 8779 O  O   . HOH R 6 .   ? -4.255  29.013  19.950  1.00 47.99  ? 743  HOH A O   1 
HETATM 8780 O  O   . HOH R 6 .   ? -20.747 6.158   4.762   1.00 30.37  ? 744  HOH A O   1 
HETATM 8781 O  O   . HOH R 6 .   ? -4.998  -8.434  8.318   1.00 36.07  ? 745  HOH A O   1 
HETATM 8782 O  O   . HOH R 6 .   ? -12.466 18.230  19.297  1.00 44.18  ? 746  HOH A O   1 
HETATM 8783 O  O   . HOH R 6 .   ? -27.387 -5.737  34.389  1.00 37.47  ? 747  HOH A O   1 
HETATM 8784 O  O   . HOH R 6 .   ? -26.238 -16.767 23.003  1.00 37.22  ? 748  HOH A O   1 
HETATM 8785 O  O   . HOH R 6 .   ? -6.632  -0.527  6.298   1.00 26.34  ? 749  HOH A O   1 
HETATM 8786 O  O   . HOH R 6 .   ? 10.022  -17.258 36.816  1.00 40.31  ? 750  HOH A O   1 
HETATM 8787 O  O   . HOH R 6 .   ? 12.519  -2.261  9.516   1.00 41.74  ? 751  HOH A O   1 
HETATM 8788 O  O   . HOH R 6 .   ? -6.788  2.644   37.359  1.00 29.89  ? 752  HOH A O   1 
HETATM 8789 O  O   . HOH R 6 .   ? -8.280  -26.331 25.193  1.00 37.76  ? 753  HOH A O   1 
HETATM 8790 O  O   . HOH R 6 .   ? 16.550  3.182   10.738  1.00 33.56  ? 754  HOH A O   1 
HETATM 8791 O  O   . HOH R 6 .   ? -22.024 13.273  33.069  1.00 45.53  ? 755  HOH A O   1 
HETATM 8792 O  O   . HOH R 6 .   ? -7.189  -2.522  -2.932  1.00 40.17  ? 756  HOH A O   1 
HETATM 8793 O  O   . HOH R 6 .   ? 20.939  -2.837  34.908  1.00 33.20  ? 757  HOH A O   1 
HETATM 8794 O  O   . HOH R 6 .   ? 12.557  20.446  8.091   1.00 45.16  ? 758  HOH A O   1 
HETATM 8795 O  O   . HOH R 6 .   ? -6.053  26.838  13.459  1.00 40.31  ? 759  HOH A O   1 
HETATM 8796 O  O   . HOH R 6 .   ? -24.823 -6.356  -2.667  1.00 37.66  ? 760  HOH A O   1 
HETATM 8797 O  O   . HOH R 6 .   ? -17.344 11.781  -7.135  1.00 41.31  ? 761  HOH A O   1 
HETATM 8798 O  O   . HOH R 6 .   ? -10.729 22.760  8.917   1.00 41.92  ? 762  HOH A O   1 
HETATM 8799 O  O   . HOH R 6 .   ? -9.503  -14.704 11.489  1.00 28.81  ? 763  HOH A O   1 
HETATM 8800 O  O   . HOH R 6 .   ? -27.185 -1.075  38.772  1.00 44.30  ? 764  HOH A O   1 
HETATM 8801 O  O   . HOH R 6 .   ? 13.663  0.990   17.094  1.00 32.70  ? 765  HOH A O   1 
HETATM 8802 O  O   . HOH R 6 .   ? -1.987  -10.493 36.256  1.00 31.76  ? 766  HOH A O   1 
HETATM 8803 O  O   . HOH R 6 .   ? 7.998   7.407   7.074   1.00 37.02  ? 767  HOH A O   1 
HETATM 8804 O  O   . HOH R 6 .   ? 16.963  -15.807 22.957  1.00 52.39  ? 768  HOH A O   1 
HETATM 8805 O  O   . HOH R 6 .   ? 2.137   -23.574 26.954  1.00 45.82  ? 769  HOH A O   1 
HETATM 8806 O  O   . HOH R 6 .   ? 12.030  -9.562  46.136  1.00 29.66  ? 770  HOH A O   1 
HETATM 8807 O  O   . HOH R 6 .   ? -7.404  -7.341  9.374   1.00 30.61  ? 771  HOH A O   1 
HETATM 8808 O  O   . HOH R 6 .   ? 11.045  -16.662 15.140  1.00 45.94  ? 772  HOH A O   1 
HETATM 8809 O  O   . HOH R 6 .   ? 11.526  0.114   19.706  1.00 38.25  ? 773  HOH A O   1 
HETATM 8810 O  O   . HOH R 6 .   ? -1.962  12.395  7.512   1.00 23.96  ? 774  HOH A O   1 
HETATM 8811 O  O   . HOH R 6 .   ? 18.766  1.277   37.593  1.00 30.04  ? 775  HOH A O   1 
HETATM 8812 O  O   . HOH R 6 .   ? -21.965 10.281  14.053  1.00 37.73  ? 776  HOH A O   1 
HETATM 8813 O  O   . HOH R 6 .   ? -5.864  7.233   -2.880  1.00 32.68  ? 777  HOH A O   1 
HETATM 8814 O  O   . HOH R 6 .   ? -3.778  -7.933  24.889  1.00 23.20  ? 778  HOH A O   1 
HETATM 8815 O  O   . HOH R 6 .   ? -21.182 3.854   36.934  1.00 28.74  ? 779  HOH A O   1 
HETATM 8816 O  O   . HOH R 6 .   ? -23.909 -16.187 38.646  1.00 54.30  ? 780  HOH A O   1 
HETATM 8817 O  O   . HOH R 6 .   ? 4.488   8.117   21.164  1.00 29.19  ? 781  HOH A O   1 
HETATM 8818 O  O   . HOH R 6 .   ? 12.710  -17.226 19.952  1.00 36.37  ? 782  HOH A O   1 
HETATM 8819 O  O   . HOH R 6 .   ? 9.854   8.692   35.595  1.00 36.14  ? 783  HOH A O   1 
HETATM 8820 O  O   . HOH R 6 .   ? -1.466  -3.179  15.749  1.00 22.51  ? 784  HOH A O   1 
HETATM 8821 O  O   . HOH R 6 .   ? 0.036   8.265   26.710  1.00 26.42  ? 785  HOH A O   1 
HETATM 8822 O  O   . HOH R 6 .   ? -10.178 -19.767 -5.751  1.00 51.37  ? 786  HOH A O   1 
HETATM 8823 O  O   . HOH R 6 .   ? -9.448  15.212  -0.932  1.00 37.25  ? 787  HOH A O   1 
HETATM 8824 O  O   . HOH R 6 .   ? -27.400 4.039   20.877  1.00 46.79  ? 788  HOH A O   1 
HETATM 8825 O  O   . HOH R 6 .   ? -8.879  6.559   1.530   1.00 24.02  ? 789  HOH A O   1 
HETATM 8826 O  O   . HOH R 6 .   ? 8.160   -21.085 23.746  1.00 46.52  ? 790  HOH A O   1 
HETATM 8827 O  O   . HOH R 6 .   ? 19.000  -8.109  35.057  1.00 34.00  ? 791  HOH A O   1 
HETATM 8828 O  O   . HOH R 6 .   ? -24.728 -11.249 41.734  1.00 44.75  ? 792  HOH A O   1 
HETATM 8829 O  O   . HOH R 6 .   ? -6.028  -19.932 36.664  1.00 48.87  ? 793  HOH A O   1 
HETATM 8830 O  O   . HOH R 6 .   ? -18.110 3.049   -9.247  1.00 31.73  ? 794  HOH A O   1 
HETATM 8831 O  O   . HOH R 6 .   ? -6.740  -9.990  48.989  1.00 30.34  ? 795  HOH A O   1 
HETATM 8832 O  O   . HOH R 6 .   ? -14.435 -6.877  40.506  1.00 31.07  ? 796  HOH A O   1 
HETATM 8833 O  O   . HOH R 6 .   ? 7.095   2.279   3.814   1.00 33.97  ? 797  HOH A O   1 
HETATM 8834 O  O   . HOH R 6 .   ? -9.696  26.840  8.898   1.00 36.02  ? 798  HOH A O   1 
HETATM 8835 O  O   . HOH R 6 .   ? -27.893 -9.160  28.602  1.00 41.16  ? 799  HOH A O   1 
HETATM 8836 O  O   . HOH R 6 .   ? -3.235  13.742  9.662   1.00 21.83  ? 800  HOH A O   1 
HETATM 8837 O  O   . HOH R 6 .   ? -24.317 0.280   12.031  1.00 24.40  ? 801  HOH A O   1 
HETATM 8838 O  O   . HOH R 6 .   ? 3.775   2.485   33.033  1.00 24.17  ? 802  HOH A O   1 
HETATM 8839 O  O   . HOH R 6 .   ? -21.200 -12.002 38.636  1.00 28.82  ? 803  HOH A O   1 
HETATM 8840 O  O   . HOH R 6 .   ? -25.629 -15.739 -1.277  1.00 47.77  ? 804  HOH A O   1 
HETATM 8841 O  O   . HOH R 6 .   ? -11.746 -19.017 42.549  1.00 45.58  ? 805  HOH A O   1 
HETATM 8842 O  O   . HOH R 6 .   ? -25.424 -2.657  39.988  1.00 44.65  ? 806  HOH A O   1 
HETATM 8843 O  O   . HOH R 6 .   ? -7.793  7.717   29.598  1.00 24.66  ? 807  HOH A O   1 
HETATM 8844 O  O   . HOH R 6 .   ? -3.405  19.087  32.346  1.00 42.21  ? 808  HOH A O   1 
HETATM 8845 O  O   . HOH R 6 .   ? -19.049 -14.099 -0.396  1.00 34.63  ? 809  HOH A O   1 
HETATM 8846 O  O   . HOH R 6 .   ? 21.158  -10.138 27.737  1.00 49.56  ? 810  HOH A O   1 
HETATM 8847 O  O   . HOH R 6 .   ? -4.506  1.262   6.091   1.00 25.83  ? 811  HOH A O   1 
HETATM 8848 O  O   . HOH R 6 .   ? -24.861 -4.683  34.166  1.00 31.48  ? 812  HOH A O   1 
HETATM 8849 O  O   . HOH R 6 .   ? 17.000  -7.975  25.049  1.00 33.10  ? 813  HOH A O   1 
HETATM 8850 O  O   . HOH R 6 .   ? -11.732 18.087  7.403   1.00 38.60  ? 814  HOH A O   1 
HETATM 8851 O  O   . HOH R 6 .   ? 15.080  -2.605  28.724  1.00 27.04  ? 815  HOH A O   1 
HETATM 8852 O  O   . HOH R 6 .   ? 14.569  0.466   24.017  1.00 41.32  ? 816  HOH A O   1 
HETATM 8853 O  O   . HOH R 6 .   ? 19.192  -6.661  44.805  1.00 33.83  ? 817  HOH A O   1 
HETATM 8854 O  O   . HOH R 6 .   ? -14.757 -21.518 16.626  1.00 34.53  ? 818  HOH A O   1 
HETATM 8855 O  O   . HOH R 6 .   ? -0.359  7.732   11.195  1.00 21.74  ? 819  HOH A O   1 
HETATM 8856 O  O   . HOH R 6 .   ? -3.462  -33.934 22.291  1.00 59.87  ? 820  HOH A O   1 
HETATM 8857 O  O   . HOH R 6 .   ? -6.770  28.146  17.358  1.00 42.84  ? 821  HOH A O   1 
HETATM 8858 O  O   . HOH R 6 .   ? 12.315  -5.542  15.966  1.00 34.17  ? 822  HOH A O   1 
HETATM 8859 O  O   . HOH R 6 .   ? 1.554   -7.588  34.163  1.00 31.29  ? 823  HOH A O   1 
HETATM 8860 O  O   . HOH R 6 .   ? -1.884  6.849   39.560  1.00 36.40  ? 824  HOH A O   1 
HETATM 8861 O  O   . HOH R 6 .   ? 7.707   -11.357 34.800  1.00 27.58  ? 825  HOH A O   1 
HETATM 8862 O  O   . HOH R 6 .   ? -13.177 -23.651 10.999  1.00 41.33  ? 826  HOH A O   1 
HETATM 8863 O  O   . HOH R 6 .   ? 13.726  -1.987  35.892  1.00 23.04  ? 827  HOH A O   1 
HETATM 8864 O  O   . HOH R 6 .   ? 21.633  -1.057  37.996  1.00 34.56  ? 828  HOH A O   1 
HETATM 8865 O  O   . HOH R 6 .   ? -6.941  14.404  -0.245  1.00 33.93  ? 829  HOH A O   1 
HETATM 8866 O  O   . HOH R 6 .   ? -17.170 7.415   3.691   1.00 35.06  ? 830  HOH A O   1 
HETATM 8867 O  O   . HOH R 6 .   ? -3.445  -23.022 29.752  1.00 41.31  ? 831  HOH A O   1 
HETATM 8868 O  O   . HOH R 6 .   ? 1.255   -3.071  15.568  1.00 24.03  ? 832  HOH A O   1 
HETATM 8869 O  O   . HOH R 6 .   ? -6.470  7.550   2.674   1.00 24.56  ? 833  HOH A O   1 
HETATM 8870 O  O   . HOH R 6 .   ? -18.593 -22.357 15.746  1.00 43.50  ? 834  HOH A O   1 
HETATM 8871 O  O   . HOH R 6 .   ? -19.819 -7.610  46.680  1.00 41.54  ? 835  HOH A O   1 
HETATM 8872 O  O   . HOH R 6 .   ? -28.914 -0.990  30.563  1.00 33.27  ? 836  HOH A O   1 
HETATM 8873 O  O   . HOH R 6 .   ? 0.388   7.607   20.709  1.00 20.96  ? 837  HOH A O   1 
HETATM 8874 O  O   . HOH R 6 .   ? -4.062  -4.692  18.568  1.00 25.34  ? 838  HOH A O   1 
HETATM 8875 O  O   . HOH R 6 .   ? 13.810  -12.822 55.746  1.00 39.57  ? 839  HOH A O   1 
HETATM 8876 O  O   . HOH R 6 .   ? 2.932   -9.986  6.725   1.00 41.90  ? 840  HOH A O   1 
HETATM 8877 O  O   . HOH R 6 .   ? 16.765  -3.704  49.837  1.00 47.18  ? 841  HOH A O   1 
HETATM 8878 O  O   . HOH R 6 .   ? 2.480   -16.322 33.456  1.00 46.17  ? 842  HOH A O   1 
HETATM 8879 O  O   . HOH R 6 .   ? -17.406 7.158   0.890   1.00 35.17  ? 843  HOH A O   1 
HETATM 8880 O  O   . HOH R 6 .   ? 3.827   -26.190 19.713  1.00 44.53  ? 844  HOH A O   1 
HETATM 8881 O  O   . HOH R 6 .   ? -6.868  -9.584  26.466  1.00 24.67  ? 845  HOH A O   1 
HETATM 8882 O  O   . HOH R 6 .   ? -25.614 -1.398  5.575   1.00 30.33  ? 846  HOH A O   1 
HETATM 8883 O  O   . HOH R 6 .   ? 3.698   10.865  15.005  1.00 24.89  ? 847  HOH A O   1 
HETATM 8884 O  O   . HOH R 6 .   ? -11.649 7.097   35.302  1.00 37.31  ? 848  HOH A O   1 
HETATM 8885 O  O   . HOH R 6 .   ? 8.906   10.611  5.662   1.00 33.93  ? 849  HOH A O   1 
HETATM 8886 O  O   . HOH R 6 .   ? 6.548   -0.110  5.558   1.00 33.63  ? 850  HOH A O   1 
HETATM 8887 O  O   . HOH R 6 .   ? 6.586   -14.913 15.887  1.00 34.44  ? 851  HOH A O   1 
HETATM 8888 O  O   . HOH R 6 .   ? -22.352 2.701   -8.555  1.00 41.55  ? 852  HOH A O   1 
HETATM 8889 O  O   . HOH R 6 .   ? -1.843  10.354  29.629  1.00 28.04  ? 853  HOH A O   1 
HETATM 8890 O  O   . HOH R 6 .   ? -5.075  20.668  22.826  1.00 27.60  ? 854  HOH A O   1 
HETATM 8891 O  O   . HOH R 6 .   ? 12.675  -18.676 28.062  1.00 38.50  ? 855  HOH A O   1 
HETATM 8892 O  O   . HOH R 6 .   ? 8.764   -14.610 51.754  1.00 40.49  ? 856  HOH A O   1 
HETATM 8893 O  O   . HOH R 6 .   ? -4.470  -26.678 13.909  1.00 49.98  ? 857  HOH A O   1 
HETATM 8894 O  O   . HOH R 6 .   ? -15.899 6.485   42.261  1.00 50.58  ? 858  HOH A O   1 
HETATM 8895 O  O   . HOH R 6 .   ? 18.934  -5.999  37.485  1.00 28.75  ? 859  HOH A O   1 
HETATM 8896 O  O   . HOH R 6 .   ? 5.876   -21.220 25.640  1.00 42.24  ? 860  HOH A O   1 
HETATM 8897 O  O   . HOH R 6 .   ? -23.164 -21.793 16.222  1.00 55.49  ? 861  HOH A O   1 
HETATM 8898 O  O   . HOH R 6 .   ? 7.310   -4.237  17.151  1.00 24.26  ? 862  HOH A O   1 
HETATM 8899 O  O   . HOH R 6 .   ? -8.156  -2.485  12.673  1.00 22.69  ? 863  HOH A O   1 
HETATM 8900 O  O   . HOH R 6 .   ? -10.827 19.462  11.137  1.00 35.88  ? 864  HOH A O   1 
HETATM 8901 O  O   . HOH R 6 .   ? -0.691  23.925  27.471  1.00 39.95  ? 865  HOH A O   1 
HETATM 8902 O  O   . HOH R 6 .   ? -10.121 -7.550  -7.199  1.00 61.48  ? 866  HOH A O   1 
HETATM 8903 O  O   . HOH R 6 .   ? 0.702   10.401  28.537  1.00 26.27  ? 867  HOH A O   1 
HETATM 8904 O  O   . HOH R 6 .   ? 1.935   -1.604  12.452  1.00 22.07  ? 868  HOH A O   1 
HETATM 8905 O  O   . HOH R 6 .   ? -16.143 4.808   0.088   1.00 34.92  ? 869  HOH A O   1 
HETATM 8906 O  O   . HOH R 6 .   ? -30.041 -3.133  31.617  1.00 32.33  ? 870  HOH A O   1 
HETATM 8907 O  O   . HOH R 6 .   ? -23.902 -7.486  33.979  1.00 26.29  ? 871  HOH A O   1 
HETATM 8908 O  O   . HOH R 6 .   ? 10.636  26.807  17.643  1.00 40.83  ? 872  HOH A O   1 
HETATM 8909 O  O   . HOH R 6 .   ? -31.078 -4.950  9.286   1.00 41.19  ? 873  HOH A O   1 
HETATM 8910 O  O   . HOH R 6 .   ? -5.783  13.943  20.127  1.00 21.95  ? 874  HOH A O   1 
HETATM 8911 O  O   . HOH R 6 .   ? -23.143 -8.043  -5.497  1.00 41.05  ? 875  HOH A O   1 
HETATM 8912 O  O   . HOH R 6 .   ? 19.270  -3.335  31.071  1.00 31.95  ? 876  HOH A O   1 
HETATM 8913 O  O   . HOH R 6 .   ? 1.300   -10.362 12.396  1.00 30.43  ? 877  HOH A O   1 
HETATM 8914 O  O   . HOH R 6 .   ? 4.297   5.662   0.484   1.00 42.39  ? 878  HOH A O   1 
HETATM 8915 O  O   . HOH R 6 .   ? 0.796   -8.955  42.840  1.00 47.12  ? 879  HOH A O   1 
HETATM 8916 O  O   . HOH R 6 .   ? -19.916 13.066  20.230  1.00 36.70  ? 880  HOH A O   1 
HETATM 8917 O  O   . HOH R 6 .   ? 8.160   30.852  17.653  1.00 43.55  ? 881  HOH A O   1 
HETATM 8918 O  O   . HOH R 6 .   ? -0.650  -8.029  36.544  1.00 30.71  ? 882  HOH A O   1 
HETATM 8919 O  O   . HOH R 6 .   ? 0.484   -11.954 38.073  1.00 45.64  ? 883  HOH A O   1 
HETATM 8920 O  O   . HOH R 6 .   ? 2.904   11.951  2.795   1.00 35.37  ? 884  HOH A O   1 
HETATM 8921 O  O   . HOH R 6 .   ? -17.963 -12.584 33.619  1.00 27.54  ? 885  HOH A O   1 
HETATM 8922 O  O   . HOH R 6 .   ? 1.003   15.390  3.762   1.00 32.19  ? 886  HOH A O   1 
HETATM 8923 O  O   . HOH R 6 .   ? -5.790  24.229  24.314  1.00 39.96  ? 887  HOH A O   1 
HETATM 8924 O  O   . HOH R 6 .   ? -0.249  -16.580 22.353  1.00 35.12  ? 888  HOH A O   1 
HETATM 8925 O  O   . HOH R 6 .   ? -15.480 -15.923 -3.035  1.00 42.62  ? 889  HOH A O   1 
HETATM 8926 O  O   . HOH R 6 .   ? -23.855 -13.942 37.206  1.00 32.93  ? 890  HOH A O   1 
HETATM 8927 O  O   . HOH R 6 .   ? 6.718   21.755  27.204  1.00 38.41  ? 891  HOH A O   1 
HETATM 8928 O  O   . HOH R 6 .   ? -13.292 -25.748 21.051  1.00 41.90  ? 892  HOH A O   1 
HETATM 8929 O  O   . HOH R 6 .   ? 8.675   0.209   26.872  1.00 28.33  ? 893  HOH A O   1 
HETATM 8930 O  O   . HOH R 6 .   ? 21.746  -3.291  39.330  1.00 36.10  ? 894  HOH A O   1 
HETATM 8931 O  O   . HOH R 6 .   ? -0.946  17.024  20.796  1.00 24.99  ? 895  HOH A O   1 
HETATM 8932 O  O   . HOH R 6 .   ? -31.624 -5.777  25.831  1.00 49.55  ? 896  HOH A O   1 
HETATM 8933 O  O   . HOH R 6 .   ? -26.393 -8.890  -1.239  1.00 55.26  ? 897  HOH A O   1 
HETATM 8934 O  O   . HOH R 6 .   ? -0.174  8.421   8.481   1.00 25.01  ? 898  HOH A O   1 
HETATM 8935 O  O   . HOH R 6 .   ? 3.313   -1.525  16.754  1.00 34.09  ? 899  HOH A O   1 
HETATM 8936 O  O   . HOH R 6 .   ? -1.502  -25.002 14.730  1.00 43.42  ? 900  HOH A O   1 
HETATM 8937 O  O   . HOH R 6 .   ? -3.083  19.924  0.187   1.00 39.75  ? 901  HOH A O   1 
HETATM 8938 O  O   . HOH R 6 .   ? 6.840   5.554   27.421  1.00 30.77  ? 902  HOH A O   1 
HETATM 8939 O  O   . HOH R 6 .   ? -30.559 -12.353 9.641   1.00 43.95  ? 903  HOH A O   1 
HETATM 8940 O  O   . HOH R 6 .   ? -25.539 -15.059 30.926  1.00 36.03  ? 904  HOH A O   1 
HETATM 8941 O  O   . HOH R 6 .   ? -11.727 -6.480  41.360  1.00 28.34  ? 905  HOH A O   1 
HETATM 8942 O  O   . HOH R 6 .   ? -14.135 14.264  36.896  1.00 41.31  ? 906  HOH A O   1 
HETATM 8943 O  O   . HOH R 6 .   ? -9.829  20.945  30.165  1.00 42.78  ? 907  HOH A O   1 
HETATM 8944 O  O   . HOH R 6 .   ? -31.032 0.491   3.317   1.00 45.96  ? 908  HOH A O   1 
HETATM 8945 O  O   . HOH R 6 .   ? -5.131  11.620  41.991  1.00 39.85  ? 909  HOH A O   1 
HETATM 8946 O  O   . HOH R 6 .   ? -9.933  -22.529 33.081  1.00 45.87  ? 910  HOH A O   1 
HETATM 8947 O  O   . HOH R 6 .   ? -20.733 -21.616 27.100  1.00 43.07  ? 911  HOH A O   1 
HETATM 8948 O  O   . HOH R 6 .   ? -4.197  2.684   37.388  1.00 27.98  ? 912  HOH A O   1 
HETATM 8949 O  O   . HOH R 6 .   ? 5.046   -0.022  14.079  1.00 26.30  ? 913  HOH A O   1 
HETATM 8950 O  O   . HOH R 6 .   ? -8.340  -29.738 18.781  1.00 48.20  ? 914  HOH A O   1 
HETATM 8951 O  O   . HOH R 6 .   ? -6.018  16.873  15.034  1.00 25.05  ? 915  HOH A O   1 
HETATM 8952 O  O   . HOH R 6 .   ? 8.985   -0.562  50.909  1.00 36.75  ? 916  HOH A O   1 
HETATM 8953 O  O   . HOH R 6 .   ? 16.334  -11.466 49.396  1.00 34.36  ? 917  HOH A O   1 
HETATM 8954 O  O   . HOH R 6 .   ? 7.503   35.877  18.134  1.00 44.49  ? 918  HOH A O   1 
HETATM 8955 O  O   . HOH R 6 .   ? -9.070  18.530  28.940  1.00 31.37  ? 919  HOH A O   1 
HETATM 8956 O  O   . HOH R 6 .   ? -28.591 -9.410  18.815  1.00 38.71  ? 920  HOH A O   1 
HETATM 8957 O  O   . HOH R 6 .   ? 2.868   -17.590 19.686  1.00 32.47  ? 921  HOH A O   1 
HETATM 8958 O  O   . HOH R 6 .   ? 8.948   10.848  36.676  1.00 40.07  ? 922  HOH A O   1 
HETATM 8959 O  O   . HOH R 6 .   ? 11.348  4.393   42.679  1.00 33.87  ? 923  HOH A O   1 
HETATM 8960 O  O   . HOH R 6 .   ? -10.031 12.939  5.019   1.00 27.09  ? 924  HOH A O   1 
HETATM 8961 O  O   . HOH R 6 .   ? 2.994   -9.748  3.390   1.00 57.64  ? 925  HOH A O   1 
HETATM 8962 O  O   . HOH R 6 .   ? 6.173   -18.529 31.237  1.00 41.77  ? 926  HOH A O   1 
HETATM 8963 O  O   . HOH R 6 .   ? 7.885   -16.692 38.283  1.00 43.69  ? 927  HOH A O   1 
HETATM 8964 O  O   . HOH R 6 .   ? -2.785  14.511  21.912  1.00 25.16  ? 928  HOH A O   1 
HETATM 8965 O  O   . HOH R 6 .   ? 15.941  -15.270 47.579  1.00 41.96  ? 929  HOH A O   1 
HETATM 8966 O  O   . HOH R 6 .   ? 7.921   -14.062 41.722  1.00 33.03  ? 930  HOH A O   1 
HETATM 8967 O  O   . HOH R 6 .   ? 2.439   -14.807 25.801  1.00 30.83  ? 931  HOH A O   1 
HETATM 8968 O  O   . HOH R 6 .   ? 8.943   11.681  41.992  1.00 45.27  ? 932  HOH A O   1 
HETATM 8969 O  O   . HOH R 6 .   ? 12.954  15.359  12.362  1.00 31.91  ? 933  HOH A O   1 
HETATM 8970 O  O   . HOH R 6 .   ? 5.017   -7.987  43.861  1.00 37.35  ? 934  HOH A O   1 
HETATM 8971 O  O   . HOH R 6 .   ? -2.235  1.735   9.863   1.00 22.46  ? 935  HOH A O   1 
HETATM 8972 O  O   . HOH R 6 .   ? -1.411  -12.421 19.156  1.00 23.67  ? 936  HOH A O   1 
HETATM 8973 O  O   . HOH R 6 .   ? 5.302   23.000  25.026  1.00 34.25  ? 937  HOH A O   1 
HETATM 8974 O  O   . HOH R 6 .   ? -15.787 16.424  15.576  1.00 46.45  ? 938  HOH A O   1 
HETATM 8975 O  O   . HOH R 6 .   ? 7.776   9.509   39.508  1.00 40.42  ? 939  HOH A O   1 
HETATM 8976 O  O   . HOH R 6 .   ? -23.460 -4.263  31.906  1.00 24.92  ? 940  HOH A O   1 
HETATM 8977 O  O   . HOH R 6 .   ? 11.215  8.136   16.699  1.00 37.43  ? 941  HOH A O   1 
HETATM 8978 O  O   . HOH R 6 .   ? 15.179  -4.008  24.867  1.00 36.80  ? 942  HOH A O   1 
HETATM 8979 O  O   . HOH R 6 .   ? -11.949 16.782  17.013  1.00 38.05  ? 943  HOH A O   1 
HETATM 8980 O  O   . HOH R 6 .   ? -27.681 3.652   25.188  1.00 35.87  ? 944  HOH A O   1 
HETATM 8981 O  O   . HOH R 6 .   ? -17.938 -10.320 45.010  1.00 34.20  ? 945  HOH A O   1 
HETATM 8982 O  O   . HOH R 6 .   ? 6.369   1.939   26.482  1.00 29.01  ? 946  HOH A O   1 
HETATM 8983 O  O   . HOH R 6 .   ? -2.835  2.459   18.112  1.00 21.61  ? 947  HOH A O   1 
HETATM 8984 O  O   . HOH R 6 .   ? 3.404   -7.792  28.110  1.00 24.85  ? 948  HOH A O   1 
HETATM 8985 O  O   . HOH R 6 .   ? -17.340 -22.523 2.584   1.00 52.66  ? 949  HOH A O   1 
HETATM 8986 O  O   . HOH R 6 .   ? -1.575  -26.750 24.932  1.00 41.46  ? 950  HOH A O   1 
HETATM 8987 O  O   . HOH R 6 .   ? -8.715  11.653  30.888  1.00 27.57  ? 951  HOH A O   1 
HETATM 8988 O  O   . HOH R 6 .   ? -25.951 9.479   20.837  1.00 41.42  ? 952  HOH A O   1 
HETATM 8989 O  O   . HOH R 6 .   ? -16.691 15.928  2.451   1.00 42.45  ? 953  HOH A O   1 
HETATM 8990 O  O   . HOH R 6 .   ? 0.326   -16.818 24.926  1.00 34.27  ? 954  HOH A O   1 
HETATM 8991 O  O   . HOH R 6 .   ? -8.613  7.016   -1.231  1.00 25.50  ? 955  HOH A O   1 
HETATM 8992 O  O   . HOH R 6 .   ? 6.747   -10.328 43.220  1.00 32.98  ? 956  HOH A O   1 
HETATM 8993 O  O   . HOH R 6 .   ? -24.826 2.159   -5.260  1.00 44.81  ? 957  HOH A O   1 
HETATM 8994 O  O   . HOH R 6 .   ? 19.108  -6.555  18.637  1.00 35.49  ? 958  HOH A O   1 
HETATM 8995 O  O   . HOH R 6 .   ? -10.861 -14.451 -7.014  1.00 43.52  ? 959  HOH A O   1 
HETATM 8996 O  O   . HOH R 6 .   ? -0.068  -21.292 30.108  1.00 40.44  ? 960  HOH A O   1 
HETATM 8997 O  O   . HOH R 6 .   ? -5.168  -1.864  -2.268  1.00 41.27  ? 961  HOH A O   1 
HETATM 8998 O  O   . HOH R 6 .   ? -22.086 -23.949 33.903  1.00 61.91  ? 962  HOH A O   1 
HETATM 8999 O  O   . HOH R 6 .   ? 13.390  -14.649 22.602  1.00 39.82  ? 963  HOH A O   1 
HETATM 9000 O  O   . HOH R 6 .   ? -7.578  -1.342  30.340  1.00 31.78  ? 964  HOH A O   1 
HETATM 9001 O  O   . HOH R 6 .   ? 20.607  -16.835 28.900  1.00 49.02  ? 965  HOH A O   1 
HETATM 9002 O  O   . HOH R 6 .   ? -21.509 13.764  31.108  1.00 43.63  ? 966  HOH A O   1 
HETATM 9003 O  O   . HOH R 6 .   ? -29.622 2.775   2.231   1.00 40.41  ? 967  HOH A O   1 
HETATM 9004 O  O   . HOH R 6 .   ? 7.528   27.849  10.961  1.00 45.05  ? 968  HOH A O   1 
HETATM 9005 O  O   . HOH R 6 .   ? -25.010 -2.209  14.929  1.00 25.11  ? 969  HOH A O   1 
HETATM 9006 O  O   . HOH R 6 .   ? -0.559  -0.912  24.930  1.00 29.19  ? 970  HOH A O   1 
HETATM 9007 O  O   . HOH R 6 .   ? -27.461 -0.004  19.101  1.00 32.62  ? 971  HOH A O   1 
HETATM 9008 O  O   . HOH R 6 .   ? 0.782   -6.298  49.089  1.00 39.13  ? 972  HOH A O   1 
HETATM 9009 O  O   . HOH R 6 .   ? 8.366   1.864   50.405  1.00 36.66  ? 973  HOH A O   1 
HETATM 9010 O  O   . HOH R 6 .   ? 9.435   -8.754  46.300  1.00 28.93  ? 974  HOH A O   1 
HETATM 9011 O  O   . HOH R 6 .   ? 4.813   28.933  9.846   1.00 43.24  ? 975  HOH A O   1 
HETATM 9012 O  O   . HOH R 6 .   ? 0.048   -10.009 3.765   1.00 41.31  ? 976  HOH A O   1 
HETATM 9013 O  O   . HOH R 6 .   ? -28.046 1.304   7.990   1.00 31.32  ? 977  HOH A O   1 
HETATM 9014 O  O   . HOH R 6 .   ? -2.410  9.866   7.491   1.00 22.79  ? 978  HOH A O   1 
HETATM 9015 O  O   . HOH R 6 .   ? -32.993 -2.176  31.262  1.00 56.58  ? 979  HOH A O   1 
HETATM 9016 O  O   . HOH R 6 .   ? 8.292   5.363   52.929  1.00 36.60  ? 980  HOH A O   1 
HETATM 9017 O  O   . HOH R 6 .   ? 2.736   -1.986  0.021   1.00 38.58  ? 981  HOH A O   1 
HETATM 9018 O  O   . HOH R 6 .   ? 5.361   13.084  16.034  1.00 35.64  ? 982  HOH A O   1 
HETATM 9019 O  O   . HOH R 6 .   ? -5.398  16.805  0.180   1.00 38.83  ? 983  HOH A O   1 
HETATM 9020 O  O   . HOH R 6 .   ? -7.167  -13.008 3.439   1.00 39.33  ? 984  HOH A O   1 
HETATM 9021 O  O   . HOH R 6 .   ? -6.419  0.270   -1.526  1.00 37.22  ? 985  HOH A O   1 
HETATM 9022 O  O   . HOH R 6 .   ? 8.459   31.781  10.723  1.00 57.54  ? 986  HOH A O   1 
HETATM 9023 O  O   . HOH R 6 .   ? -18.575 12.435  38.997  1.00 45.21  ? 987  HOH A O   1 
HETATM 9024 O  O   . HOH R 6 .   ? -26.441 -11.197 28.069  1.00 34.10  ? 988  HOH A O   1 
HETATM 9025 O  O   . HOH R 6 .   ? -25.071 8.417   11.858  1.00 41.40  ? 989  HOH A O   1 
HETATM 9026 O  O   . HOH R 6 .   ? 14.513  3.211   18.891  1.00 43.71  ? 990  HOH A O   1 
HETATM 9027 O  O   . HOH R 6 .   ? 7.932   -2.231  9.000   1.00 26.00  ? 991  HOH A O   1 
HETATM 9028 O  O   . HOH R 6 .   ? 11.417  24.760  10.436  1.00 45.79  ? 992  HOH A O   1 
HETATM 9029 O  O   . HOH R 6 .   ? -8.367  -26.548 11.840  1.00 48.06  ? 993  HOH A O   1 
HETATM 9030 O  O   . HOH R 6 .   ? 1.559   0.623   50.094  1.00 38.23  ? 994  HOH A O   1 
HETATM 9031 O  O   . HOH R 6 .   ? -2.968  -4.444  50.508  1.00 34.40  ? 995  HOH A O   1 
HETATM 9032 O  O   . HOH R 6 .   ? -14.089 -9.208  39.056  1.00 27.20  ? 996  HOH A O   1 
HETATM 9033 O  O   . HOH R 6 .   ? 10.219  -4.087  9.444   1.00 35.78  ? 997  HOH A O   1 
HETATM 9034 O  O   . HOH R 6 .   ? 11.630  10.749  19.206  1.00 34.46  ? 998  HOH A O   1 
HETATM 9035 O  O   . HOH R 6 .   ? -15.982 10.974  11.652  1.00 25.50  ? 999  HOH A O   1 
HETATM 9036 O  O   . HOH R 6 .   ? -23.433 -19.348 18.119  1.00 48.87  ? 1000 HOH A O   1 
HETATM 9037 O  O   . HOH R 6 .   ? -20.587 -20.993 35.768  1.00 54.66  ? 1001 HOH A O   1 
HETATM 9038 O  O   . HOH R 6 .   ? 3.603   -12.436 40.607  1.00 45.46  ? 1002 HOH A O   1 
HETATM 9039 O  O   . HOH R 6 .   ? 1.123   17.632  5.193   1.00 31.80  ? 1003 HOH A O   1 
HETATM 9040 O  O   . HOH R 6 .   ? 12.934  25.624  17.878  1.00 42.81  ? 1004 HOH A O   1 
HETATM 9041 O  O   . HOH R 6 .   ? -23.644 14.239  26.735  1.00 45.30  ? 1005 HOH A O   1 
HETATM 9042 O  O   . HOH R 6 .   ? 1.315   13.461  30.910  1.00 36.24  ? 1006 HOH A O   1 
HETATM 9043 O  O   . HOH R 6 .   ? -21.072 12.529  36.907  1.00 41.65  ? 1007 HOH A O   1 
HETATM 9044 O  O   . HOH R 6 .   ? -26.494 9.356   27.987  1.00 48.35  ? 1008 HOH A O   1 
HETATM 9045 O  O   . HOH R 6 .   ? -7.616  -16.241 37.928  1.00 35.33  ? 1009 HOH A O   1 
HETATM 9046 O  O   . HOH R 6 .   ? 0.280   -28.106 14.123  1.00 55.22  ? 1010 HOH A O   1 
HETATM 9047 O  O   . HOH R 6 .   ? 17.873  -13.644 42.885  1.00 38.55  ? 1011 HOH A O   1 
HETATM 9048 O  O   . HOH R 6 .   ? -24.830 -3.981  -4.090  1.00 38.90  ? 1012 HOH A O   1 
HETATM 9049 O  O   . HOH R 6 .   ? -10.992 2.403   49.251  1.00 43.59  ? 1013 HOH A O   1 
HETATM 9050 O  O   . HOH R 6 .   ? -23.989 8.014   17.131  1.00 36.41  ? 1014 HOH A O   1 
HETATM 9051 O  O   . HOH R 6 .   ? 11.140  12.184  34.066  1.00 52.56  ? 1015 HOH A O   1 
HETATM 9052 O  O   . HOH R 6 .   ? -0.412  15.054  22.697  1.00 28.08  ? 1016 HOH A O   1 
HETATM 9053 O  O   . HOH R 6 .   ? -25.307 -7.101  41.549  1.00 37.63  ? 1017 HOH A O   1 
HETATM 9054 O  O   . HOH R 6 .   ? 0.184   20.449  30.595  1.00 37.09  ? 1018 HOH A O   1 
HETATM 9055 O  O   . HOH R 6 .   ? -11.712 11.226  34.017  1.00 24.99  ? 1019 HOH A O   1 
HETATM 9056 O  O   . HOH R 6 .   ? -15.876 -22.924 38.243  1.00 47.68  ? 1020 HOH A O   1 
HETATM 9057 O  O   . HOH R 6 .   ? -9.243  7.495   -5.811  1.00 41.84  ? 1021 HOH A O   1 
HETATM 9058 O  O   . HOH R 6 .   ? -3.979  30.597  14.720  1.00 42.37  ? 1022 HOH A O   1 
HETATM 9059 O  O   . HOH R 6 .   ? -8.748  0.449   -8.198  1.00 35.17  ? 1023 HOH A O   1 
HETATM 9060 O  O   . HOH R 6 .   ? -19.701 -11.566 -1.107  1.00 35.01  ? 1024 HOH A O   1 
HETATM 9061 O  O   . HOH R 6 .   ? 13.941  5.463   36.813  1.00 30.28  ? 1025 HOH A O   1 
HETATM 9062 O  O   . HOH R 6 .   ? -27.755 -4.138  22.571  1.00 37.48  ? 1026 HOH A O   1 
HETATM 9063 O  O   . HOH R 6 .   ? 12.946  -16.423 30.943  1.00 33.62  ? 1027 HOH A O   1 
HETATM 9064 O  O   . HOH R 6 .   ? -1.362  7.037   -2.916  1.00 44.54  ? 1028 HOH A O   1 
HETATM 9065 O  O   . HOH R 6 .   ? 16.821  -0.851  8.735   1.00 45.06  ? 1029 HOH A O   1 
HETATM 9066 O  O   . HOH R 6 .   ? -3.475  4.524   39.527  1.00 36.79  ? 1030 HOH A O   1 
HETATM 9067 O  O   . HOH R 6 .   ? -26.969 7.435   23.563  1.00 44.75  ? 1031 HOH A O   1 
HETATM 9068 O  O   . HOH R 6 .   ? -18.650 12.932  13.520  1.00 40.04  ? 1032 HOH A O   1 
HETATM 9069 O  O   . HOH R 6 .   ? 8.155   -17.047 49.034  1.00 53.69  ? 1033 HOH A O   1 
HETATM 9070 O  O   . HOH R 6 .   ? 19.152  -12.509 35.107  1.00 36.49  ? 1034 HOH A O   1 
HETATM 9071 O  O   . HOH R 6 .   ? -27.715 -1.989  34.930  1.00 48.36  ? 1035 HOH A O   1 
HETATM 9072 O  O   . HOH R 6 .   ? 12.610  -14.775 13.936  1.00 34.75  ? 1036 HOH A O   1 
HETATM 9073 O  O   . HOH R 6 .   ? -3.135  30.672  18.074  1.00 41.54  ? 1037 HOH A O   1 
HETATM 9074 O  O   . HOH R 6 .   ? 12.073  3.944   29.010  1.00 47.27  ? 1038 HOH A O   1 
HETATM 9075 O  O   . HOH R 6 .   ? -12.799 0.205   -13.591 1.00 43.84  ? 1039 HOH A O   1 
HETATM 9076 O  O   . HOH R 6 .   ? -23.854 -5.346  -5.616  1.00 39.92  ? 1040 HOH A O   1 
HETATM 9077 O  O   . HOH R 6 .   ? -35.258 -3.676  14.866  1.00 35.98  ? 1041 HOH A O   1 
HETATM 9078 O  O   . HOH R 6 .   ? -6.703  21.201  29.965  1.00 36.11  ? 1042 HOH A O   1 
HETATM 9079 O  O   . HOH R 6 .   ? -13.191 9.681   -5.904  1.00 40.36  ? 1043 HOH A O   1 
HETATM 9080 O  O   . HOH R 6 .   ? 7.015   8.311   3.315   1.00 44.52  ? 1044 HOH A O   1 
HETATM 9081 O  O   . HOH R 6 .   ? -0.058  -18.988 33.029  1.00 49.82  ? 1045 HOH A O   1 
HETATM 9082 O  O   . HOH R 6 .   ? -15.584 15.257  17.578  1.00 42.14  ? 1046 HOH A O   1 
HETATM 9083 O  O   . HOH R 6 .   ? -20.721 9.640   11.670  1.00 36.80  ? 1047 HOH A O   1 
HETATM 9084 O  O   . HOH R 6 .   ? -25.079 -15.426 33.732  1.00 40.50  ? 1048 HOH A O   1 
HETATM 9085 O  O   . HOH R 6 .   ? -27.953 7.433   32.860  1.00 42.81  ? 1049 HOH A O   1 
HETATM 9086 O  O   . HOH R 6 .   ? -5.591  -21.437 5.325   1.00 47.70  ? 1050 HOH A O   1 
HETATM 9087 O  O   . HOH R 6 .   ? -2.441  -8.092  -0.312  1.00 34.50  ? 1051 HOH A O   1 
HETATM 9088 O  O   . HOH R 6 .   ? -9.869  7.720   45.567  1.00 46.86  ? 1052 HOH A O   1 
HETATM 9089 O  O   . HOH R 6 .   ? 10.052  8.922   27.895  1.00 43.83  ? 1053 HOH A O   1 
HETATM 9090 O  O   . HOH R 6 .   ? -10.698 -21.834 30.029  1.00 42.98  ? 1054 HOH A O   1 
HETATM 9091 O  O   . HOH R 6 .   ? 0.621   17.179  44.434  1.00 53.42  ? 1055 HOH A O   1 
HETATM 9092 O  O   . HOH R 6 .   ? -6.545  -9.705  44.882  1.00 24.89  ? 1056 HOH A O   1 
HETATM 9093 O  O   . HOH R 6 .   ? -3.263  -0.112  8.171   1.00 23.61  ? 1057 HOH A O   1 
HETATM 9094 O  O   . HOH R 6 .   ? -26.098 -17.532 29.768  1.00 40.85  ? 1058 HOH A O   1 
HETATM 9095 O  O   . HOH R 6 .   ? -26.834 -10.642 0.882   1.00 47.63  ? 1059 HOH A O   1 
HETATM 9096 O  O   . HOH R 6 .   ? 17.036  -9.975  51.845  1.00 38.42  ? 1060 HOH A O   1 
HETATM 9097 O  O   . HOH R 6 .   ? 15.645  -15.867 42.866  1.00 46.95  ? 1061 HOH A O   1 
HETATM 9098 O  O   . HOH R 6 .   ? -7.429  12.931  48.169  1.00 45.01  ? 1062 HOH A O   1 
HETATM 9099 O  O   . HOH R 6 .   ? -12.591 -16.425 43.274  1.00 37.79  ? 1063 HOH A O   1 
HETATM 9100 O  O   . HOH R 6 .   ? 3.264   17.878  31.742  1.00 46.13  ? 1064 HOH A O   1 
HETATM 9101 O  O   . HOH R 6 .   ? 10.665  -11.992 10.861  1.00 41.39  ? 1065 HOH A O   1 
HETATM 9102 O  O   . HOH R 6 .   ? -17.369 -21.276 22.866  1.00 33.61  ? 1066 HOH A O   1 
HETATM 9103 O  O   . HOH R 6 .   ? 10.661  4.728   12.688  1.00 35.68  ? 1067 HOH A O   1 
HETATM 9104 O  O   . HOH R 6 .   ? 20.124  -9.630  39.030  1.00 53.92  ? 1068 HOH A O   1 
HETATM 9105 O  O   . HOH R 6 .   ? 1.144   6.592   -1.335  1.00 49.71  ? 1069 HOH A O   1 
HETATM 9106 O  O   . HOH R 6 .   ? 20.732  -3.485  43.828  1.00 32.31  ? 1070 HOH A O   1 
HETATM 9107 O  O   . HOH R 6 .   ? -26.561 -1.906  -7.726  1.00 37.60  ? 1071 HOH A O   1 
HETATM 9108 O  O   . HOH R 6 .   ? -9.822  -13.988 41.628  1.00 36.59  ? 1072 HOH A O   1 
HETATM 9109 O  O   . HOH R 6 .   ? -3.059  14.909  30.682  1.00 31.23  ? 1073 HOH A O   1 
HETATM 9110 O  O   . HOH R 6 .   ? -9.720  5.178   36.140  1.00 31.48  ? 1074 HOH A O   1 
HETATM 9111 O  O   . HOH R 6 .   ? 13.185  -17.245 35.920  1.00 38.38  ? 1075 HOH A O   1 
HETATM 9112 O  O   . HOH R 6 .   ? -7.838  -11.419 -7.457  1.00 48.30  ? 1076 HOH A O   1 
HETATM 9113 O  O   . HOH R 6 .   ? -17.896 14.210  18.279  1.00 37.89  ? 1077 HOH A O   1 
HETATM 9114 O  O   . HOH R 6 .   ? 8.157   14.106  45.345  1.00 44.93  ? 1078 HOH A O   1 
HETATM 9115 O  O   . HOH R 6 .   ? 5.795   -1.686  16.142  1.00 31.57  ? 1079 HOH A O   1 
HETATM 9116 O  O   . HOH R 6 .   ? -27.867 0.544   12.566  1.00 30.70  ? 1080 HOH A O   1 
HETATM 9117 O  O   . HOH R 6 .   ? -11.805 -13.894 45.224  1.00 43.15  ? 1081 HOH A O   1 
HETATM 9118 O  O   . HOH R 6 .   ? -12.087 -26.042 5.998   1.00 57.89  ? 1082 HOH A O   1 
HETATM 9119 O  O   . HOH R 6 .   ? -3.711  2.083   -0.040  1.00 35.34  ? 1083 HOH A O   1 
HETATM 9120 O  O   . HOH R 6 .   ? 3.032   8.555   13.532  1.00 25.35  ? 1084 HOH A O   1 
HETATM 9121 O  O   . HOH R 6 .   ? 2.415   -9.124  9.736   1.00 35.70  ? 1085 HOH A O   1 
HETATM 9122 O  O   . HOH R 6 .   ? -10.660 21.970  18.456  1.00 37.21  ? 1086 HOH A O   1 
HETATM 9123 O  O   . HOH R 6 .   ? -20.988 5.536   1.901   1.00 36.56  ? 1087 HOH A O   1 
HETATM 9124 O  O   . HOH R 6 .   ? 5.328   -16.193 19.339  1.00 38.49  ? 1088 HOH A O   1 
HETATM 9125 O  O   . HOH R 6 .   ? 4.340   -11.351 37.506  1.00 43.05  ? 1089 HOH A O   1 
HETATM 9126 O  O   . HOH R 6 .   ? 5.662   10.569  30.123  1.00 33.09  ? 1090 HOH A O   1 
HETATM 9127 O  O   . HOH R 6 .   ? 13.673  11.940  8.444   1.00 52.34  ? 1091 HOH A O   1 
HETATM 9128 O  O   . HOH R 6 .   ? -27.557 0.737   22.933  1.00 35.15  ? 1092 HOH A O   1 
HETATM 9129 O  O   . HOH R 6 .   ? -11.080 12.604  31.709  1.00 29.99  ? 1093 HOH A O   1 
HETATM 9130 O  O   . HOH R 6 .   ? 3.238   9.510   3.041   1.00 33.95  ? 1094 HOH A O   1 
HETATM 9131 O  O   . HOH R 6 .   ? -8.456  14.808  6.543   1.00 32.37  ? 1095 HOH A O   1 
HETATM 9132 O  O   . HOH R 6 .   ? -4.547  -8.376  43.537  1.00 25.84  ? 1096 HOH A O   1 
HETATM 9133 O  O   . HOH R 6 .   ? -15.879 17.472  33.180  1.00 42.93  ? 1097 HOH A O   1 
HETATM 9134 O  O   . HOH R 6 .   ? -3.749  3.803   -2.119  1.00 45.53  ? 1098 HOH A O   1 
HETATM 9135 O  O   . HOH R 6 .   ? -2.924  -17.178 36.528  1.00 40.20  ? 1099 HOH A O   1 
HETATM 9136 O  O   . HOH R 6 .   ? -15.083 -23.951 15.628  1.00 35.98  ? 1100 HOH A O   1 
HETATM 9137 O  O   . HOH R 6 .   ? 19.153  -4.201  48.486  1.00 45.91  ? 1101 HOH A O   1 
HETATM 9138 O  O   . HOH R 6 .   ? -7.423  -12.458 40.617  1.00 31.09  ? 1102 HOH A O   1 
HETATM 9139 O  O   . HOH R 6 .   ? 11.484  -18.748 23.936  1.00 53.60  ? 1103 HOH A O   1 
HETATM 9140 O  O   . HOH R 6 .   ? -20.345 6.375   -7.871  1.00 39.04  ? 1104 HOH A O   1 
HETATM 9141 O  O   . HOH R 6 .   ? -6.708  5.120   38.946  1.00 44.78  ? 1105 HOH A O   1 
HETATM 9142 O  O   . HOH R 6 .   ? 18.896  -9.335  43.000  1.00 63.89  ? 1106 HOH A O   1 
HETATM 9143 O  O   . HOH R 6 .   ? -14.618 -24.229 -1.507  1.00 52.99  ? 1107 HOH A O   1 
HETATM 9144 O  O   . HOH R 6 .   ? 6.517   0.268   16.463  1.00 43.79  ? 1108 HOH A O   1 
HETATM 9145 O  O   . HOH R 6 .   ? -8.376  -8.838  -9.460  1.00 60.00  ? 1109 HOH A O   1 
HETATM 9146 O  O   . HOH R 6 .   ? 11.163  -17.030 43.881  1.00 42.69  ? 1110 HOH A O   1 
HETATM 9147 O  O   . HOH R 6 .   ? 10.561  2.752   49.107  1.00 38.52  ? 1111 HOH A O   1 
HETATM 9148 O  O   . HOH R 6 .   ? 6.300   13.196  48.459  1.00 43.48  ? 1112 HOH A O   1 
HETATM 9149 O  O   . HOH R 6 .   ? -25.888 0.393   -3.801  1.00 38.70  ? 1113 HOH A O   1 
HETATM 9150 O  O   . HOH R 6 .   ? -1.173  4.905   -2.849  1.00 47.71  ? 1114 HOH A O   1 
HETATM 9151 O  O   . HOH R 6 .   ? -27.998 2.485   22.377  1.00 47.19  ? 1115 HOH A O   1 
HETATM 9152 O  O   . HOH R 6 .   ? -10.907 -4.979  -10.158 1.00 45.02  ? 1116 HOH A O   1 
HETATM 9153 O  O   . HOH R 6 .   ? 11.658  6.817   14.151  1.00 32.35  ? 1117 HOH A O   1 
HETATM 9154 O  O   . HOH R 6 .   ? -4.599  -21.416 35.572  1.00 51.30  ? 1118 HOH A O   1 
HETATM 9155 O  O   . HOH R 6 .   ? 5.131   -13.974 17.740  1.00 36.07  ? 1119 HOH A O   1 
HETATM 9156 O  O   . HOH R 6 .   ? -14.817 -3.684  43.998  1.00 44.00  ? 1120 HOH A O   1 
HETATM 9157 O  O   . HOH R 6 .   ? -26.313 -3.801  38.140  1.00 57.57  ? 1121 HOH A O   1 
HETATM 9158 O  O   . HOH R 6 .   ? -0.273  1.154   50.339  1.00 50.00  ? 1122 HOH A O   1 
HETATM 9159 O  O   . HOH R 6 .   ? -15.379 18.058  9.360   1.00 53.57  ? 1123 HOH A O   1 
HETATM 9160 O  O   . HOH R 6 .   ? -26.877 -0.821  16.356  1.00 33.28  ? 1124 HOH A O   1 
HETATM 9161 O  O   . HOH R 6 .   ? 5.101   16.386  3.100   1.00 38.53  ? 1125 HOH A O   1 
HETATM 9162 O  O   . HOH R 6 .   ? -21.108 -22.299 24.226  1.00 54.74  ? 1126 HOH A O   1 
HETATM 9163 O  O   . HOH R 6 .   ? -17.790 0.163   40.589  1.00 46.22  ? 1127 HOH A O   1 
HETATM 9164 O  O   . HOH R 6 .   ? 15.957  0.092   27.656  1.00 38.46  ? 1128 HOH A O   1 
HETATM 9165 O  O   . HOH R 6 .   ? -30.733 -2.598  6.139   1.00 49.98  ? 1129 HOH A O   1 
HETATM 9166 O  O   . HOH R 6 .   ? 17.184  0.318   30.224  1.00 42.89  ? 1130 HOH A O   1 
HETATM 9167 O  O   . HOH R 6 .   ? -9.584  4.454   38.539  1.00 36.00  ? 1131 HOH A O   1 
HETATM 9168 O  O   . HOH R 6 .   ? -5.074  2.712   -2.908  1.00 43.15  ? 1132 HOH A O   1 
HETATM 9169 O  O   . HOH R 6 .   ? -10.226 -28.156 18.107  1.00 47.54  ? 1133 HOH A O   1 
HETATM 9170 O  O   . HOH R 6 .   ? -18.761 7.501   5.862   1.00 35.61  ? 1134 HOH A O   1 
HETATM 9171 O  O   . HOH R 6 .   ? 21.531  -4.641  34.436  1.00 65.31  ? 1135 HOH A O   1 
HETATM 9172 O  O   . HOH R 6 .   ? 16.660  -12.238 52.796  1.00 57.08  ? 1136 HOH A O   1 
HETATM 9173 O  O   . HOH R 6 .   ? -11.407 2.806   -11.397 1.00 71.46  ? 1137 HOH A O   1 
HETATM 9174 O  O   . HOH R 6 .   ? -21.346 4.977   39.677  1.00 45.26  ? 1138 HOH A O   1 
HETATM 9175 O  O   . HOH R 6 .   ? 3.705   -7.873  49.623  1.00 43.38  ? 1139 HOH A O   1 
HETATM 9176 O  O   . HOH R 6 .   ? -17.192 -3.634  45.510  1.00 49.76  ? 1140 HOH A O   1 
HETATM 9177 O  O   . HOH R 6 .   ? 3.083   10.857  30.650  1.00 39.61  ? 1141 HOH A O   1 
HETATM 9178 O  O   . HOH R 6 .   ? 8.631   35.059  14.224  1.00 47.63  ? 1142 HOH A O   1 
HETATM 9179 O  O   . HOH R 6 .   ? -13.902 -1.565  45.180  1.00 57.09  ? 1143 HOH A O   1 
HETATM 9180 O  O   . HOH R 6 .   ? -8.184  -16.136 40.431  1.00 49.04  ? 1144 HOH A O   1 
HETATM 9181 O  O   . HOH R 6 .   ? 11.995  12.736  6.305   1.00 47.31  ? 1145 HOH A O   1 
HETATM 9182 O  O   . HOH R 6 .   ? 8.996   36.401  16.048  1.00 37.83  ? 1146 HOH A O   1 
HETATM 9183 O  O   . HOH R 6 .   ? -2.938  -12.308 43.421  1.00 53.86  ? 1147 HOH A O   1 
HETATM 9184 O  O   . HOH R 6 .   ? -4.703  10.738  32.284  1.00 51.52  ? 1148 HOH A O   1 
HETATM 9185 O  O   . HOH R 6 .   ? -15.934 13.161  38.247  1.00 49.45  ? 1149 HOH A O   1 
HETATM 9186 O  O   . HOH R 6 .   ? 6.157   -12.520 47.063  1.00 47.55  ? 1150 HOH A O   1 
HETATM 9187 O  O   . HOH R 6 .   ? -8.390  3.107   49.832  1.00 34.10  ? 1151 HOH A O   1 
HETATM 9188 O  O   . HOH R 6 .   ? -18.291 9.808   10.345  1.00 33.54  ? 1152 HOH A O   1 
HETATM 9189 O  O   . HOH R 6 .   ? -15.304 -4.828  45.877  1.00 47.69  ? 1153 HOH A O   1 
HETATM 9190 O  O   . HOH R 6 .   ? -8.281  9.222   32.306  1.00 35.90  ? 1154 HOH A O   1 
HETATM 9191 O  O   . HOH R 6 .   ? -10.944 15.133  32.250  1.00 33.06  ? 1155 HOH A O   1 
HETATM 9192 O  O   . HOH R 6 .   ? -17.802 -1.852  -14.818 1.00 55.69  ? 1156 HOH A O   1 
HETATM 9193 O  O   . HOH R 6 .   ? 1.454   24.903  25.763  1.00 41.61  ? 1157 HOH A O   1 
HETATM 9194 O  O   . HOH R 6 .   ? -28.164 -1.562  21.793  1.00 44.16  ? 1158 HOH A O   1 
HETATM 9195 O  O   . HOH R 6 .   ? 0.514   22.483  30.143  1.00 46.87  ? 1159 HOH A O   1 
HETATM 9196 O  O   . HOH R 6 .   ? 4.705   14.275  49.606  1.00 61.27  ? 1160 HOH A O   1 
HETATM 9197 O  O   . HOH R 6 .   ? -5.131  -17.796 38.031  1.00 44.64  ? 1161 HOH A O   1 
HETATM 9198 O  O   . HOH R 6 .   ? -15.177 -25.046 20.119  1.00 49.17  ? 1162 HOH A O   1 
HETATM 9199 O  O   . HOH R 6 .   ? 22.701  -3.142  41.722  1.00 44.27  ? 1163 HOH A O   1 
HETATM 9200 O  O   . HOH R 6 .   ? -7.314  13.937  31.328  1.00 39.63  ? 1164 HOH A O   1 
HETATM 9201 O  O   . HOH R 6 .   ? 16.597  0.819   17.111  1.00 28.49  ? 1165 HOH A O   1 
HETATM 9202 O  O   . HOH R 6 .   ? 3.973   8.087   0.359   1.00 52.40  ? 1166 HOH A O   1 
HETATM 9203 O  O   . HOH R 6 .   ? 7.071   -10.107 45.821  1.00 37.01  ? 1167 HOH A O   1 
HETATM 9204 O  O   . HOH R 6 .   ? -28.885 -17.690 29.539  1.00 55.46  ? 1168 HOH A O   1 
HETATM 9205 O  O   . HOH R 6 .   ? -15.222 13.490  11.352  1.00 38.21  ? 1169 HOH A O   1 
HETATM 9206 O  O   . HOH R 6 .   ? 12.349  -17.823 33.269  1.00 40.33  ? 1170 HOH A O   1 
HETATM 9207 O  O   . HOH R 6 .   ? -1.930  19.380  51.832  1.00 66.07  ? 1171 HOH A O   1 
HETATM 9208 O  O   . HOH R 6 .   ? 1.571   15.577  32.458  1.00 41.22  ? 1172 HOH A O   1 
HETATM 9209 O  O   . HOH R 6 .   ? 9.776   -17.828 34.258  1.00 58.07  ? 1173 HOH A O   1 
HETATM 9210 O  O   . HOH R 6 .   ? -16.160 -24.322 10.697  1.00 56.92  ? 1174 HOH A O   1 
HETATM 9211 O  O   . HOH R 6 .   ? 15.121  -17.154 29.116  1.00 43.30  ? 1175 HOH A O   1 
HETATM 9212 O  O   . HOH R 6 .   ? -6.794  8.956   -4.244  1.00 44.08  ? 1176 HOH A O   1 
HETATM 9213 O  O   . HOH R 6 .   ? 15.408  -14.435 14.272  1.00 48.89  ? 1177 HOH A O   1 
HETATM 9214 O  O   . HOH R 6 .   ? -22.966 11.704  38.656  1.00 47.02  ? 1178 HOH A O   1 
HETATM 9215 O  O   . HOH R 6 .   ? -8.250  11.622  -3.968  1.00 43.07  ? 1179 HOH A O   1 
HETATM 9216 O  O   . HOH R 6 .   ? -28.704 6.487   2.581   1.00 43.37  ? 1180 HOH A O   1 
HETATM 9217 O  O   . HOH R 6 .   ? -13.852 19.662  9.626   1.00 48.27  ? 1181 HOH A O   1 
HETATM 9218 O  O   . HOH R 6 .   ? -5.663  21.166  32.409  1.00 46.68  ? 1182 HOH A O   1 
HETATM 9219 O  O   . HOH R 6 .   ? -2.243  -9.655  44.356  1.00 38.13  ? 1183 HOH A O   1 
HETATM 9220 O  O   . HOH R 6 .   ? -0.348  19.070  47.300  1.00 60.42  ? 1184 HOH A O   1 
HETATM 9221 O  O   . HOH R 6 .   ? 19.690  -9.881  40.797  1.00 50.01  ? 1185 HOH A O   1 
HETATM 9222 O  O   . HOH R 6 .   ? 4.546   -9.105  48.127  1.00 45.68  ? 1186 HOH A O   1 
HETATM 9223 O  O   . HOH R 6 .   ? 10.807  3.805   9.081   1.00 37.38  ? 1187 HOH A O   1 
HETATM 9224 O  O   . HOH R 6 .   ? 3.199   -17.931 31.741  1.00 35.78  ? 1188 HOH A O   1 
HETATM 9225 O  O   . HOH R 6 .   ? -25.761 12.808  25.047  1.00 46.55  ? 1189 HOH A O   1 
HETATM 9226 O  O   . HOH R 6 .   ? -20.060 8.454   -9.268  1.00 53.69  ? 1190 HOH A O   1 
HETATM 9227 O  O   . HOH R 6 .   ? -31.581 -3.999  4.368   1.00 57.82  ? 1191 HOH A O   1 
HETATM 9228 O  O   . HOH R 6 .   ? -5.333  24.853  26.835  1.00 42.44  ? 1192 HOH A O   1 
HETATM 9229 O  O   . HOH R 6 .   ? -11.099 16.599  0.596   1.00 54.61  ? 1193 HOH A O   1 
HETATM 9230 O  O   . HOH R 6 .   ? -11.303 13.118  36.222  1.00 41.45  ? 1194 HOH A O   1 
HETATM 9231 O  O   . HOH R 6 .   ? -10.547 8.766   33.642  1.00 32.47  ? 1195 HOH A O   1 
HETATM 9232 O  O   . HOH R 6 .   ? -26.665 -9.223  41.733  1.00 42.04  ? 1196 HOH A O   1 
HETATM 9233 O  O   . HOH R 6 .   ? -1.414  16.931  32.532  1.00 48.24  ? 1197 HOH A O   1 
HETATM 9234 O  O   . HOH R 6 .   ? 21.460  -11.307 37.240  1.00 47.89  ? 1198 HOH A O   1 
HETATM 9235 O  O   . HOH R 6 .   ? -6.703  24.345  29.155  1.00 49.61  ? 1199 HOH A O   1 
HETATM 9236 O  O   . HOH R 6 .   ? 15.906  16.046  9.505   1.00 44.04  ? 1200 HOH A O   1 
HETATM 9237 O  O   . HOH R 6 .   ? -20.488 3.293   -10.461 1.00 36.84  ? 1201 HOH A O   1 
HETATM 9238 O  O   . HOH R 6 .   ? -6.789  28.820  14.643  1.00 45.54  ? 1202 HOH A O   1 
HETATM 9239 O  O   . HOH R 6 .   ? -1.251  12.473  31.153  1.00 38.90  ? 1203 HOH A O   1 
HETATM 9240 O  O   . HOH R 6 .   ? -8.772  16.588  31.073  1.00 34.84  ? 1204 HOH A O   1 
HETATM 9241 O  O   . HOH R 6 .   ? 8.455   -0.486  7.243   1.00 38.87  ? 1205 HOH A O   1 
HETATM 9242 O  O   . HOH R 6 .   ? -6.051  9.345   33.244  1.00 51.81  ? 1206 HOH A O   1 
HETATM 9243 O  O   . HOH R 6 .   ? -16.909 15.081  13.179  1.00 49.84  ? 1207 HOH A O   1 
HETATM 9244 O  O   . HOH R 6 .   ? 10.287  29.508  19.087  1.00 46.65  ? 1208 HOH A O   1 
HETATM 9245 O  O   . HOH R 6 .   ? 2.187   -13.262 12.962  1.00 52.85  ? 1209 HOH A O   1 
HETATM 9246 O  O   . HOH R 6 .   ? -12.495 -27.932 19.805  1.00 46.57  ? 1210 HOH A O   1 
HETATM 9247 O  O   . HOH R 6 .   ? 5.588   -12.756 42.442  1.00 41.95  ? 1211 HOH A O   1 
HETATM 9248 O  O   . HOH R 6 .   ? -8.034  18.132  33.180  1.00 43.25  ? 1212 HOH A O   1 
HETATM 9249 O  O   . HOH R 6 .   ? -26.324 -8.036  35.419  1.00 40.86  ? 1213 HOH A O   1 
HETATM 9250 O  O   . HOH R 6 .   ? -15.260 -1.249  -15.231 1.00 55.71  ? 1214 HOH A O   1 
HETATM 9251 O  O   . HOH R 6 .   ? -16.691 -25.193 -2.542  1.00 52.59  ? 1215 HOH A O   1 
HETATM 9252 O  O   . HOH R 6 .   ? 1.619   -20.313 32.201  1.00 49.09  ? 1216 HOH A O   1 
HETATM 9253 O  O   . HOH R 6 .   ? -28.508 -4.063  36.322  1.00 55.54  ? 1217 HOH A O   1 
HETATM 9254 O  O   . HOH R 6 .   ? -24.946 8.409   14.287  1.00 44.75  ? 1218 HOH A O   1 
HETATM 9255 O  O   . HOH R 6 .   ? 4.868   13.882  1.883   1.00 48.04  ? 1219 HOH A O   1 
HETATM 9256 O  O   . HOH R 6 .   ? -26.881 -18.555 20.526  1.00 53.27  ? 1220 HOH A O   1 
HETATM 9257 O  O   . HOH R 6 .   ? 13.076  7.868   35.748  1.00 42.31  ? 1221 HOH A O   1 
HETATM 9258 O  O   . HOH R 6 .   ? -17.371 -23.498 21.677  1.00 43.01  ? 1222 HOH A O   1 
HETATM 9259 O  O   . HOH R 6 .   ? -2.752  25.553  27.697  1.00 39.48  ? 1223 HOH A O   1 
HETATM 9260 O  O   . HOH R 6 .   ? -10.702 15.417  35.100  1.00 42.77  ? 1224 HOH A O   1 
HETATM 9261 O  O   . HOH R 6 .   ? -6.022  13.268  -2.370  1.00 43.43  ? 1225 HOH A O   1 
HETATM 9262 O  O   . HOH R 6 .   ? 0.633   27.286  24.244  1.00 47.12  ? 1226 HOH A O   1 
HETATM 9263 O  O   . HOH R 6 .   ? -26.872 5.007   23.209  1.00 38.63  ? 1227 HOH A O   1 
HETATM 9264 O  O   . HOH R 6 .   ? 13.892  26.393  20.759  1.00 56.02  ? 1228 HOH A O   1 
HETATM 9265 O  O   . HOH R 6 .   ? -5.198  -10.960 47.029  1.00 37.33  ? 1229 HOH A O   1 
HETATM 9266 O  O   . HOH R 6 .   ? -2.424  28.127  26.169  1.00 55.16  ? 1230 HOH A O   1 
HETATM 9267 O  O   . HOH R 6 .   ? 3.803   24.987  26.140  1.00 39.02  ? 1231 HOH A O   1 
HETATM 9268 O  O   . HOH R 6 .   ? 8.218   -18.261 40.752  1.00 51.87  ? 1232 HOH A O   1 
HETATM 9269 O  O   . HOH R 6 .   ? -29.715 -11.192 34.370  1.00 48.85  ? 1233 HOH A O   1 
HETATM 9270 O  O   . HOH R 6 .   ? -19.075 9.900   7.326   1.00 41.66  ? 1234 HOH A O   1 
HETATM 9271 O  O   . HOH R 6 .   ? -26.539 -12.875 36.828  1.00 42.01  ? 1235 HOH A O   1 
HETATM 9272 O  O   . HOH R 6 .   ? 12.156  -19.157 37.537  1.00 45.82  ? 1236 HOH A O   1 
HETATM 9273 O  O   . HOH R 6 .   ? 8.751   -16.516 42.960  1.00 36.48  ? 1237 HOH A O   1 
HETATM 9274 O  O   . HOH R 6 .   ? 21.121  -8.394  43.022  1.00 54.91  ? 1238 HOH A O   1 
HETATM 9275 O  O   . HOH R 6 .   ? -6.655  -13.660 38.150  1.00 35.67  ? 1239 HOH A O   1 
HETATM 9276 O  O   . HOH R 6 .   ? -16.356 -25.785 17.309  1.00 53.17  ? 1240 HOH A O   1 
HETATM 9277 O  O   . HOH R 6 .   ? -18.648 -25.088 -3.781  1.00 53.77  ? 1241 HOH A O   1 
HETATM 9278 O  O   . HOH R 6 .   ? -18.229 16.971  11.682  1.00 58.55  ? 1242 HOH A O   1 
HETATM 9279 O  O   . HOH R 6 .   ? -27.624 -14.622 35.102  1.00 43.58  ? 1243 HOH A O   1 
HETATM 9280 O  O   . HOH R 6 .   ? -2.475  -9.575  47.273  1.00 43.04  ? 1244 HOH A O   1 
HETATM 9281 O  O   . HOH R 6 .   ? -23.049 16.011  24.428  1.00 58.28  ? 1245 HOH A O   1 
HETATM 9282 O  O   . HOH R 6 .   ? 5.347   -14.166 44.889  1.00 50.03  ? 1246 HOH A O   1 
HETATM 9283 O  O   . HOH R 6 .   ? -12.639 -30.174 21.603  1.00 53.01  ? 1247 HOH A O   1 
HETATM 9284 O  O   . HOH R 6 .   ? -14.623 -7.039  -11.522 1.00 50.59  ? 1248 HOH A O   1 
HETATM 9285 O  O   . HOH R 6 .   ? -28.570 -9.279  38.778  1.00 53.41  ? 1249 HOH A O   1 
HETATM 9286 O  O   . HOH R 6 .   ? -27.504 -10.490 36.122  1.00 44.34  ? 1250 HOH A O   1 
HETATM 9287 O  O   . HOH R 6 .   ? -5.562  25.310  31.364  1.00 52.98  ? 1251 HOH A O   1 
HETATM 9288 O  O   . HOH R 6 .   ? -22.643 -21.321 -6.107  1.00 67.97  ? 1252 HOH A O   1 
HETATM 9289 O  O   . HOH R 6 .   ? 10.309  1.823   7.524   1.00 40.31  ? 1253 HOH A O   1 
HETATM 9290 O  O   . HOH R 6 .   ? 13.238  -30.640 6.022   1.00 56.14  ? 1254 HOH A O   1 
HETATM 9291 O  O   . HOH R 6 .   ? 13.001  -26.813 3.874   1.00 58.45  ? 1255 HOH A O   1 
HETATM 9292 O  O   . HOH R 6 .   ? 14.624  -31.344 4.344   1.00 49.24  ? 1256 HOH A O   1 
HETATM 9293 O  O   . HOH S 6 .   ? -22.929 -70.274 16.527  1.00 49.01  ? 701  HOH B O   1 
HETATM 9294 O  O   . HOH S 6 .   ? -11.315 -54.128 16.483  1.00 38.34  ? 702  HOH B O   1 
HETATM 9295 O  O   . HOH S 6 .   ? -3.203  -64.982 -38.805 1.00 54.12  ? 703  HOH B O   1 
HETATM 9296 O  O   . HOH S 6 .   ? -28.225 -49.492 -28.775 1.00 39.19  ? 704  HOH B O   1 
HETATM 9297 O  O   . HOH S 6 .   ? 11.101  -35.714 -3.744  1.00 52.26  ? 705  HOH B O   1 
HETATM 9298 O  O   . HOH S 6 .   ? 0.586   -54.684 -27.302 1.00 34.32  ? 706  HOH B O   1 
HETATM 9299 O  O   . HOH S 6 .   ? -17.417 -75.313 -25.314 1.00 50.76  ? 707  HOH B O   1 
HETATM 9300 O  O   . HOH S 6 .   ? 11.620  -83.641 -15.743 1.00 69.76  ? 708  HOH B O   1 
HETATM 9301 O  O   . HOH S 6 .   ? 0.752   -76.598 -20.589 1.00 63.34  ? 709  HOH B O   1 
HETATM 9302 O  O   . HOH S 6 .   ? -34.737 -65.799 -26.118 1.00 44.41  ? 710  HOH B O   1 
HETATM 9303 O  O   . HOH S 6 .   ? 21.038  -51.466 11.478  1.00 44.23  ? 711  HOH B O   1 
HETATM 9304 O  O   . HOH S 6 .   ? -9.957  -32.145 -24.625 1.00 57.94  ? 712  HOH B O   1 
HETATM 9305 O  O   . HOH S 6 .   ? -24.066 -68.350 12.507  1.00 43.97  ? 713  HOH B O   1 
HETATM 9306 O  O   . HOH S 6 .   ? 12.640  -56.448 -17.855 1.00 43.89  ? 714  HOH B O   1 
HETATM 9307 O  O   . HOH S 6 .   ? 19.781  -65.150 5.931   1.00 51.62  ? 715  HOH B O   1 
HETATM 9308 O  O   . HOH S 6 .   ? -1.058  -64.516 -20.829 1.00 35.98  ? 716  HOH B O   1 
HETATM 9309 O  O   . HOH S 6 .   ? -20.176 -37.903 -5.374  1.00 47.64  ? 717  HOH B O   1 
HETATM 9310 O  O   . HOH S 6 .   ? -2.133  -53.192 -3.783  1.00 30.88  ? 718  HOH B O   1 
HETATM 9311 O  O   . HOH S 6 .   ? -2.612  -23.626 -10.190 1.00 58.21  ? 719  HOH B O   1 
HETATM 9312 O  O   . HOH S 6 .   ? -23.347 -66.338 12.907  1.00 43.66  ? 720  HOH B O   1 
HETATM 9313 O  O   . HOH S 6 .   ? -21.222 -53.734 -15.235 1.00 28.99  ? 721  HOH B O   1 
HETATM 9314 O  O   . HOH S 6 .   ? -3.577  -77.040 2.451   1.00 36.93  ? 722  HOH B O   1 
HETATM 9315 O  O   . HOH S 6 .   ? 10.045  -45.266 7.833   1.00 39.77  ? 723  HOH B O   1 
HETATM 9316 O  O   . HOH S 6 .   ? -27.013 -66.468 20.826  1.00 62.89  ? 724  HOH B O   1 
HETATM 9317 O  O   . HOH S 6 .   ? -11.762 -74.697 6.123   1.00 43.35  ? 725  HOH B O   1 
HETATM 9318 O  O   . HOH S 6 .   ? 14.321  -47.539 2.458   1.00 61.64  ? 726  HOH B O   1 
HETATM 9319 O  O   . HOH S 6 .   ? 4.298   -61.448 -17.019 1.00 28.38  ? 727  HOH B O   1 
HETATM 9320 O  O   . HOH S 6 .   ? -23.675 -45.676 -21.895 1.00 39.55  ? 728  HOH B O   1 
HETATM 9321 O  O   . HOH S 6 .   ? -15.377 -39.021 -18.341 1.00 44.36  ? 729  HOH B O   1 
HETATM 9322 O  O   . HOH S 6 .   ? -20.180 -74.056 -3.854  1.00 37.42  ? 730  HOH B O   1 
HETATM 9323 O  O   . HOH S 6 .   ? -13.491 -46.739 -38.278 1.00 51.37  ? 731  HOH B O   1 
HETATM 9324 O  O   . HOH S 6 .   ? 18.855  -52.813 10.197  1.00 27.49  ? 732  HOH B O   1 
HETATM 9325 O  O   . HOH S 6 .   ? 8.155   -47.285 -20.521 1.00 41.37  ? 733  HOH B O   1 
HETATM 9326 O  O   . HOH S 6 .   ? 13.502  -36.850 -17.036 1.00 39.19  ? 734  HOH B O   1 
HETATM 9327 O  O   . HOH S 6 .   ? -6.810  -51.107 9.877   1.00 30.30  ? 735  HOH B O   1 
HETATM 9328 O  O   . HOH S 6 .   ? 16.613  -50.912 -16.455 1.00 35.74  ? 736  HOH B O   1 
HETATM 9329 O  O   . HOH S 6 .   ? -13.151 -30.418 -8.191  1.00 56.44  ? 737  HOH B O   1 
HETATM 9330 O  O   . HOH S 6 .   ? -15.713 -40.178 -26.930 1.00 41.38  ? 738  HOH B O   1 
HETATM 9331 O  O   . HOH S 6 .   ? -10.475 -34.537 -16.583 1.00 39.91  ? 739  HOH B O   1 
HETATM 9332 O  O   . HOH S 6 .   ? -9.553  -68.786 -15.665 1.00 26.42  ? 740  HOH B O   1 
HETATM 9333 O  O   . HOH S 6 .   ? -22.877 -61.585 -10.428 1.00 26.72  ? 741  HOH B O   1 
HETATM 9334 O  O   . HOH S 6 .   ? -0.410  -70.533 -4.768  1.00 30.71  ? 742  HOH B O   1 
HETATM 9335 O  O   . HOH S 6 .   ? 10.491  -49.022 19.414  1.00 42.45  ? 743  HOH B O   1 
HETATM 9336 O  O   . HOH S 6 .   ? -15.556 -44.599 13.246  1.00 47.15  ? 744  HOH B O   1 
HETATM 9337 O  O   . HOH S 6 .   ? -18.000 -51.442 -36.649 1.00 33.40  ? 745  HOH B O   1 
HETATM 9338 O  O   . HOH S 6 .   ? -27.955 -62.928 1.348   1.00 36.88  ? 746  HOH B O   1 
HETATM 9339 O  O   . HOH S 6 .   ? -17.988 -76.802 0.494   1.00 38.43  ? 747  HOH B O   1 
HETATM 9340 O  O   . HOH S 6 .   ? -4.675  -41.830 14.585  1.00 41.90  ? 748  HOH B O   1 
HETATM 9341 O  O   . HOH S 6 .   ? 17.604  -51.255 14.454  1.00 34.58  ? 749  HOH B O   1 
HETATM 9342 O  O   . HOH S 6 .   ? 4.471   -47.345 -12.207 1.00 23.26  ? 750  HOH B O   1 
HETATM 9343 O  O   . HOH S 6 .   ? -13.192 -80.561 -3.138  1.00 48.04  ? 751  HOH B O   1 
HETATM 9344 O  O   . HOH S 6 .   ? 3.679   -80.215 -7.010  1.00 37.58  ? 752  HOH B O   1 
HETATM 9345 O  O   . HOH S 6 .   ? -3.831  -61.853 -2.300  1.00 23.51  ? 753  HOH B O   1 
HETATM 9346 O  O   . HOH S 6 .   ? 21.578  -54.989 10.701  1.00 35.58  ? 754  HOH B O   1 
HETATM 9347 O  O   . HOH S 6 .   ? -11.615 -36.205 -20.528 1.00 42.78  ? 755  HOH B O   1 
HETATM 9348 O  O   . HOH S 6 .   ? 2.720   -62.299 15.345  1.00 54.04  ? 756  HOH B O   1 
HETATM 9349 O  O   . HOH S 6 .   ? -8.757  -47.695 -25.904 1.00 28.41  ? 757  HOH B O   1 
HETATM 9350 O  O   . HOH S 6 .   ? -1.524  -57.304 -11.586 1.00 23.96  ? 758  HOH B O   1 
HETATM 9351 O  O   . HOH S 6 .   ? -24.694 -60.741 -30.058 1.00 37.12  ? 759  HOH B O   1 
HETATM 9352 O  O   . HOH S 6 .   ? -29.046 -54.526 3.340   1.00 33.83  ? 760  HOH B O   1 
HETATM 9353 O  O   . HOH S 6 .   ? -20.515 -56.275 11.879  1.00 34.11  ? 761  HOH B O   1 
HETATM 9354 O  O   . HOH S 6 .   ? 16.823  -57.108 22.578  1.00 47.81  ? 762  HOH B O   1 
HETATM 9355 O  O   . HOH S 6 .   ? 12.297  -59.708 -11.021 1.00 34.78  ? 763  HOH B O   1 
HETATM 9356 O  O   . HOH S 6 .   ? -7.704  -46.017 2.259   1.00 23.15  ? 764  HOH B O   1 
HETATM 9357 O  O   . HOH S 6 .   ? -7.404  -61.646 -17.878 1.00 26.64  ? 765  HOH B O   1 
HETATM 9358 O  O   . HOH S 6 .   ? -21.934 -43.625 -13.279 1.00 36.07  ? 766  HOH B O   1 
HETATM 9359 O  O   . HOH S 6 .   ? -6.717  -63.363 22.003  1.00 34.07  ? 767  HOH B O   1 
HETATM 9360 O  O   . HOH S 6 .   ? 3.826   -67.645 -16.930 1.00 56.48  ? 768  HOH B O   1 
HETATM 9361 O  O   . HOH S 6 .   ? -13.967 -39.159 9.078   1.00 49.33  ? 769  HOH B O   1 
HETATM 9362 O  O   . HOH S 6 .   ? -26.173 -65.110 0.900   1.00 28.26  ? 770  HOH B O   1 
HETATM 9363 O  O   . HOH S 6 .   ? -25.517 -68.676 3.663   1.00 29.55  ? 771  HOH B O   1 
HETATM 9364 O  O   . HOH S 6 .   ? 7.755   -70.287 11.321  1.00 44.87  ? 772  HOH B O   1 
HETATM 9365 O  O   . HOH S 6 .   ? -4.424  -64.767 -29.102 1.00 41.49  ? 773  HOH B O   1 
HETATM 9366 O  O   . HOH S 6 .   ? -20.866 -75.307 0.219   1.00 35.33  ? 774  HOH B O   1 
HETATM 9367 O  O   . HOH S 6 .   ? 19.025  -61.808 7.860   1.00 36.22  ? 775  HOH B O   1 
HETATM 9368 O  O   . HOH S 6 .   ? 2.204   -44.771 -8.142  1.00 30.07  ? 776  HOH B O   1 
HETATM 9369 O  O   . HOH S 6 .   ? -27.132 -44.236 8.737   1.00 45.82  ? 777  HOH B O   1 
HETATM 9370 O  O   . HOH S 6 .   ? 6.782   -54.316 -8.372  1.00 36.26  ? 778  HOH B O   1 
HETATM 9371 O  O   . HOH S 6 .   ? -19.477 -54.502 15.396  1.00 57.84  ? 779  HOH B O   1 
HETATM 9372 O  O   . HOH S 6 .   ? -10.863 -43.757 -31.127 1.00 45.83  ? 780  HOH B O   1 
HETATM 9373 O  O   . HOH S 6 .   ? 2.682   -63.889 8.240   1.00 36.61  ? 781  HOH B O   1 
HETATM 9374 O  O   . HOH S 6 .   ? -6.618  -48.135 7.541   1.00 41.19  ? 782  HOH B O   1 
HETATM 9375 O  O   . HOH S 6 .   ? -27.400 -59.236 7.091   1.00 34.12  ? 783  HOH B O   1 
HETATM 9376 O  O   . HOH S 6 .   ? -3.262  -40.462 -17.900 1.00 28.39  ? 784  HOH B O   1 
HETATM 9377 O  O   . HOH S 6 .   ? 2.387   -69.035 -9.825  1.00 31.35  ? 785  HOH B O   1 
HETATM 9378 O  O   . HOH S 6 .   ? 12.266  -42.153 5.712   1.00 47.74  ? 786  HOH B O   1 
HETATM 9379 O  O   . HOH S 6 .   ? -4.546  -53.000 -21.284 1.00 26.04  ? 787  HOH B O   1 
HETATM 9380 O  O   . HOH S 6 .   ? -19.311 -68.580 -27.513 1.00 34.77  ? 788  HOH B O   1 
HETATM 9381 O  O   . HOH S 6 .   ? -5.857  -47.265 -30.358 1.00 34.52  ? 789  HOH B O   1 
HETATM 9382 O  O   . HOH S 6 .   ? 21.016  -56.819 7.733   1.00 31.20  ? 790  HOH B O   1 
HETATM 9383 O  O   . HOH S 6 .   ? -0.322  -30.215 -0.096  1.00 44.80  ? 791  HOH B O   1 
HETATM 9384 O  O   . HOH S 6 .   ? -14.330 -60.506 13.220  1.00 26.94  ? 792  HOH B O   1 
HETATM 9385 O  O   . HOH S 6 .   ? -23.609 -77.897 -9.455  1.00 54.91  ? 793  HOH B O   1 
HETATM 9386 O  O   . HOH S 6 .   ? 18.954  -59.882 10.260  1.00 28.82  ? 794  HOH B O   1 
HETATM 9387 O  O   . HOH S 6 .   ? -17.053 -46.957 -23.880 1.00 36.43  ? 795  HOH B O   1 
HETATM 9388 O  O   . HOH S 6 .   ? -1.834  -43.507 2.111   1.00 34.66  ? 796  HOH B O   1 
HETATM 9389 O  O   . HOH S 6 .   ? -17.495 -46.917 -26.708 1.00 40.88  ? 797  HOH B O   1 
HETATM 9390 O  O   . HOH S 6 .   ? -23.438 -72.033 -20.741 1.00 53.80  ? 798  HOH B O   1 
HETATM 9391 O  O   . HOH S 6 .   ? -24.248 -53.970 -15.387 1.00 25.77  ? 799  HOH B O   1 
HETATM 9392 O  O   . HOH S 6 .   ? -24.868 -58.374 6.807   1.00 25.87  ? 800  HOH B O   1 
HETATM 9393 O  O   . HOH S 6 .   ? 3.806   -51.348 5.740   1.00 26.49  ? 801  HOH B O   1 
HETATM 9394 O  O   . HOH S 6 .   ? -14.751 -75.678 -10.339 1.00 29.33  ? 802  HOH B O   1 
HETATM 9395 O  O   . HOH S 6 .   ? -31.417 -60.946 -14.115 1.00 44.32  ? 803  HOH B O   1 
HETATM 9396 O  O   . HOH S 6 .   ? 13.413  -28.902 -9.529  1.00 55.50  ? 804  HOH B O   1 
HETATM 9397 O  O   . HOH S 6 .   ? -26.325 -70.567 -4.072  1.00 34.84  ? 805  HOH B O   1 
HETATM 9398 O  O   . HOH S 6 .   ? -20.620 -48.207 -22.642 1.00 32.49  ? 806  HOH B O   1 
HETATM 9399 O  O   . HOH S 6 .   ? -23.904 -61.373 6.798   1.00 26.10  ? 807  HOH B O   1 
HETATM 9400 O  O   . HOH S 6 .   ? -1.452  -47.065 -30.241 1.00 52.06  ? 808  HOH B O   1 
HETATM 9401 O  O   . HOH S 6 .   ? -27.863 -52.961 -19.395 1.00 32.08  ? 809  HOH B O   1 
HETATM 9402 O  O   . HOH S 6 .   ? -6.634  -54.787 -21.081 1.00 25.35  ? 810  HOH B O   1 
HETATM 9403 O  O   . HOH S 6 .   ? -18.520 -73.830 -20.272 1.00 47.69  ? 811  HOH B O   1 
HETATM 9404 O  O   . HOH S 6 .   ? -0.735  -61.650 9.452   1.00 29.87  ? 812  HOH B O   1 
HETATM 9405 O  O   . HOH S 6 .   ? -6.834  -63.513 -0.711  1.00 21.73  ? 813  HOH B O   1 
HETATM 9406 O  O   . HOH S 6 .   ? 2.896   -42.385 -24.744 1.00 37.45  ? 814  HOH B O   1 
HETATM 9407 O  O   . HOH S 6 .   ? -35.132 -55.553 0.600   1.00 56.77  ? 815  HOH B O   1 
HETATM 9408 O  O   . HOH S 6 .   ? 14.435  -46.069 -13.028 1.00 44.08  ? 816  HOH B O   1 
HETATM 9409 O  O   . HOH S 6 .   ? -5.131  -80.397 -17.656 1.00 49.23  ? 817  HOH B O   1 
HETATM 9410 O  O   . HOH S 6 .   ? -25.571 -55.610 -21.750 1.00 27.51  ? 818  HOH B O   1 
HETATM 9411 O  O   . HOH S 6 .   ? -0.233  -46.356 -16.314 1.00 26.48  ? 819  HOH B O   1 
HETATM 9412 O  O   . HOH S 6 .   ? 13.805  -66.074 28.680  1.00 36.77  ? 820  HOH B O   1 
HETATM 9413 O  O   . HOH S 6 .   ? -13.124 -79.906 -5.507  1.00 34.88  ? 821  HOH B O   1 
HETATM 9414 O  O   . HOH S 6 .   ? 0.144   -45.751 -0.795  1.00 30.31  ? 822  HOH B O   1 
HETATM 9415 O  O   . HOH S 6 .   ? 19.241  -57.467 3.820   1.00 33.83  ? 823  HOH B O   1 
HETATM 9416 O  O   . HOH S 6 .   ? 7.399   -58.561 -10.097 1.00 22.10  ? 824  HOH B O   1 
HETATM 9417 O  O   . HOH S 6 .   ? 0.126   -64.390 -23.463 1.00 38.19  ? 825  HOH B O   1 
HETATM 9418 O  O   . HOH S 6 .   ? 11.789  -62.998 19.032  1.00 29.26  ? 826  HOH B O   1 
HETATM 9419 O  O   . HOH S 6 .   ? -6.415  -46.919 -24.812 1.00 26.08  ? 827  HOH B O   1 
HETATM 9420 O  O   . HOH S 6 .   ? 0.959   -38.834 -23.783 1.00 36.19  ? 828  HOH B O   1 
HETATM 9421 O  O   . HOH S 6 .   ? 13.567  -53.841 -5.760  1.00 45.82  ? 829  HOH B O   1 
HETATM 9422 O  O   . HOH S 6 .   ? 11.452  -54.318 -7.779  1.00 37.66  ? 830  HOH B O   1 
HETATM 9423 O  O   . HOH S 6 .   ? -23.446 -82.352 -3.144  1.00 64.46  ? 831  HOH B O   1 
HETATM 9424 O  O   . HOH S 6 .   ? -10.955 -68.703 -33.960 1.00 42.30  ? 832  HOH B O   1 
HETATM 9425 O  O   . HOH S 6 .   ? 4.588   -46.074 -6.341  1.00 32.81  ? 833  HOH B O   1 
HETATM 9426 O  O   . HOH S 6 .   ? -6.929  -39.938 -27.777 1.00 36.48  ? 834  HOH B O   1 
HETATM 9427 O  O   . HOH S 6 .   ? -8.186  -56.683 -14.640 1.00 20.78  ? 835  HOH B O   1 
HETATM 9428 O  O   . HOH S 6 .   ? 0.464   -46.396 -6.778  1.00 23.79  ? 836  HOH B O   1 
HETATM 9429 O  O   . HOH S 6 .   ? 12.720  -71.439 -7.092  1.00 37.38  ? 837  HOH B O   1 
HETATM 9430 O  O   . HOH S 6 .   ? -0.445  -62.585 -37.026 1.00 56.69  ? 838  HOH B O   1 
HETATM 9431 O  O   . HOH S 6 .   ? -21.123 -49.621 9.545   1.00 27.21  ? 839  HOH B O   1 
HETATM 9432 O  O   . HOH S 6 .   ? -8.182  -80.413 -1.757  1.00 32.04  ? 840  HOH B O   1 
HETATM 9433 O  O   . HOH S 6 .   ? -20.992 -72.648 11.522  1.00 42.56  ? 841  HOH B O   1 
HETATM 9434 O  O   . HOH S 6 .   ? -9.673  -45.839 18.055  1.00 40.78  ? 842  HOH B O   1 
HETATM 9435 O  O   . HOH S 6 .   ? -8.350  -83.526 -7.967  1.00 41.65  ? 843  HOH B O   1 
HETATM 9436 O  O   . HOH S 6 .   ? -4.943  -33.276 -4.699  1.00 35.72  ? 844  HOH B O   1 
HETATM 9437 O  O   . HOH S 6 .   ? 13.272  -68.633 -4.697  1.00 39.94  ? 845  HOH B O   1 
HETATM 9438 O  O   . HOH S 6 .   ? -5.938  -37.265 -12.569 1.00 33.87  ? 846  HOH B O   1 
HETATM 9439 O  O   . HOH S 6 .   ? 17.548  -55.462 -15.269 1.00 51.07  ? 847  HOH B O   1 
HETATM 9440 O  O   . HOH S 6 .   ? 21.731  -57.488 11.960  1.00 34.28  ? 848  HOH B O   1 
HETATM 9441 O  O   . HOH S 6 .   ? 10.275  -58.550 -17.754 1.00 36.09  ? 849  HOH B O   1 
HETATM 9442 O  O   . HOH S 6 .   ? -23.352 -58.098 4.547   1.00 24.72  ? 850  HOH B O   1 
HETATM 9443 O  O   . HOH S 6 .   ? 15.106  -56.643 1.449   1.00 27.74  ? 851  HOH B O   1 
HETATM 9444 O  O   . HOH S 6 .   ? 6.716   -63.666 16.053  1.00 31.28  ? 852  HOH B O   1 
HETATM 9445 O  O   . HOH S 6 .   ? -5.082  -69.710 -23.879 1.00 48.70  ? 853  HOH B O   1 
HETATM 9446 O  O   . HOH S 6 .   ? -8.558  -42.510 3.397   1.00 34.80  ? 854  HOH B O   1 
HETATM 9447 O  O   . HOH S 6 .   ? -27.202 -47.687 -21.835 1.00 38.45  ? 855  HOH B O   1 
HETATM 9448 O  O   . HOH S 6 .   ? 1.119   -36.594 -22.238 1.00 39.70  ? 856  HOH B O   1 
HETATM 9449 O  O   . HOH S 6 .   ? -1.983  -41.761 -20.002 1.00 28.77  ? 857  HOH B O   1 
HETATM 9450 O  O   . HOH S 6 .   ? 7.309   -32.559 -0.256  1.00 54.86  ? 858  HOH B O   1 
HETATM 9451 O  O   . HOH S 6 .   ? 5.032   -54.193 -13.320 1.00 29.74  ? 859  HOH B O   1 
HETATM 9452 O  O   . HOH S 6 .   ? 7.950   -56.792 -18.354 1.00 30.73  ? 860  HOH B O   1 
HETATM 9453 O  O   . HOH S 6 .   ? -4.013  -58.691 -8.723  1.00 25.88  ? 861  HOH B O   1 
HETATM 9454 O  O   . HOH S 6 .   ? 7.799   -65.215 7.592   1.00 29.81  ? 862  HOH B O   1 
HETATM 9455 O  O   . HOH S 6 .   ? 9.116   -53.840 23.590  1.00 32.68  ? 863  HOH B O   1 
HETATM 9456 O  O   . HOH S 6 .   ? 8.968   -68.012 24.574  1.00 42.14  ? 864  HOH B O   1 
HETATM 9457 O  O   . HOH S 6 .   ? -27.665 -50.554 -2.199  1.00 30.53  ? 865  HOH B O   1 
HETATM 9458 O  O   . HOH S 6 .   ? 14.829  -69.697 -2.936  1.00 41.97  ? 866  HOH B O   1 
HETATM 9459 O  O   . HOH S 6 .   ? 16.897  -61.907 -2.175  1.00 32.85  ? 867  HOH B O   1 
HETATM 9460 O  O   . HOH S 6 .   ? 10.250  -71.192 10.066  1.00 39.02  ? 868  HOH B O   1 
HETATM 9461 O  O   . HOH S 6 .   ? -30.638 -66.122 -17.422 1.00 52.53  ? 869  HOH B O   1 
HETATM 9462 O  O   . HOH S 6 .   ? -2.116  -52.415 -17.468 1.00 24.39  ? 870  HOH B O   1 
HETATM 9463 O  O   . HOH S 6 .   ? 0.215   -65.313 10.663  1.00 43.57  ? 871  HOH B O   1 
HETATM 9464 O  O   . HOH S 6 .   ? -11.434 -46.544 7.919   1.00 39.53  ? 872  HOH B O   1 
HETATM 9465 O  O   . HOH S 6 .   ? 0.604   -33.715 2.909   1.00 42.01  ? 873  HOH B O   1 
HETATM 9466 O  O   . HOH S 6 .   ? 15.857  -68.778 20.836  1.00 38.59  ? 874  HOH B O   1 
HETATM 9467 O  O   . HOH S 6 .   ? 0.834   -43.570 1.008   1.00 28.47  ? 875  HOH B O   1 
HETATM 9468 O  O   . HOH S 6 .   ? 1.871   -55.913 -14.835 1.00 22.79  ? 876  HOH B O   1 
HETATM 9469 O  O   . HOH S 6 .   ? -17.980 -66.225 6.516   1.00 21.56  ? 877  HOH B O   1 
HETATM 9470 O  O   . HOH S 6 .   ? 13.712  -53.329 -10.333 1.00 31.79  ? 878  HOH B O   1 
HETATM 9471 O  O   . HOH S 6 .   ? -19.834 -60.954 19.411  1.00 41.22  ? 879  HOH B O   1 
HETATM 9472 O  O   . HOH S 6 .   ? -2.006  -64.274 9.230   1.00 30.03  ? 880  HOH B O   1 
HETATM 9473 O  O   . HOH S 6 .   ? 1.486   -61.383 6.943   1.00 33.17  ? 881  HOH B O   1 
HETATM 9474 O  O   . HOH S 6 .   ? -28.082 -68.142 -20.013 1.00 45.95  ? 882  HOH B O   1 
HETATM 9475 O  O   . HOH S 6 .   ? -20.829 -44.542 -15.967 1.00 36.75  ? 883  HOH B O   1 
HETATM 9476 O  O   . HOH S 6 .   ? 2.831   -71.835 -7.406  1.00 28.81  ? 884  HOH B O   1 
HETATM 9477 O  O   . HOH S 6 .   ? -24.951 -56.379 -12.431 1.00 23.12  ? 885  HOH B O   1 
HETATM 9478 O  O   . HOH S 6 .   ? -2.680  -39.647 -5.703  1.00 29.82  ? 886  HOH B O   1 
HETATM 9479 O  O   . HOH S 6 .   ? -7.530  -55.240 3.153   1.00 39.87  ? 887  HOH B O   1 
HETATM 9480 O  O   . HOH S 6 .   ? -25.929 -67.684 -14.214 1.00 40.35  ? 888  HOH B O   1 
HETATM 9481 O  O   . HOH S 6 .   ? -16.066 -49.538 -27.307 1.00 33.92  ? 889  HOH B O   1 
HETATM 9482 O  O   . HOH S 6 .   ? 15.500  -42.029 -11.299 1.00 52.70  ? 890  HOH B O   1 
HETATM 9483 O  O   . HOH S 6 .   ? -4.082  -50.964 9.969   1.00 30.43  ? 891  HOH B O   1 
HETATM 9484 O  O   . HOH S 6 .   ? 2.826   -70.130 6.485   1.00 38.92  ? 892  HOH B O   1 
HETATM 9485 O  O   . HOH S 6 .   ? 11.387  -49.211 15.174  1.00 35.91  ? 893  HOH B O   1 
HETATM 9486 O  O   . HOH S 6 .   ? 5.893   -75.285 -1.339  1.00 35.48  ? 894  HOH B O   1 
HETATM 9487 O  O   . HOH S 6 .   ? -15.550 -70.196 -30.222 1.00 40.73  ? 895  HOH B O   1 
HETATM 9488 O  O   . HOH S 6 .   ? -29.337 -63.309 -11.264 1.00 37.45  ? 896  HOH B O   1 
HETATM 9489 O  O   . HOH S 6 .   ? 3.289   -55.710 -10.650 1.00 30.43  ? 897  HOH B O   1 
HETATM 9490 O  O   . HOH S 6 .   ? -21.047 -65.518 11.590  1.00 26.06  ? 898  HOH B O   1 
HETATM 9491 O  O   . HOH S 6 .   ? -0.760  -37.011 -6.853  1.00 30.00  ? 899  HOH B O   1 
HETATM 9492 O  O   . HOH S 6 .   ? 11.451  -70.601 -11.744 1.00 50.45  ? 900  HOH B O   1 
HETATM 9493 O  O   . HOH S 6 .   ? 6.645   -54.446 -21.846 1.00 34.23  ? 901  HOH B O   1 
HETATM 9494 O  O   . HOH S 6 .   ? -10.678 -57.277 -38.463 1.00 39.70  ? 902  HOH B O   1 
HETATM 9495 O  O   . HOH S 6 .   ? -27.550 -52.253 -23.296 1.00 37.49  ? 903  HOH B O   1 
HETATM 9496 O  O   . HOH S 6 .   ? 13.735  -55.934 8.596   1.00 24.62  ? 904  HOH B O   1 
HETATM 9497 O  O   . HOH S 6 .   ? 7.987   -75.314 -3.248  1.00 38.41  ? 905  HOH B O   1 
HETATM 9498 O  O   . HOH S 6 .   ? 3.334   -61.759 0.893   1.00 20.10  ? 906  HOH B O   1 
HETATM 9499 O  O   . HOH S 6 .   ? -31.598 -60.350 -1.261  1.00 47.87  ? 907  HOH B O   1 
HETATM 9500 O  O   . HOH S 6 .   ? -7.305  -56.614 -30.115 1.00 36.48  ? 908  HOH B O   1 
HETATM 9501 O  O   . HOH S 6 .   ? -10.467 -31.442 -9.104  1.00 46.29  ? 909  HOH B O   1 
HETATM 9502 O  O   . HOH S 6 .   ? -2.805  -51.876 -9.302  1.00 22.30  ? 910  HOH B O   1 
HETATM 9503 O  O   . HOH S 6 .   ? -13.248 -78.021 -15.676 1.00 38.45  ? 911  HOH B O   1 
HETATM 9504 O  O   . HOH S 6 .   ? 16.293  -64.894 22.325  1.00 30.91  ? 912  HOH B O   1 
HETATM 9505 O  O   . HOH S 6 .   ? -2.551  -62.297 -27.350 1.00 32.66  ? 913  HOH B O   1 
HETATM 9506 O  O   . HOH S 6 .   ? -17.963 -63.828 17.848  1.00 32.55  ? 914  HOH B O   1 
HETATM 9507 O  O   . HOH S 6 .   ? -1.335  -66.600 -8.006  1.00 25.78  ? 915  HOH B O   1 
HETATM 9508 O  O   . HOH S 6 .   ? 8.432   -47.694 25.348  1.00 32.03  ? 916  HOH B O   1 
HETATM 9509 O  O   . HOH S 6 .   ? -11.979 -79.908 -16.653 1.00 48.10  ? 917  HOH B O   1 
HETATM 9510 O  O   . HOH S 6 .   ? -9.706  -76.263 6.245   1.00 30.83  ? 918  HOH B O   1 
HETATM 9511 O  O   . HOH S 6 .   ? -15.135 -80.258 4.366   1.00 43.55  ? 919  HOH B O   1 
HETATM 9512 O  O   . HOH S 6 .   ? -5.187  -37.585 -27.438 1.00 43.34  ? 920  HOH B O   1 
HETATM 9513 O  O   . HOH S 6 .   ? -27.389 -53.902 -8.174  1.00 28.98  ? 921  HOH B O   1 
HETATM 9514 O  O   . HOH S 6 .   ? 11.965  -43.648 14.946  1.00 54.71  ? 922  HOH B O   1 
HETATM 9515 O  O   . HOH S 6 .   ? 9.365   -62.111 19.160  1.00 28.76  ? 923  HOH B O   1 
HETATM 9516 O  O   . HOH S 6 .   ? 6.549   -68.667 -11.174 1.00 34.87  ? 924  HOH B O   1 
HETATM 9517 O  O   . HOH S 6 .   ? -3.659  -52.497 -27.353 1.00 32.87  ? 925  HOH B O   1 
HETATM 9518 O  O   . HOH S 6 .   ? -18.824 -76.372 -11.390 1.00 44.50  ? 926  HOH B O   1 
HETATM 9519 O  O   . HOH S 6 .   ? -14.000 -62.904 11.944  1.00 21.76  ? 927  HOH B O   1 
HETATM 9520 O  O   . HOH S 6 .   ? 0.152   -35.071 22.939  1.00 53.52  ? 928  HOH B O   1 
HETATM 9521 O  O   . HOH S 6 .   ? 15.260  -57.978 -2.277  1.00 38.24  ? 929  HOH B O   1 
HETATM 9522 O  O   . HOH S 6 .   ? 6.878   -48.289 0.078   1.00 34.84  ? 930  HOH B O   1 
HETATM 9523 O  O   . HOH S 6 .   ? 10.986  -46.433 -10.940 1.00 43.17  ? 931  HOH B O   1 
HETATM 9524 O  O   . HOH S 6 .   ? -9.531  -38.781 -28.262 1.00 42.44  ? 932  HOH B O   1 
HETATM 9525 O  O   . HOH S 6 .   ? 14.007  -48.418 9.474   1.00 32.42  ? 933  HOH B O   1 
HETATM 9526 O  O   . HOH S 6 .   ? 15.748  -51.848 3.366   1.00 39.11  ? 934  HOH B O   1 
HETATM 9527 O  O   . HOH S 6 .   ? -8.092  -75.686 8.150   1.00 35.97  ? 935  HOH B O   1 
HETATM 9528 O  O   . HOH S 6 .   ? 8.843   -43.734 -22.041 1.00 39.02  ? 936  HOH B O   1 
HETATM 9529 O  O   . HOH S 6 .   ? 0.864   -59.523 22.021  1.00 33.20  ? 937  HOH B O   1 
HETATM 9530 O  O   . HOH S 6 .   ? -23.095 -70.382 -29.807 1.00 42.18  ? 938  HOH B O   1 
HETATM 9531 O  O   . HOH S 6 .   ? 19.247  -60.318 17.457  1.00 33.25  ? 939  HOH B O   1 
HETATM 9532 O  O   . HOH S 6 .   ? 2.245   -63.648 -17.213 1.00 32.58  ? 940  HOH B O   1 
HETATM 9533 O  O   . HOH S 6 .   ? 4.989   -61.493 16.749  1.00 34.08  ? 941  HOH B O   1 
HETATM 9534 O  O   . HOH S 6 .   ? -6.090  -73.639 10.447  1.00 41.58  ? 942  HOH B O   1 
HETATM 9535 O  O   . HOH S 6 .   ? 5.166   -25.618 -17.896 1.00 56.12  ? 943  HOH B O   1 
HETATM 9536 O  O   . HOH S 6 .   ? -8.764  -35.535 1.439   1.00 36.67  ? 944  HOH B O   1 
HETATM 9537 O  O   . HOH S 6 .   ? -1.932  -79.720 8.734   1.00 42.56  ? 945  HOH B O   1 
HETATM 9538 O  O   . HOH S 6 .   ? -25.120 -55.419 12.912  1.00 43.76  ? 946  HOH B O   1 
HETATM 9539 O  O   . HOH S 6 .   ? 0.440   -62.980 15.753  1.00 45.36  ? 947  HOH B O   1 
HETATM 9540 O  O   . HOH S 6 .   ? -19.482 -34.250 -0.759  1.00 51.86  ? 948  HOH B O   1 
HETATM 9541 O  O   . HOH S 6 .   ? 10.733  -35.056 -22.533 1.00 47.46  ? 949  HOH B O   1 
HETATM 9542 O  O   . HOH S 6 .   ? -11.959 -37.437 -10.552 1.00 47.93  ? 950  HOH B O   1 
HETATM 9543 O  O   . HOH S 6 .   ? -2.326  -44.430 -20.063 1.00 26.40  ? 951  HOH B O   1 
HETATM 9544 O  O   . HOH S 6 .   ? -12.967 -44.463 -33.081 1.00 40.13  ? 952  HOH B O   1 
HETATM 9545 O  O   . HOH S 6 .   ? -8.956  -27.096 -14.591 1.00 47.19  ? 953  HOH B O   1 
HETATM 9546 O  O   . HOH S 6 .   ? 0.486   -70.733 -2.051  1.00 27.78  ? 954  HOH B O   1 
HETATM 9547 O  O   . HOH S 6 .   ? 19.021  -60.843 -8.805  1.00 37.02  ? 955  HOH B O   1 
HETATM 9548 O  O   . HOH S 6 .   ? 8.575   -36.234 -0.722  1.00 43.37  ? 956  HOH B O   1 
HETATM 9549 O  O   . HOH S 6 .   ? -24.674 -71.954 -14.302 1.00 45.22  ? 957  HOH B O   1 
HETATM 9550 O  O   . HOH S 6 .   ? 9.715   -60.141 17.637  1.00 45.95  ? 958  HOH B O   1 
HETATM 9551 O  O   . HOH S 6 .   ? -8.412  -47.319 -28.620 1.00 31.53  ? 959  HOH B O   1 
HETATM 9552 O  O   . HOH S 6 .   ? -14.716 -31.677 -3.886  1.00 53.00  ? 960  HOH B O   1 
HETATM 9553 O  O   . HOH S 6 .   ? -3.055  -70.862 9.386   1.00 38.55  ? 961  HOH B O   1 
HETATM 9554 O  O   . HOH S 6 .   ? 13.118  -39.035 -15.264 1.00 34.14  ? 962  HOH B O   1 
HETATM 9555 O  O   . HOH S 6 .   ? 2.448   -68.832 -1.297  1.00 25.92  ? 963  HOH B O   1 
HETATM 9556 O  O   . HOH S 6 .   ? -26.847 -65.265 -26.510 1.00 43.30  ? 964  HOH B O   1 
HETATM 9557 O  O   . HOH S 6 .   ? -23.773 -46.151 -10.433 1.00 37.49  ? 965  HOH B O   1 
HETATM 9558 O  O   . HOH S 6 .   ? -8.364  -39.404 -20.865 1.00 36.62  ? 966  HOH B O   1 
HETATM 9559 O  O   . HOH S 6 .   ? -9.610  -47.240 -33.243 1.00 44.04  ? 967  HOH B O   1 
HETATM 9560 O  O   . HOH S 6 .   ? -13.045 -52.497 13.596  1.00 33.77  ? 968  HOH B O   1 
HETATM 9561 O  O   . HOH S 6 .   ? 8.773   -53.725 -0.524  1.00 31.01  ? 969  HOH B O   1 
HETATM 9562 O  O   . HOH S 6 .   ? -1.549  -79.064 -12.120 1.00 33.24  ? 970  HOH B O   1 
HETATM 9563 O  O   . HOH S 6 .   ? -17.971 -81.113 1.737   1.00 45.39  ? 971  HOH B O   1 
HETATM 9564 O  O   . HOH S 6 .   ? -1.190  -61.910 6.471   1.00 31.54  ? 972  HOH B O   1 
HETATM 9565 O  O   . HOH S 6 .   ? -26.036 -44.817 -7.191  1.00 52.17  ? 973  HOH B O   1 
HETATM 9566 O  O   . HOH S 6 .   ? -20.893 -41.110 9.454   1.00 42.74  ? 974  HOH B O   1 
HETATM 9567 O  O   . HOH S 6 .   ? -9.826  -41.137 -22.482 1.00 33.12  ? 975  HOH B O   1 
HETATM 9568 O  O   . HOH S 6 .   ? 9.213   -43.054 8.983   1.00 41.72  ? 976  HOH B O   1 
HETATM 9569 O  O   . HOH S 6 .   ? -8.332  -64.896 16.582  1.00 38.28  ? 977  HOH B O   1 
HETATM 9570 O  O   . HOH S 6 .   ? -12.965 -54.460 -40.981 1.00 38.26  ? 978  HOH B O   1 
HETATM 9571 O  O   . HOH S 6 .   ? -12.598 -69.738 16.319  1.00 37.27  ? 979  HOH B O   1 
HETATM 9572 O  O   . HOH S 6 .   ? -27.810 -56.001 7.537   1.00 39.16  ? 980  HOH B O   1 
HETATM 9573 O  O   . HOH S 6 .   ? -17.590 -39.862 -9.364  1.00 40.32  ? 981  HOH B O   1 
HETATM 9574 O  O   . HOH S 6 .   ? -20.000 -75.913 8.122   1.00 44.38  ? 982  HOH B O   1 
HETATM 9575 O  O   . HOH S 6 .   ? -2.961  -34.171 -27.519 1.00 43.49  ? 983  HOH B O   1 
HETATM 9576 O  O   . HOH S 6 .   ? 9.194   -49.319 -16.782 1.00 37.77  ? 984  HOH B O   1 
HETATM 9577 O  O   . HOH S 6 .   ? -10.989 -75.351 2.914   1.00 47.40  ? 985  HOH B O   1 
HETATM 9578 O  O   . HOH S 6 .   ? -11.797 -60.011 13.951  1.00 24.60  ? 986  HOH B O   1 
HETATM 9579 O  O   . HOH S 6 .   ? 1.243   -64.629 -14.893 1.00 31.24  ? 987  HOH B O   1 
HETATM 9580 O  O   . HOH S 6 .   ? -30.077 -57.020 4.412   1.00 30.90  ? 988  HOH B O   1 
HETATM 9581 O  O   . HOH S 6 .   ? 3.858   -43.555 -12.696 1.00 28.67  ? 989  HOH B O   1 
HETATM 9582 O  O   . HOH S 6 .   ? 12.950  -72.395 0.891   1.00 37.78  ? 990  HOH B O   1 
HETATM 9583 O  O   . HOH S 6 .   ? 6.609   -52.035 -0.949  1.00 30.54  ? 991  HOH B O   1 
HETATM 9584 O  O   . HOH S 6 .   ? -21.582 -77.832 6.979   1.00 43.69  ? 992  HOH B O   1 
HETATM 9585 O  O   . HOH S 6 .   ? -0.185  -45.754 -18.943 1.00 30.15  ? 993  HOH B O   1 
HETATM 9586 O  O   . HOH S 6 .   ? -23.498 -72.672 -9.215  1.00 46.10  ? 994  HOH B O   1 
HETATM 9587 O  O   . HOH S 6 .   ? 17.669  -67.352 16.105  1.00 40.12  ? 995  HOH B O   1 
HETATM 9588 O  O   . HOH S 6 .   ? -7.606  -65.898 13.486  1.00 31.80  ? 996  HOH B O   1 
HETATM 9589 O  O   . HOH S 6 .   ? -0.522  -54.860 -2.452  1.00 30.26  ? 997  HOH B O   1 
HETATM 9590 O  O   . HOH S 6 .   ? 5.843   -56.085 -11.245 1.00 30.01  ? 998  HOH B O   1 
HETATM 9591 O  O   . HOH S 6 .   ? 5.829   -61.733 -23.662 1.00 48.83  ? 999  HOH B O   1 
HETATM 9592 O  O   . HOH S 6 .   ? -4.869  -56.286 -29.342 1.00 39.76  ? 1000 HOH B O   1 
HETATM 9593 O  O   . HOH S 6 .   ? -0.316  -72.120 6.288   1.00 46.87  ? 1001 HOH B O   1 
HETATM 9594 O  O   . HOH S 6 .   ? 12.731  -68.843 -13.300 1.00 38.46  ? 1002 HOH B O   1 
HETATM 9595 O  O   . HOH S 6 .   ? 7.666   -67.718 14.666  1.00 34.82  ? 1003 HOH B O   1 
HETATM 9596 O  O   . HOH S 6 .   ? 3.085   -64.207 -20.350 1.00 40.22  ? 1004 HOH B O   1 
HETATM 9597 O  O   . HOH S 6 .   ? -17.392 -75.172 -4.138  1.00 31.08  ? 1005 HOH B O   1 
HETATM 9598 O  O   . HOH S 6 .   ? -19.802 -65.973 -28.251 1.00 31.77  ? 1006 HOH B O   1 
HETATM 9599 O  O   . HOH S 6 .   ? 7.788   -26.555 -16.888 1.00 53.23  ? 1007 HOH B O   1 
HETATM 9600 O  O   . HOH S 6 .   ? -7.521  -69.688 10.833  1.00 33.28  ? 1008 HOH B O   1 
HETATM 9601 O  O   . HOH S 6 .   ? -23.926 -67.723 10.181  1.00 30.43  ? 1009 HOH B O   1 
HETATM 9602 O  O   . HOH S 6 .   ? -11.630 -42.440 6.478   1.00 32.47  ? 1010 HOH B O   1 
HETATM 9603 O  O   . HOH S 6 .   ? -5.756  -40.040 -7.406  1.00 26.22  ? 1011 HOH B O   1 
HETATM 9604 O  O   . HOH S 6 .   ? 4.374   -64.940 10.409  1.00 42.50  ? 1012 HOH B O   1 
HETATM 9605 O  O   . HOH S 6 .   ? -28.463 -63.125 -8.440  1.00 33.56  ? 1013 HOH B O   1 
HETATM 9606 O  O   . HOH S 6 .   ? -14.965 -78.015 -11.348 1.00 33.51  ? 1014 HOH B O   1 
HETATM 9607 O  O   . HOH S 6 .   ? -3.826  -73.746 -24.639 1.00 48.58  ? 1015 HOH B O   1 
HETATM 9608 O  O   . HOH S 6 .   ? -20.637 -48.837 -25.663 1.00 37.51  ? 1016 HOH B O   1 
HETATM 9609 O  O   . HOH S 6 .   ? -11.651 -72.395 15.910  1.00 43.17  ? 1017 HOH B O   1 
HETATM 9610 O  O   . HOH S 6 .   ? -19.876 -75.036 -29.372 1.00 50.69  ? 1018 HOH B O   1 
HETATM 9611 O  O   . HOH S 6 .   ? 3.135   -44.871 -24.440 1.00 31.96  ? 1019 HOH B O   1 
HETATM 9612 O  O   . HOH S 6 .   ? 13.299  -70.985 8.878   1.00 38.32  ? 1020 HOH B O   1 
HETATM 9613 O  O   . HOH S 6 .   ? 3.116   -45.708 -14.058 1.00 25.42  ? 1021 HOH B O   1 
HETATM 9614 O  O   . HOH S 6 .   ? -9.745  -67.038 14.531  1.00 32.77  ? 1022 HOH B O   1 
HETATM 9615 O  O   . HOH S 6 .   ? -27.674 -58.316 -4.768  1.00 34.32  ? 1023 HOH B O   1 
HETATM 9616 O  O   . HOH S 6 .   ? -24.175 -59.245 -32.322 1.00 39.19  ? 1024 HOH B O   1 
HETATM 9617 O  O   . HOH S 6 .   ? 2.926   -56.505 -27.444 1.00 41.47  ? 1025 HOH B O   1 
HETATM 9618 O  O   . HOH S 6 .   ? -0.285  -56.559 -28.021 1.00 48.23  ? 1026 HOH B O   1 
HETATM 9619 O  O   . HOH S 6 .   ? -25.227 -79.253 4.761   1.00 48.34  ? 1027 HOH B O   1 
HETATM 9620 O  O   . HOH S 6 .   ? -0.146  -75.399 3.167   1.00 35.32  ? 1028 HOH B O   1 
HETATM 9621 O  O   . HOH S 6 .   ? -26.824 -44.488 -11.798 1.00 50.95  ? 1029 HOH B O   1 
HETATM 9622 O  O   . HOH S 6 .   ? -7.164  -67.288 -23.532 1.00 42.07  ? 1030 HOH B O   1 
HETATM 9623 O  O   . HOH S 6 .   ? -18.291 -41.179 -13.987 1.00 41.32  ? 1031 HOH B O   1 
HETATM 9624 O  O   . HOH S 6 .   ? 1.118   -57.141 -11.601 1.00 23.87  ? 1032 HOH B O   1 
HETATM 9625 O  O   . HOH S 6 .   ? -15.976 -43.181 -15.967 1.00 29.82  ? 1033 HOH B O   1 
HETATM 9626 O  O   . HOH S 6 .   ? -6.309  -54.111 -28.742 1.00 37.80  ? 1034 HOH B O   1 
HETATM 9627 O  O   . HOH S 6 .   ? 12.944  -70.293 3.937   1.00 28.62  ? 1035 HOH B O   1 
HETATM 9628 O  O   . HOH S 6 .   ? 7.890   -44.452 11.857  1.00 39.38  ? 1036 HOH B O   1 
HETATM 9629 O  O   . HOH S 6 .   ? -4.636  -61.765 16.424  1.00 25.34  ? 1037 HOH B O   1 
HETATM 9630 O  O   . HOH S 6 .   ? 6.118   -72.656 4.284   1.00 39.80  ? 1038 HOH B O   1 
HETATM 9631 O  O   . HOH S 6 .   ? 17.636  -57.438 1.913   1.00 43.18  ? 1039 HOH B O   1 
HETATM 9632 O  O   . HOH S 6 .   ? 11.933  -43.516 -8.318  1.00 38.10  ? 1040 HOH B O   1 
HETATM 9633 O  O   . HOH S 6 .   ? 20.609  -57.035 16.770  1.00 30.53  ? 1041 HOH B O   1 
HETATM 9634 O  O   . HOH S 6 .   ? -2.931  -57.550 23.299  1.00 35.33  ? 1042 HOH B O   1 
HETATM 9635 O  O   . HOH S 6 .   ? -0.423  -38.997 -5.000  1.00 35.03  ? 1043 HOH B O   1 
HETATM 9636 O  O   . HOH S 6 .   ? 7.183   -52.205 -23.583 1.00 33.44  ? 1044 HOH B O   1 
HETATM 9637 O  O   . HOH S 6 .   ? -3.276  -54.496 -19.186 1.00 23.36  ? 1045 HOH B O   1 
HETATM 9638 O  O   . HOH S 6 .   ? -8.588  -78.352 -26.456 1.00 46.65  ? 1046 HOH B O   1 
HETATM 9639 O  O   . HOH S 6 .   ? -27.831 -53.725 -14.749 1.00 26.62  ? 1047 HOH B O   1 
HETATM 9640 O  O   . HOH S 6 .   ? -11.047 -41.210 4.288   1.00 32.35  ? 1048 HOH B O   1 
HETATM 9641 O  O   . HOH S 6 .   ? -24.986 -69.293 6.824   1.00 34.79  ? 1049 HOH B O   1 
HETATM 9642 O  O   . HOH S 6 .   ? 19.080  -62.833 16.060  1.00 51.29  ? 1050 HOH B O   1 
HETATM 9643 O  O   . HOH S 6 .   ? -27.021 -46.376 -3.670  1.00 39.31  ? 1051 HOH B O   1 
HETATM 9644 O  O   . HOH S 6 .   ? -8.106  -80.869 -15.181 1.00 40.71  ? 1052 HOH B O   1 
HETATM 9645 O  O   . HOH S 6 .   ? -2.214  -46.722 11.886  1.00 44.42  ? 1053 HOH B O   1 
HETATM 9646 O  O   . HOH S 6 .   ? -6.606  -63.198 17.780  1.00 22.58  ? 1054 HOH B O   1 
HETATM 9647 O  O   . HOH S 6 .   ? -24.988 -45.620 -15.310 1.00 42.04  ? 1055 HOH B O   1 
HETATM 9648 O  O   . HOH S 6 .   ? -3.433  -49.249 11.894  1.00 36.13  ? 1056 HOH B O   1 
HETATM 9649 O  O   . HOH S 6 .   ? 13.352  -33.408 -16.649 1.00 56.22  ? 1057 HOH B O   1 
HETATM 9650 O  O   . HOH S 6 .   ? 16.697  -63.541 24.844  1.00 36.72  ? 1058 HOH B O   1 
HETATM 9651 O  O   . HOH S 6 .   ? 8.497   -51.494 23.087  1.00 34.45  ? 1059 HOH B O   1 
HETATM 9652 O  O   . HOH S 6 .   ? -29.103 -52.343 9.237   1.00 54.66  ? 1060 HOH B O   1 
HETATM 9653 O  O   . HOH S 6 .   ? -29.656 -57.834 -26.736 1.00 44.07  ? 1061 HOH B O   1 
HETATM 9654 O  O   . HOH S 6 .   ? 10.995  -27.308 -9.784  1.00 51.76  ? 1062 HOH B O   1 
HETATM 9655 O  O   . HOH S 6 .   ? -3.837  -23.391 -13.464 1.00 55.91  ? 1063 HOH B O   1 
HETATM 9656 O  O   . HOH S 6 .   ? 1.547   -52.795 22.842  1.00 35.11  ? 1064 HOH B O   1 
HETATM 9657 O  O   . HOH S 6 .   ? -27.815 -70.409 -21.775 1.00 58.11  ? 1065 HOH B O   1 
HETATM 9658 O  O   . HOH S 6 .   ? 19.128  -66.374 8.023   1.00 32.87  ? 1066 HOH B O   1 
HETATM 9659 O  O   . HOH S 6 .   ? 10.927  -41.443 -1.287  1.00 45.40  ? 1067 HOH B O   1 
HETATM 9660 O  O   . HOH S 6 .   ? -29.720 -61.142 -4.315  1.00 49.75  ? 1068 HOH B O   1 
HETATM 9661 O  O   . HOH S 6 .   ? -22.126 -51.311 -36.022 1.00 42.98  ? 1069 HOH B O   1 
HETATM 9662 O  O   . HOH S 6 .   ? 11.491  -70.655 16.978  1.00 44.23  ? 1070 HOH B O   1 
HETATM 9663 O  O   . HOH S 6 .   ? -24.002 -70.142 11.135  1.00 45.64  ? 1071 HOH B O   1 
HETATM 9664 O  O   . HOH S 6 .   ? -19.794 -40.629 -7.077  1.00 42.81  ? 1072 HOH B O   1 
HETATM 9665 O  O   . HOH S 6 .   ? -25.001 -47.481 -30.842 1.00 40.96  ? 1073 HOH B O   1 
HETATM 9666 O  O   . HOH S 6 .   ? -1.646  -81.234 7.074   1.00 39.04  ? 1074 HOH B O   1 
HETATM 9667 O  O   . HOH S 6 .   ? -16.933 -70.202 -33.086 1.00 56.28  ? 1075 HOH B O   1 
HETATM 9668 O  O   . HOH S 6 .   ? 8.223   -39.321 17.543  1.00 48.13  ? 1076 HOH B O   1 
HETATM 9669 O  O   . HOH S 6 .   ? 1.285   -40.495 3.512   1.00 41.85  ? 1077 HOH B O   1 
HETATM 9670 O  O   . HOH S 6 .   ? 8.884   -75.046 -8.384  1.00 55.54  ? 1078 HOH B O   1 
HETATM 9671 O  O   . HOH S 6 .   ? -21.999 -73.097 -22.724 1.00 46.89  ? 1079 HOH B O   1 
HETATM 9672 O  O   . HOH S 6 .   ? 5.279   -70.370 -7.760  1.00 33.68  ? 1080 HOH B O   1 
HETATM 9673 O  O   . HOH S 6 .   ? -1.070  -85.655 -6.880  1.00 43.57  ? 1081 HOH B O   1 
HETATM 9674 O  O   . HOH S 6 .   ? 5.830   -43.308 2.811   1.00 37.04  ? 1082 HOH B O   1 
HETATM 9675 O  O   . HOH S 6 .   ? -26.693 -56.092 -34.746 1.00 41.06  ? 1083 HOH B O   1 
HETATM 9676 O  O   . HOH S 6 .   ? 1.360   -47.170 -28.827 1.00 53.73  ? 1084 HOH B O   1 
HETATM 9677 O  O   . HOH S 6 .   ? -9.578  -48.625 8.789   1.00 34.63  ? 1085 HOH B O   1 
HETATM 9678 O  O   . HOH S 6 .   ? 12.295  -49.891 1.524   1.00 45.67  ? 1086 HOH B O   1 
HETATM 9679 O  O   . HOH S 6 .   ? -4.744  -74.806 8.797   1.00 42.26  ? 1087 HOH B O   1 
HETATM 9680 O  O   . HOH S 6 .   ? -18.451 -46.931 -21.379 1.00 36.74  ? 1088 HOH B O   1 
HETATM 9681 O  O   . HOH S 6 .   ? 10.247  -46.023 0.342   1.00 44.83  ? 1089 HOH B O   1 
HETATM 9682 O  O   . HOH S 6 .   ? -25.395 -60.556 14.036  1.00 33.55  ? 1090 HOH B O   1 
HETATM 9683 O  O   . HOH S 6 .   ? -31.300 -58.657 -18.046 1.00 51.46  ? 1091 HOH B O   1 
HETATM 9684 O  O   . HOH S 6 .   ? 13.753  -42.332 -19.166 1.00 49.57  ? 1092 HOH B O   1 
HETATM 9685 O  O   . HOH S 6 .   ? 6.089   -40.309 20.638  1.00 48.10  ? 1093 HOH B O   1 
HETATM 9686 O  O   . HOH S 6 .   ? 9.172   -42.064 14.508  1.00 43.75  ? 1094 HOH B O   1 
HETATM 9687 O  O   . HOH S 6 .   ? -5.522  -75.777 -21.455 1.00 45.71  ? 1095 HOH B O   1 
HETATM 9688 O  O   . HOH S 6 .   ? -16.040 -36.462 5.786   1.00 47.28  ? 1096 HOH B O   1 
HETATM 9689 O  O   . HOH S 6 .   ? 14.573  -50.506 -8.328  1.00 50.86  ? 1097 HOH B O   1 
HETATM 9690 O  O   . HOH S 6 .   ? 5.115   -68.075 -9.117  1.00 31.36  ? 1098 HOH B O   1 
HETATM 9691 O  O   . HOH S 6 .   ? 20.148  -59.461 24.380  1.00 44.35  ? 1099 HOH B O   1 
HETATM 9692 O  O   . HOH S 6 .   ? 2.238   -78.200 -0.196  1.00 47.24  ? 1100 HOH B O   1 
HETATM 9693 O  O   . HOH S 6 .   ? -15.693 -80.583 7.577   1.00 46.30  ? 1101 HOH B O   1 
HETATM 9694 O  O   . HOH S 6 .   ? 11.686  -72.572 -3.165  1.00 58.22  ? 1102 HOH B O   1 
HETATM 9695 O  O   . HOH S 6 .   ? -1.338  -49.220 -30.019 1.00 53.30  ? 1103 HOH B O   1 
HETATM 9696 O  O   . HOH S 6 .   ? 2.407   -71.595 -11.317 1.00 45.71  ? 1104 HOH B O   1 
HETATM 9697 O  O   . HOH S 6 .   ? -18.573 -71.841 15.319  1.00 48.49  ? 1105 HOH B O   1 
HETATM 9698 O  O   . HOH S 6 .   ? -28.480 -65.716 -11.800 1.00 56.12  ? 1106 HOH B O   1 
HETATM 9699 O  O   . HOH S 6 .   ? -2.654  -38.969 3.152   1.00 35.38  ? 1107 HOH B O   1 
HETATM 9700 O  O   . HOH S 6 .   ? -6.492  -48.307 11.453  1.00 44.94  ? 1108 HOH B O   1 
HETATM 9701 O  O   . HOH S 6 .   ? -20.361 -51.039 -37.849 1.00 39.07  ? 1109 HOH B O   1 
HETATM 9702 O  O   . HOH S 6 .   ? -20.198 -47.654 -35.538 1.00 41.84  ? 1110 HOH B O   1 
HETATM 9703 O  O   . HOH S 6 .   ? 10.838  -50.561 21.629  1.00 42.10  ? 1111 HOH B O   1 
HETATM 9704 O  O   . HOH S 6 .   ? -25.292 -59.639 10.880  1.00 31.67  ? 1112 HOH B O   1 
HETATM 9705 O  O   . HOH S 6 .   ? 17.385  -53.612 3.286   1.00 38.91  ? 1113 HOH B O   1 
HETATM 9706 O  O   . HOH S 6 .   ? 11.654  -47.490 -13.451 1.00 38.07  ? 1114 HOH B O   1 
HETATM 9707 O  O   . HOH S 6 .   ? -26.104 -57.743 10.712  1.00 42.58  ? 1115 HOH B O   1 
HETATM 9708 O  O   . HOH S 6 .   ? -30.657 -56.019 -20.951 1.00 44.99  ? 1116 HOH B O   1 
HETATM 9709 O  O   . HOH S 6 .   ? 9.336   -74.970 -1.275  1.00 49.67  ? 1117 HOH B O   1 
HETATM 9710 O  O   . HOH S 6 .   ? -9.506  -49.085 11.225  1.00 39.76  ? 1118 HOH B O   1 
HETATM 9711 O  O   . HOH S 6 .   ? -11.253 -83.767 -11.181 1.00 50.58  ? 1119 HOH B O   1 
HETATM 9712 O  O   . HOH S 6 .   ? 6.074   -52.940 -3.656  1.00 32.05  ? 1120 HOH B O   1 
HETATM 9713 O  O   . HOH S 6 .   ? 12.479  -47.260 1.475   1.00 62.80  ? 1121 HOH B O   1 
HETATM 9714 O  O   . HOH S 6 .   ? -8.421  -53.746 -35.201 1.00 42.08  ? 1122 HOH B O   1 
HETATM 9715 O  O   . HOH S 6 .   ? -30.268 -63.248 -4.728  1.00 60.19  ? 1123 HOH B O   1 
HETATM 9716 O  O   . HOH S 6 .   ? -18.200 -77.409 -17.971 1.00 56.22  ? 1124 HOH B O   1 
HETATM 9717 O  O   . HOH S 6 .   ? -29.120 -67.779 -0.880  1.00 51.33  ? 1125 HOH B O   1 
HETATM 9718 O  O   . HOH S 6 .   ? 7.564   -55.805 -7.526  1.00 44.07  ? 1126 HOH B O   1 
HETATM 9719 O  O   . HOH S 6 .   ? -26.963 -54.931 -10.890 1.00 30.36  ? 1127 HOH B O   1 
HETATM 9720 O  O   . HOH S 6 .   ? -33.360 -63.715 -25.024 1.00 52.59  ? 1128 HOH B O   1 
HETATM 9721 O  O   . HOH S 6 .   ? -7.088  -54.478 -33.722 1.00 47.00  ? 1129 HOH B O   1 
HETATM 9722 O  O   . HOH S 6 .   ? -15.019 -70.752 17.515  1.00 50.09  ? 1130 HOH B O   1 
HETATM 9723 O  O   . HOH S 6 .   ? 0.474   -27.922 -25.852 1.00 56.54  ? 1131 HOH B O   1 
HETATM 9724 O  O   . HOH S 6 .   ? 16.035  -54.141 0.354   1.00 38.20  ? 1132 HOH B O   1 
HETATM 9725 O  O   . HOH S 6 .   ? 1.552   -29.727 -26.769 1.00 55.42  ? 1133 HOH B O   1 
HETATM 9726 O  O   . HOH S 6 .   ? -4.290  -66.559 12.473  1.00 43.71  ? 1134 HOH B O   1 
HETATM 9727 O  O   . HOH S 6 .   ? -15.265 -78.743 -6.819  1.00 39.66  ? 1135 HOH B O   1 
HETATM 9728 O  O   . HOH S 6 .   ? 16.216  -69.165 15.185  1.00 48.87  ? 1136 HOH B O   1 
HETATM 9729 O  O   . HOH S 6 .   ? -14.404 -78.785 2.181   1.00 45.15  ? 1137 HOH B O   1 
HETATM 9730 O  O   . HOH S 6 .   ? 0.581   -66.657 12.321  1.00 56.22  ? 1138 HOH B O   1 
HETATM 9731 O  O   . HOH S 6 .   ? 19.235  -57.118 21.365  1.00 47.46  ? 1139 HOH B O   1 
HETATM 9732 O  O   . HOH S 6 .   ? -23.701 -75.927 -10.793 1.00 58.42  ? 1140 HOH B O   1 
HETATM 9733 O  O   . HOH S 6 .   ? -2.443  -67.001 -38.658 1.00 59.12  ? 1141 HOH B O   1 
HETATM 9734 O  O   . HOH S 6 .   ? -7.702  -70.124 13.395  1.00 43.36  ? 1142 HOH B O   1 
HETATM 9735 O  O   . HOH S 6 .   ? 6.505   -54.027 -10.417 1.00 51.64  ? 1143 HOH B O   1 
HETATM 9736 O  O   . HOH S 6 .   ? -11.116 -59.761 -37.624 1.00 42.87  ? 1144 HOH B O   1 
HETATM 9737 O  O   . HOH S 6 .   ? 7.497   -54.503 -4.618  1.00 52.01  ? 1145 HOH B O   1 
HETATM 9738 O  O   . HOH S 6 .   ? -8.214  -50.109 22.433  1.00 36.98  ? 1146 HOH B O   1 
HETATM 9739 O  O   . HOH S 6 .   ? 17.848  -53.591 18.501  1.00 44.21  ? 1147 HOH B O   1 
HETATM 9740 O  O   . HOH S 6 .   ? 7.710   -58.369 -22.421 1.00 49.54  ? 1148 HOH B O   1 
HETATM 9741 O  O   . HOH S 6 .   ? -15.221 -40.609 -16.443 1.00 38.90  ? 1149 HOH B O   1 
HETATM 9742 O  O   . HOH S 6 .   ? -29.419 -51.728 -25.054 1.00 39.01  ? 1150 HOH B O   1 
HETATM 9743 O  O   . HOH S 6 .   ? -26.657 -44.496 -5.293  1.00 60.19  ? 1151 HOH B O   1 
HETATM 9744 O  O   . HOH S 6 .   ? -18.274 -44.389 -17.177 1.00 36.22  ? 1152 HOH B O   1 
HETATM 9745 O  O   . HOH S 6 .   ? -21.651 -48.632 -34.221 1.00 52.70  ? 1153 HOH B O   1 
HETATM 9746 O  O   . HOH S 6 .   ? 16.555  -53.449 -10.171 1.00 31.32  ? 1154 HOH B O   1 
HETATM 9747 O  O   . HOH S 6 .   ? -7.234  -39.738 3.689   1.00 40.85  ? 1155 HOH B O   1 
HETATM 9748 O  O   . HOH S 6 .   ? -29.570 -70.381 2.128   1.00 51.94  ? 1156 HOH B O   1 
HETATM 9749 O  O   . HOH S 6 .   ? -10.478 -82.302 -8.834  1.00 37.26  ? 1157 HOH B O   1 
HETATM 9750 O  O   . HOH S 6 .   ? -16.369 -79.248 0.289   1.00 46.39  ? 1158 HOH B O   1 
HETATM 9751 O  O   . HOH S 6 .   ? 6.569   -79.275 -7.651  1.00 52.23  ? 1159 HOH B O   1 
HETATM 9752 O  O   . HOH S 6 .   ? 12.293  -71.361 6.409   1.00 37.81  ? 1160 HOH B O   1 
HETATM 9753 O  O   . HOH S 6 .   ? -19.779 -43.200 -28.232 1.00 55.97  ? 1161 HOH B O   1 
HETATM 9754 O  O   . HOH S 6 .   ? -12.257 -33.118 0.163   1.00 55.22  ? 1162 HOH B O   1 
HETATM 9755 O  O   . HOH S 6 .   ? -2.390  -63.058 17.126  1.00 35.52  ? 1163 HOH B O   1 
HETATM 9756 O  O   . HOH S 6 .   ? -8.162  -44.536 4.819   1.00 39.97  ? 1164 HOH B O   1 
HETATM 9757 O  O   . HOH S 6 .   ? -17.297 -78.261 -12.716 1.00 45.23  ? 1165 HOH B O   1 
HETATM 9758 O  O   . HOH S 6 .   ? -13.703 -29.611 -2.415  1.00 53.06  ? 1166 HOH B O   1 
HETATM 9759 O  O   . HOH S 6 .   ? 15.583  -68.156 -12.647 1.00 43.15  ? 1167 HOH B O   1 
HETATM 9760 O  O   . HOH S 6 .   ? 20.139  -55.478 18.937  1.00 41.60  ? 1168 HOH B O   1 
HETATM 9761 O  O   . HOH S 6 .   ? -26.392 -72.445 2.773   1.00 33.29  ? 1169 HOH B O   1 
HETATM 9762 O  O   . HOH S 6 .   ? -23.684 -68.099 -30.681 1.00 44.66  ? 1170 HOH B O   1 
HETATM 9763 O  O   . HOH S 6 .   ? -1.952  -54.385 -29.445 1.00 53.75  ? 1171 HOH B O   1 
HETATM 9764 O  O   . HOH S 6 .   ? -19.441 -73.836 13.494  1.00 50.22  ? 1172 HOH B O   1 
HETATM 9765 O  O   . HOH S 6 .   ? -28.839 -69.624 -3.194  1.00 39.50  ? 1173 HOH B O   1 
HETATM 9766 O  O   . HOH S 6 .   ? 22.941  -57.308 14.734  1.00 43.66  ? 1174 HOH B O   1 
HETATM 9767 O  O   . HOH S 6 .   ? -0.592  -26.096 -25.439 1.00 55.08  ? 1175 HOH B O   1 
HETATM 9768 O  O   . HOH S 6 .   ? -2.492  -67.759 -36.524 1.00 51.05  ? 1176 HOH B O   1 
HETATM 9769 O  O   . HOH S 6 .   ? -5.028  -70.861 11.119  1.00 47.78  ? 1177 HOH B O   1 
HETATM 9770 O  O   . HOH S 6 .   ? -13.157 -35.024 1.932   1.00 57.72  ? 1178 HOH B O   1 
HETATM 9771 O  O   . HOH S 6 .   ? -9.068  -85.382 -6.037  1.00 46.23  ? 1179 HOH B O   1 
HETATM 9772 O  O   . HOH S 6 .   ? -28.944 -50.290 10.113  1.00 50.25  ? 1180 HOH B O   1 
HETATM 9773 O  O   . HOH S 6 .   ? -9.276  -69.116 15.541  1.00 46.22  ? 1181 HOH B O   1 
HETATM 9774 O  O   . HOH S 6 .   ? -5.111  -66.190 -24.607 1.00 51.99  ? 1182 HOH B O   1 
HETATM 9775 O  O   . HOH S 6 .   ? 6.992   -63.832 18.703  1.00 32.15  ? 1183 HOH B O   1 
HETATM 9776 O  O   . HOH S 6 .   ? 7.099   -57.492 -24.523 1.00 46.24  ? 1184 HOH B O   1 
HETATM 9777 O  O   . HOH S 6 .   ? -4.501  -63.114 24.865  1.00 51.42  ? 1185 HOH B O   1 
HETATM 9778 O  O   . HOH S 6 .   ? -26.031 -58.857 16.029  1.00 47.08  ? 1186 HOH B O   1 
HETATM 9779 O  O   . HOH S 6 .   ? -2.603  -76.754 4.462   1.00 41.37  ? 1187 HOH B O   1 
HETATM 9780 O  O   . HOH S 6 .   ? -10.354 -44.732 6.489   1.00 40.13  ? 1188 HOH B O   1 
HETATM 9781 O  O   . HOH S 6 .   ? 22.234  -59.653 10.705  1.00 45.31  ? 1189 HOH B O   1 
HETATM 9782 O  O   . HOH S 6 .   ? 3.352   -71.990 4.542   1.00 37.54  ? 1190 HOH B O   1 
HETATM 9783 O  O   . HOH S 6 .   ? -18.235 -77.404 -2.351  1.00 46.00  ? 1191 HOH B O   1 
HETATM 9784 O  O   . HOH S 6 .   ? -11.267 -40.397 8.776   1.00 42.48  ? 1192 HOH B O   1 
HETATM 9785 O  O   . HOH S 6 .   ? 22.639  -61.686 19.796  1.00 63.59  ? 1193 HOH B O   1 
HETATM 9786 O  O   . HOH S 6 .   ? 8.355   -54.656 -20.050 1.00 38.90  ? 1194 HOH B O   1 
HETATM 9787 O  O   . HOH S 6 .   ? 10.692  -50.899 -18.425 1.00 38.88  ? 1195 HOH B O   1 
HETATM 9788 O  O   . HOH S 6 .   ? -26.213 -61.836 8.159   1.00 36.35  ? 1196 HOH B O   1 
HETATM 9789 O  O   . HOH S 6 .   ? -15.704 -78.648 -16.473 1.00 49.02  ? 1197 HOH B O   1 
HETATM 9790 O  O   . HOH S 6 .   ? -27.118 -72.226 -6.139  1.00 47.49  ? 1198 HOH B O   1 
HETATM 9791 O  O   . HOH S 6 .   ? 1.415   -38.491 5.167   1.00 45.18  ? 1199 HOH B O   1 
HETATM 9792 O  O   . HOH S 6 .   ? 22.861  -59.635 20.286  1.00 51.00  ? 1200 HOH B O   1 
HETATM 9793 O  O   . HOH S 6 .   ? 17.870  -51.255 17.016  1.00 46.01  ? 1201 HOH B O   1 
HETATM 9794 O  O   . HOH S 6 .   ? -10.905 -38.173 7.253   1.00 44.66  ? 1202 HOH B O   1 
HETATM 9795 O  O   . HOH S 6 .   ? -25.944 -67.224 -30.129 1.00 55.27  ? 1203 HOH B O   1 
HETATM 9796 O  O   . HOH S 6 .   ? -24.909 -45.597 -13.090 1.00 45.31  ? 1204 HOH B O   1 
HETATM 9797 O  O   . HOH S 6 .   ? 10.958  -25.154 -8.554  1.00 58.51  ? 1205 HOH B O   1 
HETATM 9798 O  O   . HOH S 6 .   ? -15.251 -55.436 -42.689 1.00 43.49  ? 1206 HOH B O   1 
HETATM 9799 O  O   . HOH S 6 .   ? 13.017  -46.038 8.301   1.00 40.31  ? 1207 HOH B O   1 
HETATM 9800 O  O   . HOH S 6 .   ? -3.741  -44.339 12.649  1.00 38.69  ? 1208 HOH B O   1 
HETATM 9801 O  O   . HOH S 6 .   ? -15.177 -70.958 -34.603 1.00 51.65  ? 1209 HOH B O   1 
HETATM 9802 O  O   . HOH S 6 .   ? -9.301  -33.478 2.676   1.00 55.24  ? 1210 HOH B O   1 
HETATM 9803 O  O   . HOH S 6 .   ? 14.214  -71.834 -1.787  1.00 52.02  ? 1211 HOH B O   1 
HETATM 9804 O  O   . HOH S 6 .   ? -12.522 -82.022 -7.199  1.00 41.15  ? 1212 HOH B O   1 
HETATM 9805 O  O   . HOH S 6 .   ? -26.741 -48.643 -4.008  1.00 37.32  ? 1213 HOH B O   1 
HETATM 9806 O  O   . HOH S 6 .   ? 5.216   -41.142 -25.491 1.00 46.35  ? 1214 HOH B O   1 
HETATM 9807 O  O   . HOH S 6 .   ? -17.316 -77.570 -5.345  1.00 46.79  ? 1215 HOH B O   1 
HETATM 9808 O  O   . HOH S 6 .   ? -1.029  -40.989 3.934   1.00 43.64  ? 1216 HOH B O   1 
HETATM 9809 O  O   . HOH S 6 .   ? -16.875 -39.157 -14.591 1.00 47.91  ? 1217 HOH B O   1 
HETATM 9810 O  O   . HOH S 6 .   ? -6.028  -41.048 -29.870 1.00 45.56  ? 1218 HOH B O   1 
HETATM 9811 O  O   . HOH S 6 .   ? -18.368 -40.935 -28.749 1.00 59.49  ? 1219 HOH B O   1 
HETATM 9812 O  O   . HOH S 6 .   ? -8.818  -37.278 3.427   1.00 36.62  ? 1220 HOH B O   1 
HETATM 9813 O  O   . HOH S 6 .   ? -17.968 -36.590 -15.060 1.00 56.69  ? 1221 HOH B O   1 
HETATM 9814 O  O   . HOH S 6 .   ? -30.910 -52.631 2.582   1.00 48.35  ? 1222 HOH B O   1 
HETATM 9815 O  O   . HOH S 6 .   ? -25.784 -72.138 -8.937  1.00 51.70  ? 1223 HOH B O   1 
HETATM 9816 O  O   . HOH S 6 .   ? -28.456 -71.847 3.767   1.00 50.40  ? 1224 HOH B O   1 
HETATM 9817 O  O   . HOH S 6 .   ? -10.720 -38.437 4.675   1.00 33.22  ? 1225 HOH B O   1 
HETATM 9818 O  O   . HOH S 6 .   ? -5.291  -64.560 19.983  1.00 31.52  ? 1226 HOH B O   1 
HETATM 9819 O  O   . HOH S 6 .   ? -12.480 -70.218 -35.486 1.00 49.85  ? 1227 HOH B O   1 
HETATM 9820 O  O   . HOH S 6 .   ? 12.823  -71.674 -9.536  1.00 43.38  ? 1228 HOH B O   1 
HETATM 9821 O  O   . HOH S 6 .   ? -3.440  -37.795 -29.810 1.00 50.15  ? 1229 HOH B O   1 
HETATM 9822 O  O   . HOH S 6 .   ? -26.398 -66.561 9.824   1.00 35.77  ? 1230 HOH B O   1 
HETATM 9823 O  O   . HOH S 6 .   ? -15.841 -79.546 -9.251  1.00 41.74  ? 1231 HOH B O   1 
HETATM 9824 O  O   . HOH S 6 .   ? -11.131 -42.415 -33.823 1.00 53.56  ? 1232 HOH B O   1 
HETATM 9825 O  O   . HOH S 6 .   ? 10.932  -32.610 0.994   1.00 65.73  ? 1233 HOH B O   1 
HETATM 9826 O  O   . HOH S 6 .   ? -6.719  -66.912 11.056  1.00 35.93  ? 1234 HOH B O   1 
HETATM 9827 O  O   . HOH S 6 .   ? -6.710  -45.988 11.463  1.00 46.11  ? 1235 HOH B O   1 
HETATM 9828 O  O   . HOH S 6 .   ? -19.258 -44.219 -20.358 1.00 42.48  ? 1236 HOH B O   1 
HETATM 9829 O  O   . HOH S 6 .   ? -29.755 -65.193 7.346   1.00 56.43  ? 1237 HOH B O   1 
HETATM 9830 O  O   . HOH S 6 .   ? -27.326 -68.414 7.907   1.00 39.78  ? 1238 HOH B O   1 
HETATM 9831 O  O   . HOH S 6 .   ? -10.944 -51.028 22.056  1.00 47.96  ? 1239 HOH B O   1 
HETATM 9832 O  O   . HOH S 6 .   ? -3.786  -75.965 -25.871 1.00 53.14  ? 1240 HOH B O   1 
HETATM 9833 O  O   . HOH S 6 .   ? 0.527   -88.252 -3.393  1.00 57.52  ? 1241 HOH B O   1 
HETATM 9834 O  O   . HOH S 6 .   ? -2.380  -62.739 19.836  1.00 40.83  ? 1242 HOH B O   1 
HETATM 9835 O  O   . HOH S 6 .   ? -28.164 -63.300 11.643  1.00 46.81  ? 1243 HOH B O   1 
HETATM 9836 O  O   . HOH S 6 .   ? 0.207   -25.707 -27.798 1.00 55.58  ? 1244 HOH B O   1 
HETATM 9837 O  O   . HOH S 6 .   ? 10.301  -55.977 -21.961 1.00 58.02  ? 1245 HOH B O   1 
HETATM 9838 O  O   . HOH S 6 .   ? 18.341  -53.446 21.394  1.00 52.77  ? 1246 HOH B O   1 
HETATM 9839 O  O   . HOH S 6 .   ? 11.519  -29.903 1.473   1.00 69.12  ? 1247 HOH B O   1 
HETATM 9840 O  O   . HOH S 6 .   ? -27.508 -64.298 9.140   1.00 41.63  ? 1248 HOH B O   1 
HETATM 9841 O  O   . HOH S 6 .   ? -28.134 -71.964 5.597   1.00 52.77  ? 1249 HOH B O   1 
HETATM 9842 O  O   . HOH S 6 .   ? -0.418  -89.982 -5.411  1.00 54.11  ? 1250 HOH B O   1 
HETATM 9843 O  O   . HOH S 6 .   ? 10.493  -53.004 -19.942 1.00 44.60  ? 1251 HOH B O   1 
HETATM 9844 O  O   . HOH S 6 .   ? -0.806  -23.966 -27.363 1.00 60.78  ? 1252 HOH B O   1 
HETATM 9845 O  O   . HOH S 6 .   ? 12.593  -31.043 2.638   1.00 53.97  ? 1253 HOH B O   1 
HETATM 9846 O  O   . HOH S 6 .   ? 11.934  -26.340 2.000   1.00 63.51  ? 1254 HOH B O   1 
HETATM 9847 O  O   . HOH S 6 .   ? -0.987  -17.663 -28.410 1.00 61.04  ? 1255 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
A 1 538 ASP 538 538 ?   ?   ?   A . n 
A 1 539 GLY 539 539 ?   ?   ?   A . n 
A 1 540 GLU 540 540 ?   ?   ?   A . n 
A 1 541 LEU 541 541 ?   ?   ?   A . n 
A 1 542 SER 542 542 ?   ?   ?   A . n 
A 1 543 SER 543 543 ?   ?   ?   A . n 
A 1 544 SER 544 544 ?   ?   ?   A . n 
A 1 545 GLY 545 545 ?   ?   ?   A . n 
A 1 546 THR 546 546 ?   ?   ?   A . n 
A 1 547 SER 547 547 ?   ?   ?   A . n 
A 1 548 SER 548 548 ?   ?   ?   A . n 
A 1 549 SER 549 549 ?   ?   ?   A . n 
A 1 550 LYS 550 550 ?   ?   ?   A . n 
A 1 551 GLY 551 551 ?   ?   ?   A . n 
A 1 552 ILE 552 552 ?   ?   ?   A . n 
A 1 553 ILE 553 553 ?   ?   ?   A . n 
A 1 554 PHE 554 554 ?   ?   ?   A . n 
A 1 555 TYR 555 555 ?   ?   ?   A . n 
A 1 556 VAL 556 556 ?   ?   ?   A . n 
A 1 557 LEU 557 557 ?   ?   ?   A . n 
A 1 558 PHE 558 558 ?   ?   ?   A . n 
A 1 559 SER 559 559 ?   ?   ?   A . n 
A 1 560 ILE 560 560 ?   ?   ?   A . n 
A 1 561 LEU 561 561 ?   ?   ?   A . n 
A 1 562 TYR 562 562 ?   ?   ?   A . n 
A 1 563 LEU 563 563 ?   ?   ?   A . n 
A 1 564 ILE 564 564 ?   ?   ?   A . n 
A 1 565 PHE 565 565 ?   ?   ?   A . n 
B 1 1   ASP 1   1   ?   ?   ?   B . n 
B 1 2   ASP 2   2   ?   ?   ?   B . n 
B 1 3   HIS 3   3   ?   ?   ?   B . n 
B 1 4   SER 4   4   4   SER SER B . n 
B 1 5   GLU 5   5   5   GLU GLU B . n 
B 1 6   LEU 6   6   6   LEU LEU B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   VAL 8   8   8   VAL VAL B . n 
B 1 9   ASN 9   9   9   ASN ASN B . n 
B 1 10  THR 10  10  10  THR THR B . n 
B 1 11  LYS 11  11  11  LYS LYS B . n 
B 1 12  SER 12  12  12  SER SER B . n 
B 1 13  GLY 13  13  13  GLY GLY B . n 
B 1 14  LYS 14  14  14  LYS LYS B . n 
B 1 15  VAL 15  15  15  VAL VAL B . n 
B 1 16  MET 16  16  16  MET MET B . n 
B 1 17  GLY 17  17  17  GLY GLY B . n 
B 1 18  THR 18  18  18  THR THR B . n 
B 1 19  ARG 19  19  19  ARG ARG B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  PRO 21  21  21  PRO PRO B . n 
B 1 22  VAL 22  22  22  VAL VAL B . n 
B 1 23  LEU 23  23  23  LEU LEU B . n 
B 1 24  SER 24  24  24  SER SER B . n 
B 1 25  SER 25  25  25  SER SER B . n 
B 1 26  HIS 26  26  26  HIS HIS B . n 
B 1 27  ILE 27  27  27  ILE ILE B . n 
B 1 28  SER 28  28  28  SER SER B . n 
B 1 29  ALA 29  29  29  ALA ALA B . n 
B 1 30  PHE 30  30  30  PHE PHE B . n 
B 1 31  LEU 31  31  31  LEU LEU B . n 
B 1 32  GLY 32  32  32  GLY GLY B . n 
B 1 33  ILE 33  33  33  ILE ILE B . n 
B 1 34  PRO 34  34  34  PRO PRO B . n 
B 1 35  PHE 35  35  35  PHE PHE B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  GLU 37  37  37  GLU GLU B . n 
B 1 38  PRO 38  38  38  PRO PRO B . n 
B 1 39  PRO 39  39  39  PRO PRO B . n 
B 1 40  VAL 40  40  40  VAL VAL B . n 
B 1 41  GLY 41  41  41  GLY GLY B . n 
B 1 42  ASN 42  42  42  ASN ASN B . n 
B 1 43  MET 43  43  43  MET MET B . n 
B 1 44  ARG 44  44  44  ARG ARG B . n 
B 1 45  PHE 45  45  45  PHE PHE B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  ARG 47  47  47  ARG ARG B . n 
B 1 48  PRO 48  48  48  PRO PRO B . n 
B 1 49  GLU 49  49  49  GLU GLU B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  LYS 52  52  52  LYS LYS B . n 
B 1 53  PRO 53  53  53  PRO PRO B . n 
B 1 54  TRP 54  54  54  TRP TRP B . n 
B 1 55  SER 55  55  55  SER SER B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  VAL 57  57  57  VAL VAL B . n 
B 1 58  TRP 58  58  58  TRP TRP B . n 
B 1 59  ASN 59  59  59  ASN ASN B . n 
B 1 60  ALA 60  60  60  ALA ALA B . n 
B 1 61  SER 61  61  61  SER SER B . n 
B 1 62  THR 62  62  62  THR THR B . n 
B 1 63  TYR 63  63  63  TYR TYR B . n 
B 1 64  PRO 64  64  64  PRO PRO B . n 
B 1 65  ASN 65  65  65  ASN ASN B . n 
B 1 66  ASN 66  66  66  ASN ASN B . n 
B 1 67  CYS 67  67  67  CYS CYS B . n 
B 1 68  GLN 68  68  68  GLN GLN B . n 
B 1 69  GLN 69  69  69  GLN GLN B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  VAL 71  71  71  VAL VAL B . n 
B 1 72  ASP 72  72  72  ASP ASP B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  GLN 74  74  74  GLN GLN B . n 
B 1 75  PHE 75  75  75  PHE PHE B . n 
B 1 76  PRO 76  76  76  PRO PRO B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  PHE 78  78  78  PHE PHE B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  GLY 80  80  80  GLY GLY B . n 
B 1 81  SER 81  81  81  SER SER B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  MET 83  83  83  MET MET B . n 
B 1 84  TRP 84  84  84  TRP TRP B . n 
B 1 85  ASN 85  85  85  ASN ASN B . n 
B 1 86  PRO 86  86  86  PRO PRO B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  ARG 88  88  88  ARG ARG B . n 
B 1 89  GLU 89  89  89  GLU GLU B . n 
B 1 90  MET 90  90  90  MET MET B . n 
B 1 91  SER 91  91  91  SER SER B . n 
B 1 92  GLU 92  92  92  GLU GLU B . n 
B 1 93  ASP 93  93  93  ASP ASP B . n 
B 1 94  CYS 94  94  94  CYS CYS B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  TYR 96  96  96  TYR TYR B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  ASN 98  98  98  ASN ASN B . n 
B 1 99  ILE 99  99  99  ILE ILE B . n 
B 1 100 TRP 100 100 100 TRP TRP B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 PRO 102 102 102 PRO PRO B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 ARG 105 105 105 ARG ARG B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 THR 109 109 109 THR THR B . n 
B 1 110 THR 110 110 110 THR THR B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 MET 112 112 112 MET MET B . n 
B 1 113 VAL 113 113 113 VAL VAL B . n 
B 1 114 TRP 114 114 114 TRP TRP B . n 
B 1 115 ILE 115 115 115 ILE ILE B . n 
B 1 116 TYR 116 116 116 TYR TYR B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 GLY 118 118 118 GLY GLY B . n 
B 1 119 GLY 119 119 119 GLY GLY B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 TYR 121 121 121 TYR TYR B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 GLY 123 123 123 GLY GLY B . n 
B 1 124 SER 124 124 124 SER SER B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 THR 126 126 126 THR THR B . n 
B 1 127 LEU 127 127 127 LEU LEU B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 VAL 129 129 129 VAL VAL B . n 
B 1 130 TYR 130 130 130 TYR TYR B . n 
B 1 131 ASN 131 131 131 ASN ASN B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 LYS 133 133 133 LYS LYS B . n 
B 1 134 TYR 134 134 134 TYR TYR B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 TYR 137 137 137 TYR TYR B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 GLU 140 140 140 GLU GLU B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 VAL 144 144 144 VAL VAL B . n 
B 1 145 SER 145 145 145 SER SER B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 SER 147 147 147 SER SER B . n 
B 1 148 TYR 148 148 148 TYR TYR B . n 
B 1 149 ARG 149 149 149 ARG ARG B . n 
B 1 150 VAL 150 150 150 VAL VAL B . n 
B 1 151 GLY 151 151 151 GLY GLY B . n 
B 1 152 ALA 152 152 152 ALA ALA B . n 
B 1 153 PHE 153 153 153 PHE PHE B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 PHE 155 155 155 PHE PHE B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 LEU 158 158 158 LEU LEU B . n 
B 1 159 HIS 159 159 159 HIS HIS B . n 
B 1 160 GLY 160 160 160 GLY GLY B . n 
B 1 161 SER 161 161 161 SER SER B . n 
B 1 162 GLN 162 162 162 GLN GLN B . n 
B 1 163 GLU 163 163 163 GLU GLU B . n 
B 1 164 ALA 164 164 164 ALA ALA B . n 
B 1 165 PRO 165 165 165 PRO PRO B . n 
B 1 166 GLY 166 166 166 GLY GLY B . n 
B 1 167 ASN 167 167 167 ASN ASN B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 LEU 171 171 171 LEU LEU B . n 
B 1 172 ASP 172 172 172 ASP ASP B . n 
B 1 173 GLN 173 173 173 GLN GLN B . n 
B 1 174 ARG 174 174 174 ARG ARG B . n 
B 1 175 MET 175 175 175 MET MET B . n 
B 1 176 ALA 176 176 176 ALA ALA B . n 
B 1 177 LEU 177 177 177 LEU LEU B . n 
B 1 178 GLN 178 178 178 GLN GLN B . n 
B 1 179 TRP 179 179 179 TRP TRP B . n 
B 1 180 VAL 180 180 180 VAL VAL B . n 
B 1 181 HIS 181 181 181 HIS HIS B . n 
B 1 182 ASP 182 182 182 ASP ASP B . n 
B 1 183 ASN 183 183 183 ASN ASN B . n 
B 1 184 ILE 184 184 184 ILE ILE B . n 
B 1 185 GLN 185 185 185 GLN GLN B . n 
B 1 186 PHE 186 186 186 PHE PHE B . n 
B 1 187 PHE 187 187 187 PHE PHE B . n 
B 1 188 GLY 188 188 188 GLY GLY B . n 
B 1 189 GLY 189 189 189 GLY GLY B . n 
B 1 190 ASP 190 190 190 ASP ASP B . n 
B 1 191 PRO 191 191 191 PRO PRO B . n 
B 1 192 LYS 192 192 192 LYS LYS B . n 
B 1 193 THR 193 193 193 THR THR B . n 
B 1 194 VAL 194 194 194 VAL VAL B . n 
B 1 195 THR 195 195 195 THR THR B . n 
B 1 196 ILE 196 196 196 ILE ILE B . n 
B 1 197 PHE 197 197 197 PHE PHE B . n 
B 1 198 GLY 198 198 198 GLY GLY B . n 
B 1 199 GLU 199 199 199 GLU GLU B . n 
B 1 200 SER 200 200 200 SER SER B . n 
B 1 201 ALA 201 201 201 ALA ALA B . n 
B 1 202 GLY 202 202 202 GLY GLY B . n 
B 1 203 GLY 203 203 203 GLY GLY B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 SER 205 205 205 SER SER B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 GLY 207 207 207 GLY GLY B . n 
B 1 208 MET 208 208 208 MET MET B . n 
B 1 209 HIS 209 209 209 HIS HIS B . n 
B 1 210 ILE 210 210 210 ILE ILE B . n 
B 1 211 LEU 211 211 211 LEU LEU B . n 
B 1 212 SER 212 212 212 SER SER B . n 
B 1 213 PRO 213 213 213 PRO PRO B . n 
B 1 214 GLY 214 214 214 GLY GLY B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 ARG 216 216 216 ARG ARG B . n 
B 1 217 ASP 217 217 217 ASP ASP B . n 
B 1 218 LEU 218 218 218 LEU LEU B . n 
B 1 219 PHE 219 219 219 PHE PHE B . n 
B 1 220 ARG 220 220 220 ARG ARG B . n 
B 1 221 ARG 221 221 221 ARG ARG B . n 
B 1 222 ALA 222 222 222 ALA ALA B . n 
B 1 223 ILE 223 223 223 ILE ILE B . n 
B 1 224 LEU 224 224 224 LEU LEU B . n 
B 1 225 GLN 225 225 225 GLN GLN B . n 
B 1 226 SER 226 226 226 SER SER B . n 
B 1 227 GLY 227 227 227 GLY GLY B . n 
B 1 228 SER 228 228 228 SER SER B . n 
B 1 229 PRO 229 229 229 PRO PRO B . n 
B 1 230 ASN 230 230 230 ASN ASN B . n 
B 1 231 CYS 231 231 231 CYS CYS B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 TRP 233 233 233 TRP TRP B . n 
B 1 234 ALA 234 234 234 ALA ALA B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 VAL 236 236 236 VAL VAL B . n 
B 1 237 SER 237 237 237 SER SER B . n 
B 1 238 VAL 238 238 238 VAL VAL B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 GLU 240 240 240 GLU GLU B . n 
B 1 241 GLY 241 241 241 GLY GLY B . n 
B 1 242 ARG 242 242 242 ARG ARG B . n 
B 1 243 ARG 243 243 243 ARG ARG B . n 
B 1 244 ARG 244 244 244 ARG ARG B . n 
B 1 245 ALA 245 245 245 ALA ALA B . n 
B 1 246 VAL 246 246 246 VAL VAL B . n 
B 1 247 GLU 247 247 247 GLU GLU B . n 
B 1 248 LEU 248 248 248 LEU LEU B . n 
B 1 249 GLY 249 249 249 GLY GLY B . n 
B 1 250 ARG 250 250 250 ARG ARG B . n 
B 1 251 ASN 251 251 251 ASN ASN B . n 
B 1 252 LEU 252 252 252 LEU LEU B . n 
B 1 253 ASN 253 253 253 ASN ASN B . n 
B 1 254 CYS 254 254 254 CYS CYS B . n 
B 1 255 ASN 255 255 255 ASN ASN B . n 
B 1 256 LEU 256 256 256 LEU LEU B . n 
B 1 257 ASN 257 257 257 ASN ASN B . n 
B 1 258 SER 258 258 258 SER SER B . n 
B 1 259 ASP 259 259 259 ASP ASP B . n 
B 1 260 GLU 260 260 260 GLU GLU B . n 
B 1 261 GLU 261 261 261 GLU GLU B . n 
B 1 262 LEU 262 262 262 LEU LEU B . n 
B 1 263 ILE 263 263 263 ILE ILE B . n 
B 1 264 HIS 264 264 264 HIS HIS B . n 
B 1 265 CYS 265 265 265 CYS CYS B . n 
B 1 266 LEU 266 266 266 LEU LEU B . n 
B 1 267 ARG 267 267 267 ARG ARG B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LYS 269 269 269 LYS LYS B . n 
B 1 270 LYS 270 270 270 LYS LYS B . n 
B 1 271 PRO 271 271 271 PRO PRO B . n 
B 1 272 GLN 272 272 272 GLN GLN B . n 
B 1 273 GLU 273 273 273 GLU GLU B . n 
B 1 274 LEU 274 274 274 LEU LEU B . n 
B 1 275 ILE 275 275 275 ILE ILE B . n 
B 1 276 ASP 276 276 276 ASP ASP B . n 
B 1 277 VAL 277 277 277 VAL VAL B . n 
B 1 278 GLU 278 278 278 GLU GLU B . n 
B 1 279 TRP 279 279 279 TRP TRP B . n 
B 1 280 ASN 280 280 280 ASN ASN B . n 
B 1 281 VAL 281 281 281 VAL VAL B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 PRO 283 283 283 PRO PRO B . n 
B 1 284 PHE 284 284 284 PHE PHE B . n 
B 1 285 ASP 285 285 285 ASP ASP B . n 
B 1 286 SER 286 286 286 SER SER B . n 
B 1 287 ILE 287 287 287 ILE ILE B . n 
B 1 288 PHE 288 288 288 PHE PHE B . n 
B 1 289 ARG 289 289 289 ARG ARG B . n 
B 1 290 PHE 290 290 290 PHE PHE B . n 
B 1 291 SER 291 291 291 SER SER B . n 
B 1 292 PHE 292 292 292 PHE PHE B . n 
B 1 293 VAL 293 293 293 VAL VAL B . n 
B 1 294 PRO 294 294 294 PRO PRO B . n 
B 1 295 VAL 295 295 295 VAL VAL B . n 
B 1 296 ILE 296 296 296 ILE ILE B . n 
B 1 297 ASP 297 297 297 ASP ASP B . n 
B 1 298 GLY 298 298 298 GLY GLY B . n 
B 1 299 GLU 299 299 299 GLU GLU B . n 
B 1 300 PHE 300 300 300 PHE PHE B . n 
B 1 301 PHE 301 301 301 PHE PHE B . n 
B 1 302 PRO 302 302 302 PRO PRO B . n 
B 1 303 THR 303 303 303 THR THR B . n 
B 1 304 SER 304 304 304 SER SER B . n 
B 1 305 LEU 305 305 305 LEU LEU B . n 
B 1 306 GLU 306 306 306 GLU GLU B . n 
B 1 307 SER 307 307 307 SER SER B . n 
B 1 308 MET 308 308 308 MET MET B . n 
B 1 309 LEU 309 309 309 LEU LEU B . n 
B 1 310 ASN 310 310 310 ASN ASN B . n 
B 1 311 SER 311 311 311 SER SER B . n 
B 1 312 GLY 312 312 312 GLY GLY B . n 
B 1 313 ASN 313 313 313 ASN ASN B . n 
B 1 314 PHE 314 314 314 PHE PHE B . n 
B 1 315 LYS 315 315 315 LYS LYS B . n 
B 1 316 LYS 316 316 316 LYS LYS B . n 
B 1 317 THR 317 317 317 THR THR B . n 
B 1 318 GLN 318 318 318 GLN GLN B . n 
B 1 319 ILE 319 319 319 ILE ILE B . n 
B 1 320 LEU 320 320 320 LEU LEU B . n 
B 1 321 LEU 321 321 321 LEU LEU B . n 
B 1 322 GLY 322 322 322 GLY GLY B . n 
B 1 323 VAL 323 323 323 VAL VAL B . n 
B 1 324 ASN 324 324 324 ASN ASN B . n 
B 1 325 LYS 325 325 325 LYS LYS B . n 
B 1 326 ASP 326 326 326 ASP ASP B . n 
B 1 327 GLU 327 327 327 GLU GLU B . n 
B 1 328 GLY 328 328 328 GLY GLY B . n 
B 1 329 SER 329 329 329 SER SER B . n 
B 1 330 PHE 330 330 330 PHE PHE B . n 
B 1 331 PHE 331 331 331 PHE PHE B . n 
B 1 332 LEU 332 332 332 LEU LEU B . n 
B 1 333 LEU 333 333 333 LEU LEU B . n 
B 1 334 TYR 334 334 334 TYR TYR B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 ALA 336 336 336 ALA ALA B . n 
B 1 337 PRO 337 337 337 PRO PRO B . n 
B 1 338 GLY 338 338 338 GLY GLY B . n 
B 1 339 PHE 339 339 339 PHE PHE B . n 
B 1 340 SER 340 340 340 SER SER B . n 
B 1 341 LYS 341 341 341 LYS LYS B . n 
B 1 342 ASP 342 342 342 ASP ASP B . n 
B 1 343 SER 343 343 343 SER SER B . n 
B 1 344 GLU 344 344 344 GLU GLU B . n 
B 1 345 SER 345 345 345 SER SER B . n 
B 1 346 LYS 346 346 346 LYS LYS B . n 
B 1 347 ILE 347 347 347 ILE ILE B . n 
B 1 348 SER 348 348 348 SER SER B . n 
B 1 349 ARG 349 349 349 ARG ARG B . n 
B 1 350 GLU 350 350 350 GLU GLU B . n 
B 1 351 ASP 351 351 351 ASP ASP B . n 
B 1 352 PHE 352 352 352 PHE PHE B . n 
B 1 353 MET 353 353 353 MET MET B . n 
B 1 354 SER 354 354 354 SER SER B . n 
B 1 355 GLY 355 355 355 GLY GLY B . n 
B 1 356 VAL 356 356 356 VAL VAL B . n 
B 1 357 LYS 357 357 357 LYS LYS B . n 
B 1 358 LEU 358 358 358 LEU LEU B . n 
B 1 359 SER 359 359 359 SER SER B . n 
B 1 360 VAL 360 360 360 VAL VAL B . n 
B 1 361 PRO 361 361 361 PRO PRO B . n 
B 1 362 HIS 362 362 362 HIS HIS B . n 
B 1 363 ALA 363 363 363 ALA ALA B . n 
B 1 364 ASN 364 364 364 ASN ASN B . n 
B 1 365 ASP 365 365 365 ASP ASP B . n 
B 1 366 LEU 366 366 366 LEU LEU B . n 
B 1 367 GLY 367 367 367 GLY GLY B . n 
B 1 368 LEU 368 368 368 LEU LEU B . n 
B 1 369 ASP 369 369 369 ASP ASP B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 VAL 371 371 371 VAL VAL B . n 
B 1 372 THR 372 372 372 THR THR B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 GLN 374 374 374 GLN GLN B . n 
B 1 375 TYR 375 375 375 TYR TYR B . n 
B 1 376 THR 376 376 376 THR THR B . n 
B 1 377 ASP 377 377 377 ASP ASP B . n 
B 1 378 TRP 378 378 378 TRP TRP B . n 
B 1 379 MET 379 379 379 MET MET B . n 
B 1 380 ASP 380 380 380 ASP ASP B . n 
B 1 381 ASP 381 381 381 ASP ASP B . n 
B 1 382 ASN 382 382 382 ASN ASN B . n 
B 1 383 ASN 383 383 383 ASN ASN B . n 
B 1 384 GLY 384 384 384 GLY GLY B . n 
B 1 385 ILE 385 385 385 ILE ILE B . n 
B 1 386 LYS 386 386 386 LYS LYS B . n 
B 1 387 ASN 387 387 387 ASN ASN B . n 
B 1 388 ARG 388 388 388 ARG ARG B . n 
B 1 389 ASP 389 389 389 ASP ASP B . n 
B 1 390 GLY 390 390 390 GLY GLY B . n 
B 1 391 LEU 391 391 391 LEU LEU B . n 
B 1 392 ASP 392 392 392 ASP ASP B . n 
B 1 393 ASP 393 393 393 ASP ASP B . n 
B 1 394 ILE 394 394 394 ILE ILE B . n 
B 1 395 VAL 395 395 395 VAL VAL B . n 
B 1 396 GLY 396 396 396 GLY GLY B . n 
B 1 397 ASP 397 397 397 ASP ASP B . n 
B 1 398 HIS 398 398 398 HIS HIS B . n 
B 1 399 ASN 399 399 399 ASN ASN B . n 
B 1 400 VAL 400 400 400 VAL VAL B . n 
B 1 401 ILE 401 401 401 ILE ILE B . n 
B 1 402 CYS 402 402 402 CYS CYS B . n 
B 1 403 PRO 403 403 403 PRO PRO B . n 
B 1 404 LEU 404 404 404 LEU LEU B . n 
B 1 405 MET 405 405 405 MET MET B . n 
B 1 406 HIS 406 406 406 HIS HIS B . n 
B 1 407 PHE 407 407 407 PHE PHE B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 ASN 409 409 409 ASN ASN B . n 
B 1 410 LYS 410 410 410 LYS LYS B . n 
B 1 411 TYR 411 411 411 TYR TYR B . n 
B 1 412 THR 412 412 412 THR THR B . n 
B 1 413 LYS 413 413 413 LYS LYS B . n 
B 1 414 PHE 414 414 414 PHE PHE B . n 
B 1 415 GLY 415 415 415 GLY GLY B . n 
B 1 416 ASN 416 416 416 ASN ASN B . n 
B 1 417 GLY 417 417 417 GLY GLY B . n 
B 1 418 THR 418 418 418 THR THR B . n 
B 1 419 TYR 419 419 419 TYR TYR B . n 
B 1 420 LEU 420 420 420 LEU LEU B . n 
B 1 421 TYR 421 421 421 TYR TYR B . n 
B 1 422 PHE 422 422 422 PHE PHE B . n 
B 1 423 PHE 423 423 423 PHE PHE B . n 
B 1 424 ASN 424 424 424 ASN ASN B . n 
B 1 425 HIS 425 425 425 HIS HIS B . n 
B 1 426 ARG 426 426 426 ARG ARG B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 SER 428 428 428 SER SER B . n 
B 1 429 ASN 429 429 429 ASN ASN B . n 
B 1 430 LEU 430 430 430 LEU LEU B . n 
B 1 431 VAL 431 431 431 VAL VAL B . n 
B 1 432 TRP 432 432 432 TRP TRP B . n 
B 1 433 PRO 433 433 433 PRO PRO B . n 
B 1 434 GLU 434 434 434 GLU GLU B . n 
B 1 435 TRP 435 435 435 TRP TRP B . n 
B 1 436 MET 436 436 436 MET MET B . n 
B 1 437 GLY 437 437 437 GLY GLY B . n 
B 1 438 VAL 438 438 438 VAL VAL B . n 
B 1 439 ILE 439 439 439 ILE ILE B . n 
B 1 440 HIS 440 440 440 HIS HIS B . n 
B 1 441 GLY 441 441 441 GLY GLY B . n 
B 1 442 TYR 442 442 442 TYR TYR B . n 
B 1 443 GLU 443 443 443 GLU GLU B . n 
B 1 444 ILE 444 444 444 ILE ILE B . n 
B 1 445 GLU 445 445 445 GLU GLU B . n 
B 1 446 PHE 446 446 446 PHE PHE B . n 
B 1 447 VAL 447 447 447 VAL VAL B . n 
B 1 448 PHE 448 448 448 PHE PHE B . n 
B 1 449 GLY 449 449 449 GLY GLY B . n 
B 1 450 LEU 450 450 450 LEU LEU B . n 
B 1 451 PRO 451 451 451 PRO PRO B . n 
B 1 452 LEU 452 452 452 LEU LEU B . n 
B 1 453 VAL 453 453 453 VAL VAL B . n 
B 1 454 LYS 454 454 454 LYS LYS B . n 
B 1 455 GLU 455 455 455 GLU GLU B . n 
B 1 456 LEU 456 456 456 LEU LEU B . n 
B 1 457 ASN 457 457 457 ASN ASN B . n 
B 1 458 TYR 458 458 458 TYR TYR B . n 
B 1 459 THR 459 459 459 THR THR B . n 
B 1 460 ALA 460 460 460 ALA ALA B . n 
B 1 461 GLU 461 461 461 GLU GLU B . n 
B 1 462 GLU 462 462 462 GLU GLU B . n 
B 1 463 GLU 463 463 463 GLU GLU B . n 
B 1 464 ALA 464 464 464 ALA ALA B . n 
B 1 465 LEU 465 465 465 LEU LEU B . n 
B 1 466 SER 466 466 466 SER SER B . n 
B 1 467 ARG 467 467 467 ARG ARG B . n 
B 1 468 ARG 468 468 468 ARG ARG B . n 
B 1 469 ILE 469 469 469 ILE ILE B . n 
B 1 470 MET 470 470 470 MET MET B . n 
B 1 471 HIS 471 471 471 HIS HIS B . n 
B 1 472 TYR 472 472 472 TYR TYR B . n 
B 1 473 TRP 473 473 473 TRP TRP B . n 
B 1 474 ALA 474 474 474 ALA ALA B . n 
B 1 475 THR 475 475 475 THR THR B . n 
B 1 476 PHE 476 476 476 PHE PHE B . n 
B 1 477 ALA 477 477 477 ALA ALA B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 THR 479 479 479 THR THR B . n 
B 1 480 GLY 480 480 480 GLY GLY B . n 
B 1 481 ASN 481 481 481 ASN ASN B . n 
B 1 482 PRO 482 482 482 PRO PRO B . n 
B 1 483 ASN 483 483 483 ASN ASN B . n 
B 1 484 GLU 484 484 484 GLU GLU B . n 
B 1 485 PRO 485 485 485 PRO PRO B . n 
B 1 486 HIS 486 486 486 HIS HIS B . n 
B 1 487 SER 487 487 487 SER SER B . n 
B 1 488 GLN 488 488 488 GLN GLN B . n 
B 1 489 GLU 489 489 489 GLU GLU B . n 
B 1 490 SER 490 490 490 SER SER B . n 
B 1 491 LYS 491 491 491 LYS LYS B . n 
B 1 492 TRP 492 492 492 TRP TRP B . n 
B 1 493 PRO 493 493 493 PRO PRO B . n 
B 1 494 LEU 494 494 494 LEU LEU B . n 
B 1 495 PHE 495 495 495 PHE PHE B . n 
B 1 496 THR 496 496 496 THR THR B . n 
B 1 497 THR 497 497 497 THR THR B . n 
B 1 498 LYS 498 498 498 LYS LYS B . n 
B 1 499 GLU 499 499 499 GLU GLU B . n 
B 1 500 GLN 500 500 500 GLN GLN B . n 
B 1 501 LYS 501 501 501 LYS LYS B . n 
B 1 502 PHE 502 502 502 PHE PHE B . n 
B 1 503 ILE 503 503 503 ILE ILE B . n 
B 1 504 ASP 504 504 504 ASP ASP B . n 
B 1 505 LEU 505 505 505 LEU LEU B . n 
B 1 506 ASN 506 506 506 ASN ASN B . n 
B 1 507 THR 507 507 507 THR THR B . n 
B 1 508 GLU 508 508 508 GLU GLU B . n 
B 1 509 PRO 509 509 509 PRO PRO B . n 
B 1 510 MET 510 510 510 MET MET B . n 
B 1 511 LYS 511 511 511 LYS LYS B . n 
B 1 512 VAL 512 512 512 VAL VAL B . n 
B 1 513 HIS 513 513 513 HIS HIS B . n 
B 1 514 GLN 514 514 514 GLN GLN B . n 
B 1 515 ARG 515 515 515 ARG ARG B . n 
B 1 516 LEU 516 516 516 LEU LEU B . n 
B 1 517 ARG 517 517 517 ARG ARG B . n 
B 1 518 VAL 518 518 518 VAL VAL B . n 
B 1 519 GLN 519 519 519 GLN GLN B . n 
B 1 520 MET 520 520 520 MET MET B . n 
B 1 521 CYS 521 521 521 CYS CYS B . n 
B 1 522 VAL 522 522 522 VAL VAL B . n 
B 1 523 PHE 523 523 523 PHE PHE B . n 
B 1 524 TRP 524 524 524 TRP TRP B . n 
B 1 525 ASN 525 525 525 ASN ASN B . n 
B 1 526 GLN 526 526 526 GLN GLN B . n 
B 1 527 PHE 527 527 527 PHE PHE B . n 
B 1 528 LEU 528 528 528 LEU LEU B . n 
B 1 529 PRO 529 529 529 PRO PRO B . n 
B 1 530 LYS 530 530 530 LYS LYS B . n 
B 1 531 LEU 531 531 531 LEU LEU B . n 
B 1 532 LEU 532 532 532 LEU LEU B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ALA 534 534 534 ALA ALA B . n 
B 1 535 THR 535 535 535 THR THR B . n 
B 1 536 ALA 536 536 ?   ?   ?   B . n 
B 1 537 CYS 537 537 ?   ?   ?   B . n 
B 1 538 ASP 538 538 ?   ?   ?   B . n 
B 1 539 GLY 539 539 ?   ?   ?   B . n 
B 1 540 GLU 540 540 ?   ?   ?   B . n 
B 1 541 LEU 541 541 ?   ?   ?   B . n 
B 1 542 SER 542 542 ?   ?   ?   B . n 
B 1 543 SER 543 543 ?   ?   ?   B . n 
B 1 544 SER 544 544 ?   ?   ?   B . n 
B 1 545 GLY 545 545 ?   ?   ?   B . n 
B 1 546 THR 546 546 ?   ?   ?   B . n 
B 1 547 SER 547 547 ?   ?   ?   B . n 
B 1 548 SER 548 548 ?   ?   ?   B . n 
B 1 549 SER 549 549 ?   ?   ?   B . n 
B 1 550 LYS 550 550 ?   ?   ?   B . n 
B 1 551 GLY 551 551 ?   ?   ?   B . n 
B 1 552 ILE 552 552 ?   ?   ?   B . n 
B 1 553 ILE 553 553 ?   ?   ?   B . n 
B 1 554 PHE 554 554 ?   ?   ?   B . n 
B 1 555 TYR 555 555 ?   ?   ?   B . n 
B 1 556 VAL 556 556 ?   ?   ?   B . n 
B 1 557 LEU 557 557 ?   ?   ?   B . n 
B 1 558 PHE 558 558 ?   ?   ?   B . n 
B 1 559 SER 559 559 ?   ?   ?   B . n 
B 1 560 ILE 560 560 ?   ?   ?   B . n 
B 1 561 LEU 561 561 ?   ?   ?   B . n 
B 1 562 TYR 562 562 ?   ?   ?   B . n 
B 1 563 LEU 563 563 ?   ?   ?   B . n 
B 1 564 ILE 564 564 ?   ?   ?   B . n 
B 1 565 PHE 565 565 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1   601  1007 NAG NAG A . 
D 2 NAG 1   602  1008 NAG NAG A . 
E 2 NAG 1   603  1009 NAG NAG A . 
F 3 E1N 1   604  1    E1N DRG A . 
G 4 CL  1   605  1    CL  CL  A . 
H 4 CL  1   606  2    CL  CL  A . 
I 4 CL  1   607  3    CL  CL  A . 
J 5 PEG 1   608  1    PEG PEG A . 
K 5 PEG 1   609  2    PEG PEG A . 
L 2 NAG 1   601  1007 NAG NAG B . 
M 2 NAG 1   602  1008 NAG NAG B . 
N 2 NAG 1   603  1009 NAG NAG B . 
O 3 E1N 1   604  2    E1N DRG B . 
P 4 CL  1   605  4    CL  CL  B . 
Q 5 PEG 1   606  3    PEG PEG B . 
R 6 HOH 1   701  596  HOH HOH A . 
R 6 HOH 2   702  1040 HOH HOH A . 
R 6 HOH 3   703  1071 HOH HOH A . 
R 6 HOH 4   704  1073 HOH HOH A . 
R 6 HOH 5   705  1028 HOH HOH A . 
R 6 HOH 6   706  874  HOH HOH A . 
R 6 HOH 7   707  917  HOH HOH A . 
R 6 HOH 8   708  600  HOH HOH A . 
R 6 HOH 9   709  811  HOH HOH A . 
R 6 HOH 10  710  809  HOH HOH A . 
R 6 HOH 11  711  158  HOH HOH A . 
R 6 HOH 12  712  209  HOH HOH A . 
R 6 HOH 13  713  608  HOH HOH A . 
R 6 HOH 14  714  707  HOH HOH A . 
R 6 HOH 15  715  532  HOH HOH A . 
R 6 HOH 16  716  244  HOH HOH A . 
R 6 HOH 17  717  1081 HOH HOH A . 
R 6 HOH 18  718  477  HOH HOH A . 
R 6 HOH 19  719  437  HOH HOH A . 
R 6 HOH 20  720  665  HOH HOH A . 
R 6 HOH 21  721  77   HOH HOH A . 
R 6 HOH 22  722  925  HOH HOH A . 
R 6 HOH 23  723  555  HOH HOH A . 
R 6 HOH 24  724  567  HOH HOH A . 
R 6 HOH 25  725  595  HOH HOH A . 
R 6 HOH 26  726  795  HOH HOH A . 
R 6 HOH 27  727  1027 HOH HOH A . 
R 6 HOH 28  728  446  HOH HOH A . 
R 6 HOH 29  729  826  HOH HOH A . 
R 6 HOH 30  730  333  HOH HOH A . 
R 6 HOH 31  731  598  HOH HOH A . 
R 6 HOH 32  732  288  HOH HOH A . 
R 6 HOH 33  733  476  HOH HOH A . 
R 6 HOH 34  734  838  HOH HOH A . 
R 6 HOH 35  735  319  HOH HOH A . 
R 6 HOH 36  736  527  HOH HOH A . 
R 6 HOH 37  737  178  HOH HOH A . 
R 6 HOH 38  738  3    HOH HOH A . 
R 6 HOH 39  739  969  HOH HOH A . 
R 6 HOH 40  740  100  HOH HOH A . 
R 6 HOH 41  741  514  HOH HOH A . 
R 6 HOH 42  742  552  HOH HOH A . 
R 6 HOH 43  743  1059 HOH HOH A . 
R 6 HOH 44  744  102  HOH HOH A . 
R 6 HOH 45  745  536  HOH HOH A . 
R 6 HOH 46  746  1048 HOH HOH A . 
R 6 HOH 47  747  293  HOH HOH A . 
R 6 HOH 48  748  627  HOH HOH A . 
R 6 HOH 49  749  50   HOH HOH A . 
R 6 HOH 50  750  557  HOH HOH A . 
R 6 HOH 51  751  327  HOH HOH A . 
R 6 HOH 52  752  168  HOH HOH A . 
R 6 HOH 53  753  91   HOH HOH A . 
R 6 HOH 54  754  106  HOH HOH A . 
R 6 HOH 55  755  465  HOH HOH A . 
R 6 HOH 56  756  724  HOH HOH A . 
R 6 HOH 57  757  177  HOH HOH A . 
R 6 HOH 58  758  943  HOH HOH A . 
R 6 HOH 59  759  255  HOH HOH A . 
R 6 HOH 60  760  351  HOH HOH A . 
R 6 HOH 61  761  785  HOH HOH A . 
R 6 HOH 62  762  433  HOH HOH A . 
R 6 HOH 63  763  55   HOH HOH A . 
R 6 HOH 64  764  737  HOH HOH A . 
R 6 HOH 65  765  124  HOH HOH A . 
R 6 HOH 66  766  318  HOH HOH A . 
R 6 HOH 67  767  402  HOH HOH A . 
R 6 HOH 68  768  503  HOH HOH A . 
R 6 HOH 69  769  977  HOH HOH A . 
R 6 HOH 70  770  370  HOH HOH A . 
R 6 HOH 71  771  31   HOH HOH A . 
R 6 HOH 72  772  381  HOH HOH A . 
R 6 HOH 73  773  769  HOH HOH A . 
R 6 HOH 74  774  42   HOH HOH A . 
R 6 HOH 75  775  895  HOH HOH A . 
R 6 HOH 76  776  530  HOH HOH A . 
R 6 HOH 77  777  221  HOH HOH A . 
R 6 HOH 78  778  32   HOH HOH A . 
R 6 HOH 79  779  159  HOH HOH A . 
R 6 HOH 80  780  908  HOH HOH A . 
R 6 HOH 81  781  228  HOH HOH A . 
R 6 HOH 82  782  620  HOH HOH A . 
R 6 HOH 83  783  597  HOH HOH A . 
R 6 HOH 84  784  38   HOH HOH A . 
R 6 HOH 85  785  71   HOH HOH A . 
R 6 HOH 86  786  486  HOH HOH A . 
R 6 HOH 87  787  232  HOH HOH A . 
R 6 HOH 88  788  765  HOH HOH A . 
R 6 HOH 89  789  25   HOH HOH A . 
R 6 HOH 90  790  725  HOH HOH A . 
R 6 HOH 91  791  200  HOH HOH A . 
R 6 HOH 92  792  549  HOH HOH A . 
R 6 HOH 93  793  843  HOH HOH A . 
R 6 HOH 94  794  81   HOH HOH A . 
R 6 HOH 95  795  494  HOH HOH A . 
R 6 HOH 96  796  114  HOH HOH A . 
R 6 HOH 97  797  350  HOH HOH A . 
R 6 HOH 98  798  592  HOH HOH A . 
R 6 HOH 99  799  505  HOH HOH A . 
R 6 HOH 100 800  11   HOH HOH A . 
R 6 HOH 101 801  99   HOH HOH A . 
R 6 HOH 102 802  120  HOH HOH A . 
R 6 HOH 103 803  103  HOH HOH A . 
R 6 HOH 104 804  965  HOH HOH A . 
R 6 HOH 105 805  983  HOH HOH A . 
R 6 HOH 106 806  460  HOH HOH A . 
R 6 HOH 107 807  41   HOH HOH A . 
R 6 HOH 108 808  378  HOH HOH A . 
R 6 HOH 109 809  226  HOH HOH A . 
R 6 HOH 110 810  1014 HOH HOH A . 
R 6 HOH 111 811  15   HOH HOH A . 
R 6 HOH 112 812  213  HOH HOH A . 
R 6 HOH 113 813  290  HOH HOH A . 
R 6 HOH 114 814  400  HOH HOH A . 
R 6 HOH 115 815  115  HOH HOH A . 
R 6 HOH 116 816  989  HOH HOH A . 
R 6 HOH 117 817  188  HOH HOH A . 
R 6 HOH 118 818  286  HOH HOH A . 
R 6 HOH 119 819  21   HOH HOH A . 
R 6 HOH 120 820  982  HOH HOH A . 
R 6 HOH 121 821  479  HOH HOH A . 
R 6 HOH 122 822  78   HOH HOH A . 
R 6 HOH 123 823  75   HOH HOH A . 
R 6 HOH 124 824  354  HOH HOH A . 
R 6 HOH 125 825  64   HOH HOH A . 
R 6 HOH 126 826  284  HOH HOH A . 
R 6 HOH 127 827  95   HOH HOH A . 
R 6 HOH 128 828  452  HOH HOH A . 
R 6 HOH 129 829  420  HOH HOH A . 
R 6 HOH 130 830  334  HOH HOH A . 
R 6 HOH 131 831  193  HOH HOH A . 
R 6 HOH 132 832  119  HOH HOH A . 
R 6 HOH 133 833  105  HOH HOH A . 
R 6 HOH 134 834  792  HOH HOH A . 
R 6 HOH 135 835  520  HOH HOH A . 
R 6 HOH 136 836  253  HOH HOH A . 
R 6 HOH 137 837  16   HOH HOH A . 
R 6 HOH 138 838  5    HOH HOH A . 
R 6 HOH 139 839  768  HOH HOH A . 
R 6 HOH 140 840  222  HOH HOH A . 
R 6 HOH 141 841  522  HOH HOH A . 
R 6 HOH 142 842  630  HOH HOH A . 
R 6 HOH 143 843  559  HOH HOH A . 
R 6 HOH 144 844  955  HOH HOH A . 
R 6 HOH 145 845  23   HOH HOH A . 
R 6 HOH 146 846  85   HOH HOH A . 
R 6 HOH 147 847  29   HOH HOH A . 
R 6 HOH 148 848  364  HOH HOH A . 
R 6 HOH 149 849  152  HOH HOH A . 
R 6 HOH 150 850  408  HOH HOH A . 
R 6 HOH 151 851  431  HOH HOH A . 
R 6 HOH 152 852  391  HOH HOH A . 
R 6 HOH 153 853  74   HOH HOH A . 
R 6 HOH 154 854  97   HOH HOH A . 
R 6 HOH 155 855  126  HOH HOH A . 
R 6 HOH 156 856  493  HOH HOH A . 
R 6 HOH 157 857  808  HOH HOH A . 
R 6 HOH 158 858  432  HOH HOH A . 
R 6 HOH 159 859  93   HOH HOH A . 
R 6 HOH 160 860  830  HOH HOH A . 
R 6 HOH 161 861  981  HOH HOH A . 
R 6 HOH 162 862  54   HOH HOH A . 
R 6 HOH 163 863  44   HOH HOH A . 
R 6 HOH 164 864  198  HOH HOH A . 
R 6 HOH 165 865  470  HOH HOH A . 
R 6 HOH 166 866  851  HOH HOH A . 
R 6 HOH 167 867  154  HOH HOH A . 
R 6 HOH 168 868  51   HOH HOH A . 
R 6 HOH 169 869  504  HOH HOH A . 
R 6 HOH 170 870  195  HOH HOH A . 
R 6 HOH 171 871  150  HOH HOH A . 
R 6 HOH 172 872  473  HOH HOH A . 
R 6 HOH 173 873  517  HOH HOH A . 
R 6 HOH 174 874  1    HOH HOH A . 
R 6 HOH 175 875  616  HOH HOH A . 
R 6 HOH 176 876  265  HOH HOH A . 
R 6 HOH 177 877  112  HOH HOH A . 
R 6 HOH 178 878  949  HOH HOH A . 
R 6 HOH 179 879  936  HOH HOH A . 
R 6 HOH 180 880  667  HOH HOH A . 
R 6 HOH 181 881  736  HOH HOH A . 
R 6 HOH 182 882  87   HOH HOH A . 
R 6 HOH 183 883  1005 HOH HOH A . 
R 6 HOH 184 884  250  HOH HOH A . 
R 6 HOH 185 885  70   HOH HOH A . 
R 6 HOH 186 886  310  HOH HOH A . 
R 6 HOH 187 887  866  HOH HOH A . 
R 6 HOH 188 888  138  HOH HOH A . 
R 6 HOH 189 889  304  HOH HOH A . 
R 6 HOH 190 890  453  HOH HOH A . 
R 6 HOH 191 891  797  HOH HOH A . 
R 6 HOH 192 892  376  HOH HOH A . 
R 6 HOH 193 893  491  HOH HOH A . 
R 6 HOH 194 894  136  HOH HOH A . 
R 6 HOH 195 895  111  HOH HOH A . 
R 6 HOH 196 896  802  HOH HOH A . 
R 6 HOH 197 897  848  HOH HOH A . 
R 6 HOH 198 898  145  HOH HOH A . 
R 6 HOH 199 899  317  HOH HOH A . 
R 6 HOH 200 900  430  HOH HOH A . 
R 6 HOH 201 901  787  HOH HOH A . 
R 6 HOH 202 902  241  HOH HOH A . 
R 6 HOH 203 903  856  HOH HOH A . 
R 6 HOH 204 904  1026 HOH HOH A . 
R 6 HOH 205 905  143  HOH HOH A . 
R 6 HOH 206 906  475  HOH HOH A . 
R 6 HOH 207 907  506  HOH HOH A . 
R 6 HOH 208 908  1055 HOH HOH A . 
R 6 HOH 209 909  472  HOH HOH A . 
R 6 HOH 210 910  622  HOH HOH A . 
R 6 HOH 211 911  464  HOH HOH A . 
R 6 HOH 212 912  107  HOH HOH A . 
R 6 HOH 213 913  264  HOH HOH A . 
R 6 HOH 214 914  368  HOH HOH A . 
R 6 HOH 215 915  46   HOH HOH A . 
R 6 HOH 216 916  463  HOH HOH A . 
R 6 HOH 217 917  405  HOH HOH A . 
R 6 HOH 218 918  498  HOH HOH A . 
R 6 HOH 219 919  53   HOH HOH A . 
R 6 HOH 220 920  772  HOH HOH A . 
R 6 HOH 221 921  263  HOH HOH A . 
R 6 HOH 222 922  254  HOH HOH A . 
R 6 HOH 223 923  413  HOH HOH A . 
R 6 HOH 224 924  165  HOH HOH A . 
R 6 HOH 225 925  864  HOH HOH A . 
R 6 HOH 226 926  382  HOH HOH A . 
R 6 HOH 227 927  385  HOH HOH A . 
R 6 HOH 228 928  127  HOH HOH A . 
R 6 HOH 229 929  879  HOH HOH A . 
R 6 HOH 230 930  418  HOH HOH A . 
R 6 HOH 231 931  173  HOH HOH A . 
R 6 HOH 232 932  645  HOH HOH A . 
R 6 HOH 233 933  225  HOH HOH A . 
R 6 HOH 234 934  603  HOH HOH A . 
R 6 HOH 235 935  26   HOH HOH A . 
R 6 HOH 236 936  12   HOH HOH A . 
R 6 HOH 237 937  262  HOH HOH A . 
R 6 HOH 238 938  604  HOH HOH A . 
R 6 HOH 239 939  714  HOH HOH A . 
R 6 HOH 240 940  104  HOH HOH A . 
R 6 HOH 241 941  332  HOH HOH A . 
R 6 HOH 242 942  863  HOH HOH A . 
R 6 HOH 243 943  445  HOH HOH A . 
R 6 HOH 244 944  323  HOH HOH A . 
R 6 HOH 245 945  245  HOH HOH A . 
R 6 HOH 246 946  204  HOH HOH A . 
R 6 HOH 247 947  6    HOH HOH A . 
R 6 HOH 248 948  49   HOH HOH A . 
R 6 HOH 249 949  883  HOH HOH A . 
R 6 HOH 250 950  946  HOH HOH A . 
R 6 HOH 251 951  132  HOH HOH A . 
R 6 HOH 252 952  563  HOH HOH A . 
R 6 HOH 253 953  831  HOH HOH A . 
R 6 HOH 254 954  352  HOH HOH A . 
R 6 HOH 255 955  59   HOH HOH A . 
R 6 HOH 256 956  137  HOH HOH A . 
R 6 HOH 257 957  539  HOH HOH A . 
R 6 HOH 258 958  344  HOH HOH A . 
R 6 HOH 259 959  497  HOH HOH A . 
R 6 HOH 260 960  525  HOH HOH A . 
R 6 HOH 261 961  708  HOH HOH A . 
R 6 HOH 262 962  1008 HOH HOH A . 
R 6 HOH 263 963  940  HOH HOH A . 
R 6 HOH 264 964  738  HOH HOH A . 
R 6 HOH 265 965  1013 HOH HOH A . 
R 6 HOH 266 966  429  HOH HOH A . 
R 6 HOH 267 967  654  HOH HOH A . 
R 6 HOH 268 968  542  HOH HOH A . 
R 6 HOH 269 969  18   HOH HOH A . 
R 6 HOH 270 970  183  HOH HOH A . 
R 6 HOH 271 971  220  HOH HOH A . 
R 6 HOH 272 972  571  HOH HOH A . 
R 6 HOH 273 973  709  HOH HOH A . 
R 6 HOH 274 974  340  HOH HOH A . 
R 6 HOH 275 975  632  HOH HOH A . 
R 6 HOH 276 976  720  HOH HOH A . 
R 6 HOH 277 977  170  HOH HOH A . 
R 6 HOH 278 978  37   HOH HOH A . 
R 6 HOH 279 979  614  HOH HOH A . 
R 6 HOH 280 980  684  HOH HOH A . 
R 6 HOH 281 981  556  HOH HOH A . 
R 6 HOH 282 982  805  HOH HOH A . 
R 6 HOH 283 983  584  HOH HOH A . 
R 6 HOH 284 984  348  HOH HOH A . 
R 6 HOH 285 985  374  HOH HOH A . 
R 6 HOH 286 986  1085 HOH HOH A . 
R 6 HOH 287 987  807  HOH HOH A . 
R 6 HOH 288 988  139  HOH HOH A . 
R 6 HOH 289 989  545  HOH HOH A . 
R 6 HOH 290 990  857  HOH HOH A . 
R 6 HOH 291 991  63   HOH HOH A . 
R 6 HOH 292 992  1082 HOH HOH A . 
R 6 HOH 293 993  814  HOH HOH A . 
R 6 HOH 294 994  893  HOH HOH A . 
R 6 HOH 295 995  292  HOH HOH A . 
R 6 HOH 296 996  61   HOH HOH A . 
R 6 HOH 297 997  639  HOH HOH A . 
R 6 HOH 298 998  260  HOH HOH A . 
R 6 HOH 299 999  67   HOH HOH A . 
R 6 HOH 300 1000 1095 HOH HOH A . 
R 6 HOH 301 1001 523  HOH HOH A . 
R 6 HOH 302 1002 855  HOH HOH A . 
R 6 HOH 303 1003 301  HOH HOH A . 
R 6 HOH 304 1004 316  HOH HOH A . 
R 6 HOH 305 1005 976  HOH HOH A . 
R 6 HOH 306 1006 551  HOH HOH A . 
R 6 HOH 307 1007 617  HOH HOH A . 
R 6 HOH 308 1008 462  HOH HOH A . 
R 6 HOH 309 1009 163  HOH HOH A . 
R 6 HOH 310 1010 1097 HOH HOH A . 
R 6 HOH 311 1011 387  HOH HOH A . 
R 6 HOH 312 1012 679  HOH HOH A . 
R 6 HOH 313 1013 760  HOH HOH A . 
R 6 HOH 314 1014 509  HOH HOH A . 
R 6 HOH 315 1015 881  HOH HOH A . 
R 6 HOH 316 1016 199  HOH HOH A . 
R 6 HOH 317 1017 611  HOH HOH A . 
R 6 HOH 318 1018 602  HOH HOH A . 
R 6 HOH 319 1019 65   HOH HOH A . 
R 6 HOH 320 1020 692  HOH HOH A . 
R 6 HOH 321 1021 793  HOH HOH A . 
R 6 HOH 322 1022 439  HOH HOH A . 
R 6 HOH 323 1023 125  HOH HOH A . 
R 6 HOH 324 1024 219  HOH HOH A . 
R 6 HOH 325 1025 169  HOH HOH A . 
R 6 HOH 326 1026 601  HOH HOH A . 
R 6 HOH 327 1027 295  HOH HOH A . 
R 6 HOH 328 1028 398  HOH HOH A . 
R 6 HOH 329 1029 971  HOH HOH A . 
R 6 HOH 330 1030 474  HOH HOH A . 
R 6 HOH 331 1031 438  HOH HOH A . 
R 6 HOH 332 1032 440  HOH HOH A . 
R 6 HOH 333 1033 798  HOH HOH A . 
R 6 HOH 334 1034 314  HOH HOH A . 
R 6 HOH 335 1035 929  HOH HOH A . 
R 6 HOH 336 1036 201  HOH HOH A . 
R 6 HOH 337 1037 399  HOH HOH A . 
R 6 HOH 338 1038 280  HOH HOH A . 
R 6 HOH 339 1039 773  HOH HOH A . 
R 6 HOH 340 1040 483  HOH HOH A . 
R 6 HOH 341 1041 153  HOH HOH A . 
R 6 HOH 342 1042 266  HOH HOH A . 
R 6 HOH 343 1043 766  HOH HOH A . 
R 6 HOH 344 1044 1007 HOH HOH A . 
R 6 HOH 345 1045 754  HOH HOH A . 
R 6 HOH 346 1046 706  HOH HOH A . 
R 6 HOH 347 1047 565  HOH HOH A . 
R 6 HOH 348 1048 745  HOH HOH A . 
R 6 HOH 349 1049 669  HOH HOH A . 
R 6 HOH 350 1050 841  HOH HOH A . 
R 6 HOH 351 1051 347  HOH HOH A . 
R 6 HOH 352 1052 867  HOH HOH A . 
R 6 HOH 353 1053 1068 HOH HOH A . 
R 6 HOH 354 1054 678  HOH HOH A . 
R 6 HOH 355 1055 912  HOH HOH A . 
R 6 HOH 356 1056 56   HOH HOH A . 
R 6 HOH 357 1057 36   HOH HOH A . 
R 6 HOH 358 1058 581  HOH HOH A . 
R 6 HOH 359 1059 868  HOH HOH A . 
R 6 HOH 360 1060 716  HOH HOH A . 
R 6 HOH 361 1061 861  HOH HOH A . 
R 6 HOH 362 1062 582  HOH HOH A . 
R 6 HOH 363 1063 346  HOH HOH A . 
R 6 HOH 364 1064 1093 HOH HOH A . 
R 6 HOH 365 1065 641  HOH HOH A . 
R 6 HOH 366 1066 151  HOH HOH A . 
R 6 HOH 367 1067 296  HOH HOH A . 
R 6 HOH 368 1068 1058 HOH HOH A . 
R 6 HOH 369 1069 783  HOH HOH A . 
R 6 HOH 370 1070 291  HOH HOH A . 
R 6 HOH 371 1071 458  HOH HOH A . 
R 6 HOH 372 1072 259  HOH HOH A . 
R 6 HOH 373 1073 285  HOH HOH A . 
R 6 HOH 374 1074 141  HOH HOH A . 
R 6 HOH 375 1075 359  HOH HOH A . 
R 6 HOH 376 1076 1067 HOH HOH A . 
R 6 HOH 377 1077 510  HOH HOH A . 
R 6 HOH 378 1078 739  HOH HOH A . 
R 6 HOH 379 1079 281  HOH HOH A . 
R 6 HOH 380 1080 383  HOH HOH A . 
R 6 HOH 381 1081 767  HOH HOH A . 
R 6 HOH 382 1082 914  HOH HOH A . 
R 6 HOH 383 1083 548  HOH HOH A . 
R 6 HOH 384 1084 39   HOH HOH A . 
R 6 HOH 385 1085 535  HOH HOH A . 
R 6 HOH 386 1086 268  HOH HOH A . 
R 6 HOH 387 1087 543  HOH HOH A . 
R 6 HOH 388 1088 312  HOH HOH A . 
R 6 HOH 389 1089 673  HOH HOH A . 
R 6 HOH 390 1090 261  HOH HOH A . 
R 6 HOH 391 1091 764  HOH HOH A . 
R 6 HOH 392 1092 424  HOH HOH A . 
R 6 HOH 393 1093 34   HOH HOH A . 
R 6 HOH 394 1094 210  HOH HOH A . 
R 6 HOH 395 1095 215  HOH HOH A . 
R 6 HOH 396 1096 47   HOH HOH A . 
R 6 HOH 397 1097 813  HOH HOH A . 
R 6 HOH 398 1098 935  HOH HOH A . 
R 6 HOH 399 1099 343  HOH HOH A . 
R 6 HOH 400 1100 302  HOH HOH A . 
R 6 HOH 401 1101 560  HOH HOH A . 
R 6 HOH 402 1102 176  HOH HOH A . 
R 6 HOH 403 1103 948  HOH HOH A . 
R 6 HOH 404 1104 309  HOH HOH A . 
R 6 HOH 405 1105 1102 HOH HOH A . 
R 6 HOH 406 1106 972  HOH HOH A . 
R 6 HOH 407 1107 1107 HOH HOH A . 
R 6 HOH 408 1108 910  HOH HOH A . 
R 6 HOH 409 1109 1091 HOH HOH A . 
R 6 HOH 410 1110 447  HOH HOH A . 
R 6 HOH 411 1111 959  HOH HOH A . 
R 6 HOH 412 1112 779  HOH HOH A . 
R 6 HOH 413 1113 371  HOH HOH A . 
R 6 HOH 414 1114 392  HOH HOH A . 
R 6 HOH 415 1115 726  HOH HOH A . 
R 6 HOH 416 1116 954  HOH HOH A . 
R 6 HOH 417 1117 322  HOH HOH A . 
R 6 HOH 418 1118 974  HOH HOH A . 
R 6 HOH 419 1119 653  HOH HOH A . 
R 6 HOH 420 1120 377  HOH HOH A . 
R 6 HOH 421 1121 909  HOH HOH A . 
R 6 HOH 422 1122 1039 HOH HOH A . 
R 6 HOH 423 1123 872  HOH HOH A . 
R 6 HOH 424 1124 277  HOH HOH A . 
R 6 HOH 425 1125 651  HOH HOH A . 
R 6 HOH 426 1126 741  HOH HOH A . 
R 6 HOH 427 1127 1021 HOH HOH A . 
R 6 HOH 428 1128 634  HOH HOH A . 
R 6 HOH 429 1129 778  HOH HOH A . 
R 6 HOH 430 1130 1036 HOH HOH A . 
R 6 HOH 431 1131 375  HOH HOH A . 
R 6 HOH 432 1132 956  HOH HOH A . 
R 6 HOH 433 1133 788  HOH HOH A . 
R 6 HOH 434 1134 624  HOH HOH A . 
R 6 HOH 435 1135 1053 HOH HOH A . 
R 6 HOH 436 1136 1098 HOH HOH A . 
R 6 HOH 437 1137 947  HOH HOH A . 
R 6 HOH 438 1138 758  HOH HOH A . 
R 6 HOH 439 1139 913  HOH HOH A . 
R 6 HOH 440 1140 362  HOH HOH A . 
R 6 HOH 441 1141 820  HOH HOH A . 
R 6 HOH 442 1142 759  HOH HOH A . 
R 6 HOH 443 1143 1060 HOH HOH A . 
R 6 HOH 444 1144 1111 HOH HOH A . 
R 6 HOH 445 1145 1016 HOH HOH A . 
R 6 HOH 446 1146 419  HOH HOH A . 
R 6 HOH 447 1147 840  HOH HOH A . 
R 6 HOH 448 1148 1017 HOH HOH A . 
R 6 HOH 449 1149 695  HOH HOH A . 
R 6 HOH 450 1150 613  HOH HOH A . 
R 6 HOH 451 1151 674  HOH HOH A . 
R 6 HOH 452 1152 577  HOH HOH A . 
R 6 HOH 453 1153 681  HOH HOH A . 
R 6 HOH 454 1154 320  HOH HOH A . 
R 6 HOH 455 1155 196  HOH HOH A . 
R 6 HOH 456 1156 643  HOH HOH A . 
R 6 HOH 457 1157 434  HOH HOH A . 
R 6 HOH 458 1158 770  HOH HOH A . 
R 6 HOH 459 1159 730  HOH HOH A . 
R 6 HOH 460 1160 1010 HOH HOH A . 
R 6 HOH 461 1161 512  HOH HOH A . 
R 6 HOH 462 1162 834  HOH HOH A . 
R 6 HOH 463 1163 719  HOH HOH A . 
R 6 HOH 464 1164 531  HOH HOH A . 
R 6 HOH 465 1165 121  HOH HOH A . 
R 6 HOH 466 1166 1074 HOH HOH A . 
R 6 HOH 467 1167 425  HOH HOH A . 
R 6 HOH 468 1168 849  HOH HOH A . 
R 6 HOH 469 1169 589  HOH HOH A . 
R 6 HOH 470 1170 216  HOH HOH A . 
R 6 HOH 471 1171 1104 HOH HOH A . 
R 6 HOH 472 1172 686  HOH HOH A . 
R 6 HOH 473 1173 1080 HOH HOH A . 
R 6 HOH 474 1174 999  HOH HOH A . 
R 6 HOH 475 1175 810  HOH HOH A . 
R 6 HOH 476 1176 699  HOH HOH A . 
R 6 HOH 477 1177 753  HOH HOH A . 
R 6 HOH 478 1178 628  HOH HOH A . 
R 6 HOH 479 1179 817  HOH HOH A . 
R 6 HOH 480 1180 980  HOH HOH A . 
R 6 HOH 481 1181 757  HOH HOH A . 
R 6 HOH 482 1182 682  HOH HOH A . 
R 6 HOH 483 1183 172  HOH HOH A . 
R 6 HOH 484 1184 1012 HOH HOH A . 
R 6 HOH 485 1185 646  HOH HOH A . 
R 6 HOH 486 1186 901  HOH HOH A . 
R 6 HOH 487 1187 683  HOH HOH A . 
R 6 HOH 488 1188 335  HOH HOH A . 
R 6 HOH 489 1189 988  HOH HOH A . 
R 6 HOH 490 1190 468  HOH HOH A . 
R 6 HOH 491 1191 973  HOH HOH A . 
R 6 HOH 492 1192 698  HOH HOH A . 
R 6 HOH 493 1193 1096 HOH HOH A . 
R 6 HOH 494 1194 409  HOH HOH A . 
R 6 HOH 495 1195 300  HOH HOH A . 
R 6 HOH 496 1196 750  HOH HOH A . 
R 6 HOH 497 1197 854  HOH HOH A . 
R 6 HOH 498 1198 1024 HOH HOH A . 
R 6 HOH 499 1199 963  HOH HOH A . 
R 6 HOH 500 1200 930  HOH HOH A . 
R 6 HOH 501 1201 688  HOH HOH A . 
R 6 HOH 502 1202 689  HOH HOH A . 
R 6 HOH 503 1203 341  HOH HOH A . 
R 6 HOH 504 1204 633  HOH HOH A . 
R 6 HOH 505 1205 731  HOH HOH A . 
R 6 HOH 506 1206 1050 HOH HOH A . 
R 6 HOH 507 1207 685  HOH HOH A . 
R 6 HOH 508 1208 966  HOH HOH A . 
R 6 HOH 509 1209 1100 HOH HOH A . 
R 6 HOH 510 1210 417  HOH HOH A . 
R 6 HOH 511 1211 782  HOH HOH A . 
R 6 HOH 512 1212 776  HOH HOH A . 
R 6 HOH 513 1213 756  HOH HOH A . 
R 6 HOH 514 1214 544  HOH HOH A . 
R 6 HOH 515 1215 640  HOH HOH A . 
R 6 HOH 516 1216 618  HOH HOH A . 
R 6 HOH 517 1217 1076 HOH HOH A . 
R 6 HOH 518 1218 887  HOH HOH A . 
R 6 HOH 519 1219 718  HOH HOH A . 
R 6 HOH 520 1220 1092 HOH HOH A . 
R 6 HOH 521 1221 794  HOH HOH A . 
R 6 HOH 522 1222 711  HOH HOH A . 
R 6 HOH 523 1223 803  HOH HOH A . 
R 6 HOH 524 1224 744  HOH HOH A . 
R 6 HOH 525 1225 588  HOH HOH A . 
R 6 HOH 526 1226 858  HOH HOH A . 
R 6 HOH 527 1227 467  HOH HOH A . 
R 6 HOH 528 1228 480  HOH HOH A . 
R 6 HOH 529 1229 680  HOH HOH A . 
R 6 HOH 530 1230 1072 HOH HOH A . 
R 6 HOH 531 1231 575  HOH HOH A . 
R 6 HOH 532 1232 932  HOH HOH A . 
R 6 HOH 533 1233 957  HOH HOH A . 
R 6 HOH 534 1234 499  HOH HOH A . 
R 6 HOH 535 1235 573  HOH HOH A . 
R 6 HOH 536 1236 717  HOH HOH A . 
R 6 HOH 537 1237 379  HOH HOH A . 
R 6 HOH 538 1238 728  HOH HOH A . 
R 6 HOH 539 1239 466  HOH HOH A . 
R 6 HOH 540 1240 1106 HOH HOH A . 
R 6 HOH 541 1241 579  HOH HOH A . 
R 6 HOH 542 1242 844  HOH HOH A . 
R 6 HOH 543 1243 591  HOH HOH A . 
R 6 HOH 544 1244 1003 HOH HOH A . 
R 6 HOH 545 1245 1088 HOH HOH A . 
R 6 HOH 546 1246 1078 HOH HOH A . 
R 6 HOH 547 1247 1054 HOH HOH A . 
R 6 HOH 548 1248 832  HOH HOH A . 
R 6 HOH 549 1249 984  HOH HOH A . 
R 6 HOH 550 1250 541  HOH HOH A . 
R 6 HOH 551 1251 987  HOH HOH A . 
R 6 HOH 552 1252 1110 HOH HOH A . 
R 6 HOH 553 1253 780  HOH HOH A . 
R 6 HOH 554 1254 1032 HOH HOH A . 
R 6 HOH 555 1255 1066 HOH HOH A . 
R 6 HOH 556 1256 1030 HOH HOH A . 
S 6 HOH 1   701  687  HOH HOH B . 
S 6 HOH 2   702  502  HOH HOH B . 
S 6 HOH 3   703  1046 HOH HOH B . 
S 6 HOH 4   704  648  HOH HOH B . 
S 6 HOH 5   705  593  HOH HOH B . 
S 6 HOH 6   706  328  HOH HOH B . 
S 6 HOH 7   707  777  HOH HOH B . 
S 6 HOH 8   708  800  HOH HOH B . 
S 6 HOH 9   709  1086 HOH HOH B . 
S 6 HOH 10  710  889  HOH HOH B . 
S 6 HOH 11  711  662  HOH HOH B . 
S 6 HOH 12  712  454  HOH HOH B . 
S 6 HOH 13  713  668  HOH HOH B . 
S 6 HOH 14  714  821  HOH HOH B . 
S 6 HOH 15  715  609  HOH HOH B . 
S 6 HOH 16  716  607  HOH HOH B . 
S 6 HOH 17  717  888  HOH HOH B . 
S 6 HOH 18  718  83   HOH HOH B . 
S 6 HOH 19  719  1079 HOH HOH B . 
S 6 HOH 20  720  615  HOH HOH B . 
S 6 HOH 21  721  90   HOH HOH B . 
S 6 HOH 22  722  650  HOH HOH B . 
S 6 HOH 23  723  331  HOH HOH B . 
S 6 HOH 24  724  568  HOH HOH B . 
S 6 HOH 25  725  904  HOH HOH B . 
S 6 HOH 26  726  1006 HOH HOH B . 
S 6 HOH 27  727  142  HOH HOH B . 
S 6 HOH 28  728  478  HOH HOH B . 
S 6 HOH 29  729  761  HOH HOH B . 
S 6 HOH 30  730  676  HOH HOH B . 
S 6 HOH 31  731  927  HOH HOH B . 
S 6 HOH 32  732  190  HOH HOH B . 
S 6 HOH 33  733  586  HOH HOH B . 
S 6 HOH 34  734  852  HOH HOH B . 
S 6 HOH 35  735  113  HOH HOH B . 
S 6 HOH 36  736  278  HOH HOH B . 
S 6 HOH 37  737  880  HOH HOH B . 
S 6 HOH 38  738  436  HOH HOH B . 
S 6 HOH 39  739  411  HOH HOH B . 
S 6 HOH 40  740  17   HOH HOH B . 
S 6 HOH 41  741  108  HOH HOH B . 
S 6 HOH 42  742  30   HOH HOH B . 
S 6 HOH 43  743  939  HOH HOH B . 
S 6 HOH 44  744  1084 HOH HOH B . 
S 6 HOH 45  745  94   HOH HOH B . 
S 6 HOH 46  746  342  HOH HOH B . 
S 6 HOH 47  747  180  HOH HOH B . 
S 6 HOH 48  748  576  HOH HOH B . 
S 6 HOH 49  749  621  HOH HOH B . 
S 6 HOH 50  750  20   HOH HOH B . 
S 6 HOH 51  751  905  HOH HOH B . 
S 6 HOH 52  752  373  HOH HOH B . 
S 6 HOH 53  753  2    HOH HOH B . 
S 6 HOH 54  754  307  HOH HOH B . 
S 6 HOH 55  755  274  HOH HOH B . 
S 6 HOH 56  756  1031 HOH HOH B . 
S 6 HOH 57  757  52   HOH HOH B . 
S 6 HOH 58  758  122  HOH HOH B . 
S 6 HOH 59  759  267  HOH HOH B . 
S 6 HOH 60  760  311  HOH HOH B . 
S 6 HOH 61  761  325  HOH HOH B . 
S 6 HOH 62  762  944  HOH HOH B . 
S 6 HOH 63  763  1019 HOH HOH B . 
S 6 HOH 64  764  10   HOH HOH B . 
S 6 HOH 65  765  4    HOH HOH B . 
S 6 HOH 66  766  443  HOH HOH B . 
S 6 HOH 67  767  393  HOH HOH B . 
S 6 HOH 68  768  964  HOH HOH B . 
S 6 HOH 69  769  871  HOH HOH B . 
S 6 HOH 70  770  155  HOH HOH B . 
S 6 HOH 71  771  273  HOH HOH B . 
S 6 HOH 72  772  550  HOH HOH B . 
S 6 HOH 73  773  415  HOH HOH B . 
S 6 HOH 74  774  367  HOH HOH B . 
S 6 HOH 75  775  205  HOH HOH B . 
S 6 HOH 76  776  166  HOH HOH B . 
S 6 HOH 77  777  751  HOH HOH B . 
S 6 HOH 78  778  533  HOH HOH B . 
S 6 HOH 79  779  853  HOH HOH B . 
S 6 HOH 80  780  358  HOH HOH B . 
S 6 HOH 81  781  900  HOH HOH B . 
S 6 HOH 82  782  967  HOH HOH B . 
S 6 HOH 83  783  357  HOH HOH B . 
S 6 HOH 84  784  35   HOH HOH B . 
S 6 HOH 85  785  101  HOH HOH B . 
S 6 HOH 86  786  1015 HOH HOH B . 
S 6 HOH 87  787  82   HOH HOH B . 
S 6 HOH 88  788  230  HOH HOH B . 
S 6 HOH 89  789  485  HOH HOH B . 
S 6 HOH 90  790  287  HOH HOH B . 
S 6 HOH 91  791  693  HOH HOH B . 
S 6 HOH 92  792  116  HOH HOH B . 
S 6 HOH 93  793  986  HOH HOH B . 
S 6 HOH 94  794  249  HOH HOH B . 
S 6 HOH 95  795  390  HOH HOH B . 
S 6 HOH 96  796  365  HOH HOH B . 
S 6 HOH 97  797  672  HOH HOH B . 
S 6 HOH 98  798  1044 HOH HOH B . 
S 6 HOH 99  799  60   HOH HOH B . 
S 6 HOH 100 800  129  HOH HOH B . 
S 6 HOH 101 801  134  HOH HOH B . 
S 6 HOH 102 802  147  HOH HOH B . 
S 6 HOH 103 803  945  HOH HOH B . 
S 6 HOH 104 804  918  HOH HOH B . 
S 6 HOH 105 805  315  HOH HOH B . 
S 6 HOH 106 806  148  HOH HOH B . 
S 6 HOH 107 807  224  HOH HOH B . 
S 6 HOH 108 808  610  HOH HOH B . 
S 6 HOH 109 809  456  HOH HOH B . 
S 6 HOH 110 810  62   HOH HOH B . 
S 6 HOH 111 811  997  HOH HOH B . 
S 6 HOH 112 812  66   HOH HOH B . 
S 6 HOH 113 813  13   HOH HOH B . 
S 6 HOH 114 814  412  HOH HOH B . 
S 6 HOH 115 815  950  HOH HOH B . 
S 6 HOH 116 816  774  HOH HOH B . 
S 6 HOH 117 817  457  HOH HOH B . 
S 6 HOH 118 818  80   HOH HOH B . 
S 6 HOH 119 819  72   HOH HOH B . 
S 6 HOH 120 820  734  HOH HOH B . 
S 6 HOH 121 821  223  HOH HOH B . 
S 6 HOH 122 822  240  HOH HOH B . 
S 6 HOH 123 823  1020 HOH HOH B . 
S 6 HOH 124 824  110  HOH HOH B . 
S 6 HOH 125 825  461  HOH HOH B . 
S 6 HOH 126 826  89   HOH HOH B . 
S 6 HOH 127 827  28   HOH HOH B . 
S 6 HOH 128 828  270  HOH HOH B . 
S 6 HOH 129 829  1099 HOH HOH B . 
S 6 HOH 130 830  743  HOH HOH B . 
S 6 HOH 131 831  1001 HOH HOH B . 
S 6 HOH 132 832  338  HOH HOH B . 
S 6 HOH 133 833  203  HOH HOH B . 
S 6 HOH 134 834  658  HOH HOH B . 
S 6 HOH 135 835  9    HOH HOH B . 
S 6 HOH 136 836  45   HOH HOH B . 
S 6 HOH 137 837  626  HOH HOH B . 
S 6 HOH 138 838  747  HOH HOH B . 
S 6 HOH 139 839  217  HOH HOH B . 
S 6 HOH 140 840  179  HOH HOH B . 
S 6 HOH 141 841  771  HOH HOH B . 
S 6 HOH 142 842  403  HOH HOH B . 
S 6 HOH 143 843  283  HOH HOH B . 
S 6 HOH 144 844  175  HOH HOH B . 
S 6 HOH 145 845  422  HOH HOH B . 
S 6 HOH 146 846  247  HOH HOH B . 
S 6 HOH 147 847  1069 HOH HOH B . 
S 6 HOH 148 848  207  HOH HOH B . 
S 6 HOH 149 849  508  HOH HOH B . 
S 6 HOH 150 850  57   HOH HOH B . 
S 6 HOH 151 851  206  HOH HOH B . 
S 6 HOH 152 852  164  HOH HOH B . 
S 6 HOH 153 853  623  HOH HOH B . 
S 6 HOH 154 854  185  HOH HOH B . 
S 6 HOH 155 855  471  HOH HOH B . 
S 6 HOH 156 856  96   HOH HOH B . 
S 6 HOH 157 857  79   HOH HOH B . 
S 6 HOH 158 858  877  HOH HOH B . 
S 6 HOH 159 859  361  HOH HOH B . 
S 6 HOH 160 860  238  HOH HOH B . 
S 6 HOH 161 861  43   HOH HOH B . 
S 6 HOH 162 862  187  HOH HOH B . 
S 6 HOH 163 863  186  HOH HOH B . 
S 6 HOH 164 864  469  HOH HOH B . 
S 6 HOH 165 865  305  HOH HOH B . 
S 6 HOH 166 866  625  HOH HOH B . 
S 6 HOH 167 867  903  HOH HOH B . 
S 6 HOH 168 868  696  HOH HOH B . 
S 6 HOH 169 869  1049 HOH HOH B . 
S 6 HOH 170 870  24   HOH HOH B . 
S 6 HOH 171 871  554  HOH HOH B . 
S 6 HOH 172 872  345  HOH HOH B . 
S 6 HOH 173 873  369  HOH HOH B . 
S 6 HOH 174 874  211  HOH HOH B . 
S 6 HOH 175 875  167  HOH HOH B . 
S 6 HOH 176 876  98   HOH HOH B . 
S 6 HOH 177 877  14   HOH HOH B . 
S 6 HOH 178 878  144  HOH HOH B . 
S 6 HOH 179 879  516  HOH HOH B . 
S 6 HOH 180 880  194  HOH HOH B . 
S 6 HOH 181 881  192  HOH HOH B . 
S 6 HOH 182 882  712  HOH HOH B . 
S 6 HOH 183 883  416  HOH HOH B . 
S 6 HOH 184 884  191  HOH HOH B . 
S 6 HOH 185 885  22   HOH HOH B . 
S 6 HOH 186 886  118  HOH HOH B . 
S 6 HOH 187 887  921  HOH HOH B . 
S 6 HOH 188 888  605  HOH HOH B . 
S 6 HOH 189 889  638  HOH HOH B . 
S 6 HOH 190 890  922  HOH HOH B . 
S 6 HOH 191 891  242  HOH HOH B . 
S 6 HOH 192 892  366  HOH HOH B . 
S 6 HOH 193 893  578  HOH HOH B . 
S 6 HOH 194 894  289  HOH HOH B . 
S 6 HOH 195 895  337  HOH HOH B . 
S 6 HOH 196 896  697  HOH HOH B . 
S 6 HOH 197 897  146  HOH HOH B . 
S 6 HOH 198 898  162  HOH HOH B . 
S 6 HOH 199 899  123  HOH HOH B . 
S 6 HOH 200 900  1063 HOH HOH B . 
S 6 HOH 201 901  330  HOH HOH B . 
S 6 HOH 202 902  572  HOH HOH B . 
S 6 HOH 203 903  574  HOH HOH B . 
S 6 HOH 204 904  33   HOH HOH B . 
S 6 HOH 205 905  619  HOH HOH B . 
S 6 HOH 206 906  7    HOH HOH B . 
S 6 HOH 207 907  847  HOH HOH B . 
S 6 HOH 208 908  723  HOH HOH B . 
S 6 HOH 209 909  401  HOH HOH B . 
S 6 HOH 210 910  40   HOH HOH B . 
S 6 HOH 211 911  128  HOH HOH B . 
S 6 HOH 212 912  208  HOH HOH B . 
S 6 HOH 213 913  564  HOH HOH B . 
S 6 HOH 214 914  174  HOH HOH B . 
S 6 HOH 215 915  19   HOH HOH B . 
S 6 HOH 216 916  360  HOH HOH B . 
S 6 HOH 217 917  755  HOH HOH B . 
S 6 HOH 218 918  269  HOH HOH B . 
S 6 HOH 219 919  501  HOH HOH B . 
S 6 HOH 220 920  594  HOH HOH B . 
S 6 HOH 221 921  372  HOH HOH B . 
S 6 HOH 222 922  1075 HOH HOH B . 
S 6 HOH 223 923  156  HOH HOH B . 
S 6 HOH 224 924  529  HOH HOH B . 
S 6 HOH 225 925  294  HOH HOH B . 
S 6 HOH 226 926  837  HOH HOH B . 
S 6 HOH 227 927  8    HOH HOH B . 
S 6 HOH 228 928  271  HOH HOH B . 
S 6 HOH 229 929  587  HOH HOH B . 
S 6 HOH 230 930  272  HOH HOH B . 
S 6 HOH 231 931  722  HOH HOH B . 
S 6 HOH 232 932  484  HOH HOH B . 
S 6 HOH 233 933  482  HOH HOH B . 
S 6 HOH 234 934  721  HOH HOH B . 
S 6 HOH 235 935  421  HOH HOH B . 
S 6 HOH 236 936  528  HOH HOH B . 
S 6 HOH 237 937  488  HOH HOH B . 
S 6 HOH 238 938  799  HOH HOH B . 
S 6 HOH 239 939  181  HOH HOH B . 
S 6 HOH 240 940  182  HOH HOH B . 
S 6 HOH 241 941  395  HOH HOH B . 
S 6 HOH 242 942  749  HOH HOH B . 
S 6 HOH 243 943  537  HOH HOH B . 
S 6 HOH 244 944  135  HOH HOH B . 
S 6 HOH 245 945  637  HOH HOH B . 
S 6 HOH 246 946  324  HOH HOH B . 
S 6 HOH 247 947  733  HOH HOH B . 
S 6 HOH 248 948  846  HOH HOH B . 
S 6 HOH 249 949  869  HOH HOH B . 
S 6 HOH 250 950  865  HOH HOH B . 
S 6 HOH 251 951  214  HOH HOH B . 
S 6 HOH 252 952  326  HOH HOH B . 
S 6 HOH 253 953  500  HOH HOH B . 
S 6 HOH 254 954  140  HOH HOH B . 
S 6 HOH 255 955  540  HOH HOH B . 
S 6 HOH 256 956  825  HOH HOH B . 
S 6 HOH 257 957  958  HOH HOH B . 
S 6 HOH 258 958  1037 HOH HOH B . 
S 6 HOH 259 959  231  HOH HOH B . 
S 6 HOH 260 960  845  HOH HOH B . 
S 6 HOH 261 961  451  HOH HOH B . 
S 6 HOH 262 962  243  HOH HOH B . 
S 6 HOH 263 963  109  HOH HOH B . 
S 6 HOH 264 964  985  HOH HOH B . 
S 6 HOH 265 965  442  HOH HOH B . 
S 6 HOH 266 966  492  HOH HOH B . 
S 6 HOH 267 967  740  HOH HOH B . 
S 6 HOH 268 968  303  HOH HOH B . 
S 6 HOH 269 969  246  HOH HOH B . 
S 6 HOH 270 970  73   HOH HOH B . 
S 6 HOH 271 971  349  HOH HOH B . 
S 6 HOH 272 972  336  HOH HOH B . 
S 6 HOH 273 973  996  HOH HOH B . 
S 6 HOH 274 974  715  HOH HOH B . 
S 6 HOH 275 975  258  HOH HOH B . 
S 6 HOH 276 976  521  HOH HOH B . 
S 6 HOH 277 977  700  HOH HOH B . 
S 6 HOH 278 978  635  HOH HOH B . 
S 6 HOH 279 979  735  HOH HOH B . 
S 6 HOH 280 980  511  HOH HOH B . 
S 6 HOH 281 981  748  HOH HOH B . 
S 6 HOH 282 982  941  HOH HOH B . 
S 6 HOH 283 983  308  HOH HOH B . 
S 6 HOH 284 984  449  HOH HOH B . 
S 6 HOH 285 985  818  HOH HOH B . 
S 6 HOH 286 986  84   HOH HOH B . 
S 6 HOH 287 987  184  HOH HOH B . 
S 6 HOH 288 988  131  HOH HOH B . 
S 6 HOH 289 989  69   HOH HOH B . 
S 6 HOH 290 990  899  HOH HOH B . 
S 6 HOH 291 991  171  HOH HOH B . 
S 6 HOH 292 992  701  HOH HOH B . 
S 6 HOH 293 993  239  HOH HOH B . 
S 6 HOH 294 994  775  HOH HOH B . 
S 6 HOH 295 995  519  HOH HOH B . 
S 6 HOH 296 996  161  HOH HOH B . 
S 6 HOH 297 997  133  HOH HOH B . 
S 6 HOH 298 998  229  HOH HOH B . 
S 6 HOH 299 999  1043 HOH HOH B . 
S 6 HOH 300 1000 569  HOH HOH B . 
S 6 HOH 301 1001 1070 HOH HOH B . 
S 6 HOH 302 1002 448  HOH HOH B . 
S 6 HOH 303 1003 389  HOH HOH B . 
S 6 HOH 304 1004 558  HOH HOH B . 
S 6 HOH 305 1005 130  HOH HOH B . 
S 6 HOH 306 1006 388  HOH HOH B . 
S 6 HOH 307 1007 850  HOH HOH B . 
S 6 HOH 308 1008 160  HOH HOH B . 
S 6 HOH 309 1009 282  HOH HOH B . 
S 6 HOH 310 1010 157  HOH HOH B . 
S 6 HOH 311 1011 27   HOH HOH B . 
S 6 HOH 312 1012 705  HOH HOH B . 
S 6 HOH 313 1013 321  HOH HOH B . 
S 6 HOH 314 1014 297  HOH HOH B . 
S 6 HOH 315 1015 873  HOH HOH B . 
S 6 HOH 316 1016 590  HOH HOH B . 
S 6 HOH 317 1017 534  HOH HOH B . 
S 6 HOH 318 1018 919  HOH HOH B . 
S 6 HOH 319 1019 279  HOH HOH B . 
S 6 HOH 320 1020 363  HOH HOH B . 
S 6 HOH 321 1021 48   HOH HOH B . 
S 6 HOH 322 1022 233  HOH HOH B . 
S 6 HOH 323 1023 410  HOH HOH B . 
S 6 HOH 324 1024 1025 HOH HOH B . 
S 6 HOH 325 1025 495  HOH HOH B . 
S 6 HOH 326 1026 661  HOH HOH B . 
S 6 HOH 327 1027 931  HOH HOH B . 
S 6 HOH 328 1028 355  HOH HOH B . 
S 6 HOH 329 1029 1002 HOH HOH B . 
S 6 HOH 330 1030 257  HOH HOH B . 
S 6 HOH 331 1031 386  HOH HOH B . 
S 6 HOH 332 1032 68   HOH HOH B . 
S 6 HOH 333 1033 86   HOH HOH B . 
S 6 HOH 334 1034 306  HOH HOH B . 
S 6 HOH 335 1035 117  HOH HOH B . 
S 6 HOH 336 1036 729  HOH HOH B . 
S 6 HOH 337 1037 92   HOH HOH B . 
S 6 HOH 338 1038 276  HOH HOH B . 
S 6 HOH 339 1039 657  HOH HOH B . 
S 6 HOH 340 1040 487  HOH HOH B . 
S 6 HOH 341 1041 236  HOH HOH B . 
S 6 HOH 342 1042 524  HOH HOH B . 
S 6 HOH 343 1043 251  HOH HOH B . 
S 6 HOH 344 1044 218  HOH HOH B . 
S 6 HOH 345 1045 88   HOH HOH B . 
S 6 HOH 346 1046 828  HOH HOH B . 
S 6 HOH 347 1047 414  HOH HOH B . 
S 6 HOH 348 1048 58   HOH HOH B . 
S 6 HOH 349 1049 237  HOH HOH B . 
S 6 HOH 350 1050 812  HOH HOH B . 
S 6 HOH 351 1051 636  HOH HOH B . 
S 6 HOH 352 1052 435  HOH HOH B . 
S 6 HOH 353 1053 824  HOH HOH B . 
S 6 HOH 354 1054 76   HOH HOH B . 
S 6 HOH 355 1055 862  HOH HOH B . 
S 6 HOH 356 1056 666  HOH HOH B . 
S 6 HOH 357 1057 553  HOH HOH B . 
S 6 HOH 358 1058 703  HOH HOH B . 
S 6 HOH 359 1059 407  HOH HOH B . 
S 6 HOH 360 1060 870  HOH HOH B . 
S 6 HOH 361 1061 599  HOH HOH B . 
S 6 HOH 362 1062 836  HOH HOH B . 
S 6 HOH 363 1063 752  HOH HOH B . 
S 6 HOH 364 1064 896  HOH HOH B . 
S 6 HOH 365 1065 937  HOH HOH B . 
S 6 HOH 366 1066 202  HOH HOH B . 
S 6 HOH 367 1067 928  HOH HOH B . 
S 6 HOH 368 1068 384  HOH HOH B . 
S 6 HOH 369 1069 518  HOH HOH B . 
S 6 HOH 370 1070 606  HOH HOH B . 
S 6 HOH 371 1071 538  HOH HOH B . 
S 6 HOH 372 1072 570  HOH HOH B . 
S 6 HOH 373 1073 631  HOH HOH B . 
S 6 HOH 374 1074 660  HOH HOH B . 
S 6 HOH 375 1075 781  HOH HOH B . 
S 6 HOH 376 1076 562  HOH HOH B . 
S 6 HOH 377 1077 727  HOH HOH B . 
S 6 HOH 378 1078 1089 HOH HOH B . 
S 6 HOH 379 1079 916  HOH HOH B . 
S 6 HOH 380 1080 299  HOH HOH B . 
S 6 HOH 381 1081 427  HOH HOH B . 
S 6 HOH 382 1082 915  HOH HOH B . 
S 6 HOH 383 1083 515  HOH HOH B . 
S 6 HOH 384 1084 561  HOH HOH B . 
S 6 HOH 385 1085 149  HOH HOH B . 
S 6 HOH 386 1086 891  HOH HOH B . 
S 6 HOH 387 1087 876  HOH HOH B . 
S 6 HOH 388 1088 671  HOH HOH B . 
S 6 HOH 389 1089 694  HOH HOH B . 
S 6 HOH 390 1090 507  HOH HOH B . 
S 6 HOH 391 1091 1038 HOH HOH B . 
S 6 HOH 392 1092 1000 HOH HOH B . 
S 6 HOH 393 1093 428  HOH HOH B . 
S 6 HOH 394 1094 444  HOH HOH B . 
S 6 HOH 395 1095 252  HOH HOH B . 
S 6 HOH 396 1096 1061 HOH HOH B . 
S 6 HOH 397 1097 884  HOH HOH B . 
S 6 HOH 398 1098 313  HOH HOH B . 
S 6 HOH 399 1099 1023 HOH HOH B . 
S 6 HOH 400 1100 675  HOH HOH B . 
S 6 HOH 401 1101 990  HOH HOH B . 
S 6 HOH 402 1102 823  HOH HOH B . 
S 6 HOH 403 1103 1004 HOH HOH B . 
S 6 HOH 404 1104 459  HOH HOH B . 
S 6 HOH 405 1105 839  HOH HOH B . 
S 6 HOH 406 1106 952  HOH HOH B . 
S 6 HOH 407 1107 189  HOH HOH B . 
S 6 HOH 408 1108 1033 HOH HOH B . 
S 6 HOH 409 1109 329  HOH HOH B . 
S 6 HOH 410 1110 256  HOH HOH B . 
S 6 HOH 411 1111 732  HOH HOH B . 
S 6 HOH 412 1112 892  HOH HOH B . 
S 6 HOH 413 1113 796  HOH HOH B . 
S 6 HOH 414 1114 380  HOH HOH B . 
S 6 HOH 415 1115 934  HOH HOH B . 
S 6 HOH 416 1116 970  HOH HOH B . 
S 6 HOH 417 1117 763  HOH HOH B . 
S 6 HOH 418 1118 339  HOH HOH B . 
S 6 HOH 419 1119 762  HOH HOH B . 
S 6 HOH 420 1120 227  HOH HOH B . 
S 6 HOH 421 1121 1056 HOH HOH B . 
S 6 HOH 422 1122 906  HOH HOH B . 
S 6 HOH 423 1123 885  HOH HOH B . 
S 6 HOH 424 1124 960  HOH HOH B . 
S 6 HOH 425 1125 816  HOH HOH B . 
S 6 HOH 426 1126 938  HOH HOH B . 
S 6 HOH 427 1127 234  HOH HOH B . 
S 6 HOH 428 1128 993  HOH HOH B . 
S 6 HOH 429 1129 978  HOH HOH B . 
S 6 HOH 430 1130 1009 HOH HOH B . 
S 6 HOH 431 1131 704  HOH HOH B . 
S 6 HOH 432 1132 496  HOH HOH B . 
S 6 HOH 433 1133 649  HOH HOH B . 
S 6 HOH 434 1134 526  HOH HOH B . 
S 6 HOH 435 1135 353  HOH HOH B . 
S 6 HOH 436 1136 1062 HOH HOH B . 
S 6 HOH 437 1137 1029 HOH HOH B . 
S 6 HOH 438 1138 1109 HOH HOH B . 
S 6 HOH 439 1139 894  HOH HOH B . 
S 6 HOH 440 1140 1065 HOH HOH B . 
S 6 HOH 441 1141 1057 HOH HOH B . 
S 6 HOH 442 1142 642  HOH HOH B . 
S 6 HOH 443 1143 1042 HOH HOH B . 
S 6 HOH 444 1144 786  HOH HOH B . 
S 6 HOH 445 1145 396  HOH HOH B . 
S 6 HOH 446 1146 898  HOH HOH B . 
S 6 HOH 447 1147 842  HOH HOH B . 
S 6 HOH 448 1148 815  HOH HOH B . 
S 6 HOH 449 1149 691  HOH HOH B . 
S 6 HOH 450 1150 397  HOH HOH B . 
S 6 HOH 451 1151 1051 HOH HOH B . 
S 6 HOH 452 1152 404  HOH HOH B . 
S 6 HOH 453 1153 644  HOH HOH B . 
S 6 HOH 454 1154 197  HOH HOH B . 
S 6 HOH 455 1155 455  HOH HOH B . 
S 6 HOH 456 1156 923  HOH HOH B . 
S 6 HOH 457 1157 212  HOH HOH B . 
S 6 HOH 458 1158 860  HOH HOH B . 
S 6 HOH 459 1159 742  HOH HOH B . 
S 6 HOH 460 1160 746  HOH HOH B . 
S 6 HOH 461 1161 1090 HOH HOH B . 
S 6 HOH 462 1162 1018 HOH HOH B . 
S 6 HOH 463 1163 248  HOH HOH B . 
S 6 HOH 464 1164 426  HOH HOH B . 
S 6 HOH 465 1165 962  HOH HOH B . 
S 6 HOH 466 1166 911  HOH HOH B . 
S 6 HOH 467 1167 953  HOH HOH B . 
S 6 HOH 468 1168 441  HOH HOH B . 
S 6 HOH 469 1169 890  HOH HOH B . 
S 6 HOH 470 1170 806  HOH HOH B . 
S 6 HOH 471 1171 998  HOH HOH B . 
S 6 HOH 472 1172 791  HOH HOH B . 
S 6 HOH 473 1173 423  HOH HOH B . 
S 6 HOH 474 1174 902  HOH HOH B . 
S 6 HOH 475 1175 585  HOH HOH B . 
S 6 HOH 476 1176 1035 HOH HOH B . 
S 6 HOH 477 1177 942  HOH HOH B . 
S 6 HOH 478 1178 1041 HOH HOH B . 
S 6 HOH 479 1179 924  HOH HOH B . 
S 6 HOH 480 1180 790  HOH HOH B . 
S 6 HOH 481 1181 789  HOH HOH B . 
S 6 HOH 482 1182 920  HOH HOH B . 
S 6 HOH 483 1183 406  HOH HOH B . 
S 6 HOH 484 1184 827  HOH HOH B . 
S 6 HOH 485 1185 1045 HOH HOH B . 
S 6 HOH 486 1186 819  HOH HOH B . 
S 6 HOH 487 1187 655  HOH HOH B . 
S 6 HOH 488 1188 513  HOH HOH B . 
S 6 HOH 489 1189 690  HOH HOH B . 
S 6 HOH 490 1190 663  HOH HOH B . 
S 6 HOH 491 1191 784  HOH HOH B . 
S 6 HOH 492 1192 995  HOH HOH B . 
S 6 HOH 493 1193 878  HOH HOH B . 
S 6 HOH 494 1194 394  HOH HOH B . 
S 6 HOH 495 1195 629  HOH HOH B . 
S 6 HOH 496 1196 450  HOH HOH B . 
S 6 HOH 497 1197 670  HOH HOH B . 
S 6 HOH 498 1198 951  HOH HOH B . 
S 6 HOH 499 1199 710  HOH HOH B . 
S 6 HOH 500 1200 702  HOH HOH B . 
S 6 HOH 501 1201 804  HOH HOH B . 
S 6 HOH 502 1202 979  HOH HOH B . 
S 6 HOH 503 1203 1094 HOH HOH B . 
S 6 HOH 504 1204 961  HOH HOH B . 
S 6 HOH 505 1205 835  HOH HOH B . 
S 6 HOH 506 1206 612  HOH HOH B . 
S 6 HOH 507 1207 968  HOH HOH B . 
S 6 HOH 508 1208 647  HOH HOH B . 
S 6 HOH 509 1209 801  HOH HOH B . 
S 6 HOH 510 1210 1011 HOH HOH B . 
S 6 HOH 511 1211 882  HOH HOH B . 
S 6 HOH 512 1212 275  HOH HOH B . 
S 6 HOH 513 1213 656  HOH HOH B . 
S 6 HOH 514 1214 822  HOH HOH B . 
S 6 HOH 515 1215 664  HOH HOH B . 
S 6 HOH 516 1216 583  HOH HOH B . 
S 6 HOH 517 1217 859  HOH HOH B . 
S 6 HOH 518 1218 975  HOH HOH B . 
S 6 HOH 519 1219 1064 HOH HOH B . 
S 6 HOH 520 1220 298  HOH HOH B . 
S 6 HOH 521 1221 1087 HOH HOH B . 
S 6 HOH 522 1222 566  HOH HOH B . 
S 6 HOH 523 1223 1083 HOH HOH B . 
S 6 HOH 524 1224 907  HOH HOH B . 
S 6 HOH 525 1225 489  HOH HOH B . 
S 6 HOH 526 1226 652  HOH HOH B . 
S 6 HOH 527 1227 926  HOH HOH B . 
S 6 HOH 528 1228 546  HOH HOH B . 
S 6 HOH 529 1229 1103 HOH HOH B . 
S 6 HOH 530 1230 481  HOH HOH B . 
S 6 HOH 531 1231 547  HOH HOH B . 
S 6 HOH 532 1232 1101 HOH HOH B . 
S 6 HOH 533 1233 897  HOH HOH B . 
S 6 HOH 534 1234 356  HOH HOH B . 
S 6 HOH 535 1235 1022 HOH HOH B . 
S 6 HOH 536 1236 713  HOH HOH B . 
S 6 HOH 537 1237 886  HOH HOH B . 
S 6 HOH 538 1238 659  HOH HOH B . 
S 6 HOH 539 1239 1105 HOH HOH B . 
S 6 HOH 540 1240 994  HOH HOH B . 
S 6 HOH 541 1241 829  HOH HOH B . 
S 6 HOH 542 1242 933  HOH HOH B . 
S 6 HOH 543 1243 875  HOH HOH B . 
S 6 HOH 544 1244 677  HOH HOH B . 
S 6 HOH 545 1245 1108 HOH HOH B . 
S 6 HOH 546 1246 992  HOH HOH B . 
S 6 HOH 547 1247 1047 HOH HOH B . 
S 6 HOH 548 1248 580  HOH HOH B . 
S 6 HOH 549 1249 1052 HOH HOH B . 
S 6 HOH 550 1250 833  HOH HOH B . 
S 6 HOH 551 1251 490  HOH HOH B . 
S 6 HOH 552 1252 235  HOH HOH B . 
S 6 HOH 553 1253 1034 HOH HOH B . 
S 6 HOH 554 1254 1077 HOH HOH B . 
S 6 HOH 555 1255 991  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,G,H,I,J,K,R 
1 2 B,L,M,N,O,P,Q,S       
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4290  ? 
1 MORE         -16   ? 
1 'SSA (A^2)'  39460 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z           1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 3_555 -x,y+1/2,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
1.0000000000 0.0000000000 53.2200000000 0.0000000000 0.0000000000 -1.0000000000 75.3400000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-04-04 
2 'Structure model' 2 0 2019-05-01 
3 'Structure model' 2 1 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' Advisory               
2  2 'Structure model' 'Atomic model'         
3  2 'Structure model' 'Data collection'      
4  2 'Structure model' 'Database references'  
5  2 'Structure model' 'Derived calculations' 
6  2 'Structure model' 'Polymer sequence'     
7  2 'Structure model' 'Source and taxonomy'  
8  2 'Structure model' 'Structure summary'    
9  3 'Structure model' 'Data collection'      
10 3 'Structure model' 'Derived calculations' 
11 3 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' atom_site                       
2  2 'Structure model' entity                          
3  2 'Structure model' entity_poly                     
4  2 'Structure model' entity_poly_seq                 
5  2 'Structure model' entity_src_nat                  
6  2 'Structure model' pdbx_poly_seq_scheme            
7  2 'Structure model' pdbx_struct_sheet_hbond         
8  2 'Structure model' pdbx_unobs_or_zero_occ_atoms    
9  2 'Structure model' pdbx_unobs_or_zero_occ_residues 
10 2 'Structure model' struct_conf                     
11 2 'Structure model' struct_conn                     
12 2 'Structure model' struct_mon_prot_cis             
13 2 'Structure model' struct_ref                      
14 2 'Structure model' struct_ref_seq                  
15 2 'Structure model' struct_sheet_range              
16 2 'Structure model' struct_site_gen                 
17 3 'Structure model' chem_comp                       
18 3 'Structure model' entity                          
19 3 'Structure model' pdbx_chem_comp_identifier       
20 3 'Structure model' pdbx_entity_nonpoly             
21 3 'Structure model' struct_conn                     
22 3 'Structure model' struct_site                     
23 3 'Structure model' struct_site_gen                 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_atom_site.label_seq_id'                       
2  2 'Structure model' '_entity.formula_weight'                        
3  2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code'         
4  2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can'     
5  2 'Structure model' '_entity_src_nat.pdbx_end_seq_num'              
6  2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_seq_id' 
7  2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id' 
8  2 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.label_seq_id'    
9  2 'Structure model' '_struct_conf.beg_label_seq_id'                 
10 2 'Structure model' '_struct_conf.end_label_seq_id'                 
11 2 'Structure model' '_struct_conn.ptnr1_label_seq_id'               
12 2 'Structure model' '_struct_conn.ptnr2_label_seq_id'               
13 2 'Structure model' '_struct_mon_prot_cis.label_seq_id'             
14 2 'Structure model' '_struct_mon_prot_cis.pdbx_label_seq_id_2'      
15 2 'Structure model' '_struct_ref.pdbx_align_begin'                  
16 2 'Structure model' '_struct_ref.pdbx_seq_one_letter_code'          
17 2 'Structure model' '_struct_ref_seq.db_align_beg'                  
18 2 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_beg'       
19 2 'Structure model' '_struct_ref_seq.seq_align_end'                 
20 2 'Structure model' '_struct_sheet_range.beg_label_seq_id'          
21 2 'Structure model' '_struct_sheet_range.end_label_seq_id'          
22 2 'Structure model' '_struct_site_gen.label_seq_id'                 
23 3 'Structure model' '_chem_comp.name'                               
24 3 'Structure model' '_chem_comp.type'                               
25 3 'Structure model' '_entity.pdbx_description'                      
26 3 'Structure model' '_pdbx_entity_nonpoly.name'                     
27 3 'Structure model' '_struct_conn.pdbx_role'                        
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .                    3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .                    4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A HOH 1068 ? ? O A HOH 1185 ? ? 1.84 
2  1 O   B HOH 1224 ? ? O B HOH 1249 ? ? 1.86 
3  1 O   B HOH 778  ? ? O B HOH 1126 ? ? 1.88 
4  1 O   A HOH 1092 ? ? O A HOH 1115 ? ? 1.89 
5  1 O   A HOH 1098 ? ? O A HOH 1132 ? ? 1.89 
6  1 O   A HOH 704  ? ? O A HOH 780  ? ? 1.89 
7  1 NE2 A GLN 526  ? ? O A HOH 701  ? ? 1.92 
8  1 O   A HOH 994  ? ? O A HOH 1122 ? ? 1.92 
9  1 O   B HOH 1247 ? ? O B HOH 1253 ? ? 1.95 
10 1 O   A HOH 757  ? ? O A HOH 1135 ? ? 1.96 
11 1 NH1 A ARG 349  ? ? O A HOH 702  ? ? 1.96 
12 1 O   A LYS 107  ? ? O A HOH 703  ? ? 1.98 
13 1 OE1 A GLU 499  ? ? O A HOH 704  ? ? 2.01 
14 1 O1  A PEG 609  ? ? O A HOH 705  ? ? 2.01 
15 1 OE2 B GLU 499  ? ? O B HOH 701  ? ? 2.02 
16 1 O   B HOH 973  ? ? O B HOH 1151 ? ? 2.02 
17 1 OE1 B GLN 526  ? ? O B HOH 702  ? ? 2.04 
18 1 O   B HOH 1244 ? ? O B HOH 1252 ? ? 2.06 
19 1 O   B HOH 1112 ? ? O B HOH 1115 ? ? 2.07 
20 1 O   B HOH 778  ? ? O B HOH 1143 ? ? 2.08 
21 1 O   A HOH 755  ? ? O A HOH 966  ? ? 2.09 
22 1 NZ  A LYS 341  ? ? O A HOH 706  ? ? 2.09 
23 1 O   A HOH 707  ? ? O A HOH 870  ? ? 2.10 
24 1 O7  A NAG 602  ? ? O A HOH 707  ? ? 2.10 
25 1 O   B HOH 726  ? ? O B HOH 1121 ? ? 2.11 
26 1 O   A HOH 1079 ? ? O A HOH 1108 ? ? 2.11 
27 1 O   A HOH 1018 ? ? O A HOH 1159 ? ? 2.11 
28 1 O   A HOH 1139 ? ? O A HOH 1186 ? ? 2.11 
29 1 O4  B NAG 601  ? ? O B HOH 703  ? ? 2.12 
30 1 O   B HOH 1193 ? ? O B HOH 1200 ? ? 2.12 
31 1 O   B HOH 1122 ? ? O B HOH 1129 ? ? 2.12 
32 1 ND2 A ASN 257  ? ? O A HOH 708  ? ? 2.12 
33 1 NZ  B LYS 11   ? ? O B HOH 704  ? ? 2.14 
34 1 O   A HOH 1028 ? ? O A HOH 1114 ? ? 2.14 
35 1 OE2 B GLU 247  ? ? O B HOH 705  ? ? 2.15 
36 1 OD1 B ASN 65   ? ? O B HOH 706  ? ? 2.15 
37 1 O   B HOH 1131 ? ? O B HOH 1175 ? ? 2.15 
38 1 O   B HOH 703  ? ? O B HOH 1141 ? ? 2.16 
39 1 O   A HOH 1148 ? ? O A HOH 1206 ? ? 2.16 
40 1 O   B HOH 871  ? ? O B HOH 1138 ? ? 2.17 
41 1 O   B HOH 808  ? ? O B HOH 1103 ? ? 2.17 
42 1 O   B HOH 713  ? ? O B HOH 720  ? ? 2.17 
43 1 O   B HOH 706  ? ? O B HOH 1026 ? ? 2.19 
44 1 O   B HOH 1110 ? ? O B HOH 1153 ? ? 2.19 
45 1 O   B SER 103  ? ? O B HOH 707  ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     903 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     890 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_445 
_pdbx_validate_symm_contact.dist              2.03 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 23  ? ? 56.28   -122.83 
2  1 SER A 25  ? ? -124.30 -155.05 
3  1 PHE A 45  ? ? 77.52   -8.44   
4  1 SER A 108 ? ? -157.38 81.59   
5  1 LEU A 158 ? ? -115.65 78.73   
6  1 ASN A 167 ? ? 57.30   15.30   
7  1 SER A 200 ? ? 57.41   -123.02 
8  1 GLU A 299 ? ? -123.48 -67.37  
9  1 ASP A 380 ? ? -153.11 49.67   
10 1 VAL A 400 ? ? -129.49 -61.43  
11 1 HIS A 440 ? ? -37.80  129.34  
12 1 HIS A 486 ? ? 56.07   10.88   
13 1 ARG A 515 ? ? 59.64   71.94   
14 1 ARG A 517 ? ? 37.52   48.16   
15 1 GLN A 526 ? ? -120.83 -56.20  
16 1 LEU B 23  ? ? 51.19   -120.84 
17 1 SER B 25  ? ? -137.17 -156.76 
18 1 PHE B 45  ? ? 76.60   -8.04   
19 1 ALA B 60  ? ? -106.71 43.17   
20 1 SER B 108 ? ? -157.72 75.27   
21 1 PHE B 155 ? ? -141.97 12.63   
22 1 SER B 200 ? ? 55.92   -124.67 
23 1 GLU B 299 ? ? -126.99 -70.10  
24 1 ASP B 380 ? ? -158.07 48.73   
25 1 VAL B 400 ? ? -123.85 -61.20  
26 1 HIS B 440 ? ? -38.04  132.08  
27 1 HIS B 486 ? ? 64.30   -5.51   
28 1 ASN B 506 ? ? -162.07 -169.17 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A HOH 1252 ? 6.04  .    
2  1 O ? A HOH 1253 ? 6.08  .    
3  1 O ? A HOH 1254 ? .     6.25 
4  1 O ? A HOH 1255 ? .     7.14 
5  1 O ? A HOH 1256 ? .     8.49 
6  1 O ? B HOH 1247 ? 5.90  .    
7  1 O ? B HOH 1248 ? 5.93  .    
8  1 O ? B HOH 1249 ? 5.98  .    
9  1 O ? B HOH 1250 ? 6.16  .    
10 1 O ? B HOH 1251 ? 6.20  .    
11 1 O ? B HOH 1252 ? 6.22  .    
12 1 O ? B HOH 1253 ? 7.14  .    
13 1 O ? B HOH 1254 ? 7.39  .    
14 1 O ? B HOH 1255 ? 11.16 .    
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 454 ? CE ? A LYS 454 CE 
2 1 Y 1 A LYS 454 ? NZ ? A LYS 454 NZ 
3 1 Y 1 A LYS 511 ? CE ? A LYS 511 CE 
4 1 Y 1 A LYS 511 ? NZ ? A LYS 511 NZ 
5 1 Y 1 B LYS 454 ? CE ? B LYS 454 CE 
6 1 Y 1 B LYS 454 ? NZ ? B LYS 454 NZ 
7 1 Y 1 B LYS 511 ? CE ? B LYS 511 CE 
8 1 Y 1 B LYS 511 ? NZ ? B LYS 511 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A ALA 536 ? A ALA 536 
5  1 Y 1 A CYS 537 ? A CYS 537 
6  1 Y 1 A ASP 538 ? A ASP 538 
7  1 Y 1 A GLY 539 ? A GLY 539 
8  1 Y 1 A GLU 540 ? A GLU 540 
9  1 Y 1 A LEU 541 ? A LEU 541 
10 1 Y 1 A SER 542 ? A SER 542 
11 1 Y 1 A SER 543 ? A SER 543 
12 1 Y 1 A SER 544 ? A SER 544 
13 1 Y 1 A GLY 545 ? A GLY 545 
14 1 Y 1 A THR 546 ? A THR 546 
15 1 Y 1 A SER 547 ? A SER 547 
16 1 Y 1 A SER 548 ? A SER 548 
17 1 Y 1 A SER 549 ? A SER 549 
18 1 Y 1 A LYS 550 ? A LYS 550 
19 1 Y 1 A GLY 551 ? A GLY 551 
20 1 Y 1 A ILE 552 ? A ILE 552 
21 1 Y 1 A ILE 553 ? A ILE 553 
22 1 Y 1 A PHE 554 ? A PHE 554 
23 1 Y 1 A TYR 555 ? A TYR 555 
24 1 Y 1 A VAL 556 ? A VAL 556 
25 1 Y 1 A LEU 557 ? A LEU 557 
26 1 Y 1 A PHE 558 ? A PHE 558 
27 1 Y 1 A SER 559 ? A SER 559 
28 1 Y 1 A ILE 560 ? A ILE 560 
29 1 Y 1 A LEU 561 ? A LEU 561 
30 1 Y 1 A TYR 562 ? A TYR 562 
31 1 Y 1 A LEU 563 ? A LEU 563 
32 1 Y 1 A ILE 564 ? A ILE 564 
33 1 Y 1 A PHE 565 ? A PHE 565 
34 1 Y 1 B ASP 1   ? B ASP 1   
35 1 Y 1 B ASP 2   ? B ASP 2   
36 1 Y 1 B HIS 3   ? B HIS 3   
37 1 Y 1 B ALA 536 ? B ALA 536 
38 1 Y 1 B CYS 537 ? B CYS 537 
39 1 Y 1 B ASP 538 ? B ASP 538 
40 1 Y 1 B GLY 539 ? B GLY 539 
41 1 Y 1 B GLU 540 ? B GLU 540 
42 1 Y 1 B LEU 541 ? B LEU 541 
43 1 Y 1 B SER 542 ? B SER 542 
44 1 Y 1 B SER 543 ? B SER 543 
45 1 Y 1 B SER 544 ? B SER 544 
46 1 Y 1 B GLY 545 ? B GLY 545 
47 1 Y 1 B THR 546 ? B THR 546 
48 1 Y 1 B SER 547 ? B SER 547 
49 1 Y 1 B SER 548 ? B SER 548 
50 1 Y 1 B SER 549 ? B SER 549 
51 1 Y 1 B LYS 550 ? B LYS 550 
52 1 Y 1 B GLY 551 ? B GLY 551 
53 1 Y 1 B ILE 552 ? B ILE 552 
54 1 Y 1 B ILE 553 ? B ILE 553 
55 1 Y 1 B PHE 554 ? B PHE 554 
56 1 Y 1 B TYR 555 ? B TYR 555 
57 1 Y 1 B VAL 556 ? B VAL 556 
58 1 Y 1 B LEU 557 ? B LEU 557 
59 1 Y 1 B PHE 558 ? B PHE 558 
60 1 Y 1 B SER 559 ? B SER 559 
61 1 Y 1 B ILE 560 ? B ILE 560 
62 1 Y 1 B LEU 561 ? B LEU 561 
63 1 Y 1 B TYR 562 ? B TYR 562 
64 1 Y 1 B LEU 563 ? B LEU 563 
65 1 Y 1 B ILE 564 ? B ILE 564 
66 1 Y 1 B PHE 565 ? B PHE 565 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose                                                     NAG 
3 '12-Amino-3-chloro-6,7,10,11-tetrahydro-5,9-dimethyl-7,11-methanocycloocta[b]quinolin-5-ium' E1N 
4 'CHLORIDE ION'                                                                               CL  
5 'DI(HYDROXYETHYL)ETHER'                                                                      PEG 
6 water                                                                                        HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_au